data_1GQR
# 
_entry.id   1GQR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GQR         
PDBE  EBI-9065     
WWPDB D_1290009065 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3- (3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GQR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-12-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Raves, M.L.'   1 ? 
'Harel, M.'     2 ? 
'Silman, I.'    3 ? 
'Sussman, J.L.' 4 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Kinetic and Structural Studies on the Interaction of Cholinesterases with the Anti-Alzheimer Drug Rivastigmine' 
Biochemistry                41  3555 ?   2002 BICHAW US 0006-2960 0033 ? 11888271 10.1021/BI020016X              
1       'Mechanism of Inhibition of Cholinesterases by Huperzine A'                                                      
Biochem.Biophys.Res.Commun. 184 719  ?   1992 BBRCA9 US 0006-291X 0146 ? 1575745  '10.1016/0006-291X(92)90649-6' 
2       
;Huperzine A--A Potent Acetylcholinesterase Inhibitor of Use in the Treatment of Alzheimer'S Disease
;
'Acta Crystallogr.,Sect.C'  47  824  827 1991 ACSCEE DK 0108-2701 0591 ? 1863425  10.1107/S0108270190008952      
3       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein'  Science 
253 872  ?   1991 SCIEAS US 0036-8075 0038 ? 1678899  10.1126/SCIENCE.1678899        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bar-on, P.'        1  
primary 'Millard, C.B.'     2  
primary 'Harel, M.'         3  
primary 'Dvir, H.'          4  
primary 'Enz, A.'           5  
primary 'Sussman, J.L.'     6  
primary 'Silman, I.'        7  
1       'Ashani, Y.'        8  
1       'Peggins III, J.O.' 9  
1       'Doctor, B.P.'      10 
2       'Geib, S.J.'        11 
2       'Tuckmantel, W.'    12 
2       'Kozikowski, A.P.'  13 
3       'Sussman, J.L.'     14 
3       'Harel, M.'         15 
3       'Frolow, F.'        16 
3       'Oefner, C.'        17 
3       'Goldman, A.'       18 
3       'Toker, L.'         19 
3       'Silman, I.'        20 
# 
_cell.entry_id           1GQR 
_cell.length_a           112.052 
_cell.length_b           112.052 
_cell.length_c           136.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GQR 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                    60193.977 1   3.1.1.7 ? 'RESIDUES 25-556' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                  221.208   2   ?       ? ?                 ? 
3 non-polymer syn '3-[(1S)-1-(DIMETHYLAMINO)ETHYL]PHENOL' 165.232   1   ?       ? ?                 ? 
4 non-polymer syn '[METHYL(VINYL)AMINO]METHANOL'          101.104   1   ?       ? ?                 ? 
5 water       nat water                                   18.015    386 ?       ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   LEU n 
1 4   LEU n 
1 5   VAL n 
1 6   ASN n 
1 7   THR n 
1 8   LYS n 
1 9   SER n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  MET n 
1 14  GLY n 
1 15  THR n 
1 16  ARG n 
1 17  VAL n 
1 18  PRO n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  SER n 
1 23  HIS n 
1 24  ILE n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  GLY n 
1 30  ILE n 
1 31  PRO n 
1 32  PHE n 
1 33  ALA n 
1 34  GLU n 
1 35  PRO n 
1 36  PRO n 
1 37  VAL n 
1 38  GLY n 
1 39  ASN n 
1 40  MET n 
1 41  ARG n 
1 42  PHE n 
1 43  ARG n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  PRO n 
1 48  LYS n 
1 49  LYS n 
1 50  PRO n 
1 51  TRP n 
1 52  SER n 
1 53  GLY n 
1 54  VAL n 
1 55  TRP n 
1 56  ASN n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  TYR n 
1 61  PRO n 
1 62  ASN n 
1 63  ASN n 
1 64  CYS n 
1 65  GLN n 
1 66  GLN n 
1 67  TYR n 
1 68  VAL n 
1 69  ASP n 
1 70  GLU n 
1 71  GLN n 
1 72  PHE n 
1 73  PRO n 
1 74  GLY n 
1 75  PHE n 
1 76  SER n 
1 77  GLY n 
1 78  SER n 
1 79  GLU n 
1 80  MET n 
1 81  TRP n 
1 82  ASN n 
1 83  PRO n 
1 84  ASN n 
1 85  ARG n 
1 86  GLU n 
1 87  MET n 
1 88  SER n 
1 89  GLU n 
1 90  ASP n 
1 91  CYS n 
1 92  LEU n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  ILE n 
1 97  TRP n 
1 98  VAL n 
1 99  PRO n 
1 100 SER n 
1 101 PRO n 
1 102 ARG n 
1 103 PRO n 
1 104 LYS n 
1 105 SER n 
1 106 THR n 
1 107 THR n 
1 108 VAL n 
1 109 MET n 
1 110 VAL n 
1 111 TRP n 
1 112 ILE n 
1 113 TYR n 
1 114 GLY n 
1 115 GLY n 
1 116 GLY n 
1 117 PHE n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 SER n 
1 122 SER n 
1 123 THR n 
1 124 LEU n 
1 125 ASP n 
1 126 VAL n 
1 127 TYR n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 TYR n 
1 132 LEU n 
1 133 ALA n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 LEU n 
1 141 VAL n 
1 142 SER n 
1 143 LEU n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 VAL n 
1 148 GLY n 
1 149 ALA n 
1 150 PHE n 
1 151 GLY n 
1 152 PHE n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 HIS n 
1 157 GLY n 
1 158 SER n 
1 159 GLN n 
1 160 GLU n 
1 161 ALA n 
1 162 PRO n 
1 163 GLY n 
1 164 ASN n 
1 165 VAL n 
1 166 GLY n 
1 167 LEU n 
1 168 LEU n 
1 169 ASP n 
1 170 GLN n 
1 171 ARG n 
1 172 MET n 
1 173 ALA n 
1 174 LEU n 
1 175 GLN n 
1 176 TRP n 
1 177 VAL n 
1 178 HIS n 
1 179 ASP n 
1 180 ASN n 
1 181 ILE n 
1 182 GLN n 
1 183 PHE n 
1 184 PHE n 
1 185 GLY n 
1 186 GLY n 
1 187 ASP n 
1 188 PRO n 
1 189 LYS n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 ILE n 
1 194 PHE n 
1 195 GLY n 
1 196 GLU n 
1 197 SER n 
1 198 ALA n 
1 199 GLY n 
1 200 GLY n 
1 201 ALA n 
1 202 SER n 
1 203 VAL n 
1 204 GLY n 
1 205 MET n 
1 206 HIS n 
1 207 ILE n 
1 208 LEU n 
1 209 SER n 
1 210 PRO n 
1 211 GLY n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 PHE n 
1 217 ARG n 
1 218 ARG n 
1 219 ALA n 
1 220 ILE n 
1 221 LEU n 
1 222 GLN n 
1 223 SER n 
1 224 GLY n 
1 225 SER n 
1 226 PRO n 
1 227 ASN n 
1 228 CYS n 
1 229 PRO n 
1 230 TRP n 
1 231 ALA n 
1 232 SER n 
1 233 VAL n 
1 234 SER n 
1 235 VAL n 
1 236 ALA n 
1 237 GLU n 
1 238 GLY n 
1 239 ARG n 
1 240 ARG n 
1 241 ARG n 
1 242 ALA n 
1 243 VAL n 
1 244 GLU n 
1 245 LEU n 
1 246 GLY n 
1 247 ARG n 
1 248 ASN n 
1 249 LEU n 
1 250 ASN n 
1 251 CYS n 
1 252 ASN n 
1 253 LEU n 
1 254 ASN n 
1 255 SER n 
1 256 ASP n 
1 257 GLU n 
1 258 GLU n 
1 259 LEU n 
1 260 ILE n 
1 261 HIS n 
1 262 CYS n 
1 263 LEU n 
1 264 ARG n 
1 265 GLU n 
1 266 LYS n 
1 267 LYS n 
1 268 PRO n 
1 269 GLN n 
1 270 GLU n 
1 271 LEU n 
1 272 ILE n 
1 273 ASP n 
1 274 VAL n 
1 275 GLU n 
1 276 TRP n 
1 277 ASN n 
1 278 VAL n 
1 279 LEU n 
1 280 PRO n 
1 281 PHE n 
1 282 ASP n 
1 283 SER n 
1 284 ILE n 
1 285 PHE n 
1 286 ARG n 
1 287 PHE n 
1 288 SER n 
1 289 PHE n 
1 290 VAL n 
1 291 PRO n 
1 292 VAL n 
1 293 ILE n 
1 294 ASP n 
1 295 GLY n 
1 296 GLU n 
1 297 PHE n 
1 298 PHE n 
1 299 PRO n 
1 300 THR n 
1 301 SER n 
1 302 LEU n 
1 303 GLU n 
1 304 SER n 
1 305 MET n 
1 306 LEU n 
1 307 ASN n 
1 308 SER n 
1 309 GLY n 
1 310 ASN n 
1 311 PHE n 
1 312 LYS n 
1 313 LYS n 
1 314 THR n 
1 315 GLN n 
1 316 ILE n 
1 317 LEU n 
1 318 LEU n 
1 319 GLY n 
1 320 VAL n 
1 321 ASN n 
1 322 LYS n 
1 323 ASP n 
1 324 GLU n 
1 325 GLY n 
1 326 SER n 
1 327 PHE n 
1 328 PHE n 
1 329 LEU n 
1 330 LEU n 
1 331 TYR n 
1 332 GLY n 
1 333 ALA n 
1 334 PRO n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 LYS n 
1 339 ASP n 
1 340 SER n 
1 341 GLU n 
1 342 SER n 
1 343 LYS n 
1 344 ILE n 
1 345 SER n 
1 346 ARG n 
1 347 GLU n 
1 348 ASP n 
1 349 PHE n 
1 350 MET n 
1 351 SER n 
1 352 GLY n 
1 353 VAL n 
1 354 LYS n 
1 355 LEU n 
1 356 SER n 
1 357 VAL n 
1 358 PRO n 
1 359 HIS n 
1 360 ALA n 
1 361 ASN n 
1 362 ASP n 
1 363 LEU n 
1 364 GLY n 
1 365 LEU n 
1 366 ASP n 
1 367 ALA n 
1 368 VAL n 
1 369 THR n 
1 370 LEU n 
1 371 GLN n 
1 372 TYR n 
1 373 THR n 
1 374 ASP n 
1 375 TRP n 
1 376 MET n 
1 377 ASP n 
1 378 ASP n 
1 379 ASN n 
1 380 ASN n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 LEU n 
1 389 ASP n 
1 390 ASP n 
1 391 ILE n 
1 392 VAL n 
1 393 GLY n 
1 394 ASP n 
1 395 HIS n 
1 396 ASN n 
1 397 VAL n 
1 398 ILE n 
1 399 CYS n 
1 400 PRO n 
1 401 LEU n 
1 402 MET n 
1 403 HIS n 
1 404 PHE n 
1 405 VAL n 
1 406 ASN n 
1 407 LYS n 
1 408 TYR n 
1 409 THR n 
1 410 LYS n 
1 411 PHE n 
1 412 GLY n 
1 413 ASN n 
1 414 GLY n 
1 415 THR n 
1 416 TYR n 
1 417 LEU n 
1 418 TYR n 
1 419 PHE n 
1 420 PHE n 
1 421 ASN n 
1 422 HIS n 
1 423 ARG n 
1 424 ALA n 
1 425 SER n 
1 426 ASN n 
1 427 LEU n 
1 428 VAL n 
1 429 TRP n 
1 430 PRO n 
1 431 GLU n 
1 432 TRP n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 ILE n 
1 437 HIS n 
1 438 GLY n 
1 439 TYR n 
1 440 GLU n 
1 441 ILE n 
1 442 GLU n 
1 443 PHE n 
1 444 VAL n 
1 445 PHE n 
1 446 GLY n 
1 447 LEU n 
1 448 PRO n 
1 449 LEU n 
1 450 VAL n 
1 451 LYS n 
1 452 GLU n 
1 453 LEU n 
1 454 ASN n 
1 455 TYR n 
1 456 THR n 
1 457 ALA n 
1 458 GLU n 
1 459 GLU n 
1 460 GLU n 
1 461 ALA n 
1 462 LEU n 
1 463 SER n 
1 464 ARG n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 HIS n 
1 469 TYR n 
1 470 TRP n 
1 471 ALA n 
1 472 THR n 
1 473 PHE n 
1 474 ALA n 
1 475 LYS n 
1 476 THR n 
1 477 GLY n 
1 478 ASN n 
1 479 PRO n 
1 480 ASN n 
1 481 GLU n 
1 482 PRO n 
1 483 HIS n 
1 484 SER n 
1 485 GLN n 
1 486 GLU n 
1 487 SER n 
1 488 LYS n 
1 489 TRP n 
1 490 PRO n 
1 491 LEU n 
1 492 PHE n 
1 493 THR n 
1 494 THR n 
1 495 LYS n 
1 496 GLU n 
1 497 GLN n 
1 498 LYS n 
1 499 PHE n 
1 500 ILE n 
1 501 ASP n 
1 502 LEU n 
1 503 ASN n 
1 504 THR n 
1 505 GLU n 
1 506 PRO n 
1 507 MET n 
1 508 LYS n 
1 509 VAL n 
1 510 HIS n 
1 511 GLN n 
1 512 ARG n 
1 513 LEU n 
1 514 ARG n 
1 515 VAL n 
1 516 GLN n 
1 517 MET n 
1 518 CYS n 
1 519 VAL n 
1 520 PHE n 
1 521 TRP n 
1 522 ASN n 
1 523 GLN n 
1 524 PHE n 
1 525 LEU n 
1 526 PRO n 
1 527 LYS n 
1 528 LEU n 
1 529 LEU n 
1 530 ASN n 
1 531 ALA n 
1 532 THR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GQR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 532 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  556 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       535 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                 ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ?                        'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                ?                        'C3 H7 N O2 S'   121.158 
EMM non-polymer         . '[METHYL(VINYL)AMINO]METHANOL'          N,N-ETHYLMETHYLCARBAMATE 'C4 H7 N O2'     101.104 
GLN 'L-peptide linking' y GLUTAMINE                               ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ?                        'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ?                        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ?                        'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                  ?                        'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE                           ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ?                        'C5 H9 N O2'     115.130 
SAF non-polymer         . '3-[(1S)-1-(DIMETHYLAMINO)ETHYL]PHENOL' ?                        'C10 H15 N O'    165.232 
SER 'L-peptide linking' y SERINE                                  ?                        'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ?                        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GQR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.12 
_exptl_crystal.density_percent_sol   70.13 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.80' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GQR 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   50861 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.7000 
_reflns.B_iso_Wilson_estimate        21.1 
_reflns.pdbx_redundancy              4.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.32200 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.400 
_reflns_shell.pdbx_redundancy        2.60 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GQR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     46026 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.13 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    90.7 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  2111 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               35.5 
_refine.aniso_B[1][1]                            1.55 
_refine.aniso_B[2][2]                            1.55 
_refine.aniso_B[3][3]                            -3.09 
_refine.aniso_B[1][2]                            0.34 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GQR 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4198 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             386 
_refine_hist.number_atoms_total               4630 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        29.13 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.13  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.59  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.51  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             3.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            4.24  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             6498 
_refine_ls_shell.R_factor_R_work                  0.317 
_refine_ls_shell.percent_reflns_obs               80.3 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            0.026 
_refine_ls_shell.percent_reflns_R_free            2.9 
_refine_ls_shell.number_reflns_R_free             194 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
# 
_struct.entry_id                  1GQR 
_struct.title                     'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GQR 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, NEUROTRANSMITTER CLEAVAGE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 37  ? ARG A 41  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 75  ? MET A 80  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 124 ? ASN A 128 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 129 ? GLU A 137 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 147 ? LEU A 153 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 164 ? ILE A 181 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 182 ? PHE A 184 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 197 ? SER A 209 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 209 ? ASP A 214 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 10 SER A 234 ? LEU A 249 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 11 SER A 255 ? LYS A 266 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 267 ? GLU A 275 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 276 ? LEU A 279 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 301 ? GLY A 309 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 325 ? ALA A 333 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 345 ? VAL A 357 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 361 ? THR A 373 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 380 ? VAL A 397 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 397 ? GLY A 412 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 430 ? GLY A 434 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 440 ? PHE A 445 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 446 ? VAL A 450 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 450 ? ASN A 454 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 456 ? GLY A 477 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 514 ? GLN A 523 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 523 ? THR A 532 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 64  SG  ? ? ? 1_555 A CYS 91  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? A CYS 251 SG  ? ? ? 1_555 A CYS 262 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 399 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.037 ? 
covale1 covale ? ? A ASN 56  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 1996 1_555 ? ? ? ? ? ? ? 1.455 ? 
covale2 covale ? ? A SER 197 OG  ? ? ? 1_555 E EMM .   C  ? ? A SER 200 A EMM 1999 1_555 ? ? ? ? ? ? ? 1.444 ? 
covale3 covale ? ? A ASN 413 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 1997 1_555 ? ? ? ? ? ? ? 1.451 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           100 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    101 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.28 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 4   ? THR A 7   ? LEU A 7   THR A 10  
AA 2  GLY A 10  ? MET A 13  ? GLY A 13  MET A 16  
AA 3  VAL A 54  ? ASN A 56  ? VAL A 57  ASN A 59  
AB 1  THR A 15  ? VAL A 19  ? THR A 18  VAL A 22  
AB 2  SER A 22  ? PRO A 31  ? SER A 25  PRO A 34  
AB 3  TYR A 93  ? VAL A 98  ? TYR A 96  VAL A 101 
AB 4  VAL A 139 ? SER A 142 ? VAL A 142 SER A 145 
AB 5  THR A 106 ? ILE A 112 ? THR A 109 ILE A 115 
AB 6  GLY A 186 ? GLU A 196 ? GLY A 189 GLU A 199 
AB 7  ARG A 218 ? GLN A 222 ? ARG A 221 GLN A 225 
AB 8  ILE A 316 ? ASN A 321 ? ILE A 319 ASN A 324 
AB 9  THR A 415 ? PHE A 420 ? THR A 418 PHE A 423 
AB 10 LYS A 498 ? LEU A 502 ? LYS A 501 LEU A 505 
AB 11 VAL A 509 ? GLN A 511 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 7   ? N THR A 10  O GLY A 10  ? O GLY A 13  
AA 2  3  N MET A 13  ? N MET A 16  O TRP A 55  ? O TRP A 58  
AB 1  2  N VAL A 19  ? N VAL A 22  O SER A 22  ? O SER A 25  
AB 2  3  N ILE A 30  ? N ILE A 33  O LEU A 94  ? O LEU A 97  
AB 3  4  N TRP A 97  ? N TRP A 100 O LEU A 140 ? O LEU A 143 
AB 4  5  N VAL A 139 ? N VAL A 142 O THR A 107 ? O THR A 110 
AB 5  6  O THR A 106 ? O THR A 109 N ASP A 187 ? N ASP A 190 
AB 6  7  N ILE A 193 ? N ILE A 196 O ARG A 218 ? O ARG A 221 
AB 7  8  N LEU A 221 ? N LEU A 224 O LEU A 317 ? O LEU A 320 
AB 8  9  N LEU A 318 ? N LEU A 321 O TYR A 416 ? O TYR A 419 
AB 9  10 N PHE A 419 ? N PHE A 422 O ILE A 500 ? O ILE A 503 
AB 10 11 N PHE A 499 ? N PHE A 502 O HIS A 510 ? O HIS A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SAF A 1998' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE EMM A 1999' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG A 1996' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NAG A 1997' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 TRP A 81  ? TRP A 84   . ? 1_555 ? 
2  AC1 11 GLY A 114 ? GLY A 117  . ? 1_555 ? 
3  AC1 11 GLY A 115 ? GLY A 118  . ? 1_555 ? 
4  AC1 11 TYR A 127 ? TYR A 130  . ? 1_555 ? 
5  AC1 11 GLU A 196 ? GLU A 199  . ? 1_555 ? 
6  AC1 11 SER A 197 ? SER A 200  . ? 1_555 ? 
7  AC1 11 PHE A 327 ? PHE A 330  . ? 1_555 ? 
8  AC1 11 HIS A 437 ? HIS A 440  . ? 1_555 ? 
9  AC1 11 EMM E .   ? EMM A 1999 . ? 1_555 ? 
10 AC1 11 HOH F .   ? HOH A 2385 . ? 1_555 ? 
11 AC1 11 HOH F .   ? HOH A 2386 . ? 1_555 ? 
12 AC2 11 GLY A 115 ? GLY A 118  . ? 1_555 ? 
13 AC2 11 GLY A 116 ? GLY A 119  . ? 1_555 ? 
14 AC2 11 SER A 197 ? SER A 200  . ? 1_555 ? 
15 AC2 11 ALA A 198 ? ALA A 201  . ? 1_555 ? 
16 AC2 11 TRP A 230 ? TRP A 233  . ? 1_555 ? 
17 AC2 11 PHE A 285 ? PHE A 288  . ? 1_555 ? 
18 AC2 11 PHE A 287 ? PHE A 290  . ? 1_555 ? 
19 AC2 11 PHE A 328 ? PHE A 331  . ? 1_555 ? 
20 AC2 11 HIS A 437 ? HIS A 440  . ? 1_555 ? 
21 AC2 11 SAF D .   ? SAF A 1998 . ? 1_555 ? 
22 AC2 11 HOH F .   ? HOH A 2242 . ? 1_555 ? 
23 AC3 4  ASN A 56  ? ASN A 59   . ? 1_555 ? 
24 AC3 4  SER A 58  ? SER A 61   . ? 1_555 ? 
25 AC3 4  HOH F .   ? HOH A 2377 . ? 1_555 ? 
26 AC3 4  HOH F .   ? HOH A 2378 . ? 1_555 ? 
27 AC4 3  ASN A 413 ? ASN A 416  . ? 1_555 ? 
28 AC4 3  HOH F .   ? HOH A 2296 . ? 1_555 ? 
29 AC4 3  HOH F .   ? HOH A 2379 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GQR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GQR 
_atom_sites.fract_transf_matrix[1][1]   0.008924 
_atom_sites.fract_transf_matrix[1][2]   0.005152 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010305 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007311 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -12.259 88.217 33.996 1.00 55.44  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? -11.904 88.430 35.431 1.00 53.88  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? -10.795 87.488 35.888 1.00 51.08  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? -10.928 86.267 35.806 1.00 50.35  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? -13.136 88.236 36.315 1.00 56.05  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? -12.812 88.417 37.683 1.00 58.35  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 2   ? -9.726  88.070 36.420 1.00 48.97  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 2   ? -8.572  87.315 36.901 1.00 45.91  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 2   ? -8.895  86.379 38.069 1.00 43.06  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 2   ? -8.209  85.377 38.282 1.00 43.68  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 2   ? -7.468  88.286 37.307 1.00 46.76  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 2   ? -6.190  87.630 37.774 1.00 49.94  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 2   ? -5.088  88.636 38.025 1.00 53.56  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 2   ? -5.386  89.765 38.472 1.00 56.62  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 2   ? -3.918  88.295 37.771 1.00 56.91  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 3   ? -9.939  86.707 38.820 1.00 39.08  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 3   ? -10.333 85.899 39.960 1.00 37.82  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 3   ? -11.346 84.821 39.616 1.00 37.86  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 3   ? -11.753 84.048 40.479 1.00 40.19  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 3   ? -10.862 86.788 41.083 1.00 35.79  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 3   ? -9.847  87.759 41.688 1.00 36.30  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 3   ? -10.518 88.551 42.789 1.00 36.34  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 3   ? -8.647  87.001 42.235 1.00 36.00  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 4   ? -11.768 84.773 38.361 1.00 36.45  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 4   ? -12.719 83.756 37.948 1.00 36.50  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 4   ? -12.046 82.776 36.994 1.00 36.91  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 4   ? -11.444 83.169 35.992 1.00 35.27  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 4   ? -13.947 84.388 37.303 1.00 38.92  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 4   ? -15.047 83.402 36.911 1.00 41.87  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 4   ? -15.527 82.603 38.114 1.00 43.87  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 4   ? -16.194 84.176 36.311 1.00 47.87  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 5   ? -12.109 81.499 37.350 1.00 36.13  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 5   ? -11.503 80.446 36.554 1.00 34.70  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 5   ? -12.516 79.331 36.348 1.00 35.78  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 5   ? -13.183 78.901 37.283 1.00 37.06  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 5   ? -10.239 79.868 37.249 1.00 33.54  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 5   ? -9.649  78.741 36.424 1.00 31.41  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 5   ? -9.203  80.956 37.462 1.00 28.07  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 6   ? -12.647 78.889 35.105 1.00 39.24  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 6   ? -13.572 77.819 34.765 1.00 39.53  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 6   ? -12.776 76.524 34.661 1.00 37.06  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 6   ? -11.776 76.447 33.947 1.00 36.50  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 6   ? -14.281 78.123 33.439 1.00 44.73  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 6   ? -15.491 77.229 33.202 1.00 53.00  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 6   ? -15.922 76.485 34.094 1.00 55.95  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 6   ? -16.055 77.306 31.998 1.00 57.86  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 7   ? -13.208 75.521 35.410 1.00 34.13  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 7   ? -12.535 74.239 35.415 1.00 32.72  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 7   ? -13.483 73.174 34.896 1.00 33.51  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 7   ? -14.674 73.427 34.721 1.00 35.44  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 7   ? -12.098 73.855 36.839 1.00 31.29  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 7   ? -13.256 73.595 37.641 1.00 30.15  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7   ? -11.299 74.983 37.473 1.00 30.47  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 8   ? -12.950 71.975 34.689 1.00 32.61  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 8   ? -13.727 70.838 34.212 1.00 30.12  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 8   ? -14.792 70.430 35.220 1.00 30.93  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 8   ? -15.680 69.639 34.905 1.00 33.12  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 8   ? -12.796 69.665 33.934 1.00 30.31  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 8   ? -11.738 69.993 32.897 1.00 31.06  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 8   ? -10.701 68.905 32.797 1.00 30.81  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 8   ? -9.705  69.232 31.707 1.00 29.78  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 8   ? -8.676  68.171 31.568 1.00 31.36  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 9   ? -14.686 70.964 36.436 1.00 31.41  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 9   ? -15.636 70.674 37.507 1.00 33.27  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 9   ? -16.604 71.832 37.724 1.00 32.54  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 9   ? -17.635 71.679 38.376 1.00 32.63  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 9   ? -14.895 70.376 38.812 1.00 33.84  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 9   ? -14.111 69.202 38.701 1.00 42.10  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 10  ? -16.259 72.994 37.186 1.00 32.63  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 10  ? -17.117 74.151 37.338 1.00 32.78  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 10  ? -16.305 75.412 37.492 1.00 34.39  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 10  ? -15.081 75.368 37.545 1.00 34.71  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 11  ? -16.990 76.545 37.558 1.00 36.53  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 11  ? -16.332 77.835 37.710 1.00 37.79  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 11  ? -16.025 78.077 39.179 1.00 37.04  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 11  ? -16.807 77.698 40.046 1.00 36.15  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 11  ? -17.244 78.946 37.184 1.00 41.49  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 11  ? -17.626 78.773 35.723 1.00 46.37  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 11  ? -18.834 79.607 35.331 1.00 51.38  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 11  ? -19.305 79.254 33.920 1.00 55.32  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 11  ? -20.514 80.028 33.511 1.00 61.59  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 12  ? -14.868 78.672 39.450 1.00 36.80  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 12  ? -14.450 78.984 40.812 1.00 36.14  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 12  ? -14.091 80.457 40.867 1.00 37.45  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 12  ? -13.553 81.009 39.907 1.00 37.82  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 12  ? -13.224 78.148 41.262 1.00 33.68  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 12  ? -13.577 76.675 41.297 1.00 34.55  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 12  ? -12.041 78.386 40.338 1.00 34.83  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 13  ? -14.402 81.095 41.989 1.00 38.93  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 13  ? -14.111 82.510 42.163 1.00 41.17  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 13  ? -13.184 82.698 43.356 1.00 40.53  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 13  ? -13.580 82.482 44.501 1.00 40.84  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 13  ? -15.414 83.297 42.363 1.00 45.49  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 13  ? -15.251 84.812 42.504 1.00 51.46  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 13  ? -14.573 85.622 41.035 1.00 59.15  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 13  ? -16.078 85.933 40.105 1.00 61.72  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 14  ? -11.940 83.069 43.072 1.00 39.23  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 14  ? -10.964 83.289 44.122 1.00 41.34  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 14  ? -11.058 84.659 44.765 1.00 41.79  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 14  ? -12.129 85.267 44.794 1.00 41.46  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 15  ? -9.927  85.149 45.268 1.00 42.52  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 15  ? -9.869  86.447 45.926 1.00 42.44  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 15  ? -8.487  87.087 45.821 1.00 42.39  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 15  ? -7.468  86.391 45.823 1.00 43.35  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 15  ? -10.258 86.327 47.414 1.00 43.39  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 15  ? -10.140 87.608 48.045 1.00 49.29  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 15  ? -9.364  85.319 48.128 1.00 43.25  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 16  ? -8.456  88.412 45.692 1.00 42.49  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 16  ? -7.188  89.122 45.599 1.00 43.69  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 16  ? -6.603  89.256 46.994 1.00 45.57  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 16  ? -7.170  89.917 47.865 1.00 47.48  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 16  ? -7.350  90.492 44.948 1.00 42.34  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 16  ? -6.016  91.149 44.653 1.00 47.57  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 16  ? -6.130  92.224 43.583 1.00 52.78  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 16  ? -4.815  92.713 43.165 1.00 58.41  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 16  ? -4.055  92.137 42.233 1.00 60.16  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 16  ? -4.476  91.047 41.603 1.00 61.49  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 16  ? -2.850  92.626 41.961 1.00 58.98  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 17  ? -5.481  88.578 47.196 1.00 44.52  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 17  ? -4.787  88.555 48.470 1.00 42.85  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 17  ? -3.496  89.355 48.434 1.00 41.31  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 17  ? -2.676  89.183 47.540 1.00 41.08  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 17  ? -4.451  87.102 48.856 1.00 42.29  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 17  ? -3.762  87.057 50.188 1.00 46.46  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 17  ? -5.715  86.272 48.897 1.00 44.32  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 18  ? -3.310  90.256 49.407 1.00 42.15  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 18  ? -2.096  91.073 49.473 1.00 42.17  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 18  ? -0.920  90.244 49.983 1.00 42.50  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 18  ? -1.077  89.411 50.878 1.00 42.95  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 18  ? -2.483  92.177 50.461 1.00 42.99  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 18  ? -3.426  91.484 51.383 1.00 40.13  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 18  ? -4.286  90.686 50.425 1.00 42.84  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 19  ? 0.251   90.471 49.397 1.00 42.74  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 19  ? 1.462   89.755 49.771 1.00 43.89  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 19  ? 2.707   90.605 49.508 1.00 47.60  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 19  ? 2.994   90.959 48.359 1.00 48.98  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 19  ? 1.578   88.406 49.002 1.00 43.65  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 19  ? 1.326   88.607 47.506 1.00 41.62  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 19  ? 2.949   87.777 49.230 1.00 41.21  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 20  ? 3.432   90.935 50.578 1.00 48.69  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 20  ? 4.661   91.734 50.491 1.00 51.32  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 20  ? 4.573   92.955 49.556 1.00 53.07  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 20  ? 5.303   93.046 48.555 1.00 52.03  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 20  ? 5.838   90.838 50.087 1.00 51.11  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 20  ? 6.202   89.691 51.032 1.00 49.92  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 20  ? 7.187   88.765 50.348 1.00 49.26  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 20  ? 6.781   90.235 52.332 1.00 50.23  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 21  ? 3.656   93.865 49.892 1.00 52.23  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 21  ? 3.402   95.107 49.153 1.00 54.02  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 21  ? 2.751   94.946 47.773 1.00 54.00  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 21  ? 2.576   95.928 47.047 1.00 58.38  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 21  ? 4.679   95.951 49.039 1.00 54.52  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 21  ? 5.577   95.423 48.074 1.00 57.62  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 22  ? 2.364   93.720 47.429 1.00 51.49  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 22  ? 1.733   93.440 46.142 1.00 46.91  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 22  ? 0.463   92.619 46.379 1.00 46.27  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 22  ? -0.108  92.670 47.467 1.00 45.96  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 22  ? 2.720   92.692 45.240 1.00 45.42  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 22  ? 2.224   92.542 43.922 1.00 44.95  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 23  ? -0.002  91.900 45.360 1.00 46.10  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 23  ? -1.205  91.074 45.482 1.00 47.50  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 23  ? -1.143  89.868 44.557 1.00 46.87  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 23  ? -0.405  89.869 43.573 1.00 46.29  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 23  ? -2.459  91.874 45.121 1.00 51.37  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 23  ? -2.875  92.871 46.156 1.00 58.71  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 23  ? -2.220  94.071 46.342 1.00 60.42  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 23  ? -3.893  92.856 47.049 1.00 61.74  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 23  ? -2.815  94.750 47.306 1.00 62.56  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 23  ? -3.833  94.036 47.752 1.00 63.73  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 24  ? -1.922  88.840 44.886 1.00 43.02  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 24  ? -2.014  87.625 44.081 1.00 41.34  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 24  ? -3.426  87.080 44.214 1.00 39.30  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 24  ? -4.211  87.572 45.020 1.00 40.14  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 24  ? -1.027  86.521 44.516 1.00 41.10  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 24  ? -1.232  86.161 45.981 1.00 42.48  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 24  ? 0.397   86.941 44.242 1.00 44.49  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 24  ? -0.411  84.985 46.403 1.00 46.67  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 25  ? -3.756  86.088 43.397 1.00 36.59  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 25  ? -5.076  85.483 43.439 1.00 34.87  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 25  ? -5.003  84.274 44.351 1.00 34.99  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 25  ? -3.969  83.610 44.434 1.00 34.56  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 25  ? -5.503  85.033 42.042 1.00 38.03  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 25  ? -5.445  86.099 41.113 1.00 37.65  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 26  ? -6.103  83.990 45.034 1.00 33.70  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 26  ? -6.157  82.846 45.924 1.00 33.73  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 26  ? -7.491  82.138 45.785 1.00 33.72  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 26  ? -8.550  82.723 46.002 1.00 34.22  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 26  ? -5.926  83.272 47.373 1.00 33.92  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 27  ? -7.430  80.883 45.372 1.00 32.23  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 27  ? -8.624  80.083 45.212 1.00 33.17  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 27  ? -8.580  79.082 46.353 1.00 33.73  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 27  ? -7.925  78.042 46.272 1.00 34.25  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 27  ? -8.609  79.417 43.836 1.00 32.48  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 27  ? -8.506  80.400 42.701 1.00 31.13  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 27  ? -7.267  80.909 42.316 1.00 29.08  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 27  ? -9.652  80.851 42.044 1.00 28.96  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 27  ? -7.168  81.855 41.293 1.00 30.29  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 27  ? -9.565  81.795 41.022 1.00 28.87  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 27  ? -8.321  82.300 40.646 1.00 29.69  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 28  ? -9.220  79.463 47.453 1.00 33.14  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 28  ? -9.251  78.657 48.658 1.00 30.81  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 28  ? -10.492 77.802 48.771 1.00 32.08  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 28  ? -11.581 78.226 48.413 1.00 33.61  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 28  ? -9.157  79.570 49.877 1.00 29.66  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 28  ? -8.068  80.644 49.813 1.00 30.68  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 28  ? -8.060  81.426 51.115 1.00 28.70  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 28  ? -6.702  80.017 49.548 1.00 27.08  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 29  ? -10.311 76.583 49.264 1.00 32.69  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 29  ? -11.431 75.681 49.455 1.00 32.12  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 29  ? -12.098 75.081 48.230 1.00 33.27  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 29  ? -13.322 74.934 48.214 1.00 33.90  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 30  ? -11.321 74.720 47.213 1.00 30.16  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 30  ? -11.899 74.112 46.022 1.00 29.75  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 30  ? -12.086 72.616 46.270 1.00 30.18  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 30  ? -11.132 71.910 46.584 1.00 31.99  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 30  ? -11.006 74.324 44.797 1.00 29.09  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 30  ? -10.688 75.811 44.636 1.00 26.98  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 30  ? -11.711 73.809 43.554 1.00 30.67  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 30  ? -9.677  76.101 43.564 1.00 27.41  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 31  ? -13.323 72.111 46.137 1.00 30.17  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 31  ? -13.579 70.684 46.363 1.00 30.65  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 31  ? -12.992 69.818 45.257 1.00 32.16  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 31  ? -13.130 70.142 44.076 1.00 33.47  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 31  ? -15.105 70.620 46.371 1.00 29.77  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 31  ? -15.475 71.656 45.356 1.00 27.52  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 31  ? -14.549 72.804 45.699 1.00 28.94  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 32  ? -12.322 68.732 45.636 1.00 31.24  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 32  ? -11.738 67.829 44.644 1.00 30.12  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 32  ? -12.302 66.412 44.750 1.00 29.92  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 32  ? -11.935 65.521 43.980 1.00 30.13  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 32  ? -10.199 67.819 44.720 1.00 29.66  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 32  ? -9.637  67.213 45.985 1.00 28.43  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 32  ? -9.650  65.834 46.187 1.00 28.15  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 32  ? -9.063  68.019 46.959 1.00 29.67  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 32  ? -9.102  65.270 47.334 1.00 27.54  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 32  ? -8.509  67.461 48.114 1.00 29.32  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 32  ? -8.531  66.085 48.298 1.00 27.61  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 33  ? -13.201 66.212 45.705 1.00 28.80  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 33  ? -13.820 64.912 45.910 1.00 29.02  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 33  ? -15.160 65.092 46.593 1.00 30.36  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 33  ? -15.451 66.157 47.131 1.00 33.19  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 33  ? -12.921 64.027 46.763 1.00 24.18  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 34  ? -15.998 64.066 46.521 1.00 31.29  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 34  ? -17.291 64.106 47.177 1.00 32.09  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 34  ? -17.026 63.944 48.670 1.00 34.46  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 34  ? -16.122 63.207 49.059 1.00 33.96  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 34  ? -18.167 62.952 46.688 1.00 31.47  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 34  ? -18.740 63.150 45.294 1.00 34.86  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 34  ? -19.773 64.254 45.248 1.00 36.28  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 34  ? -20.846 64.077 45.860 1.00 41.52  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 34  ? -19.514 65.298 44.613 1.00 35.20  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 35  ? -17.758 64.684 49.520 1.00 35.74  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 35  ? -17.591 64.599 50.975 1.00 36.74  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 35  ? -17.658 63.141 51.439 1.00 36.86  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 35  ? -18.663 62.461 51.228 1.00 38.54  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 35  ? -18.778 65.402 51.487 1.00 36.53  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 35  ? -18.864 66.495 50.471 1.00 38.15  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 35  ? -18.723 65.741 49.167 1.00 35.80  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 36  ? -16.566 62.635 52.040 1.00 35.78  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 36  ? -16.450 61.260 52.541 1.00 34.54  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 36  ? -17.238 61.006 53.822 1.00 35.36  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 36  ? -16.788 60.293 54.718 1.00 34.95  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 36  ? -14.947 61.114 52.759 1.00 36.08  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 36  ? -14.550 62.485 53.186 1.00 37.32  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 36  ? -15.300 63.369 52.228 1.00 35.19  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 37  ? -18.443 61.558 53.872 1.00 35.88  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 37  ? -19.306 61.434 55.033 1.00 34.35  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 37  ? -20.290 60.287 54.890 1.00 36.08  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 37  ? -20.507 59.777 53.795 1.00 37.02  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 37  ? -20.095 62.734 55.252 1.00 32.35  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 37  ? -19.143 63.904 55.416 1.00 28.68  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 37  ? -21.021 62.980 54.076 1.00 33.02  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 38  ? -20.891 59.905 56.012 1.00 38.02  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 38  ? -21.872 58.833 56.030 1.00 38.41  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 38  ? -21.318 57.462 55.717 1.00 38.80  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 38  ? -20.302 57.049 56.278 1.00 40.96  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 39  ? -22.004 56.751 54.825 1.00 39.14  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 39  ? -21.590 55.417 54.410 1.00 38.84  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 39  ? -20.281 55.496 53.624 1.00 38.69  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 39  ? -19.647 54.481 53.358 1.00 39.36  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 39  ? -22.683 54.767 53.563 1.00 39.43  ? 42   ASN A CB  1 
ATOM   282  N N   . MET A 1 40  ? -19.886 56.717 53.267 1.00 40.05  ? 43   MET A N   1 
ATOM   283  C CA  . MET A 1 40  ? -18.650 56.975 52.532 1.00 40.75  ? 43   MET A CA  1 
ATOM   284  C C   . MET A 1 40  ? -17.420 57.004 53.460 1.00 39.46  ? 43   MET A C   1 
ATOM   285  O O   . MET A 1 40  ? -16.281 56.982 52.987 1.00 38.94  ? 43   MET A O   1 
ATOM   286  C CB  . MET A 1 40  ? -18.762 58.308 51.790 1.00 46.99  ? 43   MET A CB  1 
ATOM   287  C CG  . MET A 1 40  ? -19.877 58.371 50.762 1.00 50.71  ? 43   MET A CG  1 
ATOM   288  S SD  . MET A 1 40  ? -19.301 57.964 49.106 1.00 62.57  ? 43   MET A SD  1 
ATOM   289  C CE  . MET A 1 40  ? -18.997 59.642 48.443 1.00 57.04  ? 43   MET A CE  1 
ATOM   290  N N   . ARG A 1 41  ? -17.651 57.082 54.770 1.00 33.64  ? 44   ARG A N   1 
ATOM   291  C CA  . ARG A 1 41  ? -16.561 57.104 55.735 1.00 31.78  ? 44   ARG A CA  1 
ATOM   292  C C   . ARG A 1 41  ? -15.741 55.819 55.585 1.00 30.98  ? 44   ARG A C   1 
ATOM   293  O O   . ARG A 1 41  ? -16.303 54.731 55.533 1.00 32.03  ? 44   ARG A O   1 
ATOM   294  C CB  . ARG A 1 41  ? -17.109 57.218 57.165 1.00 30.17  ? 44   ARG A CB  1 
ATOM   295  C CG  . ARG A 1 41  ? -16.018 57.270 58.235 1.00 32.28  ? 44   ARG A CG  1 
ATOM   296  C CD  . ARG A 1 41  ? -16.556 57.106 59.645 1.00 24.04  ? 44   ARG A CD  1 
ATOM   297  N NE  . ARG A 1 41  ? -17.119 58.335 60.192 1.00 24.28  ? 44   ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 41  ? -17.754 58.399 61.357 1.00 26.53  ? 44   ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 41  ? -17.902 57.300 62.081 1.00 26.45  ? 44   ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 41  ? -18.240 59.550 61.799 1.00 23.68  ? 44   ARG A NH2 1 
ATOM   301  N N   . PHE A 1 42  ? -14.424 55.971 55.455 1.00 30.00  ? 45   PHE A N   1 
ATOM   302  C CA  . PHE A 1 42  ? -13.477 54.860 55.303 1.00 30.69  ? 45   PHE A CA  1 
ATOM   303  C C   . PHE A 1 42  ? -13.337 54.380 53.863 1.00 30.65  ? 45   PHE A C   1 
ATOM   304  O O   . PHE A 1 42  ? -12.409 53.645 53.542 1.00 31.31  ? 45   PHE A O   1 
ATOM   305  C CB  . PHE A 1 42  ? -13.841 53.665 56.194 1.00 32.55  ? 45   PHE A CB  1 
ATOM   306  C CG  . PHE A 1 42  ? -13.947 53.996 57.657 1.00 36.91  ? 45   PHE A CG  1 
ATOM   307  C CD1 . PHE A 1 42  ? -13.027 54.848 58.266 1.00 35.88  ? 45   PHE A CD1 1 
ATOM   308  C CD2 . PHE A 1 42  ? -14.967 53.447 58.429 1.00 36.79  ? 45   PHE A CD2 1 
ATOM   309  C CE1 . PHE A 1 42  ? -13.120 55.146 59.620 1.00 36.24  ? 45   PHE A CE1 1 
ATOM   310  C CE2 . PHE A 1 42  ? -15.066 53.739 59.785 1.00 37.28  ? 45   PHE A CE2 1 
ATOM   311  C CZ  . PHE A 1 42  ? -14.141 54.591 60.382 1.00 35.69  ? 45   PHE A CZ  1 
ATOM   312  N N   . ARG A 1 43  ? -14.263 54.785 53.002 1.00 31.99  ? 46   ARG A N   1 
ATOM   313  C CA  . ARG A 1 43  ? -14.226 54.388 51.596 1.00 35.14  ? 46   ARG A CA  1 
ATOM   314  C C   . ARG A 1 43  ? -13.274 55.233 50.752 1.00 35.49  ? 46   ARG A C   1 
ATOM   315  O O   . ARG A 1 43  ? -12.883 56.330 51.155 1.00 37.01  ? 46   ARG A O   1 
ATOM   316  C CB  . ARG A 1 43  ? -15.623 54.467 50.982 1.00 35.54  ? 46   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 43  ? -16.604 53.481 51.557 1.00 41.21  ? 46   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 43  ? -17.829 53.381 50.681 1.00 44.68  ? 46   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 43  ? -17.513 52.826 49.367 1.00 53.04  ? 46   ARG A NE  1 
ATOM   320  N N   . ARG A 1 44  ? -12.914 54.715 49.577 1.00 34.97  ? 47   ARG A N   1 
ATOM   321  C CA  . ARG A 1 44  ? -12.035 55.422 48.646 1.00 33.75  ? 47   ARG A CA  1 
ATOM   322  C C   . ARG A 1 44  ? -12.756 56.692 48.211 1.00 30.36  ? 47   ARG A C   1 
ATOM   323  O O   . ARG A 1 44  ? -13.985 56.723 48.164 1.00 29.93  ? 47   ARG A O   1 
ATOM   324  C CB  . ARG A 1 44  ? -11.744 54.544 47.423 1.00 37.55  ? 47   ARG A CB  1 
ATOM   325  C CG  . ARG A 1 44  ? -11.042 53.244 47.779 1.00 47.47  ? 47   ARG A CG  1 
ATOM   326  C CD  . ARG A 1 44  ? -10.997 52.245 46.630 1.00 52.52  ? 47   ARG A CD  1 
ATOM   327  N NE  . ARG A 1 44  ? -10.452 50.961 47.077 1.00 57.16  ? 47   ARG A NE  1 
ATOM   328  C CZ  . ARG A 1 44  ? -9.297  50.446 46.659 1.00 60.72  ? 47   ARG A CZ  1 
ATOM   329  N NH1 . ARG A 1 44  ? -8.552  51.104 45.769 1.00 63.80  ? 47   ARG A NH1 1 
ATOM   330  N NH2 . ARG A 1 44  ? -8.878  49.278 47.140 1.00 59.55  ? 47   ARG A NH2 1 
ATOM   331  N N   . PRO A 1 45  ? -12.005 57.764 47.919 1.00 29.51  ? 48   PRO A N   1 
ATOM   332  C CA  . PRO A 1 45  ? -12.626 59.024 47.493 1.00 30.10  ? 48   PRO A CA  1 
ATOM   333  C C   . PRO A 1 45  ? -13.248 58.982 46.097 1.00 33.23  ? 48   PRO A C   1 
ATOM   334  O O   . PRO A 1 45  ? -12.700 58.375 45.169 1.00 34.84  ? 48   PRO A O   1 
ATOM   335  C CB  . PRO A 1 45  ? -11.460 60.008 47.540 1.00 27.13  ? 48   PRO A CB  1 
ATOM   336  C CG  . PRO A 1 45  ? -10.287 59.147 47.195 1.00 25.32  ? 48   PRO A CG  1 
ATOM   337  C CD  . PRO A 1 45  ? -10.541 57.903 48.006 1.00 25.53  ? 48   PRO A CD  1 
ATOM   338  N N   . GLU A 1 46  ? -14.422 59.592 45.977 1.00 33.36  ? 49   GLU A N   1 
ATOM   339  C CA  . GLU A 1 46  ? -15.123 59.688 44.705 1.00 34.28  ? 49   GLU A CA  1 
ATOM   340  C C   . GLU A 1 46  ? -14.872 61.099 44.200 1.00 33.44  ? 49   GLU A C   1 
ATOM   341  O O   . GLU A 1 46  ? -14.781 62.035 44.985 1.00 34.48  ? 49   GLU A O   1 
ATOM   342  C CB  . GLU A 1 46  ? -16.625 59.467 44.886 1.00 35.05  ? 49   GLU A CB  1 
ATOM   343  C CG  . GLU A 1 46  ? -17.012 58.031 45.162 1.00 45.44  ? 49   GLU A CG  1 
ATOM   344  C CD  . GLU A 1 46  ? -16.507 57.073 44.091 1.00 51.37  ? 49   GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 46  ? -15.847 56.075 44.454 1.00 55.68  ? 49   GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 46  ? -16.760 57.314 42.888 1.00 55.89  ? 49   GLU A OE2 1 
ATOM   347  N N   . PRO A 1 47  ? -14.737 61.270 42.883 1.00 33.26  ? 50   PRO A N   1 
ATOM   348  C CA  . PRO A 1 47  ? -14.493 62.598 42.310 1.00 32.16  ? 50   PRO A CA  1 
ATOM   349  C C   . PRO A 1 47  ? -15.626 63.571 42.625 1.00 32.10  ? 50   PRO A C   1 
ATOM   350  O O   . PRO A 1 47  ? -16.776 63.173 42.766 1.00 33.55  ? 50   PRO A O   1 
ATOM   351  C CB  . PRO A 1 47  ? -14.427 62.309 40.812 1.00 32.39  ? 50   PRO A CB  1 
ATOM   352  C CG  . PRO A 1 47  ? -13.941 60.894 40.755 1.00 35.60  ? 50   PRO A CG  1 
ATOM   353  C CD  . PRO A 1 47  ? -14.746 60.237 41.836 1.00 33.83  ? 50   PRO A CD  1 
ATOM   354  N N   . LYS A 1 48  ? -15.299 64.848 42.748 1.00 34.57  ? 51   LYS A N   1 
ATOM   355  C CA  . LYS A 1 48  ? -16.318 65.851 43.031 1.00 36.85  ? 51   LYS A CA  1 
ATOM   356  C C   . LYS A 1 48  ? -17.191 66.071 41.793 1.00 38.95  ? 51   LYS A C   1 
ATOM   357  O O   . LYS A 1 48  ? -16.692 66.493 40.745 1.00 41.33  ? 51   LYS A O   1 
ATOM   358  C CB  . LYS A 1 48  ? -15.662 67.170 43.445 1.00 34.73  ? 51   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 48  ? -16.620 68.329 43.610 1.00 32.78  ? 51   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 48  ? -17.636 68.045 44.683 1.00 33.40  ? 51   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 48  ? -18.473 69.274 44.968 1.00 35.05  ? 51   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 48  ? -19.410 69.029 46.103 1.00 38.97  ? 51   LYS A NZ  1 
ATOM   363  N N   . LYS A 1 49  ? -18.477 65.739 41.907 1.00 37.94  ? 52   LYS A N   1 
ATOM   364  C CA  . LYS A 1 49  ? -19.429 65.924 40.813 1.00 37.45  ? 52   LYS A CA  1 
ATOM   365  C C   . LYS A 1 49  ? -19.404 67.396 40.423 1.00 37.70  ? 52   LYS A C   1 
ATOM   366  O O   . LYS A 1 49  ? -19.505 68.268 41.284 1.00 36.60  ? 52   LYS A O   1 
ATOM   367  C CB  . LYS A 1 49  ? -20.839 65.550 41.267 1.00 38.51  ? 52   LYS A CB  1 
ATOM   368  C CG  . LYS A 1 49  ? -20.979 64.105 41.716 1.00 46.55  ? 52   LYS A CG  1 
ATOM   369  C CD  . LYS A 1 49  ? -22.286 63.873 42.467 1.00 48.80  ? 52   LYS A CD  1 
ATOM   370  C CE  . LYS A 1 49  ? -22.410 62.423 42.926 1.00 50.50  ? 52   LYS A CE  1 
ATOM   371  N N   . PRO A 1 50  ? -19.218 67.693 39.126 1.00 38.04  ? 53   PRO A N   1 
ATOM   372  C CA  . PRO A 1 50  ? -19.181 69.084 38.668 1.00 37.02  ? 53   PRO A CA  1 
ATOM   373  C C   . PRO A 1 50  ? -20.416 69.849 39.114 1.00 37.48  ? 53   PRO A C   1 
ATOM   374  O O   . PRO A 1 50  ? -21.497 69.274 39.260 1.00 37.54  ? 53   PRO A O   1 
ATOM   375  C CB  . PRO A 1 50  ? -19.088 68.944 37.150 1.00 36.37  ? 53   PRO A CB  1 
ATOM   376  C CG  . PRO A 1 50  ? -19.666 67.589 36.885 1.00 39.35  ? 53   PRO A CG  1 
ATOM   377  C CD  . PRO A 1 50  ? -19.089 66.772 37.990 1.00 35.52  ? 53   PRO A CD  1 
ATOM   378  N N   . TRP A 1 51  ? -20.232 71.137 39.380 1.00 37.39  ? 54   TRP A N   1 
ATOM   379  C CA  . TRP A 1 51  ? -21.314 71.991 39.853 1.00 39.66  ? 54   TRP A CA  1 
ATOM   380  C C   . TRP A 1 51  ? -21.713 73.068 38.861 1.00 42.57  ? 54   TRP A C   1 
ATOM   381  O O   . TRP A 1 51  ? -20.906 73.497 38.033 1.00 41.37  ? 54   TRP A O   1 
ATOM   382  C CB  . TRP A 1 51  ? -20.908 72.668 41.170 1.00 35.93  ? 54   TRP A CB  1 
ATOM   383  C CG  . TRP A 1 51  ? -19.626 73.453 41.068 1.00 34.35  ? 54   TRP A CG  1 
ATOM   384  C CD1 . TRP A 1 51  ? -19.486 74.765 40.700 1.00 32.70  ? 54   TRP A CD1 1 
ATOM   385  C CD2 . TRP A 1 51  ? -18.301 72.959 41.297 1.00 32.98  ? 54   TRP A CD2 1 
ATOM   386  N NE1 . TRP A 1 51  ? -18.158 75.111 40.679 1.00 30.87  ? 54   TRP A NE1 1 
ATOM   387  C CE2 . TRP A 1 51  ? -17.409 74.022 41.041 1.00 33.47  ? 54   TRP A CE2 1 
ATOM   388  C CE3 . TRP A 1 51  ? -17.781 71.719 41.691 1.00 32.25  ? 54   TRP A CE3 1 
ATOM   389  C CZ2 . TRP A 1 51  ? -16.025 73.882 41.168 1.00 34.57  ? 54   TRP A CZ2 1 
ATOM   390  C CZ3 . TRP A 1 51  ? -16.410 71.581 41.816 1.00 31.47  ? 54   TRP A CZ3 1 
ATOM   391  C CH2 . TRP A 1 51  ? -15.546 72.656 41.556 1.00 33.30  ? 54   TRP A CH2 1 
ATOM   392  N N   . SER A 1 52  ? -22.973 73.488 38.954 1.00 45.93  ? 55   SER A N   1 
ATOM   393  C CA  . SER A 1 52  ? -23.499 74.556 38.112 1.00 47.56  ? 55   SER A CA  1 
ATOM   394  C C   . SER A 1 52  ? -23.272 75.831 38.923 1.00 48.05  ? 55   SER A C   1 
ATOM   395  O O   . SER A 1 52  ? -23.260 75.792 40.160 1.00 50.21  ? 55   SER A O   1 
ATOM   396  C CB  . SER A 1 52  ? -24.995 74.352 37.846 1.00 47.20  ? 55   SER A CB  1 
ATOM   397  N N   . GLY A 1 53  ? -23.053 76.949 38.242 1.00 46.40  ? 56   GLY A N   1 
ATOM   398  C CA  . GLY A 1 53  ? -22.820 78.193 38.955 1.00 44.24  ? 56   GLY A CA  1 
ATOM   399  C C   . GLY A 1 53  ? -21.374 78.370 39.380 1.00 42.68  ? 56   GLY A C   1 
ATOM   400  O O   . GLY A 1 53  ? -20.513 77.567 39.028 1.00 44.07  ? 56   GLY A O   1 
ATOM   401  N N   . VAL A 1 54  ? -21.113 79.418 40.154 1.00 41.92  ? 57   VAL A N   1 
ATOM   402  C CA  . VAL A 1 54  ? -19.763 79.731 40.615 1.00 38.79  ? 57   VAL A CA  1 
ATOM   403  C C   . VAL A 1 54  ? -19.470 79.277 42.038 1.00 39.07  ? 57   VAL A C   1 
ATOM   404  O O   . VAL A 1 54  ? -20.245 79.545 42.955 1.00 38.86  ? 57   VAL A O   1 
ATOM   405  C CB  . VAL A 1 54  ? -19.495 81.242 40.522 1.00 35.48  ? 57   VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 54  ? -18.115 81.567 41.037 1.00 35.05  ? 57   VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 54  ? -19.633 81.699 39.089 1.00 37.22  ? 57   VAL A CG2 1 
ATOM   408  N N   . TRP A 1 55  ? -18.347 78.581 42.211 1.00 39.07  ? 58   TRP A N   1 
ATOM   409  C CA  . TRP A 1 55  ? -17.928 78.109 43.524 1.00 37.88  ? 58   TRP A CA  1 
ATOM   410  C C   . TRP A 1 55  ? -17.148 79.234 44.185 1.00 38.39  ? 58   TRP A C   1 
ATOM   411  O O   . TRP A 1 55  ? -16.233 79.794 43.583 1.00 37.76  ? 58   TRP A O   1 
ATOM   412  C CB  . TRP A 1 55  ? -17.034 76.867 43.419 1.00 34.46  ? 58   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 55  ? -16.729 76.274 44.764 1.00 33.62  ? 58   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 55  ? -15.767 76.686 45.652 1.00 31.17  ? 58   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 55  ? -17.449 75.220 45.415 1.00 33.30  ? 58   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 55  ? -15.858 75.962 46.814 1.00 30.52  ? 58   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 55  ? -16.880 75.056 46.698 1.00 32.89  ? 58   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 55  ? -18.526 74.400 45.040 1.00 32.80  ? 58   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 55  ? -17.353 74.104 47.609 1.00 32.35  ? 58   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 55  ? -18.996 73.455 45.944 1.00 33.49  ? 58   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 55  ? -18.409 73.315 47.215 1.00 33.22  ? 58   TRP A CH2 1 
ATOM   422  N N   . ASN A 1 56  ? -17.523 79.570 45.416 1.00 39.05  ? 59   ASN A N   1 
ATOM   423  C CA  . ASN A 1 56  ? -16.853 80.632 46.156 1.00 40.81  ? 59   ASN A CA  1 
ATOM   424  C C   . ASN A 1 56  ? -15.548 80.100 46.760 1.00 40.17  ? 59   ASN A C   1 
ATOM   425  O O   . ASN A 1 56  ? -15.567 79.370 47.747 1.00 41.59  ? 59   ASN A O   1 
ATOM   426  C CB  . ASN A 1 56  ? -17.784 81.169 47.250 1.00 43.63  ? 59   ASN A CB  1 
ATOM   427  C CG  . ASN A 1 56  ? -17.237 82.415 47.930 1.00 49.98  ? 59   ASN A CG  1 
ATOM   428  O OD1 . ASN A 1 56  ? -16.253 83.006 47.476 1.00 53.72  ? 59   ASN A OD1 1 
ATOM   429  N ND2 . ASN A 1 56  ? -17.873 82.810 49.033 1.00 54.71  ? 59   ASN A ND2 1 
ATOM   430  N N   . ALA A 1 57  ? -14.425 80.442 46.133 1.00 38.65  ? 60   ALA A N   1 
ATOM   431  C CA  . ALA A 1 57  ? -13.110 80.002 46.591 1.00 34.92  ? 60   ALA A CA  1 
ATOM   432  C C   . ALA A 1 57  ? -12.355 81.153 47.249 1.00 35.93  ? 60   ALA A C   1 
ATOM   433  O O   . ALA A 1 57  ? -11.171 81.377 46.982 1.00 37.21  ? 60   ALA A O   1 
ATOM   434  C CB  . ALA A 1 57  ? -12.317 79.448 45.421 1.00 32.42  ? 60   ALA A CB  1 
ATOM   435  N N   . SER A 1 58  ? -13.038 81.865 48.135 1.00 35.77  ? 61   SER A N   1 
ATOM   436  C CA  . SER A 1 58  ? -12.438 83.010 48.806 1.00 36.52  ? 61   SER A CA  1 
ATOM   437  C C   . SER A 1 58  ? -12.002 82.760 50.241 1.00 36.01  ? 61   SER A C   1 
ATOM   438  O O   . SER A 1 58  ? -11.302 83.583 50.823 1.00 36.49  ? 61   SER A O   1 
ATOM   439  C CB  . SER A 1 58  ? -13.403 84.191 48.768 1.00 34.53  ? 61   SER A CB  1 
ATOM   440  O OG  . SER A 1 58  ? -14.639 83.830 49.356 1.00 39.12  ? 61   SER A OG  1 
ATOM   441  N N   . THR A 1 59  ? -12.430 81.646 50.824 1.00 37.14  ? 62   THR A N   1 
ATOM   442  C CA  . THR A 1 59  ? -12.061 81.336 52.204 1.00 39.07  ? 62   THR A CA  1 
ATOM   443  C C   . THR A 1 59  ? -11.623 79.887 52.422 1.00 36.76  ? 62   THR A C   1 
ATOM   444  O O   . THR A 1 59  ? -12.050 78.972 51.717 1.00 37.15  ? 62   THR A O   1 
ATOM   445  C CB  . THR A 1 59  ? -13.216 81.648 53.181 1.00 41.61  ? 62   THR A CB  1 
ATOM   446  O OG1 . THR A 1 59  ? -14.334 80.800 52.890 1.00 43.98  ? 62   THR A OG1 1 
ATOM   447  C CG2 . THR A 1 59  ? -13.648 83.102 53.059 1.00 42.94  ? 62   THR A CG2 1 
ATOM   448  N N   . TYR A 1 60  ? -10.765 79.693 53.414 1.00 34.38  ? 63   TYR A N   1 
ATOM   449  C CA  . TYR A 1 60  ? -10.261 78.375 53.758 1.00 30.27  ? 63   TYR A CA  1 
ATOM   450  C C   . TYR A 1 60  ? -11.351 77.384 54.110 1.00 29.86  ? 63   TYR A C   1 
ATOM   451  O O   . TYR A 1 60  ? -12.377 77.741 54.690 1.00 33.23  ? 63   TYR A O   1 
ATOM   452  C CB  . TYR A 1 60  ? -9.317  78.478 54.939 1.00 27.16  ? 63   TYR A CB  1 
ATOM   453  C CG  . TYR A 1 60  ? -7.909  78.804 54.557 1.00 28.03  ? 63   TYR A CG  1 
ATOM   454  C CD1 . TYR A 1 60  ? -7.344  78.283 53.391 1.00 27.12  ? 63   TYR A CD1 1 
ATOM   455  C CD2 . TYR A 1 60  ? -7.107  79.566 55.400 1.00 26.04  ? 63   TYR A CD2 1 
ATOM   456  C CE1 . TYR A 1 60  ? -6.011  78.506 53.091 1.00 27.04  ? 63   TYR A CE1 1 
ATOM   457  C CE2 . TYR A 1 60  ? -5.780  79.793 55.106 1.00 24.16  ? 63   TYR A CE2 1 
ATOM   458  C CZ  . TYR A 1 60  ? -5.237  79.258 53.958 1.00 25.69  ? 63   TYR A CZ  1 
ATOM   459  O OH  . TYR A 1 60  ? -3.905  79.448 53.707 1.00 31.47  ? 63   TYR A OH  1 
ATOM   460  N N   . PRO A 1 61  ? -11.134 76.113 53.767 1.00 27.92  ? 64   PRO A N   1 
ATOM   461  C CA  . PRO A 1 61  ? -12.097 75.052 54.051 1.00 27.50  ? 64   PRO A CA  1 
ATOM   462  C C   . PRO A 1 61  ? -11.955 74.511 55.481 1.00 27.92  ? 64   PRO A C   1 
ATOM   463  O O   . PRO A 1 61  ? -11.093 74.948 56.248 1.00 28.53  ? 64   PRO A O   1 
ATOM   464  C CB  . PRO A 1 61  ? -11.723 73.995 53.020 1.00 25.88  ? 64   PRO A CB  1 
ATOM   465  C CG  . PRO A 1 61  ? -10.242 74.120 52.956 1.00 23.50  ? 64   PRO A CG  1 
ATOM   466  C CD  . PRO A 1 61  ? -10.032 75.616 52.920 1.00 27.16  ? 64   PRO A CD  1 
ATOM   467  N N   . ASN A 1 62  ? -12.836 73.585 55.843 1.00 27.08  ? 65   ASN A N   1 
ATOM   468  C CA  . ASN A 1 62  ? -12.789 72.961 57.155 1.00 29.45  ? 65   ASN A CA  1 
ATOM   469  C C   . ASN A 1 62  ? -11.580 72.051 57.151 1.00 30.54  ? 65   ASN A C   1 
ATOM   470  O O   . ASN A 1 62  ? -11.094 71.663 56.092 1.00 29.39  ? 65   ASN A O   1 
ATOM   471  C CB  . ASN A 1 62  ? -14.021 72.082 57.398 1.00 29.16  ? 65   ASN A CB  1 
ATOM   472  C CG  . ASN A 1 62  ? -15.301 72.874 57.526 1.00 35.15  ? 65   ASN A CG  1 
ATOM   473  O OD1 . ASN A 1 62  ? -16.361 72.407 57.111 1.00 37.56  ? 65   ASN A OD1 1 
ATOM   474  N ND2 . ASN A 1 62  ? -15.221 74.066 58.116 1.00 32.32  ? 65   ASN A ND2 1 
ATOM   475  N N   . ASN A 1 63  ? -11.095 71.712 58.336 1.00 31.91  ? 66   ASN A N   1 
ATOM   476  C CA  . ASN A 1 63  ? -9.967  70.804 58.458 1.00 31.45  ? 66   ASN A CA  1 
ATOM   477  C C   . ASN A 1 63  ? -10.575 69.429 58.713 1.00 31.13  ? 66   ASN A C   1 
ATOM   478  O O   . ASN A 1 63  ? -11.715 69.337 59.160 1.00 31.50  ? 66   ASN A O   1 
ATOM   479  C CB  . ASN A 1 63  ? -9.061  71.239 59.609 1.00 32.30  ? 66   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 63  ? -8.451  72.613 59.380 1.00 35.13  ? 66   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 63  ? -8.348  73.422 60.302 1.00 39.15  ? 66   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 63  ? -8.037  72.879 58.144 1.00 34.51  ? 66   ASN A ND2 1 
ATOM   483  N N   . CYS A 1 64  ? -9.853  68.367 58.369 1.00 29.81  ? 67   CYS A N   1 
ATOM   484  C CA  . CYS A 1 64  ? -10.362 67.016 58.575 1.00 27.83  ? 67   CYS A CA  1 
ATOM   485  C C   . CYS A 1 64  ? -10.413 66.678 60.057 1.00 28.06  ? 67   CYS A C   1 
ATOM   486  O O   . CYS A 1 64  ? -9.664  67.250 60.846 1.00 28.91  ? 67   CYS A O   1 
ATOM   487  C CB  . CYS A 1 64  ? -9.496  65.998 57.828 1.00 27.35  ? 67   CYS A CB  1 
ATOM   488  S SG  . CYS A 1 64  ? -9.527  66.214 56.015 1.00 33.24  ? 67   CYS A SG  1 
ATOM   489  N N   . GLN A 1 65  ? -11.346 65.805 60.435 1.00 27.78  ? 68   GLN A N   1 
ATOM   490  C CA  . GLN A 1 65  ? -11.494 65.366 61.820 1.00 27.83  ? 68   GLN A CA  1 
ATOM   491  C C   . GLN A 1 65  ? -10.180 64.749 62.277 1.00 29.06  ? 68   GLN A C   1 
ATOM   492  O O   . GLN A 1 65  ? -9.678  63.805 61.665 1.00 30.31  ? 68   GLN A O   1 
ATOM   493  C CB  . GLN A 1 65  ? -12.614 64.335 61.945 1.00 27.75  ? 68   GLN A CB  1 
ATOM   494  C CG  . GLN A 1 65  ? -13.996 64.906 61.789 1.00 31.25  ? 68   GLN A CG  1 
ATOM   495  C CD  . GLN A 1 65  ? -14.387 65.857 62.914 1.00 36.28  ? 68   GLN A CD  1 
ATOM   496  O OE1 . GLN A 1 65  ? -15.414 66.531 62.835 1.00 36.17  ? 68   GLN A OE1 1 
ATOM   497  N NE2 . GLN A 1 65  ? -13.584 65.902 63.974 1.00 36.82  ? 68   GLN A NE2 1 
ATOM   498  N N   . GLN A 1 66  ? -9.641  65.260 63.376 1.00 29.76  ? 69   GLN A N   1 
ATOM   499  C CA  . GLN A 1 66  ? -8.368  64.771 63.868 1.00 30.25  ? 69   GLN A CA  1 
ATOM   500  C C   . GLN A 1 66  ? -8.128  65.042 65.342 1.00 31.28  ? 69   GLN A C   1 
ATOM   501  O O   . GLN A 1 66  ? -8.753  65.913 65.959 1.00 27.69  ? 69   GLN A O   1 
ATOM   502  C CB  . GLN A 1 66  ? -7.244  65.437 63.078 1.00 29.41  ? 69   GLN A CB  1 
ATOM   503  C CG  . GLN A 1 66  ? -7.240  66.948 63.256 1.00 29.03  ? 69   GLN A CG  1 
ATOM   504  C CD  . GLN A 1 66  ? -6.257  67.650 62.357 1.00 30.94  ? 69   GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 66  ? -5.113  67.896 62.740 1.00 30.76  ? 69   GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 66  ? -6.704  68.001 61.156 1.00 32.31  ? 69   GLN A NE2 1 
ATOM   507  N N   . TYR A 1 67  ? -7.157  64.315 65.875 1.00 30.96  ? 70   TYR A N   1 
ATOM   508  C CA  . TYR A 1 67  ? -6.752  64.464 67.249 1.00 32.44  ? 70   TYR A CA  1 
ATOM   509  C C   . TYR A 1 67  ? -6.108  65.841 67.347 1.00 32.78  ? 70   TYR A C   1 
ATOM   510  O O   . TYR A 1 67  ? -5.283  66.213 66.509 1.00 32.84  ? 70   TYR A O   1 
ATOM   511  C CB  . TYR A 1 67  ? -5.735  63.384 67.609 1.00 34.17  ? 70   TYR A CB  1 
ATOM   512  C CG  . TYR A 1 67  ? -4.996  63.678 68.885 1.00 36.53  ? 70   TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 67  ? -5.518  63.292 70.114 1.00 34.22  ? 70   TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 67  ? -3.789  64.381 68.867 1.00 34.74  ? 70   TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 67  ? -4.863  63.601 71.290 1.00 35.40  ? 70   TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 67  ? -3.129  64.694 70.036 1.00 34.70  ? 70   TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 67  ? -3.672  64.301 71.244 1.00 35.99  ? 70   TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 67  ? -3.024  64.613 72.411 1.00 41.37  ? 70   TYR A OH  1 
ATOM   519  N N   . VAL A 1 68  ? -6.510  66.602 68.356 1.00 31.94  ? 71   VAL A N   1 
ATOM   520  C CA  . VAL A 1 68  ? -5.975  67.939 68.568 1.00 32.09  ? 71   VAL A CA  1 
ATOM   521  C C   . VAL A 1 68  ? -5.044  67.977 69.781 1.00 33.47  ? 71   VAL A C   1 
ATOM   522  O O   . VAL A 1 68  ? -5.412  67.551 70.874 1.00 34.83  ? 71   VAL A O   1 
ATOM   523  C CB  . VAL A 1 68  ? -7.118  68.958 68.742 1.00 32.08  ? 71   VAL A CB  1 
ATOM   524  C CG1 . VAL A 1 68  ? -6.563  70.335 69.055 1.00 31.10  ? 71   VAL A CG1 1 
ATOM   525  C CG2 . VAL A 1 68  ? -7.971  68.997 67.479 1.00 32.30  ? 71   VAL A CG2 1 
ATOM   526  N N   . ASP A 1 69  ? -3.833  68.480 69.570 1.00 32.22  ? 72   ASP A N   1 
ATOM   527  C CA  . ASP A 1 69  ? -2.842  68.584 70.627 1.00 31.88  ? 72   ASP A CA  1 
ATOM   528  C C   . ASP A 1 69  ? -3.248  69.642 71.644 1.00 35.64  ? 72   ASP A C   1 
ATOM   529  O O   . ASP A 1 69  ? -3.433  70.806 71.300 1.00 36.02  ? 72   ASP A O   1 
ATOM   530  C CB  . ASP A 1 69  ? -1.482  68.940 70.021 1.00 34.74  ? 72   ASP A CB  1 
ATOM   531  C CG  . ASP A 1 69  ? -0.379  69.082 71.065 1.00 35.60  ? 72   ASP A CG  1 
ATOM   532  O OD1 . ASP A 1 69  ? -0.536  68.584 72.195 1.00 38.76  ? 72   ASP A OD1 1 
ATOM   533  O OD2 . ASP A 1 69  ? 0.666   69.680 70.747 1.00 37.15  ? 72   ASP A OD2 1 
ATOM   534  N N   . GLU A 1 70  ? -3.376  69.226 72.901 1.00 38.22  ? 73   GLU A N   1 
ATOM   535  C CA  . GLU A 1 70  ? -3.743  70.129 73.987 1.00 39.12  ? 73   GLU A CA  1 
ATOM   536  C C   . GLU A 1 70  ? -2.742  70.061 75.140 1.00 38.04  ? 73   GLU A C   1 
ATOM   537  O O   . GLU A 1 70  ? -3.038  70.469 76.263 1.00 37.81  ? 73   GLU A O   1 
ATOM   538  C CB  . GLU A 1 70  ? -5.159  69.829 74.479 1.00 41.29  ? 73   GLU A CB  1 
ATOM   539  C CG  . GLU A 1 70  ? -6.242  70.446 73.604 1.00 52.59  ? 73   GLU A CG  1 
ATOM   540  C CD  . GLU A 1 70  ? -7.661  70.078 74.030 1.00 58.27  ? 73   GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 70  ? -7.864  69.612 75.177 1.00 59.61  ? 73   GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 70  ? -8.584  70.264 73.203 1.00 64.87  ? 73   GLU A OE2 1 
ATOM   543  N N   . GLN A 1 71  ? -1.544  69.569 74.842 1.00 37.01  ? 74   GLN A N   1 
ATOM   544  C CA  . GLN A 1 71  ? -0.483  69.444 75.834 1.00 37.88  ? 74   GLN A CA  1 
ATOM   545  C C   . GLN A 1 71  ? -0.088  70.778 76.460 1.00 37.61  ? 74   GLN A C   1 
ATOM   546  O O   . GLN A 1 71  ? 0.188   70.859 77.658 1.00 36.25  ? 74   GLN A O   1 
ATOM   547  C CB  . GLN A 1 71  ? 0.754   68.815 75.199 1.00 36.10  ? 74   GLN A CB  1 
ATOM   548  C CG  . GLN A 1 71  ? 0.940   67.368 75.534 1.00 41.32  ? 74   GLN A CG  1 
ATOM   549  C CD  . GLN A 1 71  ? 1.232   67.149 76.998 1.00 44.01  ? 74   GLN A CD  1 
ATOM   550  O OE1 . GLN A 1 71  ? 0.364   66.721 77.753 1.00 45.35  ? 74   GLN A OE1 1 
ATOM   551  N NE2 . GLN A 1 71  ? 2.463   67.433 77.408 1.00 49.18  ? 74   GLN A NE2 1 
ATOM   552  N N   . PHE A 1 72  ? -0.063  71.822 75.640 1.00 35.45  ? 75   PHE A N   1 
ATOM   553  C CA  . PHE A 1 72  ? 0.328   73.141 76.108 1.00 34.92  ? 75   PHE A CA  1 
ATOM   554  C C   . PHE A 1 72  ? -0.696  74.182 75.659 1.00 35.74  ? 75   PHE A C   1 
ATOM   555  O O   . PHE A 1 72  ? -0.437  74.974 74.753 1.00 35.31  ? 75   PHE A O   1 
ATOM   556  C CB  . PHE A 1 72  ? 1.733   73.462 75.572 1.00 31.27  ? 75   PHE A CB  1 
ATOM   557  C CG  . PHE A 1 72  ? 2.746   72.371 75.838 1.00 30.75  ? 75   PHE A CG  1 
ATOM   558  C CD1 . PHE A 1 72  ? 3.257   72.169 77.121 1.00 29.29  ? 75   PHE A CD1 1 
ATOM   559  C CD2 . PHE A 1 72  ? 3.159   71.521 74.818 1.00 28.53  ? 75   PHE A CD2 1 
ATOM   560  C CE1 . PHE A 1 72  ? 4.161   71.137 77.379 1.00 28.24  ? 75   PHE A CE1 1 
ATOM   561  C CE2 . PHE A 1 72  ? 4.062   70.486 75.067 1.00 27.50  ? 75   PHE A CE2 1 
ATOM   562  C CZ  . PHE A 1 72  ? 4.562   70.294 76.347 1.00 28.86  ? 75   PHE A CZ  1 
ATOM   563  N N   . PRO A 1 73  ? -1.889  74.177 76.286 1.00 36.70  ? 76   PRO A N   1 
ATOM   564  C CA  . PRO A 1 73  ? -2.960  75.121 75.950 1.00 35.86  ? 76   PRO A CA  1 
ATOM   565  C C   . PRO A 1 73  ? -2.450  76.549 75.919 1.00 38.21  ? 76   PRO A C   1 
ATOM   566  O O   . PRO A 1 73  ? -1.793  77.003 76.860 1.00 39.94  ? 76   PRO A O   1 
ATOM   567  C CB  . PRO A 1 73  ? -3.962  74.907 77.080 1.00 32.59  ? 76   PRO A CB  1 
ATOM   568  C CG  . PRO A 1 73  ? -3.808  73.456 77.371 1.00 32.29  ? 76   PRO A CG  1 
ATOM   569  C CD  . PRO A 1 73  ? -2.308  73.291 77.388 1.00 35.76  ? 76   PRO A CD  1 
ATOM   570  N N   . GLY A 1 74  ? -2.718  77.232 74.809 1.00 40.28  ? 77   GLY A N   1 
ATOM   571  C CA  . GLY A 1 74  ? -2.284  78.610 74.640 1.00 39.85  ? 77   GLY A CA  1 
ATOM   572  C C   . GLY A 1 74  ? -0.867  78.776 74.107 1.00 41.24  ? 77   GLY A C   1 
ATOM   573  O O   . GLY A 1 74  ? -0.466  79.885 73.744 1.00 45.64  ? 77   GLY A O   1 
ATOM   574  N N   . PHE A 1 75  ? -0.107  77.685 74.044 1.00 37.58  ? 78   PHE A N   1 
ATOM   575  C CA  . PHE A 1 75  ? 1.268   77.735 73.561 1.00 32.54  ? 78   PHE A CA  1 
ATOM   576  C C   . PHE A 1 75  ? 1.272   77.733 72.039 1.00 31.42  ? 78   PHE A C   1 
ATOM   577  O O   . PHE A 1 75  ? 0.785   76.794 71.419 1.00 35.19  ? 78   PHE A O   1 
ATOM   578  C CB  . PHE A 1 75  ? 2.044   76.535 74.102 1.00 29.76  ? 78   PHE A CB  1 
ATOM   579  C CG  . PHE A 1 75  ? 3.505   76.562 73.780 1.00 30.70  ? 78   PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 75  ? 4.281   77.671 74.096 1.00 29.47  ? 78   PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 75  ? 4.115   75.470 73.177 1.00 28.66  ? 78   PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 75  ? 5.644   77.691 73.816 1.00 30.23  ? 78   PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 75  ? 5.477   75.478 72.892 1.00 31.23  ? 78   PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 75  ? 6.245   76.588 73.213 1.00 32.43  ? 78   PHE A CZ  1 
ATOM   585  N N   . SER A 1 76  ? 1.831   78.780 71.443 1.00 30.60  ? 79   SER A N   1 
ATOM   586  C CA  . SER A 1 76  ? 1.881   78.902 69.987 1.00 32.47  ? 79   SER A CA  1 
ATOM   587  C C   . SER A 1 76  ? 2.680   77.789 69.316 1.00 33.90  ? 79   SER A C   1 
ATOM   588  O O   . SER A 1 76  ? 2.272   77.268 68.277 1.00 32.91  ? 79   SER A O   1 
ATOM   589  C CB  . SER A 1 76  ? 2.455   80.259 69.581 1.00 31.86  ? 79   SER A CB  1 
ATOM   590  O OG  . SER A 1 76  ? 3.837   80.354 69.893 1.00 35.87  ? 79   SER A OG  1 
ATOM   591  N N   . GLY A 1 77  ? 3.803   77.418 69.927 1.00 32.49  ? 80   GLY A N   1 
ATOM   592  C CA  . GLY A 1 77  ? 4.650   76.374 69.378 1.00 33.16  ? 80   GLY A CA  1 
ATOM   593  C C   . GLY A 1 77  ? 3.920   75.085 69.055 1.00 33.45  ? 80   GLY A C   1 
ATOM   594  O O   . GLY A 1 77  ? 4.287   74.378 68.118 1.00 33.08  ? 80   GLY A O   1 
ATOM   595  N N   . SER A 1 78  ? 2.882   74.781 69.825 1.00 31.69  ? 81   SER A N   1 
ATOM   596  C CA  . SER A 1 78  ? 2.109   73.568 69.612 1.00 32.59  ? 81   SER A CA  1 
ATOM   597  C C   . SER A 1 78  ? 0.795   73.828 68.879 1.00 33.29  ? 81   SER A C   1 
ATOM   598  O O   . SER A 1 78  ? 0.385   73.051 68.015 1.00 31.94  ? 81   SER A O   1 
ATOM   599  C CB  . SER A 1 78  ? 1.833   72.881 70.953 1.00 33.08  ? 81   SER A CB  1 
ATOM   600  O OG  . SER A 1 78  ? 1.138   73.747 71.832 1.00 33.54  ? 81   SER A OG  1 
ATOM   601  N N   . GLU A 1 79  ? 0.145   74.935 69.212 1.00 32.89  ? 82   GLU A N   1 
ATOM   602  C CA  . GLU A 1 79  ? -1.131  75.269 68.598 1.00 33.01  ? 82   GLU A CA  1 
ATOM   603  C C   . GLU A 1 79  ? -1.034  75.739 67.155 1.00 31.58  ? 82   GLU A C   1 
ATOM   604  O O   . GLU A 1 79  ? -2.032  75.736 66.432 1.00 28.83  ? 82   GLU A O   1 
ATOM   605  C CB  . GLU A 1 79  ? -1.873  76.283 69.455 1.00 35.15  ? 82   GLU A CB  1 
ATOM   606  C CG  . GLU A 1 79  ? -2.104  75.766 70.860 1.00 41.57  ? 82   GLU A CG  1 
ATOM   607  C CD  . GLU A 1 79  ? -3.013  76.652 71.667 1.00 45.55  ? 82   GLU A CD  1 
ATOM   608  O OE1 . GLU A 1 79  ? -2.928  77.891 71.527 1.00 50.52  ? 82   GLU A OE1 1 
ATOM   609  O OE2 . GLU A 1 79  ? -3.822  76.108 72.443 1.00 48.22  ? 82   GLU A OE2 1 
ATOM   610  N N   . MET A 1 80  ? 0.172   76.111 66.731 1.00 28.07  ? 83   MET A N   1 
ATOM   611  C CA  . MET A 1 80  ? 0.393   76.555 65.362 1.00 27.48  ? 83   MET A CA  1 
ATOM   612  C C   . MET A 1 80  ? 0.242   75.379 64.391 1.00 28.40  ? 83   MET A C   1 
ATOM   613  O O   . MET A 1 80  ? 0.203   75.570 63.179 1.00 27.96  ? 83   MET A O   1 
ATOM   614  C CB  . MET A 1 80  ? 1.784   77.167 65.213 1.00 26.97  ? 83   MET A CB  1 
ATOM   615  C CG  . MET A 1 80  ? 2.909   76.168 65.313 1.00 27.51  ? 83   MET A CG  1 
ATOM   616  S SD  . MET A 1 80  ? 4.503   76.958 65.158 1.00 31.44  ? 83   MET A SD  1 
ATOM   617  C CE  . MET A 1 80  ? 4.721   76.923 63.410 1.00 30.35  ? 83   MET A CE  1 
ATOM   618  N N   . TRP A 1 81  ? 0.172   74.169 64.941 1.00 27.13  ? 84   TRP A N   1 
ATOM   619  C CA  . TRP A 1 81  ? 0.020   72.949 64.156 1.00 27.35  ? 84   TRP A CA  1 
ATOM   620  C C   . TRP A 1 81  ? -1.398  72.406 64.240 1.00 29.54  ? 84   TRP A C   1 
ATOM   621  O O   . TRP A 1 81  ? -1.772  71.536 63.455 1.00 29.81  ? 84   TRP A O   1 
ATOM   622  C CB  . TRP A 1 81  ? 0.983   71.872 64.656 1.00 25.66  ? 84   TRP A CB  1 
ATOM   623  C CG  . TRP A 1 81  ? 2.393   72.311 64.651 1.00 26.26  ? 84   TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 81  ? 3.185   72.533 65.738 1.00 26.13  ? 84   TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 81  ? 3.186   72.620 63.501 1.00 26.57  ? 84   TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 81  ? 4.425   72.967 65.339 1.00 27.51  ? 84   TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 81  ? 4.456   73.029 63.969 1.00 28.67  ? 84   TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 81  ? 2.949   72.595 62.118 1.00 26.29  ? 84   TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 81  ? 5.492   73.408 63.100 1.00 25.85  ? 84   TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 81  ? 3.981   72.974 61.253 1.00 23.20  ? 84   TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 81  ? 5.234   73.373 61.752 1.00 24.88  ? 84   TRP A CH2 1 
ATOM   632  N N   . ASN A 1 82  ? -2.162  72.890 65.219 1.00 29.51  ? 85   ASN A N   1 
ATOM   633  C CA  . ASN A 1 82  ? -3.541  72.455 65.434 1.00 28.30  ? 85   ASN A CA  1 
ATOM   634  C C   . ASN A 1 82  ? -4.478  73.026 64.390 1.00 27.92  ? 85   ASN A C   1 
ATOM   635  O O   . ASN A 1 82  ? -4.164  74.034 63.760 1.00 27.37  ? 85   ASN A O   1 
ATOM   636  C CB  . ASN A 1 82  ? -4.032  72.892 66.819 1.00 31.90  ? 85   ASN A CB  1 
ATOM   637  C CG  . ASN A 1 82  ? -3.539  71.992 67.929 1.00 34.91  ? 85   ASN A CG  1 
ATOM   638  O OD1 . ASN A 1 82  ? -3.259  70.808 67.718 1.00 38.06  ? 85   ASN A OD1 1 
ATOM   639  N ND2 . ASN A 1 82  ? -3.447  72.546 69.129 1.00 35.38  ? 85   ASN A ND2 1 
ATOM   640  N N   . PRO A 1 83  ? -5.639  72.375 64.179 1.00 26.05  ? 86   PRO A N   1 
ATOM   641  C CA  . PRO A 1 83  ? -6.606  72.867 63.192 1.00 25.00  ? 86   PRO A CA  1 
ATOM   642  C C   . PRO A 1 83  ? -6.978  74.305 63.536 1.00 25.79  ? 86   PRO A C   1 
ATOM   643  O O   . PRO A 1 83  ? -7.132  74.647 64.710 1.00 25.66  ? 86   PRO A O   1 
ATOM   644  C CB  . PRO A 1 83  ? -7.805  71.938 63.396 1.00 22.19  ? 86   PRO A CB  1 
ATOM   645  C CG  . PRO A 1 83  ? -7.175  70.662 63.832 1.00 23.10  ? 86   PRO A CG  1 
ATOM   646  C CD  . PRO A 1 83  ? -6.102  71.113 64.790 1.00 22.10  ? 86   PRO A CD  1 
ATOM   647  N N   . ASN A 1 84  ? -7.068  75.152 62.518 1.00 26.29  ? 87   ASN A N   1 
ATOM   648  C CA  . ASN A 1 84  ? -7.429  76.545 62.726 1.00 25.91  ? 87   ASN A CA  1 
ATOM   649  C C   . ASN A 1 84  ? -8.752  76.875 62.043 1.00 27.96  ? 87   ASN A C   1 
ATOM   650  O O   . ASN A 1 84  ? -9.064  78.040 61.806 1.00 30.81  ? 87   ASN A O   1 
ATOM   651  C CB  . ASN A 1 84  ? -6.314  77.470 62.238 1.00 27.52  ? 87   ASN A CB  1 
ATOM   652  C CG  . ASN A 1 84  ? -6.022  77.312 60.757 1.00 33.00  ? 87   ASN A CG  1 
ATOM   653  O OD1 . ASN A 1 84  ? -6.509  76.383 60.106 1.00 34.30  ? 87   ASN A OD1 1 
ATOM   654  N ND2 . ASN A 1 84  ? -5.219  78.221 60.218 1.00 29.73  ? 87   ASN A ND2 1 
ATOM   655  N N   . ARG A 1 85  ? -9.500  75.832 61.692 1.00 28.57  ? 88   ARG A N   1 
ATOM   656  C CA  . ARG A 1 85  ? -10.813 75.956 61.054 1.00 30.63  ? 88   ARG A CA  1 
ATOM   657  C C   . ARG A 1 85  ? -11.669 74.881 61.714 1.00 32.39  ? 88   ARG A C   1 
ATOM   658  O O   . ARG A 1 85  ? -11.140 73.999 62.396 1.00 34.09  ? 88   ARG A O   1 
ATOM   659  C CB  . ARG A 1 85  ? -10.741 75.640 59.552 1.00 29.81  ? 88   ARG A CB  1 
ATOM   660  C CG  . ARG A 1 85  ? -9.568  76.239 58.811 1.00 34.11  ? 88   ARG A CG  1 
ATOM   661  C CD  . ARG A 1 85  ? -9.615  77.739 58.821 1.00 35.31  ? 88   ARG A CD  1 
ATOM   662  N NE  . ARG A 1 85  ? -10.852 78.231 58.236 1.00 39.67  ? 88   ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 85  ? -11.084 79.511 57.974 1.00 42.90  ? 88   ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 85  ? -10.156 80.423 58.257 1.00 38.92  ? 88   ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 85  ? -12.224 79.871 57.395 1.00 42.48  ? 88   ARG A NH2 1 
ATOM   666  N N   . GLU A 1 86  ? -12.983 74.939 61.518 1.00 32.91  ? 89   GLU A N   1 
ATOM   667  C CA  . GLU A 1 86  ? -13.853 73.918 62.091 1.00 33.82  ? 89   GLU A CA  1 
ATOM   668  C C   . GLU A 1 86  ? -13.455 72.583 61.471 1.00 32.57  ? 89   GLU A C   1 
ATOM   669  O O   . GLU A 1 86  ? -13.119 72.525 60.293 1.00 33.99  ? 89   GLU A O   1 
ATOM   670  C CB  . GLU A 1 86  ? -15.324 74.206 61.773 1.00 35.35  ? 89   GLU A CB  1 
ATOM   671  C CG  . GLU A 1 86  ? -15.879 75.454 62.443 1.00 41.79  ? 89   GLU A CG  1 
ATOM   672  N N   . MET A 1 87  ? -13.392 71.534 62.282 1.00 30.71  ? 90   MET A N   1 
ATOM   673  C CA  . MET A 1 87  ? -13.059 70.215 61.763 1.00 30.41  ? 90   MET A CA  1 
ATOM   674  C C   . MET A 1 87  ? -14.337 69.630 61.193 1.00 30.65  ? 90   MET A C   1 
ATOM   675  O O   . MET A 1 87  ? -15.431 69.935 61.670 1.00 31.48  ? 90   MET A O   1 
ATOM   676  C CB  . MET A 1 87  ? -12.504 69.299 62.855 1.00 30.33  ? 90   MET A CB  1 
ATOM   677  C CG  . MET A 1 87  ? -11.094 69.640 63.304 1.00 27.71  ? 90   MET A CG  1 
ATOM   678  S SD  . MET A 1 87  ? -10.452 68.407 64.445 1.00 32.52  ? 90   MET A SD  1 
ATOM   679  C CE  . MET A 1 87  ? -11.627 68.552 65.824 1.00 27.57  ? 90   MET A CE  1 
ATOM   680  N N   . SER A 1 88  ? -14.197 68.803 60.163 1.00 30.43  ? 91   SER A N   1 
ATOM   681  C CA  . SER A 1 88  ? -15.341 68.187 59.515 1.00 29.54  ? 91   SER A CA  1 
ATOM   682  C C   . SER A 1 88  ? -14.893 67.037 58.647 1.00 29.07  ? 91   SER A C   1 
ATOM   683  O O   . SER A 1 88  ? -13.790 67.057 58.108 1.00 29.29  ? 91   SER A O   1 
ATOM   684  C CB  . SER A 1 88  ? -16.060 69.213 58.637 1.00 29.47  ? 91   SER A CB  1 
ATOM   685  O OG  . SER A 1 88  ? -17.211 68.642 58.038 1.00 33.11  ? 91   SER A OG  1 
ATOM   686  N N   . GLU A 1 89  ? -15.748 66.025 58.525 1.00 29.27  ? 92   GLU A N   1 
ATOM   687  C CA  . GLU A 1 89  ? -15.446 64.886 57.673 1.00 30.84  ? 92   GLU A CA  1 
ATOM   688  C C   . GLU A 1 89  ? -15.514 65.377 56.224 1.00 32.07  ? 92   GLU A C   1 
ATOM   689  O O   . GLU A 1 89  ? -14.969 64.748 55.315 1.00 33.47  ? 92   GLU A O   1 
ATOM   690  C CB  . GLU A 1 89  ? -16.430 63.744 57.904 1.00 30.88  ? 92   GLU A CB  1 
ATOM   691  C CG  . GLU A 1 89  ? -16.242 63.032 59.225 1.00 30.42  ? 92   GLU A CG  1 
ATOM   692  C CD  . GLU A 1 89  ? -16.878 61.659 59.227 1.00 33.69  ? 92   GLU A CD  1 
ATOM   693  O OE1 . GLU A 1 89  ? -18.006 61.516 59.736 1.00 35.85  ? 92   GLU A OE1 1 
ATOM   694  O OE2 . GLU A 1 89  ? -16.253 60.714 58.706 1.00 37.26  ? 92   GLU A OE2 1 
ATOM   695  N N   . ASP A 1 90  ? -16.217 66.490 56.016 1.00 29.34  ? 93   ASP A N   1 
ATOM   696  C CA  . ASP A 1 90  ? -16.310 67.109 54.700 1.00 30.21  ? 93   ASP A CA  1 
ATOM   697  C C   . ASP A 1 90  ? -15.104 68.040 54.706 1.00 30.20  ? 93   ASP A C   1 
ATOM   698  O O   . ASP A 1 90  ? -15.205 69.210 55.079 1.00 30.82  ? 93   ASP A O   1 
ATOM   699  C CB  . ASP A 1 90  ? -17.615 67.902 54.572 1.00 32.20  ? 93   ASP A CB  1 
ATOM   700  C CG  . ASP A 1 90  ? -17.783 68.561 53.201 1.00 34.87  ? 93   ASP A CG  1 
ATOM   701  O OD1 . ASP A 1 90  ? -16.890 68.422 52.334 1.00 36.45  ? 93   ASP A OD1 1 
ATOM   702  O OD2 . ASP A 1 90  ? -18.819 69.226 52.987 1.00 37.60  ? 93   ASP A OD2 1 
ATOM   703  N N   . CYS A 1 91  ? -13.963 67.519 54.269 1.00 29.56  ? 94   CYS A N   1 
ATOM   704  C CA  . CYS A 1 91  ? -12.734 68.294 54.302 1.00 29.23  ? 94   CYS A CA  1 
ATOM   705  C C   . CYS A 1 91  ? -11.808 68.076 53.119 1.00 29.23  ? 94   CYS A C   1 
ATOM   706  O O   . CYS A 1 91  ? -10.652 68.486 53.154 1.00 28.83  ? 94   CYS A O   1 
ATOM   707  C CB  . CYS A 1 91  ? -11.984 67.926 55.572 1.00 25.32  ? 94   CYS A CB  1 
ATOM   708  S SG  . CYS A 1 91  ? -11.516 66.171 55.573 1.00 27.42  ? 94   CYS A SG  1 
ATOM   709  N N   . LEU A 1 92  ? -12.298 67.428 52.074 1.00 28.96  ? 95   LEU A N   1 
ATOM   710  C CA  . LEU A 1 92  ? -11.456 67.180 50.915 1.00 25.51  ? 95   LEU A CA  1 
ATOM   711  C C   . LEU A 1 92  ? -11.488 68.347 49.942 1.00 24.94  ? 95   LEU A C   1 
ATOM   712  O O   . LEU A 1 92  ? -12.213 68.346 48.947 1.00 23.89  ? 95   LEU A O   1 
ATOM   713  C CB  . LEU A 1 92  ? -11.844 65.861 50.261 1.00 22.11  ? 95   LEU A CB  1 
ATOM   714  C CG  . LEU A 1 92  ? -11.641 64.723 51.253 1.00 17.77  ? 95   LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 92  ? -12.006 63.413 50.611 1.00 21.12  ? 95   LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 92  ? -10.191 64.718 51.725 1.00 17.02  ? 95   LEU A CD2 1 
ATOM   717  N N   . TYR A 1 93  ? -10.678 69.348 50.258 1.00 25.28  ? 96   TYR A N   1 
ATOM   718  C CA  . TYR A 1 93  ? -10.586 70.559 49.461 1.00 26.54  ? 96   TYR A CA  1 
ATOM   719  C C   . TYR A 1 93  ? -9.134  70.919 49.223 1.00 25.86  ? 96   TYR A C   1 
ATOM   720  O O   . TYR A 1 93  ? -8.246  70.406 49.895 1.00 26.27  ? 96   TYR A O   1 
ATOM   721  C CB  . TYR A 1 93  ? -11.278 71.709 50.199 1.00 28.25  ? 96   TYR A CB  1 
ATOM   722  C CG  . TYR A 1 93  ? -12.740 71.458 50.445 1.00 28.55  ? 96   TYR A CG  1 
ATOM   723  C CD1 . TYR A 1 93  ? -13.169 70.740 51.560 1.00 28.24  ? 96   TYR A CD1 1 
ATOM   724  C CD2 . TYR A 1 93  ? -13.695 71.893 49.534 1.00 29.52  ? 96   TYR A CD2 1 
ATOM   725  C CE1 . TYR A 1 93  ? -14.514 70.458 51.754 1.00 30.13  ? 96   TYR A CE1 1 
ATOM   726  C CE2 . TYR A 1 93  ? -15.039 71.617 49.719 1.00 30.95  ? 96   TYR A CE2 1 
ATOM   727  C CZ  . TYR A 1 93  ? -15.443 70.901 50.824 1.00 29.95  ? 96   TYR A CZ  1 
ATOM   728  O OH  . TYR A 1 93  ? -16.775 70.621 50.981 1.00 29.52  ? 96   TYR A OH  1 
ATOM   729  N N   . LEU A 1 94  ? -8.899  71.803 48.262 1.00 26.01  ? 97   LEU A N   1 
ATOM   730  C CA  . LEU A 1 94  ? -7.549  72.244 47.955 1.00 26.21  ? 97   LEU A CA  1 
ATOM   731  C C   . LEU A 1 94  ? -7.526  73.761 47.793 1.00 26.75  ? 97   LEU A C   1 
ATOM   732  O O   . LEU A 1 94  ? -8.555  74.382 47.512 1.00 25.78  ? 97   LEU A O   1 
ATOM   733  C CB  . LEU A 1 94  ? -7.004  71.523 46.713 1.00 29.10  ? 97   LEU A CB  1 
ATOM   734  C CG  . LEU A 1 94  ? -7.711  71.554 45.349 1.00 27.87  ? 97   LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 94  ? -7.433  72.859 44.620 1.00 27.93  ? 97   LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 94  ? -7.182  70.399 44.508 1.00 28.60  ? 97   LEU A CD2 1 
ATOM   737  N N   . ASN A 1 95  ? -6.352  74.348 48.014 1.00 28.14  ? 98   ASN A N   1 
ATOM   738  C CA  . ASN A 1 95  ? -6.160  75.793 47.918 1.00 27.59  ? 98   ASN A CA  1 
ATOM   739  C C   . ASN A 1 95  ? -5.097  76.069 46.871 1.00 27.00  ? 98   ASN A C   1 
ATOM   740  O O   . ASN A 1 95  ? -4.113  75.338 46.777 1.00 26.90  ? 98   ASN A O   1 
ATOM   741  C CB  . ASN A 1 95  ? -5.704  76.355 49.269 1.00 25.28  ? 98   ASN A CB  1 
ATOM   742  C CG  . ASN A 1 95  ? -6.497  75.787 50.429 1.00 25.97  ? 98   ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 95  ? -7.690  76.051 50.573 1.00 29.89  ? 98   ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 95  ? -5.841  74.981 51.249 1.00 23.51  ? 98   ASN A ND2 1 
ATOM   745  N N   . ILE A 1 96  ? -5.289  77.136 46.102 1.00 26.84  ? 99   ILE A N   1 
ATOM   746  C CA  . ILE A 1 96  ? -4.348  77.491 45.051 1.00 26.38  ? 99   ILE A CA  1 
ATOM   747  C C   . ILE A 1 96  ? -3.986  78.959 45.108 1.00 27.71  ? 99   ILE A C   1 
ATOM   748  O O   . ILE A 1 96  ? -4.857  79.817 45.208 1.00 28.78  ? 99   ILE A O   1 
ATOM   749  C CB  . ILE A 1 96  ? -4.936  77.219 43.642 1.00 25.32  ? 99   ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 96  ? -5.549  75.814 43.576 1.00 25.98  ? 99   ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 96  ? -3.849  77.373 42.588 1.00 20.11  ? 99   ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 96  ? -6.238  75.500 42.262 1.00 29.01  ? 99   ILE A CD1 1 
ATOM   753  N N   . TRP A 1 97  ? -2.691  79.238 45.080 1.00 27.57  ? 100  TRP A N   1 
ATOM   754  C CA  . TRP A 1 97  ? -2.201  80.606 45.068 1.00 31.29  ? 100  TRP A CA  1 
ATOM   755  C C   . TRP A 1 97  ? -1.654  80.826 43.660 1.00 32.75  ? 100  TRP A C   1 
ATOM   756  O O   . TRP A 1 97  ? -0.753  80.112 43.212 1.00 33.54  ? 100  TRP A O   1 
ATOM   757  C CB  . TRP A 1 97  ? -1.121  80.820 46.133 1.00 29.85  ? 100  TRP A CB  1 
ATOM   758  C CG  . TRP A 1 97  ? -1.697  80.946 47.506 1.00 31.91  ? 100  TRP A CG  1 
ATOM   759  C CD1 . TRP A 1 97  ? -2.107  82.097 48.126 1.00 30.12  ? 100  TRP A CD1 1 
ATOM   760  C CD2 . TRP A 1 97  ? -1.981  79.877 48.416 1.00 30.93  ? 100  TRP A CD2 1 
ATOM   761  N NE1 . TRP A 1 97  ? -2.637  81.807 49.360 1.00 30.51  ? 100  TRP A NE1 1 
ATOM   762  C CE2 . TRP A 1 97  ? -2.573  80.454 49.566 1.00 32.95  ? 100  TRP A CE2 1 
ATOM   763  C CE3 . TRP A 1 97  ? -1.799  78.487 48.370 1.00 30.21  ? 100  TRP A CE3 1 
ATOM   764  C CZ2 . TRP A 1 97  ? -2.984  79.686 50.662 1.00 31.80  ? 100  TRP A CZ2 1 
ATOM   765  C CZ3 . TRP A 1 97  ? -2.209  77.723 49.461 1.00 29.74  ? 100  TRP A CZ3 1 
ATOM   766  C CH2 . TRP A 1 97  ? -2.796  78.327 50.592 1.00 31.11  ? 100  TRP A CH2 1 
ATOM   767  N N   . VAL A 1 98  ? -2.254  81.773 42.945 1.00 33.46  ? 101  VAL A N   1 
ATOM   768  C CA  . VAL A 1 98  ? -1.861  82.067 41.572 1.00 33.51  ? 101  VAL A CA  1 
ATOM   769  C C   . VAL A 1 98  ? -1.292  83.470 41.403 1.00 34.35  ? 101  VAL A C   1 
ATOM   770  O O   . VAL A 1 98  ? -1.933  84.459 41.768 1.00 35.99  ? 101  VAL A O   1 
ATOM   771  C CB  . VAL A 1 98  ? -3.070  81.908 40.624 1.00 34.09  ? 101  VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 98  ? -2.681  82.251 39.199 1.00 34.36  ? 101  VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 98  ? -3.619  80.497 40.711 1.00 33.55  ? 101  VAL A CG2 1 
ATOM   774  N N   . PRO A 1 99  ? -0.079  83.575 40.834 1.00 34.08  ? 102  PRO A N   1 
ATOM   775  C CA  . PRO A 1 99  ? 0.563   84.874 40.615 1.00 34.84  ? 102  PRO A CA  1 
ATOM   776  C C   . PRO A 1 99  ? -0.340  85.798 39.803 1.00 37.14  ? 102  PRO A C   1 
ATOM   777  O O   . PRO A 1 99  ? -1.178  85.335 39.030 1.00 35.83  ? 102  PRO A O   1 
ATOM   778  C CB  . PRO A 1 99  ? 1.816   84.500 39.826 1.00 32.61  ? 102  PRO A CB  1 
ATOM   779  C CG  . PRO A 1 99  ? 2.165   83.169 40.379 1.00 31.94  ? 102  PRO A CG  1 
ATOM   780  C CD  . PRO A 1 99  ? 0.819   82.479 40.429 1.00 33.11  ? 102  PRO A CD  1 
ATOM   781  N N   . SER A 1 100 ? -0.198  87.100 40.028 1.00 40.16  ? 103  SER A N   1 
ATOM   782  C CA  . SER A 1 100 ? -0.987  88.101 39.317 1.00 41.75  ? 103  SER A CA  1 
ATOM   783  C C   . SER A 1 100 ? -0.022  89.006 38.558 1.00 41.98  ? 103  SER A C   1 
ATOM   784  O O   . SER A 1 100 ? 0.847   89.631 39.164 1.00 41.57  ? 103  SER A O   1 
ATOM   785  C CB  . SER A 1 100 ? -1.815  88.925 40.304 1.00 42.90  ? 103  SER A CB  1 
ATOM   786  O OG  . SER A 1 100 ? -2.641  89.856 39.626 1.00 45.14  ? 103  SER A OG  1 
ATOM   787  N N   . PRO A 1 101 ? -0.186  89.126 37.224 1.00 42.48  ? 104  PRO A N   1 
ATOM   788  C CA  . PRO A 1 101 ? -1.186  88.508 36.340 1.00 40.75  ? 104  PRO A CA  1 
ATOM   789  C C   . PRO A 1 101 ? -1.118  86.987 36.291 1.00 40.02  ? 104  PRO A C   1 
ATOM   790  O O   . PRO A 1 101 ? -0.048  86.398 36.439 1.00 36.98  ? 104  PRO A O   1 
ATOM   791  C CB  . PRO A 1 101 ? -0.838  89.087 34.967 1.00 41.52  ? 104  PRO A CB  1 
ATOM   792  C CG  . PRO A 1 101 ? -0.093  90.342 35.281 1.00 43.68  ? 104  PRO A CG  1 
ATOM   793  C CD  . PRO A 1 101 ? 0.759   89.928 36.431 1.00 43.13  ? 104  PRO A CD  1 
ATOM   794  N N   . ARG A 1 102 ? -2.264  86.358 36.050 1.00 40.09  ? 105  ARG A N   1 
ATOM   795  C CA  . ARG A 1 102 ? -2.325  84.906 35.971 1.00 39.72  ? 105  ARG A CA  1 
ATOM   796  C C   . ARG A 1 102 ? -1.315  84.416 34.948 1.00 40.02  ? 105  ARG A C   1 
ATOM   797  O O   . ARG A 1 102 ? -1.325  84.869 33.808 1.00 44.00  ? 105  ARG A O   1 
ATOM   798  C CB  . ARG A 1 102 ? -3.721  84.455 35.550 1.00 37.18  ? 105  ARG A CB  1 
ATOM   799  C CG  . ARG A 1 102 ? -3.862  82.947 35.450 1.00 36.08  ? 105  ARG A CG  1 
ATOM   800  C CD  . ARG A 1 102 ? -5.201  82.567 34.884 1.00 32.82  ? 105  ARG A CD  1 
ATOM   801  N NE  . ARG A 1 102 ? -6.287  83.197 35.623 1.00 33.18  ? 105  ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 102 ? -7.550  83.207 35.214 1.00 34.29  ? 105  ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 102 ? -7.879  82.617 34.074 1.00 32.46  ? 105  ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 102 ? -8.478  83.833 35.926 1.00 30.95  ? 105  ARG A NH2 1 
ATOM   805  N N   . PRO A 1 103 ? -0.390  83.530 35.357 1.00 40.02  ? 106  PRO A N   1 
ATOM   806  C CA  . PRO A 1 103 ? 0.610   83.014 34.417 1.00 40.16  ? 106  PRO A CA  1 
ATOM   807  C C   . PRO A 1 103 ? -0.046  82.180 33.314 1.00 41.23  ? 106  PRO A C   1 
ATOM   808  O O   . PRO A 1 103 ? -1.248  81.912 33.362 1.00 41.34  ? 106  PRO A O   1 
ATOM   809  C CB  . PRO A 1 103 ? 1.524   82.178 35.318 1.00 38.67  ? 106  PRO A CB  1 
ATOM   810  C CG  . PRO A 1 103 ? 0.628   81.759 36.429 1.00 40.40  ? 106  PRO A CG  1 
ATOM   811  C CD  . PRO A 1 103 ? -0.152  83.007 36.712 1.00 39.33  ? 106  PRO A CD  1 
ATOM   812  N N   . LYS A 1 104 ? 0.725   81.815 32.295 1.00 43.31  ? 107  LYS A N   1 
ATOM   813  C CA  . LYS A 1 104 ? 0.176   81.023 31.200 1.00 44.71  ? 107  LYS A CA  1 
ATOM   814  C C   . LYS A 1 104 ? 0.448   79.527 31.361 1.00 44.34  ? 107  LYS A C   1 
ATOM   815  O O   . LYS A 1 104 ? -0.436  78.700 31.152 1.00 43.00  ? 107  LYS A O   1 
ATOM   816  C CB  . LYS A 1 104 ? 0.704   81.521 29.849 1.00 46.97  ? 107  LYS A CB  1 
ATOM   817  C CG  . LYS A 1 104 ? 0.393   82.983 29.555 1.00 46.90  ? 107  LYS A CG  1 
ATOM   818  C CD  . LYS A 1 104 ? -1.089  83.287 29.725 1.00 49.01  ? 107  LYS A CD  1 
ATOM   819  C CE  . LYS A 1 104 ? -1.368  84.778 29.543 1.00 51.32  ? 107  LYS A CE  1 
ATOM   820  N NZ  . LYS A 1 104 ? -2.750  85.157 29.959 1.00 50.51  ? 107  LYS A NZ  1 
ATOM   821  N N   . SER A 1 105 ? 1.668   79.186 31.754 1.00 44.38  ? 108  SER A N   1 
ATOM   822  C CA  . SER A 1 105 ? 2.036   77.790 31.940 1.00 45.54  ? 108  SER A CA  1 
ATOM   823  C C   . SER A 1 105 ? 3.315   77.748 32.758 1.00 44.62  ? 108  SER A C   1 
ATOM   824  O O   . SER A 1 105 ? 4.398   77.461 32.238 1.00 45.34  ? 108  SER A O   1 
ATOM   825  C CB  . SER A 1 105 ? 2.248   77.118 30.585 1.00 46.10  ? 108  SER A CB  1 
ATOM   826  O OG  . SER A 1 105 ? 2.079   75.718 30.685 1.00 51.55  ? 108  SER A OG  1 
ATOM   827  N N   . THR A 1 106 ? 3.176   78.051 34.044 1.00 42.60  ? 109  THR A N   1 
ATOM   828  C CA  . THR A 1 106 ? 4.313   78.075 34.945 1.00 41.78  ? 109  THR A CA  1 
ATOM   829  C C   . THR A 1 106 ? 4.348   76.878 35.889 1.00 39.19  ? 109  THR A C   1 
ATOM   830  O O   . THR A 1 106 ? 3.342   76.197 36.090 1.00 37.90  ? 109  THR A O   1 
ATOM   831  C CB  . THR A 1 106 ? 4.336   79.377 35.764 1.00 40.31  ? 109  THR A CB  1 
ATOM   832  O OG1 . THR A 1 106 ? 5.594   79.491 36.443 1.00 44.02  ? 109  THR A OG1 1 
ATOM   833  C CG2 . THR A 1 106 ? 3.205   79.388 36.781 1.00 40.20  ? 109  THR A CG2 1 
ATOM   834  N N   . THR A 1 107 ? 5.519   76.651 36.478 1.00 38.05  ? 110  THR A N   1 
ATOM   835  C CA  . THR A 1 107 ? 5.742   75.553 37.415 1.00 36.30  ? 110  THR A CA  1 
ATOM   836  C C   . THR A 1 107 ? 4.698   75.493 38.538 1.00 34.49  ? 110  THR A C   1 
ATOM   837  O O   . THR A 1 107 ? 4.295   76.515 39.098 1.00 31.51  ? 110  THR A O   1 
ATOM   838  C CB  . THR A 1 107 ? 7.137   75.660 38.050 1.00 35.71  ? 110  THR A CB  1 
ATOM   839  O OG1 . THR A 1 107 ? 8.119   75.837 37.023 1.00 38.49  ? 110  THR A OG1 1 
ATOM   840  C CG2 . THR A 1 107 ? 7.457   74.408 38.848 1.00 36.78  ? 110  THR A CG2 1 
ATOM   841  N N   . VAL A 1 108 ? 4.257   74.277 38.839 1.00 32.94  ? 111  VAL A N   1 
ATOM   842  C CA  . VAL A 1 108 ? 3.275   74.037 39.884 1.00 31.07  ? 111  VAL A CA  1 
ATOM   843  C C   . VAL A 1 108 ? 3.913   73.235 41.015 1.00 31.40  ? 111  VAL A C   1 
ATOM   844  O O   . VAL A 1 108 ? 4.682   72.302 40.770 1.00 31.25  ? 111  VAL A O   1 
ATOM   845  C CB  . VAL A 1 108 ? 2.061   73.240 39.339 1.00 30.87  ? 111  VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 108 ? 1.067   72.924 40.462 1.00 27.53  ? 111  VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 108 ? 1.376   74.028 38.243 1.00 29.46  ? 111  VAL A CG2 1 
ATOM   848  N N   . MET A 1 109 ? 3.611   73.629 42.251 1.00 28.41  ? 112  MET A N   1 
ATOM   849  C CA  . MET A 1 109 ? 4.114   72.936 43.430 1.00 25.53  ? 112  MET A CA  1 
ATOM   850  C C   . MET A 1 109 ? 2.910   72.552 44.274 1.00 25.36  ? 112  MET A C   1 
ATOM   851  O O   . MET A 1 109 ? 2.048   73.386 44.529 1.00 26.73  ? 112  MET A O   1 
ATOM   852  C CB  . MET A 1 109 ? 5.062   73.832 44.224 1.00 24.28  ? 112  MET A CB  1 
ATOM   853  C CG  . MET A 1 109 ? 6.372   74.105 43.516 1.00 25.76  ? 112  MET A CG  1 
ATOM   854  S SD  . MET A 1 109 ? 7.522   75.099 44.483 1.00 29.03  ? 112  MET A SD  1 
ATOM   855  C CE  . MET A 1 109 ? 8.159   73.870 45.645 1.00 25.50  ? 112  MET A CE  1 
ATOM   856  N N   . VAL A 1 110 ? 2.807   71.273 44.627 1.00 24.23  ? 113  VAL A N   1 
ATOM   857  C CA  . VAL A 1 110 ? 1.696   70.786 45.442 1.00 24.34  ? 113  VAL A CA  1 
ATOM   858  C C   . VAL A 1 110 ? 2.192   70.341 46.822 1.00 24.98  ? 113  VAL A C   1 
ATOM   859  O O   . VAL A 1 110 ? 2.953   69.388 46.950 1.00 23.84  ? 113  VAL A O   1 
ATOM   860  C CB  . VAL A 1 110 ? 0.943   69.625 44.750 1.00 22.18  ? 113  VAL A CB  1 
ATOM   861  C CG1 . VAL A 1 110 ? -0.298  69.248 45.546 1.00 18.34  ? 113  VAL A CG1 1 
ATOM   862  C CG2 . VAL A 1 110 ? 0.548   70.030 43.353 1.00 17.67  ? 113  VAL A CG2 1 
ATOM   863  N N   . TRP A 1 111 ? 1.761   71.062 47.848 1.00 24.53  ? 114  TRP A N   1 
ATOM   864  C CA  . TRP A 1 111 ? 2.145   70.786 49.223 1.00 23.61  ? 114  TRP A CA  1 
ATOM   865  C C   . TRP A 1 111 ? 1.265   69.732 49.892 1.00 23.35  ? 114  TRP A C   1 
ATOM   866  O O   . TRP A 1 111 ? 0.041   69.811 49.843 1.00 23.09  ? 114  TRP A O   1 
ATOM   867  C CB  . TRP A 1 111 ? 2.106   72.094 50.030 1.00 24.11  ? 114  TRP A CB  1 
ATOM   868  C CG  . TRP A 1 111 ? 2.367   71.939 51.510 1.00 24.00  ? 114  TRP A CG  1 
ATOM   869  C CD1 . TRP A 1 111 ? 1.459   72.089 52.528 1.00 24.80  ? 114  TRP A CD1 1 
ATOM   870  C CD2 . TRP A 1 111 ? 3.618   71.614 52.135 1.00 22.96  ? 114  TRP A CD2 1 
ATOM   871  N NE1 . TRP A 1 111 ? 2.071   71.875 53.744 1.00 23.07  ? 114  TRP A NE1 1 
ATOM   872  C CE2 . TRP A 1 111 ? 3.392   71.584 53.533 1.00 20.88  ? 114  TRP A CE2 1 
ATOM   873  C CE3 . TRP A 1 111 ? 4.907   71.353 51.652 1.00 18.49  ? 114  TRP A CE3 1 
ATOM   874  C CZ2 . TRP A 1 111 ? 4.406   71.301 54.446 1.00 21.02  ? 114  TRP A CZ2 1 
ATOM   875  C CZ3 . TRP A 1 111 ? 5.916   71.075 52.562 1.00 20.83  ? 114  TRP A CZ3 1 
ATOM   876  C CH2 . TRP A 1 111 ? 5.660   71.051 53.944 1.00 22.06  ? 114  TRP A CH2 1 
ATOM   877  N N   . ILE A 1 112 ? 1.908   68.752 50.522 1.00 24.88  ? 115  ILE A N   1 
ATOM   878  C CA  . ILE A 1 112 ? 1.216   67.684 51.245 1.00 24.51  ? 115  ILE A CA  1 
ATOM   879  C C   . ILE A 1 112 ? 1.662   67.795 52.712 1.00 24.19  ? 115  ILE A C   1 
ATOM   880  O O   . ILE A 1 112 ? 2.816   67.502 53.040 1.00 22.47  ? 115  ILE A O   1 
ATOM   881  C CB  . ILE A 1 112 ? 1.591   66.275 50.698 1.00 22.41  ? 115  ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 112 ? 1.342   66.213 49.180 1.00 22.70  ? 115  ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 112 ? 0.780   65.201 51.423 1.00 18.73  ? 115  ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 112 ? 1.701   64.871 48.530 1.00 20.02  ? 115  ILE A CD1 1 
ATOM   885  N N   . TYR A 1 113 ? 0.751   68.232 53.581 1.00 23.96  ? 116  TYR A N   1 
ATOM   886  C CA  . TYR A 1 113 ? 1.055   68.413 55.005 1.00 24.15  ? 116  TYR A CA  1 
ATOM   887  C C   . TYR A 1 113 ? 1.402   67.141 55.771 1.00 24.34  ? 116  TYR A C   1 
ATOM   888  O O   . TYR A 1 113 ? 0.969   66.049 55.407 1.00 25.19  ? 116  TYR A O   1 
ATOM   889  C CB  . TYR A 1 113 ? -0.081  69.170 55.728 1.00 22.50  ? 116  TYR A CB  1 
ATOM   890  C CG  . TYR A 1 113 ? -1.452  68.505 55.726 1.00 21.82  ? 116  TYR A CG  1 
ATOM   891  C CD1 . TYR A 1 113 ? -1.707  67.355 56.475 1.00 20.49  ? 116  TYR A CD1 1 
ATOM   892  C CD2 . TYR A 1 113 ? -2.502  69.043 54.984 1.00 23.28  ? 116  TYR A CD2 1 
ATOM   893  C CE1 . TYR A 1 113 ? -2.973  66.763 56.477 1.00 17.30  ? 116  TYR A CE1 1 
ATOM   894  C CE2 . TYR A 1 113 ? -3.767  68.458 54.984 1.00 20.62  ? 116  TYR A CE2 1 
ATOM   895  C CZ  . TYR A 1 113 ? -3.992  67.324 55.725 1.00 19.88  ? 116  TYR A CZ  1 
ATOM   896  O OH  . TYR A 1 113 ? -5.237  66.747 55.680 1.00 22.48  ? 116  TYR A OH  1 
ATOM   897  N N   . GLY A 1 114 ? 2.184   67.303 56.837 1.00 26.45  ? 117  GLY A N   1 
ATOM   898  C CA  . GLY A 1 114 ? 2.567   66.174 57.671 1.00 22.06  ? 117  GLY A CA  1 
ATOM   899  C C   . GLY A 1 114 ? 1.647   66.068 58.874 1.00 21.80  ? 117  GLY A C   1 
ATOM   900  O O   . GLY A 1 114 ? 0.569   66.674 58.890 1.00 21.79  ? 117  GLY A O   1 
ATOM   901  N N   . GLY A 1 115 ? 2.070   65.319 59.888 1.00 21.32  ? 118  GLY A N   1 
ATOM   902  C CA  . GLY A 1 115 ? 1.255   65.160 61.080 1.00 17.11  ? 118  GLY A CA  1 
ATOM   903  C C   . GLY A 1 115 ? 1.051   63.703 61.461 1.00 19.80  ? 118  GLY A C   1 
ATOM   904  O O   . GLY A 1 115 ? 0.005   63.337 61.990 1.00 22.03  ? 118  GLY A O   1 
ATOM   905  N N   . GLY A 1 116 ? 2.026   62.867 61.117 1.00 19.14  ? 119  GLY A N   1 
ATOM   906  C CA  . GLY A 1 116 ? 1.977   61.450 61.431 1.00 20.65  ? 119  GLY A CA  1 
ATOM   907  C C   . GLY A 1 116 ? 0.791   60.678 60.894 1.00 21.21  ? 119  GLY A C   1 
ATOM   908  O O   . GLY A 1 116 ? 0.498   59.591 61.383 1.00 24.60  ? 119  GLY A O   1 
ATOM   909  N N   . PHE A 1 117 ? 0.133   61.210 59.869 1.00 21.68  ? 120  PHE A N   1 
ATOM   910  C CA  . PHE A 1 117 ? -1.053  60.577 59.274 1.00 22.21  ? 120  PHE A CA  1 
ATOM   911  C C   . PHE A 1 117 ? -2.246  60.594 60.228 1.00 22.73  ? 120  PHE A C   1 
ATOM   912  O O   . PHE A 1 117 ? -3.303  60.057 59.903 1.00 24.50  ? 120  PHE A O   1 
ATOM   913  C CB  . PHE A 1 117 ? -0.772  59.128 58.819 1.00 20.66  ? 120  PHE A CB  1 
ATOM   914  C CG  . PHE A 1 117 ? 0.212   59.019 57.687 1.00 18.83  ? 120  PHE A CG  1 
ATOM   915  C CD1 . PHE A 1 117 ? -0.118  59.478 56.415 1.00 17.54  ? 120  PHE A CD1 1 
ATOM   916  C CD2 . PHE A 1 117 ? 1.476   58.468 57.899 1.00 20.56  ? 120  PHE A CD2 1 
ATOM   917  C CE1 . PHE A 1 117 ? 0.800   59.387 55.365 1.00 20.18  ? 120  PHE A CE1 1 
ATOM   918  C CE2 . PHE A 1 117 ? 2.407   58.368 56.860 1.00 19.60  ? 120  PHE A CE2 1 
ATOM   919  C CZ  . PHE A 1 117 ? 2.067   58.832 55.587 1.00 22.52  ? 120  PHE A CZ  1 
ATOM   920  N N   . TYR A 1 118 ? -2.081  61.207 61.401 1.00 22.86  ? 121  TYR A N   1 
ATOM   921  C CA  . TYR A 1 118 ? -3.165  61.286 62.388 1.00 23.43  ? 121  TYR A CA  1 
ATOM   922  C C   . TYR A 1 118 ? -3.662  62.718 62.576 1.00 24.35  ? 121  TYR A C   1 
ATOM   923  O O   . TYR A 1 118 ? -4.648  62.959 63.283 1.00 23.95  ? 121  TYR A O   1 
ATOM   924  C CB  . TYR A 1 118 ? -2.730  60.704 63.747 1.00 22.66  ? 121  TYR A CB  1 
ATOM   925  C CG  . TYR A 1 118 ? -1.713  61.538 64.509 1.00 22.38  ? 121  TYR A CG  1 
ATOM   926  C CD1 . TYR A 1 118 ? -2.113  62.622 65.291 1.00 23.99  ? 121  TYR A CD1 1 
ATOM   927  C CD2 . TYR A 1 118 ? -0.351  61.241 64.445 1.00 22.51  ? 121  TYR A CD2 1 
ATOM   928  C CE1 . TYR A 1 118 ? -1.183  63.390 65.989 1.00 24.80  ? 121  TYR A CE1 1 
ATOM   929  C CE2 . TYR A 1 118 ? 0.588   61.997 65.134 1.00 21.13  ? 121  TYR A CE2 1 
ATOM   930  C CZ  . TYR A 1 118 ? 0.169   63.070 65.904 1.00 26.21  ? 121  TYR A CZ  1 
ATOM   931  O OH  . TYR A 1 118 ? 1.104   63.824 66.586 1.00 28.22  ? 121  TYR A OH  1 
ATOM   932  N N   . SER A 1 119 ? -2.963  63.663 61.959 1.00 22.17  ? 122  SER A N   1 
ATOM   933  C CA  . SER A 1 119 ? -3.326  65.070 62.054 1.00 22.42  ? 122  SER A CA  1 
ATOM   934  C C   . SER A 1 119 ? -2.772  65.818 60.862 1.00 21.78  ? 122  SER A C   1 
ATOM   935  O O   . SER A 1 119 ? -2.068  65.241 60.036 1.00 23.75  ? 122  SER A O   1 
ATOM   936  C CB  . SER A 1 119 ? -2.745  65.674 63.326 1.00 23.77  ? 122  SER A CB  1 
ATOM   937  O OG  . SER A 1 119 ? -1.332  65.608 63.294 1.00 25.72  ? 122  SER A OG  1 
ATOM   938  N N   . GLY A 1 120 ? -3.073  67.110 60.793 1.00 22.44  ? 123  GLY A N   1 
ATOM   939  C CA  . GLY A 1 120 ? -2.587  67.930 59.698 1.00 24.85  ? 123  GLY A CA  1 
ATOM   940  C C   . GLY A 1 120 ? -3.663  68.804 59.080 1.00 26.47  ? 123  GLY A C   1 
ATOM   941  O O   . GLY A 1 120 ? -4.827  68.404 58.987 1.00 25.03  ? 123  GLY A O   1 
ATOM   942  N N   . SER A 1 121 ? -3.267  70.001 58.658 1.00 25.32  ? 124  SER A N   1 
ATOM   943  C CA  . SER A 1 121 ? -4.184  70.948 58.036 1.00 24.67  ? 124  SER A CA  1 
ATOM   944  C C   . SER A 1 121 ? -3.458  71.667 56.926 1.00 24.06  ? 124  SER A C   1 
ATOM   945  O O   . SER A 1 121 ? -2.265  71.904 57.019 1.00 25.52  ? 124  SER A O   1 
ATOM   946  C CB  . SER A 1 121 ? -4.672  71.979 59.055 1.00 23.60  ? 124  SER A CB  1 
ATOM   947  O OG  . SER A 1 121 ? -5.528  71.381 60.011 1.00 26.35  ? 124  SER A OG  1 
ATOM   948  N N   . SER A 1 122 ? -4.176  71.994 55.862 1.00 26.29  ? 125  SER A N   1 
ATOM   949  C CA  . SER A 1 122 ? -3.580  72.706 54.734 1.00 28.32  ? 125  SER A CA  1 
ATOM   950  C C   . SER A 1 122 ? -3.730  74.210 54.951 1.00 28.74  ? 125  SER A C   1 
ATOM   951  O O   . SER A 1 122 ? -3.092  75.022 54.274 1.00 27.24  ? 125  SER A O   1 
ATOM   952  C CB  . SER A 1 122 ? -4.292  72.322 53.437 1.00 28.62  ? 125  SER A CB  1 
ATOM   953  O OG  . SER A 1 122 ? -5.615  72.830 53.420 1.00 25.53  ? 125  SER A OG  1 
ATOM   954  N N   . THR A 1 123 ? -4.569  74.554 55.924 1.00 28.94  ? 126  THR A N   1 
ATOM   955  C CA  . THR A 1 123 ? -4.894  75.929 56.254 1.00 28.28  ? 126  THR A CA  1 
ATOM   956  C C   . THR A 1 123 ? -4.004  76.622 57.294 1.00 29.94  ? 126  THR A C   1 
ATOM   957  O O   . THR A 1 123 ? -4.223  77.792 57.601 1.00 30.91  ? 126  THR A O   1 
ATOM   958  C CB  . THR A 1 123 ? -6.359  76.006 56.696 1.00 28.24  ? 126  THR A CB  1 
ATOM   959  O OG1 . THR A 1 123 ? -6.536  75.195 57.862 1.00 29.73  ? 126  THR A OG1 1 
ATOM   960  C CG2 . THR A 1 123 ? -7.268  75.458 55.605 1.00 26.45  ? 126  THR A CG2 1 
ATOM   961  N N   . LEU A 1 124 ? -3.001  75.921 57.823 1.00 28.44  ? 127  LEU A N   1 
ATOM   962  C CA  . LEU A 1 124 ? -2.096  76.506 58.817 1.00 28.23  ? 127  LEU A CA  1 
ATOM   963  C C   . LEU A 1 124 ? -1.386  77.752 58.302 1.00 31.89  ? 127  LEU A C   1 
ATOM   964  O O   . LEU A 1 124 ? -1.109  77.875 57.108 1.00 35.25  ? 127  LEU A O   1 
ATOM   965  C CB  . LEU A 1 124 ? -1.041  75.494 59.265 1.00 24.81  ? 127  LEU A CB  1 
ATOM   966  C CG  . LEU A 1 124 ? -1.529  74.183 59.879 1.00 26.44  ? 127  LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 124 ? -0.335  73.372 60.375 1.00 21.85  ? 127  LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 124 ? -2.504  74.461 61.007 1.00 22.78  ? 127  LEU A CD2 1 
ATOM   969  N N   . ASP A 1 125 ? -1.060  78.663 59.214 1.00 34.08  ? 128  ASP A N   1 
ATOM   970  C CA  . ASP A 1 125 ? -0.378  79.899 58.846 1.00 34.06  ? 128  ASP A CA  1 
ATOM   971  C C   . ASP A 1 125 ? 0.975   79.644 58.192 1.00 32.46  ? 128  ASP A C   1 
ATOM   972  O O   . ASP A 1 125 ? 1.344   80.343 57.249 1.00 33.70  ? 128  ASP A O   1 
ATOM   973  C CB  . ASP A 1 125 ? -0.215  80.821 60.064 1.00 38.42  ? 128  ASP A CB  1 
ATOM   974  C CG  . ASP A 1 125 ? -1.537  81.452 60.521 1.00 42.48  ? 128  ASP A CG  1 
ATOM   975  O OD1 . ASP A 1 125 ? -2.601  81.174 59.929 1.00 43.09  ? 128  ASP A OD1 1 
ATOM   976  O OD2 . ASP A 1 125 ? -1.512  82.236 61.494 1.00 48.57  ? 128  ASP A OD2 1 
ATOM   977  N N   . VAL A 1 126 ? 1.710   78.645 58.682 1.00 32.17  ? 129  VAL A N   1 
ATOM   978  C CA  . VAL A 1 126 ? 3.019   78.320 58.112 1.00 28.82  ? 129  VAL A CA  1 
ATOM   979  C C   . VAL A 1 126 ? 2.922   77.686 56.737 1.00 30.10  ? 129  VAL A C   1 
ATOM   980  O O   . VAL A 1 126 ? 3.942   77.489 56.075 1.00 32.57  ? 129  VAL A O   1 
ATOM   981  C CB  . VAL A 1 126 ? 3.847   77.384 59.002 1.00 26.87  ? 129  VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 126 ? 4.605   78.183 60.018 1.00 29.02  ? 129  VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 126 ? 2.953   76.349 59.662 1.00 27.43  ? 129  VAL A CG2 1 
ATOM   984  N N   . TYR A 1 127 ? 1.707   77.325 56.328 1.00 29.69  ? 130  TYR A N   1 
ATOM   985  C CA  . TYR A 1 127 ? 1.495   76.722 55.015 1.00 29.98  ? 130  TYR A CA  1 
ATOM   986  C C   . TYR A 1 127 ? 0.930   77.724 54.009 1.00 31.35  ? 130  TYR A C   1 
ATOM   987  O O   . TYR A 1 127 ? 0.563   77.339 52.904 1.00 31.96  ? 130  TYR A O   1 
ATOM   988  C CB  . TYR A 1 127 ? 0.557   75.520 55.104 1.00 26.45  ? 130  TYR A CB  1 
ATOM   989  C CG  . TYR A 1 127 ? 1.065   74.367 55.940 1.00 26.98  ? 130  TYR A CG  1 
ATOM   990  C CD1 . TYR A 1 127 ? 2.412   74.263 56.305 1.00 25.61  ? 130  TYR A CD1 1 
ATOM   991  C CD2 . TYR A 1 127 ? 0.189   73.374 56.371 1.00 27.95  ? 130  TYR A CD2 1 
ATOM   992  C CE1 . TYR A 1 127 ? 2.863   73.197 57.080 1.00 23.92  ? 130  TYR A CE1 1 
ATOM   993  C CE2 . TYR A 1 127 ? 0.628   72.309 57.139 1.00 25.19  ? 130  TYR A CE2 1 
ATOM   994  C CZ  . TYR A 1 127 ? 1.957   72.223 57.490 1.00 26.52  ? 130  TYR A CZ  1 
ATOM   995  O OH  . TYR A 1 127 ? 2.359   71.143 58.238 1.00 27.19  ? 130  TYR A OH  1 
ATOM   996  N N   . ASN A 1 128 ? 0.862   78.999 54.389 1.00 32.31  ? 131  ASN A N   1 
ATOM   997  C CA  . ASN A 1 128 ? 0.344   80.035 53.498 1.00 32.75  ? 131  ASN A CA  1 
ATOM   998  C C   . ASN A 1 128 ? 1.211   80.117 52.243 1.00 31.63  ? 131  ASN A C   1 
ATOM   999  O O   . ASN A 1 128 ? 2.344   80.603 52.299 1.00 29.47  ? 131  ASN A O   1 
ATOM   1000 C CB  . ASN A 1 128 ? 0.329   81.389 54.208 1.00 34.52  ? 131  ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 128 ? -0.553  82.412 53.503 1.00 37.14  ? 131  ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 128 ? -0.977  82.220 52.359 1.00 35.35  ? 131  ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 128 ? -0.844  83.506 54.195 1.00 41.21  ? 131  ASN A ND2 1 
ATOM   1004 N N   . GLY A 1 129 ? 0.656   79.663 51.117 1.00 30.91  ? 132  GLY A N   1 
ATOM   1005 C CA  . GLY A 1 129 ? 1.380   79.652 49.851 1.00 32.72  ? 132  GLY A CA  1 
ATOM   1006 C C   . GLY A 1 129 ? 1.612   80.994 49.182 1.00 35.45  ? 132  GLY A C   1 
ATOM   1007 O O   . GLY A 1 129 ? 2.292   81.094 48.159 1.00 33.13  ? 132  GLY A O   1 
ATOM   1008 N N   . LYS A 1 130 ? 1.052   82.024 49.798 1.00 37.36  ? 133  LYS A N   1 
ATOM   1009 C CA  . LYS A 1 130 ? 1.134   83.403 49.347 1.00 36.80  ? 133  LYS A CA  1 
ATOM   1010 C C   . LYS A 1 130 ? 2.546   83.857 48.984 1.00 37.20  ? 133  LYS A C   1 
ATOM   1011 O O   . LYS A 1 130 ? 2.795   84.279 47.856 1.00 39.64  ? 133  LYS A O   1 
ATOM   1012 C CB  . LYS A 1 130 ? 0.603   84.289 50.471 1.00 39.46  ? 133  LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 130 ? -0.053  85.560 50.044 1.00 41.17  ? 133  LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 130 ? -0.707  86.229 51.235 1.00 40.32  ? 133  LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 130 ? 0.309   86.708 52.240 1.00 39.72  ? 133  LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 130 ? -0.364  87.483 53.315 1.00 41.37  ? 133  LYS A NZ  1 
ATOM   1017 N N   . TYR A 1 131 ? 3.465   83.736 49.941 1.00 36.62  ? 134  TYR A N   1 
ATOM   1018 C CA  . TYR A 1 131 ? 4.853   84.184 49.780 1.00 35.54  ? 134  TYR A CA  1 
ATOM   1019 C C   . TYR A 1 131 ? 5.693   83.451 48.746 1.00 34.42  ? 134  TYR A C   1 
ATOM   1020 O O   . TYR A 1 131 ? 6.495   84.066 48.046 1.00 32.86  ? 134  TYR A O   1 
ATOM   1021 C CB  . TYR A 1 131 ? 5.573   84.166 51.139 1.00 37.19  ? 134  TYR A CB  1 
ATOM   1022 C CG  . TYR A 1 131 ? 4.749   84.751 52.269 1.00 37.92  ? 134  TYR A CG  1 
ATOM   1023 C CD1 . TYR A 1 131 ? 4.090   83.923 53.180 1.00 39.46  ? 134  TYR A CD1 1 
ATOM   1024 C CD2 . TYR A 1 131 ? 4.582   86.128 52.395 1.00 37.99  ? 134  TYR A CD2 1 
ATOM   1025 C CE1 . TYR A 1 131 ? 3.281   84.453 54.181 1.00 37.41  ? 134  TYR A CE1 1 
ATOM   1026 C CE2 . TYR A 1 131 ? 3.777   86.666 53.390 1.00 37.44  ? 134  TYR A CE2 1 
ATOM   1027 C CZ  . TYR A 1 131 ? 3.131   85.825 54.276 1.00 38.93  ? 134  TYR A CZ  1 
ATOM   1028 O OH  . TYR A 1 131 ? 2.328   86.362 55.254 1.00 42.46  ? 134  TYR A OH  1 
ATOM   1029 N N   . LEU A 1 132 ? 5.525   82.136 48.671 1.00 34.12  ? 135  LEU A N   1 
ATOM   1030 C CA  . LEU A 1 132 ? 6.279   81.312 47.733 1.00 34.32  ? 135  LEU A CA  1 
ATOM   1031 C C   . LEU A 1 132 ? 5.754   81.493 46.308 1.00 35.30  ? 135  LEU A C   1 
ATOM   1032 O O   . LEU A 1 132 ? 6.534   81.618 45.361 1.00 37.54  ? 135  LEU A O   1 
ATOM   1033 C CB  . LEU A 1 132 ? 6.201   79.842 48.165 1.00 31.85  ? 135  LEU A CB  1 
ATOM   1034 C CG  . LEU A 1 132 ? 7.011   78.782 47.416 1.00 29.96  ? 135  LEU A CG  1 
ATOM   1035 C CD1 . LEU A 1 132 ? 8.473   79.194 47.328 1.00 26.73  ? 135  LEU A CD1 1 
ATOM   1036 C CD2 . LEU A 1 132 ? 6.859   77.434 48.127 1.00 26.23  ? 135  LEU A CD2 1 
ATOM   1037 N N   . ALA A 1 133 ? 4.431   81.522 46.164 1.00 34.38  ? 136  ALA A N   1 
ATOM   1038 C CA  . ALA A 1 133 ? 3.803   81.700 44.858 1.00 35.53  ? 136  ALA A CA  1 
ATOM   1039 C C   . ALA A 1 133 ? 4.228   83.048 44.278 1.00 36.85  ? 136  ALA A C   1 
ATOM   1040 O O   . ALA A 1 133 ? 4.659   83.141 43.127 1.00 36.39  ? 136  ALA A O   1 
ATOM   1041 C CB  . ALA A 1 133 ? 2.282   81.631 44.987 1.00 29.56  ? 136  ALA A CB  1 
ATOM   1042 N N   . TYR A 1 134 ? 4.154   84.076 45.115 1.00 36.64  ? 137  TYR A N   1 
ATOM   1043 C CA  . TYR A 1 134 ? 4.519   85.426 44.727 1.00 35.53  ? 137  TYR A CA  1 
ATOM   1044 C C   . TYR A 1 134 ? 6.013   85.593 44.452 1.00 34.34  ? 137  TYR A C   1 
ATOM   1045 O O   . TYR A 1 134 ? 6.406   86.046 43.381 1.00 36.51  ? 137  TYR A O   1 
ATOM   1046 C CB  . TYR A 1 134 ? 4.064   86.407 45.816 1.00 40.39  ? 137  TYR A CB  1 
ATOM   1047 C CG  . TYR A 1 134 ? 4.611   87.811 45.662 1.00 45.17  ? 137  TYR A CG  1 
ATOM   1048 C CD1 . TYR A 1 134 ? 4.065   88.694 44.732 1.00 46.58  ? 137  TYR A CD1 1 
ATOM   1049 C CD2 . TYR A 1 134 ? 5.707   88.241 46.419 1.00 46.32  ? 137  TYR A CD2 1 
ATOM   1050 C CE1 . TYR A 1 134 ? 4.599   89.971 44.551 1.00 49.80  ? 137  TYR A CE1 1 
ATOM   1051 C CE2 . TYR A 1 134 ? 6.249   89.514 46.246 1.00 48.12  ? 137  TYR A CE2 1 
ATOM   1052 C CZ  . TYR A 1 134 ? 5.691   90.375 45.308 1.00 50.24  ? 137  TYR A CZ  1 
ATOM   1053 O OH  . TYR A 1 134 ? 6.228   91.631 45.116 1.00 50.90  ? 137  TYR A OH  1 
ATOM   1054 N N   . THR A 1 135 ? 6.843   85.203 45.412 1.00 33.91  ? 138  THR A N   1 
ATOM   1055 C CA  . THR A 1 135 ? 8.292   85.355 45.292 1.00 31.85  ? 138  THR A CA  1 
ATOM   1056 C C   . THR A 1 135 ? 8.926   84.540 44.181 1.00 34.22  ? 138  THR A C   1 
ATOM   1057 O O   . THR A 1 135 ? 9.844   85.009 43.509 1.00 36.80  ? 138  THR A O   1 
ATOM   1058 C CB  . THR A 1 135 ? 9.005   85.000 46.617 1.00 27.70  ? 138  THR A CB  1 
ATOM   1059 O OG1 . THR A 1 135 ? 8.429   85.756 47.683 1.00 29.77  ? 138  THR A OG1 1 
ATOM   1060 C CG2 . THR A 1 135 ? 10.481  85.324 46.544 1.00 26.05  ? 138  THR A CG2 1 
ATOM   1061 N N   . GLU A 1 136 ? 8.423   83.330 43.976 1.00 35.36  ? 139  GLU A N   1 
ATOM   1062 C CA  . GLU A 1 136 ? 8.991   82.440 42.978 1.00 35.27  ? 139  GLU A CA  1 
ATOM   1063 C C   . GLU A 1 136 ? 8.230   82.277 41.676 1.00 36.54  ? 139  GLU A C   1 
ATOM   1064 O O   . GLU A 1 136 ? 8.676   81.552 40.786 1.00 35.94  ? 139  GLU A O   1 
ATOM   1065 C CB  . GLU A 1 136 ? 9.259   81.081 43.611 1.00 34.00  ? 139  GLU A CB  1 
ATOM   1066 C CG  . GLU A 1 136 ? 10.353  81.132 44.657 1.00 30.23  ? 139  GLU A CG  1 
ATOM   1067 C CD  . GLU A 1 136 ? 11.666  81.611 44.082 1.00 31.85  ? 139  GLU A CD  1 
ATOM   1068 O OE1 . GLU A 1 136 ? 12.069  81.100 43.020 1.00 33.66  ? 139  GLU A OE1 1 
ATOM   1069 O OE2 . GLU A 1 136 ? 12.297  82.501 44.685 1.00 32.73  ? 139  GLU A OE2 1 
ATOM   1070 N N   . GLU A 1 137 ? 7.101   82.965 41.549 1.00 39.16  ? 140  GLU A N   1 
ATOM   1071 C CA  . GLU A 1 137 ? 6.284   82.914 40.344 1.00 40.65  ? 140  GLU A CA  1 
ATOM   1072 C C   . GLU A 1 137 ? 5.841   81.487 40.039 1.00 40.07  ? 140  GLU A C   1 
ATOM   1073 O O   . GLU A 1 137 ? 6.016   81.004 38.908 1.00 42.21  ? 140  GLU A O   1 
ATOM   1074 C CB  . GLU A 1 137 ? 7.045   83.505 39.156 1.00 43.73  ? 140  GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 137 ? 7.446   84.959 39.338 1.00 46.49  ? 140  GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 137 ? 8.208   85.508 38.148 0.50 45.37  ? 140  GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 137 ? 7.566   85.799 37.116 0.50 45.78  ? 140  GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 137 ? 9.445   85.647 38.245 0.50 43.69  ? 140  GLU A OE2 1 
ATOM   1079 N N   . VAL A 1 138 ? 5.281   80.802 41.033 1.00 38.10  ? 141  VAL A N   1 
ATOM   1080 C CA  . VAL A 1 138 ? 4.790   79.434 40.859 1.00 32.81  ? 141  VAL A CA  1 
ATOM   1081 C C   . VAL A 1 138 ? 3.337   79.339 41.293 1.00 32.36  ? 141  VAL A C   1 
ATOM   1082 O O   . VAL A 1 138 ? 2.857   80.159 42.076 1.00 32.17  ? 141  VAL A O   1 
ATOM   1083 C CB  . VAL A 1 138 ? 5.610   78.384 41.689 1.00 33.09  ? 141  VAL A CB  1 
ATOM   1084 C CG1 . VAL A 1 138 ? 7.090   78.434 41.324 1.00 28.93  ? 141  VAL A CG1 1 
ATOM   1085 C CG2 . VAL A 1 138 ? 5.413   78.592 43.188 1.00 29.93  ? 141  VAL A CG2 1 
ATOM   1086 N N   . VAL A 1 139 ? 2.616   78.378 40.729 1.00 32.31  ? 142  VAL A N   1 
ATOM   1087 C CA  . VAL A 1 139 ? 1.233   78.166 41.126 1.00 32.22  ? 142  VAL A CA  1 
ATOM   1088 C C   . VAL A 1 139 ? 1.363   77.173 42.279 1.00 33.43  ? 142  VAL A C   1 
ATOM   1089 O O   . VAL A 1 139 ? 1.767   76.025 42.083 1.00 34.42  ? 142  VAL A O   1 
ATOM   1090 C CB  . VAL A 1 139 ? 0.389   77.565 39.983 1.00 31.20  ? 142  VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 139 ? -1.023  77.281 40.461 1.00 27.42  ? 142  VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 139 ? 0.356   78.524 38.808 1.00 29.57  ? 142  VAL A CG2 1 
ATOM   1093 N N   . LEU A 1 140 ? 1.135   77.652 43.494 1.00 32.39  ? 143  LEU A N   1 
ATOM   1094 C CA  . LEU A 1 140 ? 1.253   76.794 44.660 1.00 28.60  ? 143  LEU A CA  1 
ATOM   1095 C C   . LEU A 1 140 ? -0.088  76.232 45.080 1.00 27.35  ? 143  LEU A C   1 
ATOM   1096 O O   . LEU A 1 140 ? -1.041  76.970 45.321 1.00 27.67  ? 143  LEU A O   1 
ATOM   1097 C CB  . LEU A 1 140 ? 1.893   77.547 45.827 1.00 30.17  ? 143  LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 140 ? 2.298   76.675 47.015 1.00 30.47  ? 143  LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 140 ? 3.298   75.631 46.577 1.00 31.55  ? 143  LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 140 ? 2.917   77.529 48.070 1.00 35.39  ? 143  LEU A CD2 1 
ATOM   1101 N N   . VAL A 1 141 ? -0.153  74.909 45.146 1.00 26.54  ? 144  VAL A N   1 
ATOM   1102 C CA  . VAL A 1 141 ? -1.359  74.204 45.553 1.00 24.91  ? 144  VAL A CA  1 
ATOM   1103 C C   . VAL A 1 141 ? -1.081  73.469 46.866 1.00 25.30  ? 144  VAL A C   1 
ATOM   1104 O O   . VAL A 1 141 ? 0.034   73.014 47.103 1.00 22.41  ? 144  VAL A O   1 
ATOM   1105 C CB  . VAL A 1 141 ? -1.780  73.147 44.491 1.00 20.60  ? 144  VAL A CB  1 
ATOM   1106 C CG1 . VAL A 1 141 ? -2.982  72.352 44.970 1.00 18.28  ? 144  VAL A CG1 1 
ATOM   1107 C CG2 . VAL A 1 141 ? -2.095  73.822 43.174 1.00 22.70  ? 144  VAL A CG2 1 
ATOM   1108 N N   . SER A 1 142 ? -2.073  73.443 47.748 1.00 24.62  ? 145  SER A N   1 
ATOM   1109 C CA  . SER A 1 142 ? -1.957  72.701 48.990 1.00 24.26  ? 145  SER A CA  1 
ATOM   1110 C C   . SER A 1 142 ? -3.225  71.864 49.041 1.00 24.08  ? 145  SER A C   1 
ATOM   1111 O O   . SER A 1 142 ? -4.335  72.382 48.900 1.00 23.04  ? 145  SER A O   1 
ATOM   1112 C CB  . SER A 1 142 ? -1.812  73.608 50.221 1.00 22.37  ? 145  SER A CB  1 
ATOM   1113 O OG  . SER A 1 142 ? -2.983  74.346 50.499 1.00 25.83  ? 145  SER A OG  1 
ATOM   1114 N N   . LEU A 1 143 ? -3.039  70.552 49.110 1.00 23.07  ? 146  LEU A N   1 
ATOM   1115 C CA  . LEU A 1 143 ? -4.158  69.624 49.151 1.00 24.11  ? 146  LEU A CA  1 
ATOM   1116 C C   . LEU A 1 143 ? -4.491  69.214 50.585 1.00 25.41  ? 146  LEU A C   1 
ATOM   1117 O O   . LEU A 1 143 ? -3.861  69.673 51.536 1.00 25.44  ? 146  LEU A O   1 
ATOM   1118 C CB  . LEU A 1 143 ? -3.823  68.392 48.295 1.00 21.89  ? 146  LEU A CB  1 
ATOM   1119 C CG  . LEU A 1 143 ? -2.525  67.616 48.576 1.00 24.25  ? 146  LEU A CG  1 
ATOM   1120 C CD1 . LEU A 1 143 ? -2.691  66.656 49.755 1.00 21.24  ? 146  LEU A CD1 1 
ATOM   1121 C CD2 . LEU A 1 143 ? -2.141  66.825 47.355 1.00 22.08  ? 146  LEU A CD2 1 
ATOM   1122 N N   . SER A 1 144 ? -5.511  68.377 50.736 1.00 26.48  ? 147  SER A N   1 
ATOM   1123 C CA  . SER A 1 144 ? -5.899  67.872 52.044 1.00 25.54  ? 147  SER A CA  1 
ATOM   1124 C C   . SER A 1 144 ? -6.239  66.403 51.873 1.00 25.11  ? 147  SER A C   1 
ATOM   1125 O O   . SER A 1 144 ? -6.509  65.942 50.761 1.00 26.03  ? 147  SER A O   1 
ATOM   1126 C CB  . SER A 1 144 ? -7.098  68.634 52.602 1.00 25.67  ? 147  SER A CB  1 
ATOM   1127 O OG  . SER A 1 144 ? -8.259  68.388 51.830 1.00 34.49  ? 147  SER A OG  1 
ATOM   1128 N N   . TYR A 1 145 ? -6.199  65.666 52.974 1.00 25.52  ? 148  TYR A N   1 
ATOM   1129 C CA  . TYR A 1 145 ? -6.504  64.246 52.957 1.00 23.94  ? 148  TYR A CA  1 
ATOM   1130 C C   . TYR A 1 145 ? -6.941  63.792 54.335 1.00 25.02  ? 148  TYR A C   1 
ATOM   1131 O O   . TYR A 1 145 ? -6.590  64.403 55.348 1.00 24.33  ? 148  TYR A O   1 
ATOM   1132 C CB  . TYR A 1 145 ? -5.292  63.427 52.480 1.00 22.48  ? 148  TYR A CB  1 
ATOM   1133 C CG  . TYR A 1 145 ? -4.045  63.560 53.329 1.00 19.38  ? 148  TYR A CG  1 
ATOM   1134 C CD1 . TYR A 1 145 ? -3.179  64.643 53.166 1.00 18.50  ? 148  TYR A CD1 1 
ATOM   1135 C CD2 . TYR A 1 145 ? -3.717  62.588 54.276 1.00 19.44  ? 148  TYR A CD2 1 
ATOM   1136 C CE1 . TYR A 1 145 ? -2.019  64.755 53.921 1.00 18.14  ? 148  TYR A CE1 1 
ATOM   1137 C CE2 . TYR A 1 145 ? -2.562  62.689 55.038 1.00 18.53  ? 148  TYR A CE2 1 
ATOM   1138 C CZ  . TYR A 1 145 ? -1.719  63.775 54.857 1.00 20.73  ? 148  TYR A CZ  1 
ATOM   1139 O OH  . TYR A 1 145 ? -0.584  63.880 55.625 1.00 19.38  ? 148  TYR A OH  1 
ATOM   1140 N N   . ARG A 1 146 ? -7.733  62.729 54.361 1.00 24.16  ? 149  ARG A N   1 
ATOM   1141 C CA  . ARG A 1 146 ? -8.225  62.179 55.609 1.00 24.88  ? 149  ARG A CA  1 
ATOM   1142 C C   . ARG A 1 146 ? -7.087  61.564 56.414 1.00 25.76  ? 149  ARG A C   1 
ATOM   1143 O O   . ARG A 1 146 ? -6.232  60.854 55.870 1.00 25.78  ? 149  ARG A O   1 
ATOM   1144 C CB  . ARG A 1 146 ? -9.318  61.151 55.331 1.00 21.01  ? 149  ARG A CB  1 
ATOM   1145 C CG  . ARG A 1 146 ? -10.628 61.790 54.952 1.00 21.30  ? 149  ARG A CG  1 
ATOM   1146 C CD  . ARG A 1 146 ? -11.613 60.753 54.492 1.00 22.11  ? 149  ARG A CD  1 
ATOM   1147 N NE  . ARG A 1 146 ? -11.276 60.267 53.161 1.00 24.46  ? 149  ARG A NE  1 
ATOM   1148 C CZ  . ARG A 1 146 ? -11.808 59.187 52.602 1.00 24.79  ? 149  ARG A CZ  1 
ATOM   1149 N NH1 . ARG A 1 146 ? -12.706 58.466 53.257 1.00 22.85  ? 149  ARG A NH1 1 
ATOM   1150 N NH2 . ARG A 1 146 ? -11.447 58.830 51.377 1.00 26.27  ? 149  ARG A NH2 1 
ATOM   1151 N N   . VAL A 1 147 ? -7.057  61.908 57.699 1.00 24.12  ? 150  VAL A N   1 
ATOM   1152 C CA  . VAL A 1 147 ? -6.051  61.414 58.631 1.00 21.08  ? 150  VAL A CA  1 
ATOM   1153 C C   . VAL A 1 147 ? -6.747  60.537 59.666 1.00 23.25  ? 150  VAL A C   1 
ATOM   1154 O O   . VAL A 1 147 ? -7.972  60.404 59.656 1.00 26.43  ? 150  VAL A O   1 
ATOM   1155 C CB  . VAL A 1 147 ? -5.309  62.585 59.333 1.00 18.87  ? 150  VAL A CB  1 
ATOM   1156 C CG1 . VAL A 1 147 ? -4.529  63.400 58.308 1.00 16.85  ? 150  VAL A CG1 1 
ATOM   1157 C CG2 . VAL A 1 147 ? -6.289  63.478 60.066 1.00 11.40  ? 150  VAL A CG2 1 
ATOM   1158 N N   . GLY A 1 148 ? -5.968  59.921 60.544 1.00 22.21  ? 151  GLY A N   1 
ATOM   1159 C CA  . GLY A 1 148 ? -6.539  59.068 61.567 1.00 23.05  ? 151  GLY A CA  1 
ATOM   1160 C C   . GLY A 1 148 ? -7.262  57.883 60.974 1.00 26.72  ? 151  GLY A C   1 
ATOM   1161 O O   . GLY A 1 148 ? -6.976  57.475 59.848 1.00 29.03  ? 151  GLY A O   1 
ATOM   1162 N N   . ALA A 1 149 ? -8.204  57.335 61.733 1.00 27.73  ? 152  ALA A N   1 
ATOM   1163 C CA  . ALA A 1 149 ? -8.988  56.189 61.292 1.00 27.10  ? 152  ALA A CA  1 
ATOM   1164 C C   . ALA A 1 149 ? -9.761  56.520 60.016 1.00 27.83  ? 152  ALA A C   1 
ATOM   1165 O O   . ALA A 1 149 ? -9.906  55.672 59.133 1.00 27.49  ? 152  ALA A O   1 
ATOM   1166 C CB  . ALA A 1 149 ? -9.940  55.758 62.396 1.00 25.76  ? 152  ALA A CB  1 
ATOM   1167 N N   . PHE A 1 150 ? -10.193 57.775 59.907 1.00 27.23  ? 153  PHE A N   1 
ATOM   1168 C CA  . PHE A 1 150 ? -10.949 58.259 58.753 1.00 27.57  ? 153  PHE A CA  1 
ATOM   1169 C C   . PHE A 1 150 ? -10.204 58.064 57.445 1.00 28.66  ? 153  PHE A C   1 
ATOM   1170 O O   . PHE A 1 150 ? -10.808 57.754 56.417 1.00 29.30  ? 153  PHE A O   1 
ATOM   1171 C CB  . PHE A 1 150 ? -11.272 59.739 58.920 1.00 24.73  ? 153  PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 150 ? -11.959 60.057 60.200 1.00 30.85  ? 153  PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 150 ? -13.334 59.880 60.330 1.00 32.92  ? 153  PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 150 ? -11.232 60.518 61.295 1.00 32.43  ? 153  PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 150 ? -13.978 60.157 61.538 1.00 32.80  ? 153  PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 150 ? -11.863 60.798 62.506 1.00 31.84  ? 153  PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 150 ? -13.236 60.618 62.627 1.00 31.61  ? 153  PHE A CZ  1 
ATOM   1178 N N   . GLY A 1 151 ? -8.890  58.258 57.478 1.00 27.71  ? 154  GLY A N   1 
ATOM   1179 C CA  . GLY A 1 151 ? -8.116  58.096 56.269 1.00 25.32  ? 154  GLY A CA  1 
ATOM   1180 C C   . GLY A 1 151 ? -7.304  56.823 56.206 1.00 26.45  ? 154  GLY A C   1 
ATOM   1181 O O   . GLY A 1 151 ? -6.875  56.427 55.123 1.00 26.09  ? 154  GLY A O   1 
ATOM   1182 N N   . PHE A 1 152 ? -7.121  56.141 57.334 1.00 26.13  ? 155  PHE A N   1 
ATOM   1183 C CA  . PHE A 1 152 ? -6.287  54.950 57.309 1.00 25.33  ? 155  PHE A CA  1 
ATOM   1184 C C   . PHE A 1 152 ? -6.744  53.685 58.007 1.00 25.01  ? 155  PHE A C   1 
ATOM   1185 O O   . PHE A 1 152 ? -5.970  52.738 58.122 1.00 26.26  ? 155  PHE A O   1 
ATOM   1186 C CB  . PHE A 1 152 ? -4.855  55.322 57.707 1.00 25.39  ? 155  PHE A CB  1 
ATOM   1187 C CG  . PHE A 1 152 ? -4.239  56.342 56.792 1.00 26.19  ? 155  PHE A CG  1 
ATOM   1188 C CD1 . PHE A 1 152 ? -3.625  55.950 55.606 1.00 25.45  ? 155  PHE A CD1 1 
ATOM   1189 C CD2 . PHE A 1 152 ? -4.359  57.703 57.063 1.00 26.15  ? 155  PHE A CD2 1 
ATOM   1190 C CE1 . PHE A 1 152 ? -3.152  56.896 54.703 1.00 25.94  ? 155  PHE A CE1 1 
ATOM   1191 C CE2 . PHE A 1 152 ? -3.888  58.660 56.161 1.00 24.18  ? 155  PHE A CE2 1 
ATOM   1192 C CZ  . PHE A 1 152 ? -3.285  58.256 54.981 1.00 25.85  ? 155  PHE A CZ  1 
ATOM   1193 N N   . LEU A 1 153 ? -8.002  53.645 58.431 1.00 24.43  ? 156  LEU A N   1 
ATOM   1194 C CA  . LEU A 1 153 ? -8.546  52.450 59.070 1.00 29.58  ? 156  LEU A CA  1 
ATOM   1195 C C   . LEU A 1 153 ? -8.434  51.377 57.984 1.00 32.01  ? 156  LEU A C   1 
ATOM   1196 O O   . LEU A 1 153 ? -8.944  51.558 56.878 1.00 32.95  ? 156  LEU A O   1 
ATOM   1197 C CB  . LEU A 1 153 ? -10.011 52.693 59.452 1.00 32.46  ? 156  LEU A CB  1 
ATOM   1198 C CG  . LEU A 1 153 ? -10.811 51.690 60.291 1.00 34.52  ? 156  LEU A CG  1 
ATOM   1199 C CD1 . LEU A 1 153 ? -11.395 50.597 59.419 1.00 33.76  ? 156  LEU A CD1 1 
ATOM   1200 C CD2 . LEU A 1 153 ? -9.945  51.130 61.406 1.00 33.30  ? 156  LEU A CD2 1 
ATOM   1201 N N   . ALA A 1 154 ? -7.747  50.279 58.281 1.00 32.43  ? 157  ALA A N   1 
ATOM   1202 C CA  . ALA A 1 154 ? -7.548  49.243 57.277 1.00 30.50  ? 157  ALA A CA  1 
ATOM   1203 C C   . ALA A 1 154 ? -8.036  47.834 57.590 1.00 32.77  ? 157  ALA A C   1 
ATOM   1204 O O   . ALA A 1 154 ? -7.454  47.126 58.409 1.00 33.33  ? 157  ALA A O   1 
ATOM   1205 C CB  . ALA A 1 154 ? -6.081  49.196 56.885 1.00 27.33  ? 157  ALA A CB  1 
ATOM   1206 N N   . LEU A 1 155 ? -9.100  47.427 56.912 1.00 33.90  ? 158  LEU A N   1 
ATOM   1207 C CA  . LEU A 1 155 ? -9.643  46.081 57.054 1.00 34.59  ? 158  LEU A CA  1 
ATOM   1208 C C   . LEU A 1 155 ? -9.488  45.462 55.675 1.00 36.67  ? 158  LEU A C   1 
ATOM   1209 O O   . LEU A 1 155 ? -10.461 45.280 54.948 1.00 39.86  ? 158  LEU A O   1 
ATOM   1210 C CB  . LEU A 1 155 ? -11.111 46.121 57.477 1.00 32.60  ? 158  LEU A CB  1 
ATOM   1211 C CG  . LEU A 1 155 ? -11.348 46.402 58.962 1.00 35.28  ? 158  LEU A CG  1 
ATOM   1212 C CD1 . LEU A 1 155 ? -12.829 46.600 59.215 1.00 30.63  ? 158  LEU A CD1 1 
ATOM   1213 C CD2 . LEU A 1 155 ? -10.787 45.256 59.813 1.00 31.17  ? 158  LEU A CD2 1 
ATOM   1214 N N   . HIS A 1 156 ? -8.238  45.195 55.307 1.00 40.15  ? 159  HIS A N   1 
ATOM   1215 C CA  . HIS A 1 156 ? -7.884  44.627 54.008 1.00 42.30  ? 159  HIS A CA  1 
ATOM   1216 C C   . HIS A 1 156 ? -8.756  43.468 53.559 1.00 44.40  ? 159  HIS A C   1 
ATOM   1217 O O   . HIS A 1 156 ? -8.906  42.472 54.267 1.00 45.96  ? 159  HIS A O   1 
ATOM   1218 C CB  . HIS A 1 156 ? -6.422  44.192 53.987 1.00 42.57  ? 159  HIS A CB  1 
ATOM   1219 C CG  . HIS A 1 156 ? -5.962  43.713 52.647 1.00 44.48  ? 159  HIS A CG  1 
ATOM   1220 N ND1 . HIS A 1 156 ? -5.790  44.564 51.575 1.00 43.19  ? 159  HIS A ND1 1 
ATOM   1221 C CD2 . HIS A 1 156 ? -5.656  42.473 52.198 1.00 43.31  ? 159  HIS A CD2 1 
ATOM   1222 C CE1 . HIS A 1 156 ? -5.398  43.868 50.523 1.00 44.16  ? 159  HIS A CE1 1 
ATOM   1223 N NE2 . HIS A 1 156 ? -5.309  42.597 50.875 1.00 43.78  ? 159  HIS A NE2 1 
ATOM   1224 N N   . GLY A 1 157 ? -9.242  43.572 52.328 1.00 46.63  ? 160  GLY A N   1 
ATOM   1225 C CA  . GLY A 1 157 ? -10.122 42.562 51.773 1.00 47.15  ? 160  GLY A CA  1 
ATOM   1226 C C   . GLY A 1 157 ? -11.525 43.136 51.669 1.00 47.86  ? 160  GLY A C   1 
ATOM   1227 O O   . GLY A 1 157 ? -12.350 42.651 50.896 1.00 48.52  ? 160  GLY A O   1 
ATOM   1228 N N   . SER A 1 158 ? -11.787 44.172 52.465 1.00 48.57  ? 161  SER A N   1 
ATOM   1229 C CA  . SER A 1 158 ? -13.074 44.856 52.488 1.00 48.14  ? 161  SER A CA  1 
ATOM   1230 C C   . SER A 1 158 ? -13.086 46.020 51.499 1.00 47.11  ? 161  SER A C   1 
ATOM   1231 O O   . SER A 1 158 ? -12.068 46.682 51.293 1.00 49.32  ? 161  SER A O   1 
ATOM   1232 C CB  . SER A 1 158 ? -13.357 45.373 53.903 1.00 49.09  ? 161  SER A CB  1 
ATOM   1233 O OG  . SER A 1 158 ? -14.409 46.323 53.908 1.00 53.54  ? 161  SER A OG  1 
ATOM   1234 N N   . GLN A 1 159 ? -14.233 46.256 50.874 1.00 44.87  ? 162  GLN A N   1 
ATOM   1235 C CA  . GLN A 1 159 ? -14.354 47.354 49.928 1.00 43.81  ? 162  GLN A CA  1 
ATOM   1236 C C   . GLN A 1 159 ? -14.752 48.619 50.673 1.00 41.49  ? 162  GLN A C   1 
ATOM   1237 O O   . GLN A 1 159 ? -14.498 49.723 50.203 1.00 41.48  ? 162  GLN A O   1 
ATOM   1238 C CB  . GLN A 1 159 ? -15.393 47.036 48.839 1.00 48.22  ? 162  GLN A CB  1 
ATOM   1239 C CG  . GLN A 1 159 ? -15.011 45.897 47.888 1.00 50.48  ? 162  GLN A CG  1 
ATOM   1240 C CD  . GLN A 1 159 ? -13.671 46.128 47.206 1.00 52.80  ? 162  GLN A CD  1 
ATOM   1241 N N   . GLU A 1 160 ? -15.352 48.450 51.849 1.00 41.08  ? 163  GLU A N   1 
ATOM   1242 C CA  . GLU A 1 160 ? -15.808 49.575 52.665 1.00 41.68  ? 163  GLU A CA  1 
ATOM   1243 C C   . GLU A 1 160 ? -14.694 50.325 53.378 1.00 40.15  ? 163  GLU A C   1 
ATOM   1244 O O   . GLU A 1 160 ? -14.784 51.534 53.578 1.00 41.27  ? 163  GLU A O   1 
ATOM   1245 C CB  . GLU A 1 160 ? -16.828 49.100 53.696 1.00 47.66  ? 163  GLU A CB  1 
ATOM   1246 C CG  . GLU A 1 160 ? -18.048 48.415 53.110 1.00 55.13  ? 163  GLU A CG  1 
ATOM   1247 C CD  . GLU A 1 160 ? -18.747 49.248 52.045 1.00 60.43  ? 163  GLU A CD  1 
ATOM   1248 O OE1 . GLU A 1 160 ? -18.878 50.480 52.221 1.00 63.17  ? 163  GLU A OE1 1 
ATOM   1249 O OE2 . GLU A 1 160 ? -19.167 48.661 51.023 1.00 65.90  ? 163  GLU A OE2 1 
ATOM   1250 N N   . ALA A 1 161 ? -13.664 49.595 53.793 1.00 37.03  ? 164  ALA A N   1 
ATOM   1251 C CA  . ALA A 1 161 ? -12.523 50.185 54.483 1.00 35.59  ? 164  ALA A CA  1 
ATOM   1252 C C   . ALA A 1 161 ? -11.273 49.404 54.086 1.00 33.78  ? 164  ALA A C   1 
ATOM   1253 O O   . ALA A 1 161 ? -10.747 48.611 54.868 1.00 35.03  ? 164  ALA A O   1 
ATOM   1254 C CB  . ALA A 1 161 ? -12.737 50.131 55.998 1.00 35.44  ? 164  ALA A CB  1 
ATOM   1255 N N   . PRO A 1 162 ? -10.785 49.616 52.850 1.00 31.99  ? 165  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 162 ? -9.596  48.925 52.344 1.00 31.50  ? 165  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 162 ? -8.290  49.436 52.935 1.00 31.99  ? 165  PRO A C   1 
ATOM   1258 O O   . PRO A 1 162 ? -7.287  48.720 52.951 1.00 34.15  ? 165  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 162 ? -9.661  49.209 50.844 1.00 30.19  ? 165  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 162 ? -10.208 50.596 50.803 1.00 28.58  ? 165  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 162 ? -11.327 50.540 51.834 1.00 30.62  ? 165  PRO A CD  1 
ATOM   1262 N N   . GLY A 1 163 ? -8.324  50.662 53.450 1.00 31.17  ? 166  GLY A N   1 
ATOM   1263 C CA  . GLY A 1 163 ? -7.134  51.281 53.999 1.00 27.62  ? 166  GLY A CA  1 
ATOM   1264 C C   . GLY A 1 163 ? -6.523  52.135 52.903 1.00 28.01  ? 166  GLY A C   1 
ATOM   1265 O O   . GLY A 1 163 ? -6.948  52.046 51.747 1.00 25.84  ? 166  GLY A O   1 
ATOM   1266 N N   . ASN A 1 164 ? -5.566  52.989 53.265 1.00 27.84  ? 167  ASN A N   1 
ATOM   1267 C CA  . ASN A 1 164 ? -4.880  53.864 52.309 1.00 26.06  ? 167  ASN A CA  1 
ATOM   1268 C C   . ASN A 1 164 ? -5.758  54.924 51.642 1.00 25.92  ? 167  ASN A C   1 
ATOM   1269 O O   . ASN A 1 164 ? -5.291  55.638 50.753 1.00 25.61  ? 167  ASN A O   1 
ATOM   1270 C CB  . ASN A 1 164 ? -4.174  53.033 51.226 1.00 24.19  ? 167  ASN A CB  1 
ATOM   1271 C CG  . ASN A 1 164 ? -2.949  52.315 51.748 1.00 24.77  ? 167  ASN A CG  1 
ATOM   1272 O OD1 . ASN A 1 164 ? -2.376  52.710 52.754 1.00 28.74  ? 167  ASN A OD1 1 
ATOM   1273 N ND2 . ASN A 1 164 ? -2.534  51.262 51.058 1.00 21.56  ? 167  ASN A ND2 1 
ATOM   1274 N N   . VAL A 1 165 ? -7.005  55.059 52.097 1.00 26.16  ? 168  VAL A N   1 
ATOM   1275 C CA  . VAL A 1 165 ? -7.927  56.032 51.509 1.00 27.48  ? 168  VAL A CA  1 
ATOM   1276 C C   . VAL A 1 165 ? -7.447  57.482 51.622 1.00 27.12  ? 168  VAL A C   1 
ATOM   1277 O O   . VAL A 1 165 ? -7.754  58.303 50.757 1.00 30.02  ? 168  VAL A O   1 
ATOM   1278 C CB  . VAL A 1 165 ? -9.391  55.871 52.033 1.00 26.23  ? 168  VAL A CB  1 
ATOM   1279 C CG1 . VAL A 1 165 ? -9.896  54.467 51.744 1.00 24.87  ? 168  VAL A CG1 1 
ATOM   1280 C CG2 . VAL A 1 165 ? -9.488  56.171 53.514 1.00 29.76  ? 168  VAL A CG2 1 
ATOM   1281 N N   . GLY A 1 166 ? -6.658  57.778 52.654 1.00 25.87  ? 169  GLY A N   1 
ATOM   1282 C CA  . GLY A 1 166 ? -6.118  59.119 52.819 1.00 21.94  ? 169  GLY A CA  1 
ATOM   1283 C C   . GLY A 1 166 ? -5.099  59.398 51.720 1.00 21.37  ? 169  GLY A C   1 
ATOM   1284 O O   . GLY A 1 166 ? -4.949  60.533 51.272 1.00 20.63  ? 169  GLY A O   1 
ATOM   1285 N N   . LEU A 1 167 ? -4.379  58.355 51.307 1.00 22.52  ? 170  LEU A N   1 
ATOM   1286 C CA  . LEU A 1 167 ? -3.391  58.464 50.237 1.00 22.40  ? 170  LEU A CA  1 
ATOM   1287 C C   . LEU A 1 167 ? -4.103  58.663 48.896 1.00 23.97  ? 170  LEU A C   1 
ATOM   1288 O O   . LEU A 1 167 ? -3.603  59.369 48.013 1.00 23.92  ? 170  LEU A O   1 
ATOM   1289 C CB  . LEU A 1 167 ? -2.519  57.210 50.188 1.00 20.55  ? 170  LEU A CB  1 
ATOM   1290 C CG  . LEU A 1 167 ? -1.365  57.129 51.187 1.00 20.47  ? 170  LEU A CG  1 
ATOM   1291 C CD1 . LEU A 1 167 ? -0.713  55.751 51.164 1.00 17.88  ? 170  LEU A CD1 1 
ATOM   1292 C CD2 . LEU A 1 167 ? -0.351  58.200 50.852 1.00 17.33  ? 170  LEU A CD2 1 
ATOM   1293 N N   . LEU A 1 168 ? -5.269  58.030 48.751 1.00 24.86  ? 171  LEU A N   1 
ATOM   1294 C CA  . LEU A 1 168 ? -6.072  58.156 47.537 1.00 24.60  ? 171  LEU A CA  1 
ATOM   1295 C C   . LEU A 1 168 ? -6.657  59.566 47.434 1.00 24.64  ? 171  LEU A C   1 
ATOM   1296 O O   . LEU A 1 168 ? -6.863  60.068 46.333 1.00 25.39  ? 171  LEU A O   1 
ATOM   1297 C CB  . LEU A 1 168 ? -7.177  57.099 47.500 1.00 23.32  ? 171  LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 168 ? -6.690  55.651 47.435 1.00 21.96  ? 171  LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 168 ? -7.872  54.707 47.328 1.00 17.46  ? 171  LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 168 ? -5.765  55.479 46.247 1.00 20.86  ? 171  LEU A CD2 1 
ATOM   1301 N N   . ASP A 1 169 ? -6.912  60.203 48.580 1.00 27.48  ? 172  ASP A N   1 
ATOM   1302 C CA  . ASP A 1 169 ? -7.426  61.577 48.604 1.00 27.84  ? 172  ASP A CA  1 
ATOM   1303 C C   . ASP A 1 169 ? -6.337  62.456 47.992 1.00 27.42  ? 172  ASP A C   1 
ATOM   1304 O O   . ASP A 1 169 ? -6.612  63.332 47.174 1.00 29.39  ? 172  ASP A O   1 
ATOM   1305 C CB  . ASP A 1 169 ? -7.674  62.062 50.043 1.00 25.04  ? 172  ASP A CB  1 
ATOM   1306 C CG  . ASP A 1 169 ? -8.816  61.341 50.733 1.00 28.95  ? 172  ASP A CG  1 
ATOM   1307 O OD1 . ASP A 1 169 ? -9.625  60.670 50.063 1.00 28.78  ? 172  ASP A OD1 1 
ATOM   1308 O OD2 . ASP A 1 169 ? -8.921  61.465 51.972 1.00 32.82  ? 172  ASP A OD2 1 
ATOM   1309 N N   . GLN A 1 170 ? -5.098  62.219 48.420 1.00 27.21  ? 173  GLN A N   1 
ATOM   1310 C CA  . GLN A 1 170 ? -3.955  62.969 47.925 1.00 26.47  ? 173  GLN A CA  1 
ATOM   1311 C C   . GLN A 1 170 ? -3.877  62.793 46.423 1.00 25.33  ? 173  GLN A C   1 
ATOM   1312 O O   . GLN A 1 170 ? -3.781  63.770 45.681 1.00 24.76  ? 173  GLN A O   1 
ATOM   1313 C CB  . GLN A 1 170 ? -2.662  62.462 48.566 1.00 24.75  ? 173  GLN A CB  1 
ATOM   1314 C CG  . GLN A 1 170 ? -2.579  62.658 50.069 1.00 22.84  ? 173  GLN A CG  1 
ATOM   1315 C CD  . GLN A 1 170 ? -1.269  62.145 50.647 1.00 23.73  ? 173  GLN A CD  1 
ATOM   1316 O OE1 . GLN A 1 170 ? -0.292  61.982 49.932 1.00 22.01  ? 173  GLN A OE1 1 
ATOM   1317 N NE2 . GLN A 1 170 ? -1.252  61.885 51.950 1.00 25.17  ? 173  GLN A NE2 1 
ATOM   1318 N N   . ARG A 1 171 ? -3.969  61.536 45.988 1.00 26.57  ? 174  ARG A N   1 
ATOM   1319 C CA  . ARG A 1 171 ? -3.910  61.183 44.572 1.00 25.92  ? 174  ARG A CA  1 
ATOM   1320 C C   . ARG A 1 171 ? -5.006  61.872 43.768 1.00 26.45  ? 174  ARG A C   1 
ATOM   1321 O O   . ARG A 1 171 ? -4.743  62.378 42.680 1.00 28.22  ? 174  ARG A O   1 
ATOM   1322 C CB  . ARG A 1 171 ? -4.008  59.670 44.400 1.00 23.10  ? 174  ARG A CB  1 
ATOM   1323 C CG  . ARG A 1 171 ? -4.054  59.232 42.957 1.00 24.90  ? 174  ARG A CG  1 
ATOM   1324 C CD  . ARG A 1 171 ? -4.306  57.757 42.850 1.00 23.60  ? 174  ARG A CD  1 
ATOM   1325 N NE  . ARG A 1 171 ? -3.125  56.982 43.204 1.00 21.79  ? 174  ARG A NE  1 
ATOM   1326 C CZ  . ARG A 1 171 ? -3.126  55.663 43.378 1.00 25.91  ? 174  ARG A CZ  1 
ATOM   1327 N NH1 . ARG A 1 171 ? -4.250  54.970 43.242 1.00 23.89  ? 174  ARG A NH1 1 
ATOM   1328 N NH2 . ARG A 1 171 ? -1.990  55.024 43.615 1.00 27.75  ? 174  ARG A NH2 1 
ATOM   1329 N N   . MET A 1 172 ? -6.220  61.914 44.314 1.00 25.25  ? 175  MET A N   1 
ATOM   1330 C CA  . MET A 1 172 ? -7.334  62.550 43.631 1.00 24.86  ? 175  MET A CA  1 
ATOM   1331 C C   . MET A 1 172 ? -7.091  64.039 43.496 1.00 25.99  ? 175  MET A C   1 
ATOM   1332 O O   . MET A 1 172 ? -7.406  64.628 42.468 1.00 26.12  ? 175  MET A O   1 
ATOM   1333 C CB  . MET A 1 172 ? -8.651  62.294 44.350 1.00 24.88  ? 175  MET A CB  1 
ATOM   1334 C CG  . MET A 1 172 ? -9.856  62.708 43.513 1.00 28.54  ? 175  MET A CG  1 
ATOM   1335 S SD  . MET A 1 172 ? -11.385 61.963 44.051 1.00 35.31  ? 175  MET A SD  1 
ATOM   1336 C CE  . MET A 1 172 ? -11.218 60.333 43.353 1.00 30.43  ? 175  MET A CE  1 
ATOM   1337 N N   . ALA A 1 173 ? -6.510  64.642 44.527 1.00 26.42  ? 176  ALA A N   1 
ATOM   1338 C CA  . ALA A 1 173 ? -6.202  66.061 44.496 1.00 24.13  ? 176  ALA A CA  1 
ATOM   1339 C C   . ALA A 1 173 ? -5.156  66.274 43.407 1.00 25.54  ? 176  ALA A C   1 
ATOM   1340 O O   . ALA A 1 173 ? -5.230  67.232 42.641 1.00 26.41  ? 176  ALA A O   1 
ATOM   1341 C CB  . ALA A 1 173 ? -5.671  66.512 45.841 1.00 25.49  ? 176  ALA A CB  1 
ATOM   1342 N N   . LEU A 1 174 ? -4.196  65.355 43.324 1.00 25.48  ? 177  LEU A N   1 
ATOM   1343 C CA  . LEU A 1 174 ? -3.147  65.429 42.310 1.00 25.25  ? 177  LEU A CA  1 
ATOM   1344 C C   . LEU A 1 174 ? -3.762  65.259 40.915 1.00 26.55  ? 177  LEU A C   1 
ATOM   1345 O O   . LEU A 1 174 ? -3.316  65.881 39.948 1.00 24.52  ? 177  LEU A O   1 
ATOM   1346 C CB  . LEU A 1 174 ? -2.098  64.343 42.541 1.00 22.75  ? 177  LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 174 ? -1.199  64.444 43.765 1.00 22.88  ? 177  LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 174 ? -0.189  63.311 43.709 1.00 21.86  ? 177  LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 174 ? -0.495  65.803 43.793 1.00 22.70  ? 177  LEU A CD2 1 
ATOM   1350 N N   . GLN A 1 175 ? -4.797  64.424 40.830 1.00 27.62  ? 178  GLN A N   1 
ATOM   1351 C CA  . GLN A 1 175 ? -5.499  64.172 39.571 1.00 28.72  ? 178  GLN A CA  1 
ATOM   1352 C C   . GLN A 1 175 ? -6.220  65.447 39.140 1.00 28.00  ? 178  GLN A C   1 
ATOM   1353 O O   . GLN A 1 175 ? -6.158  65.829 37.974 1.00 31.10  ? 178  GLN A O   1 
ATOM   1354 C CB  . GLN A 1 175 ? -6.513  63.032 39.735 1.00 28.04  ? 178  GLN A CB  1 
ATOM   1355 C CG  . GLN A 1 175 ? -7.265  62.648 38.462 1.00 25.17  ? 178  GLN A CG  1 
ATOM   1356 C CD  . GLN A 1 175 ? -6.342  62.140 37.374 1.00 27.34  ? 178  GLN A CD  1 
ATOM   1357 O OE1 . GLN A 1 175 ? -5.801  61.039 37.467 1.00 28.14  ? 178  GLN A OE1 1 
ATOM   1358 N NE2 . GLN A 1 175 ? -6.136  62.954 36.345 1.00 28.91  ? 178  GLN A NE2 1 
ATOM   1359 N N   . TRP A 1 176 ? -6.849  66.125 40.099 1.00 23.88  ? 179  TRP A N   1 
ATOM   1360 C CA  . TRP A 1 176 ? -7.571  67.354 39.818 1.00 23.67  ? 179  TRP A CA  1 
ATOM   1361 C C   . TRP A 1 176 ? -6.608  68.448 39.368 1.00 24.50  ? 179  TRP A C   1 
ATOM   1362 O O   . TRP A 1 176 ? -6.950  69.261 38.518 1.00 27.09  ? 179  TRP A O   1 
ATOM   1363 C CB  . TRP A 1 176 ? -8.373  67.800 41.044 1.00 24.75  ? 179  TRP A CB  1 
ATOM   1364 C CG  . TRP A 1 176 ? -9.407  68.861 40.756 1.00 24.78  ? 179  TRP A CG  1 
ATOM   1365 C CD1 . TRP A 1 176 ? -10.742 68.668 40.530 1.00 21.56  ? 179  TRP A CD1 1 
ATOM   1366 C CD2 . TRP A 1 176 ? -9.186  70.277 40.665 1.00 22.95  ? 179  TRP A CD2 1 
ATOM   1367 N NE1 . TRP A 1 176 ? -11.363 69.872 40.304 1.00 22.60  ? 179  TRP A NE1 1 
ATOM   1368 C CE2 . TRP A 1 176 ? -10.432 70.876 40.379 1.00 22.19  ? 179  TRP A CE2 1 
ATOM   1369 C CE3 . TRP A 1 176 ? -8.057  71.095 40.795 1.00 22.23  ? 179  TRP A CE3 1 
ATOM   1370 C CZ2 . TRP A 1 176 ? -10.582 72.256 40.221 1.00 23.06  ? 179  TRP A CZ2 1 
ATOM   1371 C CZ3 . TRP A 1 176 ? -8.205  72.469 40.636 1.00 22.77  ? 179  TRP A CZ3 1 
ATOM   1372 C CH2 . TRP A 1 176 ? -9.458  73.033 40.352 1.00 25.47  ? 179  TRP A CH2 1 
ATOM   1373 N N   . VAL A 1 177 ? -5.410  68.475 39.942 1.00 25.61  ? 180  VAL A N   1 
ATOM   1374 C CA  . VAL A 1 177 ? -4.400  69.461 39.556 1.00 27.15  ? 180  VAL A CA  1 
ATOM   1375 C C   . VAL A 1 177 ? -3.943  69.144 38.132 1.00 30.10  ? 180  VAL A C   1 
ATOM   1376 O O   . VAL A 1 177 ? -3.746  70.042 37.311 1.00 30.99  ? 180  VAL A O   1 
ATOM   1377 C CB  . VAL A 1 177 ? -3.178  69.418 40.511 1.00 26.39  ? 180  VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 177 ? -1.986  70.155 39.914 1.00 22.94  ? 180  VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 177 ? -3.548  70.040 41.837 1.00 25.17  ? 180  VAL A CG2 1 
ATOM   1380 N N   . HIS A 1 178 ? -3.810  67.853 37.843 1.00 29.68  ? 181  HIS A N   1 
ATOM   1381 C CA  . HIS A 1 178 ? -3.391  67.396 36.529 1.00 28.32  ? 181  HIS A CA  1 
ATOM   1382 C C   . HIS A 1 178 ? -4.379  67.868 35.475 1.00 27.91  ? 181  HIS A C   1 
ATOM   1383 O O   . HIS A 1 178 ? -3.988  68.416 34.453 1.00 26.39  ? 181  HIS A O   1 
ATOM   1384 C CB  . HIS A 1 178 ? -3.315  65.868 36.506 1.00 29.96  ? 181  HIS A CB  1 
ATOM   1385 C CG  . HIS A 1 178 ? -2.893  65.299 35.185 1.00 34.85  ? 181  HIS A CG  1 
ATOM   1386 N ND1 . HIS A 1 178 ? -3.795  64.778 34.279 1.00 36.84  ? 181  HIS A ND1 1 
ATOM   1387 C CD2 . HIS A 1 178 ? -1.670  65.156 34.622 1.00 32.81  ? 181  HIS A CD2 1 
ATOM   1388 C CE1 . HIS A 1 178 ? -3.143  64.340 33.215 1.00 34.18  ? 181  HIS A CE1 1 
ATOM   1389 N NE2 . HIS A 1 178 ? -1.853  64.557 33.398 1.00 33.91  ? 181  HIS A NE2 1 
ATOM   1390 N N   . ASP A 1 179 ? -5.663  67.714 35.778 1.00 26.19  ? 182  ASP A N   1 
ATOM   1391 C CA  . ASP A 1 179 ? -6.727  68.081 34.860 1.00 26.27  ? 182  ASP A CA  1 
ATOM   1392 C C   . ASP A 1 179 ? -7.161  69.534 34.796 1.00 28.06  ? 182  ASP A C   1 
ATOM   1393 O O   . ASP A 1 179 ? -7.693  69.955 33.775 1.00 28.87  ? 182  ASP A O   1 
ATOM   1394 C CB  . ASP A 1 179 ? -7.951  67.225 35.142 1.00 22.44  ? 182  ASP A CB  1 
ATOM   1395 C CG  . ASP A 1 179 ? -7.647  65.755 35.088 1.00 26.52  ? 182  ASP A CG  1 
ATOM   1396 O OD1 . ASP A 1 179 ? -6.711  65.351 34.364 1.00 32.01  ? 182  ASP A OD1 1 
ATOM   1397 O OD2 . ASP A 1 179 ? -8.339  64.993 35.779 1.00 28.31  ? 182  ASP A OD2 1 
ATOM   1398 N N   . ASN A 1 180 ? -6.902  70.314 35.840 1.00 27.87  ? 183  ASN A N   1 
ATOM   1399 C CA  . ASN A 1 180 ? -7.370  71.696 35.856 1.00 28.32  ? 183  ASN A CA  1 
ATOM   1400 C C   . ASN A 1 180 ? -6.381  72.824 36.099 1.00 28.89  ? 183  ASN A C   1 
ATOM   1401 O O   . ASN A 1 180 ? -6.684  73.980 35.796 1.00 30.65  ? 183  ASN A O   1 
ATOM   1402 C CB  . ASN A 1 180 ? -8.498  71.830 36.876 1.00 28.36  ? 183  ASN A CB  1 
ATOM   1403 C CG  . ASN A 1 180 ? -9.626  70.856 36.625 1.00 33.01  ? 183  ASN A CG  1 
ATOM   1404 O OD1 . ASN A 1 180 ? -10.545 71.137 35.857 1.00 32.34  ? 183  ASN A OD1 1 
ATOM   1405 N ND2 . ASN A 1 180 ? -9.563  69.700 37.271 1.00 31.01  ? 183  ASN A ND2 1 
ATOM   1406 N N   . ILE A 1 181 ? -5.211  72.514 36.645 1.00 28.83  ? 184  ILE A N   1 
ATOM   1407 C CA  . ILE A 1 181 ? -4.238  73.561 36.945 1.00 29.44  ? 184  ILE A CA  1 
ATOM   1408 C C   . ILE A 1 181 ? -3.870  74.441 35.748 1.00 31.09  ? 184  ILE A C   1 
ATOM   1409 O O   . ILE A 1 181 ? -3.407  75.570 35.919 1.00 33.07  ? 184  ILE A O   1 
ATOM   1410 C CB  . ILE A 1 181 ? -2.960  72.986 37.606 1.00 26.46  ? 184  ILE A CB  1 
ATOM   1411 C CG1 . ILE A 1 181 ? -2.355  74.019 38.559 1.00 23.59  ? 184  ILE A CG1 1 
ATOM   1412 C CG2 . ILE A 1 181 ? -1.943  72.581 36.551 1.00 24.09  ? 184  ILE A CG2 1 
ATOM   1413 C CD1 . ILE A 1 181 ? -3.290  74.419 39.682 1.00 23.90  ? 184  ILE A CD1 1 
ATOM   1414 N N   . GLN A 1 182 ? -4.102  73.939 34.540 1.00 32.11  ? 185  GLN A N   1 
ATOM   1415 C CA  . GLN A 1 182 ? -3.785  74.700 33.337 1.00 31.93  ? 185  GLN A CA  1 
ATOM   1416 C C   . GLN A 1 182 ? -4.646  75.955 33.282 1.00 32.67  ? 185  GLN A C   1 
ATOM   1417 O O   . GLN A 1 182 ? -4.196  77.007 32.835 1.00 33.82  ? 185  GLN A O   1 
ATOM   1418 C CB  . GLN A 1 182 ? -4.019  73.850 32.088 1.00 31.82  ? 185  GLN A CB  1 
ATOM   1419 C CG  . GLN A 1 182 ? -5.478  73.540 31.820 1.00 33.88  ? 185  GLN A CG  1 
ATOM   1420 C CD  . GLN A 1 182 ? -5.660  72.422 30.818 1.00 34.84  ? 185  GLN A CD  1 
ATOM   1421 O OE1 . GLN A 1 182 ? -5.358  71.266 31.111 1.00 37.59  ? 185  GLN A OE1 1 
ATOM   1422 N NE2 . GLN A 1 182 ? -6.169  72.754 29.635 1.00 33.54  ? 185  GLN A NE2 1 
ATOM   1423 N N   . PHE A 1 183 ? -5.869  75.849 33.791 1.00 31.41  ? 186  PHE A N   1 
ATOM   1424 C CA  . PHE A 1 183 ? -6.795  76.971 33.790 1.00 30.57  ? 186  PHE A CA  1 
ATOM   1425 C C   . PHE A 1 183 ? -6.398  78.090 34.746 1.00 31.68  ? 186  PHE A C   1 
ATOM   1426 O O   . PHE A 1 183 ? -6.931  79.195 34.659 1.00 33.09  ? 186  PHE A O   1 
ATOM   1427 C CB  . PHE A 1 183 ? -8.208  76.479 34.084 1.00 31.55  ? 186  PHE A CB  1 
ATOM   1428 C CG  . PHE A 1 183 ? -8.663  75.383 33.163 1.00 31.73  ? 186  PHE A CG  1 
ATOM   1429 C CD1 . PHE A 1 183 ? -8.608  75.550 31.784 1.00 30.95  ? 186  PHE A CD1 1 
ATOM   1430 C CD2 . PHE A 1 183 ? -9.119  74.173 33.674 1.00 32.69  ? 186  PHE A CD2 1 
ATOM   1431 C CE1 . PHE A 1 183 ? -9.001  74.528 30.927 1.00 31.05  ? 186  PHE A CE1 1 
ATOM   1432 C CE2 . PHE A 1 183 ? -9.516  73.141 32.828 1.00 32.28  ? 186  PHE A CE2 1 
ATOM   1433 C CZ  . PHE A 1 183 ? -9.455  73.316 31.451 1.00 31.47  ? 186  PHE A CZ  1 
ATOM   1434 N N   . PHE A 1 184 ? -5.470  77.805 35.657 1.00 31.17  ? 187  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 184 ? -5.000  78.810 36.610 1.00 30.14  ? 187  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 184 ? -3.643  79.321 36.163 1.00 30.95  ? 187  PHE A C   1 
ATOM   1437 O O   . PHE A 1 184 ? -3.022  80.143 36.835 1.00 31.13  ? 187  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 184 ? -4.898  78.221 38.015 1.00 28.23  ? 187  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 184 ? -6.191  77.690 38.537 1.00 26.63  ? 187  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 184 ? -6.631  76.423 38.173 1.00 26.77  ? 187  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 184 ? -6.983  78.463 39.373 1.00 28.06  ? 187  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 184 ? -7.840  75.933 38.632 1.00 27.14  ? 187  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 184 ? -8.195  77.984 39.840 1.00 26.87  ? 187  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 184 ? -8.627  76.717 39.469 1.00 28.96  ? 187  PHE A CZ  1 
ATOM   1445 N N   . GLY A 1 185 ? -3.190  78.822 35.017 1.00 31.74  ? 188  GLY A N   1 
ATOM   1446 C CA  . GLY A 1 185 ? -1.909  79.232 34.478 1.00 31.21  ? 188  GLY A CA  1 
ATOM   1447 C C   . GLY A 1 185 ? -0.793  78.280 34.841 1.00 32.35  ? 188  GLY A C   1 
ATOM   1448 O O   . GLY A 1 185 ? 0.381   78.550 34.580 1.00 33.72  ? 188  GLY A O   1 
ATOM   1449 N N   . GLY A 1 186 ? -1.156  77.170 35.469 1.00 31.90  ? 189  GLY A N   1 
ATOM   1450 C CA  . GLY A 1 186 ? -0.159  76.198 35.852 1.00 30.29  ? 189  GLY A CA  1 
ATOM   1451 C C   . GLY A 1 186 ? 0.118   75.198 34.753 1.00 30.69  ? 189  GLY A C   1 
ATOM   1452 O O   . GLY A 1 186 ? -0.765  74.854 33.971 1.00 32.49  ? 189  GLY A O   1 
ATOM   1453 N N   . ASP A 1 187 ? 1.359   74.739 34.697 1.00 29.03  ? 190  ASP A N   1 
ATOM   1454 C CA  . ASP A 1 187 ? 1.785   73.750 33.724 1.00 29.94  ? 190  ASP A CA  1 
ATOM   1455 C C   . ASP A 1 187 ? 1.665   72.364 34.363 1.00 31.40  ? 190  ASP A C   1 
ATOM   1456 O O   . ASP A 1 187 ? 2.491   71.979 35.190 1.00 34.57  ? 190  ASP A O   1 
ATOM   1457 C CB  . ASP A 1 187 ? 3.235   74.018 33.332 1.00 28.53  ? 190  ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 187 ? 3.811   72.942 32.436 1.00 31.69  ? 190  ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 187 ? 3.047   72.094 31.926 1.00 31.26  ? 190  ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 187 ? 5.043   72.953 32.237 1.00 35.14  ? 190  ASP A OD2 1 
ATOM   1461 N N   . PRO A 1 188 ? 0.664   71.576 33.945 1.00 31.49  ? 191  PRO A N   1 
ATOM   1462 C CA  . PRO A 1 188 ? 0.437   70.230 34.478 1.00 31.49  ? 191  PRO A CA  1 
ATOM   1463 C C   . PRO A 1 188 ? 1.579   69.253 34.208 1.00 31.60  ? 191  PRO A C   1 
ATOM   1464 O O   . PRO A 1 188 ? 1.674   68.203 34.846 1.00 32.56  ? 191  PRO A O   1 
ATOM   1465 C CB  . PRO A 1 188 ? -0.854  69.805 33.778 1.00 31.24  ? 191  PRO A CB  1 
ATOM   1466 C CG  . PRO A 1 188 ? -0.770  70.514 32.472 1.00 28.80  ? 191  PRO A CG  1 
ATOM   1467 C CD  . PRO A 1 188 ? -0.317  71.888 32.893 1.00 32.93  ? 191  PRO A CD  1 
ATOM   1468 N N   . LYS A 1 189 ? 2.438   69.604 33.259 1.00 30.55  ? 192  LYS A N   1 
ATOM   1469 C CA  . LYS A 1 189 ? 3.575   68.768 32.908 1.00 30.81  ? 192  LYS A CA  1 
ATOM   1470 C C   . LYS A 1 189 ? 4.745   69.035 33.847 1.00 30.86  ? 192  LYS A C   1 
ATOM   1471 O O   . LYS A 1 189 ? 5.733   68.305 33.845 1.00 30.86  ? 192  LYS A O   1 
ATOM   1472 C CB  . LYS A 1 189 ? 3.998   69.036 31.463 1.00 29.88  ? 192  LYS A CB  1 
ATOM   1473 N N   . THR A 1 190 ? 4.632   70.081 34.656 1.00 29.31  ? 193  THR A N   1 
ATOM   1474 C CA  . THR A 1 190 ? 5.700   70.416 35.583 1.00 30.47  ? 193  THR A CA  1 
ATOM   1475 C C   . THR A 1 190 ? 5.160   70.635 36.988 1.00 28.68  ? 193  THR A C   1 
ATOM   1476 O O   . THR A 1 190 ? 5.181   71.745 37.517 1.00 28.57  ? 193  THR A O   1 
ATOM   1477 C CB  . THR A 1 190 ? 6.482   71.641 35.092 1.00 30.76  ? 193  THR A CB  1 
ATOM   1478 O OG1 . THR A 1 190 ? 6.872   71.417 33.734 1.00 37.90  ? 193  THR A OG1 1 
ATOM   1479 C CG2 . THR A 1 190 ? 7.741   71.848 35.909 1.00 26.21  ? 193  THR A CG2 1 
ATOM   1480 N N   . VAL A 1 191 ? 4.656   69.555 37.573 1.00 27.80  ? 194  VAL A N   1 
ATOM   1481 C CA  . VAL A 1 191 ? 4.107   69.574 38.919 1.00 26.80  ? 194  VAL A CA  1 
ATOM   1482 C C   . VAL A 1 191 ? 5.061   68.871 39.868 1.00 28.42  ? 194  VAL A C   1 
ATOM   1483 O O   . VAL A 1 191 ? 5.428   67.715 39.655 1.00 29.05  ? 194  VAL A O   1 
ATOM   1484 C CB  . VAL A 1 191 ? 2.747   68.852 38.994 1.00 25.18  ? 194  VAL A CB  1 
ATOM   1485 C CG1 . VAL A 1 191 ? 2.272   68.768 40.429 1.00 22.52  ? 194  VAL A CG1 1 
ATOM   1486 C CG2 . VAL A 1 191 ? 1.719   69.583 38.160 1.00 26.14  ? 194  VAL A CG2 1 
ATOM   1487 N N   . THR A 1 192 ? 5.510   69.597 40.882 1.00 27.10  ? 195  THR A N   1 
ATOM   1488 C CA  . THR A 1 192 ? 6.385   69.022 41.888 1.00 26.98  ? 195  THR A CA  1 
ATOM   1489 C C   . THR A 1 192 ? 5.568   68.832 43.156 1.00 28.27  ? 195  THR A C   1 
ATOM   1490 O O   . THR A 1 192 ? 4.926   69.774 43.629 1.00 28.39  ? 195  THR A O   1 
ATOM   1491 C CB  . THR A 1 192 ? 7.574   69.939 42.216 1.00 24.48  ? 195  THR A CB  1 
ATOM   1492 O OG1 . THR A 1 192 ? 8.484   69.949 41.116 1.00 27.34  ? 195  THR A OG1 1 
ATOM   1493 C CG2 . THR A 1 192 ? 8.312   69.445 43.462 1.00 23.15  ? 195  THR A CG2 1 
ATOM   1494 N N   . ILE A 1 193 ? 5.499   67.603 43.653 1.00 25.72  ? 196  ILE A N   1 
ATOM   1495 C CA  . ILE A 1 193 ? 4.786   67.384 44.898 1.00 23.93  ? 196  ILE A CA  1 
ATOM   1496 C C   . ILE A 1 193 ? 5.829   67.469 46.013 1.00 24.75  ? 196  ILE A C   1 
ATOM   1497 O O   . ILE A 1 193 ? 6.952   66.983 45.863 1.00 25.79  ? 196  ILE A O   1 
ATOM   1498 C CB  . ILE A 1 193 ? 4.038   66.039 44.920 1.00 22.93  ? 196  ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 193 ? 5.003   64.867 44.731 1.00 20.10  ? 196  ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 193 ? 2.953   66.046 43.853 1.00 20.51  ? 196  ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 193 ? 4.356   63.521 44.952 1.00 16.83  ? 196  ILE A CD1 1 
ATOM   1502 N N   . PHE A 1 194 ? 5.518   68.223 47.060 1.00 24.26  ? 197  PHE A N   1 
ATOM   1503 C CA  . PHE A 1 194 ? 6.439   68.350 48.177 1.00 26.14  ? 197  PHE A CA  1 
ATOM   1504 C C   . PHE A 1 194 ? 5.697   68.313 49.501 1.00 26.00  ? 197  PHE A C   1 
ATOM   1505 O O   . PHE A 1 194 ? 4.573   68.797 49.606 1.00 27.86  ? 197  PHE A O   1 
ATOM   1506 C CB  . PHE A 1 194 ? 7.353   69.589 48.038 1.00 26.48  ? 197  PHE A CB  1 
ATOM   1507 C CG  . PHE A 1 194 ? 6.669   70.918 48.245 1.00 24.10  ? 197  PHE A CG  1 
ATOM   1508 C CD1 . PHE A 1 194 ? 5.474   71.229 47.603 1.00 24.60  ? 197  PHE A CD1 1 
ATOM   1509 C CD2 . PHE A 1 194 ? 7.258   71.880 49.067 1.00 24.72  ? 197  PHE A CD2 1 
ATOM   1510 C CE1 . PHE A 1 194 ? 4.877   72.481 47.779 1.00 24.42  ? 197  PHE A CE1 1 
ATOM   1511 C CE2 . PHE A 1 194 ? 6.668   73.136 49.249 1.00 24.95  ? 197  PHE A CE2 1 
ATOM   1512 C CZ  . PHE A 1 194 ? 5.472   73.436 48.602 1.00 24.50  ? 197  PHE A CZ  1 
ATOM   1513 N N   . GLY A 1 195 ? 6.305   67.669 50.490 1.00 26.16  ? 198  GLY A N   1 
ATOM   1514 C CA  . GLY A 1 195 ? 5.672   67.554 51.791 1.00 25.80  ? 198  GLY A CA  1 
ATOM   1515 C C   . GLY A 1 195 ? 6.676   67.315 52.893 1.00 25.52  ? 198  GLY A C   1 
ATOM   1516 O O   . GLY A 1 195 ? 7.827   66.964 52.631 1.00 24.42  ? 198  GLY A O   1 
ATOM   1517 N N   . GLU A 1 196 ? 6.223   67.481 54.131 1.00 24.73  ? 199  GLU A N   1 
ATOM   1518 C CA  . GLU A 1 196 ? 7.082   67.311 55.294 1.00 25.52  ? 199  GLU A CA  1 
ATOM   1519 C C   . GLU A 1 196 ? 6.542   66.243 56.242 1.00 25.11  ? 199  GLU A C   1 
ATOM   1520 O O   . GLU A 1 196 ? 5.328   66.123 56.416 1.00 26.03  ? 199  GLU A O   1 
ATOM   1521 C CB  . GLU A 1 196 ? 7.215   68.656 56.011 1.00 25.14  ? 199  GLU A CB  1 
ATOM   1522 C CG  . GLU A 1 196 ? 8.291   68.719 57.081 1.00 25.82  ? 199  GLU A CG  1 
ATOM   1523 C CD  . GLU A 1 196 ? 7.773   68.403 58.472 1.00 27.18  ? 199  GLU A CD  1 
ATOM   1524 O OE1 . GLU A 1 196 ? 6.548   68.457 58.691 1.00 25.46  ? 199  GLU A OE1 1 
ATOM   1525 O OE2 . GLU A 1 196 ? 8.599   68.107 59.355 1.00 27.59  ? 199  GLU A OE2 1 
ATOM   1526 N N   . SER A 1 197 ? 7.444   65.460 56.835 1.00 24.62  ? 200  SER A N   1 
ATOM   1527 C CA  . SER A 1 197 ? 7.066   64.407 57.771 1.00 22.74  ? 200  SER A CA  1 
ATOM   1528 C C   . SER A 1 197 ? 6.211   63.344 57.070 1.00 23.89  ? 200  SER A C   1 
ATOM   1529 O O   . SER A 1 197 ? 6.684   62.716 56.126 1.00 26.76  ? 200  SER A O   1 
ATOM   1530 C CB  . SER A 1 197 ? 6.330   65.026 58.957 1.00 22.81  ? 200  SER A CB  1 
ATOM   1531 O OG  . SER A 1 197 ? 6.828   64.306 60.038 1.00 25.00  ? 200  SER A OG  1 
ATOM   1532 N N   . ALA A 1 198 ? 4.961   63.153 57.504 1.00 22.66  ? 201  ALA A N   1 
ATOM   1533 C CA  . ALA A 1 198 ? 4.059   62.179 56.881 1.00 21.65  ? 201  ALA A CA  1 
ATOM   1534 C C   . ALA A 1 198 ? 3.777   62.609 55.431 1.00 22.44  ? 201  ALA A C   1 
ATOM   1535 O O   . ALA A 1 198 ? 3.431   61.782 54.584 1.00 21.83  ? 201  ALA A O   1 
ATOM   1536 C CB  . ALA A 1 198 ? 2.749   62.066 57.676 1.00 16.15  ? 201  ALA A CB  1 
ATOM   1537 N N   . GLY A 1 199 ? 3.916   63.913 55.174 1.00 21.62  ? 202  GLY A N   1 
ATOM   1538 C CA  . GLY A 1 199 ? 3.720   64.457 53.844 1.00 20.90  ? 202  GLY A CA  1 
ATOM   1539 C C   . GLY A 1 199 ? 4.908   64.092 52.974 1.00 23.86  ? 202  GLY A C   1 
ATOM   1540 O O   . GLY A 1 199 ? 4.758   63.878 51.770 1.00 24.71  ? 202  GLY A O   1 
ATOM   1541 N N   . GLY A 1 200 ? 6.095   64.051 53.583 1.00 23.44  ? 203  GLY A N   1 
ATOM   1542 C CA  . GLY A 1 200 ? 7.301   63.668 52.870 1.00 22.88  ? 203  GLY A CA  1 
ATOM   1543 C C   . GLY A 1 200 ? 7.239   62.178 52.589 1.00 24.91  ? 203  GLY A C   1 
ATOM   1544 O O   . GLY A 1 200 ? 7.623   61.718 51.512 1.00 27.00  ? 203  GLY A O   1 
ATOM   1545 N N   . ALA A 1 201 ? 6.737   61.418 53.561 1.00 23.79  ? 204  ALA A N   1 
ATOM   1546 C CA  . ALA A 1 201 ? 6.587   59.975 53.415 1.00 22.14  ? 204  ALA A CA  1 
ATOM   1547 C C   . ALA A 1 201 ? 5.606   59.735 52.271 1.00 21.24  ? 204  ALA A C   1 
ATOM   1548 O O   . ALA A 1 201 ? 5.844   58.897 51.399 1.00 22.26  ? 204  ALA A O   1 
ATOM   1549 C CB  . ALA A 1 201 ? 6.055   59.362 54.710 1.00 19.68  ? 204  ALA A CB  1 
ATOM   1550 N N   . SER A 1 202 ? 4.515   60.499 52.282 1.00 19.48  ? 205  SER A N   1 
ATOM   1551 C CA  . SER A 1 202 ? 3.474   60.420 51.262 1.00 20.53  ? 205  SER A CA  1 
ATOM   1552 C C   . SER A 1 202 ? 4.055   60.657 49.869 1.00 23.46  ? 205  SER A C   1 
ATOM   1553 O O   . SER A 1 202 ? 3.735   59.925 48.928 1.00 26.12  ? 205  SER A O   1 
ATOM   1554 C CB  . SER A 1 202 ? 2.381   61.458 51.539 1.00 18.39  ? 205  SER A CB  1 
ATOM   1555 O OG  . SER A 1 202 ? 1.592   61.090 52.650 1.00 19.54  ? 205  SER A OG  1 
ATOM   1556 N N   . VAL A 1 203 ? 4.901   61.680 49.750 1.00 22.43  ? 206  VAL A N   1 
ATOM   1557 C CA  . VAL A 1 203 ? 5.536   62.015 48.482 1.00 23.21  ? 206  VAL A CA  1 
ATOM   1558 C C   . VAL A 1 203 ? 6.292   60.802 47.945 1.00 24.73  ? 206  VAL A C   1 
ATOM   1559 O O   . VAL A 1 203 ? 6.146   60.439 46.773 1.00 26.37  ? 206  VAL A O   1 
ATOM   1560 C CB  . VAL A 1 203 ? 6.478   63.236 48.632 1.00 22.88  ? 206  VAL A CB  1 
ATOM   1561 C CG1 . VAL A 1 203 ? 7.395   63.361 47.439 1.00 22.10  ? 206  VAL A CG1 1 
ATOM   1562 C CG2 . VAL A 1 203 ? 5.652   64.508 48.765 1.00 21.11  ? 206  VAL A CG2 1 
ATOM   1563 N N   . GLY A 1 204 ? 7.057   60.153 48.819 1.00 23.14  ? 207  GLY A N   1 
ATOM   1564 C CA  . GLY A 1 204 ? 7.803   58.973 48.421 1.00 22.14  ? 207  GLY A CA  1 
ATOM   1565 C C   . GLY A 1 204 ? 6.876   57.810 48.105 1.00 22.15  ? 207  GLY A C   1 
ATOM   1566 O O   . GLY A 1 204 ? 7.199   56.961 47.278 1.00 21.83  ? 207  GLY A O   1 
ATOM   1567 N N   . MET A 1 205 ? 5.723   57.766 48.768 1.00 21.91  ? 208  MET A N   1 
ATOM   1568 C CA  . MET A 1 205 ? 4.754   56.704 48.543 1.00 21.89  ? 208  MET A CA  1 
ATOM   1569 C C   . MET A 1 205 ? 4.081   56.865 47.185 1.00 24.73  ? 208  MET A C   1 
ATOM   1570 O O   . MET A 1 205 ? 3.712   55.875 46.564 1.00 29.11  ? 208  MET A O   1 
ATOM   1571 C CB  . MET A 1 205 ? 3.729   56.660 49.666 1.00 18.99  ? 208  MET A CB  1 
ATOM   1572 C CG  . MET A 1 205 ? 4.318   56.200 50.991 1.00 22.05  ? 208  MET A CG  1 
ATOM   1573 S SD  . MET A 1 205 ? 3.157   56.234 52.345 1.00 25.69  ? 208  MET A SD  1 
ATOM   1574 C CE  . MET A 1 205 ? 4.033   55.229 53.522 1.00 18.25  ? 208  MET A CE  1 
ATOM   1575 N N   . HIS A 1 206 ? 3.939   58.105 46.718 1.00 23.92  ? 209  HIS A N   1 
ATOM   1576 C CA  . HIS A 1 206 ? 3.353   58.370 45.404 1.00 23.17  ? 209  HIS A CA  1 
ATOM   1577 C C   . HIS A 1 206 ? 4.382   58.061 44.320 1.00 24.22  ? 209  HIS A C   1 
ATOM   1578 O O   . HIS A 1 206 ? 4.031   57.697 43.194 1.00 26.73  ? 209  HIS A O   1 
ATOM   1579 C CB  . HIS A 1 206 ? 2.878   59.814 45.310 1.00 22.89  ? 209  HIS A CB  1 
ATOM   1580 C CG  . HIS A 1 206 ? 1.643   60.083 46.109 1.00 24.65  ? 209  HIS A CG  1 
ATOM   1581 N ND1 . HIS A 1 206 ? 0.488   59.344 45.958 1.00 22.66  ? 209  HIS A ND1 1 
ATOM   1582 C CD2 . HIS A 1 206 ? 1.387   60.988 47.084 1.00 21.92  ? 209  HIS A CD2 1 
ATOM   1583 C CE1 . HIS A 1 206 ? -0.429  59.783 46.801 1.00 21.96  ? 209  HIS A CE1 1 
ATOM   1584 N NE2 . HIS A 1 206 ? 0.090   60.779 47.495 1.00 24.13  ? 209  HIS A NE2 1 
ATOM   1585 N N   . ILE A 1 207 ? 5.657   58.216 44.671 1.00 23.08  ? 210  ILE A N   1 
ATOM   1586 C CA  . ILE A 1 207 ? 6.751   57.901 43.762 1.00 22.61  ? 210  ILE A CA  1 
ATOM   1587 C C   . ILE A 1 207 ? 6.742   56.387 43.572 1.00 22.49  ? 210  ILE A C   1 
ATOM   1588 O O   . ILE A 1 207 ? 6.980   55.887 42.478 1.00 24.57  ? 210  ILE A O   1 
ATOM   1589 C CB  . ILE A 1 207 ? 8.113   58.303 44.359 1.00 21.27  ? 210  ILE A CB  1 
ATOM   1590 C CG1 . ILE A 1 207 ? 8.298   59.811 44.290 1.00 21.13  ? 210  ILE A CG1 1 
ATOM   1591 C CG2 . ILE A 1 207 ? 9.255   57.623 43.628 1.00 20.60  ? 210  ILE A CG2 1 
ATOM   1592 C CD1 . ILE A 1 207 ? 9.589   60.257 44.914 1.00 21.09  ? 210  ILE A CD1 1 
ATOM   1593 N N   . LEU A 1 208 ? 6.451   55.665 44.649 1.00 23.15  ? 211  LEU A N   1 
ATOM   1594 C CA  . LEU A 1 208 ? 6.409   54.209 44.619 1.00 24.72  ? 211  LEU A CA  1 
ATOM   1595 C C   . LEU A 1 208 ? 5.158   53.642 43.946 1.00 26.27  ? 211  LEU A C   1 
ATOM   1596 O O   . LEU A 1 208 ? 5.256   52.791 43.066 1.00 29.00  ? 211  LEU A O   1 
ATOM   1597 C CB  . LEU A 1 208 ? 6.505   53.652 46.038 1.00 26.86  ? 211  LEU A CB  1 
ATOM   1598 C CG  . LEU A 1 208 ? 7.855   53.713 46.756 1.00 30.12  ? 211  LEU A CG  1 
ATOM   1599 C CD1 . LEU A 1 208 ? 7.659   53.285 48.196 1.00 30.75  ? 211  LEU A CD1 1 
ATOM   1600 C CD2 . LEU A 1 208 ? 8.862   52.802 46.069 1.00 30.89  ? 211  LEU A CD2 1 
ATOM   1601 N N   . SER A 1 209 ? 3.990   54.118 44.362 1.00 26.29  ? 212  SER A N   1 
ATOM   1602 C CA  . SER A 1 209 ? 2.718   53.642 43.832 1.00 25.68  ? 212  SER A CA  1 
ATOM   1603 C C   . SER A 1 209 ? 2.492   53.960 42.362 1.00 27.48  ? 212  SER A C   1 
ATOM   1604 O O   . SER A 1 209 ? 2.418   55.132 41.974 1.00 27.30  ? 212  SER A O   1 
ATOM   1605 C CB  . SER A 1 209 ? 1.564   54.215 44.641 1.00 24.35  ? 212  SER A CB  1 
ATOM   1606 O OG  . SER A 1 209 ? 0.332   53.695 44.181 1.00 23.32  ? 212  SER A OG  1 
ATOM   1607 N N   . PRO A 1 210 ? 2.323   52.907 41.535 1.00 30.21  ? 213  PRO A N   1 
ATOM   1608 C CA  . PRO A 1 210 ? 2.090   52.982 40.084 1.00 28.81  ? 213  PRO A CA  1 
ATOM   1609 C C   . PRO A 1 210 ? 0.920   53.891 39.740 1.00 27.12  ? 213  PRO A C   1 
ATOM   1610 O O   . PRO A 1 210 ? 0.980   54.668 38.785 1.00 27.96  ? 213  PRO A O   1 
ATOM   1611 C CB  . PRO A 1 210 ? 1.773   51.530 39.719 1.00 28.81  ? 213  PRO A CB  1 
ATOM   1612 C CG  . PRO A 1 210 ? 2.598   50.749 40.699 1.00 28.87  ? 213  PRO A CG  1 
ATOM   1613 C CD  . PRO A 1 210 ? 2.346   51.501 41.987 1.00 28.83  ? 213  PRO A CD  1 
ATOM   1614 N N   . GLY A 1 211 ? -0.132  53.808 40.549 1.00 26.32  ? 214  GLY A N   1 
ATOM   1615 C CA  . GLY A 1 211 ? -1.312  54.620 40.323 1.00 24.74  ? 214  GLY A CA  1 
ATOM   1616 C C   . GLY A 1 211 ? -1.136  56.103 40.571 1.00 26.71  ? 214  GLY A C   1 
ATOM   1617 O O   . GLY A 1 211 ? -2.045  56.878 40.294 1.00 30.41  ? 214  GLY A O   1 
ATOM   1618 N N   . SER A 1 212 ? 0.027   56.514 41.070 1.00 26.26  ? 215  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 0.264   57.928 41.349 1.00 25.35  ? 215  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 1.374   58.538 40.511 1.00 24.79  ? 215  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 1.355   59.733 40.238 1.00 24.99  ? 215  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 0.603   58.126 42.829 1.00 21.19  ? 215  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? -0.410  57.602 43.658 1.00 22.68  ? 215  SER A OG  1 
ATOM   1624 N N   . ARG A 1 213 ? 2.332   57.709 40.110 1.00 24.97  ? 216  ARG A N   1 
ATOM   1625 C CA  . ARG A 1 213 ? 3.493   58.148 39.337 1.00 27.99  ? 216  ARG A CA  1 
ATOM   1626 C C   . ARG A 1 213 ? 3.266   59.132 38.201 1.00 29.43  ? 216  ARG A C   1 
ATOM   1627 O O   . ARG A 1 213 ? 4.022   60.088 38.040 1.00 31.51  ? 216  ARG A O   1 
ATOM   1628 C CB  . ARG A 1 213 ? 4.229   56.944 38.761 1.00 28.76  ? 216  ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 213 ? 4.719   55.974 39.783 1.00 30.82  ? 216  ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 213 ? 5.403   54.811 39.119 1.00 27.69  ? 216  ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 213 ? 5.547   53.717 40.067 1.00 29.56  ? 216  ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 213 ? 6.038   52.522 39.769 1.00 29.20  ? 216  ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 213 ? 6.450   52.257 38.539 1.00 29.38  ? 216  ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 213 ? 6.076   51.578 40.698 1.00 30.21  ? 216  ARG A NH2 1 
ATOM   1635 N N   . ASP A 1 214 ? 2.257   58.871 37.382 1.00 30.13  ? 217  ASP A N   1 
ATOM   1636 C CA  . ASP A 1 214 ? 1.983   59.722 36.224 1.00 30.53  ? 217  ASP A CA  1 
ATOM   1637 C C   . ASP A 1 214 ? 1.394   61.080 36.558 1.00 30.62  ? 217  ASP A C   1 
ATOM   1638 O O   . ASP A 1 214 ? 1.367   61.960 35.698 1.00 34.74  ? 217  ASP A O   1 
ATOM   1639 C CB  . ASP A 1 214 ? 1.058   59.005 35.235 1.00 27.77  ? 217  ASP A CB  1 
ATOM   1640 C CG  . ASP A 1 214 ? 1.546   57.606 34.859 1.00 29.77  ? 217  ASP A CG  1 
ATOM   1641 O OD1 . ASP A 1 214 ? 2.686   57.223 35.194 1.00 27.71  ? 217  ASP A OD1 1 
ATOM   1642 O OD2 . ASP A 1 214 ? 0.767   56.874 34.220 1.00 31.25  ? 217  ASP A OD2 1 
ATOM   1643 N N   . LEU A 1 215 ? 0.952   61.265 37.800 1.00 29.25  ? 218  LEU A N   1 
ATOM   1644 C CA  . LEU A 1 215 ? 0.328   62.520 38.214 1.00 26.81  ? 218  LEU A CA  1 
ATOM   1645 C C   . LEU A 1 215 ? 1.251   63.679 38.590 1.00 27.56  ? 218  LEU A C   1 
ATOM   1646 O O   . LEU A 1 215 ? 0.767   64.762 38.928 1.00 27.49  ? 218  LEU A O   1 
ATOM   1647 C CB  . LEU A 1 215 ? -0.666  62.267 39.349 1.00 27.18  ? 218  LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 215 ? -1.762  61.235 39.075 1.00 28.18  ? 218  LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 215 ? -2.665  61.103 40.294 1.00 25.84  ? 218  LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 215 ? -2.565  61.646 37.853 1.00 26.67  ? 218  LEU A CD2 1 
ATOM   1651 N N   . PHE A 1 216 ? 2.566   63.477 38.523 1.00 24.38  ? 219  PHE A N   1 
ATOM   1652 C CA  . PHE A 1 216 ? 3.495   64.546 38.872 1.00 22.08  ? 219  PHE A CA  1 
ATOM   1653 C C   . PHE A 1 216 ? 4.829   64.368 38.182 1.00 22.09  ? 219  PHE A C   1 
ATOM   1654 O O   . PHE A 1 216 ? 5.160   63.279 37.726 1.00 23.87  ? 219  PHE A O   1 
ATOM   1655 C CB  . PHE A 1 216 ? 3.684   64.632 40.392 1.00 21.84  ? 219  PHE A CB  1 
ATOM   1656 C CG  . PHE A 1 216 ? 4.319   63.409 40.997 1.00 21.86  ? 219  PHE A CG  1 
ATOM   1657 C CD1 . PHE A 1 216 ? 3.563   62.261 41.231 1.00 20.66  ? 219  PHE A CD1 1 
ATOM   1658 C CD2 . PHE A 1 216 ? 5.670   63.401 41.323 1.00 16.92  ? 219  PHE A CD2 1 
ATOM   1659 C CE1 . PHE A 1 216 ? 4.151   61.124 41.782 1.00 20.15  ? 219  PHE A CE1 1 
ATOM   1660 C CE2 . PHE A 1 216 ? 6.265   62.271 41.874 1.00 18.05  ? 219  PHE A CE2 1 
ATOM   1661 C CZ  . PHE A 1 216 ? 5.504   61.131 42.102 1.00 18.86  ? 219  PHE A CZ  1 
ATOM   1662 N N   . ARG A 1 217 ? 5.607   65.441 38.153 1.00 21.47  ? 220  ARG A N   1 
ATOM   1663 C CA  . ARG A 1 217 ? 6.909   65.459 37.499 1.00 23.65  ? 220  ARG A CA  1 
ATOM   1664 C C   . ARG A 1 217 ? 8.098   65.166 38.421 1.00 25.43  ? 220  ARG A C   1 
ATOM   1665 O O   . ARG A 1 217 ? 8.892   64.260 38.163 1.00 24.81  ? 220  ARG A O   1 
ATOM   1666 C CB  . ARG A 1 217 ? 7.091   66.829 36.834 1.00 25.13  ? 220  ARG A CB  1 
ATOM   1667 C CG  . ARG A 1 217 ? 8.408   67.058 36.117 1.00 28.36  ? 220  ARG A CG  1 
ATOM   1668 C CD  . ARG A 1 217 ? 8.514   66.167 34.911 1.00 33.62  ? 220  ARG A CD  1 
ATOM   1669 N NE  . ARG A 1 217 ? 9.587   66.577 34.010 1.00 37.83  ? 220  ARG A NE  1 
ATOM   1670 C CZ  . ARG A 1 217 ? 9.439   67.450 33.017 1.00 37.91  ? 220  ARG A CZ  1 
ATOM   1671 N NH1 . ARG A 1 217 ? 8.266   68.028 32.795 1.00 36.59  ? 220  ARG A NH1 1 
ATOM   1672 N NH2 . ARG A 1 217 ? 10.451  67.690 32.198 1.00 40.93  ? 220  ARG A NH2 1 
ATOM   1673 N N   . ARG A 1 218 ? 8.235   65.971 39.469 1.00 24.79  ? 221  ARG A N   1 
ATOM   1674 C CA  . ARG A 1 218 ? 9.336   65.841 40.414 1.00 22.27  ? 221  ARG A CA  1 
ATOM   1675 C C   . ARG A 1 218 ? 8.805   65.793 41.841 1.00 23.57  ? 221  ARG A C   1 
ATOM   1676 O O   . ARG A 1 218 ? 7.620   66.039 42.075 1.00 23.41  ? 221  ARG A O   1 
ATOM   1677 C CB  . ARG A 1 218 ? 10.279  67.032 40.262 1.00 22.18  ? 221  ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 218 ? 11.011  67.061 38.952 1.00 28.09  ? 221  ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 218 ? 12.009  68.189 38.908 1.00 27.93  ? 221  ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 218 ? 11.561  69.267 38.042 1.00 35.74  ? 221  ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 218 ? 11.595  69.231 36.712 1.00 34.91  ? 221  ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 218 ? 12.074  68.172 36.075 1.00 31.16  ? 221  ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 218 ? 11.074  70.232 36.018 1.00 37.50  ? 221  ARG A NH2 1 
ATOM   1684 N N   . ALA A 1 219 ? 9.700   65.551 42.798 1.00 24.53  ? 222  ALA A N   1 
ATOM   1685 C CA  . ALA A 1 219 ? 9.302   65.462 44.198 1.00 23.60  ? 222  ALA A CA  1 
ATOM   1686 C C   . ALA A 1 219 ? 10.326  65.993 45.201 1.00 24.28  ? 222  ALA A C   1 
ATOM   1687 O O   . ALA A 1 219 ? 11.538  65.935 44.973 1.00 24.02  ? 222  ALA A O   1 
ATOM   1688 C CB  . ALA A 1 219 ? 8.943   64.018 44.538 1.00 19.72  ? 222  ALA A CB  1 
ATOM   1689 N N   . ILE A 1 220 ? 9.798   66.533 46.299 1.00 26.39  ? 223  ILE A N   1 
ATOM   1690 C CA  . ILE A 1 220 ? 10.585  67.061 47.413 1.00 24.63  ? 223  ILE A CA  1 
ATOM   1691 C C   . ILE A 1 220 ? 10.093  66.393 48.702 1.00 23.53  ? 223  ILE A C   1 
ATOM   1692 O O   . ILE A 1 220 ? 8.894   66.397 49.000 1.00 22.46  ? 223  ILE A O   1 
ATOM   1693 C CB  . ILE A 1 220 ? 10.435  68.593 47.558 1.00 23.97  ? 223  ILE A CB  1 
ATOM   1694 C CG1 . ILE A 1 220 ? 10.978  69.295 46.311 1.00 24.58  ? 223  ILE A CG1 1 
ATOM   1695 C CG2 . ILE A 1 220 ? 11.161  69.085 48.818 1.00 20.93  ? 223  ILE A CG2 1 
ATOM   1696 C CD1 . ILE A 1 220 ? 10.827  70.796 46.338 1.00 24.72  ? 223  ILE A CD1 1 
ATOM   1697 N N   . LEU A 1 221 ? 11.017  65.777 49.432 1.00 22.29  ? 224  LEU A N   1 
ATOM   1698 C CA  . LEU A 1 221 ? 10.682  65.115 50.683 1.00 22.54  ? 224  LEU A CA  1 
ATOM   1699 C C   . LEU A 1 221 ? 11.459  65.750 51.832 1.00 21.82  ? 224  LEU A C   1 
ATOM   1700 O O   . LEU A 1 221 ? 12.690  65.753 51.844 1.00 20.16  ? 224  LEU A O   1 
ATOM   1701 C CB  . LEU A 1 221 ? 10.990  63.614 50.612 1.00 22.59  ? 224  LEU A CB  1 
ATOM   1702 C CG  . LEU A 1 221 ? 10.336  62.762 49.520 1.00 20.89  ? 224  LEU A CG  1 
ATOM   1703 C CD1 . LEU A 1 221 ? 11.123  62.901 48.216 1.00 20.62  ? 224  LEU A CD1 1 
ATOM   1704 C CD2 . LEU A 1 221 ? 10.321  61.309 49.963 1.00 17.81  ? 224  LEU A CD2 1 
ATOM   1705 N N   . GLN A 1 222 ? 10.723  66.305 52.788 1.00 23.75  ? 225  GLN A N   1 
ATOM   1706 C CA  . GLN A 1 222 ? 11.318  66.951 53.957 1.00 23.72  ? 225  GLN A CA  1 
ATOM   1707 C C   . GLN A 1 222 ? 11.037  66.118 55.212 1.00 25.09  ? 225  GLN A C   1 
ATOM   1708 O O   . GLN A 1 222 ? 9.875   65.895 55.565 1.00 22.99  ? 225  GLN A O   1 
ATOM   1709 C CB  . GLN A 1 222 ? 10.737  68.363 54.125 1.00 23.06  ? 225  GLN A CB  1 
ATOM   1710 C CG  . GLN A 1 222 ? 11.027  69.314 52.960 1.00 22.87  ? 225  GLN A CG  1 
ATOM   1711 C CD  . GLN A 1 222 ? 10.195  70.590 53.000 1.00 24.61  ? 225  GLN A CD  1 
ATOM   1712 O OE1 . GLN A 1 222 ? 9.782   71.100 51.963 1.00 27.62  ? 225  GLN A OE1 1 
ATOM   1713 N NE2 . GLN A 1 222 ? 9.942   71.105 54.195 1.00 25.43  ? 225  GLN A NE2 1 
ATOM   1714 N N   . SER A 1 223 ? 12.100  65.607 55.836 1.00 24.69  ? 226  SER A N   1 
ATOM   1715 C CA  . SER A 1 223 ? 11.998  64.811 57.064 1.00 23.96  ? 226  SER A CA  1 
ATOM   1716 C C   . SER A 1 223 ? 10.936  63.722 56.974 1.00 24.58  ? 226  SER A C   1 
ATOM   1717 O O   . SER A 1 223 ? 10.136  63.544 57.892 1.00 28.77  ? 226  SER A O   1 
ATOM   1718 C CB  . SER A 1 223 ? 11.685  65.725 58.256 1.00 23.84  ? 226  SER A CB  1 
ATOM   1719 O OG  . SER A 1 223 ? 12.617  66.788 58.354 1.00 19.95  ? 226  SER A OG  1 
ATOM   1720 N N   . GLY A 1 224 ? 10.930  62.994 55.867 1.00 24.32  ? 227  GLY A N   1 
ATOM   1721 C CA  . GLY A 1 224 ? 9.949   61.944 55.684 1.00 21.30  ? 227  GLY A CA  1 
ATOM   1722 C C   . GLY A 1 224 ? 10.380  61.025 54.565 1.00 23.34  ? 227  GLY A C   1 
ATOM   1723 O O   . GLY A 1 224 ? 10.908  61.467 53.546 1.00 24.11  ? 227  GLY A O   1 
ATOM   1724 N N   . SER A 1 225 ? 10.113  59.741 54.753 1.00 23.45  ? 228  SER A N   1 
ATOM   1725 C CA  . SER A 1 225 ? 10.483  58.710 53.806 1.00 21.24  ? 228  SER A CA  1 
ATOM   1726 C C   . SER A 1 225 ? 9.360   57.699 53.794 1.00 23.40  ? 228  SER A C   1 
ATOM   1727 O O   . SER A 1 225 ? 8.763   57.433 54.832 1.00 24.21  ? 228  SER A O   1 
ATOM   1728 C CB  . SER A 1 225 ? 11.727  58.011 54.318 1.00 20.75  ? 228  SER A CB  1 
ATOM   1729 O OG  . SER A 1 225 ? 12.776  58.150 53.406 1.00 31.34  ? 228  SER A OG  1 
ATOM   1730 N N   . PRO A 1 226 ? 9.056   57.108 52.626 1.00 23.94  ? 229  PRO A N   1 
ATOM   1731 C CA  . PRO A 1 226 ? 7.972   56.117 52.597 1.00 24.75  ? 229  PRO A CA  1 
ATOM   1732 C C   . PRO A 1 226 ? 8.277   54.911 53.490 1.00 23.72  ? 229  PRO A C   1 
ATOM   1733 O O   . PRO A 1 226 ? 7.367   54.271 54.015 1.00 24.40  ? 229  PRO A O   1 
ATOM   1734 C CB  . PRO A 1 226 ? 7.904   55.729 51.118 1.00 26.14  ? 229  PRO A CB  1 
ATOM   1735 C CG  . PRO A 1 226 ? 9.324   55.987 50.624 1.00 24.59  ? 229  PRO A CG  1 
ATOM   1736 C CD  . PRO A 1 226 ? 9.642   57.295 51.287 1.00 22.26  ? 229  PRO A CD  1 
ATOM   1737 N N   . ASN A 1 227 ? 9.569   54.653 53.694 1.00 24.51  ? 230  ASN A N   1 
ATOM   1738 C CA  . ASN A 1 227 ? 10.043  53.539 54.506 1.00 21.86  ? 230  ASN A CA  1 
ATOM   1739 C C   . ASN A 1 227 ? 10.241  53.833 55.986 1.00 22.11  ? 230  ASN A C   1 
ATOM   1740 O O   . ASN A 1 227 ? 10.799  53.011 56.702 1.00 25.76  ? 230  ASN A O   1 
ATOM   1741 C CB  . ASN A 1 227 ? 11.337  52.969 53.925 1.00 21.21  ? 230  ASN A CB  1 
ATOM   1742 C CG  . ASN A 1 227 ? 12.436  54.001 53.824 1.00 23.51  ? 230  ASN A CG  1 
ATOM   1743 O OD1 . ASN A 1 227 ? 12.227  55.095 53.321 1.00 28.55  ? 230  ASN A OD1 1 
ATOM   1744 N ND2 . ASN A 1 227 ? 13.619  53.652 54.296 1.00 25.64  ? 230  ASN A ND2 1 
ATOM   1745 N N   . CYS A 1 228 ? 9.822   55.002 56.453 1.00 22.69  ? 231  CYS A N   1 
ATOM   1746 C CA  . CYS A 1 228 ? 9.967   55.309 57.873 1.00 23.40  ? 231  CYS A CA  1 
ATOM   1747 C C   . CYS A 1 228 ? 9.186   54.257 58.674 1.00 25.00  ? 231  CYS A C   1 
ATOM   1748 O O   . CYS A 1 228 ? 8.092   53.847 58.272 1.00 27.07  ? 231  CYS A O   1 
ATOM   1749 C CB  . CYS A 1 228 ? 9.462   56.724 58.169 1.00 21.91  ? 231  CYS A CB  1 
ATOM   1750 S SG  . CYS A 1 228 ? 10.599  58.007 57.613 1.00 25.12  ? 231  CYS A SG  1 
ATOM   1751 N N   . PRO A 1 229 ? 9.741   53.800 59.810 1.00 24.50  ? 232  PRO A N   1 
ATOM   1752 C CA  . PRO A 1 229 ? 9.112   52.786 60.668 1.00 22.64  ? 232  PRO A CA  1 
ATOM   1753 C C   . PRO A 1 229 ? 7.715   53.104 61.186 1.00 22.30  ? 232  PRO A C   1 
ATOM   1754 O O   . PRO A 1 229 ? 6.968   52.202 61.538 1.00 23.44  ? 232  PRO A O   1 
ATOM   1755 C CB  . PRO A 1 229 ? 10.128  52.610 61.803 1.00 22.74  ? 232  PRO A CB  1 
ATOM   1756 C CG  . PRO A 1 229 ? 10.829  53.918 61.855 1.00 23.10  ? 232  PRO A CG  1 
ATOM   1757 C CD  . PRO A 1 229 ? 11.008  54.268 60.403 1.00 22.00  ? 232  PRO A CD  1 
ATOM   1758 N N   . TRP A 1 230 ? 7.343   54.375 61.159 1.00 21.63  ? 233  TRP A N   1 
ATOM   1759 C CA  . TRP A 1 230 ? 6.035   54.814 61.635 1.00 21.50  ? 233  TRP A CA  1 
ATOM   1760 C C   . TRP A 1 230 ? 5.045   55.125 60.503 1.00 23.65  ? 233  TRP A C   1 
ATOM   1761 O O   . TRP A 1 230 ? 3.860   55.361 60.763 1.00 25.58  ? 233  TRP A O   1 
ATOM   1762 C CB  . TRP A 1 230 ? 6.221   56.074 62.485 1.00 18.08  ? 233  TRP A CB  1 
ATOM   1763 C CG  . TRP A 1 230 ? 7.030   57.118 61.777 1.00 16.01  ? 233  TRP A CG  1 
ATOM   1764 C CD1 . TRP A 1 230 ? 8.377   57.300 61.865 1.00 18.01  ? 233  TRP A CD1 1 
ATOM   1765 C CD2 . TRP A 1 230 ? 6.557   58.079 60.819 1.00 19.96  ? 233  TRP A CD2 1 
ATOM   1766 N NE1 . TRP A 1 230 ? 8.777   58.307 61.021 1.00 17.88  ? 233  TRP A NE1 1 
ATOM   1767 C CE2 . TRP A 1 230 ? 7.681   58.805 60.369 1.00 19.75  ? 233  TRP A CE2 1 
ATOM   1768 C CE3 . TRP A 1 230 ? 5.291   58.394 60.294 1.00 22.72  ? 233  TRP A CE3 1 
ATOM   1769 C CZ2 . TRP A 1 230 ? 7.580   59.829 59.419 1.00 19.04  ? 233  TRP A CZ2 1 
ATOM   1770 C CZ3 . TRP A 1 230 ? 5.194   59.414 59.345 1.00 19.71  ? 233  TRP A CZ3 1 
ATOM   1771 C CH2 . TRP A 1 230 ? 6.330   60.116 58.921 1.00 20.30  ? 233  TRP A CH2 1 
ATOM   1772 N N   . ALA A 1 231 ? 5.533   55.142 59.260 1.00 22.16  ? 234  ALA A N   1 
ATOM   1773 C CA  . ALA A 1 231 ? 4.709   55.487 58.101 1.00 21.26  ? 234  ALA A CA  1 
ATOM   1774 C C   . ALA A 1 231 ? 3.827   54.406 57.477 1.00 21.49  ? 234  ALA A C   1 
ATOM   1775 O O   . ALA A 1 231 ? 3.011   54.711 56.612 1.00 23.19  ? 234  ALA A O   1 
ATOM   1776 C CB  . ALA A 1 231 ? 5.566   56.151 57.033 1.00 20.88  ? 234  ALA A CB  1 
ATOM   1777 N N   . SER A 1 232 ? 3.988   53.151 57.883 1.00 22.01  ? 235  SER A N   1 
ATOM   1778 C CA  . SER A 1 232 ? 3.149   52.084 57.340 1.00 23.16  ? 235  SER A CA  1 
ATOM   1779 C C   . SER A 1 232 ? 3.097   50.869 58.246 1.00 25.69  ? 235  SER A C   1 
ATOM   1780 O O   . SER A 1 232 ? 3.947   50.700 59.121 1.00 24.79  ? 235  SER A O   1 
ATOM   1781 C CB  . SER A 1 232 ? 3.640   51.650 55.963 1.00 22.01  ? 235  SER A CB  1 
ATOM   1782 O OG  . SER A 1 232 ? 4.838   50.910 56.069 1.00 17.69  ? 235  SER A OG  1 
ATOM   1783 N N   . VAL A 1 233 ? 2.075   50.043 58.046 1.00 25.20  ? 236  VAL A N   1 
ATOM   1784 C CA  . VAL A 1 233 ? 1.900   48.815 58.813 1.00 25.13  ? 236  VAL A CA  1 
ATOM   1785 C C   . VAL A 1 233 ? 1.458   47.710 57.863 1.00 27.82  ? 236  VAL A C   1 
ATOM   1786 O O   . VAL A 1 233 ? 1.027   47.977 56.739 1.00 28.38  ? 236  VAL A O   1 
ATOM   1787 C CB  . VAL A 1 233 ? 0.845   48.954 59.938 1.00 23.63  ? 236  VAL A CB  1 
ATOM   1788 C CG1 . VAL A 1 233 ? 1.330   49.911 60.993 1.00 23.51  ? 236  VAL A CG1 1 
ATOM   1789 C CG2 . VAL A 1 233 ? -0.496  49.410 59.380 1.00 21.13  ? 236  VAL A CG2 1 
ATOM   1790 N N   . SER A 1 234 ? 1.621   46.467 58.296 1.00 26.65  ? 237  SER A N   1 
ATOM   1791 C CA  . SER A 1 234 ? 1.212   45.327 57.498 1.00 26.15  ? 237  SER A CA  1 
ATOM   1792 C C   . SER A 1 234 ? -0.311  45.302 57.511 1.00 26.56  ? 237  SER A C   1 
ATOM   1793 O O   . SER A 1 234 ? -0.936  45.963 58.344 1.00 27.77  ? 237  SER A O   1 
ATOM   1794 C CB  . SER A 1 234 ? 1.746   44.035 58.119 1.00 27.51  ? 237  SER A CB  1 
ATOM   1795 O OG  . SER A 1 234 ? 1.095   43.752 59.351 1.00 28.39  ? 237  SER A OG  1 
ATOM   1796 N N   . VAL A 1 235 ? -0.909  44.548 56.593 1.00 26.99  ? 238  VAL A N   1 
ATOM   1797 C CA  . VAL A 1 235 ? -2.363  44.445 56.544 1.00 27.43  ? 238  VAL A CA  1 
ATOM   1798 C C   . VAL A 1 235 ? -2.870  43.734 57.796 1.00 27.67  ? 238  VAL A C   1 
ATOM   1799 O O   . VAL A 1 235 ? -3.960  44.026 58.284 1.00 28.36  ? 238  VAL A O   1 
ATOM   1800 C CB  . VAL A 1 235 ? -2.868  43.712 55.260 1.00 28.96  ? 238  VAL A CB  1 
ATOM   1801 C CG1 . VAL A 1 235 ? -2.554  44.533 54.025 1.00 29.14  ? 238  VAL A CG1 1 
ATOM   1802 C CG2 . VAL A 1 235 ? -2.242  42.346 55.132 1.00 29.65  ? 238  VAL A CG2 1 
ATOM   1803 N N   . ALA A 1 236 ? -2.051  42.838 58.342 1.00 28.71  ? 239  ALA A N   1 
ATOM   1804 C CA  . ALA A 1 236 ? -2.421  42.101 59.548 1.00 28.35  ? 239  ALA A CA  1 
ATOM   1805 C C   . ALA A 1 236 ? -2.495  43.056 60.730 1.00 29.88  ? 239  ALA A C   1 
ATOM   1806 O O   . ALA A 1 236 ? -3.468  43.044 61.491 1.00 30.43  ? 239  ALA A O   1 
ATOM   1807 C CB  . ALA A 1 236 ? -1.407  41.003 59.824 1.00 28.37  ? 239  ALA A CB  1 
ATOM   1808 N N   . GLU A 1 237 ? -1.479  43.909 60.854 1.00 29.72  ? 240  GLU A N   1 
ATOM   1809 C CA  . GLU A 1 237 ? -1.427  44.880 61.938 1.00 28.47  ? 240  GLU A CA  1 
ATOM   1810 C C   . GLU A 1 237 ? -2.550  45.897 61.804 1.00 27.33  ? 240  GLU A C   1 
ATOM   1811 O O   . GLU A 1 237 ? -3.163  46.275 62.800 1.00 26.96  ? 240  GLU A O   1 
ATOM   1812 C CB  . GLU A 1 237 ? -0.059  45.563 61.979 1.00 28.71  ? 240  GLU A CB  1 
ATOM   1813 C CG  . GLU A 1 237 ? 0.114   46.589 63.099 1.00 34.24  ? 240  GLU A CG  1 
ATOM   1814 C CD  . GLU A 1 237 ? -0.165  46.042 64.505 1.00 36.48  ? 240  GLU A CD  1 
ATOM   1815 O OE1 . GLU A 1 237 ? -0.154  44.809 64.717 1.00 31.98  ? 240  GLU A OE1 1 
ATOM   1816 O OE2 . GLU A 1 237 ? -0.393  46.866 65.411 1.00 34.33  ? 240  GLU A OE2 1 
ATOM   1817 N N   . GLY A 1 238 ? -2.845  46.291 60.564 1.00 27.95  ? 241  GLY A N   1 
ATOM   1818 C CA  . GLY A 1 238 ? -3.914  47.244 60.306 1.00 26.76  ? 241  GLY A CA  1 
ATOM   1819 C C   . GLY A 1 238 ? -5.265  46.678 60.712 1.00 28.23  ? 241  GLY A C   1 
ATOM   1820 O O   . GLY A 1 238 ? -6.088  47.365 61.319 1.00 28.50  ? 241  GLY A O   1 
ATOM   1821 N N   . ARG A 1 239 ? -5.490  45.412 60.379 1.00 29.15  ? 242  ARG A N   1 
ATOM   1822 C CA  . ARG A 1 239 ? -6.732  44.729 60.718 1.00 32.87  ? 242  ARG A CA  1 
ATOM   1823 C C   . ARG A 1 239 ? -6.838  44.604 62.238 1.00 33.12  ? 242  ARG A C   1 
ATOM   1824 O O   . ARG A 1 239 ? -7.897  44.841 62.824 1.00 34.48  ? 242  ARG A O   1 
ATOM   1825 C CB  . ARG A 1 239 ? -6.750  43.346 60.068 1.00 34.16  ? 242  ARG A CB  1 
ATOM   1826 C CG  . ARG A 1 239 ? -7.945  42.490 60.433 1.00 35.79  ? 242  ARG A CG  1 
ATOM   1827 C CD  . ARG A 1 239 ? -8.078  41.329 59.458 1.00 37.49  ? 242  ARG A CD  1 
ATOM   1828 N NE  . ARG A 1 239 ? -8.525  41.787 58.144 1.00 37.31  ? 242  ARG A NE  1 
ATOM   1829 C CZ  . ARG A 1 239 ? -9.797  42.023 57.836 1.00 38.40  ? 242  ARG A CZ  1 
ATOM   1830 N NH1 . ARG A 1 239 ? -10.123 42.446 56.627 1.00 39.16  ? 242  ARG A NH1 1 
ATOM   1831 N NH2 . ARG A 1 239 ? -10.747 41.827 58.737 1.00 39.75  ? 242  ARG A NH2 1 
ATOM   1832 N N   . ARG A 1 240 ? -5.715  44.263 62.861 1.00 32.11  ? 243  ARG A N   1 
ATOM   1833 C CA  . ARG A 1 240 ? -5.619  44.113 64.307 1.00 31.11  ? 243  ARG A CA  1 
ATOM   1834 C C   . ARG A 1 240 ? -6.080  45.405 64.997 1.00 30.36  ? 243  ARG A C   1 
ATOM   1835 O O   . ARG A 1 240 ? -6.960  45.375 65.854 1.00 31.91  ? 243  ARG A O   1 
ATOM   1836 C CB  . ARG A 1 240 ? -4.167  43.810 64.674 1.00 32.65  ? 243  ARG A CB  1 
ATOM   1837 C CG  . ARG A 1 240 ? -3.955  43.218 66.043 1.00 35.92  ? 243  ARG A CG  1 
ATOM   1838 C CD  . ARG A 1 240 ? -2.800  43.917 66.749 1.00 38.03  ? 243  ARG A CD  1 
ATOM   1839 N NE  . ARG A 1 240 ? -3.302  44.728 67.852 1.00 41.14  ? 243  ARG A NE  1 
ATOM   1840 C CZ  . ARG A 1 240 ? -2.857  45.937 68.181 1.00 43.20  ? 243  ARG A CZ  1 
ATOM   1841 N NH1 . ARG A 1 240 ? -3.401  46.574 69.206 1.00 49.30  ? 243  ARG A NH1 1 
ATOM   1842 N NH2 . ARG A 1 240 ? -1.878  46.512 67.500 1.00 43.35  ? 243  ARG A NH2 1 
ATOM   1843 N N   . ARG A 1 241 ? -5.524  46.539 64.571 1.00 28.24  ? 244  ARG A N   1 
ATOM   1844 C CA  . ARG A 1 241 ? -5.861  47.846 65.138 1.00 24.72  ? 244  ARG A CA  1 
ATOM   1845 C C   . ARG A 1 241 ? -7.281  48.292 64.839 1.00 26.78  ? 244  ARG A C   1 
ATOM   1846 O O   . ARG A 1 241 ? -7.877  49.022 65.625 1.00 26.66  ? 244  ARG A O   1 
ATOM   1847 C CB  . ARG A 1 241 ? -4.890  48.916 64.635 1.00 22.03  ? 244  ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 241 ? -3.454  48.661 65.023 1.00 20.93  ? 244  ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 241 ? -2.531  49.693 64.427 1.00 22.89  ? 244  ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 241 ? -1.147  49.424 64.791 1.00 19.81  ? 244  ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 241 ? -0.125  50.230 64.526 1.00 23.09  ? 244  ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 241 ? -0.316  51.383 63.897 1.00 22.70  ? 244  ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 241 ? 1.100   49.864 64.864 1.00 21.00  ? 244  ARG A NH2 1 
ATOM   1854 N N   . ALA A 1 242 ? -7.802  47.889 63.685 1.00 27.52  ? 245  ALA A N   1 
ATOM   1855 C CA  . ALA A 1 242 ? -9.158  48.252 63.283 1.00 28.95  ? 245  ALA A CA  1 
ATOM   1856 C C   . ALA A 1 242 ? -10.156 47.581 64.209 1.00 31.27  ? 245  ALA A C   1 
ATOM   1857 O O   . ALA A 1 242 ? -11.134 48.195 64.641 1.00 32.75  ? 245  ALA A O   1 
ATOM   1858 C CB  . ALA A 1 242 ? -9.407  47.830 61.846 1.00 30.30  ? 245  ALA A CB  1 
ATOM   1859 N N   . VAL A 1 243 ? -9.885  46.314 64.513 1.00 33.44  ? 246  VAL A N   1 
ATOM   1860 C CA  . VAL A 1 243 ? -10.722 45.513 65.404 1.00 33.61  ? 246  VAL A CA  1 
ATOM   1861 C C   . VAL A 1 243 ? -10.644 46.043 66.840 1.00 34.97  ? 246  VAL A C   1 
ATOM   1862 O O   . VAL A 1 243 ? -11.663 46.156 67.525 1.00 33.88  ? 246  VAL A O   1 
ATOM   1863 C CB  . VAL A 1 243 ? -10.282 44.031 65.383 1.00 34.21  ? 246  VAL A CB  1 
ATOM   1864 C CG1 . VAL A 1 243 ? -11.061 43.224 66.420 1.00 31.95  ? 246  VAL A CG1 1 
ATOM   1865 C CG2 . VAL A 1 243 ? -10.474 43.449 63.983 1.00 30.89  ? 246  VAL A CG2 1 
ATOM   1866 N N   . GLU A 1 244 ? -9.428  46.370 67.279 1.00 34.13  ? 247  GLU A N   1 
ATOM   1867 C CA  . GLU A 1 244 ? -9.200  46.905 68.618 1.00 33.84  ? 247  GLU A CA  1 
ATOM   1868 C C   . GLU A 1 244 ? -9.910  48.252 68.778 1.00 33.22  ? 247  GLU A C   1 
ATOM   1869 O O   . GLU A 1 244 ? -10.403 48.577 69.858 1.00 33.43  ? 247  GLU A O   1 
ATOM   1870 C CB  . GLU A 1 244 ? -7.696  47.040 68.879 1.00 35.59  ? 247  GLU A CB  1 
ATOM   1871 C CG  . GLU A 1 244 ? -7.317  47.362 70.322 1.00 40.42  ? 247  GLU A CG  1 
ATOM   1872 C CD  . GLU A 1 244 ? -7.842  46.344 71.335 1.00 43.27  ? 247  GLU A CD  1 
ATOM   1873 O OE1 . GLU A 1 244 ? -8.252  46.779 72.432 1.00 41.22  ? 247  GLU A OE1 1 
ATOM   1874 O OE2 . GLU A 1 244 ? -7.838  45.121 71.049 1.00 38.49  ? 247  GLU A OE2 1 
ATOM   1875 N N   . LEU A 1 245 ? -9.992  49.015 67.689 1.00 33.31  ? 248  LEU A N   1 
ATOM   1876 C CA  . LEU A 1 245 ? -10.674 50.306 67.708 1.00 31.41  ? 248  LEU A CA  1 
ATOM   1877 C C   . LEU A 1 245 ? -12.149 50.031 67.925 1.00 33.65  ? 248  LEU A C   1 
ATOM   1878 O O   . LEU A 1 245 ? -12.801 50.698 68.725 1.00 35.02  ? 248  LEU A O   1 
ATOM   1879 C CB  . LEU A 1 245 ? -10.497 51.038 66.380 1.00 29.76  ? 248  LEU A CB  1 
ATOM   1880 C CG  . LEU A 1 245 ? -11.147 52.421 66.340 1.00 30.97  ? 248  LEU A CG  1 
ATOM   1881 C CD1 . LEU A 1 245 ? -10.357 53.381 67.221 1.00 30.25  ? 248  LEU A CD1 1 
ATOM   1882 C CD2 . LEU A 1 245 ? -11.207 52.930 64.912 1.00 28.18  ? 248  LEU A CD2 1 
ATOM   1883 N N   . GLY A 1 246 ? -12.665 49.040 67.200 1.00 35.18  ? 249  GLY A N   1 
ATOM   1884 C CA  . GLY A 1 246 ? -14.062 48.668 67.330 1.00 35.75  ? 249  GLY A CA  1 
ATOM   1885 C C   . GLY A 1 246 ? -14.338 48.130 68.720 1.00 35.38  ? 249  GLY A C   1 
ATOM   1886 O O   . GLY A 1 246 ? -15.392 48.379 69.296 1.00 33.68  ? 249  GLY A O   1 
ATOM   1887 N N   . ARG A 1 247 ? -13.364 47.418 69.273 1.00 35.34  ? 250  ARG A N   1 
ATOM   1888 C CA  . ARG A 1 247 ? -13.481 46.854 70.609 1.00 36.69  ? 250  ARG A CA  1 
ATOM   1889 C C   . ARG A 1 247 ? -13.548 47.995 71.639 1.00 37.93  ? 250  ARG A C   1 
ATOM   1890 O O   . ARG A 1 247 ? -14.237 47.894 72.656 1.00 37.47  ? 250  ARG A O   1 
ATOM   1891 C CB  . ARG A 1 247 ? -12.289 45.940 70.877 1.00 37.28  ? 250  ARG A CB  1 
ATOM   1892 C CG  . ARG A 1 247 ? -12.398 45.120 72.135 1.00 41.95  ? 250  ARG A CG  1 
ATOM   1893 C CD  . ARG A 1 247 ? -11.203 44.190 72.291 1.00 45.12  ? 250  ARG A CD  1 
ATOM   1894 N NE  . ARG A 1 247 ? -11.320 42.966 71.501 1.00 48.34  ? 250  ARG A NE  1 
ATOM   1895 C CZ  . ARG A 1 247 ? -10.607 42.702 70.408 1.00 53.98  ? 250  ARG A CZ  1 
ATOM   1896 N NH1 . ARG A 1 247 ? -9.722  43.583 69.954 1.00 53.64  ? 250  ARG A NH1 1 
ATOM   1897 N NH2 . ARG A 1 247 ? -10.749 41.533 69.792 1.00 54.88  ? 250  ARG A NH2 1 
ATOM   1898 N N   . ASN A 1 248 ? -12.851 49.091 71.347 1.00 37.21  ? 251  ASN A N   1 
ATOM   1899 C CA  . ASN A 1 248 ? -12.844 50.265 72.212 1.00 35.28  ? 251  ASN A CA  1 
ATOM   1900 C C   . ASN A 1 248 ? -14.180 50.995 72.155 1.00 36.80  ? 251  ASN A C   1 
ATOM   1901 O O   . ASN A 1 248 ? -14.537 51.730 73.074 1.00 36.71  ? 251  ASN A O   1 
ATOM   1902 C CB  . ASN A 1 248 ? -11.746 51.233 71.776 1.00 35.40  ? 251  ASN A CB  1 
ATOM   1903 C CG  . ASN A 1 248 ? -10.469 51.061 72.560 1.00 33.50  ? 251  ASN A CG  1 
ATOM   1904 O OD1 . ASN A 1 248 ? -10.192 51.832 73.476 1.00 36.21  ? 251  ASN A OD1 1 
ATOM   1905 N ND2 . ASN A 1 248 ? -9.680  50.055 72.206 1.00 29.37  ? 251  ASN A ND2 1 
ATOM   1906 N N   . LEU A 1 249 ? -14.902 50.816 71.054 1.00 38.68  ? 252  LEU A N   1 
ATOM   1907 C CA  . LEU A 1 249 ? -16.191 51.471 70.866 1.00 39.11  ? 252  LEU A CA  1 
ATOM   1908 C C   . LEU A 1 249 ? -17.376 50.519 70.978 1.00 41.09  ? 252  LEU A C   1 
ATOM   1909 O O   . LEU A 1 249 ? -18.479 50.833 70.529 1.00 40.26  ? 252  LEU A O   1 
ATOM   1910 C CB  . LEU A 1 249 ? -16.204 52.189 69.524 1.00 34.55  ? 252  LEU A CB  1 
ATOM   1911 C CG  . LEU A 1 249 ? -15.144 53.278 69.486 1.00 33.32  ? 252  LEU A CG  1 
ATOM   1912 C CD1 . LEU A 1 249 ? -14.759 53.565 68.062 1.00 36.33  ? 252  LEU A CD1 1 
ATOM   1913 C CD2 . LEU A 1 249 ? -15.644 54.521 70.203 1.00 31.40  ? 252  LEU A CD2 1 
ATOM   1914 N N   . ASN A 1 250 ? -17.137 49.362 71.590 1.00 43.65  ? 253  ASN A N   1 
ATOM   1915 C CA  . ASN A 1 250 ? -18.168 48.348 71.795 1.00 49.02  ? 253  ASN A CA  1 
ATOM   1916 C C   . ASN A 1 250 ? -18.886 48.007 70.505 1.00 48.92  ? 253  ASN A C   1 
ATOM   1917 O O   . ASN A 1 250 ? -20.104 48.156 70.396 1.00 50.93  ? 253  ASN A O   1 
ATOM   1918 C CB  . ASN A 1 250 ? -19.171 48.820 72.847 1.00 54.53  ? 253  ASN A CB  1 
ATOM   1919 C CG  . ASN A 1 250 ? -18.493 49.296 74.117 1.00 62.62  ? 253  ASN A CG  1 
ATOM   1920 O OD1 . ASN A 1 250 ? -18.533 50.485 74.447 1.00 65.88  ? 253  ASN A OD1 1 
ATOM   1921 N ND2 . ASN A 1 250 ? -17.832 48.375 74.820 1.00 65.76  ? 253  ASN A ND2 1 
ATOM   1922 N N   . CYS A 1 251 ? -18.111 47.568 69.521 1.00 48.13  ? 254  CYS A N   1 
ATOM   1923 C CA  . CYS A 1 251 ? -18.650 47.206 68.224 1.00 46.81  ? 254  CYS A CA  1 
ATOM   1924 C C   . CYS A 1 251 ? -18.826 45.709 68.105 1.00 47.78  ? 254  CYS A C   1 
ATOM   1925 O O   . CYS A 1 251 ? -18.140 44.936 68.782 1.00 46.64  ? 254  CYS A O   1 
ATOM   1926 C CB  . CYS A 1 251 ? -17.717 47.672 67.103 1.00 45.11  ? 254  CYS A CB  1 
ATOM   1927 S SG  . CYS A 1 251 ? -17.740 49.458 66.797 1.00 43.69  ? 254  CYS A SG  1 
ATOM   1928 N N   . ASN A 1 252 ? -19.769 45.313 67.254 1.00 47.60  ? 255  ASN A N   1 
ATOM   1929 C CA  . ASN A 1 252 ? -20.016 43.909 66.985 1.00 47.53  ? 255  ASN A CA  1 
ATOM   1930 C C   . ASN A 1 252 ? -18.785 43.539 66.174 1.00 48.43  ? 255  ASN A C   1 
ATOM   1931 O O   . ASN A 1 252 ? -18.550 44.106 65.109 1.00 48.83  ? 255  ASN A O   1 
ATOM   1932 C CB  . ASN A 1 252 ? -21.278 43.749 66.137 1.00 49.24  ? 255  ASN A CB  1 
ATOM   1933 C CG  . ASN A 1 252 ? -21.648 42.295 65.907 1.00 51.02  ? 255  ASN A CG  1 
ATOM   1934 O OD1 . ASN A 1 252 ? -20.834 41.499 65.438 1.00 50.69  ? 255  ASN A OD1 1 
ATOM   1935 N ND2 . ASN A 1 252 ? -22.890 41.945 66.228 1.00 52.48  ? 255  ASN A ND2 1 
ATOM   1936 N N   . LEU A 1 253 ? -17.964 42.642 66.705 1.00 48.44  ? 256  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 253 ? -16.744 42.258 66.011 1.00 50.02  ? 256  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 253 ? -16.837 40.933 65.260 1.00 53.52  ? 256  LEU A C   1 
ATOM   1939 O O   . LEU A 1 253 ? -15.809 40.356 64.890 1.00 57.16  ? 256  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 253 ? -15.573 42.215 66.997 1.00 47.10  ? 256  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 253 ? -15.336 43.436 67.889 1.00 45.05  ? 256  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 253 ? -14.074 43.210 68.697 1.00 43.61  ? 256  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 253 ? -15.219 44.707 67.064 1.00 42.96  ? 256  LEU A CD2 1 
ATOM   1944 N N   . ASN A 1 254 ? -18.058 40.472 64.993 1.00 54.11  ? 257  ASN A N   1 
ATOM   1945 C CA  . ASN A 1 254 ? -18.253 39.201 64.296 1.00 53.46  ? 257  ASN A CA  1 
ATOM   1946 C C   . ASN A 1 254 ? -17.909 39.221 62.807 1.00 52.39  ? 257  ASN A C   1 
ATOM   1947 O O   . ASN A 1 254 ? -17.542 38.187 62.242 1.00 52.93  ? 257  ASN A O   1 
ATOM   1948 C CB  . ASN A 1 254 ? -19.679 38.686 64.508 1.00 55.64  ? 257  ASN A CB  1 
ATOM   1949 C CG  . ASN A 1 254 ? -19.943 38.275 65.947 1.00 56.15  ? 257  ASN A CG  1 
ATOM   1950 N N   . SER A 1 255 ? -18.008 40.391 62.178 1.00 50.55  ? 258  SER A N   1 
ATOM   1951 C CA  . SER A 1 255 ? -17.696 40.529 60.754 1.00 48.64  ? 258  SER A CA  1 
ATOM   1952 C C   . SER A 1 255 ? -17.174 41.925 60.433 1.00 48.15  ? 258  SER A C   1 
ATOM   1953 O O   . SER A 1 255 ? -17.383 42.862 61.205 1.00 46.32  ? 258  SER A O   1 
ATOM   1954 C CB  . SER A 1 255 ? -18.943 40.260 59.908 1.00 47.77  ? 258  SER A CB  1 
ATOM   1955 O OG  . SER A 1 255 ? -19.926 41.258 60.127 1.00 45.62  ? 258  SER A OG  1 
ATOM   1956 N N   . ASP A 1 256 ? -16.496 42.061 59.294 1.00 46.98  ? 259  ASP A N   1 
ATOM   1957 C CA  . ASP A 1 256 ? -15.979 43.361 58.878 1.00 45.23  ? 259  ASP A CA  1 
ATOM   1958 C C   . ASP A 1 256 ? -17.143 44.287 58.606 1.00 45.04  ? 259  ASP A C   1 
ATOM   1959 O O   . ASP A 1 256 ? -17.069 45.477 58.879 1.00 45.23  ? 259  ASP A O   1 
ATOM   1960 C CB  . ASP A 1 256 ? -15.128 43.242 57.614 1.00 43.66  ? 259  ASP A CB  1 
ATOM   1961 C CG  . ASP A 1 256 ? -13.730 42.724 57.892 1.00 48.04  ? 259  ASP A CG  1 
ATOM   1962 O OD1 . ASP A 1 256 ? -13.447 42.318 59.041 1.00 47.49  ? 259  ASP A OD1 1 
ATOM   1963 O OD2 . ASP A 1 256 ? -12.906 42.725 56.951 1.00 49.45  ? 259  ASP A OD2 1 
ATOM   1964 N N   . GLU A 1 257 ? -18.227 43.714 58.088 1.00 46.89  ? 260  GLU A N   1 
ATOM   1965 C CA  . GLU A 1 257 ? -19.440 44.456 57.760 1.00 48.71  ? 260  GLU A CA  1 
ATOM   1966 C C   . GLU A 1 257 ? -20.045 45.085 59.005 1.00 48.37  ? 260  GLU A C   1 
ATOM   1967 O O   . GLU A 1 257 ? -20.482 46.236 58.978 1.00 48.08  ? 260  GLU A O   1 
ATOM   1968 C CB  . GLU A 1 257 ? -20.477 43.535 57.106 1.00 53.40  ? 260  GLU A CB  1 
ATOM   1969 C CG  . GLU A 1 257 ? -20.109 43.015 55.715 1.00 61.06  ? 260  GLU A CG  1 
ATOM   1970 C CD  . GLU A 1 257 ? -18.998 41.959 55.713 1.00 66.98  ? 260  GLU A CD  1 
ATOM   1971 O OE1 . GLU A 1 257 ? -18.793 41.261 56.735 1.00 68.53  ? 260  GLU A OE1 1 
ATOM   1972 O OE2 . GLU A 1 257 ? -18.334 41.815 54.662 1.00 71.19  ? 260  GLU A OE2 1 
ATOM   1973 N N   . GLU A 1 258 ? -20.078 44.320 60.093 1.00 48.50  ? 261  GLU A N   1 
ATOM   1974 C CA  . GLU A 1 258 ? -20.629 44.814 61.350 1.00 49.72  ? 261  GLU A CA  1 
ATOM   1975 C C   . GLU A 1 258 ? -19.690 45.766 62.082 1.00 47.85  ? 261  GLU A C   1 
ATOM   1976 O O   . GLU A 1 258 ? -20.146 46.695 62.752 1.00 48.12  ? 261  GLU A O   1 
ATOM   1977 C CB  . GLU A 1 258 ? -21.045 43.651 62.243 1.00 52.95  ? 261  GLU A CB  1 
ATOM   1978 C CG  . GLU A 1 258 ? -22.282 42.955 61.715 1.00 60.37  ? 261  GLU A CG  1 
ATOM   1979 C CD  . GLU A 1 258 ? -22.728 41.806 62.577 1.00 62.17  ? 261  GLU A CD  1 
ATOM   1980 O OE1 . GLU A 1 258 ? -23.781 41.939 63.238 1.00 62.64  ? 261  GLU A OE1 1 
ATOM   1981 O OE2 . GLU A 1 258 ? -22.027 40.768 62.580 1.00 65.69  ? 261  GLU A OE2 1 
ATOM   1982 N N   . LEU A 1 259 ? -18.384 45.539 61.940 1.00 44.81  ? 262  LEU A N   1 
ATOM   1983 C CA  . LEU A 1 259 ? -17.375 46.396 62.559 1.00 39.58  ? 262  LEU A CA  1 
ATOM   1984 C C   . LEU A 1 259 ? -17.440 47.756 61.873 1.00 38.75  ? 262  LEU A C   1 
ATOM   1985 O O   . LEU A 1 259 ? -17.606 48.786 62.529 1.00 39.06  ? 262  LEU A O   1 
ATOM   1986 C CB  . LEU A 1 259 ? -15.977 45.780 62.398 1.00 35.60  ? 262  LEU A CB  1 
ATOM   1987 C CG  . LEU A 1 259 ? -14.743 46.593 62.805 1.00 32.96  ? 262  LEU A CG  1 
ATOM   1988 C CD1 . LEU A 1 259 ? -14.894 47.130 64.210 1.00 32.81  ? 262  LEU A CD1 1 
ATOM   1989 C CD2 . LEU A 1 259 ? -13.499 45.726 62.696 1.00 29.75  ? 262  LEU A CD2 1 
ATOM   1990 N N   . ILE A 1 260 ? -17.385 47.737 60.545 1.00 36.47  ? 263  ILE A N   1 
ATOM   1991 C CA  . ILE A 1 260 ? -17.436 48.956 59.754 1.00 35.73  ? 263  ILE A CA  1 
ATOM   1992 C C   . ILE A 1 260 ? -18.760 49.693 59.920 1.00 34.84  ? 263  ILE A C   1 
ATOM   1993 O O   . ILE A 1 260 ? -18.772 50.917 59.991 1.00 37.55  ? 263  ILE A O   1 
ATOM   1994 C CB  . ILE A 1 260 ? -17.169 48.675 58.264 1.00 34.96  ? 263  ILE A CB  1 
ATOM   1995 C CG1 . ILE A 1 260 ? -15.761 48.104 58.088 1.00 36.55  ? 263  ILE A CG1 1 
ATOM   1996 C CG2 . ILE A 1 260 ? -17.306 49.949 57.455 1.00 36.11  ? 263  ILE A CG2 1 
ATOM   1997 C CD1 . ILE A 1 260 ? -15.469 47.602 56.694 1.00 33.06  ? 263  ILE A CD1 1 
ATOM   1998 N N   . HIS A 1 261 ? -19.871 48.962 59.996 1.00 36.30  ? 264  HIS A N   1 
ATOM   1999 C CA  . HIS A 1 261 ? -21.172 49.610 60.165 1.00 37.06  ? 264  HIS A CA  1 
ATOM   2000 C C   . HIS A 1 261 ? -21.204 50.339 61.498 1.00 39.30  ? 264  HIS A C   1 
ATOM   2001 O O   . HIS A 1 261 ? -21.687 51.472 61.590 1.00 40.53  ? 264  HIS A O   1 
ATOM   2002 C CB  . HIS A 1 261 ? -22.324 48.601 60.110 1.00 37.53  ? 264  HIS A CB  1 
ATOM   2003 C CG  . HIS A 1 261 ? -23.638 49.170 60.555 0.50 37.93  ? 264  HIS A CG  1 
ATOM   2004 N ND1 . HIS A 1 261 ? -24.287 50.172 59.865 0.50 38.87  ? 264  HIS A ND1 1 
ATOM   2005 C CD2 . HIS A 1 261 ? -24.398 48.913 61.646 0.50 37.83  ? 264  HIS A CD2 1 
ATOM   2006 C CE1 . HIS A 1 261 ? -25.388 50.509 60.513 0.50 38.15  ? 264  HIS A CE1 1 
ATOM   2007 N NE2 . HIS A 1 261 ? -25.479 49.761 61.596 0.50 38.33  ? 264  HIS A NE2 1 
ATOM   2008 N N   . CYS A 1 262 ? -20.684 49.675 62.527 1.00 40.44  ? 265  CYS A N   1 
ATOM   2009 C CA  . CYS A 1 262 ? -20.629 50.238 63.868 1.00 40.72  ? 265  CYS A CA  1 
ATOM   2010 C C   . CYS A 1 262 ? -19.779 51.507 63.878 1.00 40.46  ? 265  CYS A C   1 
ATOM   2011 O O   . CYS A 1 262 ? -20.238 52.571 64.307 1.00 38.18  ? 265  CYS A O   1 
ATOM   2012 C CB  . CYS A 1 262 ? -20.045 49.207 64.839 1.00 42.74  ? 265  CYS A CB  1 
ATOM   2013 S SG  . CYS A 1 262 ? -19.716 49.828 66.520 1.00 47.87  ? 265  CYS A SG  1 
ATOM   2014 N N   . LEU A 1 263 ? -18.561 51.391 63.346 1.00 38.65  ? 266  LEU A N   1 
ATOM   2015 C CA  . LEU A 1 263 ? -17.622 52.507 63.291 1.00 35.98  ? 266  LEU A CA  1 
ATOM   2016 C C   . LEU A 1 263 ? -18.188 53.698 62.526 1.00 36.27  ? 266  LEU A C   1 
ATOM   2017 O O   . LEU A 1 263 ? -17.909 54.844 62.866 1.00 37.26  ? 266  LEU A O   1 
ATOM   2018 C CB  . LEU A 1 263 ? -16.283 52.055 62.692 1.00 33.67  ? 266  LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 263 ? -15.490 50.995 63.470 1.00 30.56  ? 266  LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 263 ? -14.280 50.545 62.669 1.00 30.11  ? 266  LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 263 ? -15.063 51.546 64.824 1.00 30.06  ? 266  LEU A CD2 1 
ATOM   2022 N N   . ARG A 1 264 ? -19.027 53.429 61.530 1.00 37.36  ? 267  ARG A N   1 
ATOM   2023 C CA  . ARG A 1 264 ? -19.622 54.501 60.743 1.00 38.86  ? 267  ARG A CA  1 
ATOM   2024 C C   . ARG A 1 264 ? -20.706 55.246 61.490 1.00 39.54  ? 267  ARG A C   1 
ATOM   2025 O O   . ARG A 1 264 ? -20.944 56.423 61.218 1.00 41.31  ? 267  ARG A O   1 
ATOM   2026 C CB  . ARG A 1 264 ? -20.160 53.979 59.419 1.00 37.51  ? 267  ARG A CB  1 
ATOM   2027 C CG  . ARG A 1 264 ? -19.071 53.666 58.429 1.00 39.79  ? 267  ARG A CG  1 
ATOM   2028 C CD  . ARG A 1 264 ? -19.636 53.345 57.063 1.00 41.16  ? 267  ARG A CD  1 
ATOM   2029 N NE  . ARG A 1 264 ? -18.563 53.197 56.089 1.00 44.22  ? 267  ARG A NE  1 
ATOM   2030 C CZ  . ARG A 1 264 ? -18.573 52.328 55.085 1.00 44.25  ? 267  ARG A CZ  1 
ATOM   2031 N NH1 . ARG A 1 264 ? -19.612 51.519 54.914 1.00 40.04  ? 267  ARG A NH1 1 
ATOM   2032 N NH2 . ARG A 1 264 ? -17.530 52.259 54.266 1.00 39.92  ? 267  ARG A NH2 1 
ATOM   2033 N N   . GLU A 1 265 ? -21.361 54.564 62.430 1.00 40.59  ? 268  GLU A N   1 
ATOM   2034 C CA  . GLU A 1 265 ? -22.416 55.182 63.224 1.00 40.40  ? 268  GLU A CA  1 
ATOM   2035 C C   . GLU A 1 265 ? -21.833 56.033 64.347 1.00 40.22  ? 268  GLU A C   1 
ATOM   2036 O O   . GLU A 1 265 ? -22.538 56.875 64.913 1.00 41.76  ? 268  GLU A O   1 
ATOM   2037 C CB  . GLU A 1 265 ? -23.353 54.115 63.793 1.00 41.56  ? 268  GLU A CB  1 
ATOM   2038 C CG  . GLU A 1 265 ? -24.055 53.278 62.736 1.00 45.06  ? 268  GLU A CG  1 
ATOM   2039 C CD  . GLU A 1 265 ? -24.927 54.111 61.818 1.00 20.00  ? 268  GLU A CD  1 
ATOM   2040 O OE1 . GLU A 1 265 ? -24.408 54.613 60.798 1.00 20.00  ? 268  GLU A OE1 1 
ATOM   2041 O OE2 . GLU A 1 265 ? -26.130 54.262 62.118 1.00 20.00  ? 268  GLU A OE2 1 
ATOM   2042 N N   . LYS A 1 266 ? -20.554 55.835 64.659 1.00 39.45  ? 269  LYS A N   1 
ATOM   2043 C CA  . LYS A 1 266 ? -19.889 56.600 65.712 1.00 36.87  ? 269  LYS A CA  1 
ATOM   2044 C C   . LYS A 1 266 ? -19.601 58.015 65.246 1.00 36.22  ? 269  LYS A C   1 
ATOM   2045 O O   . LYS A 1 266 ? -19.246 58.238 64.093 1.00 36.33  ? 269  LYS A O   1 
ATOM   2046 C CB  . LYS A 1 266 ? -18.562 55.950 66.107 1.00 38.51  ? 269  LYS A CB  1 
ATOM   2047 C CG  . LYS A 1 266 ? -18.669 54.524 66.580 1.00 41.05  ? 269  LYS A CG  1 
ATOM   2048 C CD  . LYS A 1 266 ? -19.483 54.415 67.852 1.00 42.45  ? 269  LYS A CD  1 
ATOM   2049 C CE  . LYS A 1 266 ? -19.605 52.961 68.265 1.00 45.04  ? 269  LYS A CE  1 
ATOM   2050 N NZ  . LYS A 1 266 ? -20.250 52.815 69.592 1.00 47.96  ? 269  LYS A NZ  1 
ATOM   2051 N N   . LYS A 1 267 ? -19.783 58.976 66.144 1.00 37.36  ? 270  LYS A N   1 
ATOM   2052 C CA  . LYS A 1 267 ? -19.500 60.366 65.825 1.00 36.65  ? 270  LYS A CA  1 
ATOM   2053 C C   . LYS A 1 267 ? -17.985 60.450 65.664 1.00 35.62  ? 270  LYS A C   1 
ATOM   2054 O O   . LYS A 1 267 ? -17.247 59.660 66.255 1.00 36.33  ? 270  LYS A O   1 
ATOM   2055 C CB  . LYS A 1 267 ? -19.976 61.284 66.951 1.00 39.72  ? 270  LYS A CB  1 
ATOM   2056 C CG  . LYS A 1 267 ? -21.487 61.346 67.100 1.00 42.58  ? 270  LYS A CG  1 
ATOM   2057 C CD  . LYS A 1 267 ? -21.898 62.228 68.275 1.00 47.27  ? 270  LYS A CD  1 
ATOM   2058 N N   . PRO A 1 268 ? -17.500 61.395 64.848 1.00 33.27  ? 271  PRO A N   1 
ATOM   2059 C CA  . PRO A 1 268 ? -16.060 61.536 64.633 1.00 32.26  ? 271  PRO A CA  1 
ATOM   2060 C C   . PRO A 1 268 ? -15.215 61.524 65.908 1.00 31.23  ? 271  PRO A C   1 
ATOM   2061 O O   . PRO A 1 268 ? -14.292 60.721 66.040 1.00 31.03  ? 271  PRO A O   1 
ATOM   2062 C CB  . PRO A 1 268 ? -15.965 62.874 63.905 1.00 30.70  ? 271  PRO A CB  1 
ATOM   2063 C CG  . PRO A 1 268 ? -17.215 62.900 63.110 1.00 30.12  ? 271  PRO A CG  1 
ATOM   2064 C CD  . PRO A 1 268 ? -18.241 62.426 64.102 1.00 30.46  ? 271  PRO A CD  1 
ATOM   2065 N N   . GLN A 1 269 ? -15.581 62.366 66.868 1.00 31.97  ? 272  GLN A N   1 
ATOM   2066 C CA  . GLN A 1 269 ? -14.829 62.475 68.108 1.00 32.93  ? 272  GLN A CA  1 
ATOM   2067 C C   . GLN A 1 269 ? -14.751 61.192 68.916 1.00 33.16  ? 272  GLN A C   1 
ATOM   2068 O O   . GLN A 1 269 ? -13.838 61.023 69.720 1.00 33.21  ? 272  GLN A O   1 
ATOM   2069 C CB  . GLN A 1 269 ? -15.366 63.620 68.963 1.00 33.33  ? 272  GLN A CB  1 
ATOM   2070 C CG  . GLN A 1 269 ? -14.429 64.036 70.085 1.00 37.07  ? 272  GLN A CG  1 
ATOM   2071 C CD  . GLN A 1 269 ? -13.037 64.374 69.587 1.00 38.40  ? 272  GLN A CD  1 
ATOM   2072 O OE1 . GLN A 1 269 ? -12.864 65.216 68.700 1.00 37.78  ? 272  GLN A OE1 1 
ATOM   2073 N NE2 . GLN A 1 269 ? -12.035 63.709 70.150 1.00 38.24  ? 272  GLN A NE2 1 
ATOM   2074 N N   . GLU A 1 270 ? -15.682 60.274 68.674 1.00 33.27  ? 273  GLU A N   1 
ATOM   2075 C CA  . GLU A 1 270 ? -15.690 58.998 69.388 1.00 35.46  ? 273  GLU A CA  1 
ATOM   2076 C C   . GLU A 1 270 ? -14.523 58.111 68.971 1.00 34.68  ? 273  GLU A C   1 
ATOM   2077 O O   . GLU A 1 270 ? -13.946 57.402 69.796 1.00 34.62  ? 273  GLU A O   1 
ATOM   2078 C CB  . GLU A 1 270 ? -17.008 58.268 69.164 1.00 36.41  ? 273  GLU A CB  1 
ATOM   2079 C CG  . GLU A 1 270 ? -18.196 59.047 69.654 1.00 40.86  ? 273  GLU A CG  1 
ATOM   2080 C CD  . GLU A 1 270 ? -19.451 58.220 69.671 1.00 45.72  ? 273  GLU A CD  1 
ATOM   2081 O OE1 . GLU A 1 270 ? -19.489 57.201 70.398 1.00 49.43  ? 273  GLU A OE1 1 
ATOM   2082 O OE2 . GLU A 1 270 ? -20.404 58.591 68.962 1.00 49.12  ? 273  GLU A OE2 1 
ATOM   2083 N N   . LEU A 1 271 ? -14.190 58.149 67.684 1.00 34.16  ? 274  LEU A N   1 
ATOM   2084 C CA  . LEU A 1 271 ? -13.078 57.369 67.158 1.00 33.35  ? 274  LEU A CA  1 
ATOM   2085 C C   . LEU A 1 271 ? -11.772 58.033 67.590 1.00 31.20  ? 274  LEU A C   1 
ATOM   2086 O O   . LEU A 1 271 ? -10.807 57.354 67.943 1.00 31.90  ? 274  LEU A O   1 
ATOM   2087 C CB  . LEU A 1 271 ? -13.143 57.300 65.627 1.00 35.57  ? 274  LEU A CB  1 
ATOM   2088 C CG  . LEU A 1 271 ? -14.424 56.810 64.942 1.00 35.96  ? 274  LEU A CG  1 
ATOM   2089 C CD1 . LEU A 1 271 ? -14.208 56.822 63.445 1.00 37.87  ? 274  LEU A CD1 1 
ATOM   2090 C CD2 . LEU A 1 271 ? -14.777 55.417 65.390 1.00 35.64  ? 274  LEU A CD2 1 
ATOM   2091 N N   . ILE A 1 272 ? -11.757 59.363 67.571 1.00 28.78  ? 275  ILE A N   1 
ATOM   2092 C CA  . ILE A 1 272 ? -10.580 60.128 67.960 1.00 27.77  ? 275  ILE A CA  1 
ATOM   2093 C C   . ILE A 1 272 ? -10.238 59.918 69.436 1.00 29.62  ? 275  ILE A C   1 
ATOM   2094 O O   . ILE A 1 272 ? -9.068  59.783 69.793 1.00 28.65  ? 275  ILE A O   1 
ATOM   2095 C CB  . ILE A 1 272 ? -10.778 61.620 67.661 1.00 26.24  ? 275  ILE A CB  1 
ATOM   2096 C CG1 . ILE A 1 272 ? -10.994 61.810 66.158 1.00 23.19  ? 275  ILE A CG1 1 
ATOM   2097 C CG2 . ILE A 1 272 ? -9.568  62.423 68.126 1.00 24.25  ? 275  ILE A CG2 1 
ATOM   2098 C CD1 . ILE A 1 272 ? -11.310 63.224 65.756 1.00 23.85  ? 275  ILE A CD1 1 
ATOM   2099 N N   . ASP A 1 273 ? -11.270 59.820 70.273 1.00 30.13  ? 276  ASP A N   1 
ATOM   2100 C CA  . ASP A 1 273 ? -11.099 59.610 71.709 1.00 29.27  ? 276  ASP A CA  1 
ATOM   2101 C C   . ASP A 1 273 ? -10.323 58.357 72.075 1.00 29.18  ? 276  ASP A C   1 
ATOM   2102 O O   . ASP A 1 273 ? -9.483  58.391 72.971 1.00 32.78  ? 276  ASP A O   1 
ATOM   2103 C CB  . ASP A 1 273 ? -12.457 59.567 72.415 1.00 31.68  ? 276  ASP A CB  1 
ATOM   2104 C CG  . ASP A 1 273 ? -13.007 60.948 72.718 1.00 32.79  ? 276  ASP A CG  1 
ATOM   2105 O OD1 . ASP A 1 273 ? -12.270 61.947 72.566 1.00 31.64  ? 276  ASP A OD1 1 
ATOM   2106 O OD2 . ASP A 1 273 ? -14.186 61.030 73.122 1.00 38.72  ? 276  ASP A OD2 1 
ATOM   2107 N N   . VAL A 1 274 ? -10.597 57.256 71.381 1.00 28.08  ? 277  VAL A N   1 
ATOM   2108 C CA  . VAL A 1 274 ? -9.929  55.982 71.654 1.00 25.92  ? 277  VAL A CA  1 
ATOM   2109 C C   . VAL A 1 274 ? -8.819  55.612 70.660 1.00 25.73  ? 277  VAL A C   1 
ATOM   2110 O O   . VAL A 1 274 ? -8.186  54.557 70.779 1.00 22.03  ? 277  VAL A O   1 
ATOM   2111 C CB  . VAL A 1 274 ? -10.961 54.834 71.683 1.00 29.00  ? 277  VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1 274 ? -11.972 55.072 72.797 1.00 26.77  ? 277  VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1 274 ? -11.670 54.719 70.327 1.00 26.77  ? 277  VAL A CG2 1 
ATOM   2114 N N   . GLU A 1 275 ? -8.570  56.503 69.704 1.00 26.52  ? 278  GLU A N   1 
ATOM   2115 C CA  . GLU A 1 275 ? -7.577  56.288 68.657 1.00 26.64  ? 278  GLU A CA  1 
ATOM   2116 C C   . GLU A 1 275 ? -6.222  55.737 69.088 1.00 27.84  ? 278  GLU A C   1 
ATOM   2117 O O   . GLU A 1 275 ? -5.692  54.812 68.476 1.00 28.64  ? 278  GLU A O   1 
ATOM   2118 C CB  . GLU A 1 275 ? -7.361  57.585 67.883 1.00 28.53  ? 278  GLU A CB  1 
ATOM   2119 C CG  . GLU A 1 275 ? -6.246  57.494 66.857 1.00 30.62  ? 278  GLU A CG  1 
ATOM   2120 C CD  . GLU A 1 275 ? -6.060  58.767 66.055 1.00 33.41  ? 278  GLU A CD  1 
ATOM   2121 O OE1 . GLU A 1 275 ? -7.022  59.559 65.925 1.00 31.39  ? 278  GLU A OE1 1 
ATOM   2122 O OE2 . GLU A 1 275 ? -4.939  58.968 65.542 1.00 34.95  ? 278  GLU A OE2 1 
ATOM   2123 N N   . TRP A 1 276 ? -5.664  56.309 70.143 1.00 28.14  ? 279  TRP A N   1 
ATOM   2124 C CA  . TRP A 1 276 ? -4.358  55.901 70.623 1.00 27.58  ? 279  TRP A CA  1 
ATOM   2125 C C   . TRP A 1 276 ? -4.329  54.610 71.432 1.00 29.22  ? 279  TRP A C   1 
ATOM   2126 O O   . TRP A 1 276 ? -3.256  54.061 71.688 1.00 31.64  ? 279  TRP A O   1 
ATOM   2127 C CB  . TRP A 1 276 ? -3.744  57.047 71.414 1.00 28.12  ? 279  TRP A CB  1 
ATOM   2128 C CG  . TRP A 1 276 ? -3.651  58.308 70.608 1.00 30.08  ? 279  TRP A CG  1 
ATOM   2129 C CD1 . TRP A 1 276 ? -4.584  59.307 70.529 1.00 30.40  ? 279  TRP A CD1 1 
ATOM   2130 C CD2 . TRP A 1 276 ? -2.563  58.706 69.762 1.00 29.35  ? 279  TRP A CD2 1 
ATOM   2131 N NE1 . TRP A 1 276 ? -4.140  60.302 69.688 1.00 31.56  ? 279  TRP A NE1 1 
ATOM   2132 C CE2 . TRP A 1 276 ? -2.904  59.959 69.204 1.00 31.24  ? 279  TRP A CE2 1 
ATOM   2133 C CE3 . TRP A 1 276 ? -1.331  58.126 69.423 1.00 30.95  ? 279  TRP A CE3 1 
ATOM   2134 C CZ2 . TRP A 1 276 ? -2.055  60.642 68.325 1.00 32.72  ? 279  TRP A CZ2 1 
ATOM   2135 C CZ3 . TRP A 1 276 ? -0.485  58.808 68.548 1.00 32.80  ? 279  TRP A CZ3 1 
ATOM   2136 C CH2 . TRP A 1 276 ? -0.853  60.052 68.011 1.00 32.90  ? 279  TRP A CH2 1 
ATOM   2137 N N   . ASN A 1 277 ? -5.503  54.097 71.791 1.00 29.52  ? 280  ASN A N   1 
ATOM   2138 C CA  . ASN A 1 277 ? -5.592  52.866 72.576 1.00 28.40  ? 280  ASN A CA  1 
ATOM   2139 C C   . ASN A 1 277 ? -5.294  51.608 71.776 1.00 29.15  ? 280  ASN A C   1 
ATOM   2140 O O   . ASN A 1 277 ? -5.157  50.536 72.350 1.00 30.81  ? 280  ASN A O   1 
ATOM   2141 C CB  . ASN A 1 277 ? -6.984  52.723 73.204 1.00 27.33  ? 280  ASN A CB  1 
ATOM   2142 C CG  . ASN A 1 277 ? -7.328  53.863 74.152 1.00 30.33  ? 280  ASN A CG  1 
ATOM   2143 O OD1 . ASN A 1 277 ? -6.455  54.627 74.571 1.00 31.99  ? 280  ASN A OD1 1 
ATOM   2144 N ND2 . ASN A 1 277 ? -8.609  53.989 74.486 1.00 26.16  ? 280  ASN A ND2 1 
ATOM   2145 N N   . VAL A 1 278 ? -5.161  51.736 70.459 1.00 30.49  ? 281  VAL A N   1 
ATOM   2146 C CA  . VAL A 1 278 ? -4.921  50.577 69.606 1.00 28.39  ? 281  VAL A CA  1 
ATOM   2147 C C   . VAL A 1 278 ? -3.466  50.252 69.303 1.00 28.10  ? 281  VAL A C   1 
ATOM   2148 O O   . VAL A 1 278 ? -3.180  49.237 68.680 1.00 30.44  ? 281  VAL A O   1 
ATOM   2149 C CB  . VAL A 1 278 ? -5.710  50.691 68.280 1.00 29.85  ? 281  VAL A CB  1 
ATOM   2150 C CG1 . VAL A 1 278 ? -7.175  50.999 68.572 1.00 28.06  ? 281  VAL A CG1 1 
ATOM   2151 C CG2 . VAL A 1 278 ? -5.101  51.758 67.376 1.00 29.57  ? 281  VAL A CG2 1 
ATOM   2152 N N   . LEU A 1 279 ? -2.542  51.110 69.717 1.00 28.51  ? 282  LEU A N   1 
ATOM   2153 C CA  . LEU A 1 279 ? -1.129  50.842 69.470 1.00 28.89  ? 282  LEU A CA  1 
ATOM   2154 C C   . LEU A 1 279 ? -0.701  49.546 70.146 1.00 30.15  ? 282  LEU A C   1 
ATOM   2155 O O   . LEU A 1 279 ? -1.149  49.232 71.245 1.00 30.48  ? 282  LEU A O   1 
ATOM   2156 C CB  . LEU A 1 279 ? -0.261  52.005 69.939 1.00 29.52  ? 282  LEU A CB  1 
ATOM   2157 C CG  . LEU A 1 279 ? -0.402  53.249 69.060 1.00 31.15  ? 282  LEU A CG  1 
ATOM   2158 C CD1 . LEU A 1 279 ? 0.426   54.386 69.635 1.00 28.19  ? 282  LEU A CD1 1 
ATOM   2159 C CD2 . LEU A 1 279 ? 0.032   52.918 67.629 1.00 29.99  ? 282  LEU A CD2 1 
ATOM   2160 N N   . PRO A 1 280 ? 0.170   48.769 69.487 1.00 32.27  ? 283  PRO A N   1 
ATOM   2161 C CA  . PRO A 1 280 ? 0.645   47.495 70.031 1.00 33.15  ? 283  PRO A CA  1 
ATOM   2162 C C   . PRO A 1 280 ? 1.647   47.576 71.175 1.00 34.96  ? 283  PRO A C   1 
ATOM   2163 O O   . PRO A 1 280 ? 1.685   46.683 72.019 1.00 35.28  ? 283  PRO A O   1 
ATOM   2164 C CB  . PRO A 1 280 ? 1.262   46.818 68.807 1.00 31.53  ? 283  PRO A CB  1 
ATOM   2165 C CG  . PRO A 1 280 ? 1.835   47.973 68.059 1.00 31.10  ? 283  PRO A CG  1 
ATOM   2166 C CD  . PRO A 1 280 ? 0.722   48.999 68.139 1.00 31.34  ? 283  PRO A CD  1 
ATOM   2167 N N   . PHE A 1 281 ? 2.461   48.628 71.201 1.00 35.87  ? 284  PHE A N   1 
ATOM   2168 C CA  . PHE A 1 281 ? 3.480   48.763 72.238 1.00 35.28  ? 284  PHE A CA  1 
ATOM   2169 C C   . PHE A 1 281 ? 3.473   50.092 72.949 1.00 36.84  ? 284  PHE A C   1 
ATOM   2170 O O   . PHE A 1 281 ? 2.915   51.078 72.459 1.00 36.15  ? 284  PHE A O   1 
ATOM   2171 C CB  . PHE A 1 281 ? 4.877   48.614 71.641 1.00 35.47  ? 284  PHE A CB  1 
ATOM   2172 C CG  . PHE A 1 281 ? 5.030   47.439 70.750 1.00 39.54  ? 284  PHE A CG  1 
ATOM   2173 C CD1 . PHE A 1 281 ? 5.309   47.614 69.403 1.00 43.37  ? 284  PHE A CD1 1 
ATOM   2174 C CD2 . PHE A 1 281 ? 4.901   46.153 71.251 1.00 42.32  ? 284  PHE A CD2 1 
ATOM   2175 C CE1 . PHE A 1 281 ? 5.459   46.522 68.560 1.00 46.66  ? 284  PHE A CE1 1 
ATOM   2176 C CE2 . PHE A 1 281 ? 5.047   45.050 70.424 1.00 46.87  ? 284  PHE A CE2 1 
ATOM   2177 C CZ  . PHE A 1 281 ? 5.328   45.233 69.072 1.00 48.34  ? 284  PHE A CZ  1 
ATOM   2178 N N   . ASP A 1 282 ? 4.114   50.098 74.115 1.00 36.12  ? 285  ASP A N   1 
ATOM   2179 C CA  . ASP A 1 282 ? 4.291   51.306 74.900 1.00 35.93  ? 285  ASP A CA  1 
ATOM   2180 C C   . ASP A 1 282 ? 5.439   51.909 74.093 1.00 35.06  ? 285  ASP A C   1 
ATOM   2181 O O   . ASP A 1 282 ? 6.568   51.410 74.128 1.00 34.64  ? 285  ASP A O   1 
ATOM   2182 C CB  . ASP A 1 282 ? 4.748   50.948 76.318 1.00 34.76  ? 285  ASP A CB  1 
ATOM   2183 C CG  . ASP A 1 282 ? 4.992   52.164 77.177 1.00 32.23  ? 285  ASP A CG  1 
ATOM   2184 O OD1 . ASP A 1 282 ? 4.641   53.285 76.746 1.00 30.48  ? 285  ASP A OD1 1 
ATOM   2185 O OD2 . ASP A 1 282 ? 5.539   51.996 78.287 1.00 32.92  ? 285  ASP A OD2 1 
ATOM   2186 N N   . SER A 1 283 ? 5.136   52.946 73.322 1.00 33.50  ? 286  SER A N   1 
ATOM   2187 C CA  . SER A 1 283 ? 6.144   53.530 72.454 1.00 32.12  ? 286  SER A CA  1 
ATOM   2188 C C   . SER A 1 283 ? 5.955   55.004 72.163 1.00 30.24  ? 286  SER A C   1 
ATOM   2189 O O   . SER A 1 283 ? 4.963   55.616 72.556 1.00 32.53  ? 286  SER A O   1 
ATOM   2190 C CB  . SER A 1 283 ? 6.105   52.792 71.113 1.00 33.45  ? 286  SER A CB  1 
ATOM   2191 O OG  . SER A 1 283 ? 4.832   52.960 70.491 1.00 32.08  ? 286  SER A OG  1 
ATOM   2192 N N   . ILE A 1 284 ? 6.943   55.566 71.482 1.00 26.75  ? 287  ILE A N   1 
ATOM   2193 C CA  . ILE A 1 284 ? 6.889   56.947 71.054 1.00 27.69  ? 287  ILE A CA  1 
ATOM   2194 C C   . ILE A 1 284 ? 7.172   56.891 69.560 1.00 28.14  ? 287  ILE A C   1 
ATOM   2195 O O   . ILE A 1 284 ? 7.808   55.946 69.073 1.00 27.48  ? 287  ILE A O   1 
ATOM   2196 C CB  . ILE A 1 284 ? 7.932   57.862 71.764 1.00 26.63  ? 287  ILE A CB  1 
ATOM   2197 C CG1 . ILE A 1 284 ? 9.359   57.387 71.504 1.00 25.52  ? 287  ILE A CG1 1 
ATOM   2198 C CG2 . ILE A 1 284 ? 7.646   57.938 73.252 1.00 29.39  ? 287  ILE A CG2 1 
ATOM   2199 C CD1 . ILE A 1 284 ? 10.400  58.376 71.980 1.00 22.71  ? 287  ILE A CD1 1 
ATOM   2200 N N   . PHE A 1 285 ? 6.654   57.875 68.835 1.00 28.48  ? 288  PHE A N   1 
ATOM   2201 C CA  . PHE A 1 285 ? 6.842   57.964 67.393 1.00 29.16  ? 288  PHE A CA  1 
ATOM   2202 C C   . PHE A 1 285 ? 6.131   56.846 66.622 1.00 29.25  ? 288  PHE A C   1 
ATOM   2203 O O   . PHE A 1 285 ? 6.635   56.358 65.607 1.00 31.62  ? 288  PHE A O   1 
ATOM   2204 C CB  . PHE A 1 285 ? 8.338   57.979 67.067 1.00 27.43  ? 288  PHE A CB  1 
ATOM   2205 C CG  . PHE A 1 285 ? 8.722   58.990 66.035 1.00 29.68  ? 288  PHE A CG  1 
ATOM   2206 C CD1 . PHE A 1 285 ? 8.019   59.089 64.839 1.00 27.79  ? 288  PHE A CD1 1 
ATOM   2207 C CD2 . PHE A 1 285 ? 9.808   59.833 66.247 1.00 26.94  ? 288  PHE A CD2 1 
ATOM   2208 C CE1 . PHE A 1 285 ? 8.395   60.011 63.872 1.00 27.46  ? 288  PHE A CE1 1 
ATOM   2209 C CE2 . PHE A 1 285 ? 10.188  60.754 65.287 1.00 26.29  ? 288  PHE A CE2 1 
ATOM   2210 C CZ  . PHE A 1 285 ? 9.479   60.842 64.096 1.00 26.51  ? 288  PHE A CZ  1 
ATOM   2211 N N   . ARG A 1 286 ? 4.988   56.409 67.141 1.00 25.90  ? 289  ARG A N   1 
ATOM   2212 C CA  . ARG A 1 286 ? 4.183   55.383 66.489 1.00 23.36  ? 289  ARG A CA  1 
ATOM   2213 C C   . ARG A 1 286 ? 2.766   55.904 66.507 1.00 23.53  ? 289  ARG A C   1 
ATOM   2214 O O   . ARG A 1 286 ? 2.306   56.434 67.512 1.00 22.73  ? 289  ARG A O   1 
ATOM   2215 C CB  . ARG A 1 286 ? 4.276   54.040 67.204 1.00 19.44  ? 289  ARG A CB  1 
ATOM   2216 C CG  . ARG A 1 286 ? 5.633   53.381 67.092 1.00 23.11  ? 289  ARG A CG  1 
ATOM   2217 C CD  . ARG A 1 286 ? 6.003   53.111 65.642 1.00 24.14  ? 289  ARG A CD  1 
ATOM   2218 N NE  . ARG A 1 286 ? 7.283   52.412 65.520 1.00 24.99  ? 289  ARG A NE  1 
ATOM   2219 C CZ  . ARG A 1 286 ? 8.470   53.010 65.462 1.00 25.24  ? 289  ARG A CZ  1 
ATOM   2220 N NH1 . ARG A 1 286 ? 8.561   54.331 65.507 1.00 21.87  ? 289  ARG A NH1 1 
ATOM   2221 N NH2 . ARG A 1 286 ? 9.572   52.279 65.367 1.00 25.93  ? 289  ARG A NH2 1 
ATOM   2222 N N   . PHE A 1 287 ? 2.091   55.792 65.372 1.00 24.36  ? 290  PHE A N   1 
ATOM   2223 C CA  . PHE A 1 287 ? 0.735   56.297 65.239 1.00 23.00  ? 290  PHE A CA  1 
ATOM   2224 C C   . PHE A 1 287 ? -0.174  55.175 64.780 1.00 22.08  ? 290  PHE A C   1 
ATOM   2225 O O   . PHE A 1 287 ? 0.224   54.307 64.012 1.00 22.25  ? 290  PHE A O   1 
ATOM   2226 C CB  . PHE A 1 287 ? 0.764   57.480 64.278 1.00 23.67  ? 290  PHE A CB  1 
ATOM   2227 C CG  . PHE A 1 287 ? 2.000   58.327 64.439 1.00 24.10  ? 290  PHE A CG  1 
ATOM   2228 C CD1 . PHE A 1 287 ? 2.196   59.073 65.596 1.00 26.55  ? 290  PHE A CD1 1 
ATOM   2229 C CD2 . PHE A 1 287 ? 3.010   58.303 63.481 1.00 24.42  ? 290  PHE A CD2 1 
ATOM   2230 C CE1 . PHE A 1 287 ? 3.381   59.777 65.800 1.00 27.68  ? 290  PHE A CE1 1 
ATOM   2231 C CE2 . PHE A 1 287 ? 4.200   59.003 63.673 1.00 23.62  ? 290  PHE A CE2 1 
ATOM   2232 C CZ  . PHE A 1 287 ? 4.387   59.740 64.833 1.00 26.31  ? 290  PHE A CZ  1 
ATOM   2233 N N   . SER A 1 288 ? -1.386  55.178 65.305 1.00 23.74  ? 291  SER A N   1 
ATOM   2234 C CA  . SER A 1 288 ? -2.362  54.134 65.036 1.00 27.39  ? 291  SER A CA  1 
ATOM   2235 C C   . SER A 1 288 ? -2.728  53.804 63.596 1.00 27.83  ? 291  SER A C   1 
ATOM   2236 O O   . SER A 1 288 ? -2.505  52.680 63.145 1.00 26.32  ? 291  SER A O   1 
ATOM   2237 C CB  . SER A 1 288 ? -3.622  54.409 65.847 1.00 27.75  ? 291  SER A CB  1 
ATOM   2238 O OG  . SER A 1 288 ? -3.290  54.522 67.217 1.00 30.37  ? 291  SER A OG  1 
ATOM   2239 N N   . PHE A 1 289 ? -3.298  54.775 62.886 1.00 28.62  ? 292  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 289 ? -3.734  54.563 61.509 1.00 24.96  ? 292  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 289 ? -2.862  55.236 60.484 1.00 23.97  ? 292  PHE A C   1 
ATOM   2242 O O   . PHE A 1 289 ? -2.920  56.445 60.272 1.00 24.39  ? 292  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 289 ? -5.191  54.977 61.368 1.00 24.56  ? 292  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 289 ? -6.065  54.341 62.392 1.00 25.33  ? 292  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 289 ? -6.420  52.997 62.279 1.00 24.78  ? 292  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 289 ? -6.444  55.047 63.532 1.00 25.50  ? 292  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 289 ? -7.132  52.362 63.290 1.00 24.30  ? 292  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 289 ? -7.155  54.423 64.548 1.00 24.85  ? 292  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 289 ? -7.497  53.077 64.429 1.00 26.91  ? 292  PHE A CZ  1 
ATOM   2250 N N   . VAL A 1 290 ? -2.059  54.410 59.833 1.00 21.02  ? 293  VAL A N   1 
ATOM   2251 C CA  . VAL A 1 290 ? -1.126  54.865 58.828 1.00 20.82  ? 293  VAL A CA  1 
ATOM   2252 C C   . VAL A 1 290 ? -1.293  53.986 57.591 1.00 23.23  ? 293  VAL A C   1 
ATOM   2253 O O   . VAL A 1 290 ? -2.071  53.032 57.607 1.00 23.75  ? 293  VAL A O   1 
ATOM   2254 C CB  . VAL A 1 290 ? 0.322   54.718 59.356 1.00 18.21  ? 293  VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 290 ? 0.551   55.633 60.545 1.00 19.78  ? 293  VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 290 ? 0.593   53.272 59.743 1.00 16.78  ? 293  VAL A CG2 1 
ATOM   2257 N N   . PRO A 1 291 ? -0.620  54.338 56.481 1.00 22.24  ? 294  PRO A N   1 
ATOM   2258 C CA  . PRO A 1 291 ? -0.710  53.547 55.257 1.00 22.29  ? 294  PRO A CA  1 
ATOM   2259 C C   . PRO A 1 291 ? -0.427  52.068 55.520 1.00 25.38  ? 294  PRO A C   1 
ATOM   2260 O O   . PRO A 1 291 ? 0.389   51.719 56.373 1.00 26.17  ? 294  PRO A O   1 
ATOM   2261 C CB  . PRO A 1 291 ? 0.385   54.161 54.389 1.00 21.31  ? 294  PRO A CB  1 
ATOM   2262 C CG  . PRO A 1 291 ? 0.263   55.606 54.718 1.00 22.60  ? 294  PRO A CG  1 
ATOM   2263 C CD  . PRO A 1 291 ? 0.107   55.599 56.228 1.00 22.24  ? 294  PRO A CD  1 
ATOM   2264 N N   . VAL A 1 292 ? -1.131  51.207 54.798 1.00 24.52  ? 295  VAL A N   1 
ATOM   2265 C CA  . VAL A 1 292 ? -0.961  49.771 54.925 1.00 25.50  ? 295  VAL A CA  1 
ATOM   2266 C C   . VAL A 1 292 ? -0.346  49.216 53.633 1.00 24.98  ? 295  VAL A C   1 
ATOM   2267 O O   . VAL A 1 292 ? -0.604  49.735 52.547 1.00 23.88  ? 295  VAL A O   1 
ATOM   2268 C CB  . VAL A 1 292 ? -2.323  49.088 55.214 1.00 27.91  ? 295  VAL A CB  1 
ATOM   2269 C CG1 . VAL A 1 292 ? -3.314  49.329 54.073 1.00 28.63  ? 295  VAL A CG1 1 
ATOM   2270 C CG2 . VAL A 1 292 ? -2.127  47.625 55.439 1.00 30.90  ? 295  VAL A CG2 1 
ATOM   2271 N N   . ILE A 1 293 ? 0.530   48.223 53.757 1.00 24.04  ? 296  ILE A N   1 
ATOM   2272 C CA  . ILE A 1 293 ? 1.147   47.617 52.578 1.00 25.45  ? 296  ILE A CA  1 
ATOM   2273 C C   . ILE A 1 293 ? 0.119   46.597 52.071 1.00 27.91  ? 296  ILE A C   1 
ATOM   2274 O O   . ILE A 1 293 ? 0.169   45.421 52.413 1.00 28.45  ? 296  ILE A O   1 
ATOM   2275 C CB  . ILE A 1 293 ? 2.488   46.935 52.934 1.00 25.22  ? 296  ILE A CB  1 
ATOM   2276 C CG1 . ILE A 1 293 ? 3.363   47.897 53.741 1.00 20.39  ? 296  ILE A CG1 1 
ATOM   2277 C CG2 . ILE A 1 293 ? 3.222   46.517 51.658 1.00 24.84  ? 296  ILE A CG2 1 
ATOM   2278 C CD1 . ILE A 1 293 ? 3.599   49.234 53.060 1.00 24.18  ? 296  ILE A CD1 1 
ATOM   2279 N N   . ASP A 1 294 ? -0.815  47.081 51.256 1.00 29.98  ? 297  ASP A N   1 
ATOM   2280 C CA  . ASP A 1 294 ? -1.931  46.288 50.744 1.00 31.63  ? 297  ASP A CA  1 
ATOM   2281 C C   . ASP A 1 294 ? -1.770  45.466 49.472 1.00 32.77  ? 297  ASP A C   1 
ATOM   2282 O O   . ASP A 1 294 ? -2.637  44.651 49.159 1.00 35.88  ? 297  ASP A O   1 
ATOM   2283 C CB  . ASP A 1 294 ? -3.166  47.193 50.586 1.00 28.67  ? 297  ASP A CB  1 
ATOM   2284 C CG  . ASP A 1 294 ? -2.970  48.293 49.538 1.00 31.39  ? 297  ASP A CG  1 
ATOM   2285 O OD1 . ASP A 1 294 ? -1.821  48.512 49.082 1.00 25.81  ? 297  ASP A OD1 1 
ATOM   2286 O OD2 . ASP A 1 294 ? -3.975  48.941 49.166 1.00 34.24  ? 297  ASP A OD2 1 
ATOM   2287 N N   . GLY A 1 295 ? -0.706  45.693 48.716 1.00 32.17  ? 298  GLY A N   1 
ATOM   2288 C CA  . GLY A 1 295 ? -0.551  44.947 47.482 1.00 32.43  ? 298  GLY A CA  1 
ATOM   2289 C C   . GLY A 1 295 ? -1.299  45.620 46.339 1.00 33.11  ? 298  GLY A C   1 
ATOM   2290 O O   . GLY A 1 295 ? -1.246  45.155 45.203 1.00 35.09  ? 298  GLY A O   1 
ATOM   2291 N N   . GLU A 1 296 ? -2.039  46.662 46.653 1.00 30.55  ? 299  GLU A N   1 
ATOM   2292 C CA  . GLU A 1 296 ? -2.739  47.455 45.651 1.00 29.84  ? 299  GLU A CA  1 
ATOM   2293 C C   . GLU A 1 296 ? -2.045  48.793 45.423 1.00 29.92  ? 299  GLU A C   1 
ATOM   2294 O O   . GLU A 1 296 ? -1.340  48.978 44.439 1.00 31.11  ? 299  GLU A O   1 
ATOM   2295 C CB  . GLU A 1 296 ? -4.196  47.670 46.063 1.00 33.65  ? 299  GLU A CB  1 
ATOM   2296 C CG  . GLU A 1 296 ? -4.991  46.385 46.224 1.00 36.61  ? 299  GLU A CG  1 
ATOM   2297 C CD  . GLU A 1 296 ? -6.427  46.634 46.643 1.00 20.00  ? 299  GLU A CD  1 
ATOM   2298 O OE1 . GLU A 1 296 ? -6.802  47.816 46.800 1.00 20.00  ? 299  GLU A OE1 1 
ATOM   2299 O OE2 . GLU A 1 296 ? -7.176  45.651 46.814 1.00 20.00  ? 299  GLU A OE2 1 
ATOM   2300 N N   . PHE A 1 297 ? -2.155  49.674 46.419 1.00 27.84  ? 300  PHE A N   1 
ATOM   2301 C CA  . PHE A 1 297 ? -1.483  50.969 46.347 1.00 25.05  ? 300  PHE A CA  1 
ATOM   2302 C C   . PHE A 1 297 ? 0.016   50.695 46.245 1.00 25.89  ? 300  PHE A C   1 
ATOM   2303 O O   . PHE A 1 297 ? 0.716   51.268 45.408 1.00 26.20  ? 300  PHE A O   1 
ATOM   2304 C CB  . PHE A 1 297 ? -1.805  51.810 47.585 1.00 21.15  ? 300  PHE A CB  1 
ATOM   2305 C CG  . PHE A 1 297 ? -1.431  53.253 47.447 1.00 21.45  ? 300  PHE A CG  1 
ATOM   2306 C CD1 . PHE A 1 297 ? -0.123  53.673 47.670 1.00 23.39  ? 300  PHE A CD1 1 
ATOM   2307 C CD2 . PHE A 1 297 ? -2.381  54.195 47.078 1.00 19.53  ? 300  PHE A CD2 1 
ATOM   2308 C CE1 . PHE A 1 297 ? 0.234   55.009 47.527 1.00 22.27  ? 300  PHE A CE1 1 
ATOM   2309 C CE2 . PHE A 1 297 ? -2.038  55.532 46.930 1.00 19.63  ? 300  PHE A CE2 1 
ATOM   2310 C CZ  . PHE A 1 297 ? -0.726  55.941 47.154 1.00 21.94  ? 300  PHE A CZ  1 
ATOM   2311 N N   . PHE A 1 298 ? 0.489   49.790 47.096 1.00 26.13  ? 301  PHE A N   1 
ATOM   2312 C CA  . PHE A 1 298 ? 1.886   49.374 47.100 1.00 26.64  ? 301  PHE A CA  1 
ATOM   2313 C C   . PHE A 1 298 ? 1.840   47.930 46.629 1.00 28.42  ? 301  PHE A C   1 
ATOM   2314 O O   . PHE A 1 298 ? 1.332   47.062 47.333 1.00 29.44  ? 301  PHE A O   1 
ATOM   2315 C CB  . PHE A 1 298 ? 2.481   49.447 48.514 1.00 25.75  ? 301  PHE A CB  1 
ATOM   2316 C CG  . PHE A 1 298 ? 2.424   50.823 49.130 1.00 24.49  ? 301  PHE A CG  1 
ATOM   2317 C CD1 . PHE A 1 298 ? 3.296   51.825 48.714 1.00 24.79  ? 301  PHE A CD1 1 
ATOM   2318 C CD2 . PHE A 1 298 ? 1.495   51.117 50.123 1.00 24.90  ? 301  PHE A CD2 1 
ATOM   2319 C CE1 . PHE A 1 298 ? 3.244   53.096 49.279 1.00 24.33  ? 301  PHE A CE1 1 
ATOM   2320 C CE2 . PHE A 1 298 ? 1.435   52.387 50.695 1.00 24.29  ? 301  PHE A CE2 1 
ATOM   2321 C CZ  . PHE A 1 298 ? 2.311   53.376 50.272 1.00 24.28  ? 301  PHE A CZ  1 
ATOM   2322 N N   . PRO A 1 299 ? 2.324   47.662 45.409 1.00 29.83  ? 302  PRO A N   1 
ATOM   2323 C CA  . PRO A 1 299 ? 2.345   46.321 44.812 1.00 30.28  ? 302  PRO A CA  1 
ATOM   2324 C C   . PRO A 1 299 ? 2.975   45.263 45.728 1.00 30.81  ? 302  PRO A C   1 
ATOM   2325 O O   . PRO A 1 299 ? 2.402   44.196 45.954 1.00 31.34  ? 302  PRO A O   1 
ATOM   2326 C CB  . PRO A 1 299 ? 3.170   46.535 43.545 1.00 29.65  ? 302  PRO A CB  1 
ATOM   2327 C CG  . PRO A 1 299 ? 2.848   47.947 43.175 1.00 29.67  ? 302  PRO A CG  1 
ATOM   2328 C CD  . PRO A 1 299 ? 2.929   48.649 44.495 1.00 29.22  ? 302  PRO A CD  1 
ATOM   2329 N N   . THR A 1 300 ? 4.166   45.559 46.235 1.00 29.95  ? 303  THR A N   1 
ATOM   2330 C CA  . THR A 1 300 ? 4.868   44.652 47.133 1.00 28.10  ? 303  THR A CA  1 
ATOM   2331 C C   . THR A 1 300 ? 5.491   45.481 48.245 1.00 29.34  ? 303  THR A C   1 
ATOM   2332 O O   . THR A 1 300 ? 5.231   46.685 48.350 1.00 29.06  ? 303  THR A O   1 
ATOM   2333 C CB  . THR A 1 300 ? 5.983   43.886 46.414 1.00 27.22  ? 303  THR A CB  1 
ATOM   2334 O OG1 . THR A 1 300 ? 6.916   44.814 45.860 1.00 30.30  ? 303  THR A OG1 1 
ATOM   2335 C CG2 . THR A 1 300 ? 5.419   43.033 45.306 1.00 32.23  ? 303  THR A CG2 1 
ATOM   2336 N N   . SER A 1 301 ? 6.328   44.840 49.057 1.00 27.79  ? 304  SER A N   1 
ATOM   2337 C CA  . SER A 1 301 ? 6.992   45.513 50.168 1.00 27.52  ? 304  SER A CA  1 
ATOM   2338 C C   . SER A 1 301 ? 7.776   46.710 49.657 1.00 27.53  ? 304  SER A C   1 
ATOM   2339 O O   . SER A 1 301 ? 8.329   46.682 48.553 1.00 28.73  ? 304  SER A O   1 
ATOM   2340 C CB  . SER A 1 301 ? 7.941   44.556 50.889 1.00 26.28  ? 304  SER A CB  1 
ATOM   2341 O OG  . SER A 1 301 ? 9.087   44.274 50.102 1.00 27.08  ? 304  SER A OG  1 
ATOM   2342 N N   . LEU A 1 302 ? 7.813   47.764 50.461 1.00 24.98  ? 305  LEU A N   1 
ATOM   2343 C CA  . LEU A 1 302 ? 8.522   48.966 50.076 1.00 23.97  ? 305  LEU A CA  1 
ATOM   2344 C C   . LEU A 1 302 ? 9.960   48.626 49.741 1.00 24.55  ? 305  LEU A C   1 
ATOM   2345 O O   . LEU A 1 302 ? 10.472  49.042 48.706 1.00 27.17  ? 305  LEU A O   1 
ATOM   2346 C CB  . LEU A 1 302 ? 8.466   49.999 51.196 1.00 22.28  ? 305  LEU A CB  1 
ATOM   2347 C CG  . LEU A 1 302 ? 7.060   50.350 51.698 1.00 22.88  ? 305  LEU A CG  1 
ATOM   2348 C CD1 . LEU A 1 302 ? 7.155   51.429 52.765 1.00 20.28  ? 305  LEU A CD1 1 
ATOM   2349 C CD2 . LEU A 1 302 ? 6.176   50.803 50.550 1.00 20.28  ? 305  LEU A CD2 1 
ATOM   2350 N N   . GLU A 1 303 ? 10.573  47.791 50.574 1.00 25.01  ? 306  GLU A N   1 
ATOM   2351 C CA  . GLU A 1 303 ? 11.960  47.398 50.384 1.00 25.07  ? 306  GLU A CA  1 
ATOM   2352 C C   . GLU A 1 303 ? 12.215  46.718 49.051 1.00 25.92  ? 306  GLU A C   1 
ATOM   2353 O O   . GLU A 1 303 ? 13.174  47.057 48.361 1.00 28.63  ? 306  GLU A O   1 
ATOM   2354 C CB  . GLU A 1 303 ? 12.426  46.504 51.534 1.00 24.42  ? 306  GLU A CB  1 
ATOM   2355 C CG  . GLU A 1 303 ? 13.867  46.021 51.421 1.00 26.91  ? 306  GLU A CG  1 
ATOM   2356 C CD  . GLU A 1 303 ? 14.880  47.152 51.323 1.00 34.88  ? 306  GLU A CD  1 
ATOM   2357 O OE1 . GLU A 1 303 ? 14.542  48.305 51.661 1.00 38.95  ? 306  GLU A OE1 1 
ATOM   2358 O OE2 . GLU A 1 303 ? 16.026  46.889 50.907 1.00 39.69  ? 306  GLU A OE2 1 
ATOM   2359 N N   . SER A 1 304 ? 11.363  45.765 48.684 1.00 26.36  ? 307  SER A N   1 
ATOM   2360 C CA  . SER A 1 304 ? 11.543  45.074 47.411 1.00 29.42  ? 307  SER A CA  1 
ATOM   2361 C C   . SER A 1 304 ? 11.345  46.042 46.243 1.00 29.79  ? 307  SER A C   1 
ATOM   2362 O O   . SER A 1 304 ? 12.074  45.975 45.252 1.00 30.16  ? 307  SER A O   1 
ATOM   2363 C CB  . SER A 1 304 ? 10.606  43.867 47.287 1.00 27.14  ? 307  SER A CB  1 
ATOM   2364 O OG  . SER A 1 304 ? 9.248   44.259 47.264 1.00 34.86  ? 307  SER A OG  1 
ATOM   2365 N N   . MET A 1 305 ? 10.389  46.962 46.380 1.00 28.24  ? 308  MET A N   1 
ATOM   2366 C CA  . MET A 1 305 ? 10.135  47.954 45.338 1.00 26.92  ? 308  MET A CA  1 
ATOM   2367 C C   . MET A 1 305 ? 11.361  48.846 45.185 1.00 28.05  ? 308  MET A C   1 
ATOM   2368 O O   . MET A 1 305 ? 11.793  49.140 44.073 1.00 30.53  ? 308  MET A O   1 
ATOM   2369 C CB  . MET A 1 305 ? 8.900   48.798 45.667 1.00 25.33  ? 308  MET A CB  1 
ATOM   2370 C CG  . MET A 1 305 ? 7.581   48.033 45.598 1.00 21.60  ? 308  MET A CG  1 
ATOM   2371 S SD  . MET A 1 305 ? 6.122   49.077 45.868 1.00 29.55  ? 308  MET A SD  1 
ATOM   2372 C CE  . MET A 1 305 ? 6.165   50.066 44.377 1.00 27.40  ? 308  MET A CE  1 
ATOM   2373 N N   . LEU A 1 306 ? 11.960  49.219 46.311 1.00 28.68  ? 309  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 306 ? 13.143  50.064 46.306 1.00 29.41  ? 309  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 306 ? 14.321  49.350 45.672 1.00 30.23  ? 309  LEU A C   1 
ATOM   2376 O O   . LEU A 1 306 ? 15.050  49.929 44.869 1.00 32.31  ? 309  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 306 ? 13.498  50.489 47.730 1.00 28.87  ? 309  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 306 ? 12.603  51.574 48.334 1.00 30.49  ? 309  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 306 ? 13.015  51.835 49.775 1.00 31.38  ? 309  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 306 ? 12.704  52.854 47.510 1.00 26.99  ? 309  LEU A CD2 1 
ATOM   2381 N N   . ASN A 1 307 ? 14.487  48.081 46.021 1.00 31.72  ? 310  ASN A N   1 
ATOM   2382 C CA  . ASN A 1 307 ? 15.579  47.275 45.495 1.00 32.98  ? 310  ASN A CA  1 
ATOM   2383 C C   . ASN A 1 307 ? 15.502  47.030 44.005 1.00 31.56  ? 310  ASN A C   1 
ATOM   2384 O O   . ASN A 1 307 ? 16.505  47.122 43.307 1.00 32.15  ? 310  ASN A O   1 
ATOM   2385 C CB  . ASN A 1 307 ? 15.635  45.927 46.203 1.00 37.54  ? 310  ASN A CB  1 
ATOM   2386 C CG  . ASN A 1 307 ? 16.366  45.996 47.512 1.00 43.63  ? 310  ASN A CG  1 
ATOM   2387 O OD1 . ASN A 1 307 ? 15.952  45.391 48.500 1.00 50.36  ? 310  ASN A OD1 1 
ATOM   2388 N ND2 . ASN A 1 307 ? 17.473  46.728 47.532 1.00 44.85  ? 310  ASN A ND2 1 
ATOM   2389 N N   . SER A 1 308 ? 14.309  46.693 43.531 1.00 30.55  ? 311  SER A N   1 
ATOM   2390 C CA  . SER A 1 308 ? 14.088  46.403 42.122 1.00 30.98  ? 311  SER A CA  1 
ATOM   2391 C C   . SER A 1 308 ? 13.976  47.633 41.237 1.00 30.72  ? 311  SER A C   1 
ATOM   2392 O O   . SER A 1 308 ? 13.987  47.522 40.013 1.00 32.79  ? 311  SER A O   1 
ATOM   2393 C CB  . SER A 1 308 ? 12.830  45.554 41.961 1.00 28.70  ? 311  SER A CB  1 
ATOM   2394 O OG  . SER A 1 308 ? 11.694  46.232 42.465 1.00 33.47  ? 311  SER A OG  1 
ATOM   2395 N N   . GLY A 1 309 ? 13.881  48.807 41.845 1.00 30.55  ? 312  GLY A N   1 
ATOM   2396 C CA  . GLY A 1 309 ? 13.740  50.013 41.053 1.00 28.28  ? 312  GLY A CA  1 
ATOM   2397 C C   . GLY A 1 309 ? 12.303  50.168 40.592 1.00 28.29  ? 312  GLY A C   1 
ATOM   2398 O O   . GLY A 1 309 ? 12.030  50.838 39.600 1.00 28.48  ? 312  GLY A O   1 
ATOM   2399 N N   . ASN A 1 310 ? 11.385  49.511 41.298 1.00 26.45  ? 313  ASN A N   1 
ATOM   2400 C CA  . ASN A 1 310 ? 9.967   49.583 40.979 1.00 25.14  ? 313  ASN A CA  1 
ATOM   2401 C C   . ASN A 1 310 ? 9.369   50.857 41.576 1.00 25.85  ? 313  ASN A C   1 
ATOM   2402 O O   . ASN A 1 310 ? 8.637   50.822 42.574 1.00 27.16  ? 313  ASN A O   1 
ATOM   2403 C CB  . ASN A 1 310 ? 9.236   48.343 41.504 1.00 24.95  ? 313  ASN A CB  1 
ATOM   2404 C CG  . ASN A 1 310 ? 7.763   48.323 41.124 1.00 29.04  ? 313  ASN A CG  1 
ATOM   2405 O OD1 . ASN A 1 310 ? 7.299   49.145 40.330 1.00 29.68  ? 313  ASN A OD1 1 
ATOM   2406 N ND2 . ASN A 1 310 ? 7.021   47.382 41.692 1.00 28.60  ? 313  ASN A ND2 1 
ATOM   2407 N N   . PHE A 1 311 ? 9.703   51.983 40.956 1.00 25.73  ? 314  PHE A N   1 
ATOM   2408 C CA  . PHE A 1 311 ? 9.224   53.290 41.389 1.00 25.12  ? 314  PHE A CA  1 
ATOM   2409 C C   . PHE A 1 311 ? 9.443   54.323 40.286 1.00 25.70  ? 314  PHE A C   1 
ATOM   2410 O O   . PHE A 1 311 ? 10.146  54.054 39.311 1.00 24.77  ? 314  PHE A O   1 
ATOM   2411 C CB  . PHE A 1 311 ? 9.906   53.727 42.704 1.00 23.37  ? 314  PHE A CB  1 
ATOM   2412 C CG  . PHE A 1 311 ? 11.422  53.640 42.689 1.00 20.58  ? 314  PHE A CG  1 
ATOM   2413 C CD1 . PHE A 1 311 ? 12.190  54.620 42.063 1.00 19.12  ? 314  PHE A CD1 1 
ATOM   2414 C CD2 . PHE A 1 311 ? 12.080  52.594 43.339 1.00 21.54  ? 314  PHE A CD2 1 
ATOM   2415 C CE1 . PHE A 1 311 ? 13.587  54.563 42.082 1.00 18.28  ? 314  PHE A CE1 1 
ATOM   2416 C CE2 . PHE A 1 311 ? 13.481  52.528 43.364 1.00 19.53  ? 314  PHE A CE2 1 
ATOM   2417 C CZ  . PHE A 1 311 ? 14.233  53.515 42.735 1.00 17.55  ? 314  PHE A CZ  1 
ATOM   2418 N N   . LYS A 1 312 ? 8.838   55.499 40.444 1.00 25.83  ? 315  LYS A N   1 
ATOM   2419 C CA  . LYS A 1 312 ? 8.959   56.573 39.466 1.00 24.43  ? 315  LYS A CA  1 
ATOM   2420 C C   . LYS A 1 312 ? 10.373  57.101 39.446 1.00 25.58  ? 315  LYS A C   1 
ATOM   2421 O O   . LYS A 1 312 ? 10.909  57.525 40.467 1.00 25.66  ? 315  LYS A O   1 
ATOM   2422 C CB  . LYS A 1 312 ? 8.006   57.719 39.792 1.00 25.89  ? 315  LYS A CB  1 
ATOM   2423 C CG  . LYS A 1 312 ? 8.067   58.866 38.798 1.00 22.78  ? 315  LYS A CG  1 
ATOM   2424 C CD  . LYS A 1 312 ? 7.342   60.081 39.337 1.00 24.43  ? 315  LYS A CD  1 
ATOM   2425 C CE  . LYS A 1 312 ? 7.316   61.203 38.324 1.00 23.26  ? 315  LYS A CE  1 
ATOM   2426 N NZ  . LYS A 1 312 ? 6.434   60.868 37.179 1.00 21.98  ? 315  LYS A NZ  1 
ATOM   2427 N N   . LYS A 1 313 ? 10.979  57.077 38.272 1.00 26.19  ? 316  LYS A N   1 
ATOM   2428 C CA  . LYS A 1 313 ? 12.338  57.555 38.132 1.00 28.70  ? 316  LYS A CA  1 
ATOM   2429 C C   . LYS A 1 313 ? 12.300  58.977 37.614 1.00 28.62  ? 316  LYS A C   1 
ATOM   2430 O O   . LYS A 1 313 ? 11.819  59.242 36.512 1.00 32.54  ? 316  LYS A O   1 
ATOM   2431 C CB  . LYS A 1 313 ? 13.118  56.610 37.226 1.00 30.67  ? 316  LYS A CB  1 
ATOM   2432 C CG  . LYS A 1 313 ? 13.060  55.185 37.765 1.00 33.84  ? 316  LYS A CG  1 
ATOM   2433 C CD  . LYS A 1 313 ? 13.781  54.194 36.895 1.00 40.85  ? 316  LYS A CD  1 
ATOM   2434 C CE  . LYS A 1 313 ? 13.484  52.775 37.347 1.00 42.97  ? 316  LYS A CE  1 
ATOM   2435 N NZ  . LYS A 1 313 ? 12.024  52.489 37.289 1.00 45.43  ? 316  LYS A NZ  1 
ATOM   2436 N N   . THR A 1 314 ? 12.748  59.895 38.465 1.00 27.72  ? 317  THR A N   1 
ATOM   2437 C CA  . THR A 1 314 ? 12.758  61.316 38.159 1.00 23.93  ? 317  THR A CA  1 
ATOM   2438 C C   . THR A 1 314 ? 13.762  61.977 39.096 1.00 25.88  ? 317  THR A C   1 
ATOM   2439 O O   . THR A 1 314 ? 14.642  61.298 39.630 1.00 26.07  ? 317  THR A O   1 
ATOM   2440 C CB  . THR A 1 314 ? 11.342  61.912 38.357 1.00 21.70  ? 317  THR A CB  1 
ATOM   2441 O OG1 . THR A 1 314 ? 11.358  63.313 38.072 1.00 22.60  ? 317  THR A OG1 1 
ATOM   2442 C CG2 . THR A 1 314 ? 10.850  61.690 39.780 1.00 22.53  ? 317  THR A CG2 1 
ATOM   2443 N N   . GLN A 1 315 ? 13.688  63.297 39.243 1.00 25.89  ? 318  GLN A N   1 
ATOM   2444 C CA  . GLN A 1 315 ? 14.595  63.989 40.148 1.00 27.99  ? 318  GLN A CA  1 
ATOM   2445 C C   . GLN A 1 315 ? 13.896  64.207 41.487 1.00 27.76  ? 318  GLN A C   1 
ATOM   2446 O O   . GLN A 1 315 ? 12.672  64.390 41.548 1.00 26.06  ? 318  GLN A O   1 
ATOM   2447 C CB  . GLN A 1 315 ? 15.038  65.354 39.595 1.00 31.05  ? 318  GLN A CB  1 
ATOM   2448 C CG  . GLN A 1 315 ? 15.666  65.345 38.209 1.00 34.05  ? 318  GLN A CG  1 
ATOM   2449 C CD  . GLN A 1 315 ? 14.629  65.354 37.103 1.00 35.43  ? 318  GLN A CD  1 
ATOM   2450 O OE1 . GLN A 1 315 ? 13.566  65.958 37.237 1.00 35.41  ? 318  GLN A OE1 1 
ATOM   2451 N NE2 . GLN A 1 315 ? 14.932  64.678 36.004 1.00 39.51  ? 318  GLN A NE2 1 
ATOM   2452 N N   . ILE A 1 316 ? 14.681  64.151 42.558 1.00 26.28  ? 319  ILE A N   1 
ATOM   2453 C CA  . ILE A 1 316 ? 14.166  64.372 43.899 1.00 24.81  ? 319  ILE A CA  1 
ATOM   2454 C C   . ILE A 1 316 ? 15.109  65.266 44.680 1.00 23.25  ? 319  ILE A C   1 
ATOM   2455 O O   . ILE A 1 316 ? 16.318  65.288 44.428 1.00 22.57  ? 319  ILE A O   1 
ATOM   2456 C CB  . ILE A 1 316 ? 13.972  63.050 44.702 1.00 23.27  ? 319  ILE A CB  1 
ATOM   2457 C CG1 . ILE A 1 316 ? 15.300  62.309 44.884 1.00 23.09  ? 319  ILE A CG1 1 
ATOM   2458 C CG2 . ILE A 1 316 ? 12.950  62.158 44.029 1.00 23.37  ? 319  ILE A CG2 1 
ATOM   2459 C CD1 . ILE A 1 316 ? 15.218  61.176 45.913 1.00 19.51  ? 319  ILE A CD1 1 
ATOM   2460 N N   . LEU A 1 317 ? 14.522  66.072 45.558 1.00 22.39  ? 320  LEU A N   1 
ATOM   2461 C CA  . LEU A 1 317 ? 15.270  66.952 46.445 1.00 23.80  ? 320  LEU A CA  1 
ATOM   2462 C C   . LEU A 1 317 ? 14.700  66.601 47.821 1.00 24.77  ? 320  LEU A C   1 
ATOM   2463 O O   . LEU A 1 317 ? 13.484  66.637 48.027 1.00 25.06  ? 320  LEU A O   1 
ATOM   2464 C CB  . LEU A 1 317 ? 15.040  68.426 46.096 1.00 21.57  ? 320  LEU A CB  1 
ATOM   2465 C CG  . LEU A 1 317 ? 15.866  69.470 46.857 1.00 23.32  ? 320  LEU A CG  1 
ATOM   2466 C CD1 . LEU A 1 317 ? 15.998  70.743 46.048 1.00 19.62  ? 320  LEU A CD1 1 
ATOM   2467 C CD2 . LEU A 1 317 ? 15.219  69.771 48.191 1.00 25.40  ? 320  LEU A CD2 1 
ATOM   2468 N N   . LEU A 1 318 ? 15.568  66.186 48.736 1.00 22.88  ? 321  LEU A N   1 
ATOM   2469 C CA  . LEU A 1 318 ? 15.122  65.795 50.062 1.00 22.82  ? 321  LEU A CA  1 
ATOM   2470 C C   . LEU A 1 318 ? 16.163  66.045 51.146 1.00 25.76  ? 321  LEU A C   1 
ATOM   2471 O O   . LEU A 1 318 ? 17.340  66.303 50.870 1.00 24.51  ? 321  LEU A O   1 
ATOM   2472 C CB  . LEU A 1 318 ? 14.719  64.317 50.064 1.00 20.92  ? 321  LEU A CB  1 
ATOM   2473 C CG  . LEU A 1 318 ? 15.812  63.247 49.963 1.00 20.02  ? 321  LEU A CG  1 
ATOM   2474 C CD1 . LEU A 1 318 ? 15.157  61.865 50.014 1.00 16.87  ? 321  LEU A CD1 1 
ATOM   2475 C CD2 . LEU A 1 318 ? 16.635  63.411 48.689 1.00 19.65  ? 321  LEU A CD2 1 
ATOM   2476 N N   . GLY A 1 319 ? 15.716  65.977 52.392 1.00 24.72  ? 322  GLY A N   1 
ATOM   2477 C CA  . GLY A 1 319 ? 16.631  66.198 53.486 1.00 25.16  ? 322  GLY A CA  1 
ATOM   2478 C C   . GLY A 1 319 ? 15.935  66.115 54.816 1.00 25.21  ? 322  GLY A C   1 
ATOM   2479 O O   . GLY A 1 319 ? 14.733  65.849 54.884 1.00 23.94  ? 322  GLY A O   1 
ATOM   2480 N N   . VAL A 1 320 ? 16.702  66.375 55.870 1.00 26.00  ? 323  VAL A N   1 
ATOM   2481 C CA  . VAL A 1 320 ? 16.201  66.326 57.236 1.00 23.57  ? 323  VAL A CA  1 
ATOM   2482 C C   . VAL A 1 320 ? 16.676  67.530 58.041 1.00 24.04  ? 323  VAL A C   1 
ATOM   2483 O O   . VAL A 1 320 ? 17.493  68.320 57.581 1.00 24.01  ? 323  VAL A O   1 
ATOM   2484 C CB  . VAL A 1 320 ? 16.716  65.061 57.961 1.00 20.67  ? 323  VAL A CB  1 
ATOM   2485 C CG1 . VAL A 1 320 ? 16.231  63.796 57.260 1.00 18.73  ? 323  VAL A CG1 1 
ATOM   2486 C CG2 . VAL A 1 320 ? 18.241  65.084 58.024 1.00 19.33  ? 323  VAL A CG2 1 
ATOM   2487 N N   . ASN A 1 321 ? 16.099  67.680 59.227 1.00 24.81  ? 324  ASN A N   1 
ATOM   2488 C CA  . ASN A 1 321 ? 16.475  68.728 60.163 1.00 25.03  ? 324  ASN A CA  1 
ATOM   2489 C C   . ASN A 1 321 ? 17.403  68.067 61.178 1.00 25.94  ? 324  ASN A C   1 
ATOM   2490 O O   . ASN A 1 321 ? 17.330  66.854 61.408 1.00 25.24  ? 324  ASN A O   1 
ATOM   2491 C CB  . ASN A 1 321 ? 15.250  69.298 60.870 1.00 23.51  ? 324  ASN A CB  1 
ATOM   2492 C CG  . ASN A 1 321 ? 14.458  70.234 59.992 1.00 26.69  ? 324  ASN A CG  1 
ATOM   2493 O OD1 . ASN A 1 321 ? 14.739  70.380 58.798 1.00 29.48  ? 324  ASN A OD1 1 
ATOM   2494 N ND2 . ASN A 1 321 ? 13.470  70.893 60.579 1.00 24.57  ? 324  ASN A ND2 1 
ATOM   2495 N N   . LYS A 1 322 ? 18.259  68.866 61.800 1.00 27.18  ? 325  LYS A N   1 
ATOM   2496 C CA  . LYS A 1 322 ? 19.221  68.352 62.767 1.00 28.06  ? 325  LYS A CA  1 
ATOM   2497 C C   . LYS A 1 322 ? 18.636  67.571 63.943 1.00 26.41  ? 325  LYS A C   1 
ATOM   2498 O O   . LYS A 1 322 ? 19.124  66.494 64.267 1.00 27.03  ? 325  LYS A O   1 
ATOM   2499 C CB  . LYS A 1 322 ? 20.100  69.490 63.294 1.00 28.50  ? 325  LYS A CB  1 
ATOM   2500 C CG  . LYS A 1 322 ? 21.233  69.016 64.163 1.00 27.84  ? 325  LYS A CG  1 
ATOM   2501 C CD  . LYS A 1 322 ? 21.963  70.175 64.813 1.00 32.59  ? 325  LYS A CD  1 
ATOM   2502 C CE  . LYS A 1 322 ? 23.085  69.666 65.709 1.00 32.29  ? 325  LYS A CE  1 
ATOM   2503 N NZ  . LYS A 1 322 ? 22.559  68.744 66.761 1.00 40.13  ? 325  LYS A NZ  1 
ATOM   2504 N N   . ASP A 1 323 ? 17.575  68.086 64.558 1.00 28.11  ? 326  ASP A N   1 
ATOM   2505 C CA  . ASP A 1 323 ? 17.000  67.414 65.720 1.00 30.89  ? 326  ASP A CA  1 
ATOM   2506 C C   . ASP A 1 323 ? 15.599  66.860 65.511 1.00 31.95  ? 326  ASP A C   1 
ATOM   2507 O O   . ASP A 1 323 ? 14.603  67.446 65.950 1.00 34.91  ? 326  ASP A O   1 
ATOM   2508 C CB  . ASP A 1 323 ? 17.083  68.341 66.935 1.00 31.00  ? 326  ASP A CB  1 
ATOM   2509 C CG  . ASP A 1 323 ? 18.521  68.799 67.214 1.00 33.51  ? 326  ASP A CG  1 
ATOM   2510 O OD1 . ASP A 1 323 ? 19.335  67.981 67.714 1.00 35.80  ? 326  ASP A OD1 1 
ATOM   2511 O OD2 . ASP A 1 323 ? 18.850  69.963 66.891 1.00 31.07  ? 326  ASP A OD2 1 
ATOM   2512 N N   . GLU A 1 324 ? 15.570  65.669 64.913 1.00 30.31  ? 327  GLU A N   1 
ATOM   2513 C CA  . GLU A 1 324 ? 14.350  64.940 64.564 1.00 30.25  ? 327  GLU A CA  1 
ATOM   2514 C C   . GLU A 1 324 ? 13.688  64.118 65.669 1.00 30.64  ? 327  GLU A C   1 
ATOM   2515 O O   . GLU A 1 324 ? 12.679  63.451 65.425 1.00 33.33  ? 327  GLU A O   1 
ATOM   2516 C CB  . GLU A 1 324 ? 14.644  63.995 63.389 1.00 28.44  ? 327  GLU A CB  1 
ATOM   2517 C CG  . GLU A 1 324 ? 15.053  64.669 62.091 1.00 23.74  ? 327  GLU A CG  1 
ATOM   2518 C CD  . GLU A 1 324 ? 13.882  65.233 61.318 1.00 25.79  ? 327  GLU A CD  1 
ATOM   2519 O OE1 . GLU A 1 324 ? 12.719  65.056 61.729 1.00 28.14  ? 327  GLU A OE1 1 
ATOM   2520 O OE2 . GLU A 1 324 ? 14.127  65.848 60.273 1.00 27.22  ? 327  GLU A OE2 1 
ATOM   2521 N N   . GLY A 1 325 ? 14.256  64.120 66.866 1.00 31.34  ? 328  GLY A N   1 
ATOM   2522 C CA  . GLY A 1 325 ? 13.659  63.332 67.928 1.00 30.12  ? 328  GLY A CA  1 
ATOM   2523 C C   . GLY A 1 325 ? 13.094  64.095 69.106 1.00 28.93  ? 328  GLY A C   1 
ATOM   2524 O O   . GLY A 1 325 ? 12.179  63.612 69.763 1.00 29.12  ? 328  GLY A O   1 
ATOM   2525 N N   . SER A 1 326 ? 13.588  65.308 69.331 1.00 29.85  ? 329  SER A N   1 
ATOM   2526 C CA  . SER A 1 326 ? 13.169  66.119 70.468 1.00 29.41  ? 329  SER A CA  1 
ATOM   2527 C C   . SER A 1 326 ? 11.673  66.247 70.710 1.00 30.09  ? 329  SER A C   1 
ATOM   2528 O O   . SER A 1 326 ? 11.227  66.260 71.861 1.00 32.79  ? 329  SER A O   1 
ATOM   2529 C CB  . SER A 1 326 ? 13.810  67.505 70.402 1.00 29.45  ? 329  SER A CB  1 
ATOM   2530 O OG  . SER A 1 326 ? 13.365  68.219 69.268 1.00 34.58  ? 329  SER A OG  1 
ATOM   2531 N N   . PHE A 1 327 ? 10.892  66.313 69.641 1.00 30.31  ? 330  PHE A N   1 
ATOM   2532 C CA  . PHE A 1 327 ? 9.450   66.455 69.785 1.00 30.84  ? 330  PHE A CA  1 
ATOM   2533 C C   . PHE A 1 327 ? 8.744   65.294 70.463 1.00 31.12  ? 330  PHE A C   1 
ATOM   2534 O O   . PHE A 1 327 ? 7.926   65.490 71.363 1.00 33.45  ? 330  PHE A O   1 
ATOM   2535 C CB  . PHE A 1 327 ? 8.794   66.720 68.434 1.00 33.21  ? 330  PHE A CB  1 
ATOM   2536 C CG  . PHE A 1 327 ? 7.989   67.965 68.418 1.00 39.38  ? 330  PHE A CG  1 
ATOM   2537 C CD1 . PHE A 1 327 ? 8.331   69.013 67.578 1.00 43.93  ? 330  PHE A CD1 1 
ATOM   2538 C CD2 . PHE A 1 327 ? 6.956   68.142 69.330 1.00 40.02  ? 330  PHE A CD2 1 
ATOM   2539 C CE1 . PHE A 1 327 ? 7.665   70.237 67.653 1.00 45.47  ? 330  PHE A CE1 1 
ATOM   2540 C CE2 . PHE A 1 327 ? 6.283   69.352 69.415 1.00 42.63  ? 330  PHE A CE2 1 
ATOM   2541 C CZ  . PHE A 1 327 ? 6.640   70.405 68.578 1.00 44.24  ? 330  PHE A CZ  1 
ATOM   2542 N N   . PHE A 1 328 ? 9.070   64.084 70.037 1.00 30.04  ? 331  PHE A N   1 
ATOM   2543 C CA  . PHE A 1 328 ? 8.436   62.895 70.577 1.00 30.38  ? 331  PHE A CA  1 
ATOM   2544 C C   . PHE A 1 328 ? 8.974   62.504 71.942 1.00 29.21  ? 331  PHE A C   1 
ATOM   2545 O O   . PHE A 1 328 ? 8.291   61.837 72.714 1.00 30.62  ? 331  PHE A O   1 
ATOM   2546 C CB  . PHE A 1 328 ? 8.516   61.775 69.540 1.00 32.16  ? 331  PHE A CB  1 
ATOM   2547 C CG  . PHE A 1 328 ? 7.974   62.194 68.199 1.00 33.67  ? 331  PHE A CG  1 
ATOM   2548 C CD1 . PHE A 1 328 ? 8.780   62.892 67.295 1.00 35.46  ? 331  PHE A CD1 1 
ATOM   2549 C CD2 . PHE A 1 328 ? 6.631   62.011 67.889 1.00 32.26  ? 331  PHE A CD2 1 
ATOM   2550 C CE1 . PHE A 1 328 ? 8.254   63.408 66.110 1.00 34.62  ? 331  PHE A CE1 1 
ATOM   2551 C CE2 . PHE A 1 328 ? 6.096   62.521 66.708 1.00 33.46  ? 331  PHE A CE2 1 
ATOM   2552 C CZ  . PHE A 1 328 ? 6.911   63.223 65.818 1.00 32.97  ? 331  PHE A CZ  1 
ATOM   2553 N N   . LEU A 1 329 ? 10.186  62.956 72.248 1.00 26.85  ? 332  LEU A N   1 
ATOM   2554 C CA  . LEU A 1 329 ? 10.782  62.700 73.549 1.00 24.78  ? 332  LEU A CA  1 
ATOM   2555 C C   . LEU A 1 329 ? 10.066  63.618 74.541 1.00 25.65  ? 332  LEU A C   1 
ATOM   2556 O O   . LEU A 1 329 ? 9.628   63.173 75.601 1.00 27.39  ? 332  LEU A O   1 
ATOM   2557 C CB  . LEU A 1 329 ? 12.278  62.993 73.519 1.00 22.07  ? 332  LEU A CB  1 
ATOM   2558 C CG  . LEU A 1 329 ? 13.095  61.942 72.774 1.00 21.55  ? 332  LEU A CG  1 
ATOM   2559 C CD1 . LEU A 1 329 ? 14.484  62.470 72.518 1.00 21.43  ? 332  LEU A CD1 1 
ATOM   2560 C CD2 . LEU A 1 329 ? 13.140  60.647 73.575 1.00 18.18  ? 332  LEU A CD2 1 
ATOM   2561 N N   . LEU A 1 330 ? 9.896   64.884 74.161 1.00 24.87  ? 333  LEU A N   1 
ATOM   2562 C CA  . LEU A 1 330 ? 9.204   65.855 75.000 1.00 26.74  ? 333  LEU A CA  1 
ATOM   2563 C C   . LEU A 1 330 ? 7.807   65.350 75.356 1.00 28.90  ? 333  LEU A C   1 
ATOM   2564 O O   . LEU A 1 330 ? 7.411   65.364 76.518 1.00 29.60  ? 333  LEU A O   1 
ATOM   2565 C CB  . LEU A 1 330 ? 9.076   67.200 74.276 1.00 27.75  ? 333  LEU A CB  1 
ATOM   2566 C CG  . LEU A 1 330 ? 8.153   68.216 74.968 1.00 28.83  ? 333  LEU A CG  1 
ATOM   2567 C CD1 . LEU A 1 330 ? 8.662   68.511 76.368 1.00 25.02  ? 333  LEU A CD1 1 
ATOM   2568 C CD2 . LEU A 1 330 ? 8.050   69.490 74.163 1.00 24.69  ? 333  LEU A CD2 1 
ATOM   2569 N N   . TYR A 1 331 ? 7.078   64.895 74.344 1.00 28.37  ? 334  TYR A N   1 
ATOM   2570 C CA  . TYR A 1 331 ? 5.726   64.395 74.528 1.00 27.46  ? 334  TYR A CA  1 
ATOM   2571 C C   . TYR A 1 331 ? 5.561   63.024 75.162 1.00 28.69  ? 334  TYR A C   1 
ATOM   2572 O O   . TYR A 1 331 ? 4.543   62.775 75.798 1.00 31.48  ? 334  TYR A O   1 
ATOM   2573 C CB  . TYR A 1 331 ? 4.962   64.427 73.207 1.00 22.89  ? 334  TYR A CB  1 
ATOM   2574 C CG  . TYR A 1 331 ? 4.464   65.799 72.842 1.00 21.68  ? 334  TYR A CG  1 
ATOM   2575 C CD1 . TYR A 1 331 ? 5.349   66.833 72.563 1.00 21.73  ? 334  TYR A CD1 1 
ATOM   2576 C CD2 . TYR A 1 331 ? 3.102   66.072 72.804 1.00 21.90  ? 334  TYR A CD2 1 
ATOM   2577 C CE1 . TYR A 1 331 ? 4.890   68.108 72.260 1.00 21.65  ? 334  TYR A CE1 1 
ATOM   2578 C CE2 . TYR A 1 331 ? 2.634   67.345 72.502 1.00 22.32  ? 334  TYR A CE2 1 
ATOM   2579 C CZ  . TYR A 1 331 ? 3.531   68.357 72.233 1.00 23.66  ? 334  TYR A CZ  1 
ATOM   2580 O OH  . TYR A 1 331 ? 3.060   69.616 71.956 1.00 21.80  ? 334  TYR A OH  1 
ATOM   2581 N N   . GLY A 1 332 ? 6.548   62.144 75.042 1.00 29.21  ? 335  GLY A N   1 
ATOM   2582 C CA  . GLY A 1 332 ? 6.366   60.820 75.617 1.00 31.07  ? 335  GLY A CA  1 
ATOM   2583 C C   . GLY A 1 332 ? 7.442   60.176 76.470 1.00 31.55  ? 335  GLY A C   1 
ATOM   2584 O O   . GLY A 1 332 ? 7.166   59.202 77.176 1.00 33.83  ? 335  GLY A O   1 
ATOM   2585 N N   . ALA A 1 333 ? 8.664   60.686 76.404 1.00 29.64  ? 336  ALA A N   1 
ATOM   2586 C CA  . ALA A 1 333 ? 9.751   60.110 77.176 1.00 28.70  ? 336  ALA A CA  1 
ATOM   2587 C C   . ALA A 1 333 ? 9.868   60.677 78.582 1.00 30.56  ? 336  ALA A C   1 
ATOM   2588 O O   . ALA A 1 333 ? 9.684   61.873 78.808 1.00 30.49  ? 336  ALA A O   1 
ATOM   2589 C CB  . ALA A 1 333 ? 11.062  60.280 76.438 1.00 28.37  ? 336  ALA A CB  1 
ATOM   2590 N N   . PRO A 1 334 ? 10.171  59.813 79.555 1.00 31.48  ? 337  PRO A N   1 
ATOM   2591 C CA  . PRO A 1 334 ? 10.320  60.243 80.945 1.00 32.74  ? 337  PRO A CA  1 
ATOM   2592 C C   . PRO A 1 334 ? 11.542  61.152 81.105 1.00 32.59  ? 337  PRO A C   1 
ATOM   2593 O O   . PRO A 1 334 ? 12.593  60.901 80.514 1.00 31.22  ? 337  PRO A O   1 
ATOM   2594 C CB  . PRO A 1 334 ? 10.521  58.918 81.684 1.00 33.24  ? 337  PRO A CB  1 
ATOM   2595 C CG  . PRO A 1 334 ? 11.206  58.055 80.659 1.00 31.30  ? 337  PRO A CG  1 
ATOM   2596 C CD  . PRO A 1 334 ? 10.390  58.360 79.430 1.00 33.19  ? 337  PRO A CD  1 
ATOM   2597 N N   . GLY A 1 335 ? 11.387  62.225 81.875 1.00 31.63  ? 338  GLY A N   1 
ATOM   2598 C CA  . GLY A 1 335 ? 12.497  63.133 82.102 1.00 29.27  ? 338  GLY A CA  1 
ATOM   2599 C C   . GLY A 1 335 ? 12.499  64.374 81.232 1.00 28.49  ? 338  GLY A C   1 
ATOM   2600 O O   . GLY A 1 335 ? 13.296  65.286 81.454 1.00 29.85  ? 338  GLY A O   1 
ATOM   2601 N N   . PHE A 1 336 ? 11.628  64.413 80.232 1.00 25.66  ? 339  PHE A N   1 
ATOM   2602 C CA  . PHE A 1 336 ? 11.562  65.565 79.355 1.00 23.53  ? 339  PHE A CA  1 
ATOM   2603 C C   . PHE A 1 336 ? 10.367  66.417 79.688 1.00 25.29  ? 339  PHE A C   1 
ATOM   2604 O O   . PHE A 1 336 ? 9.280   65.908 79.951 1.00 28.38  ? 339  PHE A O   1 
ATOM   2605 C CB  . PHE A 1 336 ? 11.452  65.134 77.897 1.00 23.55  ? 339  PHE A CB  1 
ATOM   2606 C CG  . PHE A 1 336 ? 12.641  64.399 77.399 1.00 18.81  ? 339  PHE A CG  1 
ATOM   2607 C CD1 . PHE A 1 336 ? 13.652  65.070 76.737 1.00 19.14  ? 339  PHE A CD1 1 
ATOM   2608 C CD2 . PHE A 1 336 ? 12.748  63.029 77.580 1.00 19.08  ? 339  PHE A CD2 1 
ATOM   2609 C CE1 . PHE A 1 336 ? 14.759  64.388 76.257 1.00 18.09  ? 339  PHE A CE1 1 
ATOM   2610 C CE2 . PHE A 1 336 ? 13.845  62.339 77.108 1.00 17.52  ? 339  PHE A CE2 1 
ATOM   2611 C CZ  . PHE A 1 336 ? 14.856  63.016 76.442 1.00 17.81  ? 339  PHE A CZ  1 
ATOM   2612 N N   . SER A 1 337 ? 10.582  67.724 79.677 1.00 25.80  ? 340  SER A N   1 
ATOM   2613 C CA  . SER A 1 337 ? 9.524   68.683 79.933 1.00 26.91  ? 340  SER A CA  1 
ATOM   2614 C C   . SER A 1 337 ? 9.888   69.971 79.211 1.00 27.15  ? 340  SER A C   1 
ATOM   2615 O O   . SER A 1 337 ? 11.065  70.308 79.055 1.00 28.61  ? 340  SER A O   1 
ATOM   2616 C CB  . SER A 1 337 ? 9.306   68.903 81.434 1.00 26.21  ? 340  SER A CB  1 
ATOM   2617 O OG  . SER A 1 337 ? 10.481  69.348 82.071 1.00 33.86  ? 340  SER A OG  1 
ATOM   2618 N N   . LYS A 1 338 ? 8.866   70.640 78.698 1.00 28.03  ? 341  LYS A N   1 
ATOM   2619 C CA  . LYS A 1 338 ? 9.028   71.866 77.943 1.00 27.81  ? 341  LYS A CA  1 
ATOM   2620 C C   . LYS A 1 338 ? 9.800   72.968 78.656 1.00 30.68  ? 341  LYS A C   1 
ATOM   2621 O O   . LYS A 1 338 ? 10.657  73.617 78.054 1.00 31.51  ? 341  LYS A O   1 
ATOM   2622 C CB  . LYS A 1 338 ? 7.649   72.391 77.536 1.00 27.38  ? 341  LYS A CB  1 
ATOM   2623 C CG  . LYS A 1 338 ? 7.690   73.444 76.438 1.00 29.98  ? 341  LYS A CG  1 
ATOM   2624 C CD  . LYS A 1 338 ? 6.299   73.920 76.032 1.00 30.14  ? 341  LYS A CD  1 
ATOM   2625 C CE  . LYS A 1 338 ? 5.661   74.788 77.104 1.00 31.16  ? 341  LYS A CE  1 
ATOM   2626 N NZ  . LYS A 1 338 ? 6.463   76.014 77.376 1.00 31.70  ? 341  LYS A NZ  1 
ATOM   2627 N N   . ASP A 1 339 ? 9.545   73.129 79.952 1.00 30.89  ? 342  ASP A N   1 
ATOM   2628 C CA  . ASP A 1 339 ? 10.159  74.201 80.726 1.00 29.31  ? 342  ASP A CA  1 
ATOM   2629 C C   . ASP A 1 339 ? 11.466  73.975 81.486 1.00 29.12  ? 342  ASP A C   1 
ATOM   2630 O O   . ASP A 1 339 ? 11.863  74.803 82.301 1.00 29.73  ? 342  ASP A O   1 
ATOM   2631 C CB  . ASP A 1 339 ? 9.101   74.833 81.629 1.00 31.31  ? 342  ASP A CB  1 
ATOM   2632 C CG  . ASP A 1 339 ? 7.920   75.396 80.839 1.00 33.93  ? 342  ASP A CG  1 
ATOM   2633 O OD1 . ASP A 1 339 ? 8.031   75.569 79.603 1.00 31.84  ? 342  ASP A OD1 1 
ATOM   2634 O OD2 . ASP A 1 339 ? 6.871   75.664 81.460 1.00 35.50  ? 342  ASP A OD2 1 
ATOM   2635 N N   . SER A 1 340 ? 12.141  72.868 81.218 1.00 29.70  ? 343  SER A N   1 
ATOM   2636 C CA  . SER A 1 340 ? 13.422  72.601 81.857 1.00 29.42  ? 343  SER A CA  1 
ATOM   2637 C C   . SER A 1 340 ? 14.372  72.167 80.750 1.00 30.68  ? 343  SER A C   1 
ATOM   2638 O O   . SER A 1 340 ? 13.934  71.898 79.632 1.00 31.38  ? 343  SER A O   1 
ATOM   2639 C CB  . SER A 1 340 ? 13.295  71.498 82.907 1.00 27.98  ? 343  SER A CB  1 
ATOM   2640 O OG  . SER A 1 340 ? 13.032  70.246 82.310 1.00 33.80  ? 343  SER A OG  1 
ATOM   2641 N N   . GLU A 1 341 ? 15.665  72.100 81.055 1.00 33.19  ? 344  GLU A N   1 
ATOM   2642 C CA  . GLU A 1 341 ? 16.664  71.694 80.070 1.00 35.50  ? 344  GLU A CA  1 
ATOM   2643 C C   . GLU A 1 341 ? 16.618  70.202 79.774 1.00 35.66  ? 344  GLU A C   1 
ATOM   2644 O O   . GLU A 1 341 ? 17.377  69.706 78.942 1.00 35.83  ? 344  GLU A O   1 
ATOM   2645 C CB  . GLU A 1 341 ? 18.063  72.071 80.538 1.00 40.50  ? 344  GLU A CB  1 
ATOM   2646 C CG  . GLU A 1 341 ? 18.312  73.560 80.591 1.00 51.76  ? 344  GLU A CG  1 
ATOM   2647 C CD  . GLU A 1 341 ? 19.770  73.890 80.866 1.00 62.14  ? 344  GLU A CD  1 
ATOM   2648 O OE1 . GLU A 1 341 ? 20.331  74.733 80.130 1.00 68.69  ? 344  GLU A OE1 1 
ATOM   2649 O OE2 . GLU A 1 341 ? 20.358  73.307 81.810 1.00 67.04  ? 344  GLU A OE2 1 
ATOM   2650 N N   . SER A 1 342 ? 15.754  69.494 80.497 1.00 34.64  ? 345  SER A N   1 
ATOM   2651 C CA  . SER A 1 342 ? 15.556  68.059 80.335 1.00 33.01  ? 345  SER A CA  1 
ATOM   2652 C C   . SER A 1 342 ? 16.820  67.210 80.319 1.00 34.49  ? 345  SER A C   1 
ATOM   2653 O O   . SER A 1 342 ? 16.994  66.358 79.441 1.00 35.69  ? 345  SER A O   1 
ATOM   2654 C CB  . SER A 1 342 ? 14.706  67.775 79.094 1.00 30.53  ? 345  SER A CB  1 
ATOM   2655 O OG  . SER A 1 342 ? 13.399  68.293 79.264 1.00 32.41  ? 345  SER A OG  1 
ATOM   2656 N N   . LYS A 1 343 ? 17.702  67.445 81.288 1.00 33.40  ? 346  LYS A N   1 
ATOM   2657 C CA  . LYS A 1 343 ? 18.927  66.666 81.396 1.00 33.53  ? 346  LYS A CA  1 
ATOM   2658 C C   . LYS A 1 343 ? 18.506  65.268 81.836 1.00 32.92  ? 346  LYS A C   1 
ATOM   2659 O O   . LYS A 1 343 ? 17.846  65.091 82.858 1.00 32.08  ? 346  LYS A O   1 
ATOM   2660 C CB  . LYS A 1 343 ? 19.889  67.312 82.386 1.00 35.04  ? 346  LYS A CB  1 
ATOM   2661 C CG  . LYS A 1 343 ? 20.456  68.621 81.869 1.00 36.81  ? 346  LYS A CG  1 
ATOM   2662 C CD  . LYS A 1 343 ? 21.346  69.272 82.895 1.00 41.67  ? 346  LYS A CD  1 
ATOM   2663 C CE  . LYS A 1 343 ? 21.795  70.636 82.424 1.00 43.26  ? 346  LYS A CE  1 
ATOM   2664 N NZ  . LYS A 1 343 ? 22.402  71.401 83.547 1.00 49.91  ? 346  LYS A NZ  1 
ATOM   2665 N N   . ILE A 1 344 ? 18.852  64.283 81.022 1.00 31.67  ? 347  ILE A N   1 
ATOM   2666 C CA  . ILE A 1 344 ? 18.450  62.911 81.272 1.00 32.13  ? 347  ILE A CA  1 
ATOM   2667 C C   . ILE A 1 344 ? 19.439  62.042 82.051 1.00 32.15  ? 347  ILE A C   1 
ATOM   2668 O O   . ILE A 1 344 ? 20.646  62.066 81.812 1.00 31.28  ? 347  ILE A O   1 
ATOM   2669 C CB  . ILE A 1 344 ? 18.041  62.241 79.913 1.00 32.00  ? 347  ILE A CB  1 
ATOM   2670 C CG1 . ILE A 1 344 ? 16.917  63.051 79.257 1.00 30.64  ? 347  ILE A CG1 1 
ATOM   2671 C CG2 . ILE A 1 344 ? 17.575  60.810 80.106 1.00 32.16  ? 347  ILE A CG2 1 
ATOM   2672 C CD1 . ILE A 1 344 ? 15.715  63.295 80.154 1.00 24.78  ? 347  ILE A CD1 1 
ATOM   2673 N N   . SER A 1 345 ? 18.898  61.280 82.994 1.00 32.46  ? 348  SER A N   1 
ATOM   2674 C CA  . SER A 1 345 ? 19.683  60.369 83.813 1.00 34.38  ? 348  SER A CA  1 
ATOM   2675 C C   . SER A 1 345 ? 19.885  59.061 83.053 1.00 35.48  ? 348  SER A C   1 
ATOM   2676 O O   . SER A 1 345 ? 19.232  58.820 82.042 1.00 36.13  ? 348  SER A O   1 
ATOM   2677 C CB  . SER A 1 345 ? 18.930  60.074 85.109 1.00 35.10  ? 348  SER A CB  1 
ATOM   2678 O OG  . SER A 1 345 ? 17.722  59.380 84.849 1.00 33.32  ? 348  SER A OG  1 
ATOM   2679 N N   . ARG A 1 346 ? 20.778  58.214 83.552 1.00 35.66  ? 349  ARG A N   1 
ATOM   2680 C CA  . ARG A 1 346 ? 21.039  56.918 82.932 1.00 38.86  ? 349  ARG A CA  1 
ATOM   2681 C C   . ARG A 1 346 ? 19.768  56.078 82.928 1.00 39.59  ? 349  ARG A C   1 
ATOM   2682 O O   . ARG A 1 346 ? 19.507  55.329 81.987 1.00 41.55  ? 349  ARG A O   1 
ATOM   2683 C CB  . ARG A 1 346 ? 22.094  56.161 83.730 1.00 40.37  ? 349  ARG A CB  1 
ATOM   2684 C CG  . ARG A 1 346 ? 23.511  56.331 83.261 1.00 46.40  ? 349  ARG A CG  1 
ATOM   2685 C CD  . ARG A 1 346 ? 23.806  55.389 82.126 1.00 47.88  ? 349  ARG A CD  1 
ATOM   2686 N NE  . ARG A 1 346 ? 23.826  56.093 80.855 1.00 51.08  ? 349  ARG A NE  1 
ATOM   2687 C CZ  . ARG A 1 346 ? 23.698  55.499 79.676 1.00 53.90  ? 349  ARG A CZ  1 
ATOM   2688 N NH1 . ARG A 1 346 ? 23.530  54.183 79.602 1.00 53.34  ? 349  ARG A NH1 1 
ATOM   2689 N NH2 . ARG A 1 346 ? 23.771  56.222 78.570 1.00 55.61  ? 349  ARG A NH2 1 
ATOM   2690 N N   . GLU A 1 347 ? 18.990  56.219 83.997 1.00 40.79  ? 350  GLU A N   1 
ATOM   2691 C CA  . GLU A 1 347 ? 17.752  55.478 84.189 1.00 42.96  ? 350  GLU A CA  1 
ATOM   2692 C C   . GLU A 1 347 ? 16.732  55.846 83.132 1.00 42.54  ? 350  GLU A C   1 
ATOM   2693 O O   . GLU A 1 347 ? 16.143  54.968 82.498 1.00 43.08  ? 350  GLU A O   1 
ATOM   2694 C CB  . GLU A 1 347 ? 17.187  55.745 85.590 1.00 49.62  ? 350  GLU A CB  1 
ATOM   2695 C CG  . GLU A 1 347 ? 18.067  55.247 86.755 1.00 59.04  ? 350  GLU A CG  1 
ATOM   2696 C CD  . GLU A 1 347 ? 19.472  55.873 86.782 1.00 63.46  ? 350  GLU A CD  1 
ATOM   2697 O OE1 . GLU A 1 347 ? 19.589  57.111 86.951 1.00 64.38  ? 350  GLU A OE1 1 
ATOM   2698 O OE2 . GLU A 1 347 ? 20.465  55.122 86.631 1.00 66.95  ? 350  GLU A OE2 1 
ATOM   2699 N N   . ASP A 1 348 ? 16.534  57.147 82.940 1.00 41.35  ? 351  ASP A N   1 
ATOM   2700 C CA  . ASP A 1 348 ? 15.590  57.639 81.939 1.00 41.01  ? 351  ASP A CA  1 
ATOM   2701 C C   . ASP A 1 348 ? 16.100  57.429 80.519 1.00 39.38  ? 351  ASP A C   1 
ATOM   2702 O O   . ASP A 1 348 ? 15.317  57.285 79.581 1.00 39.01  ? 351  ASP A O   1 
ATOM   2703 C CB  . ASP A 1 348 ? 15.283  59.116 82.166 1.00 40.73  ? 351  ASP A CB  1 
ATOM   2704 C CG  . ASP A 1 348 ? 14.243  59.338 83.248 1.00 40.12  ? 351  ASP A CG  1 
ATOM   2705 O OD1 . ASP A 1 348 ? 13.548  58.372 83.635 1.00 38.32  ? 351  ASP A OD1 1 
ATOM   2706 O OD2 . ASP A 1 348 ? 14.113  60.495 83.696 1.00 40.46  ? 351  ASP A OD2 1 
ATOM   2707 N N   . PHE A 1 349 ? 17.417  57.409 80.366 1.00 37.09  ? 352  PHE A N   1 
ATOM   2708 C CA  . PHE A 1 349 ? 18.011  57.199 79.065 1.00 33.65  ? 352  PHE A CA  1 
ATOM   2709 C C   . PHE A 1 349 ? 17.576  55.839 78.558 1.00 33.77  ? 352  PHE A C   1 
ATOM   2710 O O   . PHE A 1 349 ? 17.048  55.719 77.462 1.00 36.89  ? 352  PHE A O   1 
ATOM   2711 C CB  . PHE A 1 349 ? 19.527  57.243 79.157 1.00 29.82  ? 352  PHE A CB  1 
ATOM   2712 C CG  . PHE A 1 349 ? 20.199  57.112 77.838 1.00 31.93  ? 352  PHE A CG  1 
ATOM   2713 C CD1 . PHE A 1 349 ? 20.247  58.193 76.963 1.00 31.89  ? 352  PHE A CD1 1 
ATOM   2714 C CD2 . PHE A 1 349 ? 20.748  55.899 77.443 1.00 31.31  ? 352  PHE A CD2 1 
ATOM   2715 C CE1 . PHE A 1 349 ? 20.830  58.068 75.711 1.00 32.25  ? 352  PHE A CE1 1 
ATOM   2716 C CE2 . PHE A 1 349 ? 21.337  55.759 76.192 1.00 32.83  ? 352  PHE A CE2 1 
ATOM   2717 C CZ  . PHE A 1 349 ? 21.378  56.846 75.322 1.00 33.73  ? 352  PHE A CZ  1 
ATOM   2718 N N   . MET A 1 350 ? 17.744  54.825 79.397 1.00 35.85  ? 353  MET A N   1 
ATOM   2719 C CA  . MET A 1 350 ? 17.386  53.462 79.036 1.00 36.40  ? 353  MET A CA  1 
ATOM   2720 C C   . MET A 1 350 ? 15.884  53.243 78.885 1.00 36.68  ? 353  MET A C   1 
ATOM   2721 O O   . MET A 1 350 ? 15.451  52.351 78.145 1.00 36.18  ? 353  MET A O   1 
ATOM   2722 C CB  . MET A 1 350 ? 17.994  52.485 80.034 1.00 40.28  ? 353  MET A CB  1 
ATOM   2723 C CG  . MET A 1 350 ? 19.502  52.629 80.147 1.00 45.06  ? 353  MET A CG  1 
ATOM   2724 S SD  . MET A 1 350 ? 20.225  51.322 81.128 1.00 60.69  ? 353  MET A SD  1 
ATOM   2725 C CE  . MET A 1 350 ? 19.512  51.694 82.779 1.00 58.39  ? 353  MET A CE  1 
ATOM   2726 N N   . SER A 1 351 ? 15.110  54.032 79.626 1.00 34.20  ? 354  SER A N   1 
ATOM   2727 C CA  . SER A 1 351 ? 13.663  53.971 79.462 1.00 34.62  ? 354  SER A CA  1 
ATOM   2728 C C   . SER A 1 351 ? 13.239  54.543 78.114 1.00 34.04  ? 354  SER A C   1 
ATOM   2729 O O   . SER A 1 351 ? 12.371  54.041 77.446 1.00 34.07  ? 354  SER A O   1 
ATOM   2730 C CB  . SER A 1 351 ? 12.962  54.712 80.602 1.00 31.74  ? 354  SER A CB  1 
ATOM   2731 O OG  . SER A 1 351 ? 13.225  54.094 81.850 1.00 43.37  ? 354  SER A OG  1 
ATOM   2732 N N   . GLY A 1 352 ? 14.000  55.590 77.730 1.00 30.83  ? 355  GLY A N   1 
ATOM   2733 C CA  . GLY A 1 352 ? 13.779  56.245 76.454 1.00 29.96  ? 355  GLY A CA  1 
ATOM   2734 C C   . GLY A 1 352 ? 14.132  55.319 75.305 1.00 30.81  ? 355  GLY A C   1 
ATOM   2735 O O   . GLY A 1 352 ? 13.363  55.190 74.352 1.00 29.51  ? 355  GLY A O   1 
ATOM   2736 N N   . VAL A 1 353 ? 15.279  54.650 75.416 1.00 28.98  ? 356  VAL A N   1 
ATOM   2737 C CA  . VAL A 1 353 ? 15.738  53.716 74.396 1.00 29.47  ? 356  VAL A CA  1 
ATOM   2738 C C   . VAL A 1 353 ? 14.678  52.653 74.157 1.00 32.80  ? 356  VAL A C   1 
ATOM   2739 O O   . VAL A 1 353 ? 14.379  52.310 73.011 1.00 35.24  ? 356  VAL A O   1 
ATOM   2740 C CB  . VAL A 1 353 ? 17.055  53.026 74.813 1.00 27.37  ? 356  VAL A CB  1 
ATOM   2741 C CG1 . VAL A 1 353 ? 17.347  51.846 73.903 1.00 27.16  ? 356  VAL A CG1 1 
ATOM   2742 C CG2 . VAL A 1 353 ? 18.204  54.013 74.754 1.00 23.44  ? 356  VAL A CG2 1 
ATOM   2743 N N   . LYS A 1 354 ? 14.094  52.160 75.245 1.00 35.94  ? 357  LYS A N   1 
ATOM   2744 C CA  . LYS A 1 354 ? 13.060  51.135 75.164 1.00 36.11  ? 357  LYS A CA  1 
ATOM   2745 C C   . LYS A 1 354 ? 11.808  51.662 74.448 1.00 35.92  ? 357  LYS A C   1 
ATOM   2746 O O   . LYS A 1 354 ? 11.197  50.946 73.651 1.00 35.65  ? 357  LYS A O   1 
ATOM   2747 C CB  . LYS A 1 354 ? 12.720  50.601 76.559 1.00 33.79  ? 357  LYS A CB  1 
ATOM   2748 C CG  . LYS A 1 354 ? 11.977  49.272 76.526 1.00 36.69  ? 357  LYS A CG  1 
ATOM   2749 C CD  . LYS A 1 354 ? 11.888  48.630 77.900 1.00 40.76  ? 357  LYS A CD  1 
ATOM   2750 N N   . LEU A 1 355 ? 11.450  52.919 74.707 1.00 34.38  ? 358  LEU A N   1 
ATOM   2751 C CA  . LEU A 1 355 ? 10.290  53.530 74.063 1.00 34.10  ? 358  LEU A CA  1 
ATOM   2752 C C   . LEU A 1 355 ? 10.563  53.816 72.582 1.00 34.51  ? 358  LEU A C   1 
ATOM   2753 O O   . LEU A 1 355 ? 9.654   53.768 71.755 1.00 35.46  ? 358  LEU A O   1 
ATOM   2754 C CB  . LEU A 1 355 ? 9.898   54.827 74.779 1.00 31.08  ? 358  LEU A CB  1 
ATOM   2755 C CG  . LEU A 1 355 ? 9.249   54.728 76.165 1.00 33.39  ? 358  LEU A CG  1 
ATOM   2756 C CD1 . LEU A 1 355 ? 9.086   56.120 76.775 1.00 30.95  ? 358  LEU A CD1 1 
ATOM   2757 C CD2 . LEU A 1 355 ? 7.898   54.031 76.064 1.00 31.68  ? 358  LEU A CD2 1 
ATOM   2758 N N   . SER A 1 356 ? 11.825  54.077 72.254 1.00 35.21  ? 359  SER A N   1 
ATOM   2759 C CA  . SER A 1 356 ? 12.245  54.393 70.888 1.00 34.20  ? 359  SER A CA  1 
ATOM   2760 C C   . SER A 1 356 ? 12.296  53.212 69.933 1.00 34.73  ? 359  SER A C   1 
ATOM   2761 O O   . SER A 1 356 ? 12.019  53.354 68.741 1.00 36.77  ? 359  SER A O   1 
ATOM   2762 C CB  . SER A 1 356 ? 13.616  55.059 70.916 1.00 35.42  ? 359  SER A CB  1 
ATOM   2763 O OG  . SER A 1 356 ? 13.569  56.243 71.685 1.00 39.76  ? 359  SER A OG  1 
ATOM   2764 N N   . VAL A 1 357 ? 12.706  52.058 70.444 1.00 32.89  ? 360  VAL A N   1 
ATOM   2765 C CA  . VAL A 1 357 ? 12.798  50.858 69.628 1.00 33.55  ? 360  VAL A CA  1 
ATOM   2766 C C   . VAL A 1 357 ? 11.811  49.852 70.213 1.00 36.40  ? 360  VAL A C   1 
ATOM   2767 O O   . VAL A 1 357 ? 12.216  48.843 70.793 1.00 34.38  ? 360  VAL A O   1 
ATOM   2768 C CB  . VAL A 1 357 ? 14.219  50.276 69.669 1.00 32.92  ? 360  VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 357 ? 14.424  49.340 68.500 1.00 36.07  ? 360  VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 357 ? 15.249  51.391 69.647 1.00 32.99  ? 360  VAL A CG2 1 
ATOM   2771 N N   . PRO A 1 358 ? 10.499  50.095 70.007 1.00 39.41  ? 361  PRO A N   1 
ATOM   2772 C CA  . PRO A 1 358 ? 9.346   49.309 70.465 1.00 42.56  ? 361  PRO A CA  1 
ATOM   2773 C C   . PRO A 1 358 ? 9.499   47.799 70.583 1.00 46.03  ? 361  PRO A C   1 
ATOM   2774 O O   . PRO A 1 358 ? 9.352   47.253 71.676 1.00 47.46  ? 361  PRO A O   1 
ATOM   2775 C CB  . PRO A 1 358 ? 8.254   49.708 69.479 1.00 42.46  ? 361  PRO A CB  1 
ATOM   2776 C CG  . PRO A 1 358 ? 8.549   51.136 69.253 1.00 39.69  ? 361  PRO A CG  1 
ATOM   2777 C CD  . PRO A 1 358 ? 10.048  51.118 69.043 1.00 40.18  ? 361  PRO A CD  1 
ATOM   2778 N N   . HIS A 1 359 ? 9.762   47.103 69.485 1.00 50.44  ? 362  HIS A N   1 
ATOM   2779 C CA  . HIS A 1 359 ? 9.903   45.662 69.619 1.00 58.06  ? 362  HIS A CA  1 
ATOM   2780 C C   . HIS A 1 359 ? 11.310  45.142 69.377 1.00 57.73  ? 362  HIS A C   1 
ATOM   2781 O O   . HIS A 1 359 ? 11.565  44.354 68.454 1.00 59.50  ? 362  HIS A O   1 
ATOM   2782 C CB  . HIS A 1 359 ? 8.875   44.900 68.781 1.00 66.09  ? 362  HIS A CB  1 
ATOM   2783 C CG  . HIS A 1 359 ? 8.423   43.620 69.422 1.00 72.61  ? 362  HIS A CG  1 
ATOM   2784 N ND1 . HIS A 1 359 ? 8.158   42.474 68.701 1.00 75.32  ? 362  HIS A ND1 1 
ATOM   2785 C CD2 . HIS A 1 359 ? 8.209   43.307 70.722 1.00 73.00  ? 362  HIS A CD2 1 
ATOM   2786 C CE1 . HIS A 1 359 ? 7.801   41.509 69.532 1.00 76.23  ? 362  HIS A CE1 1 
ATOM   2787 N NE2 . HIS A 1 359 ? 7.823   41.987 70.763 1.00 75.04  ? 362  HIS A NE2 1 
ATOM   2788 N N   . ALA A 1 360 ? 12.223  45.621 70.213 1.00 53.91  ? 363  ALA A N   1 
ATOM   2789 C CA  . ALA A 1 360 ? 13.613  45.211 70.159 1.00 49.92  ? 363  ALA A CA  1 
ATOM   2790 C C   . ALA A 1 360 ? 13.842  44.384 71.408 1.00 48.59  ? 363  ALA A C   1 
ATOM   2791 O O   . ALA A 1 360 ? 13.356  44.733 72.483 1.00 51.63  ? 363  ALA A O   1 
ATOM   2792 C CB  . ALA A 1 360 ? 14.521  46.424 70.167 1.00 47.49  ? 363  ALA A CB  1 
ATOM   2793 N N   . ASN A 1 361 ? 14.533  43.262 71.265 1.00 45.43  ? 364  ASN A N   1 
ATOM   2794 C CA  . ASN A 1 361 ? 14.826  42.423 72.416 1.00 41.72  ? 364  ASN A CA  1 
ATOM   2795 C C   . ASN A 1 361 ? 15.903  43.104 73.252 1.00 40.06  ? 364  ASN A C   1 
ATOM   2796 O O   . ASN A 1 361 ? 16.447  44.130 72.844 1.00 39.14  ? 364  ASN A O   1 
ATOM   2797 C CB  . ASN A 1 361 ? 15.285  41.035 71.964 1.00 42.85  ? 364  ASN A CB  1 
ATOM   2798 C CG  . ASN A 1 361 ? 16.323  41.089 70.868 1.00 43.99  ? 364  ASN A CG  1 
ATOM   2799 O OD1 . ASN A 1 361 ? 17.176  41.974 70.840 1.00 44.74  ? 364  ASN A OD1 1 
ATOM   2800 N ND2 . ASN A 1 361 ? 16.249  40.144 69.947 1.00 44.45  ? 364  ASN A ND2 1 
ATOM   2801 N N   . ASP A 1 362 ? 16.200  42.542 74.420 1.00 39.62  ? 365  ASP A N   1 
ATOM   2802 C CA  . ASP A 1 362 ? 17.211  43.105 75.310 1.00 40.42  ? 365  ASP A CA  1 
ATOM   2803 C C   . ASP A 1 362 ? 18.523  43.349 74.592 1.00 37.85  ? 365  ASP A C   1 
ATOM   2804 O O   . ASP A 1 362 ? 19.136  44.396 74.767 1.00 38.33  ? 365  ASP A O   1 
ATOM   2805 C CB  . ASP A 1 362 ? 17.452  42.193 76.519 1.00 46.49  ? 365  ASP A CB  1 
ATOM   2806 C CG  . ASP A 1 362 ? 16.352  42.293 77.570 1.00 51.13  ? 365  ASP A CG  1 
ATOM   2807 O OD1 . ASP A 1 362 ? 15.393  43.079 77.392 1.00 54.11  ? 365  ASP A OD1 1 
ATOM   2808 O OD2 . ASP A 1 362 ? 16.456  41.582 78.593 1.00 56.92  ? 365  ASP A OD2 1 
ATOM   2809 N N   . LEU A 1 363 ? 18.937  42.389 73.768 1.00 34.72  ? 366  LEU A N   1 
ATOM   2810 C CA  . LEU A 1 363 ? 20.177  42.508 73.015 1.00 31.94  ? 366  LEU A CA  1 
ATOM   2811 C C   . LEU A 1 363 ? 20.100  43.712 72.083 1.00 30.93  ? 366  LEU A C   1 
ATOM   2812 O O   . LEU A 1 363 ? 21.050  44.486 71.980 1.00 31.95  ? 366  LEU A O   1 
ATOM   2813 C CB  . LEU A 1 363 ? 20.437  41.232 72.216 1.00 32.65  ? 366  LEU A CB  1 
ATOM   2814 C CG  . LEU A 1 363 ? 21.753  41.174 71.434 1.00 36.30  ? 366  LEU A CG  1 
ATOM   2815 C CD1 . LEU A 1 363 ? 22.939  41.329 72.377 1.00 32.00  ? 366  LEU A CD1 1 
ATOM   2816 C CD2 . LEU A 1 363 ? 21.844  39.864 70.667 1.00 37.25  ? 366  LEU A CD2 1 
ATOM   2817 N N   . GLY A 1 364 ? 18.949  43.883 71.440 1.00 29.03  ? 367  GLY A N   1 
ATOM   2818 C CA  . GLY A 1 364 ? 18.756  45.002 70.536 1.00 29.98  ? 367  GLY A CA  1 
ATOM   2819 C C   . GLY A 1 364 ? 18.880  46.305 71.302 1.00 28.97  ? 367  GLY A C   1 
ATOM   2820 O O   . GLY A 1 364 ? 19.581  47.225 70.882 1.00 31.09  ? 367  GLY A O   1 
ATOM   2821 N N   . LEU A 1 365 ? 18.220  46.363 72.453 1.00 29.02  ? 368  LEU A N   1 
ATOM   2822 C CA  . LEU A 1 365 ? 18.261  47.542 73.302 1.00 29.01  ? 368  LEU A CA  1 
ATOM   2823 C C   . LEU A 1 365 ? 19.694  47.832 73.746 1.00 30.15  ? 368  LEU A C   1 
ATOM   2824 O O   . LEU A 1 365 ? 20.101  48.993 73.815 1.00 32.31  ? 368  LEU A O   1 
ATOM   2825 C CB  . LEU A 1 365 ? 17.344  47.350 74.511 1.00 27.89  ? 368  LEU A CB  1 
ATOM   2826 C CG  . LEU A 1 365 ? 15.852  47.216 74.184 1.00 30.52  ? 368  LEU A CG  1 
ATOM   2827 C CD1 . LEU A 1 365 ? 15.089  46.858 75.430 1.00 25.57  ? 368  LEU A CD1 1 
ATOM   2828 C CD2 . LEU A 1 365 ? 15.317  48.512 73.583 1.00 29.66  ? 368  LEU A CD2 1 
ATOM   2829 N N   . ASP A 1 366 ? 20.467  46.776 74.005 1.00 30.04  ? 369  ASP A N   1 
ATOM   2830 C CA  . ASP A 1 366 ? 21.863  46.927 74.418 1.00 31.50  ? 369  ASP A CA  1 
ATOM   2831 C C   . ASP A 1 366 ? 22.712  47.469 73.282 1.00 29.01  ? 369  ASP A C   1 
ATOM   2832 O O   . ASP A 1 366 ? 23.612  48.276 73.507 1.00 28.94  ? 369  ASP A O   1 
ATOM   2833 C CB  . ASP A 1 366 ? 22.454  45.594 74.884 1.00 33.19  ? 369  ASP A CB  1 
ATOM   2834 C CG  . ASP A 1 366 ? 21.951  45.172 76.252 1.00 37.16  ? 369  ASP A CG  1 
ATOM   2835 O OD1 . ASP A 1 366 ? 22.197  44.009 76.627 1.00 41.94  ? 369  ASP A OD1 1 
ATOM   2836 O OD2 . ASP A 1 366 ? 21.320  45.989 76.958 1.00 39.19  ? 369  ASP A OD2 1 
ATOM   2837 N N   . ALA A 1 367 ? 22.429  47.007 72.068 1.00 27.82  ? 370  ALA A N   1 
ATOM   2838 C CA  . ALA A 1 367 ? 23.157  47.453 70.891 1.00 26.43  ? 370  ALA A CA  1 
ATOM   2839 C C   . ALA A 1 367 ? 22.953  48.951 70.716 1.00 24.74  ? 370  ALA A C   1 
ATOM   2840 O O   . ALA A 1 367 ? 23.910  49.681 70.478 1.00 26.38  ? 370  ALA A O   1 
ATOM   2841 C CB  . ALA A 1 367 ? 22.685  46.698 69.655 1.00 25.31  ? 370  ALA A CB  1 
ATOM   2842 N N   . VAL A 1 368 ? 21.711  49.405 70.886 1.00 26.44  ? 371  VAL A N   1 
ATOM   2843 C CA  . VAL A 1 368 ? 21.372  50.826 70.751 1.00 26.96  ? 371  VAL A CA  1 
ATOM   2844 C C   . VAL A 1 368 ? 22.080  51.661 71.818 1.00 28.60  ? 371  VAL A C   1 
ATOM   2845 O O   . VAL A 1 368 ? 22.731  52.659 71.506 1.00 30.19  ? 371  VAL A O   1 
ATOM   2846 C CB  . VAL A 1 368 ? 19.838  51.071 70.870 1.00 25.75  ? 371  VAL A CB  1 
ATOM   2847 C CG1 . VAL A 1 368 ? 19.526  52.555 70.768 1.00 22.27  ? 371  VAL A CG1 1 
ATOM   2848 C CG2 . VAL A 1 368 ? 19.089  50.312 69.796 1.00 22.73  ? 371  VAL A CG2 1 
ATOM   2849 N N   . THR A 1 369 ? 21.976  51.227 73.071 1.00 28.93  ? 372  THR A N   1 
ATOM   2850 C CA  . THR A 1 369 ? 22.592  51.936 74.189 1.00 29.47  ? 372  THR A CA  1 
ATOM   2851 C C   . THR A 1 369 ? 24.105  52.070 74.036 1.00 28.37  ? 372  THR A C   1 
ATOM   2852 O O   . THR A 1 369 ? 24.650  53.164 74.164 1.00 28.28  ? 372  THR A O   1 
ATOM   2853 C CB  . THR A 1 369 ? 22.269  51.240 75.525 1.00 32.80  ? 372  THR A CB  1 
ATOM   2854 O OG1 . THR A 1 369 ? 20.850  51.088 75.637 1.00 35.77  ? 372  THR A OG1 1 
ATOM   2855 C CG2 . THR A 1 369 ? 22.762  52.076 76.704 1.00 31.20  ? 372  THR A CG2 1 
ATOM   2856 N N   . LEU A 1 370 ? 24.773  50.958 73.742 1.00 28.20  ? 373  LEU A N   1 
ATOM   2857 C CA  . LEU A 1 370 ? 26.222  50.957 73.560 1.00 27.23  ? 373  LEU A CA  1 
ATOM   2858 C C   . LEU A 1 370 ? 26.589  51.910 72.439 1.00 28.42  ? 373  LEU A C   1 
ATOM   2859 O O   . LEU A 1 370 ? 27.523  52.698 72.561 1.00 30.94  ? 373  LEU A O   1 
ATOM   2860 C CB  . LEU A 1 370 ? 26.713  49.554 73.194 1.00 25.98  ? 373  LEU A CB  1 
ATOM   2861 C CG  . LEU A 1 370 ? 28.198  49.400 72.876 1.00 25.24  ? 373  LEU A CG  1 
ATOM   2862 C CD1 . LEU A 1 370 ? 29.030  49.715 74.105 1.00 28.54  ? 373  LEU A CD1 1 
ATOM   2863 C CD2 . LEU A 1 370 ? 28.480  47.997 72.408 1.00 27.53  ? 373  LEU A CD2 1 
ATOM   2864 N N   . GLN A 1 371 ? 25.820  51.837 71.357 1.00 28.77  ? 374  GLN A N   1 
ATOM   2865 C CA  . GLN A 1 371 ? 26.034  52.654 70.175 1.00 26.73  ? 374  GLN A CA  1 
ATOM   2866 C C   . GLN A 1 371 ? 25.949  54.143 70.481 1.00 27.71  ? 374  GLN A C   1 
ATOM   2867 O O   . GLN A 1 371 ? 26.728  54.937 69.951 1.00 28.03  ? 374  GLN A O   1 
ATOM   2868 C CB  . GLN A 1 371 ? 25.005  52.285 69.106 1.00 26.38  ? 374  GLN A CB  1 
ATOM   2869 C CG  . GLN A 1 371 ? 25.242  52.922 67.759 1.00 27.08  ? 374  GLN A CG  1 
ATOM   2870 C CD  . GLN A 1 371 ? 26.469  52.378 67.051 1.00 31.90  ? 374  GLN A CD  1 
ATOM   2871 O OE1 . GLN A 1 371 ? 26.960  52.989 66.107 1.00 33.56  ? 374  GLN A OE1 1 
ATOM   2872 N NE2 . GLN A 1 371 ? 26.960  51.219 67.490 1.00 32.06  ? 374  GLN A NE2 1 
ATOM   2873 N N   . TYR A 1 372 ? 25.036  54.510 71.375 1.00 28.19  ? 375  TYR A N   1 
ATOM   2874 C CA  . TYR A 1 372 ? 24.831  55.910 71.731 1.00 27.77  ? 375  TYR A CA  1 
ATOM   2875 C C   . TYR A 1 372 ? 25.294  56.339 73.115 1.00 29.27  ? 375  TYR A C   1 
ATOM   2876 O O   . TYR A 1 372 ? 24.904  57.404 73.591 1.00 32.51  ? 375  TYR A O   1 
ATOM   2877 C CB  . TYR A 1 372 ? 23.358  56.275 71.556 1.00 24.91  ? 375  TYR A CB  1 
ATOM   2878 C CG  . TYR A 1 372 ? 22.937  56.368 70.113 1.00 24.47  ? 375  TYR A CG  1 
ATOM   2879 C CD1 . TYR A 1 372 ? 22.916  57.595 69.460 1.00 22.43  ? 375  TYR A CD1 1 
ATOM   2880 C CD2 . TYR A 1 372 ? 22.565  55.232 69.397 1.00 23.01  ? 375  TYR A CD2 1 
ATOM   2881 C CE1 . TYR A 1 372 ? 22.541  57.691 68.133 1.00 21.53  ? 375  TYR A CE1 1 
ATOM   2882 C CE2 . TYR A 1 372 ? 22.188  55.317 68.069 1.00 20.19  ? 375  TYR A CE2 1 
ATOM   2883 C CZ  . TYR A 1 372 ? 22.179  56.552 67.448 1.00 23.30  ? 375  TYR A CZ  1 
ATOM   2884 O OH  . TYR A 1 372 ? 21.821  56.656 66.129 1.00 26.08  ? 375  TYR A OH  1 
ATOM   2885 N N   . THR A 1 373 ? 26.123  55.533 73.766 1.00 28.42  ? 376  THR A N   1 
ATOM   2886 C CA  . THR A 1 373 ? 26.600  55.906 75.090 1.00 28.42  ? 376  THR A CA  1 
ATOM   2887 C C   . THR A 1 373 ? 28.100  56.167 75.172 1.00 29.19  ? 376  THR A C   1 
ATOM   2888 O O   . THR A 1 373 ? 28.913  55.378 74.688 1.00 29.17  ? 376  THR A O   1 
ATOM   2889 C CB  . THR A 1 373 ? 26.224  54.858 76.158 1.00 27.77  ? 376  THR A CB  1 
ATOM   2890 O OG1 . THR A 1 373 ? 24.800  54.766 76.263 1.00 25.63  ? 376  THR A OG1 1 
ATOM   2891 C CG2 . THR A 1 373 ? 26.774  55.259 77.510 1.00 27.63  ? 376  THR A CG2 1 
ATOM   2892 N N   . ASP A 1 374 ? 28.442  57.301 75.778 1.00 29.97  ? 377  ASP A N   1 
ATOM   2893 C CA  . ASP A 1 374 ? 29.824  57.702 76.005 1.00 31.19  ? 377  ASP A CA  1 
ATOM   2894 C C   . ASP A 1 374 ? 30.165  57.167 77.398 1.00 33.33  ? 377  ASP A C   1 
ATOM   2895 O O   . ASP A 1 374 ? 29.825  57.786 78.407 1.00 31.32  ? 377  ASP A O   1 
ATOM   2896 C CB  . ASP A 1 374 ? 29.936  59.229 75.988 1.00 31.68  ? 377  ASP A CB  1 
ATOM   2897 C CG  . ASP A 1 374 ? 31.330  59.728 76.346 1.00 32.38  ? 377  ASP A CG  1 
ATOM   2898 O OD1 . ASP A 1 374 ? 32.253  58.908 76.523 1.00 34.83  ? 377  ASP A OD1 1 
ATOM   2899 O OD2 . ASP A 1 374 ? 31.506  60.957 76.454 1.00 35.68  ? 377  ASP A OD2 1 
ATOM   2900 N N   . TRP A 1 375 ? 30.832  56.018 77.442 1.00 33.42  ? 378  TRP A N   1 
ATOM   2901 C CA  . TRP A 1 375 ? 31.195  55.385 78.701 1.00 36.44  ? 378  TRP A CA  1 
ATOM   2902 C C   . TRP A 1 375 ? 32.282  56.058 79.527 1.00 38.33  ? 378  TRP A C   1 
ATOM   2903 O O   . TRP A 1 375 ? 32.690  55.547 80.570 1.00 39.34  ? 378  TRP A O   1 
ATOM   2904 C CB  . TRP A 1 375 ? 31.490  53.907 78.472 1.00 36.34  ? 378  TRP A CB  1 
ATOM   2905 C CG  . TRP A 1 375 ? 30.235  53.175 78.225 1.00 40.10  ? 378  TRP A CG  1 
ATOM   2906 C CD1 . TRP A 1 375 ? 29.816  52.633 77.048 1.00 40.74  ? 378  TRP A CD1 1 
ATOM   2907 C CD2 . TRP A 1 375 ? 29.160  53.000 79.157 1.00 42.57  ? 378  TRP A CD2 1 
ATOM   2908 N NE1 . TRP A 1 375 ? 28.538  52.143 77.184 1.00 42.78  ? 378  TRP A NE1 1 
ATOM   2909 C CE2 . TRP A 1 375 ? 28.112  52.354 78.470 1.00 43.11  ? 378  TRP A CE2 1 
ATOM   2910 C CE3 . TRP A 1 375 ? 28.979  53.336 80.508 1.00 45.53  ? 378  TRP A CE3 1 
ATOM   2911 C CZ2 . TRP A 1 375 ? 26.893  52.037 79.087 1.00 44.50  ? 378  TRP A CZ2 1 
ATOM   2912 C CZ3 . TRP A 1 375 ? 27.764  53.020 81.122 1.00 44.90  ? 378  TRP A CZ3 1 
ATOM   2913 C CH2 . TRP A 1 375 ? 26.739  52.377 80.408 1.00 43.40  ? 378  TRP A CH2 1 
ATOM   2914 N N   . MET A 1 376 ? 32.747  57.206 79.052 1.00 40.45  ? 379  MET A N   1 
ATOM   2915 C CA  . MET A 1 376 ? 33.753  57.988 79.754 1.00 44.11  ? 379  MET A CA  1 
ATOM   2916 C C   . MET A 1 376 ? 33.019  59.057 80.565 1.00 42.91  ? 379  MET A C   1 
ATOM   2917 O O   . MET A 1 376 ? 33.571  59.613 81.510 1.00 44.48  ? 379  MET A O   1 
ATOM   2918 C CB  . MET A 1 376 ? 34.689  58.683 78.749 1.00 48.03  ? 379  MET A CB  1 
ATOM   2919 C CG  . MET A 1 376 ? 35.785  57.812 78.141 1.00 54.42  ? 379  MET A CG  1 
ATOM   2920 S SD  . MET A 1 376 ? 37.191  57.569 79.260 1.00 63.58  ? 379  MET A SD  1 
ATOM   2921 C CE  . MET A 1 376 ? 38.436  56.864 78.121 1.00 61.30  ? 379  MET A CE  1 
ATOM   2922 N N   . ASP A 1 377 ? 31.758  59.299 80.208 1.00 42.24  ? 380  ASP A N   1 
ATOM   2923 C CA  . ASP A 1 377 ? 30.931  60.334 80.832 1.00 40.94  ? 380  ASP A CA  1 
ATOM   2924 C C   . ASP A 1 377 ? 29.447  59.941 80.692 1.00 40.86  ? 380  ASP A C   1 
ATOM   2925 O O   . ASP A 1 377 ? 28.623  60.739 80.244 1.00 39.78  ? 380  ASP A O   1 
ATOM   2926 C CB  . ASP A 1 377 ? 31.223  61.652 80.087 1.00 39.13  ? 380  ASP A CB  1 
ATOM   2927 C CG  . ASP A 1 377 ? 30.568  62.866 80.714 1.00 41.62  ? 380  ASP A CG  1 
ATOM   2928 O OD1 . ASP A 1 377 ? 30.122  62.801 81.877 1.00 44.83  ? 380  ASP A OD1 1 
ATOM   2929 O OD2 . ASP A 1 377 ? 30.511  63.907 80.027 1.00 42.72  ? 380  ASP A OD2 1 
ATOM   2930 N N   . ASP A 1 378 ? 29.113  58.726 81.126 1.00 41.20  ? 381  ASP A N   1 
ATOM   2931 C CA  . ASP A 1 378 ? 27.752  58.180 81.014 1.00 42.39  ? 381  ASP A CA  1 
ATOM   2932 C C   . ASP A 1 378 ? 26.608  58.799 81.829 1.00 43.24  ? 381  ASP A C   1 
ATOM   2933 O O   . ASP A 1 378 ? 25.433  58.499 81.580 1.00 43.83  ? 381  ASP A O   1 
ATOM   2934 C CB  . ASP A 1 378 ? 27.777  56.669 81.249 1.00 42.81  ? 381  ASP A CB  1 
ATOM   2935 C CG  . ASP A 1 378 ? 28.199  56.305 82.658 1.00 46.23  ? 381  ASP A CG  1 
ATOM   2936 O OD1 . ASP A 1 378 ? 29.306  56.714 83.079 1.00 44.01  ? 381  ASP A OD1 1 
ATOM   2937 O OD2 . ASP A 1 378 ? 27.416  55.610 83.342 1.00 47.79  ? 381  ASP A OD2 1 
ATOM   2938 N N   . ASN A 1 379 ? 26.933  59.636 82.807 1.00 43.10  ? 382  ASN A N   1 
ATOM   2939 C CA  . ASN A 1 379 ? 25.895  60.266 83.617 1.00 42.81  ? 382  ASN A CA  1 
ATOM   2940 C C   . ASN A 1 379 ? 25.625  61.696 83.188 1.00 41.71  ? 382  ASN A C   1 
ATOM   2941 O O   . ASN A 1 379 ? 24.803  62.389 83.791 1.00 45.71  ? 382  ASN A O   1 
ATOM   2942 C CB  . ASN A 1 379 ? 26.252  60.217 85.099 1.00 44.79  ? 382  ASN A CB  1 
ATOM   2943 C CG  . ASN A 1 379 ? 26.236  58.812 85.646 1.00 47.97  ? 382  ASN A CG  1 
ATOM   2944 O OD1 . ASN A 1 379 ? 27.272  58.278 86.058 1.00 53.17  ? 382  ASN A OD1 1 
ATOM   2945 N ND2 . ASN A 1 379 ? 25.063  58.188 85.630 1.00 46.42  ? 382  ASN A ND2 1 
ATOM   2946 N N   . ASN A 1 380 ? 26.310  62.127 82.134 1.00 36.25  ? 383  ASN A N   1 
ATOM   2947 C CA  . ASN A 1 380 ? 26.137  63.469 81.603 1.00 34.23  ? 383  ASN A CA  1 
ATOM   2948 C C   . ASN A 1 380 ? 24.690  63.608 81.143 1.00 33.76  ? 383  ASN A C   1 
ATOM   2949 O O   . ASN A 1 380 ? 24.290  63.006 80.154 1.00 35.11  ? 383  ASN A O   1 
ATOM   2950 C CB  . ASN A 1 380 ? 27.077  63.668 80.425 1.00 33.28  ? 383  ASN A CB  1 
ATOM   2951 C CG  . ASN A 1 380 ? 27.213  65.109 80.023 1.00 33.24  ? 383  ASN A CG  1 
ATOM   2952 O OD1 . ASN A 1 380 ? 28.316  65.568 79.733 1.00 34.83  ? 383  ASN A OD1 1 
ATOM   2953 N ND2 . ASN A 1 380 ? 26.096  65.832 79.968 1.00 30.78  ? 383  ASN A ND2 1 
ATOM   2954 N N   . GLY A 1 381 ? 23.918  64.413 81.865 1.00 33.16  ? 384  GLY A N   1 
ATOM   2955 C CA  . GLY A 1 381 ? 22.516  64.608 81.538 1.00 30.14  ? 384  GLY A CA  1 
ATOM   2956 C C   . GLY A 1 381 ? 22.254  65.208 80.174 1.00 29.75  ? 384  GLY A C   1 
ATOM   2957 O O   . GLY A 1 381 ? 21.234  64.914 79.549 1.00 30.96  ? 384  GLY A O   1 
ATOM   2958 N N   . ILE A 1 382 ? 23.151  66.080 79.731 1.00 28.46  ? 385  ILE A N   1 
ATOM   2959 C CA  . ILE A 1 382 ? 23.017  66.723 78.431 1.00 29.77  ? 385  ILE A CA  1 
ATOM   2960 C C   . ILE A 1 382 ? 23.352  65.720 77.329 1.00 31.01  ? 385  ILE A C   1 
ATOM   2961 O O   . ILE A 1 382 ? 22.666  65.657 76.312 1.00 30.18  ? 385  ILE A O   1 
ATOM   2962 C CB  . ILE A 1 382 ? 23.910  67.980 78.330 1.00 28.67  ? 385  ILE A CB  1 
ATOM   2963 C CG1 . ILE A 1 382 ? 23.349  69.081 79.237 1.00 26.86  ? 385  ILE A CG1 1 
ATOM   2964 C CG2 . ILE A 1 382 ? 24.006  68.461 76.886 1.00 27.34  ? 385  ILE A CG2 1 
ATOM   2965 C CD1 . ILE A 1 382 ? 24.186  70.337 79.267 1.00 27.51  ? 385  ILE A CD1 1 
ATOM   2966 N N   . LYS A 1 383 ? 24.378  64.905 77.564 1.00 30.48  ? 386  LYS A N   1 
ATOM   2967 C CA  . LYS A 1 383 ? 24.780  63.886 76.600 1.00 30.20  ? 386  LYS A CA  1 
ATOM   2968 C C   . LYS A 1 383 ? 23.706  62.805 76.488 1.00 30.29  ? 386  LYS A C   1 
ATOM   2969 O O   . LYS A 1 383 ? 23.442  62.299 75.396 1.00 31.80  ? 386  LYS A O   1 
ATOM   2970 C CB  . LYS A 1 383 ? 26.126  63.261 76.984 1.00 29.27  ? 386  LYS A CB  1 
ATOM   2971 C CG  . LYS A 1 383 ? 27.325  64.127 76.653 1.00 29.27  ? 386  LYS A CG  1 
ATOM   2972 C CD  . LYS A 1 383 ? 28.627  63.433 76.991 1.00 31.26  ? 386  LYS A CD  1 
ATOM   2973 C CE  . LYS A 1 383 ? 29.804  64.295 76.579 1.00 32.03  ? 386  LYS A CE  1 
ATOM   2974 N NZ  . LYS A 1 383 ? 31.100  63.697 76.987 1.00 35.63  ? 386  LYS A NZ  1 
ATOM   2975 N N   . ASN A 1 384 ? 23.089  62.464 77.620 1.00 28.80  ? 387  ASN A N   1 
ATOM   2976 C CA  . ASN A 1 384 ? 22.034  61.461 77.650 1.00 28.22  ? 387  ASN A CA  1 
ATOM   2977 C C   . ASN A 1 384 ? 20.805  62.000 76.940 1.00 28.21  ? 387  ASN A C   1 
ATOM   2978 O O   . ASN A 1 384 ? 20.114  61.263 76.246 1.00 31.00  ? 387  ASN A O   1 
ATOM   2979 C CB  . ASN A 1 384 ? 21.684  61.073 79.090 1.00 29.08  ? 387  ASN A CB  1 
ATOM   2980 C CG  . ASN A 1 384 ? 22.739  60.183 79.734 1.00 32.73  ? 387  ASN A CG  1 
ATOM   2981 O OD1 . ASN A 1 384 ? 23.578  59.607 79.046 1.00 33.42  ? 387  ASN A OD1 1 
ATOM   2982 N ND2 . ASN A 1 384 ? 22.695  60.062 81.058 1.00 33.99  ? 387  ASN A ND2 1 
ATOM   2983 N N   . ARG A 1 385 ? 20.547  63.294 77.107 1.00 27.74  ? 388  ARG A N   1 
ATOM   2984 C CA  . ARG A 1 385 ? 19.406  63.941 76.477 1.00 24.83  ? 388  ARG A CA  1 
ATOM   2985 C C   . ARG A 1 385 ? 19.616  63.995 74.962 1.00 26.05  ? 388  ARG A C   1 
ATOM   2986 O O   . ARG A 1 385 ? 18.759  63.568 74.192 1.00 26.06  ? 388  ARG A O   1 
ATOM   2987 C CB  . ARG A 1 385 ? 19.232  65.351 77.039 1.00 24.75  ? 388  ARG A CB  1 
ATOM   2988 C CG  . ARG A 1 385 ? 17.989  66.071 76.549 1.00 25.76  ? 388  ARG A CG  1 
ATOM   2989 C CD  . ARG A 1 385 ? 18.356  67.310 75.760 1.00 29.39  ? 388  ARG A CD  1 
ATOM   2990 N NE  . ARG A 1 385 ? 18.683  68.435 76.623 1.00 30.90  ? 388  ARG A NE  1 
ATOM   2991 C CZ  . ARG A 1 385 ? 19.738  69.233 76.470 1.00 30.42  ? 388  ARG A CZ  1 
ATOM   2992 N NH1 . ARG A 1 385 ? 20.593  69.038 75.484 1.00 29.45  ? 388  ARG A NH1 1 
ATOM   2993 N NH2 . ARG A 1 385 ? 19.924  70.251 77.299 1.00 30.16  ? 388  ARG A NH2 1 
ATOM   2994 N N   . ASP A 1 386 ? 20.773  64.490 74.543 1.00 23.44  ? 389  ASP A N   1 
ATOM   2995 C CA  . ASP A 1 386 ? 21.087  64.591 73.129 1.00 23.85  ? 389  ASP A CA  1 
ATOM   2996 C C   . ASP A 1 386 ? 21.245  63.229 72.490 1.00 24.61  ? 389  ASP A C   1 
ATOM   2997 O O   . ASP A 1 386 ? 20.950  63.063 71.308 1.00 27.37  ? 389  ASP A O   1 
ATOM   2998 C CB  . ASP A 1 386 ? 22.344  65.421 72.926 1.00 23.05  ? 389  ASP A CB  1 
ATOM   2999 C CG  . ASP A 1 386 ? 22.155  66.858 73.347 1.00 23.49  ? 389  ASP A CG  1 
ATOM   3000 O OD1 . ASP A 1 386 ? 20.993  67.279 73.506 1.00 25.72  ? 389  ASP A OD1 1 
ATOM   3001 O OD2 . ASP A 1 386 ? 23.164  67.571 73.519 1.00 26.59  ? 389  ASP A OD2 1 
ATOM   3002 N N   . GLY A 1 387 ? 21.695  62.259 73.284 1.00 23.25  ? 390  GLY A N   1 
ATOM   3003 C CA  . GLY A 1 387 ? 21.868  60.904 72.795 1.00 23.93  ? 390  GLY A CA  1 
ATOM   3004 C C   . GLY A 1 387 ? 20.522  60.314 72.429 1.00 26.18  ? 390  GLY A C   1 
ATOM   3005 O O   . GLY A 1 387 ? 20.404  59.601 71.435 1.00 28.83  ? 390  GLY A O   1 
ATOM   3006 N N   . LEU A 1 388 ? 19.505  60.619 73.234 1.00 25.62  ? 391  LEU A N   1 
ATOM   3007 C CA  . LEU A 1 388 ? 18.150  60.142 72.988 1.00 25.11  ? 391  LEU A CA  1 
ATOM   3008 C C   . LEU A 1 388 ? 17.537  60.827 71.782 1.00 26.35  ? 391  LEU A C   1 
ATOM   3009 O O   . LEU A 1 388 ? 16.804  60.203 71.020 1.00 28.27  ? 391  LEU A O   1 
ATOM   3010 C CB  . LEU A 1 388 ? 17.261  60.378 74.205 1.00 25.12  ? 391  LEU A CB  1 
ATOM   3011 C CG  . LEU A 1 388 ? 17.198  59.207 75.186 1.00 29.28  ? 391  LEU A CG  1 
ATOM   3012 C CD1 . LEU A 1 388 ? 16.361  59.582 76.400 1.00 27.25  ? 391  LEU A CD1 1 
ATOM   3013 C CD2 . LEU A 1 388 ? 16.614  57.982 74.481 1.00 29.48  ? 391  LEU A CD2 1 
ATOM   3014 N N   . ASP A 1 389 ? 17.797  62.125 71.645 1.00 27.35  ? 392  ASP A N   1 
ATOM   3015 C CA  . ASP A 1 389 ? 17.296  62.907 70.520 1.00 27.78  ? 392  ASP A CA  1 
ATOM   3016 C C   . ASP A 1 389 ? 17.819  62.264 69.243 1.00 27.52  ? 392  ASP A C   1 
ATOM   3017 O O   . ASP A 1 389 ? 17.080  62.102 68.273 1.00 29.20  ? 392  ASP A O   1 
ATOM   3018 C CB  . ASP A 1 389 ? 17.789  64.354 70.620 1.00 30.89  ? 392  ASP A CB  1 
ATOM   3019 C CG  . ASP A 1 389 ? 17.400  65.194 69.415 1.00 37.49  ? 392  ASP A CG  1 
ATOM   3020 O OD1 . ASP A 1 389 ? 18.125  65.165 68.394 1.00 43.86  ? 392  ASP A OD1 1 
ATOM   3021 O OD2 . ASP A 1 389 ? 16.377  65.901 69.487 1.00 42.07  ? 392  ASP A OD2 1 
ATOM   3022 N N   . ASP A 1 390 ? 19.089  61.870 69.269 1.00 24.23  ? 393  ASP A N   1 
ATOM   3023 C CA  . ASP A 1 390 ? 19.711  61.230 68.125 1.00 22.95  ? 393  ASP A CA  1 
ATOM   3024 C C   . ASP A 1 390 ? 19.104  59.869 67.856 1.00 23.63  ? 393  ASP A C   1 
ATOM   3025 O O   . ASP A 1 390 ? 18.792  59.557 66.720 1.00 25.04  ? 393  ASP A O   1 
ATOM   3026 C CB  . ASP A 1 390 ? 21.213  61.105 68.327 1.00 24.35  ? 393  ASP A CB  1 
ATOM   3027 C CG  . ASP A 1 390 ? 21.934  62.424 68.154 1.00 28.51  ? 393  ASP A CG  1 
ATOM   3028 O OD1 . ASP A 1 390 ? 21.439  63.286 67.390 1.00 28.01  ? 393  ASP A OD1 1 
ATOM   3029 O OD2 . ASP A 1 390 ? 23.010  62.595 68.772 1.00 34.18  ? 393  ASP A OD2 1 
ATOM   3030 N N   . ILE A 1 391 ? 18.940  59.059 68.897 1.00 22.32  ? 394  ILE A N   1 
ATOM   3031 C CA  . ILE A 1 391 ? 18.342  57.731 68.749 1.00 23.04  ? 394  ILE A CA  1 
ATOM   3032 C C   . ILE A 1 391 ? 16.973  57.824 68.065 1.00 23.72  ? 394  ILE A C   1 
ATOM   3033 O O   . ILE A 1 391 ? 16.729  57.183 67.045 1.00 26.88  ? 394  ILE A O   1 
ATOM   3034 C CB  . ILE A 1 391 ? 18.174  57.032 70.127 1.00 22.59  ? 394  ILE A CB  1 
ATOM   3035 C CG1 . ILE A 1 391 ? 19.547  56.681 70.707 1.00 22.73  ? 394  ILE A CG1 1 
ATOM   3036 C CG2 . ILE A 1 391 ? 17.312  55.776 69.996 1.00 18.69  ? 394  ILE A CG2 1 
ATOM   3037 C CD1 . ILE A 1 391 ? 19.500  56.112 72.105 1.00 24.42  ? 394  ILE A CD1 1 
ATOM   3038 N N   . VAL A 1 392 ? 16.102  58.661 68.611 1.00 22.78  ? 395  VAL A N   1 
ATOM   3039 C CA  . VAL A 1 392 ? 14.764  58.842 68.075 1.00 22.49  ? 395  VAL A CA  1 
ATOM   3040 C C   . VAL A 1 392 ? 14.795  59.380 66.644 1.00 21.56  ? 395  VAL A C   1 
ATOM   3041 O O   . VAL A 1 392 ? 14.142  58.830 65.759 1.00 21.09  ? 395  VAL A O   1 
ATOM   3042 C CB  . VAL A 1 392 ? 13.946  59.767 69.003 1.00 23.45  ? 395  VAL A CB  1 
ATOM   3043 C CG1 . VAL A 1 392 ? 12.541  59.992 68.457 1.00 21.71  ? 395  VAL A CG1 1 
ATOM   3044 C CG2 . VAL A 1 392 ? 13.874  59.146 70.397 1.00 21.65  ? 395  VAL A CG2 1 
ATOM   3045 N N   . GLY A 1 393 ? 15.594  60.419 66.419 1.00 20.53  ? 396  GLY A N   1 
ATOM   3046 C CA  . GLY A 1 393 ? 15.699  61.014 65.099 1.00 18.86  ? 396  GLY A CA  1 
ATOM   3047 C C   . GLY A 1 393 ? 16.297  60.112 64.036 1.00 20.47  ? 396  GLY A C   1 
ATOM   3048 O O   . GLY A 1 393 ? 15.757  59.998 62.941 1.00 23.11  ? 396  GLY A O   1 
ATOM   3049 N N   . ASP A 1 394 ? 17.419  59.476 64.360 1.00 19.58  ? 397  ASP A N   1 
ATOM   3050 C CA  . ASP A 1 394 ? 18.114  58.582 63.443 1.00 19.42  ? 397  ASP A CA  1 
ATOM   3051 C C   . ASP A 1 394 ? 17.248  57.407 63.042 1.00 22.53  ? 397  ASP A C   1 
ATOM   3052 O O   . ASP A 1 394 ? 17.076  57.121 61.862 1.00 23.75  ? 397  ASP A O   1 
ATOM   3053 C CB  . ASP A 1 394 ? 19.402  58.057 64.084 1.00 17.25  ? 397  ASP A CB  1 
ATOM   3054 C CG  . ASP A 1 394 ? 20.453  59.131 64.259 1.00 21.38  ? 397  ASP A CG  1 
ATOM   3055 O OD1 . ASP A 1 394 ? 20.260  60.252 63.753 1.00 21.00  ? 397  ASP A OD1 1 
ATOM   3056 O OD2 . ASP A 1 394 ? 21.487  58.858 64.897 1.00 22.57  ? 397  ASP A OD2 1 
ATOM   3057 N N   . HIS A 1 395 ? 16.712  56.717 64.038 1.00 23.10  ? 398  HIS A N   1 
ATOM   3058 C CA  . HIS A 1 395 ? 15.873  55.565 63.789 1.00 21.86  ? 398  HIS A CA  1 
ATOM   3059 C C   . HIS A 1 395 ? 14.602  55.890 63.014 1.00 23.36  ? 398  HIS A C   1 
ATOM   3060 O O   . HIS A 1 395 ? 14.286  55.219 62.037 1.00 23.97  ? 398  HIS A O   1 
ATOM   3061 C CB  . HIS A 1 395 ? 15.493  54.884 65.101 1.00 22.55  ? 398  HIS A CB  1 
ATOM   3062 C CG  . HIS A 1 395 ? 14.523  53.759 64.930 1.00 23.41  ? 398  HIS A CG  1 
ATOM   3063 N ND1 . HIS A 1 395 ? 13.323  53.705 65.600 1.00 28.50  ? 398  HIS A ND1 1 
ATOM   3064 C CD2 . HIS A 1 395 ? 14.554  52.670 64.126 1.00 23.43  ? 398  HIS A CD2 1 
ATOM   3065 C CE1 . HIS A 1 395 ? 12.652  52.633 65.216 1.00 26.22  ? 398  HIS A CE1 1 
ATOM   3066 N NE2 . HIS A 1 395 ? 13.379  51.991 64.321 1.00 27.15  ? 398  HIS A NE2 1 
ATOM   3067 N N   . ASN A 1 396 ? 13.892  56.928 63.440 1.00 22.17  ? 399  ASN A N   1 
ATOM   3068 C CA  . ASN A 1 396 ? 12.630  57.296 62.816 1.00 22.28  ? 399  ASN A CA  1 
ATOM   3069 C C   . ASN A 1 396 ? 12.606  58.176 61.565 1.00 22.24  ? 399  ASN A C   1 
ATOM   3070 O O   . ASN A 1 396 ? 11.660  58.094 60.782 1.00 24.66  ? 399  ASN A O   1 
ATOM   3071 C CB  . ASN A 1 396 ? 11.710  57.897 63.871 1.00 22.86  ? 399  ASN A CB  1 
ATOM   3072 C CG  . ASN A 1 396 ? 11.269  56.882 64.893 1.00 24.40  ? 399  ASN A CG  1 
ATOM   3073 O OD1 . ASN A 1 396 ? 10.514  55.965 64.579 1.00 25.05  ? 399  ASN A OD1 1 
ATOM   3074 N ND2 . ASN A 1 396 ? 11.732  57.040 66.124 1.00 20.34  ? 399  ASN A ND2 1 
ATOM   3075 N N   . VAL A 1 397 ? 13.618  59.010 61.360 1.00 21.38  ? 400  VAL A N   1 
ATOM   3076 C CA  . VAL A 1 397 ? 13.607  59.900 60.201 1.00 20.68  ? 400  VAL A CA  1 
ATOM   3077 C C   . VAL A 1 397 ? 14.871  59.889 59.360 1.00 23.97  ? 400  VAL A C   1 
ATOM   3078 O O   . VAL A 1 397 ? 14.840  59.534 58.182 1.00 26.70  ? 400  VAL A O   1 
ATOM   3079 C CB  . VAL A 1 397 ? 13.349  61.362 60.631 1.00 19.07  ? 400  VAL A CB  1 
ATOM   3080 C CG1 . VAL A 1 397 ? 13.426  62.285 59.435 1.00 15.57  ? 400  VAL A CG1 1 
ATOM   3081 C CG2 . VAL A 1 397 ? 11.996  61.485 61.311 1.00 18.97  ? 400  VAL A CG2 1 
ATOM   3082 N N   . ILE A 1 398 ? 15.984  60.268 59.977 1.00 25.88  ? 401  ILE A N   1 
ATOM   3083 C CA  . ILE A 1 398 ? 17.253  60.371 59.273 1.00 24.37  ? 401  ILE A CA  1 
ATOM   3084 C C   . ILE A 1 398 ? 17.732  59.114 58.572 1.00 24.97  ? 401  ILE A C   1 
ATOM   3085 O O   . ILE A 1 398 ? 17.935  59.133 57.362 1.00 25.13  ? 401  ILE A O   1 
ATOM   3086 C CB  . ILE A 1 398 ? 18.354  60.964 60.179 1.00 22.41  ? 401  ILE A CB  1 
ATOM   3087 C CG1 . ILE A 1 398 ? 17.863  62.301 60.754 1.00 21.27  ? 401  ILE A CG1 1 
ATOM   3088 C CG2 . ILE A 1 398 ? 19.644  61.172 59.386 1.00 17.25  ? 401  ILE A CG2 1 
ATOM   3089 C CD1 . ILE A 1 398 ? 18.902  63.061 61.547 1.00 21.55  ? 401  ILE A CD1 1 
ATOM   3090 N N   . CYS A 1 399 ? 17.883  58.017 59.306 1.00 24.19  ? 402  CYS A N   1 
ATOM   3091 C CA  . CYS A 1 399 ? 18.352  56.782 58.687 1.00 23.58  ? 402  CYS A CA  1 
ATOM   3092 C C   . CYS A 1 399 ? 17.398  56.174 57.663 1.00 23.27  ? 402  CYS A C   1 
ATOM   3093 O O   . CYS A 1 399 ? 17.849  55.545 56.705 1.00 23.89  ? 402  CYS A O   1 
ATOM   3094 C CB  . CYS A 1 399 ? 18.831  55.788 59.737 1.00 23.57  ? 402  CYS A CB  1 
ATOM   3095 S SG  . CYS A 1 399 ? 20.267  56.466 60.638 1.00 25.11  ? 402  CYS A SG  1 
ATOM   3096 N N   . PRO A 1 400 ? 16.072  56.268 57.891 1.00 23.70  ? 403  PRO A N   1 
ATOM   3097 C CA  . PRO A 1 400 ? 15.161  55.708 56.885 1.00 24.30  ? 403  PRO A CA  1 
ATOM   3098 C C   . PRO A 1 400 ? 15.283  56.541 55.603 1.00 25.57  ? 403  PRO A C   1 
ATOM   3099 O O   . PRO A 1 400 ? 15.321  55.996 54.502 1.00 26.43  ? 403  PRO A O   1 
ATOM   3100 C CB  . PRO A 1 400 ? 13.792  55.883 57.535 1.00 19.49  ? 403  PRO A CB  1 
ATOM   3101 C CG  . PRO A 1 400 ? 14.098  55.614 58.952 1.00 21.60  ? 403  PRO A CG  1 
ATOM   3102 C CD  . PRO A 1 400 ? 15.363  56.444 59.169 1.00 23.89  ? 403  PRO A CD  1 
ATOM   3103 N N   . LEU A 1 401 ? 15.406  57.861 55.763 1.00 26.23  ? 404  LEU A N   1 
ATOM   3104 C CA  . LEU A 1 401 ? 15.549  58.760 54.621 1.00 25.71  ? 404  LEU A CA  1 
ATOM   3105 C C   . LEU A 1 401 ? 16.846  58.467 53.871 1.00 26.65  ? 404  LEU A C   1 
ATOM   3106 O O   . LEU A 1 401 ? 16.862  58.468 52.642 1.00 25.77  ? 404  LEU A O   1 
ATOM   3107 C CB  . LEU A 1 401 ? 15.496  60.232 55.059 1.00 25.31  ? 404  LEU A CB  1 
ATOM   3108 C CG  . LEU A 1 401 ? 15.453  61.249 53.904 1.00 27.03  ? 404  LEU A CG  1 
ATOM   3109 C CD1 . LEU A 1 401 ? 14.476  62.390 54.218 1.00 23.67  ? 404  LEU A CD1 1 
ATOM   3110 C CD2 . LEU A 1 401 ? 16.857  61.774 53.585 1.00 19.54  ? 404  LEU A CD2 1 
ATOM   3111 N N   . MET A 1 402 ? 17.919  58.181 54.609 1.00 24.58  ? 405  MET A N   1 
ATOM   3112 C CA  . MET A 1 402 ? 19.203  57.872 53.996 1.00 24.17  ? 405  MET A CA  1 
ATOM   3113 C C   . MET A 1 402 ? 19.147  56.547 53.250 1.00 24.46  ? 405  MET A C   1 
ATOM   3114 O O   . MET A 1 402 ? 19.793  56.384 52.215 1.00 25.04  ? 405  MET A O   1 
ATOM   3115 C CB  . MET A 1 402 ? 20.326  57.851 55.029 1.00 23.34  ? 405  MET A CB  1 
ATOM   3116 C CG  . MET A 1 402 ? 20.675  59.220 55.562 1.00 23.83  ? 405  MET A CG  1 
ATOM   3117 S SD  . MET A 1 402 ? 20.887  60.426 54.244 1.00 26.45  ? 405  MET A SD  1 
ATOM   3118 C CE  . MET A 1 402 ? 22.359  59.792 53.435 1.00 21.36  ? 405  MET A CE  1 
ATOM   3119 N N   . HIS A 1 403 ? 18.384  55.597 53.778 1.00 23.72  ? 406  HIS A N   1 
ATOM   3120 C CA  . HIS A 1 403 ? 18.242  54.314 53.114 1.00 23.06  ? 406  HIS A CA  1 
ATOM   3121 C C   . HIS A 1 403 ? 17.506  54.557 51.798 1.00 24.57  ? 406  HIS A C   1 
ATOM   3122 O O   . HIS A 1 403 ? 17.919  54.074 50.752 1.00 28.54  ? 406  HIS A O   1 
ATOM   3123 C CB  . HIS A 1 403 ? 17.447  53.344 53.979 1.00 22.89  ? 406  HIS A CB  1 
ATOM   3124 C CG  . HIS A 1 403 ? 17.240  52.002 53.348 1.00 26.08  ? 406  HIS A CG  1 
ATOM   3125 N ND1 . HIS A 1 403 ? 18.270  51.108 53.142 1.00 26.60  ? 406  HIS A ND1 1 
ATOM   3126 C CD2 . HIS A 1 403 ? 16.117  51.395 52.891 1.00 22.98  ? 406  HIS A CD2 1 
ATOM   3127 C CE1 . HIS A 1 403 ? 17.792  50.009 52.588 1.00 23.47  ? 406  HIS A CE1 1 
ATOM   3128 N NE2 . HIS A 1 403 ? 16.491  50.157 52.425 1.00 24.75  ? 406  HIS A NE2 1 
ATOM   3129 N N   . PHE A 1 404 ? 16.438  55.345 51.857 1.00 23.78  ? 407  PHE A N   1 
ATOM   3130 C CA  . PHE A 1 404 ? 15.641  55.660 50.676 1.00 25.14  ? 407  PHE A CA  1 
ATOM   3131 C C   . PHE A 1 404 ? 16.444  56.437 49.641 1.00 26.55  ? 407  PHE A C   1 
ATOM   3132 O O   . PHE A 1 404 ? 16.365  56.151 48.449 1.00 27.71  ? 407  PHE A O   1 
ATOM   3133 C CB  . PHE A 1 404 ? 14.398  56.468 51.068 1.00 22.06  ? 407  PHE A CB  1 
ATOM   3134 C CG  . PHE A 1 404 ? 13.591  56.950 49.896 1.00 21.79  ? 407  PHE A CG  1 
ATOM   3135 C CD1 . PHE A 1 404 ? 12.726  56.093 49.230 1.00 25.32  ? 407  PHE A CD1 1 
ATOM   3136 C CD2 . PHE A 1 404 ? 13.716  58.259 49.440 1.00 22.84  ? 407  PHE A CD2 1 
ATOM   3137 C CE1 . PHE A 1 404 ? 11.995  56.532 48.119 1.00 24.04  ? 407  PHE A CE1 1 
ATOM   3138 C CE2 . PHE A 1 404 ? 12.994  58.706 48.334 1.00 22.28  ? 407  PHE A CE2 1 
ATOM   3139 C CZ  . PHE A 1 404 ? 12.133  57.838 47.674 1.00 22.09  ? 407  PHE A CZ  1 
ATOM   3140 N N   . VAL A 1 405 ? 17.229  57.408 50.092 1.00 25.51  ? 408  VAL A N   1 
ATOM   3141 C CA  . VAL A 1 405 ? 18.000  58.211 49.161 1.00 28.02  ? 408  VAL A CA  1 
ATOM   3142 C C   . VAL A 1 405 ? 19.017  57.363 48.410 1.00 28.92  ? 408  VAL A C   1 
ATOM   3143 O O   . VAL A 1 405 ? 19.170  57.495 47.199 1.00 29.15  ? 408  VAL A O   1 
ATOM   3144 C CB  . VAL A 1 405 ? 18.676  59.434 49.847 1.00 26.62  ? 408  VAL A CB  1 
ATOM   3145 C CG1 . VAL A 1 405 ? 19.865  59.014 50.662 1.00 28.22  ? 408  VAL A CG1 1 
ATOM   3146 C CG2 . VAL A 1 405 ? 19.091  60.451 48.808 1.00 31.80  ? 408  VAL A CG2 1 
ATOM   3147 N N   . ASN A 1 406 ? 19.659  56.441 49.115 1.00 29.20  ? 409  ASN A N   1 
ATOM   3148 C CA  . ASN A 1 406 ? 20.646  55.588 48.488 1.00 29.09  ? 409  ASN A CA  1 
ATOM   3149 C C   . ASN A 1 406 ? 20.027  54.560 47.560 1.00 29.71  ? 409  ASN A C   1 
ATOM   3150 O O   . ASN A 1 406 ? 20.596  54.246 46.519 1.00 33.61  ? 409  ASN A O   1 
ATOM   3151 C CB  . ASN A 1 406 ? 21.541  54.944 49.539 1.00 32.54  ? 409  ASN A CB  1 
ATOM   3152 C CG  . ASN A 1 406 ? 22.645  55.883 50.002 1.00 37.80  ? 409  ASN A CG  1 
ATOM   3153 O OD1 . ASN A 1 406 ? 23.597  56.150 49.261 1.00 41.60  ? 409  ASN A OD1 1 
ATOM   3154 N ND2 . ASN A 1 406 ? 22.513  56.407 51.217 1.00 35.42  ? 409  ASN A ND2 1 
ATOM   3155 N N   . LYS A 1 407 ? 18.852  54.052 47.916 1.00 29.03  ? 410  LYS A N   1 
ATOM   3156 C CA  . LYS A 1 407 ? 18.165  53.080 47.069 1.00 28.70  ? 410  LYS A CA  1 
ATOM   3157 C C   . LYS A 1 407 ? 17.645  53.788 45.824 1.00 28.87  ? 410  LYS A C   1 
ATOM   3158 O O   . LYS A 1 407 ? 17.830  53.318 44.701 1.00 28.50  ? 410  LYS A O   1 
ATOM   3159 C CB  . LYS A 1 407 ? 16.986  52.441 47.809 1.00 27.41  ? 410  LYS A CB  1 
ATOM   3160 C CG  . LYS A 1 407 ? 17.372  51.386 48.818 1.00 28.61  ? 410  LYS A CG  1 
ATOM   3161 C CD  . LYS A 1 407 ? 18.117  50.264 48.134 1.00 30.98  ? 410  LYS A CD  1 
ATOM   3162 C CE  . LYS A 1 407 ? 18.451  49.156 49.095 1.00 30.98  ? 410  LYS A CE  1 
ATOM   3163 N NZ  . LYS A 1 407 ? 19.408  48.226 48.455 1.00 35.11  ? 410  LYS A NZ  1 
ATOM   3164 N N   . TYR A 1 408 ? 17.025  54.943 46.041 1.00 27.53  ? 411  TYR A N   1 
ATOM   3165 C CA  . TYR A 1 408 ? 16.458  55.724 44.959 1.00 27.00  ? 411  TYR A CA  1 
ATOM   3166 C C   . TYR A 1 408 ? 17.505  56.181 43.973 1.00 27.57  ? 411  TYR A C   1 
ATOM   3167 O O   . TYR A 1 408 ? 17.346  56.005 42.774 1.00 27.00  ? 411  TYR A O   1 
ATOM   3168 C CB  . TYR A 1 408 ? 15.721  56.953 45.485 1.00 26.72  ? 411  TYR A CB  1 
ATOM   3169 C CG  . TYR A 1 408 ? 14.938  57.646 44.394 1.00 26.88  ? 411  TYR A CG  1 
ATOM   3170 C CD1 . TYR A 1 408 ? 13.654  57.219 44.070 1.00 25.15  ? 411  TYR A CD1 1 
ATOM   3171 C CD2 . TYR A 1 408 ? 15.510  58.666 43.626 1.00 25.17  ? 411  TYR A CD2 1 
ATOM   3172 C CE1 . TYR A 1 408 ? 12.959  57.773 43.009 1.00 27.02  ? 411  TYR A CE1 1 
ATOM   3173 C CE2 . TYR A 1 408 ? 14.818  59.229 42.555 1.00 26.20  ? 411  TYR A CE2 1 
ATOM   3174 C CZ  . TYR A 1 408 ? 13.544  58.769 42.253 1.00 27.00  ? 411  TYR A CZ  1 
ATOM   3175 O OH  . TYR A 1 408 ? 12.852  59.264 41.175 1.00 29.10  ? 411  TYR A OH  1 
ATOM   3176 N N   . THR A 1 409 ? 18.568  56.779 44.490 1.00 27.02  ? 412  THR A N   1 
ATOM   3177 C CA  . THR A 1 409 ? 19.639  57.298 43.661 1.00 29.69  ? 412  THR A CA  1 
ATOM   3178 C C   . THR A 1 409 ? 20.203  56.288 42.663 1.00 32.83  ? 412  THR A C   1 
ATOM   3179 O O   . THR A 1 409 ? 20.721  56.674 41.615 1.00 33.31  ? 412  THR A O   1 
ATOM   3180 C CB  . THR A 1 409 ? 20.741  57.930 44.541 1.00 29.76  ? 412  THR A CB  1 
ATOM   3181 O OG1 . THR A 1 409 ? 20.184  59.062 45.222 1.00 32.78  ? 412  THR A OG1 1 
ATOM   3182 C CG2 . THR A 1 409 ? 21.938  58.389 43.713 1.00 25.12  ? 412  THR A CG2 1 
ATOM   3183 N N   . LYS A 1 410 ? 20.052  54.999 42.950 1.00 33.63  ? 413  LYS A N   1 
ATOM   3184 C CA  . LYS A 1 410 ? 20.548  53.981 42.034 1.00 37.07  ? 413  LYS A CA  1 
ATOM   3185 C C   . LYS A 1 410 ? 19.754  53.959 40.727 1.00 38.20  ? 413  LYS A C   1 
ATOM   3186 O O   . LYS A 1 410 ? 20.309  53.666 39.676 1.00 40.31  ? 413  LYS A O   1 
ATOM   3187 C CB  . LYS A 1 410 ? 20.552  52.599 42.691 1.00 38.64  ? 413  LYS A CB  1 
ATOM   3188 C CG  . LYS A 1 410 ? 21.597  52.473 43.786 1.00 46.63  ? 413  LYS A CG  1 
ATOM   3189 C CD  . LYS A 1 410 ? 21.503  51.152 44.518 1.00 52.30  ? 413  LYS A CD  1 
ATOM   3190 C CE  . LYS A 1 410 ? 22.535  51.082 45.631 1.00 54.70  ? 413  LYS A CE  1 
ATOM   3191 N NZ  . LYS A 1 410 ? 22.342  49.870 46.481 1.00 58.94  ? 413  LYS A NZ  1 
ATOM   3192 N N   . PHE A 1 411 ? 18.470  54.308 40.785 1.00 36.22  ? 414  PHE A N   1 
ATOM   3193 C CA  . PHE A 1 411 ? 17.630  54.317 39.589 1.00 34.68  ? 414  PHE A CA  1 
ATOM   3194 C C   . PHE A 1 411 ? 17.120  55.709 39.200 1.00 34.81  ? 414  PHE A C   1 
ATOM   3195 O O   . PHE A 1 411 ? 16.668  55.912 38.077 1.00 37.09  ? 414  PHE A O   1 
ATOM   3196 C CB  . PHE A 1 411 ? 16.430  53.389 39.773 1.00 34.48  ? 414  PHE A CB  1 
ATOM   3197 C CG  . PHE A 1 411 ? 16.795  51.960 40.039 1.00 36.10  ? 414  PHE A CG  1 
ATOM   3198 C CD1 . PHE A 1 411 ? 16.885  51.047 38.996 1.00 38.71  ? 414  PHE A CD1 1 
ATOM   3199 C CD2 . PHE A 1 411 ? 17.016  51.517 41.336 1.00 36.20  ? 414  PHE A CD2 1 
ATOM   3200 C CE1 . PHE A 1 411 ? 17.187  49.712 39.241 1.00 39.42  ? 414  PHE A CE1 1 
ATOM   3201 C CE2 . PHE A 1 411 ? 17.319  50.187 41.592 1.00 38.85  ? 414  PHE A CE2 1 
ATOM   3202 C CZ  . PHE A 1 411 ? 17.405  49.282 40.546 1.00 39.21  ? 414  PHE A CZ  1 
ATOM   3203 N N   . GLY A 1 412 ? 17.209  56.664 40.120 1.00 33.39  ? 415  GLY A N   1 
ATOM   3204 C CA  . GLY A 1 412 ? 16.723  58.007 39.858 1.00 30.89  ? 415  GLY A CA  1 
ATOM   3205 C C   . GLY A 1 412 ? 17.483  58.788 38.813 1.00 29.23  ? 415  GLY A C   1 
ATOM   3206 O O   . GLY A 1 412 ? 18.529  58.363 38.334 1.00 31.23  ? 415  GLY A O   1 
ATOM   3207 N N   . ASN A 1 413 ? 16.973  59.970 38.500 1.00 30.34  ? 416  ASN A N   1 
ATOM   3208 C CA  . ASN A 1 413 ? 17.582  60.825 37.492 1.00 30.25  ? 416  ASN A CA  1 
ATOM   3209 C C   . ASN A 1 413 ? 18.175  62.095 38.106 1.00 31.45  ? 416  ASN A C   1 
ATOM   3210 O O   . ASN A 1 413 ? 18.341  63.105 37.430 1.00 31.07  ? 416  ASN A O   1 
ATOM   3211 C CB  . ASN A 1 413 ? 16.526  61.166 36.429 1.00 31.50  ? 416  ASN A CB  1 
ATOM   3212 C CG  . ASN A 1 413 ? 17.104  61.898 35.225 1.00 34.64  ? 416  ASN A CG  1 
ATOM   3213 O OD1 . ASN A 1 413 ? 16.569  62.929 34.813 1.00 34.83  ? 416  ASN A OD1 1 
ATOM   3214 N ND2 . ASN A 1 413 ? 18.197  61.380 34.669 1.00 31.07  ? 416  ASN A ND2 1 
ATOM   3215 N N   . GLY A 1 414 ? 18.506  62.039 39.393 1.00 33.59  ? 417  GLY A N   1 
ATOM   3216 C CA  . GLY A 1 414 ? 19.078  63.201 40.056 1.00 32.31  ? 417  GLY A CA  1 
ATOM   3217 C C   . GLY A 1 414 ? 18.566  63.369 41.470 1.00 31.66  ? 417  GLY A C   1 
ATOM   3218 O O   . GLY A 1 414 ? 17.364  63.479 41.693 1.00 31.19  ? 417  GLY A O   1 
ATOM   3219 N N   . THR A 1 415 ? 19.487  63.416 42.426 1.00 31.35  ? 418  THR A N   1 
ATOM   3220 C CA  . THR A 1 415 ? 19.129  63.554 43.829 1.00 30.32  ? 418  THR A CA  1 
ATOM   3221 C C   . THR A 1 415 ? 19.849  64.740 44.451 1.00 31.51  ? 418  THR A C   1 
ATOM   3222 O O   . THR A 1 415 ? 21.028  64.965 44.180 1.00 30.42  ? 418  THR A O   1 
ATOM   3223 C CB  . THR A 1 415 ? 19.534  62.293 44.622 1.00 30.28  ? 418  THR A CB  1 
ATOM   3224 O OG1 . THR A 1 415 ? 19.002  61.125 43.985 1.00 27.90  ? 418  THR A OG1 1 
ATOM   3225 C CG2 . THR A 1 415 ? 19.016  62.373 46.052 1.00 30.04  ? 418  THR A CG2 1 
ATOM   3226 N N   . TYR A 1 416 ? 19.128  65.504 45.268 1.00 30.32  ? 419  TYR A N   1 
ATOM   3227 C CA  . TYR A 1 416 ? 19.705  66.650 45.971 1.00 29.34  ? 419  TYR A CA  1 
ATOM   3228 C C   . TYR A 1 416 ? 19.369  66.497 47.447 1.00 27.27  ? 419  TYR A C   1 
ATOM   3229 O O   . TYR A 1 416 ? 18.201  66.482 47.823 1.00 27.51  ? 419  TYR A O   1 
ATOM   3230 C CB  . TYR A 1 416 ? 19.165  67.965 45.415 1.00 31.43  ? 419  TYR A CB  1 
ATOM   3231 C CG  . TYR A 1 416 ? 19.632  68.215 44.004 1.00 32.37  ? 419  TYR A CG  1 
ATOM   3232 C CD1 . TYR A 1 416 ? 18.864  67.807 42.910 1.00 31.39  ? 419  TYR A CD1 1 
ATOM   3233 C CD2 . TYR A 1 416 ? 20.869  68.802 43.761 1.00 32.52  ? 419  TYR A CD2 1 
ATOM   3234 C CE1 . TYR A 1 416 ? 19.320  67.971 41.614 1.00 31.49  ? 419  TYR A CE1 1 
ATOM   3235 C CE2 . TYR A 1 416 ? 21.334  68.972 42.468 1.00 33.51  ? 419  TYR A CE2 1 
ATOM   3236 C CZ  . TYR A 1 416 ? 20.557  68.551 41.400 1.00 32.32  ? 419  TYR A CZ  1 
ATOM   3237 O OH  . TYR A 1 416 ? 21.040  68.688 40.123 1.00 34.21  ? 419  TYR A OH  1 
ATOM   3238 N N   . LEU A 1 417 ? 20.405  66.364 48.269 1.00 25.27  ? 420  LEU A N   1 
ATOM   3239 C CA  . LEU A 1 417 ? 20.239  66.161 49.701 1.00 23.61  ? 420  LEU A CA  1 
ATOM   3240 C C   . LEU A 1 417 ? 20.699  67.336 50.561 1.00 23.77  ? 420  LEU A C   1 
ATOM   3241 O O   . LEU A 1 417 ? 21.772  67.898 50.351 1.00 25.44  ? 420  LEU A O   1 
ATOM   3242 C CB  . LEU A 1 417 ? 20.985  64.888 50.112 1.00 22.31  ? 420  LEU A CB  1 
ATOM   3243 C CG  . LEU A 1 417 ? 20.803  64.356 51.531 1.00 22.24  ? 420  LEU A CG  1 
ATOM   3244 C CD1 . LEU A 1 417 ? 19.369  63.895 51.727 1.00 21.11  ? 420  LEU A CD1 1 
ATOM   3245 C CD2 . LEU A 1 417 ? 21.764  63.215 51.762 1.00 18.37  ? 420  LEU A CD2 1 
ATOM   3246 N N   . TYR A 1 418 ? 19.880  67.704 51.538 1.00 23.08  ? 421  TYR A N   1 
ATOM   3247 C CA  . TYR A 1 418 ? 20.230  68.800 52.428 1.00 24.53  ? 421  TYR A CA  1 
ATOM   3248 C C   . TYR A 1 418 ? 20.123  68.371 53.888 1.00 26.90  ? 421  TYR A C   1 
ATOM   3249 O O   . TYR A 1 418 ? 19.444  67.389 54.224 1.00 25.16  ? 421  TYR A O   1 
ATOM   3250 C CB  . TYR A 1 418 ? 19.328  70.023 52.194 1.00 20.89  ? 421  TYR A CB  1 
ATOM   3251 C CG  . TYR A 1 418 ? 17.897  69.843 52.654 1.00 21.39  ? 421  TYR A CG  1 
ATOM   3252 C CD1 . TYR A 1 418 ? 17.542  70.037 53.989 1.00 23.81  ? 421  TYR A CD1 1 
ATOM   3253 C CD2 . TYR A 1 418 ? 16.905  69.436 51.765 1.00 22.10  ? 421  TYR A CD2 1 
ATOM   3254 C CE1 . TYR A 1 418 ? 16.235  69.821 54.428 1.00 21.84  ? 421  TYR A CE1 1 
ATOM   3255 C CE2 . TYR A 1 418 ? 15.602  69.224 52.193 1.00 21.31  ? 421  TYR A CE2 1 
ATOM   3256 C CZ  . TYR A 1 418 ? 15.274  69.413 53.524 1.00 21.52  ? 421  TYR A CZ  1 
ATOM   3257 O OH  . TYR A 1 418 ? 13.993  69.166 53.946 1.00 22.73  ? 421  TYR A OH  1 
ATOM   3258 N N   . PHE A 1 419 ? 20.766  69.155 54.747 1.00 27.07  ? 422  PHE A N   1 
ATOM   3259 C CA  . PHE A 1 419 ? 20.755  68.934 56.185 1.00 25.79  ? 422  PHE A CA  1 
ATOM   3260 C C   . PHE A 1 419 ? 20.505  70.303 56.803 1.00 25.63  ? 422  PHE A C   1 
ATOM   3261 O O   . PHE A 1 419 ? 21.419  71.120 56.923 1.00 26.12  ? 422  PHE A O   1 
ATOM   3262 C CB  . PHE A 1 419 ? 22.090  68.361 56.649 1.00 26.90  ? 422  PHE A CB  1 
ATOM   3263 C CG  . PHE A 1 419 ? 22.133  68.035 58.110 1.00 30.69  ? 422  PHE A CG  1 
ATOM   3264 C CD1 . PHE A 1 419 ? 21.491  66.901 58.599 1.00 29.93  ? 422  PHE A CD1 1 
ATOM   3265 C CD2 . PHE A 1 419 ? 22.831  68.851 58.997 1.00 29.01  ? 422  PHE A CD2 1 
ATOM   3266 C CE1 . PHE A 1 419 ? 21.544  66.580 59.950 1.00 31.23  ? 422  PHE A CE1 1 
ATOM   3267 C CE2 . PHE A 1 419 ? 22.890  68.539 60.351 1.00 31.33  ? 422  PHE A CE2 1 
ATOM   3268 C CZ  . PHE A 1 419 ? 22.246  67.400 60.829 1.00 31.01  ? 422  PHE A CZ  1 
ATOM   3269 N N   . PHE A 1 420 ? 19.238  70.569 57.105 1.00 25.78  ? 423  PHE A N   1 
ATOM   3270 C CA  . PHE A 1 420 ? 18.813  71.833 57.687 1.00 27.52  ? 423  PHE A CA  1 
ATOM   3271 C C   . PHE A 1 420 ? 19.184  71.876 59.166 1.00 29.21  ? 423  PHE A C   1 
ATOM   3272 O O   . PHE A 1 420 ? 18.620  71.139 59.984 1.00 29.79  ? 423  PHE A O   1 
ATOM   3273 C CB  . PHE A 1 420 ? 17.301  72.009 57.502 1.00 24.23  ? 423  PHE A CB  1 
ATOM   3274 C CG  . PHE A 1 420 ? 16.787  73.340 57.959 1.00 25.76  ? 423  PHE A CG  1 
ATOM   3275 C CD1 . PHE A 1 420 ? 16.819  74.439 57.109 1.00 23.02  ? 423  PHE A CD1 1 
ATOM   3276 C CD2 . PHE A 1 420 ? 16.270  73.500 59.241 1.00 25.34  ? 423  PHE A CD2 1 
ATOM   3277 C CE1 . PHE A 1 420 ? 16.344  75.678 57.526 1.00 23.26  ? 423  PHE A CE1 1 
ATOM   3278 C CE2 . PHE A 1 420 ? 15.793  74.735 59.666 1.00 24.20  ? 423  PHE A CE2 1 
ATOM   3279 C CZ  . PHE A 1 420 ? 15.831  75.827 58.803 1.00 23.85  ? 423  PHE A CZ  1 
ATOM   3280 N N   . ASN A 1 421 ? 20.137  72.735 59.509 1.00 28.60  ? 424  ASN A N   1 
ATOM   3281 C CA  . ASN A 1 421 ? 20.558  72.829 60.893 1.00 29.03  ? 424  ASN A CA  1 
ATOM   3282 C C   . ASN A 1 421 ? 20.531  74.229 61.479 1.00 30.40  ? 424  ASN A C   1 
ATOM   3283 O O   . ASN A 1 421 ? 21.310  74.544 62.379 1.00 33.32  ? 424  ASN A O   1 
ATOM   3284 C CB  . ASN A 1 421 ? 21.925  72.170 61.101 1.00 27.08  ? 424  ASN A CB  1 
ATOM   3285 C CG  . ASN A 1 421 ? 23.003  72.778 60.243 1.00 27.92  ? 424  ASN A CG  1 
ATOM   3286 O OD1 . ASN A 1 421 ? 22.735  73.630 59.396 1.00 30.34  ? 424  ASN A OD1 1 
ATOM   3287 N ND2 . ASN A 1 421 ? 24.234  72.341 60.452 1.00 27.29  ? 424  ASN A ND2 1 
ATOM   3288 N N   . HIS A 1 422 ? 19.630  75.067 60.983 1.00 27.90  ? 425  HIS A N   1 
ATOM   3289 C CA  . HIS A 1 422 ? 19.502  76.405 61.533 1.00 28.97  ? 425  HIS A CA  1 
ATOM   3290 C C   . HIS A 1 422 ? 18.241  76.523 62.392 1.00 30.22  ? 425  HIS A C   1 
ATOM   3291 O O   . HIS A 1 422 ? 17.129  76.330 61.905 1.00 33.43  ? 425  HIS A O   1 
ATOM   3292 C CB  . HIS A 1 422 ? 19.464  77.465 60.436 1.00 30.32  ? 425  HIS A CB  1 
ATOM   3293 C CG  . HIS A 1 422 ? 19.093  78.825 60.945 1.00 29.58  ? 425  HIS A CG  1 
ATOM   3294 N ND1 . HIS A 1 422 ? 20.011  79.694 61.495 1.00 28.49  ? 425  HIS A ND1 1 
ATOM   3295 C CD2 . HIS A 1 422 ? 17.887  79.432 61.060 1.00 30.43  ? 425  HIS A CD2 1 
ATOM   3296 C CE1 . HIS A 1 422 ? 19.388  80.774 61.932 1.00 27.05  ? 425  HIS A CE1 1 
ATOM   3297 N NE2 . HIS A 1 422 ? 18.099  80.639 61.680 1.00 27.62  ? 425  HIS A NE2 1 
ATOM   3298 N N   . ARG A 1 423 ? 18.410  76.865 63.662 1.00 29.44  ? 426  ARG A N   1 
ATOM   3299 C CA  . ARG A 1 423 ? 17.269  77.023 64.556 1.00 29.99  ? 426  ARG A CA  1 
ATOM   3300 C C   . ARG A 1 423 ? 16.728  78.446 64.428 1.00 30.85  ? 426  ARG A C   1 
ATOM   3301 O O   . ARG A 1 423 ? 17.476  79.414 64.571 1.00 30.70  ? 426  ARG A O   1 
ATOM   3302 C CB  . ARG A 1 423 ? 17.686  76.732 66.003 1.00 29.33  ? 426  ARG A CB  1 
ATOM   3303 C CG  . ARG A 1 423 ? 16.570  76.900 67.024 1.00 30.20  ? 426  ARG A CG  1 
ATOM   3304 C CD  . ARG A 1 423 ? 17.054  76.570 68.423 1.00 31.58  ? 426  ARG A CD  1 
ATOM   3305 N NE  . ARG A 1 423 ? 16.213  77.186 69.445 1.00 29.71  ? 426  ARG A NE  1 
ATOM   3306 C CZ  . ARG A 1 423 ? 15.278  76.545 70.137 1.00 34.05  ? 426  ARG A CZ  1 
ATOM   3307 N NH1 . ARG A 1 423 ? 15.046  75.250 69.928 1.00 30.03  ? 426  ARG A NH1 1 
ATOM   3308 N NH2 . ARG A 1 423 ? 14.585  77.203 71.054 1.00 34.17  ? 426  ARG A NH2 1 
ATOM   3309 N N   . ALA A 1 424 ? 15.436  78.570 64.133 1.00 31.67  ? 427  ALA A N   1 
ATOM   3310 C CA  . ALA A 1 424 ? 14.811  79.880 63.989 1.00 31.73  ? 427  ALA A CA  1 
ATOM   3311 C C   . ALA A 1 424 ? 15.028  80.660 65.282 1.00 35.95  ? 427  ALA A C   1 
ATOM   3312 O O   . ALA A 1 424 ? 14.827  80.131 66.380 1.00 36.85  ? 427  ALA A O   1 
ATOM   3313 C CB  . ALA A 1 424 ? 13.332  79.729 63.699 1.00 33.13  ? 427  ALA A CB  1 
ATOM   3314 N N   . SER A 1 425 ? 15.410  81.926 65.138 1.00 37.59  ? 428  SER A N   1 
ATOM   3315 C CA  . SER A 1 425 ? 15.705  82.802 66.270 1.00 36.27  ? 428  SER A CA  1 
ATOM   3316 C C   . SER A 1 425 ? 14.485  83.081 67.130 1.00 36.07  ? 428  SER A C   1 
ATOM   3317 O O   . SER A 1 425 ? 14.604  83.317 68.335 1.00 36.33  ? 428  SER A O   1 
ATOM   3318 C CB  . SER A 1 425 ? 16.309  84.121 65.774 1.00 35.56  ? 428  SER A CB  1 
ATOM   3319 O OG  . SER A 1 425 ? 15.399  84.811 64.937 1.00 33.16  ? 428  SER A OG  1 
ATOM   3320 N N   . ASN A 1 426 ? 13.314  83.045 66.507 1.00 34.48  ? 429  ASN A N   1 
ATOM   3321 C CA  . ASN A 1 426 ? 12.069  83.294 67.216 1.00 34.04  ? 429  ASN A CA  1 
ATOM   3322 C C   . ASN A 1 426 ? 11.362  82.009 67.633 1.00 33.44  ? 429  ASN A C   1 
ATOM   3323 O O   . ASN A 1 426 ? 10.161  82.022 67.919 1.00 33.92  ? 429  ASN A O   1 
ATOM   3324 C CB  . ASN A 1 426 ? 11.139  84.155 66.357 1.00 34.98  ? 429  ASN A CB  1 
ATOM   3325 C CG  . ASN A 1 426 ? 10.893  83.562 64.981 1.00 36.95  ? 429  ASN A CG  1 
ATOM   3326 O OD1 . ASN A 1 426 ? 11.449  82.523 64.618 1.00 36.89  ? 429  ASN A OD1 1 
ATOM   3327 N ND2 . ASN A 1 426 ? 10.057  84.231 64.203 1.00 38.72  ? 429  ASN A ND2 1 
ATOM   3328 N N   . LEU A 1 427 ? 12.099  80.902 67.668 1.00 32.08  ? 430  LEU A N   1 
ATOM   3329 C CA  . LEU A 1 427 ? 11.509  79.626 68.053 1.00 31.94  ? 430  LEU A CA  1 
ATOM   3330 C C   . LEU A 1 427 ? 11.098  79.664 69.528 1.00 32.40  ? 430  LEU A C   1 
ATOM   3331 O O   . LEU A 1 427 ? 11.923  79.936 70.403 1.00 35.07  ? 430  LEU A O   1 
ATOM   3332 C CB  . LEU A 1 427 ? 12.488  78.479 67.784 1.00 30.69  ? 430  LEU A CB  1 
ATOM   3333 C CG  . LEU A 1 427 ? 11.920  77.322 66.952 1.00 27.85  ? 430  LEU A CG  1 
ATOM   3334 C CD1 . LEU A 1 427 ? 13.013  76.323 66.640 1.00 27.72  ? 430  LEU A CD1 1 
ATOM   3335 C CD2 . LEU A 1 427 ? 10.781  76.651 67.696 1.00 25.94  ? 430  LEU A CD2 1 
ATOM   3336 N N   . VAL A 1 428 ? 9.819   79.411 69.789 1.00 29.67  ? 431  VAL A N   1 
ATOM   3337 C CA  . VAL A 1 428 ? 9.284   79.438 71.146 1.00 28.94  ? 431  VAL A CA  1 
ATOM   3338 C C   . VAL A 1 428 ? 9.537   78.184 71.972 1.00 30.68  ? 431  VAL A C   1 
ATOM   3339 O O   . VAL A 1 428 ? 9.401   78.210 73.192 1.00 32.32  ? 431  VAL A O   1 
ATOM   3340 C CB  . VAL A 1 428 ? 7.774   79.727 71.154 1.00 31.40  ? 431  VAL A CB  1 
ATOM   3341 C CG1 . VAL A 1 428 ? 7.502   81.128 70.617 1.00 28.30  ? 431  VAL A CG1 1 
ATOM   3342 C CG2 . VAL A 1 428 ? 7.025   78.662 70.350 1.00 29.28  ? 431  VAL A CG2 1 
ATOM   3343 N N   . TRP A 1 429 ? 9.860   77.076 71.314 1.00 31.52  ? 432  TRP A N   1 
ATOM   3344 C CA  . TRP A 1 429 ? 10.137  75.833 72.028 1.00 28.36  ? 432  TRP A CA  1 
ATOM   3345 C C   . TRP A 1 429 ? 11.483  75.977 72.721 1.00 28.02  ? 432  TRP A C   1 
ATOM   3346 O O   . TRP A 1 429 ? 12.317  76.773 72.296 1.00 28.72  ? 432  TRP A O   1 
ATOM   3347 C CB  . TRP A 1 429 ? 10.173  74.655 71.057 1.00 29.31  ? 432  TRP A CB  1 
ATOM   3348 C CG  . TRP A 1 429 ? 8.837   74.277 70.507 1.00 27.86  ? 432  TRP A CG  1 
ATOM   3349 C CD1 . TRP A 1 429 ? 8.321   74.621 69.291 1.00 27.67  ? 432  TRP A CD1 1 
ATOM   3350 C CD2 . TRP A 1 429 ? 7.839   73.484 71.155 1.00 29.21  ? 432  TRP A CD2 1 
ATOM   3351 N NE1 . TRP A 1 429 ? 7.063   74.096 69.144 1.00 24.49  ? 432  TRP A NE1 1 
ATOM   3352 C CE2 . TRP A 1 429 ? 6.741   73.392 70.274 1.00 28.55  ? 432  TRP A CE2 1 
ATOM   3353 C CE3 . TRP A 1 429 ? 7.763   72.841 72.396 1.00 30.39  ? 432  TRP A CE3 1 
ATOM   3354 C CZ2 . TRP A 1 429 ? 5.583   72.680 70.594 1.00 28.60  ? 432  TRP A CZ2 1 
ATOM   3355 C CZ3 . TRP A 1 429 ? 6.611   72.132 72.712 1.00 26.82  ? 432  TRP A CZ3 1 
ATOM   3356 C CH2 . TRP A 1 429 ? 5.538   72.060 71.815 1.00 28.47  ? 432  TRP A CH2 1 
ATOM   3357 N N   . PRO A 1 430 ? 11.715  75.209 73.798 1.00 26.47  ? 433  PRO A N   1 
ATOM   3358 C CA  . PRO A 1 430 ? 12.986  75.293 74.521 1.00 25.67  ? 433  PRO A CA  1 
ATOM   3359 C C   . PRO A 1 430 ? 14.206  75.019 73.650 1.00 30.14  ? 433  PRO A C   1 
ATOM   3360 O O   . PRO A 1 430 ? 14.118  74.365 72.614 1.00 31.90  ? 433  PRO A O   1 
ATOM   3361 C CB  . PRO A 1 430 ? 12.823  74.245 75.623 1.00 26.49  ? 433  PRO A CB  1 
ATOM   3362 C CG  . PRO A 1 430 ? 11.842  73.275 75.045 1.00 24.17  ? 433  PRO A CG  1 
ATOM   3363 C CD  . PRO A 1 430 ? 10.845  74.179 74.389 1.00 23.31  ? 433  PRO A CD  1 
ATOM   3364 N N   . GLU A 1 431 ? 15.345  75.533 74.091 1.00 32.65  ? 434  GLU A N   1 
ATOM   3365 C CA  . GLU A 1 431 ? 16.612  75.380 73.389 1.00 34.42  ? 434  GLU A CA  1 
ATOM   3366 C C   . GLU A 1 431 ? 17.073  73.935 73.232 1.00 33.07  ? 434  GLU A C   1 
ATOM   3367 O O   . GLU A 1 431 ? 17.639  73.572 72.202 1.00 32.22  ? 434  GLU A O   1 
ATOM   3368 C CB  . GLU A 1 431 ? 17.704  76.152 74.132 1.00 39.57  ? 434  GLU A CB  1 
ATOM   3369 C CG  . GLU A 1 431 ? 17.639  77.662 73.985 1.00 51.03  ? 434  GLU A CG  1 
ATOM   3370 C CD  . GLU A 1 431 ? 18.178  78.144 72.652 1.00 56.38  ? 434  GLU A CD  1 
ATOM   3371 O OE1 . GLU A 1 431 ? 17.506  78.971 71.999 1.00 60.94  ? 434  GLU A OE1 1 
ATOM   3372 O OE2 . GLU A 1 431 ? 19.281  77.700 72.259 1.00 61.25  ? 434  GLU A OE2 1 
ATOM   3373 N N   . TRP A 1 432 ? 16.833  73.111 74.249 1.00 30.26  ? 435  TRP A N   1 
ATOM   3374 C CA  . TRP A 1 432 ? 17.283  71.727 74.213 1.00 28.94  ? 435  TRP A CA  1 
ATOM   3375 C C   . TRP A 1 432 ? 16.707  70.935 73.049 1.00 28.69  ? 435  TRP A C   1 
ATOM   3376 O O   . TRP A 1 432 ? 17.301  69.957 72.600 1.00 29.59  ? 435  TRP A O   1 
ATOM   3377 C CB  . TRP A 1 432 ? 17.017  71.026 75.552 1.00 27.11  ? 435  TRP A CB  1 
ATOM   3378 C CG  . TRP A 1 432 ? 15.587  70.782 75.875 1.00 28.77  ? 435  TRP A CG  1 
ATOM   3379 C CD1 . TRP A 1 432 ? 14.774  71.573 76.627 1.00 29.62  ? 435  TRP A CD1 1 
ATOM   3380 C CD2 . TRP A 1 432 ? 14.788  69.664 75.458 1.00 30.19  ? 435  TRP A CD2 1 
ATOM   3381 N NE1 . TRP A 1 432 ? 13.514  71.021 76.706 1.00 31.77  ? 435  TRP A NE1 1 
ATOM   3382 C CE2 . TRP A 1 432 ? 13.495  69.850 75.994 1.00 28.45  ? 435  TRP A CE2 1 
ATOM   3383 C CE3 . TRP A 1 432 ? 15.040  68.526 74.676 1.00 30.52  ? 435  TRP A CE3 1 
ATOM   3384 C CZ2 . TRP A 1 432 ? 12.453  68.943 75.775 1.00 29.07  ? 435  TRP A CZ2 1 
ATOM   3385 C CZ3 . TRP A 1 432 ? 13.998  67.618 74.458 1.00 30.45  ? 435  TRP A CZ3 1 
ATOM   3386 C CH2 . TRP A 1 432 ? 12.721  67.837 75.006 1.00 30.01  ? 435  TRP A CH2 1 
ATOM   3387 N N   . MET A 1 433 ? 15.565  71.382 72.541 1.00 28.34  ? 436  MET A N   1 
ATOM   3388 C CA  . MET A 1 433 ? 14.922  70.703 71.428 1.00 26.97  ? 436  MET A CA  1 
ATOM   3389 C C   . MET A 1 433 ? 15.675  70.914 70.117 1.00 26.34  ? 436  MET A C   1 
ATOM   3390 O O   . MET A 1 433 ? 15.567  70.103 69.204 1.00 26.57  ? 436  MET A O   1 
ATOM   3391 C CB  . MET A 1 433 ? 13.463  71.134 71.327 1.00 24.35  ? 436  MET A CB  1 
ATOM   3392 C CG  . MET A 1 433 ? 12.625  70.593 72.466 1.00 19.62  ? 436  MET A CG  1 
ATOM   3393 S SD  . MET A 1 433 ? 10.913  71.109 72.434 1.00 26.79  ? 436  MET A SD  1 
ATOM   3394 C CE  . MET A 1 433 ? 10.159  69.798 71.408 1.00 22.94  ? 436  MET A CE  1 
ATOM   3395 N N   . GLY A 1 434 ? 16.458  71.989 70.056 1.00 26.32  ? 437  GLY A N   1 
ATOM   3396 C CA  . GLY A 1 434 ? 17.261  72.294 68.882 1.00 27.15  ? 437  GLY A CA  1 
ATOM   3397 C C   . GLY A 1 434 ? 16.532  72.682 67.606 1.00 29.86  ? 437  GLY A C   1 
ATOM   3398 O O   . GLY A 1 434 ? 15.567  73.454 67.631 1.00 32.74  ? 437  GLY A O   1 
ATOM   3399 N N   . VAL A 1 435 ? 17.052  72.202 66.477 1.00 28.88  ? 438  VAL A N   1 
ATOM   3400 C CA  . VAL A 1 435 ? 16.456  72.470 65.173 1.00 26.22  ? 438  VAL A CA  1 
ATOM   3401 C C   . VAL A 1 435 ? 15.343  71.446 65.043 1.00 27.58  ? 438  VAL A C   1 
ATOM   3402 O O   . VAL A 1 435 ? 15.487  70.401 64.401 1.00 25.82  ? 438  VAL A O   1 
ATOM   3403 C CB  . VAL A 1 435 ? 17.472  72.287 64.040 1.00 27.58  ? 438  VAL A CB  1 
ATOM   3404 C CG1 . VAL A 1 435 ? 16.878  72.765 62.723 1.00 25.88  ? 438  VAL A CG1 1 
ATOM   3405 C CG2 . VAL A 1 435 ? 18.753  73.037 64.364 1.00 23.68  ? 438  VAL A CG2 1 
ATOM   3406 N N   . ILE A 1 436 ? 14.246  71.753 65.720 1.00 27.72  ? 439  ILE A N   1 
ATOM   3407 C CA  . ILE A 1 436 ? 13.081  70.895 65.780 1.00 28.65  ? 439  ILE A CA  1 
ATOM   3408 C C   . ILE A 1 436 ? 12.485  70.560 64.438 1.00 30.55  ? 439  ILE A C   1 
ATOM   3409 O O   . ILE A 1 436 ? 12.377  71.406 63.552 1.00 30.60  ? 439  ILE A O   1 
ATOM   3410 C CB  . ILE A 1 436 ? 11.990  71.536 66.613 1.00 31.59  ? 439  ILE A CB  1 
ATOM   3411 C CG1 . ILE A 1 436 ? 12.536  71.928 67.983 1.00 32.68  ? 439  ILE A CG1 1 
ATOM   3412 C CG2 . ILE A 1 436 ? 10.835  70.585 66.753 1.00 32.34  ? 439  ILE A CG2 1 
ATOM   3413 C CD1 . ILE A 1 436 ? 11.642  72.871 68.723 1.00 31.11  ? 439  ILE A CD1 1 
ATOM   3414 N N   . HIS A 1 437 ? 12.029  69.325 64.322 1.00 32.14  ? 440  HIS A N   1 
ATOM   3415 C CA  . HIS A 1 437 ? 11.424  68.873 63.093 1.00 33.51  ? 440  HIS A CA  1 
ATOM   3416 C C   . HIS A 1 437 ? 10.222  69.773 62.779 1.00 32.00  ? 440  HIS A C   1 
ATOM   3417 O O   . HIS A 1 437 ? 9.500   70.194 63.688 1.00 33.08  ? 440  HIS A O   1 
ATOM   3418 C CB  . HIS A 1 437 ? 11.054  67.392 63.238 1.00 35.05  ? 440  HIS A CB  1 
ATOM   3419 C CG  . HIS A 1 437 ? 9.606   67.100 63.042 1.00 37.47  ? 440  HIS A CG  1 
ATOM   3420 N ND1 . HIS A 1 437 ? 9.081   66.757 61.817 1.00 39.19  ? 440  HIS A ND1 1 
ATOM   3421 C CD2 . HIS A 1 437 ? 8.565   67.128 63.907 1.00 41.65  ? 440  HIS A CD2 1 
ATOM   3422 C CE1 . HIS A 1 437 ? 7.775   66.595 61.932 1.00 42.83  ? 440  HIS A CE1 1 
ATOM   3423 N NE2 . HIS A 1 437 ? 7.436   66.814 63.191 1.00 43.45  ? 440  HIS A NE2 1 
ATOM   3424 N N   . GLY A 1 438 ? 10.087  70.139 61.505 1.00 31.17  ? 441  GLY A N   1 
ATOM   3425 C CA  . GLY A 1 438 ? 8.993   70.988 61.065 1.00 26.65  ? 441  GLY A CA  1 
ATOM   3426 C C   . GLY A 1 438 ? 9.308   72.472 61.027 1.00 27.95  ? 441  GLY A C   1 
ATOM   3427 O O   . GLY A 1 438 ? 8.589   73.249 60.401 1.00 27.50  ? 441  GLY A O   1 
ATOM   3428 N N   . TYR A 1 439 ? 10.406  72.877 61.657 1.00 27.66  ? 442  TYR A N   1 
ATOM   3429 C CA  . TYR A 1 439 ? 10.754  74.291 61.692 1.00 28.74  ? 442  TYR A CA  1 
ATOM   3430 C C   . TYR A 1 439 ? 11.593  74.847 60.546 1.00 29.45  ? 442  TYR A C   1 
ATOM   3431 O O   . TYR A 1 439 ? 12.202  75.916 60.654 1.00 28.35  ? 442  TYR A O   1 
ATOM   3432 C CB  . TYR A 1 439 ? 11.277  74.677 63.080 1.00 26.78  ? 442  TYR A CB  1 
ATOM   3433 C CG  . TYR A 1 439 ? 10.123  74.777 64.043 1.00 25.34  ? 442  TYR A CG  1 
ATOM   3434 C CD1 . TYR A 1 439 ? 9.619   73.641 64.680 1.00 21.77  ? 442  TYR A CD1 1 
ATOM   3435 C CD2 . TYR A 1 439 ? 9.446   75.984 64.214 1.00 22.29  ? 442  TYR A CD2 1 
ATOM   3436 C CE1 . TYR A 1 439 ? 8.464   73.703 65.449 1.00 20.94  ? 442  TYR A CE1 1 
ATOM   3437 C CE2 . TYR A 1 439 ? 8.291   76.057 64.979 1.00 21.82  ? 442  TYR A CE2 1 
ATOM   3438 C CZ  . TYR A 1 439 ? 7.803   74.912 65.591 1.00 22.36  ? 442  TYR A CZ  1 
ATOM   3439 O OH  . TYR A 1 439 ? 6.636   74.980 66.320 1.00 25.14  ? 442  TYR A OH  1 
ATOM   3440 N N   . GLU A 1 440 ? 11.565  74.127 59.430 1.00 28.03  ? 443  GLU A N   1 
ATOM   3441 C CA  . GLU A 1 440 ? 12.252  74.539 58.220 1.00 26.91  ? 443  GLU A CA  1 
ATOM   3442 C C   . GLU A 1 440 ? 11.133  74.959 57.267 1.00 27.99  ? 443  GLU A C   1 
ATOM   3443 O O   . GLU A 1 440 ? 11.361  75.678 56.294 1.00 31.01  ? 443  GLU A O   1 
ATOM   3444 C CB  . GLU A 1 440 ? 13.045  73.375 57.619 1.00 27.00  ? 443  GLU A CB  1 
ATOM   3445 C CG  . GLU A 1 440 ? 12.244  72.417 56.716 1.00 28.17  ? 443  GLU A CG  1 
ATOM   3446 C CD  . GLU A 1 440 ? 11.388  71.406 57.471 1.00 28.06  ? 443  GLU A CD  1 
ATOM   3447 O OE1 . GLU A 1 440 ? 11.244  71.510 58.702 1.00 30.68  ? 443  GLU A OE1 1 
ATOM   3448 O OE2 . GLU A 1 440 ? 10.860  70.489 56.821 1.00 26.50  ? 443  GLU A OE2 1 
ATOM   3449 N N   . ILE A 1 441 ? 9.919   74.510 57.574 1.00 25.95  ? 444  ILE A N   1 
ATOM   3450 C CA  . ILE A 1 441 ? 8.754   74.807 56.758 1.00 26.36  ? 444  ILE A CA  1 
ATOM   3451 C C   . ILE A 1 441 ? 8.547   76.307 56.605 1.00 28.51  ? 444  ILE A C   1 
ATOM   3452 O O   . ILE A 1 441 ? 8.294   76.787 55.502 1.00 29.68  ? 444  ILE A O   1 
ATOM   3453 C CB  . ILE A 1 441 ? 7.479   74.171 57.345 1.00 24.91  ? 444  ILE A CB  1 
ATOM   3454 C CG1 . ILE A 1 441 ? 7.621   72.647 57.382 1.00 22.40  ? 444  ILE A CG1 1 
ATOM   3455 C CG2 . ILE A 1 441 ? 6.258   74.589 56.535 1.00 24.74  ? 444  ILE A CG2 1 
ATOM   3456 C CD1 . ILE A 1 441 ? 6.462   71.946 58.042 1.00 19.82  ? 444  ILE A CD1 1 
ATOM   3457 N N   . GLU A 1 442 ? 8.662   77.043 57.707 1.00 28.88  ? 445  GLU A N   1 
ATOM   3458 C CA  . GLU A 1 442 ? 8.490   78.495 57.673 1.00 30.18  ? 445  GLU A CA  1 
ATOM   3459 C C   . GLU A 1 442 ? 9.492   79.144 56.723 1.00 30.16  ? 445  GLU A C   1 
ATOM   3460 O O   . GLU A 1 442 ? 9.227   80.204 56.160 1.00 31.29  ? 445  GLU A O   1 
ATOM   3461 C CB  . GLU A 1 442 ? 8.611   79.089 59.079 1.00 30.86  ? 445  GLU A CB  1 
ATOM   3462 C CG  . GLU A 1 442 ? 9.851   78.652 59.851 1.00 31.69  ? 445  GLU A CG  1 
ATOM   3463 C CD  . GLU A 1 442 ? 9.664   78.751 61.359 1.00 31.35  ? 445  GLU A CD  1 
ATOM   3464 O OE1 . GLU A 1 442 ? 8.620   78.283 61.864 1.00 29.24  ? 445  GLU A OE1 1 
ATOM   3465 O OE2 . GLU A 1 442 ? 10.562  79.288 62.038 1.00 30.72  ? 445  GLU A OE2 1 
ATOM   3466 N N   . PHE A 1 443 ? 10.642  78.502 56.544 1.00 28.96  ? 446  PHE A N   1 
ATOM   3467 C CA  . PHE A 1 443 ? 11.644  79.022 55.628 1.00 30.61  ? 446  PHE A CA  1 
ATOM   3468 C C   . PHE A 1 443 ? 11.250  78.670 54.194 1.00 31.41  ? 446  PHE A C   1 
ATOM   3469 O O   . PHE A 1 443 ? 11.399  79.484 53.278 1.00 32.75  ? 446  PHE A O   1 
ATOM   3470 C CB  . PHE A 1 443 ? 13.026  78.469 55.976 1.00 32.10  ? 446  PHE A CB  1 
ATOM   3471 C CG  . PHE A 1 443 ? 13.557  78.981 57.280 1.00 38.22  ? 446  PHE A CG  1 
ATOM   3472 C CD1 . PHE A 1 443 ? 13.184  78.386 58.481 1.00 36.80  ? 446  PHE A CD1 1 
ATOM   3473 C CD2 . PHE A 1 443 ? 14.391  80.098 57.315 1.00 41.21  ? 446  PHE A CD2 1 
ATOM   3474 C CE1 . PHE A 1 443 ? 13.632  78.894 59.698 1.00 39.17  ? 446  PHE A CE1 1 
ATOM   3475 C CE2 . PHE A 1 443 ? 14.846  80.616 58.532 1.00 39.66  ? 446  PHE A CE2 1 
ATOM   3476 C CZ  . PHE A 1 443 ? 14.463  80.013 59.725 1.00 39.41  ? 446  PHE A CZ  1 
ATOM   3477 N N   . VAL A 1 444 ? 10.717  77.466 54.013 1.00 27.89  ? 447  VAL A N   1 
ATOM   3478 C CA  . VAL A 1 444 ? 10.286  77.004 52.701 1.00 25.69  ? 447  VAL A CA  1 
ATOM   3479 C C   . VAL A 1 444 ? 9.113   77.851 52.222 1.00 27.24  ? 447  VAL A C   1 
ATOM   3480 O O   . VAL A 1 444 ? 8.998   78.150 51.036 1.00 28.71  ? 447  VAL A O   1 
ATOM   3481 C CB  . VAL A 1 444 ? 9.880   75.510 52.747 1.00 25.54  ? 447  VAL A CB  1 
ATOM   3482 C CG1 . VAL A 1 444 ? 9.121   75.110 51.490 1.00 24.85  ? 447  VAL A CG1 1 
ATOM   3483 C CG2 . VAL A 1 444 ? 11.116  74.644 52.909 1.00 23.60  ? 447  VAL A CG2 1 
ATOM   3484 N N   . PHE A 1 445 ? 8.270   78.277 53.157 1.00 26.38  ? 448  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 445 ? 7.115   79.091 52.816 1.00 26.46  ? 448  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 445 ? 7.335   80.593 52.900 1.00 26.60  ? 448  PHE A C   1 
ATOM   3487 O O   . PHE A 1 445 ? 6.391   81.370 52.793 1.00 25.67  ? 448  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 445 ? 5.897   78.656 53.620 1.00 24.00  ? 448  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 445 ? 5.274   77.404 53.100 1.00 26.66  ? 448  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 445 ? 5.861   76.168 53.345 1.00 27.40  ? 448  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 445 ? 4.136   77.458 52.307 1.00 27.05  ? 448  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 445 ? 5.326   75.006 52.804 1.00 26.18  ? 448  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 445 ? 3.591   76.298 51.761 1.00 26.86  ? 448  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 445 ? 4.190   75.071 52.010 1.00 26.66  ? 448  PHE A CZ  1 
ATOM   3495 N N   . GLY A 1 446 ? 8.592   80.986 53.086 1.00 28.72  ? 449  GLY A N   1 
ATOM   3496 C CA  . GLY A 1 446 ? 8.950   82.393 53.133 1.00 30.41  ? 449  GLY A CA  1 
ATOM   3497 C C   . GLY A 1 446 ? 8.368   83.283 54.213 1.00 32.22  ? 449  GLY A C   1 
ATOM   3498 O O   . GLY A 1 446 ? 8.185   84.476 53.987 1.00 33.24  ? 449  GLY A O   1 
ATOM   3499 N N   . LEU A 1 447 ? 8.070   82.721 55.378 1.00 33.54  ? 450  LEU A N   1 
ATOM   3500 C CA  . LEU A 1 447 ? 7.539   83.511 56.485 1.00 33.06  ? 450  LEU A CA  1 
ATOM   3501 C C   . LEU A 1 447 ? 8.547   84.573 56.955 1.00 34.15  ? 450  LEU A C   1 
ATOM   3502 O O   . LEU A 1 447 ? 8.142   85.645 57.400 1.00 33.40  ? 450  LEU A O   1 
ATOM   3503 C CB  . LEU A 1 447 ? 7.112   82.610 57.651 1.00 32.24  ? 450  LEU A CB  1 
ATOM   3504 C CG  . LEU A 1 447 ? 5.788   81.838 57.537 1.00 32.50  ? 450  LEU A CG  1 
ATOM   3505 C CD1 . LEU A 1 447 ? 4.612   82.781 57.615 1.00 33.86  ? 450  LEU A CD1 1 
ATOM   3506 C CD2 . LEU A 1 447 ? 5.736   81.051 56.244 1.00 35.53  ? 450  LEU A CD2 1 
ATOM   3507 N N   . PRO A 1 448 ? 9.869   84.285 56.874 1.00 35.75  ? 451  PRO A N   1 
ATOM   3508 C CA  . PRO A 1 448 ? 10.895  85.252 57.295 1.00 37.59  ? 451  PRO A CA  1 
ATOM   3509 C C   . PRO A 1 448 ? 10.928  86.588 56.533 1.00 40.22  ? 451  PRO A C   1 
ATOM   3510 O O   . PRO A 1 448 ? 11.599  87.530 56.967 1.00 41.15  ? 451  PRO A O   1 
ATOM   3511 C CB  . PRO A 1 448 ? 12.196  84.472 57.098 1.00 36.03  ? 451  PRO A CB  1 
ATOM   3512 C CG  . PRO A 1 448 ? 11.793  83.089 57.427 1.00 34.65  ? 451  PRO A CG  1 
ATOM   3513 C CD  . PRO A 1 448 ? 10.491  82.959 56.677 1.00 35.57  ? 451  PRO A CD  1 
ATOM   3514 N N   . LEU A 1 449 ? 10.235  86.670 55.397 1.00 42.15  ? 452  LEU A N   1 
ATOM   3515 C CA  . LEU A 1 449 ? 10.205  87.914 54.625 1.00 43.48  ? 452  LEU A CA  1 
ATOM   3516 C C   . LEU A 1 449 ? 9.246   88.897 55.289 1.00 43.76  ? 452  LEU A C   1 
ATOM   3517 O O   . LEU A 1 449 ? 9.353   90.107 55.103 1.00 46.52  ? 452  LEU A O   1 
ATOM   3518 C CB  . LEU A 1 449 ? 9.755   87.673 53.180 1.00 41.60  ? 452  LEU A CB  1 
ATOM   3519 C CG  . LEU A 1 449 ? 10.318  86.510 52.364 1.00 44.27  ? 452  LEU A CG  1 
ATOM   3520 C CD1 . LEU A 1 449 ? 10.132  86.837 50.897 1.00 41.93  ? 452  LEU A CD1 1 
ATOM   3521 C CD2 . LEU A 1 449 ? 11.780  86.256 52.662 1.00 42.61  ? 452  LEU A CD2 1 
ATOM   3522 N N   . VAL A 1 450 ? 8.290   88.361 56.042 1.00 43.69  ? 453  VAL A N   1 
ATOM   3523 C CA  . VAL A 1 450 ? 7.307   89.173 56.747 1.00 44.38  ? 453  VAL A CA  1 
ATOM   3524 C C   . VAL A 1 450 ? 7.948   89.680 58.041 1.00 47.94  ? 453  VAL A C   1 
ATOM   3525 O O   . VAL A 1 450 ? 8.118   88.924 59.003 1.00 48.21  ? 453  VAL A O   1 
ATOM   3526 C CB  . VAL A 1 450 ? 6.060   88.343 57.070 1.00 42.82  ? 453  VAL A CB  1 
ATOM   3527 C CG1 . VAL A 1 450 ? 4.957   89.232 57.589 1.00 43.04  ? 453  VAL A CG1 1 
ATOM   3528 C CG2 . VAL A 1 450 ? 5.609   87.592 55.838 1.00 39.43  ? 453  VAL A CG2 1 
ATOM   3529 N N   . LYS A 1 451 ? 8.304   90.964 58.049 1.00 49.86  ? 454  LYS A N   1 
ATOM   3530 C CA  . LYS A 1 451 ? 8.966   91.605 59.190 1.00 49.39  ? 454  LYS A CA  1 
ATOM   3531 C C   . LYS A 1 451 ? 8.290   91.416 60.543 1.00 49.68  ? 454  LYS A C   1 
ATOM   3532 O O   . LYS A 1 451 ? 8.961   91.191 61.553 1.00 47.86  ? 454  LYS A O   1 
ATOM   3533 C CB  . LYS A 1 451 ? 9.148   93.102 58.919 1.00 49.77  ? 454  LYS A CB  1 
ATOM   3534 N N   . GLU A 1 452 ? 6.961   91.483 60.547 1.00 50.14  ? 455  GLU A N   1 
ATOM   3535 C CA  . GLU A 1 452 ? 6.166   91.343 61.765 1.00 51.05  ? 455  GLU A CA  1 
ATOM   3536 C C   . GLU A 1 452 ? 6.400   90.015 62.483 1.00 51.34  ? 455  GLU A C   1 
ATOM   3537 O O   . GLU A 1 452 ? 6.099   89.884 63.672 1.00 53.02  ? 455  GLU A O   1 
ATOM   3538 C CB  . GLU A 1 452 ? 4.672   91.485 61.448 1.00 54.91  ? 455  GLU A CB  1 
ATOM   3539 C CG  . GLU A 1 452 ? 4.260   92.811 60.813 1.00 63.95  ? 455  GLU A CG  1 
ATOM   3540 C CD  . GLU A 1 452 ? 4.797   92.993 59.401 1.00 69.37  ? 455  GLU A CD  1 
ATOM   3541 O OE1 . GLU A 1 452 ? 5.700   93.836 59.208 1.00 73.42  ? 455  GLU A OE1 1 
ATOM   3542 O OE2 . GLU A 1 452 ? 4.323   92.288 58.483 1.00 73.08  ? 455  GLU A OE2 1 
ATOM   3543 N N   . LEU A 1 453 ? 6.922   89.031 61.752 1.00 50.16  ? 456  LEU A N   1 
ATOM   3544 C CA  . LEU A 1 453 ? 7.190   87.713 62.311 1.00 48.60  ? 456  LEU A CA  1 
ATOM   3545 C C   . LEU A 1 453 ? 8.490   87.644 63.117 1.00 49.83  ? 456  LEU A C   1 
ATOM   3546 O O   . LEU A 1 453 ? 8.816   86.611 63.702 1.00 51.29  ? 456  LEU A O   1 
ATOM   3547 C CB  . LEU A 1 453 ? 7.153   86.654 61.209 1.00 45.02  ? 456  LEU A CB  1 
ATOM   3548 C CG  . LEU A 1 453 ? 5.818   86.587 60.465 1.00 41.67  ? 456  LEU A CG  1 
ATOM   3549 C CD1 . LEU A 1 453 ? 5.806   85.397 59.537 1.00 40.42  ? 456  LEU A CD1 1 
ATOM   3550 C CD2 . LEU A 1 453 ? 4.675   86.493 61.457 1.00 37.23  ? 456  LEU A CD2 1 
ATOM   3551 N N   . ASN A 1 454 ? 9.221   88.755 63.142 1.00 50.94  ? 457  ASN A N   1 
ATOM   3552 C CA  . ASN A 1 454 ? 10.460  88.881 63.905 1.00 51.03  ? 457  ASN A CA  1 
ATOM   3553 C C   . ASN A 1 454 ? 11.596  87.922 63.581 1.00 48.14  ? 457  ASN A C   1 
ATOM   3554 O O   . ASN A 1 454 ? 12.137  87.292 64.484 1.00 52.14  ? 457  ASN A O   1 
ATOM   3555 C CB  . ASN A 1 454 ? 10.173  88.805 65.416 1.00 56.90  ? 457  ASN A CB  1 
ATOM   3556 C CG  . ASN A 1 454 ? 9.221   89.888 65.898 1.00 62.34  ? 457  ASN A CG  1 
ATOM   3557 O OD1 . ASN A 1 454 ? 9.251   91.023 65.415 1.00 65.88  ? 457  ASN A OD1 1 
ATOM   3558 N ND2 . ASN A 1 454 ? 8.373   89.542 66.869 1.00 65.43  ? 457  ASN A ND2 1 
ATOM   3559 N N   . TYR A 1 455 ? 11.951  87.783 62.310 1.00 44.70  ? 458  TYR A N   1 
ATOM   3560 C CA  . TYR A 1 455 ? 13.077  86.919 61.951 1.00 41.03  ? 458  TYR A CA  1 
ATOM   3561 C C   . TYR A 1 455 ? 14.273  87.837 61.713 1.00 41.75  ? 458  TYR A C   1 
ATOM   3562 O O   . TYR A 1 455 ? 14.102  89.046 61.551 1.00 42.87  ? 458  TYR A O   1 
ATOM   3563 C CB  . TYR A 1 455 ? 12.794  86.119 60.676 1.00 37.82  ? 458  TYR A CB  1 
ATOM   3564 C CG  . TYR A 1 455 ? 11.789  85.007 60.830 1.00 34.45  ? 458  TYR A CG  1 
ATOM   3565 C CD1 . TYR A 1 455 ? 10.434  85.233 60.605 1.00 35.17  ? 458  TYR A CD1 1 
ATOM   3566 C CD2 . TYR A 1 455 ? 12.194  83.719 61.163 1.00 35.05  ? 458  TYR A CD2 1 
ATOM   3567 C CE1 . TYR A 1 455 ? 9.505   84.206 60.703 1.00 34.48  ? 458  TYR A CE1 1 
ATOM   3568 C CE2 . TYR A 1 455 ? 11.271  82.680 61.265 1.00 34.47  ? 458  TYR A CE2 1 
ATOM   3569 C CZ  . TYR A 1 455 ? 9.928   82.933 61.033 1.00 34.35  ? 458  TYR A CZ  1 
ATOM   3570 O OH  . TYR A 1 455 ? 9.004   81.920 61.128 1.00 32.95  ? 458  TYR A OH  1 
ATOM   3571 N N   . THR A 1 456 ? 15.481  87.281 61.718 1.00 41.22  ? 459  THR A N   1 
ATOM   3572 C CA  . THR A 1 456 ? 16.670  88.089 61.474 1.00 39.55  ? 459  THR A CA  1 
ATOM   3573 C C   . THR A 1 456 ? 16.796  88.317 59.974 1.00 40.87  ? 459  THR A C   1 
ATOM   3574 O O   . THR A 1 456 ? 16.156  87.632 59.177 1.00 41.78  ? 459  THR A O   1 
ATOM   3575 C CB  . THR A 1 456 ? 17.963  87.404 61.969 1.00 37.46  ? 459  THR A CB  1 
ATOM   3576 O OG1 . THR A 1 456 ? 18.243  86.259 61.159 1.00 35.03  ? 459  THR A OG1 1 
ATOM   3577 C CG2 . THR A 1 456 ? 17.826  86.982 63.415 1.00 35.27  ? 459  THR A CG2 1 
ATOM   3578 N N   . ALA A 1 457 ? 17.629  89.280 59.598 1.00 42.11  ? 460  ALA A N   1 
ATOM   3579 C CA  . ALA A 1 457 ? 17.856  89.592 58.197 1.00 40.36  ? 460  ALA A CA  1 
ATOM   3580 C C   . ALA A 1 457 ? 18.436  88.348 57.538 1.00 40.69  ? 460  ALA A C   1 
ATOM   3581 O O   . ALA A 1 457 ? 18.079  88.010 56.409 1.00 41.66  ? 460  ALA A O   1 
ATOM   3582 C CB  . ALA A 1 457 ? 18.824  90.762 58.077 1.00 38.23  ? 460  ALA A CB  1 
ATOM   3583 N N   . GLU A 1 458 ? 19.280  87.639 58.285 1.00 41.25  ? 461  GLU A N   1 
ATOM   3584 C CA  . GLU A 1 458 ? 19.927  86.419 57.804 1.00 42.97  ? 461  GLU A CA  1 
ATOM   3585 C C   . GLU A 1 458 ? 18.887  85.339 57.524 1.00 40.93  ? 461  GLU A C   1 
ATOM   3586 O O   . GLU A 1 458 ? 18.995  84.605 56.546 1.00 40.49  ? 461  GLU A O   1 
ATOM   3587 C CB  . GLU A 1 458 ? 20.944  85.899 58.829 1.00 47.98  ? 461  GLU A CB  1 
ATOM   3588 C CG  . GLU A 1 458 ? 22.119  86.834 59.123 1.00 56.29  ? 461  GLU A CG  1 
ATOM   3589 C CD  . GLU A 1 458 ? 21.696  88.162 59.752 1.00 62.67  ? 461  GLU A CD  1 
ATOM   3590 O OE1 . GLU A 1 458 ? 20.932  88.155 60.746 1.00 65.63  ? 461  GLU A OE1 1 
ATOM   3591 O OE2 . GLU A 1 458 ? 22.122  89.222 59.242 1.00 68.74  ? 461  GLU A OE2 1 
ATOM   3592 N N   . GLU A 1 459 ? 17.873  85.260 58.377 1.00 37.94  ? 462  GLU A N   1 
ATOM   3593 C CA  . GLU A 1 459 ? 16.817  84.277 58.207 1.00 36.32  ? 462  GLU A CA  1 
ATOM   3594 C C   . GLU A 1 459 ? 15.960  84.565 56.992 1.00 37.10  ? 462  GLU A C   1 
ATOM   3595 O O   . GLU A 1 459 ? 15.455  83.644 56.352 1.00 38.46  ? 462  GLU A O   1 
ATOM   3596 C CB  . GLU A 1 459 ? 15.981  84.186 59.471 1.00 32.39  ? 462  GLU A CB  1 
ATOM   3597 C CG  . GLU A 1 459 ? 16.792  83.579 60.588 1.00 35.36  ? 462  GLU A CG  1 
ATOM   3598 C CD  . GLU A 1 459 ? 16.079  83.537 61.910 1.00 36.83  ? 462  GLU A CD  1 
ATOM   3599 O OE1 . GLU A 1 459 ? 15.188  84.374 62.155 1.00 38.08  ? 462  GLU A OE1 1 
ATOM   3600 O OE2 . GLU A 1 459 ? 16.432  82.662 62.721 1.00 37.60  ? 462  GLU A OE2 1 
ATOM   3601 N N   . GLU A 1 460 ? 15.802  85.844 56.667 1.00 37.42  ? 463  GLU A N   1 
ATOM   3602 C CA  . GLU A 1 460 ? 15.034  86.221 55.492 1.00 36.64  ? 463  GLU A CA  1 
ATOM   3603 C C   . GLU A 1 460 ? 15.822  85.781 54.262 1.00 34.11  ? 463  GLU A C   1 
ATOM   3604 O O   . GLU A 1 460 ? 15.255  85.273 53.299 1.00 35.82  ? 463  GLU A O   1 
ATOM   3605 C CB  . GLU A 1 460 ? 14.815  87.728 55.433 1.00 39.52  ? 463  GLU A CB  1 
ATOM   3606 C CG  . GLU A 1 460 ? 13.963  88.141 54.241 1.00 47.15  ? 463  GLU A CG  1 
ATOM   3607 C CD  . GLU A 1 460 ? 13.988  89.628 53.957 1.00 49.39  ? 463  GLU A CD  1 
ATOM   3608 O OE1 . GLU A 1 460 ? 13.878  90.428 54.911 1.00 53.28  ? 463  GLU A OE1 1 
ATOM   3609 O OE2 . GLU A 1 460 ? 14.111  89.995 52.768 1.00 52.58  ? 463  GLU A OE2 1 
ATOM   3610 N N   . ALA A 1 461 ? 17.138  85.965 54.317 1.00 31.58  ? 464  ALA A N   1 
ATOM   3611 C CA  . ALA A 1 461 ? 18.015  85.585 53.216 1.00 32.64  ? 464  ALA A CA  1 
ATOM   3612 C C   . ALA A 1 461 ? 18.020  84.074 53.029 1.00 33.66  ? 464  ALA A C   1 
ATOM   3613 O O   . ALA A 1 461 ? 18.011  83.585 51.903 1.00 34.69  ? 464  ALA A O   1 
ATOM   3614 C CB  . ALA A 1 461 ? 19.421  86.085 53.471 1.00 30.51  ? 464  ALA A CB  1 
ATOM   3615 N N   . LEU A 1 462 ? 18.038  83.341 54.140 1.00 34.13  ? 465  LEU A N   1 
ATOM   3616 C CA  . LEU A 1 462 ? 18.027  81.882 54.096 1.00 32.79  ? 465  LEU A CA  1 
ATOM   3617 C C   . LEU A 1 462 ? 16.696  81.414 53.526 1.00 31.25  ? 465  LEU A C   1 
ATOM   3618 O O   . LEU A 1 462 ? 16.650  80.490 52.721 1.00 32.45  ? 465  LEU A O   1 
ATOM   3619 C CB  . LEU A 1 462 ? 18.231  81.294 55.495 1.00 31.76  ? 465  LEU A CB  1 
ATOM   3620 C CG  . LEU A 1 462 ? 18.127  79.769 55.610 1.00 33.48  ? 465  LEU A CG  1 
ATOM   3621 C CD1 . LEU A 1 462 ? 19.167  79.079 54.729 1.00 30.63  ? 465  LEU A CD1 1 
ATOM   3622 C CD2 . LEU A 1 462 ? 18.296  79.365 57.057 1.00 33.87  ? 465  LEU A CD2 1 
ATOM   3623 N N   . SER A 1 463 ? 15.618  82.073 53.935 1.00 31.21  ? 466  SER A N   1 
ATOM   3624 C CA  . SER A 1 463 ? 14.290  81.732 53.453 1.00 32.56  ? 466  SER A CA  1 
ATOM   3625 C C   . SER A 1 463 ? 14.219  81.908 51.945 1.00 33.99  ? 466  SER A C   1 
ATOM   3626 O O   . SER A 1 463 ? 13.747  81.023 51.239 1.00 36.66  ? 466  SER A O   1 
ATOM   3627 C CB  . SER A 1 463 ? 13.234  82.613 54.110 1.00 30.57  ? 466  SER A CB  1 
ATOM   3628 O OG  . SER A 1 463 ? 11.948  82.310 53.600 1.00 29.53  ? 466  SER A OG  1 
ATOM   3629 N N   . ARG A 1 464 ? 14.711  83.046 51.460 1.00 34.58  ? 467  ARG A N   1 
ATOM   3630 C CA  . ARG A 1 464 ? 14.698  83.353 50.029 1.00 34.97  ? 467  ARG A CA  1 
ATOM   3631 C C   . ARG A 1 464 ? 15.538  82.364 49.238 1.00 33.36  ? 467  ARG A C   1 
ATOM   3632 O O   . ARG A 1 464 ? 15.178  81.961 48.134 1.00 31.53  ? 467  ARG A O   1 
ATOM   3633 C CB  . ARG A 1 464 ? 15.204  84.775 49.776 1.00 33.48  ? 467  ARG A CB  1 
ATOM   3634 C CG  . ARG A 1 464 ? 14.256  85.857 50.256 1.00 34.22  ? 467  ARG A CG  1 
ATOM   3635 C CD  . ARG A 1 464 ? 14.744  87.256 49.877 1.00 35.95  ? 467  ARG A CD  1 
ATOM   3636 N NE  . ARG A 1 464 ? 13.804  88.291 50.305 1.00 33.91  ? 467  ARG A NE  1 
ATOM   3637 C CZ  . ARG A 1 464 ? 12.728  88.660 49.616 1.00 34.87  ? 467  ARG A CZ  1 
ATOM   3638 N NH1 . ARG A 1 464 ? 12.452  88.091 48.450 1.00 32.84  ? 467  ARG A NH1 1 
ATOM   3639 N NH2 . ARG A 1 464 ? 11.885  89.544 50.133 1.00 32.98  ? 467  ARG A NH2 1 
ATOM   3640 N N   . ARG A 1 465 ? 16.649  81.965 49.838 1.00 32.54  ? 468  ARG A N   1 
ATOM   3641 C CA  . ARG A 1 465 ? 17.578  81.029 49.236 1.00 31.59  ? 468  ARG A CA  1 
ATOM   3642 C C   . ARG A 1 465 ? 16.967  79.631 49.172 1.00 31.79  ? 468  ARG A C   1 
ATOM   3643 O O   . ARG A 1 465 ? 17.145  78.920 48.194 1.00 34.71  ? 468  ARG A O   1 
ATOM   3644 C CB  . ARG A 1 465 ? 18.858  81.034 50.061 1.00 32.52  ? 468  ARG A CB  1 
ATOM   3645 C CG  . ARG A 1 465 ? 19.989  80.243 49.504 1.00 37.04  ? 468  ARG A CG  1 
ATOM   3646 C CD  . ARG A 1 465 ? 21.211  80.487 50.357 1.00 39.43  ? 468  ARG A CD  1 
ATOM   3647 N NE  . ARG A 1 465 ? 22.080  79.320 50.389 1.00 44.65  ? 468  ARG A NE  1 
ATOM   3648 C CZ  . ARG A 1 465 ? 22.433  78.685 51.501 1.00 47.66  ? 468  ARG A CZ  1 
ATOM   3649 N NH1 . ARG A 1 465 ? 21.997  79.107 52.683 1.00 48.03  ? 468  ARG A NH1 1 
ATOM   3650 N NH2 . ARG A 1 465 ? 23.199  77.603 51.423 1.00 50.30  ? 468  ARG A NH2 1 
ATOM   3651 N N   . ILE A 1 466 ? 16.215  79.256 50.201 1.00 31.41  ? 469  ILE A N   1 
ATOM   3652 C CA  . ILE A 1 466 ? 15.576  77.946 50.233 1.00 28.73  ? 469  ILE A CA  1 
ATOM   3653 C C   . ILE A 1 466 ? 14.405  77.922 49.256 1.00 30.46  ? 469  ILE A C   1 
ATOM   3654 O O   . ILE A 1 466 ? 14.226  76.959 48.508 1.00 31.09  ? 469  ILE A O   1 
ATOM   3655 C CB  . ILE A 1 466 ? 15.102  77.588 51.661 1.00 26.04  ? 469  ILE A CB  1 
ATOM   3656 C CG1 . ILE A 1 466 ? 16.304  77.192 52.513 1.00 22.65  ? 469  ILE A CG1 1 
ATOM   3657 C CG2 . ILE A 1 466 ? 14.063  76.474 51.632 1.00 22.69  ? 469  ILE A CG2 1 
ATOM   3658 C CD1 . ILE A 1 466 ? 15.944  76.752 53.895 1.00 23.19  ? 469  ILE A CD1 1 
ATOM   3659 N N   . MET A 1 467 ? 13.623  78.995 49.250 1.00 29.21  ? 470  MET A N   1 
ATOM   3660 C CA  . MET A 1 467 ? 12.487  79.087 48.350 1.00 30.36  ? 470  MET A CA  1 
ATOM   3661 C C   . MET A 1 467 ? 12.942  79.006 46.899 1.00 31.61  ? 470  MET A C   1 
ATOM   3662 O O   . MET A 1 467 ? 12.296  78.355 46.082 1.00 32.94  ? 470  MET A O   1 
ATOM   3663 C CB  . MET A 1 467 ? 11.714  80.388 48.565 1.00 30.29  ? 470  MET A CB  1 
ATOM   3664 C CG  . MET A 1 467 ? 10.892  80.441 49.830 1.00 29.96  ? 470  MET A CG  1 
ATOM   3665 S SD  . MET A 1 467 ? 9.703   81.785 49.722 1.00 36.08  ? 470  MET A SD  1 
ATOM   3666 C CE  . MET A 1 467 ? 10.790  83.184 50.053 1.00 32.65  ? 470  MET A CE  1 
ATOM   3667 N N   . HIS A 1 468 ? 14.064  79.651 46.584 1.00 32.10  ? 471  HIS A N   1 
ATOM   3668 C CA  . HIS A 1 468 ? 14.570  79.640 45.221 1.00 31.53  ? 471  HIS A CA  1 
ATOM   3669 C C   . HIS A 1 468 ? 15.143  78.276 44.872 1.00 31.78  ? 471  HIS A C   1 
ATOM   3670 O O   . HIS A 1 468 ? 15.114  77.865 43.714 1.00 32.45  ? 471  HIS A O   1 
ATOM   3671 C CB  . HIS A 1 468 ? 15.601  80.747 44.998 1.00 33.52  ? 471  HIS A CB  1 
ATOM   3672 C CG  . HIS A 1 468 ? 15.869  81.033 43.549 1.00 36.02  ? 471  HIS A CG  1 
ATOM   3673 N ND1 . HIS A 1 468 ? 14.860  81.207 42.627 1.00 36.31  ? 471  HIS A ND1 1 
ATOM   3674 C CD2 . HIS A 1 468 ? 17.030  81.163 42.864 1.00 34.66  ? 471  HIS A CD2 1 
ATOM   3675 C CE1 . HIS A 1 468 ? 15.385  81.432 41.435 1.00 34.23  ? 471  HIS A CE1 1 
ATOM   3676 N NE2 . HIS A 1 468 ? 16.698  81.411 41.552 1.00 35.86  ? 471  HIS A NE2 1 
ATOM   3677 N N   . TYR A 1 469 ? 15.663  77.578 45.877 1.00 32.16  ? 472  TYR A N   1 
ATOM   3678 C CA  . TYR A 1 469 ? 16.207  76.232 45.683 1.00 31.56  ? 472  TYR A CA  1 
ATOM   3679 C C   . TYR A 1 469 ? 15.059  75.303 45.313 1.00 30.34  ? 472  TYR A C   1 
ATOM   3680 O O   . TYR A 1 469 ? 15.149  74.515 44.370 1.00 28.50  ? 472  TYR A O   1 
ATOM   3681 C CB  . TYR A 1 469 ? 16.798  75.708 46.986 1.00 33.06  ? 472  TYR A CB  1 
ATOM   3682 C CG  . TYR A 1 469 ? 18.211  76.116 47.268 1.00 34.74  ? 472  TYR A CG  1 
ATOM   3683 C CD1 . TYR A 1 469 ? 19.126  76.307 46.236 1.00 36.73  ? 472  TYR A CD1 1 
ATOM   3684 C CD2 . TYR A 1 469 ? 18.657  76.244 48.580 1.00 36.33  ? 472  TYR A CD2 1 
ATOM   3685 C CE1 . TYR A 1 469 ? 20.456  76.607 46.508 1.00 37.79  ? 472  TYR A CE1 1 
ATOM   3686 C CE2 . TYR A 1 469 ? 19.977  76.541 48.861 1.00 37.15  ? 472  TYR A CE2 1 
ATOM   3687 C CZ  . TYR A 1 469 ? 20.870  76.719 47.824 1.00 37.11  ? 472  TYR A CZ  1 
ATOM   3688 O OH  . TYR A 1 469 ? 22.179  76.992 48.111 1.00 40.48  ? 472  TYR A OH  1 
ATOM   3689 N N   . TRP A 1 470 ? 13.992  75.404 46.102 1.00 27.32  ? 473  TRP A N   1 
ATOM   3690 C CA  . TRP A 1 470 ? 12.795  74.603 45.938 1.00 25.88  ? 473  TRP A CA  1 
ATOM   3691 C C   . TRP A 1 470 ? 12.093  74.866 44.616 1.00 26.63  ? 473  TRP A C   1 
ATOM   3692 O O   . TRP A 1 470 ? 11.728  73.929 43.909 1.00 29.19  ? 473  TRP A O   1 
ATOM   3693 C CB  . TRP A 1 470 ? 11.826  74.883 47.085 1.00 22.26  ? 473  TRP A CB  1 
ATOM   3694 C CG  . TRP A 1 470 ? 11.898  73.924 48.233 1.00 23.29  ? 473  TRP A CG  1 
ATOM   3695 C CD1 . TRP A 1 470 ? 10.840  73.303 48.832 1.00 23.96  ? 473  TRP A CD1 1 
ATOM   3696 C CD2 . TRP A 1 470 ? 13.068  73.525 48.969 1.00 24.39  ? 473  TRP A CD2 1 
ATOM   3697 N NE1 . TRP A 1 470 ? 11.272  72.551 49.897 1.00 25.77  ? 473  TRP A NE1 1 
ATOM   3698 C CE2 . TRP A 1 470 ? 12.633  72.665 50.005 1.00 25.13  ? 473  TRP A CE2 1 
ATOM   3699 C CE3 . TRP A 1 470 ? 14.435  73.813 48.856 1.00 22.70  ? 473  TRP A CE3 1 
ATOM   3700 C CZ2 . TRP A 1 470 ? 13.518  72.088 50.931 1.00 25.48  ? 473  TRP A CZ2 1 
ATOM   3701 C CZ3 . TRP A 1 470 ? 15.319  73.242 49.776 1.00 24.36  ? 473  TRP A CZ3 1 
ATOM   3702 C CH2 . TRP A 1 470 ? 14.853  72.387 50.802 1.00 23.80  ? 473  TRP A CH2 1 
ATOM   3703 N N   . ALA A 1 471 ? 11.894  76.141 44.294 1.00 28.11  ? 474  ALA A N   1 
ATOM   3704 C CA  . ALA A 1 471 ? 11.209  76.528 43.067 1.00 27.60  ? 474  ALA A CA  1 
ATOM   3705 C C   . ALA A 1 471 ? 12.029  76.251 41.815 1.00 28.47  ? 474  ALA A C   1 
ATOM   3706 O O   . ALA A 1 471 ? 11.495  75.768 40.822 1.00 29.99  ? 474  ALA A O   1 
ATOM   3707 C CB  . ALA A 1 471 ? 10.810  77.980 43.126 1.00 25.85  ? 474  ALA A CB  1 
ATOM   3708 N N   . THR A 1 472 ? 13.324  76.543 41.859 1.00 28.43  ? 475  THR A N   1 
ATOM   3709 C CA  . THR A 1 472 ? 14.182  76.299 40.704 1.00 28.46  ? 475  THR A CA  1 
ATOM   3710 C C   . THR A 1 472 ? 14.253  74.802 40.419 1.00 29.96  ? 475  THR A C   1 
ATOM   3711 O O   . THR A 1 472 ? 14.242  74.383 39.262 1.00 29.97  ? 475  THR A O   1 
ATOM   3712 C CB  . THR A 1 472 ? 15.586  76.875 40.915 1.00 25.15  ? 475  THR A CB  1 
ATOM   3713 O OG1 . THR A 1 472 ? 15.480  78.283 41.145 1.00 24.51  ? 475  THR A OG1 1 
ATOM   3714 C CG2 . THR A 1 472 ? 16.449  76.644 39.696 1.00 23.07  ? 475  THR A CG2 1 
ATOM   3715 N N   . PHE A 1 473 ? 14.309  73.998 41.478 1.00 29.78  ? 476  PHE A N   1 
ATOM   3716 C CA  . PHE A 1 473 ? 14.346  72.551 41.321 1.00 28.85  ? 476  PHE A CA  1 
ATOM   3717 C C   . PHE A 1 473 ? 13.012  72.049 40.761 1.00 28.68  ? 476  PHE A C   1 
ATOM   3718 O O   . PHE A 1 473 ? 12.982  71.195 39.885 1.00 29.48  ? 476  PHE A O   1 
ATOM   3719 C CB  . PHE A 1 473 ? 14.632  71.872 42.661 1.00 28.04  ? 476  PHE A CB  1 
ATOM   3720 C CG  . PHE A 1 473 ? 14.300  70.406 42.675 1.00 25.22  ? 476  PHE A CG  1 
ATOM   3721 C CD1 . PHE A 1 473 ? 15.203  69.474 42.183 1.00 24.04  ? 476  PHE A CD1 1 
ATOM   3722 C CD2 . PHE A 1 473 ? 13.065  69.965 43.142 1.00 23.87  ? 476  PHE A CD2 1 
ATOM   3723 C CE1 . PHE A 1 473 ? 14.881  68.122 42.152 1.00 25.13  ? 476  PHE A CE1 1 
ATOM   3724 C CE2 . PHE A 1 473 ? 12.727  68.613 43.116 1.00 24.57  ? 476  PHE A CE2 1 
ATOM   3725 C CZ  . PHE A 1 473 ? 13.633  67.689 42.621 1.00 24.53  ? 476  PHE A CZ  1 
ATOM   3726 N N   . ALA A 1 474 ? 11.908  72.567 41.286 1.00 29.06  ? 477  ALA A N   1 
ATOM   3727 C CA  . ALA A 1 474 ? 10.586  72.151 40.831 1.00 29.70  ? 477  ALA A CA  1 
ATOM   3728 C C   . ALA A 1 474 ? 10.426  72.454 39.352 1.00 32.09  ? 477  ALA A C   1 
ATOM   3729 O O   . ALA A 1 474 ? 9.806   71.691 38.613 1.00 31.54  ? 477  ALA A O   1 
ATOM   3730 C CB  . ALA A 1 474 ? 9.509   72.873 41.623 1.00 28.85  ? 477  ALA A CB  1 
ATOM   3731 N N   . LYS A 1 475 ? 11.063  73.542 38.911 1.00 33.30  ? 478  LYS A N   1 
ATOM   3732 C CA  . LYS A 1 475 ? 10.968  74.061 37.554 1.00 34.92  ? 478  LYS A CA  1 
ATOM   3733 C C   . LYS A 1 475 ? 11.962  73.368 36.632 1.00 34.21  ? 478  LYS A C   1 
ATOM   3734 O O   . LYS A 1 475 ? 11.641  73.190 35.429 1.00 35.34  ? 478  LYS A O   1 
ATOM   3735 C CB  . LYS A 1 475 ? 11.197  75.573 37.542 1.00 35.05  ? 478  LYS A CB  1 
ATOM   3736 C CG  . LYS A 1 475 ? 12.631  75.985 37.832 1.00 43.29  ? 478  LYS A CG  1 
ATOM   3737 C CD  . LYS A 1 475 ? 12.785  77.498 37.818 1.00 47.87  ? 478  LYS A CD  1 
ATOM   3738 C CE  . LYS A 1 475 ? 12.209  78.123 39.079 1.00 54.36  ? 478  LYS A CE  1 
ATOM   3739 N NZ  . LYS A 1 475 ? 12.354  79.605 39.079 1.00 50.69  ? 478  LYS A NZ  1 
ATOM   3740 N N   . THR A 1 476 ? 13.132  72.990 37.098 1.00 32.26  ? 479  THR A N   1 
ATOM   3741 C CA  . THR A 1 476 ? 14.155  72.413 36.240 1.00 29.79  ? 479  THR A CA  1 
ATOM   3742 C C   . THR A 1 476 ? 14.675  71.041 36.621 1.00 31.80  ? 479  THR A C   1 
ATOM   3743 O O   . THR A 1 476 ? 15.309  70.380 35.804 1.00 35.65  ? 479  THR A O   1 
ATOM   3744 C CB  . THR A 1 476 ? 15.377  73.335 36.187 1.00 31.12  ? 479  THR A CB  1 
ATOM   3745 O OG1 . THR A 1 476 ? 16.045  73.308 37.453 1.00 30.12  ? 479  THR A OG1 1 
ATOM   3746 C CG2 . THR A 1 476 ? 14.958  74.765 35.890 1.00 31.64  ? 479  THR A CG2 1 
ATOM   3747 N N   . GLY A 1 477 ? 14.460  70.635 37.867 1.00 30.81  ? 480  GLY A N   1 
ATOM   3748 C CA  . GLY A 1 477 ? 14.962  69.351 38.329 1.00 26.33  ? 480  GLY A CA  1 
ATOM   3749 C C   . GLY A 1 477 ? 16.357  69.550 38.885 1.00 26.35  ? 480  GLY A C   1 
ATOM   3750 O O   . GLY A 1 477 ? 17.104  68.600 39.092 1.00 27.14  ? 480  GLY A O   1 
ATOM   3751 N N   . ASN A 1 478 ? 16.690  70.815 39.131 1.00 28.40  ? 481  ASN A N   1 
ATOM   3752 C CA  . ASN A 1 478 ? 17.987  71.234 39.659 1.00 30.46  ? 481  ASN A CA  1 
ATOM   3753 C C   . ASN A 1 478 ? 17.728  72.502 40.483 1.00 32.65  ? 481  ASN A C   1 
ATOM   3754 O O   . ASN A 1 478 ? 17.179  73.472 39.966 1.00 34.87  ? 481  ASN A O   1 
ATOM   3755 C CB  . ASN A 1 478 ? 18.915  71.564 38.488 1.00 29.35  ? 481  ASN A CB  1 
ATOM   3756 C CG  . ASN A 1 478 ? 20.359  71.771 38.906 1.00 31.75  ? 481  ASN A CG  1 
ATOM   3757 O OD1 . ASN A 1 478 ? 21.273  71.436 38.162 1.00 35.17  ? 481  ASN A OD1 1 
ATOM   3758 N ND2 . ASN A 1 478 ? 20.575  72.346 40.074 1.00 31.67  ? 481  ASN A ND2 1 
ATOM   3759 N N   . PRO A 1 479 ? 18.121  72.511 41.773 1.00 33.70  ? 482  PRO A N   1 
ATOM   3760 C CA  . PRO A 1 479 ? 17.917  73.673 42.649 1.00 35.77  ? 482  PRO A CA  1 
ATOM   3761 C C   . PRO A 1 479 ? 18.791  74.878 42.301 1.00 37.75  ? 482  PRO A C   1 
ATOM   3762 O O   . PRO A 1 479 ? 18.499  76.001 42.708 1.00 38.78  ? 482  PRO A O   1 
ATOM   3763 C CB  . PRO A 1 479 ? 18.278  73.120 44.026 1.00 33.37  ? 482  PRO A CB  1 
ATOM   3764 C CG  . PRO A 1 479 ? 19.354  72.145 43.709 1.00 31.63  ? 482  PRO A CG  1 
ATOM   3765 C CD  . PRO A 1 479 ? 18.773  71.418 42.516 1.00 32.47  ? 482  PRO A CD  1 
ATOM   3766 N N   . ASN A 1 480 ? 19.869  74.624 41.561 1.00 41.21  ? 483  ASN A N   1 
ATOM   3767 C CA  . ASN A 1 480 ? 20.827  75.649 41.144 1.00 41.52  ? 483  ASN A CA  1 
ATOM   3768 C C   . ASN A 1 480 ? 20.440  76.421 39.878 1.00 43.60  ? 483  ASN A C   1 
ATOM   3769 O O   . ASN A 1 480 ? 19.824  75.877 38.964 1.00 42.80  ? 483  ASN A O   1 
ATOM   3770 C CB  . ASN A 1 480 ? 22.206  75.013 40.929 1.00 38.03  ? 483  ASN A CB  1 
ATOM   3771 C CG  . ASN A 1 480 ? 22.692  74.234 42.140 1.00 38.40  ? 483  ASN A CG  1 
ATOM   3772 O OD1 . ASN A 1 480 ? 22.894  74.796 43.213 1.00 39.26  ? 483  ASN A OD1 1 
ATOM   3773 N ND2 . ASN A 1 480 ? 22.888  72.934 41.968 1.00 38.05  ? 483  ASN A ND2 1 
ATOM   3774 N N   . GLU A 1 481 ? 20.803  77.700 39.843 1.00 47.82  ? 484  GLU A N   1 
ATOM   3775 C CA  . GLU A 1 481 ? 20.543  78.551 38.686 1.00 51.15  ? 484  GLU A CA  1 
ATOM   3776 C C   . GLU A 1 481 ? 21.549  78.152 37.619 1.00 52.11  ? 484  GLU A C   1 
ATOM   3777 O O   . GLU A 1 481 ? 22.739  78.012 37.905 1.00 52.58  ? 484  GLU A O   1 
ATOM   3778 C CB  . GLU A 1 481 ? 20.780  80.018 39.042 1.00 55.13  ? 484  GLU A CB  1 
ATOM   3779 C CG  . GLU A 1 481 ? 19.682  80.667 39.842 1.00 61.87  ? 484  GLU A CG  1 
ATOM   3780 C CD  . GLU A 1 481 ? 18.517  81.072 38.976 1.00 65.46  ? 484  GLU A CD  1 
ATOM   3781 O OE1 . GLU A 1 481 ? 18.381  82.283 38.700 1.00 68.50  ? 484  GLU A OE1 1 
ATOM   3782 O OE2 . GLU A 1 481 ? 17.737  80.183 38.572 1.00 70.82  ? 484  GLU A OE2 1 
ATOM   3783 N N   . PRO A 1 482 ? 21.089  77.954 36.377 0.50 52.80  ? 485  PRO A N   1 
ATOM   3784 C CA  . PRO A 1 482 ? 22.002  77.570 35.299 0.50 53.84  ? 485  PRO A CA  1 
ATOM   3785 C C   . PRO A 1 482 ? 23.120  78.599 35.181 0.50 55.22  ? 485  PRO A C   1 
ATOM   3786 O O   . PRO A 1 482 ? 22.856  79.780 34.951 0.50 56.05  ? 485  PRO A O   1 
ATOM   3787 C CB  . PRO A 1 482 ? 21.096  77.592 34.072 0.50 54.30  ? 485  PRO A CB  1 
ATOM   3788 C CG  . PRO A 1 482 ? 19.763  77.215 34.637 0.50 55.14  ? 485  PRO A CG  1 
ATOM   3789 C CD  . PRO A 1 482 ? 19.705  78.050 35.886 0.50 53.32  ? 485  PRO A CD  1 
ATOM   3790 N N   . HIS A 1 483 ? 24.354  78.155 35.411 0.50 56.38  ? 486  HIS A N   1 
ATOM   3791 C CA  . HIS A 1 483 ? 25.528  79.024 35.338 0.50 58.40  ? 486  HIS A CA  1 
ATOM   3792 C C   . HIS A 1 483 ? 25.381  80.262 36.226 0.50 59.59  ? 486  HIS A C   1 
ATOM   3793 O O   . HIS A 1 483 ? 25.002  81.337 35.757 0.50 59.44  ? 486  HIS A O   1 
ATOM   3794 C CB  . HIS A 1 483 ? 25.798  79.438 33.884 0.50 59.31  ? 486  HIS A CB  1 
ATOM   3795 N N   . SER A 1 484 ? 25.670  80.095 37.514 0.50 61.11  ? 487  SER A N   1 
ATOM   3796 C CA  . SER A 1 484 ? 25.572  81.191 38.476 0.50 62.02  ? 487  SER A CA  1 
ATOM   3797 C C   . SER A 1 484 ? 26.856  81.326 39.295 0.50 61.98  ? 487  SER A C   1 
ATOM   3798 O O   . SER A 1 484 ? 27.661  80.393 39.369 0.50 62.01  ? 487  SER A O   1 
ATOM   3799 C CB  . SER A 1 484 ? 24.374  80.974 39.405 0.50 62.22  ? 487  SER A CB  1 
ATOM   3800 O OG  . SER A 1 484 ? 24.175  82.092 40.253 0.50 62.23  ? 487  SER A OG  1 
ATOM   3801 N N   . GLN A 1 485 ? 27.035  82.493 39.911 0.50 61.68  ? 488  GLN A N   1 
ATOM   3802 C CA  . GLN A 1 485 ? 28.221  82.773 40.719 0.50 62.04  ? 488  GLN A CA  1 
ATOM   3803 C C   . GLN A 1 485 ? 28.109  82.286 42.166 0.50 61.05  ? 488  GLN A C   1 
ATOM   3804 O O   . GLN A 1 485 ? 29.068  82.375 42.937 0.50 59.30  ? 488  GLN A O   1 
ATOM   3805 C CB  . GLN A 1 485 ? 28.533  84.273 40.691 0.50 62.88  ? 488  GLN A CB  1 
ATOM   3806 C CG  . GLN A 1 485 ? 28.860  84.816 39.304 0.50 61.97  ? 488  GLN A CG  1 
ATOM   3807 N N   . GLU A 1 486 ? 26.939  81.763 42.524 0.80 61.46  ? 489  GLU A N   1 
ATOM   3808 C CA  . GLU A 1 486 ? 26.694  81.255 43.868 0.80 61.22  ? 489  GLU A CA  1 
ATOM   3809 C C   . GLU A 1 486 ? 27.233  79.838 44.028 0.80 58.20  ? 489  GLU A C   1 
ATOM   3810 O O   . GLU A 1 486 ? 27.420  79.128 43.037 0.80 56.90  ? 489  GLU A O   1 
ATOM   3811 C CB  . GLU A 1 486 ? 25.201  81.302 44.194 0.80 66.23  ? 489  GLU A CB  1 
ATOM   3812 C CG  . GLU A 1 486 ? 24.600  82.696 44.147 0.80 73.71  ? 489  GLU A CG  1 
ATOM   3813 C CD  . GLU A 1 486 ? 23.117  82.704 44.463 0.80 79.08  ? 489  GLU A CD  1 
ATOM   3814 O OE1 . GLU A 1 486 ? 22.561  81.616 44.727 0.80 81.56  ? 489  GLU A OE1 1 
ATOM   3815 O OE2 . GLU A 1 486 ? 22.511  83.795 44.448 0.80 82.51  ? 489  GLU A OE2 1 
ATOM   3816 N N   . SER A 1 487 ? 27.477  79.433 45.271 1.00 56.44  ? 490  SER A N   1 
ATOM   3817 C CA  . SER A 1 487 ? 27.993  78.097 45.558 1.00 53.43  ? 490  SER A CA  1 
ATOM   3818 C C   . SER A 1 487 ? 27.007  77.053 45.032 1.00 50.00  ? 490  SER A C   1 
ATOM   3819 O O   . SER A 1 487 ? 25.798  77.182 45.226 1.00 48.45  ? 490  SER A O   1 
ATOM   3820 C CB  . SER A 1 487 ? 28.209  77.928 47.063 1.00 53.36  ? 490  SER A CB  1 
ATOM   3821 N N   . LYS A 1 488 ? 27.523  76.040 44.343 1.00 45.10  ? 491  LYS A N   1 
ATOM   3822 C CA  . LYS A 1 488 ? 26.670  75.003 43.773 1.00 43.14  ? 491  LYS A CA  1 
ATOM   3823 C C   . LYS A 1 488 ? 26.332  73.838 44.694 1.00 41.13  ? 491  LYS A C   1 
ATOM   3824 O O   . LYS A 1 488 ? 27.222  73.209 45.265 1.00 41.07  ? 491  LYS A O   1 
ATOM   3825 C CB  . LYS A 1 488 ? 27.279  74.461 42.478 1.00 44.61  ? 491  LYS A CB  1 
ATOM   3826 C CG  . LYS A 1 488 ? 27.282  75.453 41.327 1.00 47.64  ? 491  LYS A CG  1 
ATOM   3827 N N   . TRP A 1 489 ? 25.033  73.571 44.831 1.00 36.83  ? 492  TRP A N   1 
ATOM   3828 C CA  . TRP A 1 489 ? 24.525  72.465 45.637 1.00 33.03  ? 492  TRP A CA  1 
ATOM   3829 C C   . TRP A 1 489 ? 24.829  71.224 44.798 1.00 31.72  ? 492  TRP A C   1 
ATOM   3830 O O   . TRP A 1 489 ? 24.180  70.981 43.781 1.00 32.44  ? 492  TRP A O   1 
ATOM   3831 C CB  . TRP A 1 489 ? 23.008  72.628 45.847 1.00 30.08  ? 492  TRP A CB  1 
ATOM   3832 C CG  . TRP A 1 489 ? 22.321  71.537 46.647 1.00 27.44  ? 492  TRP A CG  1 
ATOM   3833 C CD1 . TRP A 1 489 ? 22.790  70.278 46.904 1.00 29.47  ? 492  TRP A CD1 1 
ATOM   3834 C CD2 . TRP A 1 489 ? 21.023  71.606 47.253 1.00 26.90  ? 492  TRP A CD2 1 
ATOM   3835 N NE1 . TRP A 1 489 ? 21.867  69.563 47.621 1.00 28.77  ? 492  TRP A NE1 1 
ATOM   3836 C CE2 . TRP A 1 489 ? 20.773  70.352 47.852 1.00 28.09  ? 492  TRP A CE2 1 
ATOM   3837 C CE3 . TRP A 1 489 ? 20.048  72.606 47.348 1.00 26.54  ? 492  TRP A CE3 1 
ATOM   3838 C CZ2 . TRP A 1 489 ? 19.582  70.068 48.540 1.00 28.01  ? 492  TRP A CZ2 1 
ATOM   3839 C CZ3 . TRP A 1 489 ? 18.862  72.322 48.035 1.00 28.51  ? 492  TRP A CZ3 1 
ATOM   3840 C CH2 . TRP A 1 489 ? 18.644  71.062 48.621 1.00 23.05  ? 492  TRP A CH2 1 
ATOM   3841 N N   . PRO A 1 490 ? 25.846  70.441 45.197 1.00 30.34  ? 493  PRO A N   1 
ATOM   3842 C CA  . PRO A 1 490 ? 26.185  69.245 44.430 1.00 29.09  ? 493  PRO A CA  1 
ATOM   3843 C C   . PRO A 1 490 ? 25.089  68.196 44.396 1.00 33.63  ? 493  PRO A C   1 
ATOM   3844 O O   . PRO A 1 490 ? 24.220  68.132 45.267 1.00 36.86  ? 493  PRO A O   1 
ATOM   3845 C CB  . PRO A 1 490 ? 27.438  68.732 45.135 1.00 26.48  ? 493  PRO A CB  1 
ATOM   3846 C CG  . PRO A 1 490 ? 27.239  69.157 46.523 1.00 27.82  ? 493  PRO A CG  1 
ATOM   3847 C CD  . PRO A 1 490 ? 26.726  70.563 46.370 1.00 28.04  ? 493  PRO A CD  1 
ATOM   3848 N N   . LEU A 1 491 ? 25.136  67.386 43.351 1.00 34.33  ? 494  LEU A N   1 
ATOM   3849 C CA  . LEU A 1 491 ? 24.188  66.309 43.147 1.00 33.87  ? 494  LEU A CA  1 
ATOM   3850 C C   . LEU A 1 491 ? 24.637  65.153 44.047 1.00 34.10  ? 494  LEU A C   1 
ATOM   3851 O O   . LEU A 1 491 ? 25.837  64.933 44.236 1.00 33.01  ? 494  LEU A O   1 
ATOM   3852 C CB  . LEU A 1 491 ? 24.241  65.895 41.671 1.00 33.19  ? 494  LEU A CB  1 
ATOM   3853 C CG  . LEU A 1 491 ? 23.227  64.974 41.001 1.00 33.86  ? 494  LEU A CG  1 
ATOM   3854 C CD1 . LEU A 1 491 ? 21.877  65.637 40.894 1.00 30.74  ? 494  LEU A CD1 1 
ATOM   3855 C CD2 . LEU A 1 491 ? 23.737  64.645 39.614 1.00 36.62  ? 494  LEU A CD2 1 
ATOM   3856 N N   . PHE A 1 492 ? 23.678  64.487 44.678 1.00 33.59  ? 495  PHE A N   1 
ATOM   3857 C CA  . PHE A 1 492 ? 23.973  63.346 45.530 1.00 31.32  ? 495  PHE A CA  1 
ATOM   3858 C C   . PHE A 1 492 ? 24.164  62.162 44.593 1.00 31.78  ? 495  PHE A C   1 
ATOM   3859 O O   . PHE A 1 492 ? 23.287  61.866 43.782 1.00 34.55  ? 495  PHE A O   1 
ATOM   3860 C CB  . PHE A 1 492 ? 22.801  63.076 46.488 1.00 30.21  ? 495  PHE A CB  1 
ATOM   3861 C CG  . PHE A 1 492 ? 22.959  61.825 47.324 1.00 27.83  ? 495  PHE A CG  1 
ATOM   3862 C CD1 . PHE A 1 492 ? 22.654  60.571 46.797 1.00 28.00  ? 495  PHE A CD1 1 
ATOM   3863 C CD2 . PHE A 1 492 ? 23.427  61.900 48.630 1.00 27.48  ? 495  PHE A CD2 1 
ATOM   3864 C CE1 . PHE A 1 492 ? 22.819  59.412 47.555 1.00 28.77  ? 495  PHE A CE1 1 
ATOM   3865 C CE2 . PHE A 1 492 ? 23.594  60.748 49.398 1.00 29.13  ? 495  PHE A CE2 1 
ATOM   3866 C CZ  . PHE A 1 492 ? 23.290  59.500 48.858 1.00 28.04  ? 495  PHE A CZ  1 
ATOM   3867 N N   . THR A 1 493 ? 25.310  61.498 44.692 1.00 33.46  ? 496  THR A N   1 
ATOM   3868 C CA  . THR A 1 493 ? 25.596  60.334 43.857 1.00 34.12  ? 496  THR A CA  1 
ATOM   3869 C C   . THR A 1 493 ? 25.906  59.118 44.724 1.00 35.75  ? 496  THR A C   1 
ATOM   3870 O O   . THR A 1 493 ? 26.366  59.253 45.859 1.00 33.83  ? 496  THR A O   1 
ATOM   3871 C CB  . THR A 1 493 ? 26.798  60.576 42.913 1.00 34.51  ? 496  THR A CB  1 
ATOM   3872 O OG1 . THR A 1 493 ? 28.012  60.634 43.672 1.00 33.63  ? 496  THR A OG1 1 
ATOM   3873 C CG2 . THR A 1 493 ? 26.624  61.876 42.147 1.00 33.04  ? 496  THR A CG2 1 
ATOM   3874 N N   . THR A 1 494 ? 25.665  57.933 44.172 1.00 38.43  ? 497  THR A N   1 
ATOM   3875 C CA  . THR A 1 494 ? 25.922  56.679 44.876 1.00 40.97  ? 497  THR A CA  1 
ATOM   3876 C C   . THR A 1 494 ? 27.364  56.650 45.390 1.00 42.14  ? 497  THR A C   1 
ATOM   3877 O O   . THR A 1 494 ? 27.631  56.174 46.496 1.00 42.80  ? 497  THR A O   1 
ATOM   3878 C CB  . THR A 1 494 ? 25.707  55.466 43.937 1.00 40.86  ? 497  THR A CB  1 
ATOM   3879 O OG1 . THR A 1 494 ? 24.397  55.533 43.363 1.00 44.06  ? 497  THR A OG1 1 
ATOM   3880 C CG2 . THR A 1 494 ? 25.841  54.153 44.701 1.00 42.35  ? 497  THR A CG2 1 
ATOM   3881 N N   . LYS A 1 495 ? 28.276  57.207 44.594 1.00 42.22  ? 498  LYS A N   1 
ATOM   3882 C CA  . LYS A 1 495 ? 29.690  57.236 44.934 1.00 41.03  ? 498  LYS A CA  1 
ATOM   3883 C C   . LYS A 1 495 ? 30.081  58.298 45.952 1.00 41.43  ? 498  LYS A C   1 
ATOM   3884 O O   . LYS A 1 495 ? 30.590  57.969 47.021 1.00 43.15  ? 498  LYS A O   1 
ATOM   3885 C CB  . LYS A 1 495 ? 30.538  57.400 43.671 1.00 39.84  ? 498  LYS A CB  1 
ATOM   3886 N N   . GLU A 1 496 ? 29.838  59.563 45.620 1.00 41.29  ? 499  GLU A N   1 
ATOM   3887 C CA  . GLU A 1 496 ? 30.203  60.684 46.487 1.00 40.83  ? 499  GLU A CA  1 
ATOM   3888 C C   . GLU A 1 496 ? 29.288  60.921 47.687 1.00 38.37  ? 499  GLU A C   1 
ATOM   3889 O O   . GLU A 1 496 ? 29.748  61.353 48.743 1.00 36.90  ? 499  GLU A O   1 
ATOM   3890 C CB  . GLU A 1 496 ? 30.306  61.969 45.666 1.00 48.19  ? 499  GLU A CB  1 
ATOM   3891 C CG  . GLU A 1 496 ? 31.147  61.847 44.405 1.00 58.24  ? 499  GLU A CG  1 
ATOM   3892 C CD  . GLU A 1 496 ? 32.496  61.219 44.671 1.00 63.47  ? 499  GLU A CD  1 
ATOM   3893 O OE1 . GLU A 1 496 ? 32.779  60.156 44.075 1.00 68.74  ? 499  GLU A OE1 1 
ATOM   3894 O OE2 . GLU A 1 496 ? 33.268  61.779 45.481 1.00 68.91  ? 499  GLU A OE2 1 
ATOM   3895 N N   . GLN A 1 497 ? 27.988  60.716 47.497 1.00 35.32  ? 500  GLN A N   1 
ATOM   3896 C CA  . GLN A 1 497 ? 27.014  60.891 48.573 1.00 34.62  ? 500  GLN A CA  1 
ATOM   3897 C C   . GLN A 1 497 ? 27.070  62.269 49.231 1.00 32.13  ? 500  GLN A C   1 
ATOM   3898 O O   . GLN A 1 497 ? 26.906  62.409 50.439 1.00 32.87  ? 500  GLN A O   1 
ATOM   3899 C CB  . GLN A 1 497 ? 27.196  59.786 49.613 1.00 34.60  ? 500  GLN A CB  1 
ATOM   3900 C CG  . GLN A 1 497 ? 26.852  58.414 49.071 1.00 37.73  ? 500  GLN A CG  1 
ATOM   3901 C CD  . GLN A 1 497 ? 27.376  57.291 49.930 1.00 38.47  ? 500  GLN A CD  1 
ATOM   3902 O OE1 . GLN A 1 497 ? 27.997  56.355 49.431 1.00 43.73  ? 500  GLN A OE1 1 
ATOM   3903 N NE2 . GLN A 1 497 ? 27.146  57.381 51.228 1.00 41.76  ? 500  GLN A NE2 1 
ATOM   3904 N N   . LYS A 1 498 ? 27.272  63.289 48.411 1.00 30.32  ? 501  LYS A N   1 
ATOM   3905 C CA  . LYS A 1 498 ? 27.354  64.651 48.900 1.00 29.50  ? 501  LYS A CA  1 
ATOM   3906 C C   . LYS A 1 498 ? 26.006  65.263 49.239 1.00 29.79  ? 501  LYS A C   1 
ATOM   3907 O O   . LYS A 1 498 ? 24.976  64.900 48.673 1.00 28.62  ? 501  LYS A O   1 
ATOM   3908 C CB  . LYS A 1 498 ? 28.035  65.546 47.868 1.00 29.22  ? 501  LYS A CB  1 
ATOM   3909 C CG  . LYS A 1 498 ? 29.453  65.162 47.533 1.00 31.53  ? 501  LYS A CG  1 
ATOM   3910 C CD  . LYS A 1 498 ? 29.989  66.089 46.466 1.00 35.89  ? 501  LYS A CD  1 
ATOM   3911 C CE  . LYS A 1 498 ? 31.388  65.703 46.047 1.00 35.95  ? 501  LYS A CE  1 
ATOM   3912 N NZ  . LYS A 1 498 ? 31.871  66.635 44.995 1.00 42.56  ? 501  LYS A NZ  1 
ATOM   3913 N N   . PHE A 1 499 ? 26.041  66.207 50.170 1.00 27.78  ? 502  PHE A N   1 
ATOM   3914 C CA  . PHE A 1 499 ? 24.865  66.945 50.589 1.00 27.16  ? 502  PHE A CA  1 
ATOM   3915 C C   . PHE A 1 499 ? 25.373  68.274 51.111 1.00 27.75  ? 502  PHE A C   1 
ATOM   3916 O O   . PHE A 1 499 ? 26.582  68.477 51.245 1.00 28.60  ? 502  PHE A O   1 
ATOM   3917 C CB  . PHE A 1 499 ? 24.086  66.192 51.677 1.00 28.65  ? 502  PHE A CB  1 
ATOM   3918 C CG  . PHE A 1 499 ? 24.794  66.109 53.001 1.00 27.61  ? 502  PHE A CG  1 
ATOM   3919 C CD1 . PHE A 1 499 ? 24.492  67.012 54.023 1.00 25.75  ? 502  PHE A CD1 1 
ATOM   3920 C CD2 . PHE A 1 499 ? 25.741  65.118 53.236 1.00 24.52  ? 502  PHE A CD2 1 
ATOM   3921 C CE1 . PHE A 1 499 ? 25.118  66.928 55.256 1.00 24.82  ? 502  PHE A CE1 1 
ATOM   3922 C CE2 . PHE A 1 499 ? 26.373  65.025 54.467 1.00 26.05  ? 502  PHE A CE2 1 
ATOM   3923 C CZ  . PHE A 1 499 ? 26.060  65.932 55.482 1.00 24.24  ? 502  PHE A CZ  1 
ATOM   3924 N N   . ILE A 1 500 ? 24.462  69.196 51.376 1.00 27.35  ? 503  ILE A N   1 
ATOM   3925 C CA  . ILE A 1 500 ? 24.871  70.486 51.894 1.00 29.18  ? 503  ILE A CA  1 
ATOM   3926 C C   . ILE A 1 500 ? 24.096  70.799 53.154 1.00 30.70  ? 503  ILE A C   1 
ATOM   3927 O O   . ILE A 1 500 ? 23.034  70.223 53.407 1.00 29.62  ? 503  ILE A O   1 
ATOM   3928 C CB  . ILE A 1 500 ? 24.588  71.629 50.892 1.00 29.66  ? 503  ILE A CB  1 
ATOM   3929 C CG1 . ILE A 1 500 ? 23.084  71.732 50.625 1.00 28.87  ? 503  ILE A CG1 1 
ATOM   3930 C CG2 . ILE A 1 500 ? 25.344  71.398 49.593 1.00 29.06  ? 503  ILE A CG2 1 
ATOM   3931 C CD1 . ILE A 1 500 ? 22.655  73.071 50.098 1.00 30.11  ? 503  ILE A CD1 1 
ATOM   3932 N N   . ASP A 1 501 ? 24.655  71.694 53.956 1.00 32.91  ? 504  ASP A N   1 
ATOM   3933 C CA  . ASP A 1 501 ? 23.992  72.147 55.161 1.00 34.10  ? 504  ASP A CA  1 
ATOM   3934 C C   . ASP A 1 501 ? 23.108  73.286 54.691 1.00 35.33  ? 504  ASP A C   1 
ATOM   3935 O O   . ASP A 1 501 ? 23.435  73.964 53.709 1.00 36.60  ? 504  ASP A O   1 
ATOM   3936 C CB  . ASP A 1 501 ? 24.994  72.721 56.158 1.00 35.74  ? 504  ASP A CB  1 
ATOM   3937 C CG  . ASP A 1 501 ? 25.849  71.667 56.813 1.00 40.31  ? 504  ASP A CG  1 
ATOM   3938 O OD1 . ASP A 1 501 ? 25.435  70.488 56.861 1.00 41.32  ? 504  ASP A OD1 1 
ATOM   3939 O OD2 . ASP A 1 501 ? 26.934  72.037 57.309 1.00 41.63  ? 504  ASP A OD2 1 
ATOM   3940 N N   . LEU A 1 502 ? 21.979  73.476 55.363 1.00 34.45  ? 505  LEU A N   1 
ATOM   3941 C CA  . LEU A 1 502 ? 21.083  74.568 55.031 1.00 34.46  ? 505  LEU A CA  1 
ATOM   3942 C C   . LEU A 1 502 ? 20.936  75.434 56.264 1.00 34.64  ? 505  LEU A C   1 
ATOM   3943 O O   . LEU A 1 502 ? 20.197  75.103 57.191 1.00 37.09  ? 505  LEU A O   1 
ATOM   3944 C CB  . LEU A 1 502 ? 19.711  74.075 54.559 1.00 32.39  ? 505  LEU A CB  1 
ATOM   3945 C CG  . LEU A 1 502 ? 19.488  73.847 53.064 1.00 29.68  ? 505  LEU A CG  1 
ATOM   3946 C CD1 . LEU A 1 502 ? 18.030  73.522 52.834 1.00 30.45  ? 505  LEU A CD1 1 
ATOM   3947 C CD2 . LEU A 1 502 ? 19.872  75.079 52.268 1.00 28.47  ? 505  LEU A CD2 1 
ATOM   3948 N N   . ASN A 1 503 ? 21.696  76.520 56.282 1.00 35.93  ? 506  ASN A N   1 
ATOM   3949 C CA  . ASN A 1 503 ? 21.676  77.470 57.380 1.00 36.80  ? 506  ASN A CA  1 
ATOM   3950 C C   . ASN A 1 503 ? 22.058  78.852 56.868 1.00 38.25  ? 506  ASN A C   1 
ATOM   3951 O O   . ASN A 1 503 ? 22.257  79.048 55.667 1.00 41.28  ? 506  ASN A O   1 
ATOM   3952 C CB  . ASN A 1 503 ? 22.621  77.025 58.497 1.00 33.88  ? 506  ASN A CB  1 
ATOM   3953 C CG  . ASN A 1 503 ? 23.981  76.632 57.986 1.00 31.72  ? 506  ASN A CG  1 
ATOM   3954 O OD1 . ASN A 1 503 ? 24.482  75.555 58.298 1.00 33.59  ? 506  ASN A OD1 1 
ATOM   3955 N ND2 . ASN A 1 503 ? 24.587  77.496 57.191 1.00 31.72  ? 506  ASN A ND2 1 
ATOM   3956 N N   . THR A 1 504 ? 22.191  79.796 57.791 1.00 37.27  ? 507  THR A N   1 
ATOM   3957 C CA  . THR A 1 504 ? 22.531  81.170 57.455 1.00 36.52  ? 507  THR A CA  1 
ATOM   3958 C C   . THR A 1 504 ? 24.005  81.407 57.114 1.00 38.15  ? 507  THR A C   1 
ATOM   3959 O O   . THR A 1 504 ? 24.392  82.525 56.783 1.00 40.59  ? 507  THR A O   1 
ATOM   3960 C CB  . THR A 1 504 ? 22.097  82.102 58.581 1.00 33.99  ? 507  THR A CB  1 
ATOM   3961 O OG1 . THR A 1 504 ? 22.590  81.591 59.821 1.00 38.32  ? 507  THR A OG1 1 
ATOM   3962 C CG2 . THR A 1 504 ? 20.581  82.183 58.652 1.00 31.59  ? 507  THR A CG2 1 
ATOM   3963 N N   . GLU A 1 505 ? 24.823  80.364 57.214 1.00 40.30  ? 508  GLU A N   1 
ATOM   3964 C CA  . GLU A 1 505 ? 26.246  80.453 56.889 1.00 43.82  ? 508  GLU A CA  1 
ATOM   3965 C C   . GLU A 1 505 ? 26.469  80.100 55.423 1.00 46.26  ? 508  GLU A C   1 
ATOM   3966 O O   . GLU A 1 505 ? 25.574  79.560 54.764 1.00 47.60  ? 508  GLU A O   1 
ATOM   3967 C CB  . GLU A 1 505 ? 27.064  79.493 57.758 1.00 46.47  ? 508  GLU A CB  1 
ATOM   3968 C CG  . GLU A 1 505 ? 27.320  79.982 59.165 1.00 56.92  ? 508  GLU A CG  1 
ATOM   3969 C CD  . GLU A 1 505 ? 26.041  80.168 59.951 1.00 63.52  ? 508  GLU A CD  1 
ATOM   3970 O OE1 . GLU A 1 505 ? 25.599  81.327 60.112 1.00 66.67  ? 508  GLU A OE1 1 
ATOM   3971 O OE2 . GLU A 1 505 ? 25.472  79.150 60.400 1.00 68.95  ? 508  GLU A OE2 1 
ATOM   3972 N N   . PRO A 1 506 ? 27.664  80.413 54.884 1.00 48.32  ? 509  PRO A N   1 
ATOM   3973 C CA  . PRO A 1 506 ? 27.974  80.108 53.482 1.00 48.65  ? 509  PRO A CA  1 
ATOM   3974 C C   . PRO A 1 506 ? 27.893  78.605 53.264 1.00 48.89  ? 509  PRO A C   1 
ATOM   3975 O O   . PRO A 1 506 ? 28.425  77.830 54.064 1.00 48.84  ? 509  PRO A O   1 
ATOM   3976 C CB  . PRO A 1 506 ? 29.413  80.600 53.341 1.00 48.67  ? 509  PRO A CB  1 
ATOM   3977 C CG  . PRO A 1 506 ? 29.476  81.729 54.310 1.00 49.43  ? 509  PRO A CG  1 
ATOM   3978 C CD  . PRO A 1 506 ? 28.773  81.155 55.508 1.00 48.48  ? 509  PRO A CD  1 
ATOM   3979 N N   . MET A 1 507 ? 27.228  78.204 52.185 1.00 48.38  ? 510  MET A N   1 
ATOM   3980 C CA  . MET A 1 507 ? 27.057  76.795 51.866 1.00 48.33  ? 510  MET A CA  1 
ATOM   3981 C C   . MET A 1 507 ? 28.326  75.969 52.043 1.00 48.86  ? 510  MET A C   1 
ATOM   3982 O O   . MET A 1 507 ? 29.420  76.381 51.649 1.00 50.05  ? 510  MET A O   1 
ATOM   3983 C CB  . MET A 1 507 ? 26.545  76.627 50.441 1.00 49.20  ? 510  MET A CB  1 
ATOM   3984 C CG  . MET A 1 507 ? 26.273  75.187 50.073 1.00 48.70  ? 510  MET A CG  1 
ATOM   3985 S SD  . MET A 1 507 ? 26.244  74.943 48.311 1.00 49.59  ? 510  MET A SD  1 
ATOM   3986 C CE  . MET A 1 507 ? 24.633  75.496 47.942 1.00 44.15  ? 510  MET A CE  1 
ATOM   3987 N N   . LYS A 1 508 ? 28.162  74.808 52.668 1.00 49.17  ? 511  LYS A N   1 
ATOM   3988 C CA  . LYS A 1 508 ? 29.264  73.889 52.913 1.00 47.74  ? 511  LYS A CA  1 
ATOM   3989 C C   . LYS A 1 508 ? 28.794  72.501 52.484 1.00 44.24  ? 511  LYS A C   1 
ATOM   3990 O O   . LYS A 1 508 ? 27.666  72.097 52.768 1.00 45.80  ? 511  LYS A O   1 
ATOM   3991 C CB  . LYS A 1 508 ? 29.654  73.911 54.395 1.00 49.63  ? 511  LYS A CB  1 
ATOM   3992 C CG  . LYS A 1 508 ? 30.991  73.255 54.698 1.00 57.90  ? 511  LYS A CG  1 
ATOM   3993 C CD  . LYS A 1 508 ? 31.433  73.488 56.145 1.00 63.89  ? 511  LYS A CD  1 
ATOM   3994 C CE  . LYS A 1 508 ? 32.751  72.764 56.441 1.00 66.14  ? 511  LYS A CE  1 
ATOM   3995 N NZ  . LYS A 1 508 ? 33.197  72.924 57.855 1.00 67.48  ? 511  LYS A NZ  1 
ATOM   3996 N N   . VAL A 1 509 ? 29.643  71.799 51.746 1.00 39.00  ? 512  VAL A N   1 
ATOM   3997 C CA  . VAL A 1 509 ? 29.309  70.473 51.257 1.00 36.20  ? 512  VAL A CA  1 
ATOM   3998 C C   . VAL A 1 509 ? 29.964  69.388 52.097 1.00 36.46  ? 512  VAL A C   1 
ATOM   3999 O O   . VAL A 1 509 ? 31.126  69.514 52.491 1.00 36.12  ? 512  VAL A O   1 
ATOM   4000 C CB  . VAL A 1 509 ? 29.743  70.308 49.785 1.00 35.76  ? 512  VAL A CB  1 
ATOM   4001 C CG1 . VAL A 1 509 ? 29.371  68.928 49.268 1.00 34.38  ? 512  VAL A CG1 1 
ATOM   4002 C CG2 . VAL A 1 509 ? 29.108  71.394 48.930 1.00 34.57  ? 512  VAL A CG2 1 
ATOM   4003 N N   . HIS A 1 510 ? 29.203  68.330 52.374 1.00 33.52  ? 513  HIS A N   1 
ATOM   4004 C CA  . HIS A 1 510 ? 29.683  67.195 53.154 1.00 31.61  ? 513  HIS A CA  1 
ATOM   4005 C C   . HIS A 1 510 ? 29.356  65.909 52.416 1.00 31.85  ? 513  HIS A C   1 
ATOM   4006 O O   . HIS A 1 510 ? 28.762  65.937 51.347 1.00 32.84  ? 513  HIS A O   1 
ATOM   4007 C CB  . HIS A 1 510 ? 29.008  67.151 54.521 1.00 30.31  ? 513  HIS A CB  1 
ATOM   4008 C CG  . HIS A 1 510 ? 29.080  68.437 55.274 1.00 31.41  ? 513  HIS A CG  1 
ATOM   4009 N ND1 . HIS A 1 510 ? 30.175  68.794 56.030 1.00 33.34  ? 513  HIS A ND1 1 
ATOM   4010 C CD2 . HIS A 1 510 ? 28.200  69.460 55.377 1.00 31.79  ? 513  HIS A CD2 1 
ATOM   4011 C CE1 . HIS A 1 510 ? 29.968  69.983 56.565 1.00 34.36  ? 513  HIS A CE1 1 
ATOM   4012 N NE2 . HIS A 1 510 ? 28.777  70.410 56.182 1.00 34.30  ? 513  HIS A NE2 1 
ATOM   4013 N N   . GLN A 1 511 ? 29.702  64.780 53.021 1.00 33.52  ? 514  GLN A N   1 
ATOM   4014 C CA  . GLN A 1 511 ? 29.446  63.476 52.429 1.00 35.40  ? 514  GLN A CA  1 
ATOM   4015 C C   . GLN A 1 511 ? 29.003  62.493 53.494 1.00 33.95  ? 514  GLN A C   1 
ATOM   4016 O O   . GLN A 1 511 ? 29.336  62.646 54.667 1.00 36.10  ? 514  GLN A O   1 
ATOM   4017 C CB  . GLN A 1 511 ? 30.710  62.922 51.783 1.00 39.69  ? 514  GLN A CB  1 
ATOM   4018 C CG  . GLN A 1 511 ? 31.258  63.745 50.651 1.00 47.01  ? 514  GLN A CG  1 
ATOM   4019 C CD  . GLN A 1 511 ? 32.596  63.226 50.191 1.00 50.69  ? 514  GLN A CD  1 
ATOM   4020 O OE1 . GLN A 1 511 ? 33.577  63.258 50.939 1.00 58.17  ? 514  GLN A OE1 1 
ATOM   4021 N NE2 . GLN A 1 511 ? 32.645  62.720 48.965 1.00 52.57  ? 514  GLN A NE2 1 
ATOM   4022 N N   . ARG A 1 512 ? 28.253  61.482 53.066 1.00 33.04  ? 515  ARG A N   1 
ATOM   4023 C CA  . ARG A 1 512 ? 27.771  60.429 53.942 1.00 31.56  ? 515  ARG A CA  1 
ATOM   4024 C C   . ARG A 1 512 ? 27.102  60.910 55.222 1.00 29.65  ? 515  ARG A C   1 
ATOM   4025 O O   . ARG A 1 512 ? 27.609  60.697 56.324 1.00 26.73  ? 515  ARG A O   1 
ATOM   4026 C CB  . ARG A 1 512 ? 28.918  59.481 54.260 1.00 32.22  ? 515  ARG A CB  1 
ATOM   4027 C CG  . ARG A 1 512 ? 29.487  58.825 53.036 1.00 36.37  ? 515  ARG A CG  1 
ATOM   4028 C CD  . ARG A 1 512 ? 30.556  57.819 53.379 1.00 41.18  ? 515  ARG A CD  1 
ATOM   4029 N NE  . ARG A 1 512 ? 30.957  57.076 52.192 1.00 46.48  ? 515  ARG A NE  1 
ATOM   4030 C CZ  . ARG A 1 512 ? 31.898  56.137 52.168 1.00 54.00  ? 515  ARG A CZ  1 
ATOM   4031 N NH1 . ARG A 1 512 ? 32.554  55.808 53.275 1.00 56.34  ? 515  ARG A NH1 1 
ATOM   4032 N NH2 . ARG A 1 512 ? 32.186  55.524 51.026 1.00 56.72  ? 515  ARG A NH2 1 
ATOM   4033 N N   . LEU A 1 513 ? 25.948  61.545 55.058 1.00 27.88  ? 516  LEU A N   1 
ATOM   4034 C CA  . LEU A 1 513 ? 25.173  62.065 56.177 1.00 29.42  ? 516  LEU A CA  1 
ATOM   4035 C C   . LEU A 1 513 ? 24.884  60.984 57.224 1.00 30.75  ? 516  LEU A C   1 
ATOM   4036 O O   . LEU A 1 513 ? 24.154  60.029 56.962 1.00 30.80  ? 516  LEU A O   1 
ATOM   4037 C CB  . LEU A 1 513 ? 23.868  62.675 55.652 1.00 28.20  ? 516  LEU A CB  1 
ATOM   4038 C CG  . LEU A 1 513 ? 22.804  63.230 56.604 1.00 29.06  ? 516  LEU A CG  1 
ATOM   4039 C CD1 . LEU A 1 513 ? 23.436  64.071 57.693 1.00 34.29  ? 516  LEU A CD1 1 
ATOM   4040 C CD2 . LEU A 1 513 ? 21.807  64.058 55.800 1.00 28.08  ? 516  LEU A CD2 1 
ATOM   4041 N N   . ARG A 1 514 ? 25.496  61.134 58.397 1.00 30.58  ? 517  ARG A N   1 
ATOM   4042 C CA  . ARG A 1 514 ? 25.334  60.202 59.512 1.00 27.14  ? 517  ARG A CA  1 
ATOM   4043 C C   . ARG A 1 514 ? 25.474  58.737 59.119 1.00 26.55  ? 517  ARG A C   1 
ATOM   4044 O O   . ARG A 1 514 ? 24.640  57.913 59.485 1.00 28.30  ? 517  ARG A O   1 
ATOM   4045 C CB  . ARG A 1 514 ? 24.004  60.461 60.243 1.00 26.83  ? 517  ARG A CB  1 
ATOM   4046 C CG  . ARG A 1 514 ? 23.939  61.866 60.867 1.00 30.72  ? 517  ARG A CG  1 
ATOM   4047 C CD  . ARG A 1 514 ? 22.723  62.098 61.745 1.00 28.12  ? 517  ARG A CD  1 
ATOM   4048 N NE  . ARG A 1 514 ? 22.760  61.322 62.982 1.00 33.26  ? 517  ARG A NE  1 
ATOM   4049 C CZ  . ARG A 1 514 ? 23.618  61.529 63.978 1.00 32.76  ? 517  ARG A CZ  1 
ATOM   4050 N NH1 . ARG A 1 514 ? 24.524  62.489 63.882 1.00 31.69  ? 517  ARG A NH1 1 
ATOM   4051 N NH2 . ARG A 1 514 ? 23.548  60.803 65.089 1.00 30.52  ? 517  ARG A NH2 1 
ATOM   4052 N N   . VAL A 1 515 ? 26.536  58.421 58.379 1.00 25.74  ? 518  VAL A N   1 
ATOM   4053 C CA  . VAL A 1 515 ? 26.791  57.048 57.935 1.00 25.98  ? 518  VAL A CA  1 
ATOM   4054 C C   . VAL A 1 515 ? 26.949  56.098 59.101 1.00 26.93  ? 518  VAL A C   1 
ATOM   4055 O O   . VAL A 1 515 ? 26.394  55.003 59.089 1.00 29.63  ? 518  VAL A O   1 
ATOM   4056 C CB  . VAL A 1 515 ? 28.120  56.873 57.142 1.00 25.81  ? 518  VAL A CB  1 
ATOM   4057 C CG1 . VAL A 1 515 ? 27.845  56.474 55.727 1.00 24.91  ? 518  VAL A CG1 1 
ATOM   4058 C CG2 . VAL A 1 515 ? 29.013  58.088 57.257 1.00 23.43  ? 518  VAL A CG2 1 
ATOM   4059 N N   . GLN A 1 516 ? 27.778  56.500 60.064 1.00 27.99  ? 519  GLN A N   1 
ATOM   4060 C CA  . GLN A 1 516 ? 28.074  55.680 61.234 1.00 28.11  ? 519  GLN A CA  1 
ATOM   4061 C C   . GLN A 1 516 ? 26.818  55.176 61.924 1.00 26.09  ? 519  GLN A C   1 
ATOM   4062 O O   . GLN A 1 516 ? 26.634  53.972 62.075 1.00 26.49  ? 519  GLN A O   1 
ATOM   4063 C CB  . GLN A 1 516 ? 28.964  56.443 62.221 1.00 27.70  ? 519  GLN A CB  1 
ATOM   4064 C CG  . GLN A 1 516 ? 29.785  55.529 63.121 1.00 25.26  ? 519  GLN A CG  1 
ATOM   4065 C CD  . GLN A 1 516 ? 30.732  54.635 62.331 1.00 30.86  ? 519  GLN A CD  1 
ATOM   4066 O OE1 . GLN A 1 516 ? 31.379  55.084 61.383 1.00 29.40  ? 519  GLN A OE1 1 
ATOM   4067 N NE2 . GLN A 1 516 ? 30.804  53.358 62.708 1.00 28.85  ? 519  GLN A NE2 1 
ATOM   4068 N N   . MET A 1 517 ? 25.936  56.097 62.298 1.00 25.64  ? 520  MET A N   1 
ATOM   4069 C CA  . MET A 1 517 ? 24.694  55.730 62.959 1.00 25.51  ? 520  MET A CA  1 
ATOM   4070 C C   . MET A 1 517 ? 23.723  55.009 62.026 1.00 25.80  ? 520  MET A C   1 
ATOM   4071 O O   . MET A 1 517 ? 23.029  54.084 62.445 1.00 28.47  ? 520  MET A O   1 
ATOM   4072 C CB  . MET A 1 517 ? 24.028  56.962 63.577 1.00 26.25  ? 520  MET A CB  1 
ATOM   4073 C CG  . MET A 1 517 ? 24.809  57.558 64.740 1.00 29.91  ? 520  MET A CG  1 
ATOM   4074 S SD  . MET A 1 517 ? 25.150  56.340 66.044 1.00 34.82  ? 520  MET A SD  1 
ATOM   4075 C CE  . MET A 1 517 ? 26.926  56.386 66.119 1.00 38.26  ? 520  MET A CE  1 
ATOM   4076 N N   . CYS A 1 518 ? 23.691  55.402 60.755 1.00 24.97  ? 521  CYS A N   1 
ATOM   4077 C CA  . CYS A 1 518 ? 22.780  54.762 59.813 1.00 23.88  ? 521  CYS A CA  1 
ATOM   4078 C C   . CYS A 1 518 ? 23.204  53.372 59.354 1.00 24.17  ? 521  CYS A C   1 
ATOM   4079 O O   . CYS A 1 518 ? 22.379  52.598 58.890 1.00 26.83  ? 521  CYS A O   1 
ATOM   4080 C CB  . CYS A 1 518 ? 22.452  55.686 58.645 1.00 24.52  ? 521  CYS A CB  1 
ATOM   4081 S SG  . CYS A 1 518 ? 21.505  57.155 59.174 1.00 26.89  ? 521  CYS A SG  1 
ATOM   4082 N N   . VAL A 1 519 ? 24.484  53.040 59.482 1.00 25.63  ? 522  VAL A N   1 
ATOM   4083 C CA  . VAL A 1 519 ? 24.918  51.687 59.133 1.00 23.69  ? 522  VAL A CA  1 
ATOM   4084 C C   . VAL A 1 519 ? 24.366  50.807 60.262 1.00 24.35  ? 522  VAL A C   1 
ATOM   4085 O O   . VAL A 1 519 ? 23.908  49.693 60.031 1.00 26.56  ? 522  VAL A O   1 
ATOM   4086 C CB  . VAL A 1 519 ? 26.460  51.564 59.051 1.00 21.77  ? 522  VAL A CB  1 
ATOM   4087 C CG1 . VAL A 1 519 ? 26.873  50.105 59.037 1.00 20.29  ? 522  VAL A CG1 1 
ATOM   4088 C CG2 . VAL A 1 519 ? 26.964  52.240 57.789 1.00 20.56  ? 522  VAL A CG2 1 
ATOM   4089 N N   . PHE A 1 520 ? 24.361  51.352 61.479 1.00 24.39  ? 523  PHE A N   1 
ATOM   4090 C CA  . PHE A 1 520 ? 23.844  50.643 62.637 1.00 22.67  ? 523  PHE A CA  1 
ATOM   4091 C C   . PHE A 1 520 ? 22.347  50.400 62.471 1.00 21.70  ? 523  PHE A C   1 
ATOM   4092 O O   . PHE A 1 520 ? 21.880  49.271 62.573 1.00 24.10  ? 523  PHE A O   1 
ATOM   4093 C CB  . PHE A 1 520 ? 24.106  51.440 63.924 1.00 20.37  ? 523  PHE A CB  1 
ATOM   4094 C CG  . PHE A 1 520 ? 23.439  50.858 65.134 1.00 21.45  ? 523  PHE A CG  1 
ATOM   4095 C CD1 . PHE A 1 520 ? 23.962  49.730 65.759 1.00 23.71  ? 523  PHE A CD1 1 
ATOM   4096 C CD2 . PHE A 1 520 ? 22.257  51.403 65.620 1.00 22.42  ? 523  PHE A CD2 1 
ATOM   4097 C CE1 . PHE A 1 520 ? 23.312  49.150 66.848 1.00 22.75  ? 523  PHE A CE1 1 
ATOM   4098 C CE2 . PHE A 1 520 ? 21.598  50.830 66.708 1.00 22.90  ? 523  PHE A CE2 1 
ATOM   4099 C CZ  . PHE A 1 520 ? 22.127  49.702 67.320 1.00 23.42  ? 523  PHE A CZ  1 
ATOM   4100 N N   . TRP A 1 521 ? 21.601  51.460 62.188 1.00 20.77  ? 524  TRP A N   1 
ATOM   4101 C CA  . TRP A 1 521 ? 20.158  51.345 62.022 1.00 22.85  ? 524  TRP A CA  1 
ATOM   4102 C C   . TRP A 1 521 ? 19.684  50.594 60.783 1.00 24.35  ? 524  TRP A C   1 
ATOM   4103 O O   . TRP A 1 521 ? 18.725  49.828 60.850 1.00 26.05  ? 524  TRP A O   1 
ATOM   4104 C CB  . TRP A 1 521 ? 19.509  52.728 62.060 1.00 20.74  ? 524  TRP A CB  1 
ATOM   4105 C CG  . TRP A 1 521 ? 19.571  53.355 63.414 1.00 22.45  ? 524  TRP A CG  1 
ATOM   4106 C CD1 . TRP A 1 521 ? 20.377  54.382 63.802 1.00 21.55  ? 524  TRP A CD1 1 
ATOM   4107 C CD2 . TRP A 1 521 ? 18.815  52.976 64.575 1.00 20.87  ? 524  TRP A CD2 1 
ATOM   4108 N NE1 . TRP A 1 521 ? 20.174  54.669 65.131 1.00 24.30  ? 524  TRP A NE1 1 
ATOM   4109 C CE2 . TRP A 1 521 ? 19.221  53.822 65.631 1.00 24.50  ? 524  TRP A CE2 1 
ATOM   4110 C CE3 . TRP A 1 521 ? 17.833  52.006 64.823 1.00 21.34  ? 524  TRP A CE3 1 
ATOM   4111 C CZ2 . TRP A 1 521 ? 18.684  53.727 66.925 1.00 20.44  ? 524  TRP A CZ2 1 
ATOM   4112 C CZ3 . TRP A 1 521 ? 17.296  51.912 66.113 1.00 20.82  ? 524  TRP A CZ3 1 
ATOM   4113 C CH2 . TRP A 1 521 ? 17.725  52.772 67.145 1.00 21.11  ? 524  TRP A CH2 1 
ATOM   4114 N N   . ASN A 1 522 ? 20.352  50.814 59.656 1.00 26.24  ? 525  ASN A N   1 
ATOM   4115 C CA  . ASN A 1 522 ? 19.968  50.182 58.391 1.00 27.91  ? 525  ASN A CA  1 
ATOM   4116 C C   . ASN A 1 522 ? 20.577  48.814 58.138 1.00 26.41  ? 525  ASN A C   1 
ATOM   4117 O O   . ASN A 1 522 ? 19.978  47.994 57.448 1.00 27.87  ? 525  ASN A O   1 
ATOM   4118 C CB  . ASN A 1 522 ? 20.289  51.108 57.209 1.00 25.63  ? 525  ASN A CB  1 
ATOM   4119 C CG  . ASN A 1 522 ? 19.538  52.423 57.274 1.00 25.68  ? 525  ASN A CG  1 
ATOM   4120 O OD1 . ASN A 1 522 ? 18.482  52.510 57.892 1.00 28.80  ? 525  ASN A OD1 1 
ATOM   4121 N ND2 . ASN A 1 522 ? 20.084  53.453 56.640 1.00 25.67  ? 525  ASN A ND2 1 
ATOM   4122 N N   . GLN A 1 523 ? 21.759  48.565 58.685 1.00 26.26  ? 526  GLN A N   1 
ATOM   4123 C CA  . GLN A 1 523 ? 22.425  47.290 58.471 1.00 27.51  ? 526  GLN A CA  1 
ATOM   4124 C C   . GLN A 1 523 ? 22.537  46.401 59.696 1.00 29.11  ? 526  GLN A C   1 
ATOM   4125 O O   . GLN A 1 523 ? 21.916  45.343 59.745 1.00 33.23  ? 526  GLN A O   1 
ATOM   4126 C CB  . GLN A 1 523 ? 23.820  47.499 57.875 1.00 28.61  ? 526  GLN A CB  1 
ATOM   4127 C CG  . GLN A 1 523 ? 23.833  48.175 56.512 1.00 35.01  ? 526  GLN A CG  1 
ATOM   4128 N N   . PHE A 1 524 ? 23.310  46.832 60.690 1.00 28.45  ? 527  PHE A N   1 
ATOM   4129 C CA  . PHE A 1 524 ? 23.528  46.025 61.887 1.00 27.37  ? 527  PHE A CA  1 
ATOM   4130 C C   . PHE A 1 524 ? 22.329  45.654 62.755 1.00 26.57  ? 527  PHE A C   1 
ATOM   4131 O O   . PHE A 1 524 ? 22.063  44.472 62.949 1.00 28.51  ? 527  PHE A O   1 
ATOM   4132 C CB  . PHE A 1 524 ? 24.632  46.617 62.766 1.00 25.99  ? 527  PHE A CB  1 
ATOM   4133 C CG  . PHE A 1 524 ? 24.981  45.750 63.941 1.00 28.67  ? 527  PHE A CG  1 
ATOM   4134 C CD1 . PHE A 1 524 ? 25.760  44.607 63.769 1.00 27.50  ? 527  PHE A CD1 1 
ATOM   4135 C CD2 . PHE A 1 524 ? 24.480  46.037 65.208 1.00 28.54  ? 527  PHE A CD2 1 
ATOM   4136 C CE1 . PHE A 1 524 ? 26.030  43.763 64.838 1.00 27.84  ? 527  PHE A CE1 1 
ATOM   4137 C CE2 . PHE A 1 524 ? 24.746  45.198 66.285 1.00 29.57  ? 527  PHE A CE2 1 
ATOM   4138 C CZ  . PHE A 1 524 ? 25.519  44.059 66.101 1.00 29.07  ? 527  PHE A CZ  1 
ATOM   4139 N N   . LEU A 1 525 ? 21.644  46.642 63.323 1.00 26.14  ? 528  LEU A N   1 
ATOM   4140 C CA  . LEU A 1 525 ? 20.500  46.355 64.188 1.00 26.43  ? 528  LEU A CA  1 
ATOM   4141 C C   . LEU A 1 525 ? 19.435  45.439 63.576 1.00 30.47  ? 528  LEU A C   1 
ATOM   4142 O O   . LEU A 1 525 ? 18.955  44.524 64.245 1.00 30.23  ? 528  LEU A O   1 
ATOM   4143 C CB  . LEU A 1 525 ? 19.853  47.636 64.723 1.00 24.11  ? 528  LEU A CB  1 
ATOM   4144 C CG  . LEU A 1 525 ? 18.757  47.381 65.769 1.00 22.60  ? 528  LEU A CG  1 
ATOM   4145 C CD1 . LEU A 1 525 ? 19.345  46.665 66.985 1.00 23.04  ? 528  LEU A CD1 1 
ATOM   4146 C CD2 . LEU A 1 525 ? 18.131  48.684 66.185 1.00 18.01  ? 528  LEU A CD2 1 
ATOM   4147 N N   . PRO A 1 526 ? 19.030  45.685 62.310 1.00 32.74  ? 529  PRO A N   1 
ATOM   4148 C CA  . PRO A 1 526 ? 18.013  44.819 61.699 1.00 34.47  ? 529  PRO A CA  1 
ATOM   4149 C C   . PRO A 1 526 ? 18.478  43.362 61.633 1.00 34.80  ? 529  PRO A C   1 
ATOM   4150 O O   . PRO A 1 526 ? 17.686  42.437 61.836 1.00 36.33  ? 529  PRO A O   1 
ATOM   4151 C CB  . PRO A 1 526 ? 17.854  45.418 60.303 1.00 33.75  ? 529  PRO A CB  1 
ATOM   4152 C CG  . PRO A 1 526 ? 18.132  46.864 60.527 1.00 32.82  ? 529  PRO A CG  1 
ATOM   4153 C CD  . PRO A 1 526 ? 19.357  46.805 61.408 1.00 33.62  ? 529  PRO A CD  1 
ATOM   4154 N N   . LYS A 1 527 ? 19.769  43.172 61.359 1.00 34.93  ? 530  LYS A N   1 
ATOM   4155 C CA  . LYS A 1 527 ? 20.352  41.841 61.296 1.00 36.82  ? 530  LYS A CA  1 
ATOM   4156 C C   . LYS A 1 527 ? 20.397  41.195 62.674 1.00 38.43  ? 530  LYS A C   1 
ATOM   4157 O O   . LYS A 1 527 ? 20.101  40.014 62.837 1.00 41.23  ? 530  LYS A O   1 
ATOM   4158 C CB  . LYS A 1 527 ? 21.751  41.900 60.684 1.00 34.81  ? 530  LYS A CB  1 
ATOM   4159 C CG  . LYS A 1 527 ? 22.438  40.549 60.576 1.00 34.95  ? 530  LYS A CG  1 
ATOM   4160 C CD  . LYS A 1 527 ? 23.821  40.683 59.961 1.00 38.18  ? 530  LYS A CD  1 
ATOM   4161 C CE  . LYS A 1 527 ? 24.504  39.330 59.841 1.00 20.00  ? 530  LYS A CE  1 
ATOM   4162 N NZ  . LYS A 1 527 ? 25.587  39.344 58.819 1.00 20.00  ? 530  LYS A NZ  1 
ATOM   4163 N N   . LEU A 1 528 ? 20.731  41.993 63.685 1.00 37.82  ? 531  LEU A N   1 
ATOM   4164 C CA  . LEU A 1 528 ? 20.793  41.504 65.050 1.00 37.35  ? 531  LEU A CA  1 
ATOM   4165 C C   . LEU A 1 528 ? 19.426  40.987 65.489 1.00 38.23  ? 531  LEU A C   1 
ATOM   4166 O O   . LEU A 1 528 ? 19.301  39.843 65.918 1.00 39.05  ? 531  LEU A O   1 
ATOM   4167 C CB  . LEU A 1 528 ? 21.280  42.617 65.975 1.00 36.52  ? 531  LEU A CB  1 
ATOM   4168 C CG  . LEU A 1 528 ? 21.398  42.314 67.463 1.00 34.44  ? 531  LEU A CG  1 
ATOM   4169 C CD1 . LEU A 1 528 ? 22.518  43.143 68.043 1.00 35.10  ? 531  LEU A CD1 1 
ATOM   4170 C CD2 . LEU A 1 528 ? 20.080  42.593 68.168 1.00 34.61  ? 531  LEU A CD2 1 
ATOM   4171 N N   . LEU A 1 529 ? 18.404  41.827 65.351 1.00 40.66  ? 532  LEU A N   1 
ATOM   4172 C CA  . LEU A 1 529 ? 17.035  41.471 65.730 1.00 43.16  ? 532  LEU A CA  1 
ATOM   4173 C C   . LEU A 1 529 ? 16.489  40.285 64.926 1.00 46.24  ? 532  LEU A C   1 
ATOM   4174 O O   . LEU A 1 529 ? 15.737  39.468 65.455 1.00 48.05  ? 532  LEU A O   1 
ATOM   4175 C CB  . LEU A 1 529 ? 16.103  42.684 65.588 1.00 37.47  ? 532  LEU A CB  1 
ATOM   4176 C CG  . LEU A 1 529 ? 16.400  43.900 66.475 1.00 35.64  ? 532  LEU A CG  1 
ATOM   4177 C CD1 . LEU A 1 529 ? 15.566  45.085 66.038 1.00 33.06  ? 532  LEU A CD1 1 
ATOM   4178 C CD2 . LEU A 1 529 ? 16.149  43.579 67.935 1.00 32.38  ? 532  LEU A CD2 1 
ATOM   4179 N N   . ASN A 1 530 ? 16.875  40.187 63.656 1.00 48.96  ? 533  ASN A N   1 
ATOM   4180 C CA  . ASN A 1 530 ? 16.421  39.086 62.809 1.00 51.84  ? 533  ASN A CA  1 
ATOM   4181 C C   . ASN A 1 530 ? 16.945  37.762 63.368 1.00 52.32  ? 533  ASN A C   1 
ATOM   4182 O O   . ASN A 1 530 ? 16.192  36.805 63.513 1.00 53.80  ? 533  ASN A O   1 
ATOM   4183 C CB  . ASN A 1 530 ? 16.903  39.280 61.364 1.00 53.59  ? 533  ASN A CB  1 
ATOM   4184 C CG  . ASN A 1 530 ? 16.358  38.220 60.408 1.00 56.65  ? 533  ASN A CG  1 
ATOM   4185 O OD1 . ASN A 1 530 ? 17.066  37.287 60.025 1.00 57.84  ? 533  ASN A OD1 1 
ATOM   4186 N ND2 . ASN A 1 530 ? 15.098  38.371 60.009 1.00 58.35  ? 533  ASN A ND2 1 
ATOM   4187 N N   . ALA A 1 531 ? 18.226  37.737 63.725 1.00 53.09  ? 534  ALA A N   1 
ATOM   4188 C CA  . ALA A 1 531 ? 18.862  36.540 64.267 1.00 55.41  ? 534  ALA A CA  1 
ATOM   4189 C C   . ALA A 1 531 ? 18.317  36.150 65.639 1.00 57.45  ? 534  ALA A C   1 
ATOM   4190 O O   . ALA A 1 531 ? 18.210  34.964 65.963 1.00 59.20  ? 534  ALA A O   1 
ATOM   4191 C CB  . ALA A 1 531 ? 20.369  36.738 64.342 1.00 53.95  ? 534  ALA A CB  1 
ATOM   4192 N N   . THR A 1 532 ? 17.956  37.151 66.432 1.00 58.41  ? 535  THR A N   1 
ATOM   4193 C CA  . THR A 1 532 ? 17.438  36.912 67.771 1.00 58.62  ? 535  THR A CA  1 
ATOM   4194 C C   . THR A 1 532 ? 15.914  37.021 67.864 1.00 59.79  ? 535  THR A C   1 
ATOM   4195 O O   . THR A 1 532 ? 15.397  38.157 67.950 1.00 61.25  ? 535  THR A O   1 
ATOM   4196 C CB  . THR A 1 532 ? 18.117  37.852 68.788 1.00 58.09  ? 535  THR A CB  1 
ATOM   4197 O OG1 . THR A 1 532 ? 18.116  39.190 68.278 1.00 56.30  ? 535  THR A OG1 1 
ATOM   4198 C CG2 . THR A 1 532 ? 19.555  37.424 69.019 1.00 58.78  ? 535  THR A CG2 1 
HETATM 4199 C C1  . NAG B 2 .   ? -18.821 83.913 48.995 0.40 55.14  ? 1996 NAG A C1  1 
HETATM 4200 C C2  . NAG B 2 .   ? -18.184 85.163 49.600 0.40 55.18  ? 1996 NAG A C2  1 
HETATM 4201 C C3  . NAG B 2 .   ? -19.123 86.361 49.465 0.40 55.96  ? 1996 NAG A C3  1 
HETATM 4202 C C4  . NAG B 2 .   ? -19.566 86.520 48.014 0.40 56.57  ? 1996 NAG A C4  1 
HETATM 4203 C C5  . NAG B 2 .   ? -20.200 85.224 47.520 0.40 56.00  ? 1996 NAG A C5  1 
HETATM 4204 C C6  . NAG B 2 .   ? -20.613 85.336 46.056 0.40 56.40  ? 1996 NAG A C6  1 
HETATM 4205 C C7  . NAG B 2 .   ? -16.987 85.654 51.645 0.40 56.95  ? 1996 NAG A C7  1 
HETATM 4206 C C8  . NAG B 2 .   ? -16.752 85.326 53.111 0.40 56.65  ? 1996 NAG A C8  1 
HETATM 4207 N N2  . NAG B 2 .   ? -17.894 84.923 51.004 0.40 55.51  ? 1996 NAG A N2  1 
HETATM 4208 O O3  . NAG B 2 .   ? -18.484 87.543 49.902 0.40 53.89  ? 1996 NAG A O3  1 
HETATM 4209 O O4  . NAG B 2 .   ? -20.486 87.586 47.901 0.40 59.99  ? 1996 NAG A O4  1 
HETATM 4210 O O5  . NAG B 2 .   ? -19.249 84.167 47.652 0.40 56.97  ? 1996 NAG A O5  1 
HETATM 4211 O O6  . NAG B 2 .   ? -21.661 86.269 45.911 0.40 57.42  ? 1996 NAG A O6  1 
HETATM 4212 O O7  . NAG B 2 .   ? -16.360 86.560 51.095 0.40 58.97  ? 1996 NAG A O7  1 
HETATM 4213 C C1  . NAG C 2 .   ? 18.845  62.064 33.566 0.80 32.09  ? 1997 NAG A C1  1 
HETATM 4214 C C2  . NAG C 2 .   ? 20.340  61.780 33.612 0.80 33.45  ? 1997 NAG A C2  1 
HETATM 4215 C C3  . NAG C 2 .   ? 21.031  62.329 32.373 0.80 35.46  ? 1997 NAG A C3  1 
HETATM 4216 C C4  . NAG C 2 .   ? 20.331  61.825 31.112 0.80 39.60  ? 1997 NAG A C4  1 
HETATM 4217 C C5  . NAG C 2 .   ? 18.856  62.198 31.162 0.80 39.05  ? 1997 NAG A C5  1 
HETATM 4218 C C6  . NAG C 2 .   ? 18.110  61.687 29.927 0.80 38.75  ? 1997 NAG A C6  1 
HETATM 4219 C C7  . NAG C 2 .   ? 21.180  61.680 35.887 0.80 32.83  ? 1997 NAG A C7  1 
HETATM 4220 C C8  . NAG C 2 .   ? 21.774  62.427 37.071 0.80 33.41  ? 1997 NAG A C8  1 
HETATM 4221 N N2  . NAG C 2 .   ? 20.915  62.399 34.796 0.80 33.10  ? 1997 NAG A N2  1 
HETATM 4222 O O3  . NAG C 2 .   ? 22.383  61.926 32.369 0.80 35.45  ? 1997 NAG A O3  1 
HETATM 4223 O O4  . NAG C 2 .   ? 20.934  62.377 29.959 0.80 43.79  ? 1997 NAG A O4  1 
HETATM 4224 O O5  . NAG C 2 .   ? 18.279  61.618 32.334 0.80 35.61  ? 1997 NAG A O5  1 
HETATM 4225 O O6  . NAG C 2 .   ? 17.703  60.346 30.106 0.80 43.30  ? 1997 NAG A O6  1 
HETATM 4226 O O7  . NAG C 2 .   ? 20.966  60.469 35.953 0.80 34.75  ? 1997 NAG A O7  1 
HETATM 4227 C C1  . SAF D 3 .   ? 5.749   69.484 63.993 0.80 51.78  ? 1998 SAF A C1  1 
HETATM 4228 C C3  . SAF D 3 .   ? 3.529   68.466 64.460 0.80 54.06  ? 1998 SAF A C3  1 
HETATM 4229 C C4  . SAF D 3 .   ? 3.811   68.557 65.990 0.80 53.43  ? 1998 SAF A C4  1 
HETATM 4230 C C5  . SAF D 3 .   ? 5.021   69.060 66.376 0.80 54.03  ? 1998 SAF A C5  1 
HETATM 4231 C C6  . SAF D 3 .   ? 5.946   69.526 65.393 0.80 53.01  ? 1998 SAF A C6  1 
HETATM 4232 O O4  . SAF D 3 .   ? 2.976   68.139 67.041 0.80 54.36  ? 1998 SAF A O4  1 
HETATM 4233 N N2  . SAF D 3 .   ? 4.009   67.418 61.328 0.80 59.67  ? 1998 SAF A N2  1 
HETATM 4234 C C7  . SAF D 3 .   ? 4.630   66.229 61.866 0.80 63.01  ? 1998 SAF A C7  1 
HETATM 4235 C C8  . SAF D 3 .   ? 4.354   67.288 59.960 0.80 59.61  ? 1998 SAF A C8  1 
HETATM 4236 C C9  . SAF D 3 .   ? 4.592   68.814 61.832 0.80 55.67  ? 1998 SAF A C9  1 
HETATM 4237 C C10 . SAF D 3 .   ? 3.908   69.881 61.131 0.80 57.41  ? 1998 SAF A C10 1 
HETATM 4238 C C40 . SAF D 3 .   ? 4.581   68.966 63.457 0.80 53.78  ? 1998 SAF A C40 1 
HETATM 4239 C C1  . EMM E 4 .   ? 7.570   62.323 61.795 1.00 30.97  ? 1999 EMM A C1  1 
HETATM 4240 C C2  . EMM E 4 .   ? 5.315   62.071 62.847 1.00 23.33  ? 1999 EMM A C2  1 
HETATM 4241 C C   . EMM E 4 .   ? 5.779   63.838 60.913 1.00 23.17  ? 1999 EMM A C   1 
HETATM 4242 O O   . EMM E 4 .   ? 4.722   63.443 60.391 1.00 24.16  ? 1999 EMM A O   1 
HETATM 4243 N N   . EMM E 4 .   ? 6.249   62.825 61.954 1.00 25.59  ? 1999 EMM A N   1 
HETATM 4244 C C3  . EMM E 4 .   ? 8.597   63.155 62.072 1.00 33.32  ? 1999 EMM A C3  1 
HETATM 4245 O O   . HOH F 5 .   ? -15.600 87.562 32.690 1.00 68.62  ? 2001 HOH A O   1 
HETATM 4246 O O   . HOH F 5 .   ? -5.796  84.102 38.569 1.00 38.42  ? 2002 HOH A O   1 
HETATM 4247 O O   . HOH F 5 .   ? -11.478 79.594 32.924 1.00 54.67  ? 2003 HOH A O   1 
HETATM 4248 O O   . HOH F 5 .   ? -12.764 76.541 30.221 1.00 48.85  ? 2004 HOH A O   1 
HETATM 4249 O O   . HOH F 5 .   ? -13.597 73.091 30.284 1.00 45.79  ? 2005 HOH A O   1 
HETATM 4250 O O   . HOH F 5 .   ? -16.180 65.936 35.577 1.00 60.75  ? 2006 HOH A O   1 
HETATM 4251 O O   . HOH F 5 .   ? 1.694   62.415 69.982 1.00 39.93  ? 2007 HOH A O   1 
HETATM 4252 O O   . HOH F 5 .   ? -19.173 83.666 33.708 1.00 70.49  ? 2008 HOH A O   1 
HETATM 4253 O O   . HOH F 5 .   ? 2.534   83.332 61.042 1.00 49.57  ? 2009 HOH A O   1 
HETATM 4254 O O   . HOH F 5 .   ? -6.842  84.076 30.458 1.00 45.55  ? 2010 HOH A O   1 
HETATM 4255 O O   . HOH F 5 .   ? -3.360  96.280 43.329 1.00 65.76  ? 2011 HOH A O   1 
HETATM 4256 O O   . HOH F 5 .   ? 7.261   93.039 47.067 1.00 47.67  ? 2012 HOH A O   1 
HETATM 4257 O O   . HOH F 5 .   ? -18.561 71.864 34.155 1.00 48.99  ? 2013 HOH A O   1 
HETATM 4258 O O   . HOH F 5 .   ? 7.058   94.587 52.186 1.00 74.12  ? 2014 HOH A O   1 
HETATM 4259 O O   . HOH F 5 .   ? -18.331 78.149 49.835 1.00 69.44  ? 2015 HOH A O   1 
HETATM 4260 O O   . HOH F 5 .   ? 0.681   65.298 70.398 1.00 57.90  ? 2016 HOH A O   1 
HETATM 4261 O O   . HOH F 5 .   ? 0.162   69.873 29.170 1.00 59.18  ? 2017 HOH A O   1 
HETATM 4262 O O   . HOH F 5 .   ? -12.446 65.446 41.342 1.00 36.43  ? 2018 HOH A O   1 
HETATM 4263 O O   . HOH F 5 .   ? 2.695   80.268 62.572 1.00 48.26  ? 2019 HOH A O   1 
HETATM 4264 O O   . HOH F 5 .   ? -15.660 60.788 48.341 1.00 44.17  ? 2020 HOH A O   1 
HETATM 4265 O O   . HOH F 5 .   ? -19.073 68.317 61.266 1.00 67.45  ? 2021 HOH A O   1 
HETATM 4266 O O   . HOH F 5 .   ? -19.975 59.390 58.822 1.00 35.22  ? 2022 HOH A O   1 
HETATM 4267 O O   . HOH F 5 .   ? -5.586  83.400 53.675 1.00 50.69  ? 2023 HOH A O   1 
HETATM 4268 O O   . HOH F 5 .   ? -3.825  85.903 53.534 1.00 89.57  ? 2024 HOH A O   1 
HETATM 4269 O O   . HOH F 5 .   ? -6.990  86.188 32.224 1.00 53.69  ? 2025 HOH A O   1 
HETATM 4270 O O   . HOH F 5 .   ? -10.023 52.685 54.526 1.00 28.20  ? 2026 HOH A O   1 
HETATM 4271 O O   . HOH F 5 .   ? -5.151  51.532 46.028 1.00 55.72  ? 2027 HOH A O   1 
HETATM 4272 O O   . HOH F 5 .   ? -6.785  50.453 49.087 1.00 41.52  ? 2028 HOH A O   1 
HETATM 4273 O O   . HOH F 5 .   ? -8.410  52.731 44.325 1.00 73.66  ? 2029 HOH A O   1 
HETATM 4274 O O   . HOH F 5 .   ? -16.028 54.933 47.197 1.00 100.00 ? 2030 HOH A O   1 
HETATM 4275 O O   . HOH F 5 .   ? -10.078 56.666 44.497 1.00 34.75  ? 2031 HOH A O   1 
HETATM 4276 O O   . HOH F 5 .   ? -17.793 69.244 48.505 1.00 30.22  ? 2032 HOH A O   1 
HETATM 4277 O O   . HOH F 5 .   ? -21.556 69.025 42.552 1.00 65.15  ? 2033 HOH A O   1 
HETATM 4278 O O   . HOH F 5 .   ? -19.822 75.681 37.344 1.00 33.88  ? 2034 HOH A O   1 
HETATM 4279 O O   . HOH F 5 .   ? -21.406 71.363 35.151 1.00 64.73  ? 2035 HOH A O   1 
HETATM 4280 O O   . HOH F 5 .   ? -22.506 75.954 44.169 1.00 47.97  ? 2036 HOH A O   1 
HETATM 4281 O O   . HOH F 5 .   ? -23.703 81.323 41.196 1.00 100.00 ? 2037 HOH A O   1 
HETATM 4282 O O   . HOH F 5 .   ? 26.952  46.441 79.770 1.00 45.62  ? 2038 HOH A O   1 
HETATM 4283 O O   . HOH F 5 .   ? 28.886  58.744 72.035 1.00 71.34  ? 2039 HOH A O   1 
HETATM 4284 O O   . HOH F 5 .   ? -19.856 78.069 46.876 1.00 62.61  ? 2040 HOH A O   1 
HETATM 4285 O O   . HOH F 5 .   ? -2.128  79.818 55.516 1.00 41.96  ? 2041 HOH A O   1 
HETATM 4286 O O   . HOH F 5 .   ? -9.960  82.011 54.979 1.00 49.77  ? 2042 HOH A O   1 
HETATM 4287 O O   . HOH F 5 .   ? -13.348 77.478 56.964 1.00 41.88  ? 2043 HOH A O   1 
HETATM 4288 O O   . HOH F 5 .   ? -14.968 72.882 53.712 1.00 39.59  ? 2044 HOH A O   1 
HETATM 4289 O O   . HOH F 5 .   ? -7.138  70.641 56.178 1.00 29.56  ? 2045 HOH A O   1 
HETATM 4290 O O   . HOH F 5 .   ? -12.085 63.723 58.742 1.00 60.83  ? 2046 HOH A O   1 
HETATM 4291 O O   . HOH F 5 .   ? -8.849  61.441 62.895 1.00 31.90  ? 2047 HOH A O   1 
HETATM 4292 O O   . HOH F 5 .   ? -10.243 60.846 39.976 1.00 76.62  ? 2048 HOH A O   1 
HETATM 4293 O O   . HOH F 5 .   ? 22.011  87.972 51.434 1.00 73.19  ? 2049 HOH A O   1 
HETATM 4294 O O   . HOH F 5 .   ? -0.755  65.256 72.346 1.00 52.56  ? 2050 HOH A O   1 
HETATM 4295 O O   . HOH F 5 .   ? -3.884  66.590 74.008 1.00 99.14  ? 2051 HOH A O   1 
HETATM 4296 O O   . HOH F 5 .   ? -0.588  61.254 72.058 1.00 39.42  ? 2052 HOH A O   1 
HETATM 4297 O O   . HOH F 5 .   ? -7.929  65.970 70.684 1.00 63.06  ? 2053 HOH A O   1 
HETATM 4298 O O   . HOH F 5 .   ? -0.513  67.241 30.694 1.00 66.56  ? 2054 HOH A O   1 
HETATM 4299 O O   . HOH F 5 .   ? -4.601  80.765 31.240 1.00 48.95  ? 2055 HOH A O   1 
HETATM 4300 O O   . HOH F 5 .   ? -3.829  69.175 78.332 1.00 34.13  ? 2056 HOH A O   1 
HETATM 4301 O O   . HOH F 5 .   ? 30.169  58.562 65.116 1.00 67.70  ? 2057 HOH A O   1 
HETATM 4302 O O   . HOH F 5 .   ? 0.846   70.433 67.897 1.00 27.95  ? 2058 HOH A O   1 
HETATM 4303 O O   . HOH F 5 .   ? -0.872  72.283 72.851 1.00 34.84  ? 2059 HOH A O   1 
HETATM 4304 O O   . HOH F 5 .   ? -3.161  76.408 64.186 1.00 31.93  ? 2060 HOH A O   1 
HETATM 4305 O O   . HOH F 5 .   ? -3.411  73.474 72.989 1.00 57.07  ? 2061 HOH A O   1 
HETATM 4306 O O   . HOH F 5 .   ? 0.819   77.633 61.623 1.00 30.15  ? 2062 HOH A O   1 
HETATM 4307 O O   . HOH F 5 .   ? -0.151  69.876 62.089 1.00 25.25  ? 2063 HOH A O   1 
HETATM 4308 O O   . HOH F 5 .   ? -7.523  73.356 67.047 1.00 36.15  ? 2064 HOH A O   1 
HETATM 4309 O O   . HOH F 5 .   ? -5.618  76.895 65.933 1.00 43.97  ? 2065 HOH A O   1 
HETATM 4310 O O   . HOH F 5 .   ? -14.351 77.085 60.279 1.00 77.26  ? 2066 HOH A O   1 
HETATM 4311 O O   . HOH F 5 .   ? 9.088   48.517 61.847 1.00 65.95  ? 2067 HOH A O   1 
HETATM 4312 O O   . HOH F 5 .   ? 4.816   48.200 62.766 1.00 38.75  ? 2068 HOH A O   1 
HETATM 4313 O O   . HOH F 5 .   ? -14.068 72.165 65.164 1.00 79.04  ? 2069 HOH A O   1 
HETATM 4314 O O   . HOH F 5 .   ? 3.726   44.139 55.647 1.00 47.25  ? 2070 HOH A O   1 
HETATM 4315 O O   . HOH F 5 .   ? 3.084   44.542 62.601 1.00 80.27  ? 2071 HOH A O   1 
HETATM 4316 O O   . HOH F 5 .   ? 1.255   41.082 54.074 1.00 66.32  ? 2072 HOH A O   1 
HETATM 4317 O O   . HOH F 5 .   ? 3.574   44.859 65.524 1.00 95.48  ? 2073 HOH A O   1 
HETATM 4318 O O   . HOH F 5 .   ? -13.421 62.938 56.202 1.00 34.20  ? 2074 HOH A O   1 
HETATM 4319 O O   . HOH F 5 .   ? -17.930 66.111 60.633 1.00 57.35  ? 2075 HOH A O   1 
HETATM 4320 O O   . HOH F 5 .   ? -14.799 60.530 56.618 1.00 30.17  ? 2076 HOH A O   1 
HETATM 4321 O O   . HOH F 5 .   ? -19.343 63.670 60.234 1.00 53.53  ? 2077 HOH A O   1 
HETATM 4322 O O   . HOH F 5 .   ? -7.561  40.733 66.015 1.00 70.93  ? 2078 HOH A O   1 
HETATM 4323 O O   . HOH F 5 .   ? 4.512   49.909 66.811 1.00 61.51  ? 2079 HOH A O   1 
HETATM 4324 O O   . HOH F 5 .   ? -14.951 66.794 51.452 1.00 27.25  ? 2080 HOH A O   1 
HETATM 4325 O O   . HOH F 5 .   ? -11.209 47.608 75.230 1.00 36.22  ? 2081 HOH A O   1 
HETATM 4326 O O   . HOH F 5 .   ? -15.000 68.247 49.110 1.00 40.12  ? 2082 HOH A O   1 
HETATM 4327 O O   . HOH F 5 .   ? -18.117 73.272 51.111 1.00 61.42  ? 2083 HOH A O   1 
HETATM 4328 O O   . HOH F 5 .   ? -13.503 38.328 61.958 1.00 71.31  ? 2084 HOH A O   1 
HETATM 4329 O O   . HOH F 5 .   ? -3.514  83.624 51.571 1.00 40.27  ? 2085 HOH A O   1 
HETATM 4330 O O   . HOH F 5 .   ? -3.653  85.782 39.192 1.00 31.57  ? 2086 HOH A O   1 
HETATM 4331 O O   . HOH F 5 .   ? 2.141   87.588 41.715 1.00 68.65  ? 2087 HOH A O   1 
HETATM 4332 O O   . HOH F 5 .   ? -11.116 68.728 69.635 1.00 56.86  ? 2088 HOH A O   1 
HETATM 4333 O O   . HOH F 5 .   ? 3.509   86.708 33.649 1.00 66.93  ? 2089 HOH A O   1 
HETATM 4334 O O   . HOH F 5 .   ? -4.599  87.832 34.427 1.00 43.99  ? 2090 HOH A O   1 
HETATM 4335 O O   . HOH F 5 .   ? 7.908   55.139 80.007 1.00 70.28  ? 2091 HOH A O   1 
HETATM 4336 O O   . HOH F 5 .   ? 4.150   41.530 51.527 1.00 45.91  ? 2092 HOH A O   1 
HETATM 4337 O O   . HOH F 5 .   ? 5.838   44.523 53.576 1.00 34.15  ? 2093 HOH A O   1 
HETATM 4338 O O   . HOH F 5 .   ? 10.280  49.411 54.691 1.00 38.46  ? 2094 HOH A O   1 
HETATM 4339 O O   . HOH F 5 .   ? 13.167  47.739 55.780 1.00 90.05  ? 2095 HOH A O   1 
HETATM 4340 O O   . HOH F 5 .   ? -1.585  58.029 62.182 1.00 21.86  ? 2096 HOH A O   1 
HETATM 4341 O O   . HOH F 5 .   ? -6.619  61.937 64.674 1.00 25.13  ? 2097 HOH A O   1 
HETATM 4342 O O   . HOH F 5 .   ? -0.355  63.654 58.441 1.00 22.14  ? 2098 HOH A O   1 
HETATM 4343 O O   . HOH F 5 .   ? -6.857  68.369 57.383 1.00 23.80  ? 2099 HOH A O   1 
HETATM 4344 O O   . HOH F 5 .   ? 20.226  74.066 68.222 1.00 46.48  ? 2100 HOH A O   1 
HETATM 4345 O O   . HOH F 5 .   ? 23.628  66.071 63.922 1.00 64.56  ? 2101 HOH A O   1 
HETATM 4346 O O   . HOH F 5 .   ? 23.360  73.062 70.858 1.00 81.72  ? 2102 HOH A O   1 
HETATM 4347 O O   . HOH F 5 .   ? -3.871  70.375 61.904 1.00 23.63  ? 2103 HOH A O   1 
HETATM 4348 O O   . HOH F 5 .   ? -1.746  75.922 52.369 1.00 31.85  ? 2104 HOH A O   1 
HETATM 4349 O O   . HOH F 5 .   ? -7.820  71.914 52.150 1.00 29.43  ? 2105 HOH A O   1 
HETATM 4350 O O   . HOH F 5 .   ? 1.025   83.272 57.157 1.00 41.78  ? 2106 HOH A O   1 
HETATM 4351 O O   . HOH F 5 .   ? -4.861  80.903 62.057 1.00 97.51  ? 2107 HOH A O   1 
HETATM 4352 O O   . HOH F 5 .   ? -3.809  80.935 58.133 1.00 51.89  ? 2108 HOH A O   1 
HETATM 4353 O O   . HOH F 5 .   ? -2.019  78.221 62.112 1.00 34.19  ? 2109 HOH A O   1 
HETATM 4354 O O   . HOH F 5 .   ? 13.606  76.147 78.569 1.00 59.10  ? 2110 HOH A O   1 
HETATM 4355 O O   . HOH F 5 .   ? 4.001   69.356 57.209 1.00 21.15  ? 2111 HOH A O   1 
HETATM 4356 O O   . HOH F 5 .   ? 0.245   69.597 59.018 1.00 22.91  ? 2112 HOH A O   1 
HETATM 4357 O O   . HOH F 5 .   ? 4.495   80.831 50.965 1.00 24.10  ? 2113 HOH A O   1 
HETATM 4358 O O   . HOH F 5 .   ? 1.796   89.835 54.023 1.00 38.82  ? 2114 HOH A O   1 
HETATM 4359 O O   . HOH F 5 .   ? 11.243  87.499 43.809 1.00 48.74  ? 2115 HOH A O   1 
HETATM 4360 O O   . HOH F 5 .   ? 26.249  46.157 76.878 1.00 40.75  ? 2116 HOH A O   1 
HETATM 4361 O O   . HOH F 5 .   ? 10.916  84.840 39.940 1.00 68.10  ? 2117 HOH A O   1 
HETATM 4362 O O   . HOH F 5 .   ? 27.635  60.968 73.699 1.00 78.54  ? 2118 HOH A O   1 
HETATM 4363 O O   . HOH F 5 .   ? -1.294  70.077 52.242 1.00 25.75  ? 2119 HOH A O   1 
HETATM 4364 O O   . HOH F 5 .   ? -9.484  62.602 59.129 1.00 21.02  ? 2120 HOH A O   1 
HETATM 4365 O O   . HOH F 5 .   ? -13.306 58.451 55.985 1.00 21.12  ? 2121 HOH A O   1 
HETATM 4366 O O   . HOH F 5 .   ? -4.374  52.370 55.893 1.00 22.91  ? 2122 HOH A O   1 
HETATM 4367 O O   . HOH F 5 .   ? -6.052  45.425 57.216 1.00 29.09  ? 2123 HOH A O   1 
HETATM 4368 O O   . HOH F 5 .   ? 20.601  55.593 35.482 1.00 74.91  ? 2124 HOH A O   1 
HETATM 4369 O O   . HOH F 5 .   ? -6.790  46.696 51.036 1.00 60.07  ? 2125 HOH A O   1 
HETATM 4370 O O   . HOH F 5 .   ? -9.350  45.815 50.573 1.00 35.84  ? 2126 HOH A O   1 
HETATM 4371 O O   . HOH F 5 .   ? -13.752 51.917 48.801 1.00 37.22  ? 2127 HOH A O   1 
HETATM 4372 O O   . HOH F 5 .   ? -20.754 52.668 51.109 1.00 61.80  ? 2128 HOH A O   1 
HETATM 4373 O O   . HOH F 5 .   ? -7.992  58.597 44.318 1.00 35.09  ? 2129 HOH A O   1 
HETATM 4374 O O   . HOH F 5 .   ? 4.507   90.875 72.520 1.00 72.04  ? 2130 HOH A O   1 
HETATM 4375 O O   . HOH F 5 .   ? -3.477  52.382 43.771 1.00 30.50  ? 2131 HOH A O   1 
HETATM 4376 O O   . HOH F 5 .   ? -7.070  55.621 42.739 1.00 86.29  ? 2132 HOH A O   1 
HETATM 4377 O O   . HOH F 5 .   ? -7.809  59.962 41.794 1.00 39.90  ? 2133 HOH A O   1 
HETATM 4378 O O   . HOH F 5 .   ? 18.616  87.930 50.325 1.00 90.55  ? 2134 HOH A O   1 
HETATM 4379 O O   . HOH F 5 .   ? 16.567  86.342 46.359 1.00 66.41  ? 2135 HOH A O   1 
HETATM 4380 O O   . HOH F 5 .   ? -4.487  61.440 33.961 1.00 35.31  ? 2136 HOH A O   1 
HETATM 4381 O O   . HOH F 5 .   ? -5.303  58.404 36.209 1.00 42.73  ? 2137 HOH A O   1 
HETATM 4382 O O   . HOH F 5 .   ? -5.830  59.216 39.677 1.00 33.01  ? 2138 HOH A O   1 
HETATM 4383 O O   . HOH F 5 .   ? -3.633  67.716 32.036 1.00 43.32  ? 2139 HOH A O   1 
HETATM 4384 O O   . HOH F 5 .   ? -1.752  61.132 33.936 1.00 56.68  ? 2140 HOH A O   1 
HETATM 4385 O O   . HOH F 5 .   ? -4.377  70.987 33.896 1.00 50.43  ? 2141 HOH A O   1 
HETATM 4386 O O   . HOH F 5 .   ? -9.941  65.770 37.778 1.00 39.60  ? 2142 HOH A O   1 
HETATM 4387 O O   . HOH F 5 .   ? -11.758 67.876 36.774 1.00 36.34  ? 2143 HOH A O   1 
HETATM 4388 O O   . HOH F 5 .   ? 24.190  60.374 39.348 1.00 47.13  ? 2144 HOH A O   1 
HETATM 4389 O O   . HOH F 5 .   ? -7.436  80.135 32.025 1.00 45.65  ? 2145 HOH A O   1 
HETATM 4390 O O   . HOH F 5 .   ? 28.105  53.835 41.093 1.00 95.23  ? 2146 HOH A O   1 
HETATM 4391 O O   . HOH F 5 .   ? 25.201  65.937 59.656 1.00 42.47  ? 2147 HOH A O   1 
HETATM 4392 O O   . HOH F 5 .   ? -0.053  66.681 36.406 1.00 33.57  ? 2148 HOH A O   1 
HETATM 4393 O O   . HOH F 5 .   ? 3.788   67.329 36.294 1.00 26.63  ? 2149 HOH A O   1 
HETATM 4394 O O   . HOH F 5 .   ? 9.087   71.741 32.114 1.00 67.59  ? 2150 HOH A O   1 
HETATM 4395 O O   . HOH F 5 .   ? 7.510   70.690 38.919 1.00 31.23  ? 2151 HOH A O   1 
HETATM 4396 O O   . HOH F 5 .   ? 30.732  59.752 62.247 1.00 37.59  ? 2152 HOH A O   1 
HETATM 4397 O O   . HOH F 5 .   ? 27.589  60.288 64.896 1.00 56.57  ? 2153 HOH A O   1 
HETATM 4398 O O   . HOH F 5 .   ? 34.389  56.301 64.541 1.00 40.30  ? 2154 HOH A O   1 
HETATM 4399 O O   . HOH F 5 .   ? 15.197  47.749 63.219 1.00 74.75  ? 2155 HOH A O   1 
HETATM 4400 O O   . HOH F 5 .   ? 26.194  53.400 52.582 1.00 57.15  ? 2156 HOH A O   1 
HETATM 4401 O O   . HOH F 5 .   ? 2.514   54.520 36.353 1.00 28.38  ? 2157 HOH A O   1 
HETATM 4402 O O   . HOH F 5 .   ? -4.327  56.507 39.176 1.00 44.13  ? 2158 HOH A O   1 
HETATM 4403 O O   . HOH F 5 .   ? 7.370   49.886 37.137 1.00 39.77  ? 2159 HOH A O   1 
HETATM 4404 O O   . HOH F 5 .   ? 1.414   64.421 34.882 1.00 69.48  ? 2160 HOH A O   1 
HETATM 4405 O O   . HOH F 5 .   ? 5.320   57.425 35.501 1.00 43.51  ? 2161 HOH A O   1 
HETATM 4406 O O   . HOH F 5 .   ? 0.027   57.310 37.903 1.00 31.47  ? 2162 HOH A O   1 
HETATM 4407 O O   . HOH F 5 .   ? -0.745  66.815 39.536 1.00 26.97  ? 2163 HOH A O   1 
HETATM 4408 O O   . HOH F 5 .   ? 4.415   64.611 34.986 1.00 34.72  ? 2164 HOH A O   1 
HETATM 4409 O O   . HOH F 5 .   ? 11.549  64.899 35.201 1.00 37.81  ? 2165 HOH A O   1 
HETATM 4410 O O   . HOH F 5 .   ? 9.146   62.703 35.506 1.00 72.73  ? 2166 HOH A O   1 
HETATM 4411 O O   . HOH F 5 .   ? 11.613  70.478 33.261 1.00 45.73  ? 2167 HOH A O   1 
HETATM 4412 O O   . HOH F 5 .   ? 11.112  68.754 58.936 1.00 26.15  ? 2168 HOH A O   1 
HETATM 4413 O O   . HOH F 5 .   ? 6.972   52.676 56.121 1.00 21.19  ? 2169 HOH A O   1 
HETATM 4414 O O   . HOH F 5 .   ? 14.236  51.398 55.901 1.00 37.93  ? 2170 HOH A O   1 
HETATM 4415 O O   . HOH F 5 .   ? 12.451  51.248 59.252 1.00 73.56  ? 2171 HOH A O   1 
HETATM 4416 O O   . HOH F 5 .   ? 2.849   54.424 63.023 1.00 23.56  ? 2172 HOH A O   1 
HETATM 4417 O O   . HOH F 5 .   ? 7.012   48.881 59.282 1.00 35.40  ? 2173 HOH A O   1 
HETATM 4418 O O   . HOH F 5 .   ? 4.593   50.869 61.651 1.00 25.43  ? 2174 HOH A O   1 
HETATM 4419 O O   . HOH F 5 .   ? 6.138   48.733 55.474 1.00 27.45  ? 2175 HOH A O   1 
HETATM 4420 O O   . HOH F 5 .   ? 3.049   46.470 60.812 1.00 32.17  ? 2176 HOH A O   1 
HETATM 4421 O O   . HOH F 5 .   ? 4.925   46.290 57.065 1.00 32.02  ? 2177 HOH A O   1 
HETATM 4422 O O   . HOH F 5 .   ? 0.087   41.105 57.114 1.00 32.27  ? 2178 HOH A O   1 
HETATM 4423 O O   . HOH F 5 .   ? -2.272  40.416 63.701 1.00 60.85  ? 2179 HOH A O   1 
HETATM 4424 O O   . HOH F 5 .   ? -5.088  40.551 62.463 1.00 48.96  ? 2180 HOH A O   1 
HETATM 4425 O O   . HOH F 5 .   ? 1.323   43.742 67.147 1.00 49.16  ? 2181 HOH A O   1 
HETATM 4426 O O   . HOH F 5 .   ? -0.519  42.196 63.778 1.00 38.83  ? 2182 HOH A O   1 
HETATM 4427 O O   . HOH F 5 .   ? -6.611  49.894 60.882 1.00 22.89  ? 2183 HOH A O   1 
HETATM 4428 O O   . HOH F 5 .   ? -10.432 40.427 61.995 1.00 82.18  ? 2184 HOH A O   1 
HETATM 4429 O O   . HOH F 5 .   ? -7.416  38.141 56.814 1.00 62.03  ? 2185 HOH A O   1 
HETATM 4430 O O   . HOH F 5 .   ? -7.479  43.221 67.651 1.00 71.87  ? 2186 HOH A O   1 
HETATM 4431 O O   . HOH F 5 .   ? -3.641  46.621 71.814 1.00 48.09  ? 2187 HOH A O   1 
HETATM 4432 O O   . HOH F 5 .   ? -5.180  42.978 69.689 1.00 78.34  ? 2188 HOH A O   1 
HETATM 4433 O O   . HOH F 5 .   ? 3.019   51.837 63.921 1.00 29.66  ? 2189 HOH A O   1 
HETATM 4434 O O   . HOH F 5 .   ? 3.452   47.739 64.913 1.00 36.63  ? 2190 HOH A O   1 
HETATM 4435 O O   . HOH F 5 .   ? -9.438  45.537 74.563 1.00 50.69  ? 2191 HOH A O   1 
HETATM 4436 O O   . HOH F 5 .   ? -10.717 41.957 75.194 1.00 66.99  ? 2192 HOH A O   1 
HETATM 4437 O O   . HOH F 5 .   ? -22.430 47.307 66.720 1.00 46.42  ? 2193 HOH A O   1 
HETATM 4438 O O   . HOH F 5 .   ? -25.776 40.083 67.651 1.00 85.88  ? 2194 HOH A O   1 
HETATM 4439 O O   . HOH F 5 .   ? -15.701 39.747 58.113 1.00 72.12  ? 2195 HOH A O   1 
HETATM 4440 O O   . HOH F 5 .   ? -13.866 41.393 61.886 1.00 44.38  ? 2196 HOH A O   1 
HETATM 4441 O O   . HOH F 5 .   ? -21.787 48.393 56.993 1.00 72.07  ? 2197 HOH A O   1 
HETATM 4442 O O   . HOH F 5 .   ? -10.406 66.234 68.137 1.00 26.48  ? 2198 HOH A O   1 
HETATM 4443 O O   . HOH F 5 .   ? -9.170  63.544 71.701 1.00 61.73  ? 2199 HOH A O   1 
HETATM 4444 O O   . HOH F 5 .   ? -14.334 66.258 66.937 1.00 43.40  ? 2200 HOH A O   1 
HETATM 4445 O O   . HOH F 5 .   ? -17.671 64.666 67.030 1.00 57.08  ? 2201 HOH A O   1 
HETATM 4446 O O   . HOH F 5 .   ? -15.289 57.562 72.402 1.00 74.75  ? 2202 HOH A O   1 
HETATM 4447 O O   . HOH F 5 .   ? -7.605  61.142 71.595 1.00 67.59  ? 2203 HOH A O   1 
HETATM 4448 O O   . HOH F 5 .   ? -7.050  57.574 72.714 1.00 52.03  ? 2204 HOH A O   1 
HETATM 4449 O O   . HOH F 5 .   ? -9.062  58.902 64.116 1.00 20.52  ? 2205 HOH A O   1 
HETATM 4450 O O   . HOH F 5 .   ? -3.909  57.531 63.527 1.00 31.50  ? 2206 HOH A O   1 
HETATM 4451 O O   . HOH F 5 .   ? -7.303  49.206 73.405 1.00 40.76  ? 2207 HOH A O   1 
HETATM 4452 O O   . HOH F 5 .   ? 3.251   50.750 69.383 1.00 23.18  ? 2208 HOH A O   1 
HETATM 4453 O O   . HOH F 5 .   ? 1.139   52.737 73.745 1.00 66.76  ? 2209 HOH A O   1 
HETATM 4454 O O   . HOH F 5 .   ? 8.629   50.507 77.465 1.00 47.35  ? 2210 HOH A O   1 
HETATM 4455 O O   . HOH F 5 .   ? 5.556   47.651 74.791 1.00 55.13  ? 2211 HOH A O   1 
HETATM 4456 O O   . HOH F 5 .   ? 5.022   53.447 80.314 1.00 45.37  ? 2212 HOH A O   1 
HETATM 4457 O O   . HOH F 5 .   ? 4.051   55.623 77.936 1.00 34.80  ? 2213 HOH A O   1 
HETATM 4458 O O   . HOH F 5 .   ? 3.960   55.738 69.905 1.00 37.16  ? 2214 HOH A O   1 
HETATM 4459 O O   . HOH F 5 .   ? 4.630   59.609 69.674 1.00 34.58  ? 2215 HOH A O   1 
HETATM 4460 O O   . HOH F 5 .   ? 10.660  49.465 66.455 1.00 74.78  ? 2216 HOH A O   1 
HETATM 4461 O O   . HOH F 5 .   ? 6.849   49.265 65.915 1.00 53.91  ? 2217 HOH A O   1 
HETATM 4462 O O   . HOH F 5 .   ? -3.990  50.593 61.575 1.00 32.23  ? 2218 HOH A O   1 
HETATM 4463 O O   . HOH F 5 .   ? -2.188  57.678 65.985 1.00 37.86  ? 2219 HOH A O   1 
HETATM 4464 O O   . HOH F 5 .   ? -3.624  51.548 59.047 1.00 25.35  ? 2220 HOH A O   1 
HETATM 4465 O O   . HOH F 5 .   ? 1.017   43.823 54.502 1.00 38.04  ? 2221 HOH A O   1 
HETATM 4466 O O   . HOH F 5 .   ? -0.794  41.704 50.967 1.00 45.53  ? 2222 HOH A O   1 
HETATM 4467 O O   . HOH F 5 .   ? 1.807   42.568 50.168 1.00 60.76  ? 2223 HOH A O   1 
HETATM 4468 O O   . HOH F 5 .   ? -1.122  51.126 42.453 1.00 45.08  ? 2224 HOH A O   1 
HETATM 4469 O O   . HOH F 5 .   ? 7.012   41.801 48.953 1.00 44.35  ? 2225 HOH A O   1 
HETATM 4470 O O   . HOH F 5 .   ? 10.920  42.602 51.099 1.00 49.51  ? 2226 HOH A O   1 
HETATM 4471 O O   . HOH F 5 .   ? 6.971   47.166 53.278 1.00 23.51  ? 2227 HOH A O   1 
HETATM 4472 O O   . HOH F 5 .   ? 13.069  49.961 53.414 1.00 46.91  ? 2228 HOH A O   1 
HETATM 4473 O O   . HOH F 5 .   ? 9.578   47.004 53.202 1.00 29.18  ? 2229 HOH A O   1 
HETATM 4474 O O   . HOH F 5 .   ? 13.428  43.407 44.773 1.00 47.96  ? 2230 HOH A O   1 
HETATM 4475 O O   . HOH F 5 .   ? 14.139  42.500 47.857 1.00 83.94  ? 2231 HOH A O   1 
HETATM 4476 O O   . HOH F 5 .   ? 4.520   46.907 39.999 1.00 46.72  ? 2232 HOH A O   1 
HETATM 4477 O O   . HOH F 5 .   ? 8.647   45.285 43.183 1.00 53.56  ? 2233 HOH A O   1 
HETATM 4478 O O   . HOH F 5 .   ? 6.545   62.758 34.952 1.00 34.33  ? 2234 HOH A O   1 
HETATM 4479 O O   . HOH F 5 .   ? 9.565   51.457 36.839 1.00 43.31  ? 2235 HOH A O   1 
HETATM 4480 O O   . HOH F 5 .   ? 9.398   56.683 35.809 1.00 29.60  ? 2236 HOH A O   1 
HETATM 4481 O O   . HOH F 5 .   ? 21.021  64.998 63.238 1.00 32.39  ? 2237 HOH A O   1 
HETATM 4482 O O   . HOH F 5 .   ? 22.167  67.139 69.522 1.00 52.31  ? 2238 HOH A O   1 
HETATM 4483 O O   . HOH F 5 .   ? 21.509  71.538 67.583 1.00 59.69  ? 2239 HOH A O   1 
HETATM 4484 O O   . HOH F 5 .   ? 25.840  70.396 67.825 1.00 74.06  ? 2240 HOH A O   1 
HETATM 4485 O O   . HOH F 5 .   ? 12.118  67.401 66.699 1.00 31.17  ? 2241 HOH A O   1 
HETATM 4486 O O   . HOH F 5 .   ? 10.687  64.265 64.073 1.00 46.54  ? 2242 HOH A O   1 
HETATM 4487 O O   . HOH F 5 .   ? 5.893   61.041 72.098 1.00 44.37  ? 2243 HOH A O   1 
HETATM 4488 O O   . HOH F 5 .   ? 6.106   66.910 78.369 1.00 54.98  ? 2244 HOH A O   1 
HETATM 4489 O O   . HOH F 5 .   ? 2.322   64.292 76.320 1.00 50.22  ? 2245 HOH A O   1 
HETATM 4490 O O   . HOH F 5 .   ? 4.776   57.562 75.656 1.00 52.34  ? 2246 HOH A O   1 
HETATM 4491 O O   . HOH F 5 .   ? 7.786   63.620 78.556 1.00 18.95  ? 2247 HOH A O   1 
HETATM 4492 O O   . HOH F 5 .   ? 11.899  67.234 82.780 1.00 36.66  ? 2248 HOH A O   1 
HETATM 4493 O O   . HOH F 5 .   ? 10.620  76.431 77.579 1.00 47.24  ? 2249 HOH A O   1 
HETATM 4494 O O   . HOH F 5 .   ? 5.357   77.922 80.475 1.00 54.93  ? 2250 HOH A O   1 
HETATM 4495 O O   . HOH F 5 .   ? 16.894  69.268 83.807 1.00 49.38  ? 2251 HOH A O   1 
HETATM 4496 O O   . HOH F 5 .   ? 15.202  65.151 83.475 1.00 34.51  ? 2252 HOH A O   1 
HETATM 4497 O O   . HOH F 5 .   ? 20.605  64.268 85.418 1.00 78.89  ? 2253 HOH A O   1 
HETATM 4498 O O   . HOH F 5 .   ? 15.823  59.163 86.864 1.00 61.47  ? 2254 HOH A O   1 
HETATM 4499 O O   . HOH F 5 .   ? 23.534  51.487 80.256 1.00 51.54  ? 2255 HOH A O   1 
HETATM 4500 O O   . HOH F 5 .   ? 15.447  52.373 83.186 1.00 76.67  ? 2256 HOH A O   1 
HETATM 4501 O O   . HOH F 5 .   ? 16.176  62.316 84.008 1.00 40.98  ? 2257 HOH A O   1 
HETATM 4502 O O   . HOH F 5 .   ? 12.732  56.020 83.918 1.00 47.73  ? 2258 HOH A O   1 
HETATM 4503 O O   . HOH F 5 .   ? 12.354  61.364 85.434 1.00 51.16  ? 2259 HOH A O   1 
HETATM 4504 O O   . HOH F 5 .   ? 10.112  52.702 78.807 1.00 50.19  ? 2260 HOH A O   1 
HETATM 4505 O O   . HOH F 5 .   ? 10.443  55.529 68.108 1.00 22.84  ? 2261 HOH A O   1 
HETATM 4506 O O   . HOH F 5 .   ? 11.877  46.717 66.396 1.00 65.70  ? 2262 HOH A O   1 
HETATM 4507 O O   . HOH F 5 .   ? 11.597  45.984 74.657 1.00 75.88  ? 2263 HOH A O   1 
HETATM 4508 O O   . HOH F 5 .   ? 13.271  43.840 75.556 1.00 87.90  ? 2264 HOH A O   1 
HETATM 4509 O O   . HOH F 5 .   ? 14.381  39.969 75.171 1.00 97.69  ? 2265 HOH A O   1 
HETATM 4510 O O   . HOH F 5 .   ? 17.962  39.474 74.304 1.00 65.08  ? 2266 HOH A O   1 
HETATM 4511 O O   . HOH F 5 .   ? 24.717  48.341 76.107 1.00 28.89  ? 2267 HOH A O   1 
HETATM 4512 O O   . HOH F 5 .   ? 25.211  43.730 77.066 1.00 68.79  ? 2268 HOH A O   1 
HETATM 4513 O O   . HOH F 5 .   ? 20.017  44.519 79.537 1.00 79.99  ? 2269 HOH A O   1 
HETATM 4514 O O   . HOH F 5 .   ? 34.236  62.029 76.774 1.00 55.23  ? 2270 HOH A O   1 
HETATM 4515 O O   . HOH F 5 .   ? 30.203  61.867 73.750 1.00 63.11  ? 2271 HOH A O   1 
HETATM 4516 O O   . HOH F 5 .   ? 26.399  50.355 76.895 1.00 35.76  ? 2272 HOH A O   1 
HETATM 4517 O O   . HOH F 5 .   ? 34.939  62.911 80.259 1.00 87.22  ? 2273 HOH A O   1 
HETATM 4518 O O   . HOH F 5 .   ? 33.811  63.412 83.076 1.00 72.06  ? 2274 HOH A O   1 
HETATM 4519 O O   . HOH F 5 .   ? 33.402  61.702 85.132 1.00 78.66  ? 2275 HOH A O   1 
HETATM 4520 O O   . HOH F 5 .   ? 26.186  60.777 78.849 1.00 38.91  ? 2276 HOH A O   1 
HETATM 4521 O O   . HOH F 5 .   ? 31.354  67.271 78.118 1.00 96.99  ? 2277 HOH A O   1 
HETATM 4522 O O   . HOH F 5 .   ? 29.245  60.849 83.975 1.00 67.26  ? 2278 HOH A O   1 
HETATM 4523 O O   . HOH F 5 .   ? 22.551  59.246 85.666 1.00 44.25  ? 2279 HOH A O   1 
HETATM 4524 O O   . HOH F 5 .   ? 27.838  68.427 78.300 1.00 50.61  ? 2280 HOH A O   1 
HETATM 4525 O O   . HOH F 5 .   ? 24.704  66.332 84.309 1.00 78.37  ? 2281 HOH A O   1 
HETATM 4526 O O   . HOH F 5 .   ? 25.284  62.419 73.037 1.00 47.96  ? 2282 HOH A O   1 
HETATM 4527 O O   . HOH F 5 .   ? 21.205  72.493 78.359 1.00 42.50  ? 2283 HOH A O   1 
HETATM 4528 O O   . HOH F 5 .   ? 22.604  72.100 75.696 1.00 62.63  ? 2284 HOH A O   1 
HETATM 4529 O O   . HOH F 5 .   ? 24.071  70.152 73.704 1.00 40.53  ? 2285 HOH A O   1 
HETATM 4530 O O   . HOH F 5 .   ? 17.575  63.612 65.843 1.00 23.39  ? 2286 HOH A O   1 
HETATM 4531 O O   . HOH F 5 .   ? 24.768  64.682 66.793 1.00 55.89  ? 2287 HOH A O   1 
HETATM 4532 O O   . HOH F 5 .   ? 20.155  62.731 64.924 1.00 22.61  ? 2288 HOH A O   1 
HETATM 4533 O O   . HOH F 5 .   ? 15.638  52.789 61.359 1.00 33.84  ? 2289 HOH A O   1 
HETATM 4534 O O   . HOH F 5 .   ? 21.134  51.955 53.368 1.00 35.25  ? 2290 HOH A O   1 
HETATM 4535 O O   . HOH F 5 .   ? 25.062  54.849 47.821 1.00 57.93  ? 2291 HOH A O   1 
HETATM 4536 O O   . HOH F 5 .   ? 17.521  50.746 44.639 1.00 23.79  ? 2292 HOH A O   1 
HETATM 4537 O O   . HOH F 5 .   ? 20.027  47.026 51.695 1.00 84.40  ? 2293 HOH A O   1 
HETATM 4538 O O   . HOH F 5 .   ? 20.603  59.027 40.485 1.00 42.76  ? 2294 HOH A O   1 
HETATM 4539 O O   . HOH F 5 .   ? 18.120  54.578 35.404 1.00 89.94  ? 2295 HOH A O   1 
HETATM 4540 O O   . HOH F 5 .   ? 18.883  58.701 35.061 1.00 36.78  ? 2296 HOH A O   1 
HETATM 4541 O O   . HOH F 5 .   ? 19.008  65.488 36.246 1.00 65.83  ? 2297 HOH A O   1 
HETATM 4542 O O   . HOH F 5 .   ? 18.233  60.222 41.530 1.00 24.66  ? 2298 HOH A O   1 
HETATM 4543 O O   . HOH F 5 .   ? 19.507  67.562 38.440 1.00 29.82  ? 2299 HOH A O   1 
HETATM 4544 O O   . HOH F 5 .   ? 23.639  69.575 39.409 1.00 74.08  ? 2300 HOH A O   1 
HETATM 4545 O O   . HOH F 5 .   ? 13.583  68.856 56.586 1.00 30.40  ? 2301 HOH A O   1 
HETATM 4546 O O   . HOH F 5 .   ? 24.851  70.339 62.578 1.00 37.81  ? 2302 HOH A O   1 
HETATM 4547 O O   . HOH F 5 .   ? 22.315  79.048 61.062 1.00 44.09  ? 2303 HOH A O   1 
HETATM 4548 O O   . HOH F 5 .   ? 15.817  80.064 69.589 1.00 77.65  ? 2304 HOH A O   1 
HETATM 4549 O O   . HOH F 5 .   ? 21.218  77.195 64.685 1.00 47.51  ? 2305 HOH A O   1 
HETATM 4550 O O   . HOH F 5 .   ? 14.401  76.639 62.541 1.00 27.45  ? 2306 HOH A O   1 
HETATM 4551 O O   . HOH F 5 .   ? 6.784   82.268 67.356 1.00 62.71  ? 2307 HOH A O   1 
HETATM 4552 O O   . HOH F 5 .   ? 8.017   79.185 67.449 1.00 52.83  ? 2308 HOH A O   1 
HETATM 4553 O O   . HOH F 5 .   ? 8.277   80.665 74.781 1.00 85.40  ? 2309 HOH A O   1 
HETATM 4554 O O   . HOH F 5 .   ? 8.757   76.988 75.725 1.00 43.43  ? 2310 HOH A O   1 
HETATM 4555 O O   . HOH F 5 .   ? 13.457  79.470 73.841 1.00 46.14  ? 2311 HOH A O   1 
HETATM 4556 O O   . HOH F 5 .   ? 15.214  77.633 76.259 1.00 32.90  ? 2312 HOH A O   1 
HETATM 4557 O O   . HOH F 5 .   ? 19.221  74.788 70.419 1.00 50.62  ? 2313 HOH A O   1 
HETATM 4558 O O   . HOH F 5 .   ? 19.630  79.386 69.110 1.00 65.80  ? 2314 HOH A O   1 
HETATM 4559 O O   . HOH F 5 .   ? 20.668  70.854 71.179 1.00 33.36  ? 2315 HOH A O   1 
HETATM 4560 O O   . HOH F 5 .   ? 16.542  74.038 76.802 1.00 64.06  ? 2316 HOH A O   1 
HETATM 4561 O O   . HOH F 5 .   ? 8.012   76.021 60.328 1.00 23.39  ? 2317 HOH A O   1 
HETATM 4562 O O   . HOH F 5 .   ? 10.173  79.994 64.580 1.00 31.97  ? 2318 HOH A O   1 
HETATM 4563 O O   . HOH F 5 .   ? 7.117   79.656 64.106 1.00 50.48  ? 2319 HOH A O   1 
HETATM 4564 O O   . HOH F 5 .   ? 10.772  88.662 59.449 1.00 54.59  ? 2320 HOH A O   1 
HETATM 4565 O O   . HOH F 5 .   ? 6.997   84.285 64.228 1.00 82.76  ? 2321 HOH A O   1 
HETATM 4566 O O   . HOH F 5 .   ? 5.790   89.653 68.686 1.00 65.64  ? 2322 HOH A O   1 
HETATM 4567 O O   . HOH F 5 .   ? 6.551   82.263 62.105 1.00 48.30  ? 2323 HOH A O   1 
HETATM 4568 O O   . HOH F 5 .   ? 20.050  84.580 61.902 1.00 48.19  ? 2324 HOH A O   1 
HETATM 4569 O O   . HOH F 5 .   ? 18.814  90.846 61.963 1.00 49.41  ? 2325 HOH A O   1 
HETATM 4570 O O   . HOH F 5 .   ? 18.314  89.582 54.015 1.00 55.16  ? 2326 HOH A O   1 
HETATM 4571 O O   . HOH F 5 .   ? 21.358  83.986 55.690 1.00 64.70  ? 2327 HOH A O   1 
HETATM 4572 O O   . HOH F 5 .   ? 18.965  84.982 49.994 1.00 47.50  ? 2328 HOH A O   1 
HETATM 4573 O O   . HOH F 5 .   ? 13.324  83.537 47.173 1.00 35.09  ? 2329 HOH A O   1 
HETATM 4574 O O   . HOH F 5 .   ? 13.957  86.307 46.827 1.00 35.98  ? 2330 HOH A O   1 
HETATM 4575 O O   . HOH F 5 .   ? 9.591   90.913 49.195 1.00 71.41  ? 2331 HOH A O   1 
HETATM 4576 O O   . HOH F 5 .   ? 21.488  82.069 53.219 1.00 44.35  ? 2332 HOH A O   1 
HETATM 4577 O O   . HOH F 5 .   ? 18.562  79.560 46.039 1.00 77.14  ? 2333 HOH A O   1 
HETATM 4578 O O   . HOH F 5 .   ? 23.345  76.737 53.456 1.00 35.96  ? 2334 HOH A O   1 
HETATM 4579 O O   . HOH F 5 .   ? 18.241  84.349 47.818 1.00 62.48  ? 2335 HOH A O   1 
HETATM 4580 O O   . HOH F 5 .   ? 24.901  80.000 50.055 1.00 86.86  ? 2336 HOH A O   1 
HETATM 4581 O O   . HOH F 5 .   ? 10.455  74.766 33.262 1.00 48.29  ? 2337 HOH A O   1 
HETATM 4582 O O   . HOH F 5 .   ? 10.283  81.532 36.549 1.00 59.63  ? 2338 HOH A O   1 
HETATM 4583 O O   . HOH F 5 .   ? 24.582  72.473 38.585 1.00 64.33  ? 2339 HOH A O   1 
HETATM 4584 O O   . HOH F 5 .   ? 19.028  78.631 43.298 1.00 39.21  ? 2340 HOH A O   1 
HETATM 4585 O O   . HOH F 5 .   ? 18.273  75.001 37.087 1.00 44.92  ? 2341 HOH A O   1 
HETATM 4586 O O   . HOH F 5 .   ? 14.854  84.052 38.732 1.00 52.18  ? 2342 HOH A O   1 
HETATM 4587 O O   . HOH F 5 .   ? 21.320  86.428 46.331 1.00 73.87  ? 2343 HOH A O   1 
HETATM 4588 O O   . HOH F 5 .   ? 23.865  78.539 46.342 1.00 52.97  ? 2344 HOH A O   1 
HETATM 4589 O O   . HOH F 5 .   ? 23.228  66.764 47.354 1.00 26.19  ? 2345 HOH A O   1 
HETATM 4590 O O   . HOH F 5 .   ? 27.889  65.682 42.656 1.00 35.28  ? 2346 HOH A O   1 
HETATM 4591 O O   . HOH F 5 .   ? 27.515  63.218 45.302 1.00 33.15  ? 2347 HOH A O   1 
HETATM 4592 O O   . HOH F 5 .   ? 26.710  68.010 40.623 1.00 53.89  ? 2348 HOH A O   1 
HETATM 4593 O O   . HOH F 5 .   ? 21.755  61.804 41.555 1.00 31.83  ? 2349 HOH A O   1 
HETATM 4594 O O   . HOH F 5 .   ? 24.949  58.067 41.138 1.00 39.42  ? 2350 HOH A O   1 
HETATM 4595 O O   . HOH F 5 .   ? 24.530  53.802 41.012 1.00 82.36  ? 2351 HOH A O   1 
HETATM 4596 O O   . HOH F 5 .   ? 27.878  57.425 41.593 1.00 58.63  ? 2352 HOH A O   1 
HETATM 4597 O O   . HOH F 5 .   ? 24.909  58.682 51.966 1.00 41.18  ? 2353 HOH A O   1 
HETATM 4598 O O   . HOH F 5 .   ? 25.068  61.456 52.331 1.00 20.80  ? 2354 HOH A O   1 
HETATM 4599 O O   . HOH F 5 .   ? 28.593  53.947 52.260 1.00 69.85  ? 2355 HOH A O   1 
HETATM 4600 O O   . HOH F 5 .   ? 31.954  69.604 46.083 1.00 55.27  ? 2356 HOH A O   1 
HETATM 4601 O O   . HOH F 5 .   ? 34.443  64.956 44.762 1.00 54.31  ? 2357 HOH A O   1 
HETATM 4602 O O   . HOH F 5 .   ? 26.460  68.590 58.828 1.00 42.53  ? 2358 HOH A O   1 
HETATM 4603 O O   . HOH F 5 .   ? 26.248  76.303 55.972 1.00 71.52  ? 2359 HOH A O   1 
HETATM 4604 O O   . HOH F 5 .   ? 25.246  82.719 52.632 1.00 76.94  ? 2360 HOH A O   1 
HETATM 4605 O O   . HOH F 5 .   ? 30.223  78.053 56.074 1.00 74.23  ? 2361 HOH A O   1 
HETATM 4606 O O   . HOH F 5 .   ? 32.201  73.372 51.153 1.00 53.26  ? 2362 HOH A O   1 
HETATM 4607 O O   . HOH F 5 .   ? 31.752  65.264 54.813 1.00 66.09  ? 2363 HOH A O   1 
HETATM 4608 O O   . HOH F 5 .   ? 31.665  55.135 48.129 1.00 72.48  ? 2364 HOH A O   1 
HETATM 4609 O O   . HOH F 5 .   ? 25.126  58.338 54.815 1.00 54.45  ? 2365 HOH A O   1 
HETATM 4610 O O   . HOH F 5 .   ? 26.797  63.644 58.896 1.00 32.79  ? 2366 HOH A O   1 
HETATM 4611 O O   . HOH F 5 .   ? 28.546  59.348 60.657 1.00 28.52  ? 2367 HOH A O   1 
HETATM 4612 O O   . HOH F 5 .   ? 32.327  57.578 61.054 1.00 55.02  ? 2368 HOH A O   1 
HETATM 4613 O O   . HOH F 5 .   ? 29.834  52.337 65.295 1.00 59.37  ? 2369 HOH A O   1 
HETATM 4614 O O   . HOH F 5 .   ? 26.440  59.047 62.563 1.00 26.10  ? 2370 HOH A O   1 
HETATM 4615 O O   . HOH F 5 .   ? 23.701  51.593 55.695 1.00 77.53  ? 2371 HOH A O   1 
HETATM 4616 O O   . HOH F 5 .   ? 16.107  49.975 62.479 1.00 41.96  ? 2372 HOH A O   1 
HETATM 4617 O O   . HOH F 5 .   ? 16.756  49.838 56.342 1.00 43.36  ? 2373 HOH A O   1 
HETATM 4618 O O   . HOH F 5 .   ? 22.767  54.491 54.704 1.00 40.18  ? 2374 HOH A O   1 
HETATM 4619 O O   . HOH F 5 .   ? 15.995  52.951 58.308 1.00 68.11  ? 2375 HOH A O   1 
HETATM 4620 O O   . HOH F 5 .   ? 20.720  43.836 57.719 1.00 85.40  ? 2376 HOH A O   1 
HETATM 4621 O O   . HOH F 5 .   ? -17.777 88.901 52.521 1.00 66.52  ? 2377 HOH A O   1 
HETATM 4622 O O   . HOH F 5 .   ? -18.844 83.883 54.728 1.00 68.18  ? 2378 HOH A O   1 
HETATM 4623 O O   . HOH F 5 .   ? 20.381  63.910 27.470 1.00 58.12  ? 2379 HOH A O   1 
HETATM 4624 O O   . HOH F 5 .   ? 22.418  57.374 35.385 1.00 76.34  ? 2380 HOH A O   1 
HETATM 4625 O O   . HOH F 5 .   ? 17.904  59.310 26.888 1.00 68.01  ? 2381 HOH A O   1 
HETATM 4626 O O   . HOH F 5 .   ? 19.848  58.434 32.248 1.00 69.79  ? 2382 HOH A O   1 
HETATM 4627 O O   . HOH F 5 .   ? 24.712  60.482 34.528 1.00 62.33  ? 2383 HOH A O   1 
HETATM 4628 O O   . HOH F 5 .   ? 15.091  63.606 30.880 1.00 77.68  ? 2384 HOH A O   1 
HETATM 4629 O O   . HOH F 5 .   ? 3.638   65.522 64.759 1.00 56.88  ? 2385 HOH A O   1 
HETATM 4630 O O   . HOH F 5 .   ? 4.417   66.425 68.694 1.00 32.98  ? 2386 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   4   4   SER SER A . n 
A 1 2   GLU 2   5   5   GLU GLU A . n 
A 1 3   LEU 3   6   6   LEU LEU A . n 
A 1 4   LEU 4   7   7   LEU LEU A . n 
A 1 5   VAL 5   8   8   VAL VAL A . n 
A 1 6   ASN 6   9   9   ASN ASN A . n 
A 1 7   THR 7   10  10  THR THR A . n 
A 1 8   LYS 8   11  11  LYS LYS A . n 
A 1 9   SER 9   12  12  SER SER A . n 
A 1 10  GLY 10  13  13  GLY GLY A . n 
A 1 11  LYS 11  14  14  LYS LYS A . n 
A 1 12  VAL 12  15  15  VAL VAL A . n 
A 1 13  MET 13  16  16  MET MET A . n 
A 1 14  GLY 14  17  17  GLY GLY A . n 
A 1 15  THR 15  18  18  THR THR A . n 
A 1 16  ARG 16  19  19  ARG ARG A . n 
A 1 17  VAL 17  20  20  VAL VAL A . n 
A 1 18  PRO 18  21  21  PRO PRO A . n 
A 1 19  VAL 19  22  22  VAL VAL A . n 
A 1 20  LEU 20  23  23  LEU LEU A . n 
A 1 21  SER 21  24  24  SER SER A . n 
A 1 22  SER 22  25  25  SER SER A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  ILE 24  27  27  ILE ILE A . n 
A 1 25  SER 25  28  28  SER SER A . n 
A 1 26  ALA 26  29  29  ALA ALA A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  LEU 28  31  31  LEU LEU A . n 
A 1 29  GLY 29  32  32  GLY GLY A . n 
A 1 30  ILE 30  33  33  ILE ILE A . n 
A 1 31  PRO 31  34  34  PRO PRO A . n 
A 1 32  PHE 32  35  35  PHE PHE A . n 
A 1 33  ALA 33  36  36  ALA ALA A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  PRO 35  38  38  PRO PRO A . n 
A 1 36  PRO 36  39  39  PRO PRO A . n 
A 1 37  VAL 37  40  40  VAL VAL A . n 
A 1 38  GLY 38  41  41  GLY GLY A . n 
A 1 39  ASN 39  42  42  ASN ASN A . n 
A 1 40  MET 40  43  43  MET MET A . n 
A 1 41  ARG 41  44  44  ARG ARG A . n 
A 1 42  PHE 42  45  45  PHE PHE A . n 
A 1 43  ARG 43  46  46  ARG ARG A . n 
A 1 44  ARG 44  47  47  ARG ARG A . n 
A 1 45  PRO 45  48  48  PRO PRO A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  PRO 47  50  50  PRO PRO A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LYS 49  52  52  LYS LYS A . n 
A 1 50  PRO 50  53  53  PRO PRO A . n 
A 1 51  TRP 51  54  54  TRP TRP A . n 
A 1 52  SER 52  55  55  SER SER A . n 
A 1 53  GLY 53  56  56  GLY GLY A . n 
A 1 54  VAL 54  57  57  VAL VAL A . n 
A 1 55  TRP 55  58  58  TRP TRP A . n 
A 1 56  ASN 56  59  59  ASN ASN A . n 
A 1 57  ALA 57  60  60  ALA ALA A . n 
A 1 58  SER 58  61  61  SER SER A . n 
A 1 59  THR 59  62  62  THR THR A . n 
A 1 60  TYR 60  63  63  TYR TYR A . n 
A 1 61  PRO 61  64  64  PRO PRO A . n 
A 1 62  ASN 62  65  65  ASN ASN A . n 
A 1 63  ASN 63  66  66  ASN ASN A . n 
A 1 64  CYS 64  67  67  CYS CYS A . n 
A 1 65  GLN 65  68  68  GLN GLN A . n 
A 1 66  GLN 66  69  69  GLN GLN A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  VAL 68  71  71  VAL VAL A . n 
A 1 69  ASP 69  72  72  ASP ASP A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  GLN 71  74  74  GLN GLN A . n 
A 1 72  PHE 72  75  75  PHE PHE A . n 
A 1 73  PRO 73  76  76  PRO PRO A . n 
A 1 74  GLY 74  77  77  GLY GLY A . n 
A 1 75  PHE 75  78  78  PHE PHE A . n 
A 1 76  SER 76  79  79  SER SER A . n 
A 1 77  GLY 77  80  80  GLY GLY A . n 
A 1 78  SER 78  81  81  SER SER A . n 
A 1 79  GLU 79  82  82  GLU GLU A . n 
A 1 80  MET 80  83  83  MET MET A . n 
A 1 81  TRP 81  84  84  TRP TRP A . n 
A 1 82  ASN 82  85  85  ASN ASN A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  ASN 84  87  87  ASN ASN A . n 
A 1 85  ARG 85  88  88  ARG ARG A . n 
A 1 86  GLU 86  89  89  GLU GLU A . n 
A 1 87  MET 87  90  90  MET MET A . n 
A 1 88  SER 88  91  91  SER SER A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  ASP 90  93  93  ASP ASP A . n 
A 1 91  CYS 91  94  94  CYS CYS A . n 
A 1 92  LEU 92  95  95  LEU LEU A . n 
A 1 93  TYR 93  96  96  TYR TYR A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  ASN 95  98  98  ASN ASN A . n 
A 1 96  ILE 96  99  99  ILE ILE A . n 
A 1 97  TRP 97  100 100 TRP TRP A . n 
A 1 98  VAL 98  101 101 VAL VAL A . n 
A 1 99  PRO 99  102 102 PRO PRO A . n 
A 1 100 SER 100 103 103 SER SER A . n 
A 1 101 PRO 101 104 104 PRO PRO A . n 
A 1 102 ARG 102 105 105 ARG ARG A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 SER 105 108 108 SER SER A . n 
A 1 106 THR 106 109 109 THR THR A . n 
A 1 107 THR 107 110 110 THR THR A . n 
A 1 108 VAL 108 111 111 VAL VAL A . n 
A 1 109 MET 109 112 112 MET MET A . n 
A 1 110 VAL 110 113 113 VAL VAL A . n 
A 1 111 TRP 111 114 114 TRP TRP A . n 
A 1 112 ILE 112 115 115 ILE ILE A . n 
A 1 113 TYR 113 116 116 TYR TYR A . n 
A 1 114 GLY 114 117 117 GLY GLY A . n 
A 1 115 GLY 115 118 118 GLY GLY A . n 
A 1 116 GLY 116 119 119 GLY GLY A . n 
A 1 117 PHE 117 120 120 PHE PHE A . n 
A 1 118 TYR 118 121 121 TYR TYR A . n 
A 1 119 SER 119 122 122 SER SER A . n 
A 1 120 GLY 120 123 123 GLY GLY A . n 
A 1 121 SER 121 124 124 SER SER A . n 
A 1 122 SER 122 125 125 SER SER A . n 
A 1 123 THR 123 126 126 THR THR A . n 
A 1 124 LEU 124 127 127 LEU LEU A . n 
A 1 125 ASP 125 128 128 ASP ASP A . n 
A 1 126 VAL 126 129 129 VAL VAL A . n 
A 1 127 TYR 127 130 130 TYR TYR A . n 
A 1 128 ASN 128 131 131 ASN ASN A . n 
A 1 129 GLY 129 132 132 GLY GLY A . n 
A 1 130 LYS 130 133 133 LYS LYS A . n 
A 1 131 TYR 131 134 134 TYR TYR A . n 
A 1 132 LEU 132 135 135 LEU LEU A . n 
A 1 133 ALA 133 136 136 ALA ALA A . n 
A 1 134 TYR 134 137 137 TYR TYR A . n 
A 1 135 THR 135 138 138 THR THR A . n 
A 1 136 GLU 136 139 139 GLU GLU A . n 
A 1 137 GLU 137 140 140 GLU GLU A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 VAL 139 142 142 VAL VAL A . n 
A 1 140 LEU 140 143 143 LEU LEU A . n 
A 1 141 VAL 141 144 144 VAL VAL A . n 
A 1 142 SER 142 145 145 SER SER A . n 
A 1 143 LEU 143 146 146 LEU LEU A . n 
A 1 144 SER 144 147 147 SER SER A . n 
A 1 145 TYR 145 148 148 TYR TYR A . n 
A 1 146 ARG 146 149 149 ARG ARG A . n 
A 1 147 VAL 147 150 150 VAL VAL A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 ALA 149 152 152 ALA ALA A . n 
A 1 150 PHE 150 153 153 PHE PHE A . n 
A 1 151 GLY 151 154 154 GLY GLY A . n 
A 1 152 PHE 152 155 155 PHE PHE A . n 
A 1 153 LEU 153 156 156 LEU LEU A . n 
A 1 154 ALA 154 157 157 ALA ALA A . n 
A 1 155 LEU 155 158 158 LEU LEU A . n 
A 1 156 HIS 156 159 159 HIS HIS A . n 
A 1 157 GLY 157 160 160 GLY GLY A . n 
A 1 158 SER 158 161 161 SER SER A . n 
A 1 159 GLN 159 162 162 GLN GLN A . n 
A 1 160 GLU 160 163 163 GLU GLU A . n 
A 1 161 ALA 161 164 164 ALA ALA A . n 
A 1 162 PRO 162 165 165 PRO PRO A . n 
A 1 163 GLY 163 166 166 GLY GLY A . n 
A 1 164 ASN 164 167 167 ASN ASN A . n 
A 1 165 VAL 165 168 168 VAL VAL A . n 
A 1 166 GLY 166 169 169 GLY GLY A . n 
A 1 167 LEU 167 170 170 LEU LEU A . n 
A 1 168 LEU 168 171 171 LEU LEU A . n 
A 1 169 ASP 169 172 172 ASP ASP A . n 
A 1 170 GLN 170 173 173 GLN GLN A . n 
A 1 171 ARG 171 174 174 ARG ARG A . n 
A 1 172 MET 172 175 175 MET MET A . n 
A 1 173 ALA 173 176 176 ALA ALA A . n 
A 1 174 LEU 174 177 177 LEU LEU A . n 
A 1 175 GLN 175 178 178 GLN GLN A . n 
A 1 176 TRP 176 179 179 TRP TRP A . n 
A 1 177 VAL 177 180 180 VAL VAL A . n 
A 1 178 HIS 178 181 181 HIS HIS A . n 
A 1 179 ASP 179 182 182 ASP ASP A . n 
A 1 180 ASN 180 183 183 ASN ASN A . n 
A 1 181 ILE 181 184 184 ILE ILE A . n 
A 1 182 GLN 182 185 185 GLN GLN A . n 
A 1 183 PHE 183 186 186 PHE PHE A . n 
A 1 184 PHE 184 187 187 PHE PHE A . n 
A 1 185 GLY 185 188 188 GLY GLY A . n 
A 1 186 GLY 186 189 189 GLY GLY A . n 
A 1 187 ASP 187 190 190 ASP ASP A . n 
A 1 188 PRO 188 191 191 PRO PRO A . n 
A 1 189 LYS 189 192 192 LYS LYS A . n 
A 1 190 THR 190 193 193 THR THR A . n 
A 1 191 VAL 191 194 194 VAL VAL A . n 
A 1 192 THR 192 195 195 THR THR A . n 
A 1 193 ILE 193 196 196 ILE ILE A . n 
A 1 194 PHE 194 197 197 PHE PHE A . n 
A 1 195 GLY 195 198 198 GLY GLY A . n 
A 1 196 GLU 196 199 199 GLU GLU A . n 
A 1 197 SER 197 200 200 SER SER A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 GLY 199 202 202 GLY GLY A . n 
A 1 200 GLY 200 203 203 GLY GLY A . n 
A 1 201 ALA 201 204 204 ALA ALA A . n 
A 1 202 SER 202 205 205 SER SER A . n 
A 1 203 VAL 203 206 206 VAL VAL A . n 
A 1 204 GLY 204 207 207 GLY GLY A . n 
A 1 205 MET 205 208 208 MET MET A . n 
A 1 206 HIS 206 209 209 HIS HIS A . n 
A 1 207 ILE 207 210 210 ILE ILE A . n 
A 1 208 LEU 208 211 211 LEU LEU A . n 
A 1 209 SER 209 212 212 SER SER A . n 
A 1 210 PRO 210 213 213 PRO PRO A . n 
A 1 211 GLY 211 214 214 GLY GLY A . n 
A 1 212 SER 212 215 215 SER SER A . n 
A 1 213 ARG 213 216 216 ARG ARG A . n 
A 1 214 ASP 214 217 217 ASP ASP A . n 
A 1 215 LEU 215 218 218 LEU LEU A . n 
A 1 216 PHE 216 219 219 PHE PHE A . n 
A 1 217 ARG 217 220 220 ARG ARG A . n 
A 1 218 ARG 218 221 221 ARG ARG A . n 
A 1 219 ALA 219 222 222 ALA ALA A . n 
A 1 220 ILE 220 223 223 ILE ILE A . n 
A 1 221 LEU 221 224 224 LEU LEU A . n 
A 1 222 GLN 222 225 225 GLN GLN A . n 
A 1 223 SER 223 226 226 SER SER A . n 
A 1 224 GLY 224 227 227 GLY GLY A . n 
A 1 225 SER 225 228 228 SER SER A . n 
A 1 226 PRO 226 229 229 PRO PRO A . n 
A 1 227 ASN 227 230 230 ASN ASN A . n 
A 1 228 CYS 228 231 231 CYS CYS A . n 
A 1 229 PRO 229 232 232 PRO PRO A . n 
A 1 230 TRP 230 233 233 TRP TRP A . n 
A 1 231 ALA 231 234 234 ALA ALA A . n 
A 1 232 SER 232 235 235 SER SER A . n 
A 1 233 VAL 233 236 236 VAL VAL A . n 
A 1 234 SER 234 237 237 SER SER A . n 
A 1 235 VAL 235 238 238 VAL VAL A . n 
A 1 236 ALA 236 239 239 ALA ALA A . n 
A 1 237 GLU 237 240 240 GLU GLU A . n 
A 1 238 GLY 238 241 241 GLY GLY A . n 
A 1 239 ARG 239 242 242 ARG ARG A . n 
A 1 240 ARG 240 243 243 ARG ARG A . n 
A 1 241 ARG 241 244 244 ARG ARG A . n 
A 1 242 ALA 242 245 245 ALA ALA A . n 
A 1 243 VAL 243 246 246 VAL VAL A . n 
A 1 244 GLU 244 247 247 GLU GLU A . n 
A 1 245 LEU 245 248 248 LEU LEU A . n 
A 1 246 GLY 246 249 249 GLY GLY A . n 
A 1 247 ARG 247 250 250 ARG ARG A . n 
A 1 248 ASN 248 251 251 ASN ASN A . n 
A 1 249 LEU 249 252 252 LEU LEU A . n 
A 1 250 ASN 250 253 253 ASN ASN A . n 
A 1 251 CYS 251 254 254 CYS CYS A . n 
A 1 252 ASN 252 255 255 ASN ASN A . n 
A 1 253 LEU 253 256 256 LEU LEU A . n 
A 1 254 ASN 254 257 257 ASN ASN A . n 
A 1 255 SER 255 258 258 SER SER A . n 
A 1 256 ASP 256 259 259 ASP ASP A . n 
A 1 257 GLU 257 260 260 GLU GLU A . n 
A 1 258 GLU 258 261 261 GLU GLU A . n 
A 1 259 LEU 259 262 262 LEU LEU A . n 
A 1 260 ILE 260 263 263 ILE ILE A . n 
A 1 261 HIS 261 264 264 HIS HIS A . n 
A 1 262 CYS 262 265 265 CYS CYS A . n 
A 1 263 LEU 263 266 266 LEU LEU A . n 
A 1 264 ARG 264 267 267 ARG ARG A . n 
A 1 265 GLU 265 268 268 GLU GLU A . n 
A 1 266 LYS 266 269 269 LYS LYS A . n 
A 1 267 LYS 267 270 270 LYS LYS A . n 
A 1 268 PRO 268 271 271 PRO PRO A . n 
A 1 269 GLN 269 272 272 GLN GLN A . n 
A 1 270 GLU 270 273 273 GLU GLU A . n 
A 1 271 LEU 271 274 274 LEU LEU A . n 
A 1 272 ILE 272 275 275 ILE ILE A . n 
A 1 273 ASP 273 276 276 ASP ASP A . n 
A 1 274 VAL 274 277 277 VAL VAL A . n 
A 1 275 GLU 275 278 278 GLU GLU A . n 
A 1 276 TRP 276 279 279 TRP TRP A . n 
A 1 277 ASN 277 280 280 ASN ASN A . n 
A 1 278 VAL 278 281 281 VAL VAL A . n 
A 1 279 LEU 279 282 282 LEU LEU A . n 
A 1 280 PRO 280 283 283 PRO PRO A . n 
A 1 281 PHE 281 284 284 PHE PHE A . n 
A 1 282 ASP 282 285 285 ASP ASP A . n 
A 1 283 SER 283 286 286 SER SER A . n 
A 1 284 ILE 284 287 287 ILE ILE A . n 
A 1 285 PHE 285 288 288 PHE PHE A . n 
A 1 286 ARG 286 289 289 ARG ARG A . n 
A 1 287 PHE 287 290 290 PHE PHE A . n 
A 1 288 SER 288 291 291 SER SER A . n 
A 1 289 PHE 289 292 292 PHE PHE A . n 
A 1 290 VAL 290 293 293 VAL VAL A . n 
A 1 291 PRO 291 294 294 PRO PRO A . n 
A 1 292 VAL 292 295 295 VAL VAL A . n 
A 1 293 ILE 293 296 296 ILE ILE A . n 
A 1 294 ASP 294 297 297 ASP ASP A . n 
A 1 295 GLY 295 298 298 GLY GLY A . n 
A 1 296 GLU 296 299 299 GLU GLU A . n 
A 1 297 PHE 297 300 300 PHE PHE A . n 
A 1 298 PHE 298 301 301 PHE PHE A . n 
A 1 299 PRO 299 302 302 PRO PRO A . n 
A 1 300 THR 300 303 303 THR THR A . n 
A 1 301 SER 301 304 304 SER SER A . n 
A 1 302 LEU 302 305 305 LEU LEU A . n 
A 1 303 GLU 303 306 306 GLU GLU A . n 
A 1 304 SER 304 307 307 SER SER A . n 
A 1 305 MET 305 308 308 MET MET A . n 
A 1 306 LEU 306 309 309 LEU LEU A . n 
A 1 307 ASN 307 310 310 ASN ASN A . n 
A 1 308 SER 308 311 311 SER SER A . n 
A 1 309 GLY 309 312 312 GLY GLY A . n 
A 1 310 ASN 310 313 313 ASN ASN A . n 
A 1 311 PHE 311 314 314 PHE PHE A . n 
A 1 312 LYS 312 315 315 LYS LYS A . n 
A 1 313 LYS 313 316 316 LYS LYS A . n 
A 1 314 THR 314 317 317 THR THR A . n 
A 1 315 GLN 315 318 318 GLN GLN A . n 
A 1 316 ILE 316 319 319 ILE ILE A . n 
A 1 317 LEU 317 320 320 LEU LEU A . n 
A 1 318 LEU 318 321 321 LEU LEU A . n 
A 1 319 GLY 319 322 322 GLY GLY A . n 
A 1 320 VAL 320 323 323 VAL VAL A . n 
A 1 321 ASN 321 324 324 ASN ASN A . n 
A 1 322 LYS 322 325 325 LYS LYS A . n 
A 1 323 ASP 323 326 326 ASP ASP A . n 
A 1 324 GLU 324 327 327 GLU GLU A . n 
A 1 325 GLY 325 328 328 GLY GLY A . n 
A 1 326 SER 326 329 329 SER SER A . n 
A 1 327 PHE 327 330 330 PHE PHE A . n 
A 1 328 PHE 328 331 331 PHE PHE A . n 
A 1 329 LEU 329 332 332 LEU LEU A . n 
A 1 330 LEU 330 333 333 LEU LEU A . n 
A 1 331 TYR 331 334 334 TYR TYR A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 ALA 333 336 336 ALA ALA A . n 
A 1 334 PRO 334 337 337 PRO PRO A . n 
A 1 335 GLY 335 338 338 GLY GLY A . n 
A 1 336 PHE 336 339 339 PHE PHE A . n 
A 1 337 SER 337 340 340 SER SER A . n 
A 1 338 LYS 338 341 341 LYS LYS A . n 
A 1 339 ASP 339 342 342 ASP ASP A . n 
A 1 340 SER 340 343 343 SER SER A . n 
A 1 341 GLU 341 344 344 GLU GLU A . n 
A 1 342 SER 342 345 345 SER SER A . n 
A 1 343 LYS 343 346 346 LYS LYS A . n 
A 1 344 ILE 344 347 347 ILE ILE A . n 
A 1 345 SER 345 348 348 SER SER A . n 
A 1 346 ARG 346 349 349 ARG ARG A . n 
A 1 347 GLU 347 350 350 GLU GLU A . n 
A 1 348 ASP 348 351 351 ASP ASP A . n 
A 1 349 PHE 349 352 352 PHE PHE A . n 
A 1 350 MET 350 353 353 MET MET A . n 
A 1 351 SER 351 354 354 SER SER A . n 
A 1 352 GLY 352 355 355 GLY GLY A . n 
A 1 353 VAL 353 356 356 VAL VAL A . n 
A 1 354 LYS 354 357 357 LYS LYS A . n 
A 1 355 LEU 355 358 358 LEU LEU A . n 
A 1 356 SER 356 359 359 SER SER A . n 
A 1 357 VAL 357 360 360 VAL VAL A . n 
A 1 358 PRO 358 361 361 PRO PRO A . n 
A 1 359 HIS 359 362 362 HIS HIS A . n 
A 1 360 ALA 360 363 363 ALA ALA A . n 
A 1 361 ASN 361 364 364 ASN ASN A . n 
A 1 362 ASP 362 365 365 ASP ASP A . n 
A 1 363 LEU 363 366 366 LEU LEU A . n 
A 1 364 GLY 364 367 367 GLY GLY A . n 
A 1 365 LEU 365 368 368 LEU LEU A . n 
A 1 366 ASP 366 369 369 ASP ASP A . n 
A 1 367 ALA 367 370 370 ALA ALA A . n 
A 1 368 VAL 368 371 371 VAL VAL A . n 
A 1 369 THR 369 372 372 THR THR A . n 
A 1 370 LEU 370 373 373 LEU LEU A . n 
A 1 371 GLN 371 374 374 GLN GLN A . n 
A 1 372 TYR 372 375 375 TYR TYR A . n 
A 1 373 THR 373 376 376 THR THR A . n 
A 1 374 ASP 374 377 377 ASP ASP A . n 
A 1 375 TRP 375 378 378 TRP TRP A . n 
A 1 376 MET 376 379 379 MET MET A . n 
A 1 377 ASP 377 380 380 ASP ASP A . n 
A 1 378 ASP 378 381 381 ASP ASP A . n 
A 1 379 ASN 379 382 382 ASN ASN A . n 
A 1 380 ASN 380 383 383 ASN ASN A . n 
A 1 381 GLY 381 384 384 GLY GLY A . n 
A 1 382 ILE 382 385 385 ILE ILE A . n 
A 1 383 LYS 383 386 386 LYS LYS A . n 
A 1 384 ASN 384 387 387 ASN ASN A . n 
A 1 385 ARG 385 388 388 ARG ARG A . n 
A 1 386 ASP 386 389 389 ASP ASP A . n 
A 1 387 GLY 387 390 390 GLY GLY A . n 
A 1 388 LEU 388 391 391 LEU LEU A . n 
A 1 389 ASP 389 392 392 ASP ASP A . n 
A 1 390 ASP 390 393 393 ASP ASP A . n 
A 1 391 ILE 391 394 394 ILE ILE A . n 
A 1 392 VAL 392 395 395 VAL VAL A . n 
A 1 393 GLY 393 396 396 GLY GLY A . n 
A 1 394 ASP 394 397 397 ASP ASP A . n 
A 1 395 HIS 395 398 398 HIS HIS A . n 
A 1 396 ASN 396 399 399 ASN ASN A . n 
A 1 397 VAL 397 400 400 VAL VAL A . n 
A 1 398 ILE 398 401 401 ILE ILE A . n 
A 1 399 CYS 399 402 402 CYS CYS A . n 
A 1 400 PRO 400 403 403 PRO PRO A . n 
A 1 401 LEU 401 404 404 LEU LEU A . n 
A 1 402 MET 402 405 405 MET MET A . n 
A 1 403 HIS 403 406 406 HIS HIS A . n 
A 1 404 PHE 404 407 407 PHE PHE A . n 
A 1 405 VAL 405 408 408 VAL VAL A . n 
A 1 406 ASN 406 409 409 ASN ASN A . n 
A 1 407 LYS 407 410 410 LYS LYS A . n 
A 1 408 TYR 408 411 411 TYR TYR A . n 
A 1 409 THR 409 412 412 THR THR A . n 
A 1 410 LYS 410 413 413 LYS LYS A . n 
A 1 411 PHE 411 414 414 PHE PHE A . n 
A 1 412 GLY 412 415 415 GLY GLY A . n 
A 1 413 ASN 413 416 416 ASN ASN A . n 
A 1 414 GLY 414 417 417 GLY GLY A . n 
A 1 415 THR 415 418 418 THR THR A . n 
A 1 416 TYR 416 419 419 TYR TYR A . n 
A 1 417 LEU 417 420 420 LEU LEU A . n 
A 1 418 TYR 418 421 421 TYR TYR A . n 
A 1 419 PHE 419 422 422 PHE PHE A . n 
A 1 420 PHE 420 423 423 PHE PHE A . n 
A 1 421 ASN 421 424 424 ASN ASN A . n 
A 1 422 HIS 422 425 425 HIS HIS A . n 
A 1 423 ARG 423 426 426 ARG ARG A . n 
A 1 424 ALA 424 427 427 ALA ALA A . n 
A 1 425 SER 425 428 428 SER SER A . n 
A 1 426 ASN 426 429 429 ASN ASN A . n 
A 1 427 LEU 427 430 430 LEU LEU A . n 
A 1 428 VAL 428 431 431 VAL VAL A . n 
A 1 429 TRP 429 432 432 TRP TRP A . n 
A 1 430 PRO 430 433 433 PRO PRO A . n 
A 1 431 GLU 431 434 434 GLU GLU A . n 
A 1 432 TRP 432 435 435 TRP TRP A . n 
A 1 433 MET 433 436 436 MET MET A . n 
A 1 434 GLY 434 437 437 GLY GLY A . n 
A 1 435 VAL 435 438 438 VAL VAL A . n 
A 1 436 ILE 436 439 439 ILE ILE A . n 
A 1 437 HIS 437 440 440 HIS HIS A . n 
A 1 438 GLY 438 441 441 GLY GLY A . n 
A 1 439 TYR 439 442 442 TYR TYR A . n 
A 1 440 GLU 440 443 443 GLU GLU A . n 
A 1 441 ILE 441 444 444 ILE ILE A . n 
A 1 442 GLU 442 445 445 GLU GLU A . n 
A 1 443 PHE 443 446 446 PHE PHE A . n 
A 1 444 VAL 444 447 447 VAL VAL A . n 
A 1 445 PHE 445 448 448 PHE PHE A . n 
A 1 446 GLY 446 449 449 GLY GLY A . n 
A 1 447 LEU 447 450 450 LEU LEU A . n 
A 1 448 PRO 448 451 451 PRO PRO A . n 
A 1 449 LEU 449 452 452 LEU LEU A . n 
A 1 450 VAL 450 453 453 VAL VAL A . n 
A 1 451 LYS 451 454 454 LYS LYS A . n 
A 1 452 GLU 452 455 455 GLU GLU A . n 
A 1 453 LEU 453 456 456 LEU LEU A . n 
A 1 454 ASN 454 457 457 ASN ASN A . n 
A 1 455 TYR 455 458 458 TYR TYR A . n 
A 1 456 THR 456 459 459 THR THR A . n 
A 1 457 ALA 457 460 460 ALA ALA A . n 
A 1 458 GLU 458 461 461 GLU GLU A . n 
A 1 459 GLU 459 462 462 GLU GLU A . n 
A 1 460 GLU 460 463 463 GLU GLU A . n 
A 1 461 ALA 461 464 464 ALA ALA A . n 
A 1 462 LEU 462 465 465 LEU LEU A . n 
A 1 463 SER 463 466 466 SER SER A . n 
A 1 464 ARG 464 467 467 ARG ARG A . n 
A 1 465 ARG 465 468 468 ARG ARG A . n 
A 1 466 ILE 466 469 469 ILE ILE A . n 
A 1 467 MET 467 470 470 MET MET A . n 
A 1 468 HIS 468 471 471 HIS HIS A . n 
A 1 469 TYR 469 472 472 TYR TYR A . n 
A 1 470 TRP 470 473 473 TRP TRP A . n 
A 1 471 ALA 471 474 474 ALA ALA A . n 
A 1 472 THR 472 475 475 THR THR A . n 
A 1 473 PHE 473 476 476 PHE PHE A . n 
A 1 474 ALA 474 477 477 ALA ALA A . n 
A 1 475 LYS 475 478 478 LYS LYS A . n 
A 1 476 THR 476 479 479 THR THR A . n 
A 1 477 GLY 477 480 480 GLY GLY A . n 
A 1 478 ASN 478 481 481 ASN ASN A . n 
A 1 479 PRO 479 482 482 PRO PRO A . n 
A 1 480 ASN 480 483 483 ASN ASN A . n 
A 1 481 GLU 481 484 484 GLU GLU A . n 
A 1 482 PRO 482 485 485 PRO PRO A . n 
A 1 483 HIS 483 486 486 HIS HIS A . n 
A 1 484 SER 484 487 487 SER SER A . n 
A 1 485 GLN 485 488 488 GLN GLN A . n 
A 1 486 GLU 486 489 489 GLU GLU A . n 
A 1 487 SER 487 490 490 SER SER A . n 
A 1 488 LYS 488 491 491 LYS LYS A . n 
A 1 489 TRP 489 492 492 TRP TRP A . n 
A 1 490 PRO 490 493 493 PRO PRO A . n 
A 1 491 LEU 491 494 494 LEU LEU A . n 
A 1 492 PHE 492 495 495 PHE PHE A . n 
A 1 493 THR 493 496 496 THR THR A . n 
A 1 494 THR 494 497 497 THR THR A . n 
A 1 495 LYS 495 498 498 LYS LYS A . n 
A 1 496 GLU 496 499 499 GLU GLU A . n 
A 1 497 GLN 497 500 500 GLN GLN A . n 
A 1 498 LYS 498 501 501 LYS LYS A . n 
A 1 499 PHE 499 502 502 PHE PHE A . n 
A 1 500 ILE 500 503 503 ILE ILE A . n 
A 1 501 ASP 501 504 504 ASP ASP A . n 
A 1 502 LEU 502 505 505 LEU LEU A . n 
A 1 503 ASN 503 506 506 ASN ASN A . n 
A 1 504 THR 504 507 507 THR THR A . n 
A 1 505 GLU 505 508 508 GLU GLU A . n 
A 1 506 PRO 506 509 509 PRO PRO A . n 
A 1 507 MET 507 510 510 MET MET A . n 
A 1 508 LYS 508 511 511 LYS LYS A . n 
A 1 509 VAL 509 512 512 VAL VAL A . n 
A 1 510 HIS 510 513 513 HIS HIS A . n 
A 1 511 GLN 511 514 514 GLN GLN A . n 
A 1 512 ARG 512 515 515 ARG ARG A . n 
A 1 513 LEU 513 516 516 LEU LEU A . n 
A 1 514 ARG 514 517 517 ARG ARG A . n 
A 1 515 VAL 515 518 518 VAL VAL A . n 
A 1 516 GLN 516 519 519 GLN GLN A . n 
A 1 517 MET 517 520 520 MET MET A . n 
A 1 518 CYS 518 521 521 CYS CYS A . n 
A 1 519 VAL 519 522 522 VAL VAL A . n 
A 1 520 PHE 520 523 523 PHE PHE A . n 
A 1 521 TRP 521 524 524 TRP TRP A . n 
A 1 522 ASN 522 525 525 ASN ASN A . n 
A 1 523 GLN 523 526 526 GLN GLN A . n 
A 1 524 PHE 524 527 527 PHE PHE A . n 
A 1 525 LEU 525 528 528 LEU LEU A . n 
A 1 526 PRO 526 529 529 PRO PRO A . n 
A 1 527 LYS 527 530 530 LYS LYS A . n 
A 1 528 LEU 528 531 531 LEU LEU A . n 
A 1 529 LEU 529 532 532 LEU LEU A . n 
A 1 530 ASN 530 533 533 ASN ASN A . n 
A 1 531 ALA 531 534 534 ALA ALA A . n 
A 1 532 THR 532 535 535 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1996 1996 NAG NAG A . 
C 2 NAG 1   1997 1997 NAG NAG A . 
D 3 SAF 1   1998 1998 SAF SAF A . 
E 4 EMM 1   1999 1999 EMM EMM A . 
F 5 HOH 1   2001 2001 HOH HOH A . 
F 5 HOH 2   2002 2002 HOH HOH A . 
F 5 HOH 3   2003 2003 HOH HOH A . 
F 5 HOH 4   2004 2004 HOH HOH A . 
F 5 HOH 5   2005 2005 HOH HOH A . 
F 5 HOH 6   2006 2006 HOH HOH A . 
F 5 HOH 7   2007 2007 HOH HOH A . 
F 5 HOH 8   2008 2008 HOH HOH A . 
F 5 HOH 9   2009 2009 HOH HOH A . 
F 5 HOH 10  2010 2010 HOH HOH A . 
F 5 HOH 11  2011 2011 HOH HOH A . 
F 5 HOH 12  2012 2012 HOH HOH A . 
F 5 HOH 13  2013 2013 HOH HOH A . 
F 5 HOH 14  2014 2014 HOH HOH A . 
F 5 HOH 15  2015 2015 HOH HOH A . 
F 5 HOH 16  2016 2016 HOH HOH A . 
F 5 HOH 17  2017 2017 HOH HOH A . 
F 5 HOH 18  2018 2018 HOH HOH A . 
F 5 HOH 19  2019 2019 HOH HOH A . 
F 5 HOH 20  2020 2020 HOH HOH A . 
F 5 HOH 21  2021 2021 HOH HOH A . 
F 5 HOH 22  2022 2022 HOH HOH A . 
F 5 HOH 23  2023 2023 HOH HOH A . 
F 5 HOH 24  2024 2024 HOH HOH A . 
F 5 HOH 25  2025 2025 HOH HOH A . 
F 5 HOH 26  2026 2026 HOH HOH A . 
F 5 HOH 27  2027 2027 HOH HOH A . 
F 5 HOH 28  2028 2028 HOH HOH A . 
F 5 HOH 29  2029 2029 HOH HOH A . 
F 5 HOH 30  2030 2030 HOH HOH A . 
F 5 HOH 31  2031 2031 HOH HOH A . 
F 5 HOH 32  2032 2032 HOH HOH A . 
F 5 HOH 33  2033 2033 HOH HOH A . 
F 5 HOH 34  2034 2034 HOH HOH A . 
F 5 HOH 35  2035 2035 HOH HOH A . 
F 5 HOH 36  2036 2036 HOH HOH A . 
F 5 HOH 37  2037 2037 HOH HOH A . 
F 5 HOH 38  2038 2038 HOH HOH A . 
F 5 HOH 39  2039 2039 HOH HOH A . 
F 5 HOH 40  2040 2040 HOH HOH A . 
F 5 HOH 41  2041 2041 HOH HOH A . 
F 5 HOH 42  2042 2042 HOH HOH A . 
F 5 HOH 43  2043 2043 HOH HOH A . 
F 5 HOH 44  2044 2044 HOH HOH A . 
F 5 HOH 45  2045 2045 HOH HOH A . 
F 5 HOH 46  2046 2046 HOH HOH A . 
F 5 HOH 47  2047 2047 HOH HOH A . 
F 5 HOH 48  2048 2048 HOH HOH A . 
F 5 HOH 49  2049 2049 HOH HOH A . 
F 5 HOH 50  2050 2050 HOH HOH A . 
F 5 HOH 51  2051 2051 HOH HOH A . 
F 5 HOH 52  2052 2052 HOH HOH A . 
F 5 HOH 53  2053 2053 HOH HOH A . 
F 5 HOH 54  2054 2054 HOH HOH A . 
F 5 HOH 55  2055 2055 HOH HOH A . 
F 5 HOH 56  2056 2056 HOH HOH A . 
F 5 HOH 57  2057 2057 HOH HOH A . 
F 5 HOH 58  2058 2058 HOH HOH A . 
F 5 HOH 59  2059 2059 HOH HOH A . 
F 5 HOH 60  2060 2060 HOH HOH A . 
F 5 HOH 61  2061 2061 HOH HOH A . 
F 5 HOH 62  2062 2062 HOH HOH A . 
F 5 HOH 63  2063 2063 HOH HOH A . 
F 5 HOH 64  2064 2064 HOH HOH A . 
F 5 HOH 65  2065 2065 HOH HOH A . 
F 5 HOH 66  2066 2066 HOH HOH A . 
F 5 HOH 67  2067 2067 HOH HOH A . 
F 5 HOH 68  2068 2068 HOH HOH A . 
F 5 HOH 69  2069 2069 HOH HOH A . 
F 5 HOH 70  2070 2070 HOH HOH A . 
F 5 HOH 71  2071 2071 HOH HOH A . 
F 5 HOH 72  2072 2072 HOH HOH A . 
F 5 HOH 73  2073 2073 HOH HOH A . 
F 5 HOH 74  2074 2074 HOH HOH A . 
F 5 HOH 75  2075 2075 HOH HOH A . 
F 5 HOH 76  2076 2076 HOH HOH A . 
F 5 HOH 77  2077 2077 HOH HOH A . 
F 5 HOH 78  2078 2078 HOH HOH A . 
F 5 HOH 79  2079 2079 HOH HOH A . 
F 5 HOH 80  2080 2080 HOH HOH A . 
F 5 HOH 81  2081 2081 HOH HOH A . 
F 5 HOH 82  2082 2082 HOH HOH A . 
F 5 HOH 83  2083 2083 HOH HOH A . 
F 5 HOH 84  2084 2084 HOH HOH A . 
F 5 HOH 85  2085 2085 HOH HOH A . 
F 5 HOH 86  2086 2086 HOH HOH A . 
F 5 HOH 87  2087 2087 HOH HOH A . 
F 5 HOH 88  2088 2088 HOH HOH A . 
F 5 HOH 89  2089 2089 HOH HOH A . 
F 5 HOH 90  2090 2090 HOH HOH A . 
F 5 HOH 91  2091 2091 HOH HOH A . 
F 5 HOH 92  2092 2092 HOH HOH A . 
F 5 HOH 93  2093 2093 HOH HOH A . 
F 5 HOH 94  2094 2094 HOH HOH A . 
F 5 HOH 95  2095 2095 HOH HOH A . 
F 5 HOH 96  2096 2096 HOH HOH A . 
F 5 HOH 97  2097 2097 HOH HOH A . 
F 5 HOH 98  2098 2098 HOH HOH A . 
F 5 HOH 99  2099 2099 HOH HOH A . 
F 5 HOH 100 2100 2100 HOH HOH A . 
F 5 HOH 101 2101 2101 HOH HOH A . 
F 5 HOH 102 2102 2102 HOH HOH A . 
F 5 HOH 103 2103 2103 HOH HOH A . 
F 5 HOH 104 2104 2104 HOH HOH A . 
F 5 HOH 105 2105 2105 HOH HOH A . 
F 5 HOH 106 2106 2106 HOH HOH A . 
F 5 HOH 107 2107 2107 HOH HOH A . 
F 5 HOH 108 2108 2108 HOH HOH A . 
F 5 HOH 109 2109 2109 HOH HOH A . 
F 5 HOH 110 2110 2110 HOH HOH A . 
F 5 HOH 111 2111 2111 HOH HOH A . 
F 5 HOH 112 2112 2112 HOH HOH A . 
F 5 HOH 113 2113 2113 HOH HOH A . 
F 5 HOH 114 2114 2114 HOH HOH A . 
F 5 HOH 115 2115 2115 HOH HOH A . 
F 5 HOH 116 2116 2116 HOH HOH A . 
F 5 HOH 117 2117 2117 HOH HOH A . 
F 5 HOH 118 2118 2118 HOH HOH A . 
F 5 HOH 119 2119 2119 HOH HOH A . 
F 5 HOH 120 2120 2120 HOH HOH A . 
F 5 HOH 121 2121 2121 HOH HOH A . 
F 5 HOH 122 2122 2122 HOH HOH A . 
F 5 HOH 123 2123 2123 HOH HOH A . 
F 5 HOH 124 2124 2124 HOH HOH A . 
F 5 HOH 125 2125 2125 HOH HOH A . 
F 5 HOH 126 2126 2126 HOH HOH A . 
F 5 HOH 127 2127 2127 HOH HOH A . 
F 5 HOH 128 2128 2128 HOH HOH A . 
F 5 HOH 129 2129 2129 HOH HOH A . 
F 5 HOH 130 2130 2130 HOH HOH A . 
F 5 HOH 131 2131 2131 HOH HOH A . 
F 5 HOH 132 2132 2132 HOH HOH A . 
F 5 HOH 133 2133 2133 HOH HOH A . 
F 5 HOH 134 2134 2134 HOH HOH A . 
F 5 HOH 135 2135 2135 HOH HOH A . 
F 5 HOH 136 2136 2136 HOH HOH A . 
F 5 HOH 137 2137 2137 HOH HOH A . 
F 5 HOH 138 2138 2138 HOH HOH A . 
F 5 HOH 139 2139 2139 HOH HOH A . 
F 5 HOH 140 2140 2140 HOH HOH A . 
F 5 HOH 141 2141 2141 HOH HOH A . 
F 5 HOH 142 2142 2142 HOH HOH A . 
F 5 HOH 143 2143 2143 HOH HOH A . 
F 5 HOH 144 2144 2144 HOH HOH A . 
F 5 HOH 145 2145 2145 HOH HOH A . 
F 5 HOH 146 2146 2146 HOH HOH A . 
F 5 HOH 147 2147 2147 HOH HOH A . 
F 5 HOH 148 2148 2148 HOH HOH A . 
F 5 HOH 149 2149 2149 HOH HOH A . 
F 5 HOH 150 2150 2150 HOH HOH A . 
F 5 HOH 151 2151 2151 HOH HOH A . 
F 5 HOH 152 2152 2152 HOH HOH A . 
F 5 HOH 153 2153 2153 HOH HOH A . 
F 5 HOH 154 2154 2154 HOH HOH A . 
F 5 HOH 155 2155 2155 HOH HOH A . 
F 5 HOH 156 2156 2156 HOH HOH A . 
F 5 HOH 157 2157 2157 HOH HOH A . 
F 5 HOH 158 2158 2158 HOH HOH A . 
F 5 HOH 159 2159 2159 HOH HOH A . 
F 5 HOH 160 2160 2160 HOH HOH A . 
F 5 HOH 161 2161 2161 HOH HOH A . 
F 5 HOH 162 2162 2162 HOH HOH A . 
F 5 HOH 163 2163 2163 HOH HOH A . 
F 5 HOH 164 2164 2164 HOH HOH A . 
F 5 HOH 165 2165 2165 HOH HOH A . 
F 5 HOH 166 2166 2166 HOH HOH A . 
F 5 HOH 167 2167 2167 HOH HOH A . 
F 5 HOH 168 2168 2168 HOH HOH A . 
F 5 HOH 169 2169 2169 HOH HOH A . 
F 5 HOH 170 2170 2170 HOH HOH A . 
F 5 HOH 171 2171 2171 HOH HOH A . 
F 5 HOH 172 2172 2172 HOH HOH A . 
F 5 HOH 173 2173 2173 HOH HOH A . 
F 5 HOH 174 2174 2174 HOH HOH A . 
F 5 HOH 175 2175 2175 HOH HOH A . 
F 5 HOH 176 2176 2176 HOH HOH A . 
F 5 HOH 177 2177 2177 HOH HOH A . 
F 5 HOH 178 2178 2178 HOH HOH A . 
F 5 HOH 179 2179 2179 HOH HOH A . 
F 5 HOH 180 2180 2180 HOH HOH A . 
F 5 HOH 181 2181 2181 HOH HOH A . 
F 5 HOH 182 2182 2182 HOH HOH A . 
F 5 HOH 183 2183 2183 HOH HOH A . 
F 5 HOH 184 2184 2184 HOH HOH A . 
F 5 HOH 185 2185 2185 HOH HOH A . 
F 5 HOH 186 2186 2186 HOH HOH A . 
F 5 HOH 187 2187 2187 HOH HOH A . 
F 5 HOH 188 2188 2188 HOH HOH A . 
F 5 HOH 189 2189 2189 HOH HOH A . 
F 5 HOH 190 2190 2190 HOH HOH A . 
F 5 HOH 191 2191 2191 HOH HOH A . 
F 5 HOH 192 2192 2192 HOH HOH A . 
F 5 HOH 193 2193 2193 HOH HOH A . 
F 5 HOH 194 2194 2194 HOH HOH A . 
F 5 HOH 195 2195 2195 HOH HOH A . 
F 5 HOH 196 2196 2196 HOH HOH A . 
F 5 HOH 197 2197 2197 HOH HOH A . 
F 5 HOH 198 2198 2198 HOH HOH A . 
F 5 HOH 199 2199 2199 HOH HOH A . 
F 5 HOH 200 2200 2200 HOH HOH A . 
F 5 HOH 201 2201 2201 HOH HOH A . 
F 5 HOH 202 2202 2202 HOH HOH A . 
F 5 HOH 203 2203 2203 HOH HOH A . 
F 5 HOH 204 2204 2204 HOH HOH A . 
F 5 HOH 205 2205 2205 HOH HOH A . 
F 5 HOH 206 2206 2206 HOH HOH A . 
F 5 HOH 207 2207 2207 HOH HOH A . 
F 5 HOH 208 2208 2208 HOH HOH A . 
F 5 HOH 209 2209 2209 HOH HOH A . 
F 5 HOH 210 2210 2210 HOH HOH A . 
F 5 HOH 211 2211 2211 HOH HOH A . 
F 5 HOH 212 2212 2212 HOH HOH A . 
F 5 HOH 213 2213 2213 HOH HOH A . 
F 5 HOH 214 2214 2214 HOH HOH A . 
F 5 HOH 215 2215 2215 HOH HOH A . 
F 5 HOH 216 2216 2216 HOH HOH A . 
F 5 HOH 217 2217 2217 HOH HOH A . 
F 5 HOH 218 2218 2218 HOH HOH A . 
F 5 HOH 219 2219 2219 HOH HOH A . 
F 5 HOH 220 2220 2220 HOH HOH A . 
F 5 HOH 221 2221 2221 HOH HOH A . 
F 5 HOH 222 2222 2222 HOH HOH A . 
F 5 HOH 223 2223 2223 HOH HOH A . 
F 5 HOH 224 2224 2224 HOH HOH A . 
F 5 HOH 225 2225 2225 HOH HOH A . 
F 5 HOH 226 2226 2226 HOH HOH A . 
F 5 HOH 227 2227 2227 HOH HOH A . 
F 5 HOH 228 2228 2228 HOH HOH A . 
F 5 HOH 229 2229 2229 HOH HOH A . 
F 5 HOH 230 2230 2230 HOH HOH A . 
F 5 HOH 231 2231 2231 HOH HOH A . 
F 5 HOH 232 2232 2232 HOH HOH A . 
F 5 HOH 233 2233 2233 HOH HOH A . 
F 5 HOH 234 2234 2234 HOH HOH A . 
F 5 HOH 235 2235 2235 HOH HOH A . 
F 5 HOH 236 2236 2236 HOH HOH A . 
F 5 HOH 237 2237 2237 HOH HOH A . 
F 5 HOH 238 2238 2238 HOH HOH A . 
F 5 HOH 239 2239 2239 HOH HOH A . 
F 5 HOH 240 2240 2240 HOH HOH A . 
F 5 HOH 241 2241 2241 HOH HOH A . 
F 5 HOH 242 2242 2242 HOH HOH A . 
F 5 HOH 243 2243 2243 HOH HOH A . 
F 5 HOH 244 2244 2244 HOH HOH A . 
F 5 HOH 245 2245 2245 HOH HOH A . 
F 5 HOH 246 2246 2246 HOH HOH A . 
F 5 HOH 247 2247 2247 HOH HOH A . 
F 5 HOH 248 2248 2248 HOH HOH A . 
F 5 HOH 249 2249 2249 HOH HOH A . 
F 5 HOH 250 2250 2250 HOH HOH A . 
F 5 HOH 251 2251 2251 HOH HOH A . 
F 5 HOH 252 2252 2252 HOH HOH A . 
F 5 HOH 253 2253 2253 HOH HOH A . 
F 5 HOH 254 2254 2254 HOH HOH A . 
F 5 HOH 255 2255 2255 HOH HOH A . 
F 5 HOH 256 2256 2256 HOH HOH A . 
F 5 HOH 257 2257 2257 HOH HOH A . 
F 5 HOH 258 2258 2258 HOH HOH A . 
F 5 HOH 259 2259 2259 HOH HOH A . 
F 5 HOH 260 2260 2260 HOH HOH A . 
F 5 HOH 261 2261 2261 HOH HOH A . 
F 5 HOH 262 2262 2262 HOH HOH A . 
F 5 HOH 263 2263 2263 HOH HOH A . 
F 5 HOH 264 2264 2264 HOH HOH A . 
F 5 HOH 265 2265 2265 HOH HOH A . 
F 5 HOH 266 2266 2266 HOH HOH A . 
F 5 HOH 267 2267 2267 HOH HOH A . 
F 5 HOH 268 2268 2268 HOH HOH A . 
F 5 HOH 269 2269 2269 HOH HOH A . 
F 5 HOH 270 2270 2270 HOH HOH A . 
F 5 HOH 271 2271 2271 HOH HOH A . 
F 5 HOH 272 2272 2272 HOH HOH A . 
F 5 HOH 273 2273 2273 HOH HOH A . 
F 5 HOH 274 2274 2274 HOH HOH A . 
F 5 HOH 275 2275 2275 HOH HOH A . 
F 5 HOH 276 2276 2276 HOH HOH A . 
F 5 HOH 277 2277 2277 HOH HOH A . 
F 5 HOH 278 2278 2278 HOH HOH A . 
F 5 HOH 279 2279 2279 HOH HOH A . 
F 5 HOH 280 2280 2280 HOH HOH A . 
F 5 HOH 281 2281 2281 HOH HOH A . 
F 5 HOH 282 2282 2282 HOH HOH A . 
F 5 HOH 283 2283 2283 HOH HOH A . 
F 5 HOH 284 2284 2284 HOH HOH A . 
F 5 HOH 285 2285 2285 HOH HOH A . 
F 5 HOH 286 2286 2286 HOH HOH A . 
F 5 HOH 287 2287 2287 HOH HOH A . 
F 5 HOH 288 2288 2288 HOH HOH A . 
F 5 HOH 289 2289 2289 HOH HOH A . 
F 5 HOH 290 2290 2290 HOH HOH A . 
F 5 HOH 291 2291 2291 HOH HOH A . 
F 5 HOH 292 2292 2292 HOH HOH A . 
F 5 HOH 293 2293 2293 HOH HOH A . 
F 5 HOH 294 2294 2294 HOH HOH A . 
F 5 HOH 295 2295 2295 HOH HOH A . 
F 5 HOH 296 2296 2296 HOH HOH A . 
F 5 HOH 297 2297 2297 HOH HOH A . 
F 5 HOH 298 2298 2298 HOH HOH A . 
F 5 HOH 299 2299 2299 HOH HOH A . 
F 5 HOH 300 2300 2300 HOH HOH A . 
F 5 HOH 301 2301 2301 HOH HOH A . 
F 5 HOH 302 2302 2302 HOH HOH A . 
F 5 HOH 303 2303 2303 HOH HOH A . 
F 5 HOH 304 2304 2304 HOH HOH A . 
F 5 HOH 305 2305 2305 HOH HOH A . 
F 5 HOH 306 2306 2306 HOH HOH A . 
F 5 HOH 307 2307 2307 HOH HOH A . 
F 5 HOH 308 2308 2308 HOH HOH A . 
F 5 HOH 309 2309 2309 HOH HOH A . 
F 5 HOH 310 2310 2310 HOH HOH A . 
F 5 HOH 311 2311 2311 HOH HOH A . 
F 5 HOH 312 2312 2312 HOH HOH A . 
F 5 HOH 313 2313 2313 HOH HOH A . 
F 5 HOH 314 2314 2314 HOH HOH A . 
F 5 HOH 315 2315 2315 HOH HOH A . 
F 5 HOH 316 2316 2316 HOH HOH A . 
F 5 HOH 317 2317 2317 HOH HOH A . 
F 5 HOH 318 2318 2318 HOH HOH A . 
F 5 HOH 319 2319 2319 HOH HOH A . 
F 5 HOH 320 2320 2320 HOH HOH A . 
F 5 HOH 321 2321 2321 HOH HOH A . 
F 5 HOH 322 2322 2322 HOH HOH A . 
F 5 HOH 323 2323 2323 HOH HOH A . 
F 5 HOH 324 2324 2324 HOH HOH A . 
F 5 HOH 325 2325 2325 HOH HOH A . 
F 5 HOH 326 2326 2326 HOH HOH A . 
F 5 HOH 327 2327 2327 HOH HOH A . 
F 5 HOH 328 2328 2328 HOH HOH A . 
F 5 HOH 329 2329 2329 HOH HOH A . 
F 5 HOH 330 2330 2330 HOH HOH A . 
F 5 HOH 331 2331 2331 HOH HOH A . 
F 5 HOH 332 2332 2332 HOH HOH A . 
F 5 HOH 333 2333 2333 HOH HOH A . 
F 5 HOH 334 2334 2334 HOH HOH A . 
F 5 HOH 335 2335 2335 HOH HOH A . 
F 5 HOH 336 2336 2336 HOH HOH A . 
F 5 HOH 337 2337 2337 HOH HOH A . 
F 5 HOH 338 2338 2338 HOH HOH A . 
F 5 HOH 339 2339 2339 HOH HOH A . 
F 5 HOH 340 2340 2340 HOH HOH A . 
F 5 HOH 341 2341 2341 HOH HOH A . 
F 5 HOH 342 2342 2342 HOH HOH A . 
F 5 HOH 343 2343 2343 HOH HOH A . 
F 5 HOH 344 2344 2344 HOH HOH A . 
F 5 HOH 345 2345 2345 HOH HOH A . 
F 5 HOH 346 2346 2346 HOH HOH A . 
F 5 HOH 347 2347 2347 HOH HOH A . 
F 5 HOH 348 2348 2348 HOH HOH A . 
F 5 HOH 349 2349 2349 HOH HOH A . 
F 5 HOH 350 2350 2350 HOH HOH A . 
F 5 HOH 351 2351 2351 HOH HOH A . 
F 5 HOH 352 2352 2352 HOH HOH A . 
F 5 HOH 353 2353 2353 HOH HOH A . 
F 5 HOH 354 2354 2354 HOH HOH A . 
F 5 HOH 355 2355 2355 HOH HOH A . 
F 5 HOH 356 2356 2356 HOH HOH A . 
F 5 HOH 357 2357 2357 HOH HOH A . 
F 5 HOH 358 2358 2358 HOH HOH A . 
F 5 HOH 359 2359 2359 HOH HOH A . 
F 5 HOH 360 2360 2360 HOH HOH A . 
F 5 HOH 361 2361 2361 HOH HOH A . 
F 5 HOH 362 2362 2362 HOH HOH A . 
F 5 HOH 363 2363 2363 HOH HOH A . 
F 5 HOH 364 2364 2364 HOH HOH A . 
F 5 HOH 365 2365 2365 HOH HOH A . 
F 5 HOH 366 2366 2366 HOH HOH A . 
F 5 HOH 367 2367 2367 HOH HOH A . 
F 5 HOH 368 2368 2368 HOH HOH A . 
F 5 HOH 369 2369 2369 HOH HOH A . 
F 5 HOH 370 2370 2370 HOH HOH A . 
F 5 HOH 371 2371 2371 HOH HOH A . 
F 5 HOH 372 2372 2372 HOH HOH A . 
F 5 HOH 373 2373 2373 HOH HOH A . 
F 5 HOH 374 2374 2374 HOH HOH A . 
F 5 HOH 375 2375 2375 HOH HOH A . 
F 5 HOH 376 2376 2376 HOH HOH A . 
F 5 HOH 377 2377 2377 HOH HOH A . 
F 5 HOH 378 2378 2378 HOH HOH A . 
F 5 HOH 379 2379 2379 HOH HOH A . 
F 5 HOH 380 2380 2380 HOH HOH A . 
F 5 HOH 381 2381 2381 HOH HOH A . 
F 5 HOH 382 2382 2382 HOH HOH A . 
F 5 HOH 383 2383 2383 HOH HOH A . 
F 5 HOH 384 2384 2384 HOH HOH A . 
F 5 HOH 385 2385 2385 HOH HOH A . 
F 5 HOH 386 2386 2386 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 56  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 413 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-15 
2 'Structure model' 1 1 2011-08-24 
3 'Structure model' 1 2 2018-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Non-polymer description'   
3 2 'Structure model' Other                       
4 2 'Structure model' 'Structure summary'         
5 2 'Structure model' 'Version format compliance' 
6 3 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_volume' 
2 3 'Structure model' '_citation.page_first'     
3 3 'Structure model' '_citation.page_last'      
4 3 'Structure model' '_citation.year'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       3.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
X-PLOR    phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASP 128 ? ? O A HOH 2108 ? ? 2.18 
2 1 NH1 A ARG 47  ? ? O A HOH 2029 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -130.72 -158.23 
2  1 PRO A 39  ? ? -73.80  41.13   
3  1 PHE A 45  ? ? 84.33   -14.59  
4  1 ALA A 60  ? ? -106.10 47.22   
5  1 CYS A 94  ? ? -142.85 12.62   
6  1 SER A 108 ? ? -163.79 72.89   
7  1 LEU A 158 ? ? -117.18 70.04   
8  1 SER A 200 ? ? 62.87   -118.03 
9  1 GLU A 299 ? ? -105.41 -71.28  
10 1 VAL A 360 ? ? -117.00 72.68   
11 1 HIS A 362 ? ? -112.08 60.83   
12 1 ASP A 380 ? ? -154.00 53.14   
13 1 VAL A 400 ? ? -129.86 -61.38  
14 1 HIS A 486 ? ? 53.99   82.20   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2038 ? 6.20 . 
2 1 O ? A HOH 2049 ? 5.96 . 
3 1 O ? A HOH 2102 ? 5.90 . 
4 1 O ? A HOH 2130 ? 6.98 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 42  ? CG  ? A ASN 39  CG  
2  1 Y 1 A ASN 42  ? OD1 ? A ASN 39  OD1 
3  1 Y 1 A ASN 42  ? ND2 ? A ASN 39  ND2 
4  1 Y 1 A ARG 46  ? CZ  ? A ARG 43  CZ  
5  1 Y 1 A ARG 46  ? NH1 ? A ARG 43  NH1 
6  1 Y 1 A ARG 46  ? NH2 ? A ARG 43  NH2 
7  1 Y 1 A LYS 52  ? NZ  ? A LYS 49  NZ  
8  1 Y 1 A SER 55  ? OG  ? A SER 52  OG  
9  1 Y 1 A GLU 89  ? CD  ? A GLU 86  CD  
10 1 Y 1 A GLU 89  ? OE1 ? A GLU 86  OE1 
11 1 Y 1 A GLU 89  ? OE2 ? A GLU 86  OE2 
12 1 Y 1 A GLN 162 ? OE1 ? A GLN 159 OE1 
13 1 Y 1 A GLN 162 ? NE2 ? A GLN 159 NE2 
14 1 Y 1 A LYS 192 ? CG  ? A LYS 189 CG  
15 1 Y 1 A LYS 192 ? CD  ? A LYS 189 CD  
16 1 Y 1 A LYS 192 ? CE  ? A LYS 189 CE  
17 1 Y 1 A LYS 192 ? NZ  ? A LYS 189 NZ  
18 1 Y 1 A ASN 257 ? OD1 ? A ASN 254 OD1 
19 1 Y 1 A ASN 257 ? ND2 ? A ASN 254 ND2 
20 1 Y 1 A LYS 270 ? CE  ? A LYS 267 CE  
21 1 Y 1 A LYS 270 ? NZ  ? A LYS 267 NZ  
22 1 Y 1 A LYS 357 ? CE  ? A LYS 354 CE  
23 1 Y 1 A LYS 357 ? NZ  ? A LYS 354 NZ  
24 1 Y 1 A LYS 454 ? CG  ? A LYS 451 CG  
25 1 Y 1 A LYS 454 ? CD  ? A LYS 451 CD  
26 1 Y 1 A LYS 454 ? CE  ? A LYS 451 CE  
27 1 Y 1 A LYS 454 ? NZ  ? A LYS 451 NZ  
28 1 Y 1 A HIS 486 ? CG  ? A HIS 483 CG  
29 1 Y 1 A HIS 486 ? ND1 ? A HIS 483 ND1 
30 1 Y 1 A HIS 486 ? CD2 ? A HIS 483 CD2 
31 1 Y 1 A HIS 486 ? CE1 ? A HIS 483 CE1 
32 1 Y 1 A HIS 486 ? NE2 ? A HIS 483 NE2 
33 1 Y 1 A GLN 488 ? CD  ? A GLN 485 CD  
34 1 Y 1 A GLN 488 ? OE1 ? A GLN 485 OE1 
35 1 Y 1 A GLN 488 ? NE2 ? A GLN 485 NE2 
36 1 Y 1 A SER 490 ? OG  ? A SER 487 OG  
37 1 Y 1 A LYS 491 ? CD  ? A LYS 488 CD  
38 1 Y 1 A LYS 491 ? CE  ? A LYS 488 CE  
39 1 Y 1 A LYS 491 ? NZ  ? A LYS 488 NZ  
40 1 Y 1 A LYS 498 ? CG  ? A LYS 495 CG  
41 1 Y 1 A LYS 498 ? CD  ? A LYS 495 CD  
42 1 Y 1 A LYS 498 ? CE  ? A LYS 495 CE  
43 1 Y 1 A LYS 498 ? NZ  ? A LYS 495 NZ  
44 1 Y 1 A GLN 526 ? CD  ? A GLN 523 CD  
45 1 Y 1 A GLN 526 ? OE1 ? A GLN 523 OE1 
46 1 Y 1 A GLN 526 ? NE2 ? A GLN 523 NE2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                  NAG 
3 '3-[(1S)-1-(DIMETHYLAMINO)ETHYL]PHENOL' SAF 
4 '[METHYL(VINYL)AMINO]METHANOL'          EMM 
5 water                                   HOH 
#