data_1GUX
# 
_entry.id   1GUX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GUX         
WWPDB D_1000173720 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GUX 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.O.'       1 
'Russo, A.A.'     2 
'Pavletich, N.P.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the retinoblastoma tumour-suppressor pocket domain bound to a peptide from HPV E7.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            391 
_citation.page_first                859 
_citation.page_last                 865 
_citation.year                      1998 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9495340 
_citation.pdbx_database_id_DOI      10.1038/36038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.O.'       1 
primary 'Russo, A.A.'     2 
primary 'Pavletich, N.P.' 3 
# 
_cell.entry_id           1GUX 
_cell.length_a           103.500 
_cell.length_b           76.800 
_cell.length_c           64.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GUX 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RETINOBLASTOMA PROTEIN' 25100.910 1   ? ? 'POCKET DOMAIN' ? 
2 polymer man 'RETINOBLASTOMA PROTEIN' 18265.477 1   ? ? 'POCKET DOMAIN' ? 
3 polymer nat ONCOPROTEIN              1160.255  1   ? ? ?               
'THE NINE RESIDUES OF PAPILLOMA VIRUS E7 PEPTIDE CONTAIN THE LXCXE MOTIF' 
4 water   nat water                    18.015    388 ? ? ?               ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;HTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVR
LYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKV
IESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESA
;
;HTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVR
LYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKV
IESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESA
;
A ? 
2 'polypeptide(L)' no no 
;FQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVK
NIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
;
;FQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVK
NIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
;
B ? 
3 'polypeptide(L)' no no DLYCYEQLN DLYCYEQLN E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   THR n 
1 3   PRO n 
1 4   VAL n 
1 5   ARG n 
1 6   THR n 
1 7   VAL n 
1 8   MET n 
1 9   ASN n 
1 10  THR n 
1 11  ILE n 
1 12  GLN n 
1 13  GLN n 
1 14  LEU n 
1 15  MET n 
1 16  MET n 
1 17  ILE n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  ALA n 
1 22  SER n 
1 23  ASP n 
1 24  GLN n 
1 25  PRO n 
1 26  SER n 
1 27  GLU n 
1 28  ASN n 
1 29  LEU n 
1 30  ILE n 
1 31  SER n 
1 32  TYR n 
1 33  PHE n 
1 34  ASN n 
1 35  ASN n 
1 36  CYS n 
1 37  THR n 
1 38  VAL n 
1 39  ASN n 
1 40  PRO n 
1 41  LYS n 
1 42  GLU n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  LYS n 
1 47  ARG n 
1 48  VAL n 
1 49  LYS n 
1 50  ASP n 
1 51  ILE n 
1 52  GLY n 
1 53  TYR n 
1 54  ILE n 
1 55  PHE n 
1 56  LYS n 
1 57  GLU n 
1 58  LYS n 
1 59  PHE n 
1 60  ALA n 
1 61  LYS n 
1 62  ALA n 
1 63  VAL n 
1 64  GLY n 
1 65  GLN n 
1 66  GLY n 
1 67  CYS n 
1 68  VAL n 
1 69  GLU n 
1 70  ILE n 
1 71  GLY n 
1 72  SER n 
1 73  GLN n 
1 74  ARG n 
1 75  TYR n 
1 76  LYS n 
1 77  LEU n 
1 78  GLY n 
1 79  VAL n 
1 80  ARG n 
1 81  LEU n 
1 82  TYR n 
1 83  TYR n 
1 84  ARG n 
1 85  VAL n 
1 86  MET n 
1 87  GLU n 
1 88  SER n 
1 89  MET n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  GLU n 
1 94  GLU n 
1 95  GLU n 
1 96  ARG n 
1 97  LEU n 
1 98  SER n 
1 99  ILE n 
1 100 GLN n 
1 101 ASN n 
1 102 PHE n 
1 103 SER n 
1 104 LYS n 
1 105 LEU n 
1 106 LEU n 
1 107 ASN n 
1 108 ASP n 
1 109 ASN n 
1 110 ILE n 
1 111 PHE n 
1 112 HIS n 
1 113 MET n 
1 114 SER n 
1 115 LEU n 
1 116 LEU n 
1 117 ALA n 
1 118 CYS n 
1 119 ALA n 
1 120 LEU n 
1 121 GLU n 
1 122 VAL n 
1 123 VAL n 
1 124 MET n 
1 125 ALA n 
1 126 THR n 
1 127 TYR n 
1 128 SER n 
1 129 ARG n 
1 130 SER n 
1 131 THR n 
1 132 SER n 
1 133 GLN n 
1 134 ASN n 
1 135 LEU n 
1 136 ASP n 
1 137 SER n 
1 138 GLY n 
1 139 THR n 
1 140 ASP n 
1 141 LEU n 
1 142 SER n 
1 143 PHE n 
1 144 PRO n 
1 145 TRP n 
1 146 ILE n 
1 147 LEU n 
1 148 ASN n 
1 149 VAL n 
1 150 LEU n 
1 151 ASN n 
1 152 LEU n 
1 153 LYS n 
1 154 ALA n 
1 155 PHE n 
1 156 ASP n 
1 157 PHE n 
1 158 TYR n 
1 159 LYS n 
1 160 VAL n 
1 161 ILE n 
1 162 GLU n 
1 163 SER n 
1 164 PHE n 
1 165 ILE n 
1 166 LYS n 
1 167 ALA n 
1 168 GLU n 
1 169 GLY n 
1 170 ASN n 
1 171 LEU n 
1 172 THR n 
1 173 ARG n 
1 174 GLU n 
1 175 MET n 
1 176 ILE n 
1 177 LYS n 
1 178 HIS n 
1 179 LEU n 
1 180 GLU n 
1 181 ARG n 
1 182 CYS n 
1 183 GLU n 
1 184 HIS n 
1 185 ARG n 
1 186 ILE n 
1 187 MET n 
1 188 GLU n 
1 189 SER n 
1 190 LEU n 
1 191 ALA n 
1 192 TRP n 
1 193 LEU n 
1 194 SER n 
1 195 ASP n 
1 196 SER n 
1 197 PRO n 
1 198 LEU n 
1 199 PHE n 
1 200 ASP n 
1 201 LEU n 
1 202 ILE n 
1 203 LYS n 
1 204 GLN n 
1 205 SER n 
1 206 LYS n 
1 207 ASP n 
1 208 ARG n 
1 209 GLU n 
1 210 GLY n 
1 211 PRO n 
1 212 THR n 
1 213 ASP n 
1 214 HIS n 
1 215 LEU n 
1 216 GLU n 
1 217 SER n 
1 218 ALA n 
2 1   PHE n 
2 2   GLN n 
2 3   THR n 
2 4   GLN n 
2 5   LYS n 
2 6   PRO n 
2 7   LEU n 
2 8   LYS n 
2 9   SER n 
2 10  THR n 
2 11  SER n 
2 12  LEU n 
2 13  SER n 
2 14  LEU n 
2 15  PHE n 
2 16  TYR n 
2 17  LYS n 
2 18  LYS n 
2 19  VAL n 
2 20  TYR n 
2 21  ARG n 
2 22  LEU n 
2 23  ALA n 
2 24  TYR n 
2 25  LEU n 
2 26  ARG n 
2 27  LEU n 
2 28  ASN n 
2 29  THR n 
2 30  LEU n 
2 31  CYS n 
2 32  GLU n 
2 33  ARG n 
2 34  LEU n 
2 35  LEU n 
2 36  SER n 
2 37  GLU n 
2 38  HIS n 
2 39  PRO n 
2 40  GLU n 
2 41  LEU n 
2 42  GLU n 
2 43  HIS n 
2 44  ILE n 
2 45  ILE n 
2 46  TRP n 
2 47  THR n 
2 48  LEU n 
2 49  PHE n 
2 50  GLN n 
2 51  HIS n 
2 52  THR n 
2 53  LEU n 
2 54  GLN n 
2 55  ASN n 
2 56  GLU n 
2 57  TYR n 
2 58  GLU n 
2 59  LEU n 
2 60  MET n 
2 61  ARG n 
2 62  ASP n 
2 63  ARG n 
2 64  HIS n 
2 65  LEU n 
2 66  ASP n 
2 67  GLN n 
2 68  ILE n 
2 69  MET n 
2 70  MET n 
2 71  CYS n 
2 72  SER n 
2 73  MET n 
2 74  TYR n 
2 75  GLY n 
2 76  ILE n 
2 77  CYS n 
2 78  LYS n 
2 79  VAL n 
2 80  LYS n 
2 81  ASN n 
2 82  ILE n 
2 83  ASP n 
2 84  LEU n 
2 85  LYS n 
2 86  PHE n 
2 87  LYS n 
2 88  ILE n 
2 89  ILE n 
2 90  VAL n 
2 91  THR n 
2 92  ALA n 
2 93  TYR n 
2 94  LYS n 
2 95  ASP n 
2 96  LEU n 
2 97  PRO n 
2 98  HIS n 
2 99  ALA n 
2 100 VAL n 
2 101 GLN n 
2 102 GLU n 
2 103 THR n 
2 104 PHE n 
2 105 LYS n 
2 106 ARG n 
2 107 VAL n 
2 108 LEU n 
2 109 ILE n 
2 110 LYS n 
2 111 GLU n 
2 112 GLU n 
2 113 GLU n 
2 114 TYR n 
2 115 ASP n 
2 116 SER n 
2 117 ILE n 
2 118 ILE n 
2 119 VAL n 
2 120 PHE n 
2 121 TYR n 
2 122 ASN n 
2 123 SER n 
2 124 VAL n 
2 125 PHE n 
2 126 MET n 
2 127 GLN n 
2 128 ARG n 
2 129 LEU n 
2 130 LYS n 
2 131 THR n 
2 132 ASN n 
2 133 ILE n 
2 134 LEU n 
2 135 GLN n 
2 136 TYR n 
2 137 ALA n 
2 138 SER n 
2 139 THR n 
2 140 ARG n 
2 141 PRO n 
2 142 PRO n 
2 143 THR n 
2 144 LEU n 
2 145 SER n 
2 146 PRO n 
2 147 ILE n 
2 148 PRO n 
2 149 HIS n 
2 150 ILE n 
2 151 PRO n 
2 152 ARG n 
3 1   ASP n 
3 2   LEU n 
3 3   TYR n 
3 4   CYS n 
3 5   TYR n 
3 6   GLU n 
3 7   GLN n 
3 8   LEU n 
3 9   ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? BL21 ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? 'GST FUSION' PGEX4T3 ? ? BL21 ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? BL21 ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? 'GST FUSION' PGEX4T3 ? ? BL21 ? ? 
# 
_entity_src_nat.entity_id                  3 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Human papillomavirus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      10566 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     E7 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP RB_HUMAN P06400 1 372 ? ? 
2 UNP RB_HUMAN P06400 2 636 ? ? 
3 PDB 1GUX     1GUX   3 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GUX A 1 ? 218 ? P06400 372 ? 589 ? 372 589 
2 2 1GUX B 1 ? 152 ? P06400 636 ? 787 ? 636 787 
3 3 1GUX E 1 ? 9   ? 1GUX   1   ? 9   ? 1   9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GUX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   56.92 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '3.5 M SODIUM FORMATE, 0.1M NA HEPES PH 7.5, 20 MIROMOLAR CDCL2' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM' 
_diffrn_detector.pdbx_collection_date   1997-07-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9080 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.9080 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1GUX 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   45533 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0480000 
_reflns.pdbx_netI_over_sigmaI        25.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.98 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.94 
_reflns_shell.percent_possible_all   84.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2110000 
_reflns_shell.meanI_over_sigI_obs    5.93 
_reflns_shell.pdbx_redundancy        1.98 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1GUX 
_refine.ls_number_reflns_obs                     39098 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    93.0 
_refine.ls_R_factor_obs                          0.2180000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2180000 
_refine.ls_R_factor_R_free                       0.2890000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  1945 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2713 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             389 
_refine_hist.number_atoms_total               3102 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        7 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.618 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      21.3  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.634 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.93 
_refine_ls_shell.number_reflns_R_work             3666 
_refine_ls_shell.R_factor_R_work                  0.3240000 
_refine_ls_shell.percent_reflns_obs               74.1 
_refine_ls_shell.R_factor_R_free                  0.3250000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.63 
_refine_ls_shell.number_reflns_R_free             189 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1GUX 
_struct.title                     'RB POCKET BOUND TO E7 LXCXE MOTIF' 
_struct.pdbx_descriptor           'RETINOBLASTOMA PROTEIN, ONCOPROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GUX 
_struct_keywords.pdbx_keywords   'COMPLEX (TRANSCRIPTION REG/PEPTIDE)' 
_struct_keywords.text            
'COMPLEX (TRANSCRIPTION REGULATION-PEPTIDE), TUMOR SUPPRESSOR PROTEIN, RETINOBLASTOMA, COMPLEX (TRANSCRIPTION REG-PEPTIDE) COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 10  ? SER A 20  ? THR A 381 SER A 391 1 ? 11 
HELX_P HELX_P2  2  GLU A 27  ? ASN A 35  ? GLU A 398 ASN A 406 1 ? 9  
HELX_P HELX_P3  3  LYS A 41  ? VAL A 63  ? LYS A 412 VAL A 434 1 ? 23 
HELX_P HELX_P4  4  GLU A 69  ? SER A 92  ? GLU A 440 SER A 463 1 ? 24 
HELX_P HELX_P5  5  PHE A 102 ? ASN A 107 ? PHE A 473 ASN A 478 1 ? 6  
HELX_P HELX_P6  6  ASN A 109 ? THR A 126 ? ASN A 480 THR A 497 1 ? 18 
HELX_P HELX_P7  7  PRO A 144 ? VAL A 149 ? PRO A 515 VAL A 520 5 ? 6  
HELX_P HELX_P8  8  ALA A 154 ? ALA A 167 ? ALA A 525 ALA A 538 1 ? 14 
HELX_P HELX_P9  9  ARG A 173 ? GLU A 188 ? ARG A 544 GLU A 559 1 ? 16 
HELX_P HELX_P10 10 LEU A 190 ? TRP A 192 ? LEU A 561 TRP A 563 5 ? 3  
HELX_P HELX_P11 11 PRO A 197 ? GLN A 204 ? PRO A 568 GLN A 575 1 ? 8  
HELX_P HELX_P12 12 SER B 11  ? LEU B 34  ? SER B 646 LEU B 669 1 ? 24 
HELX_P HELX_P13 13 LEU B 41  ? ASN B 55  ? LEU B 676 ASN B 690 1 ? 15 
HELX_P HELX_P14 14 TYR B 57  ? LEU B 59  ? TYR B 692 LEU B 694 5 ? 3  
HELX_P HELX_P15 15 LEU B 65  ? VAL B 79  ? LEU B 700 VAL B 714 1 ? 15 
HELX_P HELX_P16 16 PHE B 86  ? ASP B 95  ? PHE B 721 ASP B 730 1 ? 10 
HELX_P HELX_P17 17 GLN B 101 ? LYS B 105 ? GLN B 736 LYS B 740 5 ? 5  
HELX_P HELX_P18 18 ILE B 117 ? SER B 123 ? ILE B 752 SER B 758 1 ? 7  
HELX_P HELX_P19 19 PHE B 125 ? ALA B 137 ? PHE B 760 ALA B 772 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 3 ? TYR C 5 ? TYR E 3 TYR E 5 
A 2 CYS C 4 ? GLU C 6 ? CYS E 4 GLU E 6 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    3 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    E 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     3 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    5 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    E 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     5 
# 
_database_PDB_matrix.entry_id          1GUX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GUX 
_atom_sites.fract_transf_matrix[1][1]   0.009662 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000152 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013021 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 9   ? 53.420 35.369 38.771  1.00 31.27  ? 380 ASN A N   1 
ATOM   2    C CA  . ASN A 1 9   ? 52.492 35.061 39.919  1.00 24.76  ? 380 ASN A CA  1 
ATOM   3    C C   . ASN A 1 9   ? 52.177 33.558 39.810  1.00 25.94  ? 380 ASN A C   1 
ATOM   4    O O   . ASN A 1 9   ? 51.840 33.073 38.722  1.00 23.26  ? 380 ASN A O   1 
ATOM   5    C CB  . ASN A 1 9   ? 51.291 36.016 39.805  1.00 26.64  ? 380 ASN A CB  1 
ATOM   6    C CG  . ASN A 1 9   ? 50.086 35.582 40.572  1.00 22.23  ? 380 ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 9   ? 49.591 34.478 40.391  1.00 24.92  ? 380 ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 9   ? 49.513 36.500 41.319  1.00 25.61  ? 380 ASN A ND2 1 
ATOM   9    N N   . THR A 1 10  ? 52.406 32.804 40.896  1.00 22.88  ? 381 THR A N   1 
ATOM   10   C CA  . THR A 1 10  ? 52.219 31.348 40.887  1.00 19.15  ? 381 THR A CA  1 
ATOM   11   C C   . THR A 1 10  ? 50.815 30.846 40.620  1.00 14.28  ? 381 THR A C   1 
ATOM   12   O O   . THR A 1 10  ? 50.640 29.738 40.132  1.00 18.09  ? 381 THR A O   1 
ATOM   13   C CB  . THR A 1 10  ? 52.845 30.661 42.145  1.00 22.13  ? 381 THR A CB  1 
ATOM   14   O OG1 . THR A 1 10  ? 52.341 31.277 43.336  1.00 19.88  ? 381 THR A OG1 1 
ATOM   15   C CG2 . THR A 1 10  ? 54.366 30.817 42.122  1.00 24.95  ? 381 THR A CG2 1 
ATOM   16   N N   . ILE A 1 11  ? 49.825 31.681 40.901  1.00 18.18  ? 382 ILE A N   1 
ATOM   17   C CA  . ILE A 1 11  ? 48.421 31.337 40.656  1.00 19.46  ? 382 ILE A CA  1 
ATOM   18   C C   . ILE A 1 11  ? 48.156 31.448 39.153  1.00 22.31  ? 382 ILE A C   1 
ATOM   19   O O   . ILE A 1 11  ? 47.481 30.596 38.573  1.00 17.93  ? 382 ILE A O   1 
ATOM   20   C CB  . ILE A 1 11  ? 47.455 32.273 41.435  1.00 19.73  ? 382 ILE A CB  1 
ATOM   21   C CG1 . ILE A 1 11  ? 47.232 31.718 42.864  1.00 18.72  ? 382 ILE A CG1 1 
ATOM   22   C CG2 . ILE A 1 11  ? 46.092 32.438 40.680  1.00 21.79  ? 382 ILE A CG2 1 
ATOM   23   C CD1 . ILE A 1 11  ? 46.315 30.468 42.944  1.00 15.67  ? 382 ILE A CD1 1 
ATOM   24   N N   . GLN A 1 12  ? 48.708 32.493 38.543  1.00 22.99  ? 383 GLN A N   1 
ATOM   25   C CA  . GLN A 1 12  ? 48.572 32.712 37.102  1.00 27.25  ? 383 GLN A CA  1 
ATOM   26   C C   . GLN A 1 12  ? 49.271 31.577 36.366  1.00 22.79  ? 383 GLN A C   1 
ATOM   27   O O   . GLN A 1 12  ? 48.719 30.989 35.423  1.00 25.84  ? 383 GLN A O   1 
ATOM   28   C CB  . GLN A 1 12  ? 49.136 34.080 36.725  1.00 29.51  ? 383 GLN A CB  1 
ATOM   29   C CG  . GLN A 1 12  ? 48.255 35.225 37.229  1.00 37.39  ? 383 GLN A CG  1 
ATOM   30   C CD  . GLN A 1 12  ? 48.939 36.584 37.179  1.00 44.85  ? 383 GLN A CD  1 
ATOM   31   O OE1 . GLN A 1 12  ? 50.172 36.682 37.246  1.00 51.89  ? 383 GLN A OE1 1 
ATOM   32   N NE2 . GLN A 1 12  ? 48.144 37.646 37.091  1.00 48.45  ? 383 GLN A NE2 1 
ATOM   33   N N   . GLN A 1 13  ? 50.430 31.188 36.872  1.00 23.49  ? 384 GLN A N   1 
ATOM   34   C CA  . GLN A 1 13  ? 51.170 30.096 36.278  1.00 23.25  ? 384 GLN A CA  1 
ATOM   35   C C   . GLN A 1 13  ? 50.346 28.817 36.417  1.00 26.04  ? 384 GLN A C   1 
ATOM   36   O O   . GLN A 1 13  ? 50.286 27.999 35.489  1.00 24.50  ? 384 GLN A O   1 
ATOM   37   C CB  . GLN A 1 13  ? 52.534 29.933 36.959  1.00 27.10  ? 384 GLN A CB  1 
ATOM   38   C CG  . GLN A 1 13  ? 53.500 31.138 36.790  1.00 30.57  ? 384 GLN A CG  1 
ATOM   39   C CD  . GLN A 1 13  ? 54.909 30.901 37.384  1.00 33.57  ? 384 GLN A CD  1 
ATOM   40   O OE1 . GLN A 1 13  ? 55.241 29.798 37.819  1.00 36.16  ? 384 GLN A OE1 1 
ATOM   41   N NE2 . GLN A 1 13  ? 55.727 31.951 37.413  1.00 34.62  ? 384 GLN A NE2 1 
ATOM   42   N N   . LEU A 1 14  ? 49.671 28.650 37.561  1.00 22.76  ? 385 LEU A N   1 
ATOM   43   C CA  . LEU A 1 14  ? 48.854 27.451 37.789  1.00 21.06  ? 385 LEU A CA  1 
ATOM   44   C C   . LEU A 1 14  ? 47.661 27.367 36.813  1.00 14.47  ? 385 LEU A C   1 
ATOM   45   O O   . LEU A 1 14  ? 47.385 26.311 36.242  1.00 19.55  ? 385 LEU A O   1 
ATOM   46   C CB  . LEU A 1 14  ? 48.367 27.404 39.259  1.00 20.95  ? 385 LEU A CB  1 
ATOM   47   C CG  . LEU A 1 14  ? 47.387 26.290 39.645  1.00 21.38  ? 385 LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 14  ? 48.096 24.961 39.613  1.00 18.94  ? 385 LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 14  ? 46.784 26.560 41.036  1.00 21.23  ? 385 LEU A CD2 1 
ATOM   50   N N   . MET A 1 15  ? 46.972 28.486 36.622  1.00 16.68  ? 386 MET A N   1 
ATOM   51   C CA  . MET A 1 15  ? 45.818 28.547 35.730  1.00 17.58  ? 386 MET A CA  1 
ATOM   52   C C   . MET A 1 15  ? 46.250 28.165 34.319  1.00 20.90  ? 386 MET A C   1 
ATOM   53   O O   . MET A 1 15  ? 45.529 27.464 33.619  1.00 18.48  ? 386 MET A O   1 
ATOM   54   C CB  . MET A 1 15  ? 45.194 29.941 35.747  1.00 17.07  ? 386 MET A CB  1 
ATOM   55   C CG  . MET A 1 15  ? 44.470 30.306 37.076  1.00 20.19  ? 386 MET A CG  1 
ATOM   56   S SD  . MET A 1 15  ? 43.310 29.016 37.686  1.00 23.51  ? 386 MET A SD  1 
ATOM   57   C CE  . MET A 1 15  ? 43.741 28.927 39.539  1.00 17.48  ? 386 MET A CE  1 
ATOM   58   N N   . MET A 1 16  ? 47.461 28.575 33.943  1.00 23.05  ? 387 MET A N   1 
ATOM   59   C CA  . MET A 1 16  ? 48.022 28.254 32.638  1.00 27.09  ? 387 MET A CA  1 
ATOM   60   C C   . MET A 1 16  ? 48.169 26.762 32.496  1.00 25.89  ? 387 MET A C   1 
ATOM   61   O O   . MET A 1 16  ? 47.738 26.186 31.500  1.00 26.90  ? 387 MET A O   1 
ATOM   62   C CB  . MET A 1 16  ? 49.389 28.915 32.447  1.00 33.22  ? 387 MET A CB  1 
ATOM   63   C CG  . MET A 1 16  ? 49.453 29.821 31.240  1.00 41.29  ? 387 MET A CG  1 
ATOM   64   S SD  . MET A 1 16  ? 49.469 31.556 31.667  1.00 51.55  ? 387 MET A SD  1 
ATOM   65   C CE  . MET A 1 16  ? 50.548 32.246 30.383  1.00 50.65  ? 387 MET A CE  1 
ATOM   66   N N   . ILE A 1 17  ? 48.745 26.118 33.503  1.00 25.09  ? 388 ILE A N   1 
ATOM   67   C CA  . ILE A 1 17  ? 48.912 24.677 33.436  1.00 25.94  ? 388 ILE A CA  1 
ATOM   68   C C   . ILE A 1 17  ? 47.560 23.941 33.448  1.00 25.39  ? 388 ILE A C   1 
ATOM   69   O O   . ILE A 1 17  ? 47.367 22.933 32.742  1.00 23.30  ? 388 ILE A O   1 
ATOM   70   C CB  . ILE A 1 17  ? 49.905 24.093 34.540  1.00 30.51  ? 388 ILE A CB  1 
ATOM   71   C CG1 . ILE A 1 17  ? 49.163 23.278 35.591  1.00 32.37  ? 388 ILE A CG1 1 
ATOM   72   C CG2 . ILE A 1 17  ? 50.805 25.174 35.175  1.00 33.04  ? 388 ILE A CG2 1 
ATOM   73   C CD1 . ILE A 1 17  ? 49.112 21.819 35.264  1.00 33.61  ? 388 ILE A CD1 1 
ATOM   74   N N   . LEU A 1 18  ? 46.622 24.424 34.252  1.00 22.57  ? 389 LEU A N   1 
ATOM   75   C CA  . LEU A 1 18  ? 45.311 23.775 34.321  1.00 19.64  ? 389 LEU A CA  1 
ATOM   76   C C   . LEU A 1 18  ? 44.624 23.914 32.951  1.00 21.81  ? 389 LEU A C   1 
ATOM   77   O O   . LEU A 1 18  ? 44.022 22.969 32.421  1.00 19.16  ? 389 LEU A O   1 
ATOM   78   C CB  . LEU A 1 18  ? 44.458 24.455 35.410  1.00 19.89  ? 389 LEU A CB  1 
ATOM   79   C CG  . LEU A 1 18  ? 44.920 24.350 36.881  1.00 15.46  ? 389 LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 18  ? 43.897 25.042 37.775  1.00 12.58  ? 389 LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 18  ? 45.090 22.895 37.257  1.00 11.19  ? 389 LEU A CD2 1 
ATOM   82   N N   . ASN A 1 19  ? 44.779 25.096 32.359  1.00 22.76  ? 390 ASN A N   1 
ATOM   83   C CA  . ASN A 1 19  ? 44.183 25.379 31.069  1.00 27.07  ? 390 ASN A CA  1 
ATOM   84   C C   . ASN A 1 19  ? 44.647 24.375 30.006  1.00 27.28  ? 390 ASN A C   1 
ATOM   85   O O   . ASN A 1 19  ? 43.901 24.065 29.083  1.00 28.34  ? 390 ASN A O   1 
ATOM   86   C CB  . ASN A 1 19  ? 44.499 26.804 30.646  1.00 27.20  ? 390 ASN A CB  1 
ATOM   87   C CG  . ASN A 1 19  ? 43.576 27.293 29.565  1.00 34.26  ? 390 ASN A CG  1 
ATOM   88   O OD1 . ASN A 1 19  ? 44.014 27.925 28.594  1.00 37.35  ? 390 ASN A OD1 1 
ATOM   89   N ND2 . ASN A 1 19  ? 42.285 27.005 29.716  1.00 29.99  ? 390 ASN A ND2 1 
ATOM   90   N N   . SER A 1 20  ? 45.832 23.805 30.191  1.00 25.62  ? 391 SER A N   1 
ATOM   91   C CA  . SER A 1 20  ? 46.353 22.847 29.250  1.00 27.85  ? 391 SER A CA  1 
ATOM   92   C C   . SER A 1 20  ? 46.143 21.412 29.689  1.00 30.05  ? 391 SER A C   1 
ATOM   93   O O   . SER A 1 20  ? 46.374 20.503 28.903  1.00 27.94  ? 391 SER A O   1 
ATOM   94   C CB  . SER A 1 20  ? 47.836 23.103 29.013  1.00 29.86  ? 391 SER A CB  1 
ATOM   95   O OG  . SER A 1 20  ? 48.608 22.732 30.144  1.00 35.84  ? 391 SER A OG  1 
ATOM   96   N N   . ALA A 1 21  ? 45.686 21.196 30.920  1.00 29.83  ? 392 ALA A N   1 
ATOM   97   C CA  . ALA A 1 21  ? 45.483 19.838 31.423  1.00 30.76  ? 392 ALA A CA  1 
ATOM   98   C C   . ALA A 1 21  ? 44.213 19.180 30.893  1.00 34.54  ? 392 ALA A C   1 
ATOM   99   O O   . ALA A 1 21  ? 43.239 19.857 30.561  1.00 35.86  ? 392 ALA A O   1 
ATOM   100  C CB  . ALA A 1 21  ? 45.496 19.822 32.956  1.00 32.51  ? 392 ALA A CB  1 
ATOM   101  N N   . SER A 1 22  ? 44.224 17.854 30.815  1.00 35.99  ? 393 SER A N   1 
ATOM   102  C CA  . SER A 1 22  ? 43.068 17.129 30.306  1.00 40.75  ? 393 SER A CA  1 
ATOM   103  C C   . SER A 1 22  ? 41.938 17.152 31.318  1.00 41.40  ? 393 SER A C   1 
ATOM   104  O O   . SER A 1 22  ? 42.172 17.321 32.509  1.00 42.03  ? 393 SER A O   1 
ATOM   105  C CB  . SER A 1 22  ? 43.440 15.692 29.936  1.00 41.40  ? 393 SER A CB  1 
ATOM   106  O OG  . SER A 1 22  ? 43.129 14.782 30.973  1.00 47.53  ? 393 SER A OG  1 
ATOM   107  N N   . ASP A 1 23  ? 40.718 16.938 30.845  1.00 43.35  ? 394 ASP A N   1 
ATOM   108  C CA  . ASP A 1 23  ? 39.544 16.967 31.707  1.00 44.08  ? 394 ASP A CA  1 
ATOM   109  C C   . ASP A 1 23  ? 39.267 15.741 32.551  1.00 44.57  ? 394 ASP A C   1 
ATOM   110  O O   . ASP A 1 23  ? 38.332 15.750 33.356  1.00 47.26  ? 394 ASP A O   1 
ATOM   111  C CB  . ASP A 1 23  ? 38.304 17.306 30.889  1.00 43.23  ? 394 ASP A CB  1 
ATOM   112  C CG  . ASP A 1 23  ? 38.253 18.749 30.511  1.00 44.85  ? 394 ASP A CG  1 
ATOM   113  O OD1 . ASP A 1 23  ? 38.411 19.588 31.421  1.00 47.03  ? 394 ASP A OD1 1 
ATOM   114  O OD2 . ASP A 1 23  ? 38.053 19.052 29.318  1.00 46.97  ? 394 ASP A OD2 1 
ATOM   115  N N   . GLN A 1 24  ? 40.038 14.679 32.371  1.00 43.44  ? 395 GLN A N   1 
ATOM   116  C CA  . GLN A 1 24  ? 39.784 13.492 33.166  1.00 44.13  ? 395 GLN A CA  1 
ATOM   117  C C   . GLN A 1 24  ? 40.997 13.094 33.987  1.00 41.51  ? 395 GLN A C   1 
ATOM   118  O O   . GLN A 1 24  ? 42.096 13.612 33.764  1.00 42.43  ? 395 GLN A O   1 
ATOM   119  C CB  . GLN A 1 24  ? 39.240 12.363 32.288  1.00 48.56  ? 395 GLN A CB  1 
ATOM   120  C CG  . GLN A 1 24  ? 37.777 12.599 31.850  1.00 55.22  ? 395 GLN A CG  1 
ATOM   121  C CD  . GLN A 1 24  ? 36.722 12.463 32.982  1.00 58.63  ? 395 GLN A CD  1 
ATOM   122  O OE1 . GLN A 1 24  ? 36.665 13.267 33.933  1.00 61.23  ? 395 GLN A OE1 1 
ATOM   123  N NE2 . GLN A 1 24  ? 35.848 11.470 32.843  1.00 59.33  ? 395 GLN A NE2 1 
ATOM   124  N N   . PRO A 1 25  ? 40.809 12.222 34.993  1.00 37.26  ? 396 PRO A N   1 
ATOM   125  C CA  . PRO A 1 25  ? 41.909 11.787 35.847  1.00 36.38  ? 396 PRO A CA  1 
ATOM   126  C C   . PRO A 1 25  ? 43.101 11.231 35.077  1.00 38.14  ? 396 PRO A C   1 
ATOM   127  O O   . PRO A 1 25  ? 42.932 10.624 34.023  1.00 36.44  ? 396 PRO A O   1 
ATOM   128  C CB  . PRO A 1 25  ? 41.250 10.715 36.719  1.00 36.17  ? 396 PRO A CB  1 
ATOM   129  C CG  . PRO A 1 25  ? 40.197 10.159 35.838  1.00 35.75  ? 396 PRO A CG  1 
ATOM   130  C CD  . PRO A 1 25  ? 39.609 11.412 35.265  1.00 36.92  ? 396 PRO A CD  1 
ATOM   131  N N   . SER A 1 26  ? 44.298 11.455 35.611  1.00 37.29  ? 397 SER A N   1 
ATOM   132  C CA  . SER A 1 26  ? 45.528 10.976 35.005  1.00 39.44  ? 397 SER A CA  1 
ATOM   133  C C   . SER A 1 26  ? 45.606 9.465  35.123  1.00 40.40  ? 397 SER A C   1 
ATOM   134  O O   . SER A 1 26  ? 44.756 8.831  35.735  1.00 41.47  ? 397 SER A O   1 
ATOM   135  C CB  . SER A 1 26  ? 46.713 11.564 35.746  1.00 37.46  ? 397 SER A CB  1 
ATOM   136  O OG  . SER A 1 26  ? 46.754 11.037 37.060  1.00 40.72  ? 397 SER A OG  1 
ATOM   137  N N   . GLU A 1 27  ? 46.664 8.891  34.578  1.00 46.08  ? 398 GLU A N   1 
ATOM   138  C CA  . GLU A 1 27  ? 46.860 7.454  34.647  1.00 51.01  ? 398 GLU A CA  1 
ATOM   139  C C   . GLU A 1 27  ? 47.255 7.066  36.070  1.00 51.24  ? 398 GLU A C   1 
ATOM   140  O O   . GLU A 1 27  ? 46.879 5.990  36.551  1.00 54.62  ? 398 GLU A O   1 
ATOM   141  C CB  . GLU A 1 27  ? 47.928 7.020  33.646  1.00 55.39  ? 398 GLU A CB  1 
ATOM   142  C CG  . GLU A 1 27  ? 47.547 7.299  32.199  1.00 63.01  ? 398 GLU A CG  1 
ATOM   143  C CD  . GLU A 1 27  ? 46.190 6.717  31.830  1.00 67.11  ? 398 GLU A CD  1 
ATOM   144  O OE1 . GLU A 1 27  ? 45.990 5.488  32.014  1.00 71.26  ? 398 GLU A OE1 1 
ATOM   145  O OE2 . GLU A 1 27  ? 45.321 7.495  31.368  1.00 70.07  ? 398 GLU A OE2 1 
ATOM   146  N N   . ASN A 1 28  ? 48.002 7.953  36.733  1.00 51.14  ? 399 ASN A N   1 
ATOM   147  C CA  . ASN A 1 28  ? 48.438 7.767  38.123  1.00 50.51  ? 399 ASN A CA  1 
ATOM   148  C C   . ASN A 1 28  ? 47.211 7.646  39.019  1.00 48.80  ? 399 ASN A C   1 
ATOM   149  O O   . ASN A 1 28  ? 47.094 6.707  39.819  1.00 49.09  ? 399 ASN A O   1 
ATOM   150  C CB  . ASN A 1 28  ? 49.212 8.985  38.611  1.00 54.55  ? 399 ASN A CB  1 
ATOM   151  C CG  . ASN A 1 28  ? 50.502 9.192  37.880  1.00 60.39  ? 399 ASN A CG  1 
ATOM   152  O OD1 . ASN A 1 28  ? 50.515 9.549  36.691  1.00 65.62  ? 399 ASN A OD1 1 
ATOM   153  N ND2 . ASN A 1 28  ? 51.606 9.006  38.586  1.00 62.10  ? 399 ASN A ND2 1 
ATOM   154  N N   . LEU A 1 29  ? 46.317 8.630  38.905  1.00 43.34  ? 400 LEU A N   1 
ATOM   155  C CA  . LEU A 1 29  ? 45.106 8.643  39.700  1.00 41.36  ? 400 LEU A CA  1 
ATOM   156  C C   . LEU A 1 29  ? 44.352 7.362  39.466  1.00 40.96  ? 400 LEU A C   1 
ATOM   157  O O   . LEU A 1 29  ? 44.056 6.634  40.410  1.00 43.03  ? 400 LEU A O   1 
ATOM   158  C CB  . LEU A 1 29  ? 44.212 9.833  39.354  1.00 37.82  ? 400 LEU A CB  1 
ATOM   159  C CG  . LEU A 1 29  ? 44.146 10.952 40.402  1.00 37.46  ? 400 LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 29  ? 42.931 11.845 40.127  1.00 34.67  ? 400 LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 29  ? 44.062 10.371 41.818  1.00 27.86  ? 400 LEU A CD2 1 
ATOM   162  N N   . ILE A 1 30  ? 44.103 7.053  38.197  1.00 43.06  ? 401 ILE A N   1 
ATOM   163  C CA  . ILE A 1 30  ? 43.375 5.838  37.835  1.00 42.36  ? 401 ILE A CA  1 
ATOM   164  C C   . ILE A 1 30  ? 43.994 4.607  38.505  1.00 42.76  ? 401 ILE A C   1 
ATOM   165  O O   . ILE A 1 30  ? 43.264 3.740  39.024  1.00 40.12  ? 401 ILE A O   1 
ATOM   166  C CB  . ILE A 1 30  ? 43.292 5.659  36.303  1.00 41.44  ? 401 ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 30  ? 42.441 6.773  35.705  1.00 39.79  ? 401 ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 30  ? 42.655 4.326  35.958  1.00 41.05  ? 401 ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 30  ? 42.574 6.882  34.214  1.00 42.16  ? 401 ILE A CD1 1 
ATOM   170  N N   . SER A 1 31  ? 45.325 4.570  38.559  1.00 39.43  ? 402 SER A N   1 
ATOM   171  C CA  . SER A 1 31  ? 46.011 3.460  39.199  1.00 40.41  ? 402 SER A CA  1 
ATOM   172  C C   . SER A 1 31  ? 45.555 3.348  40.653  1.00 41.08  ? 402 SER A C   1 
ATOM   173  O O   . SER A 1 31  ? 45.237 2.254  41.127  1.00 42.23  ? 402 SER A O   1 
ATOM   174  C CB  . SER A 1 31  ? 47.523 3.648  39.145  1.00 40.50  ? 402 SER A CB  1 
ATOM   175  O OG  . SER A 1 31  ? 48.186 2.540  39.745  1.00 46.97  ? 402 SER A OG  1 
ATOM   176  N N   . TYR A 1 32  ? 45.509 4.479  41.355  1.00 40.01  ? 403 TYR A N   1 
ATOM   177  C CA  . TYR A 1 32  ? 45.071 4.484  42.746  1.00 38.24  ? 403 TYR A CA  1 
ATOM   178  C C   . TYR A 1 32  ? 43.622 3.991  42.814  1.00 38.72  ? 403 TYR A C   1 
ATOM   179  O O   . TYR A 1 32  ? 43.290 3.151  43.657  1.00 38.35  ? 403 TYR A O   1 
ATOM   180  C CB  . TYR A 1 32  ? 45.164 5.891  43.337  1.00 39.99  ? 403 TYR A CB  1 
ATOM   181  C CG  . TYR A 1 32  ? 46.567 6.409  43.568  1.00 37.26  ? 403 TYR A CG  1 
ATOM   182  C CD1 . TYR A 1 32  ? 47.449 5.747  44.416  1.00 38.51  ? 403 TYR A CD1 1 
ATOM   183  C CD2 . TYR A 1 32  ? 46.991 7.594  42.982  1.00 39.74  ? 403 TYR A CD2 1 
ATOM   184  C CE1 . TYR A 1 32  ? 48.719 6.260  44.676  1.00 38.46  ? 403 TYR A CE1 1 
ATOM   185  C CE2 . TYR A 1 32  ? 48.261 8.120  43.239  1.00 38.27  ? 403 TYR A CE2 1 
ATOM   186  C CZ  . TYR A 1 32  ? 49.111 7.448  44.084  1.00 36.47  ? 403 TYR A CZ  1 
ATOM   187  O OH  . TYR A 1 32  ? 50.345 7.973  44.345  1.00 41.20  ? 403 TYR A OH  1 
ATOM   188  N N   . PHE A 1 33  ? 42.782 4.478  41.898  1.00 36.13  ? 404 PHE A N   1 
ATOM   189  C CA  . PHE A 1 33  ? 41.370 4.086  41.835  1.00 40.46  ? 404 PHE A CA  1 
ATOM   190  C C   . PHE A 1 33  ? 41.205 2.573  41.752  1.00 43.62  ? 404 PHE A C   1 
ATOM   191  O O   . PHE A 1 33  ? 40.337 1.991  42.421  1.00 46.00  ? 404 PHE A O   1 
ATOM   192  C CB  . PHE A 1 33  ? 40.668 4.752  40.640  1.00 38.36  ? 404 PHE A CB  1 
ATOM   193  C CG  . PHE A 1 33  ? 40.604 6.253  40.733  1.00 36.59  ? 404 PHE A CG  1 
ATOM   194  C CD1 . PHE A 1 33  ? 41.078 6.922  41.862  1.00 35.21  ? 404 PHE A CD1 1 
ATOM   195  C CD2 . PHE A 1 33  ? 40.098 7.012  39.682  1.00 37.76  ? 404 PHE A CD2 1 
ATOM   196  C CE1 . PHE A 1 33  ? 41.054 8.322  41.941  1.00 34.24  ? 404 PHE A CE1 1 
ATOM   197  C CE2 . PHE A 1 33  ? 40.070 8.424  39.752  1.00 34.06  ? 404 PHE A CE2 1 
ATOM   198  C CZ  . PHE A 1 33  ? 40.550 9.072  40.883  1.00 34.08  ? 404 PHE A CZ  1 
ATOM   199  N N   . ASN A 1 34  ? 42.080 1.943  40.969  1.00 46.22  ? 405 ASN A N   1 
ATOM   200  C CA  . ASN A 1 34  ? 42.079 0.491  40.771  1.00 44.85  ? 405 ASN A CA  1 
ATOM   201  C C   . ASN A 1 34  ? 42.573 -0.277 41.984  1.00 42.76  ? 405 ASN A C   1 
ATOM   202  O O   . ASN A 1 34  ? 42.305 -1.475 42.095  1.00 41.81  ? 405 ASN A O   1 
ATOM   203  C CB  . ASN A 1 34  ? 42.941 0.110  39.563  1.00 46.32  ? 405 ASN A CB  1 
ATOM   204  C CG  . ASN A 1 34  ? 42.410 0.676  38.263  1.00 48.67  ? 405 ASN A CG  1 
ATOM   205  O OD1 . ASN A 1 34  ? 43.174 1.178  37.454  1.00 53.01  ? 405 ASN A OD1 1 
ATOM   206  N ND2 . ASN A 1 34  ? 41.101 0.589  38.051  1.00 47.73  ? 405 ASN A ND2 1 
ATOM   207  N N   . ASN A 1 35  ? 43.334 0.398  42.851  1.00 43.12  ? 406 ASN A N   1 
ATOM   208  C CA  . ASN A 1 35  ? 43.885 -0.208 44.079  1.00 43.27  ? 406 ASN A CA  1 
ATOM   209  C C   . ASN A 1 35  ? 42.890 -0.120 45.229  1.00 42.64  ? 406 ASN A C   1 
ATOM   210  O O   . ASN A 1 35  ? 43.198 -0.509 46.360  1.00 42.16  ? 406 ASN A O   1 
ATOM   211  C CB  . ASN A 1 35  ? 45.185 0.483  44.533  1.00 44.55  ? 406 ASN A CB  1 
ATOM   212  C CG  . ASN A 1 35  ? 46.366 0.204  43.616  1.00 45.65  ? 406 ASN A CG  1 
ATOM   213  O OD1 . ASN A 1 35  ? 46.353 -0.734 42.809  1.00 46.30  ? 406 ASN A OD1 1 
ATOM   214  N ND2 . ASN A 1 35  ? 47.402 1.024  43.743  1.00 45.21  ? 406 ASN A ND2 1 
ATOM   215  N N   . CYS A 1 36  ? 41.727 0.458  44.961  1.00 41.56  ? 407 CYS A N   1 
ATOM   216  C CA  . CYS A 1 36  ? 40.708 0.582  45.981  1.00 39.05  ? 407 CYS A CA  1 
ATOM   217  C C   . CYS A 1 36  ? 39.879 -0.662 46.070  1.00 39.21  ? 407 CYS A C   1 
ATOM   218  O O   . CYS A 1 36  ? 39.406 -1.182 45.059  1.00 36.15  ? 407 CYS A O   1 
ATOM   219  C CB  . CYS A 1 36  ? 39.812 1.773  45.715  1.00 35.55  ? 407 CYS A CB  1 
ATOM   220  S SG  . CYS A 1 36  ? 40.672 3.258  46.135  1.00 37.55  ? 407 CYS A SG  1 
ATOM   221  N N   . THR A 1 37  ? 39.741 -1.151 47.294  1.00 39.28  ? 408 THR A N   1 
ATOM   222  C CA  . THR A 1 37  ? 38.941 -2.322 47.560  1.00 43.70  ? 408 THR A CA  1 
ATOM   223  C C   . THR A 1 37  ? 37.601 -2.089 46.850  1.00 44.73  ? 408 THR A C   1 
ATOM   224  O O   . THR A 1 37  ? 37.065 -2.991 46.198  1.00 48.43  ? 408 THR A O   1 
ATOM   225  C CB  . THR A 1 37  ? 38.782 -2.501 49.064  1.00 45.25  ? 408 THR A CB  1 
ATOM   226  O OG1 . THR A 1 37  ? 40.089 -2.512 49.668  1.00 42.19  ? 408 THR A OG1 1 
ATOM   227  C CG2 . THR A 1 37  ? 38.069 -3.810 49.363  1.00 46.65  ? 408 THR A CG2 1 
ATOM   228  N N   . VAL A 1 38  ? 37.088 -0.866 46.933  1.00 42.28  ? 409 VAL A N   1 
ATOM   229  C CA  . VAL A 1 38  ? 35.870 -0.523 46.216  1.00 40.49  ? 409 VAL A CA  1 
ATOM   230  C C   . VAL A 1 38  ? 36.348 0.590  45.265  1.00 41.01  ? 409 VAL A C   1 
ATOM   231  O O   . VAL A 1 38  ? 36.705 1.682  45.711  1.00 39.01  ? 409 VAL A O   1 
ATOM   232  C CB  . VAL A 1 38  ? 34.743 -0.033 47.163  1.00 41.08  ? 409 VAL A CB  1 
ATOM   233  C CG1 . VAL A 1 38  ? 33.469 0.264  46.361  1.00 38.55  ? 409 VAL A CG1 1 
ATOM   234  C CG2 . VAL A 1 38  ? 34.450 -1.089 48.233  1.00 39.99  ? 409 VAL A CG2 1 
ATOM   235  N N   . ASN A 1 39  ? 36.447 0.265  43.972  1.00 40.34  ? 410 ASN A N   1 
ATOM   236  C CA  . ASN A 1 39  ? 36.922 1.190  42.933  1.00 37.32  ? 410 ASN A CA  1 
ATOM   237  C C   . ASN A 1 39  ? 36.012 2.415  42.813  1.00 34.76  ? 410 ASN A C   1 
ATOM   238  O O   . ASN A 1 39  ? 34.871 2.320  42.338  1.00 33.70  ? 410 ASN A O   1 
ATOM   239  C CB  . ASN A 1 39  ? 37.012 0.457  41.595  1.00 43.01  ? 410 ASN A CB  1 
ATOM   240  C CG  . ASN A 1 39  ? 37.759 1.254  40.534  1.00 46.76  ? 410 ASN A CG  1 
ATOM   241  O OD1 . ASN A 1 39  ? 37.211 2.184  39.934  1.00 46.32  ? 410 ASN A OD1 1 
ATOM   242  N ND2 . ASN A 1 39  ? 39.015 0.891  40.297  1.00 48.28  ? 410 ASN A ND2 1 
ATOM   243  N N   . PRO A 1 40  ? 36.545 3.604  43.145  1.00 31.79  ? 411 PRO A N   1 
ATOM   244  C CA  . PRO A 1 40  ? 35.808 4.870  43.104  1.00 30.58  ? 411 PRO A CA  1 
ATOM   245  C C   . PRO A 1 40  ? 35.684 5.574  41.735  1.00 30.35  ? 411 PRO A C   1 
ATOM   246  O O   . PRO A 1 40  ? 34.980 6.579  41.615  1.00 29.00  ? 411 PRO A O   1 
ATOM   247  C CB  . PRO A 1 40  ? 36.622 5.721  44.075  1.00 27.02  ? 411 PRO A CB  1 
ATOM   248  C CG  . PRO A 1 40  ? 38.029 5.343  43.696  1.00 25.60  ? 411 PRO A CG  1 
ATOM   249  C CD  . PRO A 1 40  ? 37.965 3.838  43.489  1.00 28.32  ? 411 PRO A CD  1 
ATOM   250  N N   . LYS A 1 41  ? 36.354 5.046  40.711  1.00 33.95  ? 412 LYS A N   1 
ATOM   251  C CA  . LYS A 1 41  ? 36.363 5.660  39.381  1.00 31.96  ? 412 LYS A CA  1 
ATOM   252  C C   . LYS A 1 41  ? 35.043 6.157  38.838  1.00 30.57  ? 412 LYS A C   1 
ATOM   253  O O   . LYS A 1 41  ? 34.927 7.329  38.484  1.00 31.20  ? 412 LYS A O   1 
ATOM   254  C CB  . LYS A 1 41  ? 37.007 4.731  38.357  1.00 36.95  ? 412 LYS A CB  1 
ATOM   255  C CG  . LYS A 1 41  ? 37.551 5.465  37.131  1.00 42.45  ? 412 LYS A CG  1 
ATOM   256  C CD  . LYS A 1 41  ? 38.016 4.494  36.056  1.00 47.20  ? 412 LYS A CD  1 
ATOM   257  C CE  . LYS A 1 41  ? 38.157 5.209  34.707  1.00 52.26  ? 412 LYS A CE  1 
ATOM   258  N NZ  . LYS A 1 41  ? 38.328 4.274  33.532  1.00 54.11  ? 412 LYS A NZ  1 
ATOM   259  N N   . GLU A 1 42  ? 34.044 5.287  38.775  1.00 30.70  ? 413 GLU A N   1 
ATOM   260  C CA  . GLU A 1 42  ? 32.753 5.686  38.223  1.00 34.00  ? 413 GLU A CA  1 
ATOM   261  C C   . GLU A 1 42  ? 31.970 6.726  39.039  1.00 32.23  ? 413 GLU A C   1 
ATOM   262  O O   . GLU A 1 42  ? 31.304 7.602  38.468  1.00 30.61  ? 413 GLU A O   1 
ATOM   263  C CB  . GLU A 1 42  ? 31.892 4.450  37.900  1.00 39.02  ? 413 GLU A CB  1 
ATOM   264  C CG  . GLU A 1 42  ? 30.934 3.977  39.005  1.00 50.40  ? 413 GLU A CG  1 
ATOM   265  C CD  . GLU A 1 42  ? 30.189 2.682  38.636  1.00 55.77  ? 413 GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 42  ? 29.254 2.735  37.794  1.00 57.66  ? 413 GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 42  ? 30.550 1.610  39.186  1.00 58.53  ? 413 GLU A OE2 1 
ATOM   268  N N   . SER A 1 43  ? 32.049 6.650  40.369  1.00 30.00  ? 414 SER A N   1 
ATOM   269  C CA  . SER A 1 43  ? 31.340 7.607  41.212  1.00 22.95  ? 414 SER A CA  1 
ATOM   270  C C   . SER A 1 43  ? 32.065 8.929  41.168  1.00 16.90  ? 414 SER A C   1 
ATOM   271  O O   . SER A 1 43  ? 31.426 9.976  41.188  1.00 20.54  ? 414 SER A O   1 
ATOM   272  C CB  . SER A 1 43  ? 31.251 7.098  42.646  1.00 26.31  ? 414 SER A CB  1 
ATOM   273  O OG  . SER A 1 43  ? 32.517 6.694  43.145  1.00 27.63  ? 414 SER A OG  1 
ATOM   274  N N   . ILE A 1 44  ? 33.394 8.887  41.081  1.00 16.32  ? 415 ILE A N   1 
ATOM   275  C CA  . ILE A 1 44  ? 34.189 10.122 40.993  1.00 19.12  ? 415 ILE A CA  1 
ATOM   276  C C   . ILE A 1 44  ? 33.853 10.873 39.686  1.00 22.15  ? 415 ILE A C   1 
ATOM   277  O O   . ILE A 1 44  ? 33.571 12.094 39.681  1.00 18.95  ? 415 ILE A O   1 
ATOM   278  C CB  . ILE A 1 44  ? 35.722 9.824  41.059  1.00 20.66  ? 415 ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 44  ? 36.134 9.499  42.507  1.00 25.23  ? 415 ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 44  ? 36.538 11.035 40.571  1.00 22.22  ? 415 ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 44  ? 37.550 8.977  42.668  1.00 20.58  ? 415 ILE A CD1 1 
ATOM   282  N N   . LEU A 1 45  ? 33.815 10.117 38.586  1.00 25.02  ? 416 LEU A N   1 
ATOM   283  C CA  . LEU A 1 45  ? 33.512 10.680 37.258  1.00 25.84  ? 416 LEU A CA  1 
ATOM   284  C C   . LEU A 1 45  ? 32.078 11.187 37.197  1.00 25.04  ? 416 LEU A C   1 
ATOM   285  O O   . LEU A 1 45  ? 31.801 12.280 36.670  1.00 26.54  ? 416 LEU A O   1 
ATOM   286  C CB  . LEU A 1 45  ? 33.764 9.629  36.163  1.00 27.14  ? 416 LEU A CB  1 
ATOM   287  C CG  . LEU A 1 45  ? 35.201 9.116  35.993  1.00 25.96  ? 416 LEU A CG  1 
ATOM   288  C CD1 . LEU A 1 45  ? 35.258 8.159  34.805  1.00 28.99  ? 416 LEU A CD1 1 
ATOM   289  C CD2 . LEU A 1 45  ? 36.141 10.275 35.773  1.00 24.17  ? 416 LEU A CD2 1 
ATOM   290  N N   . LYS A 1 46  ? 31.164 10.394 37.750  1.00 24.26  ? 417 LYS A N   1 
ATOM   291  C CA  . LYS A 1 46  ? 29.766 10.765 37.806  1.00 21.47  ? 417 LYS A CA  1 
ATOM   292  C C   . LYS A 1 46  ? 29.566 12.041 38.626  1.00 19.83  ? 417 LYS A C   1 
ATOM   293  O O   . LYS A 1 46  ? 28.818 12.934 38.204  1.00 22.96  ? 417 LYS A O   1 
ATOM   294  C CB  . LYS A 1 46  ? 28.957 9.638  38.407  1.00 24.36  ? 417 LYS A CB  1 
ATOM   295  C CG  . LYS A 1 46  ? 27.558 10.060 38.738  1.00 33.69  ? 417 LYS A CG  1 
ATOM   296  C CD  . LYS A 1 46  ? 26.618 9.854  37.581  1.00 38.21  ? 417 LYS A CD  1 
ATOM   297  C CE  . LYS A 1 46  ? 25.229 10.337 37.931  1.00 42.65  ? 417 LYS A CE  1 
ATOM   298  N NZ  . LYS A 1 46  ? 24.893 10.094 39.378  1.00 47.50  ? 417 LYS A NZ  1 
ATOM   299  N N   . ARG A 1 47  ? 30.233 12.144 39.785  1.00 21.85  ? 418 ARG A N   1 
ATOM   300  C CA  . ARG A 1 47  ? 30.117 13.339 40.629  1.00 17.63  ? 418 ARG A CA  1 
ATOM   301  C C   . ARG A 1 47  ? 30.566 14.553 39.854  1.00 16.02  ? 418 ARG A C   1 
ATOM   302  O O   . ARG A 1 47  ? 29.868 15.588 39.826  1.00 15.18  ? 418 ARG A O   1 
ATOM   303  C CB  . ARG A 1 47  ? 30.942 13.209 41.933  1.00 18.93  ? 418 ARG A CB  1 
ATOM   304  C CG  . ARG A 1 47  ? 30.972 14.512 42.812  1.00 18.62  ? 418 ARG A CG  1 
ATOM   305  C CD  . ARG A 1 47  ? 31.407 14.246 44.265  1.00 22.62  ? 418 ARG A CD  1 
ATOM   306  N NE  . ARG A 1 47  ? 32.430 13.228 44.259  1.00 27.80  ? 418 ARG A NE  1 
ATOM   307  C CZ  . ARG A 1 47  ? 32.370 12.076 44.905  1.00 23.79  ? 418 ARG A CZ  1 
ATOM   308  N NH1 . ARG A 1 47  ? 31.341 11.796 45.674  1.00 27.42  ? 418 ARG A NH1 1 
ATOM   309  N NH2 . ARG A 1 47  ? 33.275 11.138 44.637  1.00 25.90  ? 418 ARG A NH2 1 
ATOM   310  N N   . VAL A 1 48  ? 31.731 14.432 39.210  1.00 20.76  ? 419 VAL A N   1 
ATOM   311  C CA  . VAL A 1 48  ? 32.275 15.538 38.407  1.00 20.32  ? 419 VAL A CA  1 
ATOM   312  C C   . VAL A 1 48  ? 31.217 15.973 37.392  1.00 21.33  ? 419 VAL A C   1 
ATOM   313  O O   . VAL A 1 48  ? 30.889 17.157 37.279  1.00 21.47  ? 419 VAL A O   1 
ATOM   314  C CB  . VAL A 1 48  ? 33.588 15.134 37.678  1.00 23.25  ? 419 VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 48  ? 33.937 16.177 36.614  1.00 23.70  ? 419 VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 48  ? 34.735 15.029 38.683  1.00 23.29  ? 419 VAL A CG2 1 
ATOM   317  N N   . LYS A 1 49  ? 30.610 15.002 36.724  1.00 23.33  ? 420 LYS A N   1 
ATOM   318  C CA  . LYS A 1 49  ? 29.596 15.328 35.756  1.00 24.35  ? 420 LYS A CA  1 
ATOM   319  C C   . LYS A 1 49  ? 28.341 15.955 36.346  1.00 23.72  ? 420 LYS A C   1 
ATOM   320  O O   . LYS A 1 49  ? 27.827 16.942 35.812  1.00 22.98  ? 420 LYS A O   1 
ATOM   321  C CB  . LYS A 1 49  ? 29.256 14.112 34.897  1.00 31.27  ? 420 LYS A CB  1 
ATOM   322  C CG  . LYS A 1 49  ? 29.287 14.405 33.387  1.00 40.94  ? 420 LYS A CG  1 
ATOM   323  C CD  . LYS A 1 49  ? 28.835 15.857 33.028  1.00 47.51  ? 420 LYS A CD  1 
ATOM   324  C CE  . LYS A 1 49  ? 29.965 16.946 33.210  1.00 49.89  ? 420 LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 49  ? 29.471 18.370 33.352  1.00 44.64  ? 420 LYS A NZ  1 
ATOM   326  N N   . ASP A 1 50  ? 27.843 15.416 37.454  1.00 24.15  ? 421 ASP A N   1 
ATOM   327  C CA  . ASP A 1 50  ? 26.642 15.984 38.077  1.00 21.29  ? 421 ASP A CA  1 
ATOM   328  C C   . ASP A 1 50  ? 26.864 17.383 38.564  1.00 20.25  ? 421 ASP A C   1 
ATOM   329  O O   . ASP A 1 50  ? 26.016 18.269 38.384  1.00 23.67  ? 421 ASP A O   1 
ATOM   330  C CB  . ASP A 1 50  ? 26.164 15.141 39.255  1.00 25.48  ? 421 ASP A CB  1 
ATOM   331  C CG  . ASP A 1 50  ? 25.576 13.819 38.824  1.00 33.01  ? 421 ASP A CG  1 
ATOM   332  O OD1 . ASP A 1 50  ? 25.064 13.746 37.680  1.00 38.43  ? 421 ASP A OD1 1 
ATOM   333  O OD2 . ASP A 1 50  ? 25.624 12.849 39.622  1.00 33.19  ? 421 ASP A OD2 1 
ATOM   334  N N   . ILE A 1 51  ? 27.999 17.600 39.214  1.00 22.62  ? 422 ILE A N   1 
ATOM   335  C CA  . ILE A 1 51  ? 28.288 18.922 39.742  1.00 21.92  ? 422 ILE A CA  1 
ATOM   336  C C   . ILE A 1 51  ? 28.503 19.943 38.629  1.00 23.56  ? 422 ILE A C   1 
ATOM   337  O O   . ILE A 1 51  ? 28.140 21.123 38.775  1.00 24.47  ? 422 ILE A O   1 
ATOM   338  C CB  . ILE A 1 51  ? 29.488 18.870 40.724  1.00 23.73  ? 422 ILE A CB  1 
ATOM   339  C CG1 . ILE A 1 51  ? 29.113 17.982 41.921  1.00 21.57  ? 422 ILE A CG1 1 
ATOM   340  C CG2 . ILE A 1 51  ? 29.853 20.276 41.197  1.00 21.78  ? 422 ILE A CG2 1 
ATOM   341  C CD1 . ILE A 1 51  ? 27.839 18.451 42.637  1.00 22.55  ? 422 ILE A CD1 1 
ATOM   342  N N   . GLY A 1 52  ? 29.064 19.478 37.507  1.00 25.22  ? 423 GLY A N   1 
ATOM   343  C CA  . GLY A 1 52  ? 29.300 20.347 36.365  1.00 20.03  ? 423 GLY A CA  1 
ATOM   344  C C   . GLY A 1 52  ? 27.978 20.897 35.925  1.00 17.73  ? 423 GLY A C   1 
ATOM   345  O O   . GLY A 1 52  ? 27.827 22.102 35.732  1.00 19.01  ? 423 GLY A O   1 
ATOM   346  N N   . TYR A 1 53  ? 26.991 20.013 35.843  1.00 23.98  ? 424 TYR A N   1 
ATOM   347  C CA  . TYR A 1 53  ? 25.657 20.430 35.449  1.00 24.98  ? 424 TYR A CA  1 
ATOM   348  C C   . TYR A 1 53  ? 25.114 21.457 36.399  1.00 22.82  ? 424 TYR A C   1 
ATOM   349  O O   . TYR A 1 53  ? 24.654 22.515 35.978  1.00 22.93  ? 424 TYR A O   1 
ATOM   350  C CB  . TYR A 1 53  ? 24.713 19.236 35.370  1.00 32.69  ? 424 TYR A CB  1 
ATOM   351  C CG  . TYR A 1 53  ? 25.052 18.288 34.245  1.00 40.47  ? 424 TYR A CG  1 
ATOM   352  C CD1 . TYR A 1 53  ? 25.409 18.771 32.986  1.00 44.54  ? 424 TYR A CD1 1 
ATOM   353  C CD2 . TYR A 1 53  ? 25.044 16.906 34.441  1.00 45.81  ? 424 TYR A CD2 1 
ATOM   354  C CE1 . TYR A 1 53  ? 25.751 17.910 31.955  1.00 46.76  ? 424 TYR A CE1 1 
ATOM   355  C CE2 . TYR A 1 53  ? 25.389 16.035 33.409  1.00 47.27  ? 424 TYR A CE2 1 
ATOM   356  C CZ  . TYR A 1 53  ? 25.741 16.549 32.174  1.00 47.06  ? 424 TYR A CZ  1 
ATOM   357  O OH  . TYR A 1 53  ? 26.106 15.699 31.158  1.00 54.02  ? 424 TYR A OH  1 
ATOM   358  N N   . ILE A 1 54  ? 25.235 21.199 37.700  1.00 27.67  ? 425 ILE A N   1 
ATOM   359  C CA  . ILE A 1 54  ? 24.716 22.153 38.698  1.00 25.17  ? 425 ILE A CA  1 
ATOM   360  C C   . ILE A 1 54  ? 25.441 23.484 38.691  1.00 21.65  ? 425 ILE A C   1 
ATOM   361  O O   . ILE A 1 54  ? 24.819 24.556 38.669  1.00 20.08  ? 425 ILE A O   1 
ATOM   362  C CB  . ILE A 1 54  ? 24.755 21.568 40.126  1.00 27.68  ? 425 ILE A CB  1 
ATOM   363  C CG1 . ILE A 1 54  ? 23.863 20.328 40.197  1.00 30.67  ? 425 ILE A CG1 1 
ATOM   364  C CG2 . ILE A 1 54  ? 24.257 22.607 41.117  1.00 28.22  ? 425 ILE A CG2 1 
ATOM   365  C CD1 . ILE A 1 54  ? 24.319 19.290 41.191  1.00 31.32  ? 425 ILE A CD1 1 
ATOM   366  N N   . PHE A 1 55  ? 26.766 23.413 38.686  1.00 23.42  ? 426 PHE A N   1 
ATOM   367  C CA  . PHE A 1 55  ? 27.577 24.616 38.699  1.00 23.00  ? 426 PHE A CA  1 
ATOM   368  C C   . PHE A 1 55  ? 27.285 25.564 37.526  1.00 24.71  ? 426 PHE A C   1 
ATOM   369  O O   . PHE A 1 55  ? 27.081 26.772 37.720  1.00 24.21  ? 426 PHE A O   1 
ATOM   370  C CB  . PHE A 1 55  ? 29.057 24.242 38.755  1.00 22.17  ? 426 PHE A CB  1 
ATOM   371  C CG  . PHE A 1 55  ? 29.977 25.440 38.801  1.00 27.00  ? 426 PHE A CG  1 
ATOM   372  C CD1 . PHE A 1 55  ? 30.287 26.148 37.626  1.00 24.15  ? 426 PHE A CD1 1 
ATOM   373  C CD2 . PHE A 1 55  ? 30.519 25.874 40.014  1.00 22.98  ? 426 PHE A CD2 1 
ATOM   374  C CE1 . PHE A 1 55  ? 31.120 27.269 37.656  1.00 23.82  ? 426 PHE A CE1 1 
ATOM   375  C CE2 . PHE A 1 55  ? 31.358 26.996 40.057  1.00 24.52  ? 426 PHE A CE2 1 
ATOM   376  C CZ  . PHE A 1 55  ? 31.657 27.694 38.869  1.00 24.24  ? 426 PHE A CZ  1 
ATOM   377  N N   . LYS A 1 56  ? 27.277 25.022 36.306  1.00 30.14  ? 427 LYS A N   1 
ATOM   378  C CA  . LYS A 1 56  ? 27.017 25.831 35.102  1.00 27.99  ? 427 LYS A CA  1 
ATOM   379  C C   . LYS A 1 56  ? 25.625 26.433 35.161  1.00 25.30  ? 427 LYS A C   1 
ATOM   380  O O   . LYS A 1 56  ? 25.449 27.620 34.866  1.00 24.70  ? 427 LYS A O   1 
ATOM   381  C CB  . LYS A 1 56  ? 27.178 24.979 33.830  1.00 32.75  ? 427 LYS A CB  1 
ATOM   382  C CG  . LYS A 1 56  ? 28.602 24.468 33.640  1.00 37.75  ? 427 LYS A CG  1 
ATOM   383  C CD  . LYS A 1 56  ? 28.664 23.236 32.757  1.00 39.57  ? 427 LYS A CD  1 
ATOM   384  C CE  . LYS A 1 56  ? 30.024 22.582 32.896  1.00 43.07  ? 427 LYS A CE  1 
ATOM   385  N NZ  . LYS A 1 56  ? 30.031 21.127 32.564  1.00 46.77  ? 427 LYS A NZ  1 
ATOM   386  N N   . GLU A 1 57  ? 24.624 25.644 35.543  1.00 26.58  ? 428 GLU A N   1 
ATOM   387  C CA  . GLU A 1 57  ? 23.304 26.243 35.615  1.00 29.15  ? 428 GLU A CA  1 
ATOM   388  C C   . GLU A 1 57  ? 23.246 27.352 36.651  1.00 28.62  ? 428 GLU A C   1 
ATOM   389  O O   . GLU A 1 57  ? 22.748 28.440 36.360  1.00 27.12  ? 428 GLU A O   1 
ATOM   390  C CB  . GLU A 1 57  ? 22.190 25.213 35.783  1.00 34.53  ? 428 GLU A CB  1 
ATOM   391  C CG  . GLU A 1 57  ? 22.181 24.372 37.032  1.00 43.27  ? 428 GLU A CG  1 
ATOM   392  C CD  . GLU A 1 57  ? 20.875 23.565 37.149  1.00 46.67  ? 428 GLU A CD  1 
ATOM   393  O OE1 . GLU A 1 57  ? 19.782 24.188 37.124  1.00 46.60  ? 428 GLU A OE1 1 
ATOM   394  O OE2 . GLU A 1 57  ? 20.940 22.315 37.244  1.00 48.43  ? 428 GLU A OE2 1 
ATOM   395  N N   . LYS A 1 58  ? 23.864 27.136 37.814  1.00 29.10  ? 429 LYS A N   1 
ATOM   396  C CA  . LYS A 1 58  ? 23.872 28.161 38.866  1.00 29.35  ? 429 LYS A CA  1 
ATOM   397  C C   . LYS A 1 58  ? 24.703 29.387 38.500  1.00 27.68  ? 429 LYS A C   1 
ATOM   398  O O   . LYS A 1 58  ? 24.313 30.525 38.795  1.00 25.96  ? 429 LYS A O   1 
ATOM   399  C CB  . LYS A 1 58  ? 24.376 27.578 40.197  1.00 32.45  ? 429 LYS A CB  1 
ATOM   400  C CG  . LYS A 1 58  ? 23.521 26.455 40.736  1.00 37.61  ? 429 LYS A CG  1 
ATOM   401  C CD  . LYS A 1 58  ? 22.076 26.904 40.847  1.00 43.92  ? 429 LYS A CD  1 
ATOM   402  C CE  . LYS A 1 58  ? 21.137 25.716 41.049  1.00 49.90  ? 429 LYS A CE  1 
ATOM   403  N NZ  . LYS A 1 58  ? 20.933 24.903 39.805  1.00 49.66  ? 429 LYS A NZ  1 
ATOM   404  N N   . PHE A 1 59  ? 25.857 29.159 37.870  1.00 26.85  ? 430 PHE A N   1 
ATOM   405  C CA  . PHE A 1 59  ? 26.742 30.249 37.470  1.00 25.43  ? 430 PHE A CA  1 
ATOM   406  C C   . PHE A 1 59  ? 26.037 31.140 36.429  1.00 26.45  ? 430 PHE A C   1 
ATOM   407  O O   . PHE A 1 59  ? 26.100 32.374 36.502  1.00 25.97  ? 430 PHE A O   1 
ATOM   408  C CB  . PHE A 1 59  ? 28.056 29.665 36.925  1.00 26.04  ? 430 PHE A CB  1 
ATOM   409  C CG  . PHE A 1 59  ? 29.054 30.702 36.482  1.00 29.16  ? 430 PHE A CG  1 
ATOM   410  C CD1 . PHE A 1 59  ? 29.002 31.235 35.189  1.00 27.55  ? 430 PHE A CD1 1 
ATOM   411  C CD2 . PHE A 1 59  ? 30.012 31.178 37.357  1.00 26.80  ? 430 PHE A CD2 1 
ATOM   412  C CE1 . PHE A 1 59  ? 29.875 32.224 34.786  1.00 23.46  ? 430 PHE A CE1 1 
ATOM   413  C CE2 . PHE A 1 59  ? 30.898 32.176 36.959  1.00 30.02  ? 430 PHE A CE2 1 
ATOM   414  C CZ  . PHE A 1 59  ? 30.824 32.701 35.666  1.00 29.21  ? 430 PHE A CZ  1 
ATOM   415  N N   . ALA A 1 60  ? 25.303 30.506 35.513  1.00 29.49  ? 431 ALA A N   1 
ATOM   416  C CA  . ALA A 1 60  ? 24.581 31.217 34.443  1.00 32.60  ? 431 ALA A CA  1 
ATOM   417  C C   . ALA A 1 60  ? 23.440 32.065 35.009  1.00 34.93  ? 431 ALA A C   1 
ATOM   418  O O   . ALA A 1 60  ? 23.204 33.190 34.574  1.00 29.48  ? 431 ALA A O   1 
ATOM   419  C CB  . ALA A 1 60  ? 24.044 30.215 33.430  1.00 31.63  ? 431 ALA A CB  1 
ATOM   420  N N   . LYS A 1 61  ? 22.711 31.503 35.969  1.00 37.49  ? 432 LYS A N   1 
ATOM   421  C CA  . LYS A 1 61  ? 21.623 32.240 36.602  1.00 40.53  ? 432 LYS A CA  1 
ATOM   422  C C   . LYS A 1 61  ? 22.246 33.493 37.207  1.00 40.18  ? 432 LYS A C   1 
ATOM   423  O O   . LYS A 1 61  ? 21.784 34.618 36.997  1.00 41.49  ? 432 LYS A O   1 
ATOM   424  C CB  . LYS A 1 61  ? 20.987 31.424 37.739  1.00 40.18  ? 432 LYS A CB  1 
ATOM   425  C CG  . LYS A 1 61  ? 20.289 30.160 37.318  1.00 43.92  ? 432 LYS A CG  1 
ATOM   426  C CD  . LYS A 1 61  ? 20.051 29.233 38.519  1.00 46.30  ? 432 LYS A CD  1 
ATOM   427  C CE  . LYS A 1 61  ? 19.274 27.979 38.099  1.00 46.30  ? 432 LYS A CE  1 
ATOM   428  N NZ  . LYS A 1 61  ? 19.261 26.932 39.145  1.00 46.92  ? 432 LYS A NZ  1 
ATOM   429  N N   . ALA A 1 62  ? 23.327 33.277 37.936  1.00 38.74  ? 433 ALA A N   1 
ATOM   430  C CA  . ALA A 1 62  ? 23.991 34.356 38.601  1.00 38.63  ? 433 ALA A CA  1 
ATOM   431  C C   . ALA A 1 62  ? 24.416 35.421 37.617  1.00 42.89  ? 433 ALA A C   1 
ATOM   432  O O   . ALA A 1 62  ? 23.862 36.522 37.615  1.00 45.33  ? 433 ALA A O   1 
ATOM   433  C CB  . ALA A 1 62  ? 25.180 33.829 39.379  1.00 36.29  ? 433 ALA A CB  1 
ATOM   434  N N   . VAL A 1 63  ? 25.320 35.061 36.711  1.00 45.57  ? 434 VAL A N   1 
ATOM   435  C CA  . VAL A 1 63  ? 25.866 36.019 35.763  1.00 44.80  ? 434 VAL A CA  1 
ATOM   436  C C   . VAL A 1 63  ? 25.012 36.315 34.536  1.00 45.41  ? 434 VAL A C   1 
ATOM   437  O O   . VAL A 1 63  ? 25.032 37.439 34.017  1.00 47.50  ? 434 VAL A O   1 
ATOM   438  C CB  . VAL A 1 63  ? 27.310 35.630 35.382  1.00 44.41  ? 434 VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 63  ? 27.909 36.666 34.464  1.00 46.42  ? 434 VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 63  ? 28.154 35.535 36.650  1.00 44.65  ? 434 VAL A CG2 1 
ATOM   441  N N   . GLY A 1 64  ? 24.286 35.313 34.061  1.00 43.45  ? 435 GLY A N   1 
ATOM   442  C CA  . GLY A 1 64  ? 23.420 35.513 32.914  1.00 43.54  ? 435 GLY A CA  1 
ATOM   443  C C   . GLY A 1 64  ? 23.820 34.740 31.678  1.00 44.03  ? 435 GLY A C   1 
ATOM   444  O O   . GLY A 1 64  ? 24.720 33.889 31.717  1.00 41.32  ? 435 GLY A O   1 
ATOM   445  N N   . GLN A 1 65  ? 23.107 35.027 30.586  1.00 49.45  ? 436 GLN A N   1 
ATOM   446  C CA  . GLN A 1 65  ? 23.323 34.429 29.252  1.00 48.24  ? 436 GLN A CA  1 
ATOM   447  C C   . GLN A 1 65  ? 23.099 32.918 29.187  1.00 48.91  ? 436 GLN A C   1 
ATOM   448  O O   . GLN A 1 65  ? 24.033 32.155 28.968  1.00 46.26  ? 436 GLN A O   1 
ATOM   449  C CB  . GLN A 1 65  ? 24.714 34.830 28.713  1.00 46.83  ? 436 GLN A CB  1 
ATOM   450  C CG  . GLN A 1 65  ? 25.161 34.231 27.385  1.00 41.63  ? 436 GLN A CG  1 
ATOM   451  C CD  . GLN A 1 65  ? 26.530 33.562 27.496  1.00 40.42  ? 436 GLN A CD  1 
ATOM   452  O OE1 . GLN A 1 65  ? 27.567 34.212 27.441  1.00 36.70  ? 436 GLN A OE1 1 
ATOM   453  N NE2 . GLN A 1 65  ? 26.531 32.255 27.693  1.00 43.59  ? 436 GLN A NE2 1 
ATOM   454  N N   . GLY A 1 66  ? 21.841 32.514 29.379  1.00 53.50  ? 437 GLY A N   1 
ATOM   455  C CA  . GLY A 1 66  ? 21.436 31.114 29.319  1.00 58.91  ? 437 GLY A CA  1 
ATOM   456  C C   . GLY A 1 66  ? 22.511 30.042 29.211  1.00 63.16  ? 437 GLY A C   1 
ATOM   457  O O   . GLY A 1 66  ? 22.779 29.531 28.108  1.00 66.35  ? 437 GLY A O   1 
ATOM   458  N N   . CYS A 1 67  ? 23.126 29.727 30.359  1.00 64.09  ? 438 CYS A N   1 
ATOM   459  C CA  . CYS A 1 67  ? 24.203 28.715 30.519  1.00 61.62  ? 438 CYS A CA  1 
ATOM   460  C C   . CYS A 1 67  ? 25.589 28.978 29.865  1.00 54.45  ? 438 CYS A C   1 
ATOM   461  O O   . CYS A 1 67  ? 26.089 28.195 29.051  1.00 52.65  ? 438 CYS A O   1 
ATOM   462  C CB  . CYS A 1 67  ? 23.663 27.301 30.245  1.00 64.97  ? 438 CYS A CB  1 
ATOM   463  S SG  . CYS A 1 67  ? 22.426 26.786 31.504  1.00 70.20  ? 438 CYS A SG  1 
ATOM   464  N N   . VAL A 1 68  ? 26.205 30.069 30.329  1.00 45.76  ? 439 VAL A N   1 
ATOM   465  C CA  . VAL A 1 68  ? 27.500 30.573 29.907  1.00 33.71  ? 439 VAL A CA  1 
ATOM   466  C C   . VAL A 1 68  ? 28.635 29.537 29.759  1.00 35.12  ? 439 VAL A C   1 
ATOM   467  O O   . VAL A 1 68  ? 28.685 28.503 30.436  1.00 33.70  ? 439 VAL A O   1 
ATOM   468  C CB  . VAL A 1 68  ? 27.904 31.757 30.842  1.00 32.15  ? 439 VAL A CB  1 
ATOM   469  C CG1 . VAL A 1 68  ? 29.335 31.916 30.943  1.00 28.64  ? 439 VAL A CG1 1 
ATOM   470  C CG2 . VAL A 1 68  ? 27.348 33.063 30.355  1.00 31.17  ? 439 VAL A CG2 1 
ATOM   471  N N   . GLU A 1 69  ? 29.503 29.787 28.786  1.00 33.52  ? 440 GLU A N   1 
ATOM   472  C CA  . GLU A 1 69  ? 30.658 28.931 28.534  1.00 34.55  ? 440 GLU A CA  1 
ATOM   473  C C   . GLU A 1 69  ? 31.752 29.325 29.513  1.00 28.54  ? 440 GLU A C   1 
ATOM   474  O O   . GLU A 1 69  ? 32.676 28.564 29.719  1.00 28.54  ? 440 GLU A O   1 
ATOM   475  C CB  . GLU A 1 69  ? 31.202 29.125 27.109  1.00 39.11  ? 440 GLU A CB  1 
ATOM   476  C CG  . GLU A 1 69  ? 30.248 28.786 25.990  1.00 48.63  ? 440 GLU A CG  1 
ATOM   477  C CD  . GLU A 1 69  ? 30.317 27.333 25.555  1.00 53.28  ? 440 GLU A CD  1 
ATOM   478  O OE1 . GLU A 1 69  ? 30.508 26.442 26.418  1.00 52.43  ? 440 GLU A OE1 1 
ATOM   479  O OE2 . GLU A 1 69  ? 30.168 27.092 24.329  1.00 58.16  ? 440 GLU A OE2 1 
ATOM   480  N N   . ILE A 1 70  ? 31.714 30.565 30.001  1.00 29.03  ? 441 ILE A N   1 
ATOM   481  C CA  . ILE A 1 70  ? 32.699 31.043 30.987  1.00 32.12  ? 441 ILE A CA  1 
ATOM   482  C C   . ILE A 1 70  ? 32.548 30.174 32.233  1.00 30.42  ? 441 ILE A C   1 
ATOM   483  O O   . ILE A 1 70  ? 33.541 29.739 32.814  1.00 30.35  ? 441 ILE A O   1 
ATOM   484  C CB  . ILE A 1 70  ? 32.464 32.511 31.380  1.00 32.46  ? 441 ILE A CB  1 
ATOM   485  C CG1 . ILE A 1 70  ? 32.703 33.407 30.158  1.00 33.38  ? 441 ILE A CG1 1 
ATOM   486  C CG2 . ILE A 1 70  ? 33.316 32.892 32.640  1.00 27.87  ? 441 ILE A CG2 1 
ATOM   487  C CD1 . ILE A 1 70  ? 32.370 34.853 30.380  1.00 33.13  ? 441 ILE A CD1 1 
ATOM   488  N N   . GLY A 1 71  ? 31.289 29.901 32.590  1.00 27.88  ? 442 GLY A N   1 
ATOM   489  C CA  . GLY A 1 71  ? 30.990 29.058 33.722  1.00 24.21  ? 442 GLY A CA  1 
ATOM   490  C C   . GLY A 1 71  ? 31.505 27.662 33.462  1.00 24.57  ? 442 GLY A C   1 
ATOM   491  O O   . GLY A 1 71  ? 32.171 27.088 34.318  1.00 24.05  ? 442 GLY A O   1 
ATOM   492  N N   . SER A 1 72  ? 31.281 27.140 32.253  1.00 21.90  ? 443 SER A N   1 
ATOM   493  C CA  . SER A 1 72  ? 31.729 25.789 31.892  1.00 21.23  ? 443 SER A CA  1 
ATOM   494  C C   . SER A 1 72  ? 33.266 25.666 31.962  1.00 17.80  ? 443 SER A C   1 
ATOM   495  O O   . SER A 1 72  ? 33.810 24.632 32.392  1.00 16.63  ? 443 SER A O   1 
ATOM   496  C CB  . SER A 1 72  ? 31.223 25.449 30.468  1.00 25.98  ? 443 SER A CB  1 
ATOM   497  O OG  . SER A 1 72  ? 31.144 24.051 30.247  1.00 31.65  ? 443 SER A OG  1 
ATOM   498  N N   . GLN A 1 73  ? 33.935 26.740 31.541  1.00 19.63  ? 444 GLN A N   1 
ATOM   499  C CA  . GLN A 1 73  ? 35.384 26.847 31.521  1.00 23.00  ? 444 GLN A CA  1 
ATOM   500  C C   . GLN A 1 73  ? 35.916 26.967 32.950  1.00 26.26  ? 444 GLN A C   1 
ATOM   501  O O   . GLN A 1 73  ? 36.906 26.305 33.307  1.00 23.42  ? 444 GLN A O   1 
ATOM   502  C CB  . GLN A 1 73  ? 35.795 28.051 30.685  1.00 28.05  ? 444 GLN A CB  1 
ATOM   503  C CG  . GLN A 1 73  ? 37.291 28.418 30.748  1.00 34.03  ? 444 GLN A CG  1 
ATOM   504  C CD  . GLN A 1 73  ? 38.244 27.257 30.459  1.00 40.05  ? 444 GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 73  ? 37.836 26.187 29.982  1.00 40.68  ? 444 GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 73  ? 39.529 27.465 30.759  1.00 39.71  ? 444 GLN A NE2 1 
ATOM   507  N N   . ARG A 1 74  ? 35.286 27.815 33.765  1.00 23.39  ? 445 ARG A N   1 
ATOM   508  C CA  . ARG A 1 74  ? 35.699 27.923 35.174  1.00 23.01  ? 445 ARG A CA  1 
ATOM   509  C C   . ARG A 1 74  ? 35.621 26.549 35.863  1.00 17.49  ? 445 ARG A C   1 
ATOM   510  O O   . ARG A 1 74  ? 36.512 26.158 36.621  1.00 16.27  ? 445 ARG A O   1 
ATOM   511  C CB  . ARG A 1 74  ? 34.799 28.899 35.939  1.00 26.31  ? 445 ARG A CB  1 
ATOM   512  C CG  . ARG A 1 74  ? 34.973 30.338 35.573  1.00 33.07  ? 445 ARG A CG  1 
ATOM   513  C CD  . ARG A 1 74  ? 35.326 31.173 36.786  1.00 37.40  ? 445 ARG A CD  1 
ATOM   514  N NE  . ARG A 1 74  ? 35.083 32.604 36.579  1.00 45.07  ? 445 ARG A NE  1 
ATOM   515  C CZ  . ARG A 1 74  ? 34.646 33.440 37.527  1.00 48.36  ? 445 ARG A CZ  1 
ATOM   516  N NH1 . ARG A 1 74  ? 34.400 32.995 38.752  1.00 48.88  ? 445 ARG A NH1 1 
ATOM   517  N NH2 . ARG A 1 74  ? 34.459 34.730 37.256  1.00 49.65  ? 445 ARG A NH2 1 
ATOM   518  N N   . TYR A 1 75  ? 34.542 25.818 35.604  1.00 17.66  ? 446 TYR A N   1 
ATOM   519  C CA  . TYR A 1 75  ? 34.340 24.512 36.211  1.00 16.57  ? 446 TYR A CA  1 
ATOM   520  C C   . TYR A 1 75  ? 35.432 23.522 35.794  1.00 21.06  ? 446 TYR A C   1 
ATOM   521  O O   . TYR A 1 75  ? 35.924 22.721 36.609  1.00 18.47  ? 446 TYR A O   1 
ATOM   522  C CB  . TYR A 1 75  ? 32.943 23.976 35.863  1.00 14.77  ? 446 TYR A CB  1 
ATOM   523  C CG  . TYR A 1 75  ? 32.638 22.695 36.548  1.00 17.12  ? 446 TYR A CG  1 
ATOM   524  C CD1 . TYR A 1 75  ? 32.451 22.659 37.931  1.00 18.83  ? 446 TYR A CD1 1 
ATOM   525  C CD2 . TYR A 1 75  ? 32.664 21.503 35.864  1.00 13.44  ? 446 TYR A CD2 1 
ATOM   526  C CE1 . TYR A 1 75  ? 32.318 21.460 38.592  1.00 14.52  ? 446 TYR A CE1 1 
ATOM   527  C CE2 . TYR A 1 75  ? 32.538 20.308 36.514  1.00 16.53  ? 446 TYR A CE2 1 
ATOM   528  C CZ  . TYR A 1 75  ? 32.366 20.296 37.901  1.00 16.54  ? 446 TYR A CZ  1 
ATOM   529  O OH  . TYR A 1 75  ? 32.276 19.098 38.567  1.00 17.54  ? 446 TYR A OH  1 
ATOM   530  N N   . LYS A 1 76  ? 35.828 23.567 34.522  1.00 17.91  ? 447 LYS A N   1 
ATOM   531  C CA  . LYS A 1 76  ? 36.865 22.667 34.059  1.00 15.61  ? 447 LYS A CA  1 
ATOM   532  C C   . LYS A 1 76  ? 38.155 22.952 34.782  1.00 6.91   ? 447 LYS A C   1 
ATOM   533  O O   . LYS A 1 76  ? 38.854 22.033 35.124  1.00 12.62  ? 447 LYS A O   1 
ATOM   534  C CB  . LYS A 1 76  ? 37.074 22.792 32.542  1.00 23.26  ? 447 LYS A CB  1 
ATOM   535  C CG  . LYS A 1 76  ? 35.885 22.282 31.725  1.00 30.72  ? 447 LYS A CG  1 
ATOM   536  C CD  . LYS A 1 76  ? 35.994 22.718 30.272  1.00 38.90  ? 447 LYS A CD  1 
ATOM   537  C CE  . LYS A 1 76  ? 34.824 22.188 29.454  1.00 41.37  ? 447 LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 76  ? 34.889 20.698 29.383  1.00 49.11  ? 447 LYS A NZ  1 
ATOM   539  N N   . LEU A 1 77  ? 38.518 24.215 34.906  1.00 9.79   ? 448 LEU A N   1 
ATOM   540  C CA  . LEU A 1 77  ? 39.756 24.576 35.634  1.00 17.17  ? 448 LEU A CA  1 
ATOM   541  C C   . LEU A 1 77  ? 39.703 23.990 37.075  1.00 15.82  ? 448 LEU A C   1 
ATOM   542  O O   . LEU A 1 77  ? 40.666 23.381 37.564  1.00 13.15  ? 448 LEU A O   1 
ATOM   543  C CB  . LEU A 1 77  ? 39.906 26.098 35.691  1.00 15.64  ? 448 LEU A CB  1 
ATOM   544  C CG  . LEU A 1 77  ? 40.145 26.809 34.361  1.00 20.32  ? 448 LEU A CG  1 
ATOM   545  C CD1 . LEU A 1 77  ? 40.243 28.316 34.540  1.00 21.79  ? 448 LEU A CD1 1 
ATOM   546  C CD2 . LEU A 1 77  ? 41.417 26.258 33.761  1.00 22.48  ? 448 LEU A CD2 1 
ATOM   547  N N   . GLY A 1 78  ? 38.541 24.154 37.713  1.00 18.74  ? 449 GLY A N   1 
ATOM   548  C CA  . GLY A 1 78  ? 38.319 23.625 39.048  1.00 14.59  ? 449 GLY A CA  1 
ATOM   549  C C   . GLY A 1 78  ? 38.497 22.121 39.103  1.00 13.34  ? 449 GLY A C   1 
ATOM   550  O O   . GLY A 1 78  ? 39.228 21.626 39.946  1.00 14.02  ? 449 GLY A O   1 
ATOM   551  N N   . VAL A 1 79  ? 37.854 21.368 38.218  1.00 11.67  ? 450 VAL A N   1 
ATOM   552  C CA  . VAL A 1 79  ? 38.012 19.912 38.224  1.00 10.71  ? 450 VAL A CA  1 
ATOM   553  C C   . VAL A 1 79  ? 39.457 19.476 38.020  1.00 13.75  ? 450 VAL A C   1 
ATOM   554  O O   . VAL A 1 79  ? 39.912 18.487 38.608  1.00 15.64  ? 450 VAL A O   1 
ATOM   555  C CB  . VAL A 1 79  ? 37.150 19.254 37.122  1.00 15.70  ? 450 VAL A CB  1 
ATOM   556  C CG1 . VAL A 1 79  ? 37.505 17.786 36.964  1.00 17.56  ? 450 VAL A CG1 1 
ATOM   557  C CG2 . VAL A 1 79  ? 35.684 19.414 37.454  1.00 18.17  ? 450 VAL A CG2 1 
ATOM   558  N N   . ARG A 1 80  ? 40.185 20.212 37.176  1.00 15.63  ? 451 ARG A N   1 
ATOM   559  C CA  . ARG A 1 80  ? 41.591 19.898 36.907  1.00 16.78  ? 451 ARG A CA  1 
ATOM   560  C C   . ARG A 1 80  ? 42.422 20.146 38.166  1.00 11.45  ? 451 ARG A C   1 
ATOM   561  O O   . ARG A 1 80  ? 43.285 19.352 38.518  1.00 10.84  ? 451 ARG A O   1 
ATOM   562  C CB  . ARG A 1 80  ? 42.098 20.737 35.719  1.00 18.04  ? 451 ARG A CB  1 
ATOM   563  C CG  . ARG A 1 80  ? 41.456 20.285 34.401  1.00 22.40  ? 451 ARG A CG  1 
ATOM   564  C CD  . ARG A 1 80  ? 41.622 21.309 33.300  1.00 22.75  ? 451 ARG A CD  1 
ATOM   565  N NE  . ARG A 1 80  ? 40.919 20.905 32.086  1.00 27.58  ? 451 ARG A NE  1 
ATOM   566  C CZ  . ARG A 1 80  ? 40.789 21.679 31.004  1.00 34.62  ? 451 ARG A CZ  1 
ATOM   567  N NH1 . ARG A 1 80  ? 41.315 22.896 30.973  1.00 30.37  ? 451 ARG A NH1 1 
ATOM   568  N NH2 . ARG A 1 80  ? 40.110 21.247 29.951  1.00 36.70  ? 451 ARG A NH2 1 
ATOM   569  N N   . LEU A 1 81  ? 42.180 21.274 38.812  1.00 14.74  ? 452 LEU A N   1 
ATOM   570  C CA  . LEU A 1 81  ? 42.878 21.590 40.062  1.00 14.08  ? 452 LEU A CA  1 
ATOM   571  C C   . LEU A 1 81  ? 42.546 20.458 41.063  1.00 14.00  ? 452 LEU A C   1 
ATOM   572  O O   . LEU A 1 81  ? 43.427 19.884 41.690  1.00 16.33  ? 452 LEU A O   1 
ATOM   573  C CB  . LEU A 1 81  ? 42.383 22.923 40.604  1.00 14.14  ? 452 LEU A CB  1 
ATOM   574  C CG  . LEU A 1 81  ? 43.401 23.828 41.329  1.00 18.32  ? 452 LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 81  ? 42.724 24.789 42.245  1.00 12.95  ? 452 LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 81  ? 44.507 23.084 41.999  1.00 13.65  ? 452 LEU A CD2 1 
ATOM   577  N N   . TYR A 1 82  ? 41.271 20.098 41.153  1.00 16.17  ? 453 TYR A N   1 
ATOM   578  C CA  . TYR A 1 82  ? 40.815 19.030 42.029  1.00 14.55  ? 453 TYR A CA  1 
ATOM   579  C C   . TYR A 1 82  ? 41.595 17.725 41.784  1.00 18.54  ? 453 TYR A C   1 
ATOM   580  O O   . TYR A 1 82  ? 42.137 17.143 42.730  1.00 18.18  ? 453 TYR A O   1 
ATOM   581  C CB  . TYR A 1 82  ? 39.281 18.897 41.893  1.00 11.96  ? 453 TYR A CB  1 
ATOM   582  C CG  . TYR A 1 82  ? 38.658 17.589 42.288  1.00 14.56  ? 453 TYR A CG  1 
ATOM   583  C CD1 . TYR A 1 82  ? 38.464 17.241 43.629  1.00 15.77  ? 453 TYR A CD1 1 
ATOM   584  C CD2 . TYR A 1 82  ? 38.201 16.705 41.314  1.00 17.32  ? 453 TYR A CD2 1 
ATOM   585  C CE1 . TYR A 1 82  ? 37.823 16.045 43.973  1.00 15.58  ? 453 TYR A CE1 1 
ATOM   586  C CE2 . TYR A 1 82  ? 37.573 15.519 41.646  1.00 16.50  ? 453 TYR A CE2 1 
ATOM   587  C CZ  . TYR A 1 82  ? 37.386 15.192 42.978  1.00 19.05  ? 453 TYR A CZ  1 
ATOM   588  O OH  . TYR A 1 82  ? 36.782 13.997 43.306  1.00 19.52  ? 453 TYR A OH  1 
ATOM   589  N N   . TYR A 1 83  ? 41.750 17.293 40.530  1.00 18.53  ? 454 TYR A N   1 
ATOM   590  C CA  . TYR A 1 83  ? 42.512 16.061 40.263  1.00 17.96  ? 454 TYR A CA  1 
ATOM   591  C C   . TYR A 1 83  ? 43.983 16.250 40.595  1.00 14.39  ? 454 TYR A C   1 
ATOM   592  O O   . TYR A 1 83  ? 44.646 15.315 41.036  1.00 19.22  ? 454 TYR A O   1 
ATOM   593  C CB  . TYR A 1 83  ? 42.385 15.590 38.794  1.00 17.72  ? 454 TYR A CB  1 
ATOM   594  C CG  . TYR A 1 83  ? 41.040 15.008 38.408  1.00 18.94  ? 454 TYR A CG  1 
ATOM   595  C CD1 . TYR A 1 83  ? 40.444 14.011 39.184  1.00 20.77  ? 454 TYR A CD1 1 
ATOM   596  C CD2 . TYR A 1 83  ? 40.355 15.461 37.267  1.00 19.87  ? 454 TYR A CD2 1 
ATOM   597  C CE1 . TYR A 1 83  ? 39.201 13.477 38.844  1.00 22.70  ? 454 TYR A CE1 1 
ATOM   598  C CE2 . TYR A 1 83  ? 39.106 14.932 36.917  1.00 18.95  ? 454 TYR A CE2 1 
ATOM   599  C CZ  . TYR A 1 83  ? 38.535 13.942 37.706  1.00 22.85  ? 454 TYR A CZ  1 
ATOM   600  O OH  . TYR A 1 83  ? 37.303 13.396 37.382  1.00 24.47  ? 454 TYR A OH  1 
ATOM   601  N N   . ARG A 1 84  ? 44.518 17.438 40.335  1.00 17.86  ? 455 ARG A N   1 
ATOM   602  C CA  . ARG A 1 84  ? 45.926 17.709 40.646  1.00 15.56  ? 455 ARG A CA  1 
ATOM   603  C C   . ARG A 1 84  ? 46.171 17.576 42.166  1.00 19.87  ? 455 ARG A C   1 
ATOM   604  O O   . ARG A 1 84  ? 47.066 16.849 42.614  1.00 20.39  ? 455 ARG A O   1 
ATOM   605  C CB  . ARG A 1 84  ? 46.296 19.125 40.216  1.00 14.24  ? 455 ARG A CB  1 
ATOM   606  C CG  . ARG A 1 84  ? 47.655 19.548 40.680  1.00 15.79  ? 455 ARG A CG  1 
ATOM   607  C CD  . ARG A 1 84  ? 47.866 21.033 40.492  1.00 23.30  ? 455 ARG A CD  1 
ATOM   608  N NE  . ARG A 1 84  ? 48.963 21.215 39.570  1.00 34.23  ? 455 ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 84  ? 50.094 21.856 39.816  1.00 30.73  ? 455 ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 84  ? 50.336 22.451 40.969  1.00 26.79  ? 455 ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 84  ? 51.046 21.791 38.909  1.00 38.15  ? 455 ARG A NH2 1 
ATOM   612  N N   . VAL A 1 85  ? 45.369 18.283 42.951  1.00 16.03  ? 456 VAL A N   1 
ATOM   613  C CA  . VAL A 1 85  ? 45.540 18.253 44.397  1.00 19.04  ? 456 VAL A CA  1 
ATOM   614  C C   . VAL A 1 85  ? 45.305 16.852 44.955  1.00 19.39  ? 456 VAL A C   1 
ATOM   615  O O   . VAL A 1 85  ? 46.097 16.384 45.788  1.00 19.29  ? 456 VAL A O   1 
ATOM   616  C CB  . VAL A 1 85  ? 44.697 19.356 45.105  1.00 18.16  ? 456 VAL A CB  1 
ATOM   617  C CG1 . VAL A 1 85  ? 44.843 19.239 46.643  1.00 17.21  ? 456 VAL A CG1 1 
ATOM   618  C CG2 . VAL A 1 85  ? 45.203 20.739 44.680  1.00 14.81  ? 456 VAL A CG2 1 
ATOM   619  N N   . MET A 1 86  ? 44.291 16.153 44.437  1.00 17.91  ? 457 MET A N   1 
ATOM   620  C CA  . MET A 1 86  ? 44.001 14.793 44.871  1.00 19.32  ? 457 MET A CA  1 
ATOM   621  C C   . MET A 1 86  ? 45.256 13.939 44.668  1.00 25.10  ? 457 MET A C   1 
ATOM   622  O O   . MET A 1 86  ? 45.705 13.215 45.566  1.00 24.50  ? 457 MET A O   1 
ATOM   623  C CB  . MET A 1 86  ? 42.833 14.206 44.072  1.00 18.09  ? 457 MET A CB  1 
ATOM   624  C CG  . MET A 1 86  ? 42.451 12.799 44.524  1.00 21.26  ? 457 MET A CG  1 
ATOM   625  S SD  . MET A 1 86  ? 41.121 11.982 43.658  1.00 21.05  ? 457 MET A SD  1 
ATOM   626  C CE  . MET A 1 86  ? 40.130 13.302 43.349  1.00 19.54  ? 457 MET A CE  1 
ATOM   627  N N   . GLU A 1 87  ? 45.836 14.068 43.476  1.00 30.03  ? 458 GLU A N   1 
ATOM   628  C CA  . GLU A 1 87  ? 47.048 13.372 43.065  1.00 27.44  ? 458 GLU A CA  1 
ATOM   629  C C   . GLU A 1 87  ? 48.198 13.606 44.039  1.00 23.78  ? 458 GLU A C   1 
ATOM   630  O O   . GLU A 1 87  ? 48.819 12.650 44.466  1.00 24.31  ? 458 GLU A O   1 
ATOM   631  C CB  . GLU A 1 87  ? 47.438 13.885 41.682  1.00 33.04  ? 458 GLU A CB  1 
ATOM   632  C CG  . GLU A 1 87  ? 47.408 12.862 40.582  1.00 40.64  ? 458 GLU A CG  1 
ATOM   633  C CD  . GLU A 1 87  ? 48.701 12.120 40.518  1.00 42.71  ? 458 GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 87  ? 48.991 11.400 41.496  1.00 46.64  ? 458 GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 87  ? 49.444 12.287 39.522  1.00 41.91  ? 458 GLU A OE2 1 
ATOM   636  N N   . SER A 1 88  ? 48.517 14.868 44.340  1.00 22.29  ? 459 SER A N   1 
ATOM   637  C CA  . SER A 1 88  ? 49.602 15.178 45.286  1.00 27.14  ? 459 SER A CA  1 
ATOM   638  C C   . SER A 1 88  ? 49.370 14.643 46.705  1.00 27.33  ? 459 SER A C   1 
ATOM   639  O O   . SER A 1 88  ? 50.311 14.183 47.340  1.00 29.40  ? 459 SER A O   1 
ATOM   640  C CB  . SER A 1 88  ? 49.912 16.670 45.351  1.00 25.28  ? 459 SER A CB  1 
ATOM   641  O OG  . SER A 1 88  ? 48.755 17.421 45.091  1.00 38.26  ? 459 SER A OG  1 
ATOM   642  N N   . MET A 1 89  ? 48.136 14.728 47.203  1.00 29.11  ? 460 MET A N   1 
ATOM   643  C CA  . MET A 1 89  ? 47.779 14.201 48.527  1.00 30.35  ? 460 MET A CA  1 
ATOM   644  C C   . MET A 1 89  ? 48.007 12.692 48.571  1.00 31.61  ? 460 MET A C   1 
ATOM   645  O O   . MET A 1 89  ? 48.685 12.198 49.471  1.00 35.41  ? 460 MET A O   1 
ATOM   646  C CB  . MET A 1 89  ? 46.316 14.487 48.855  1.00 28.45  ? 460 MET A CB  1 
ATOM   647  C CG  . MET A 1 89  ? 46.017 15.946 49.130  1.00 27.30  ? 460 MET A CG  1 
ATOM   648  S SD  . MET A 1 89  ? 44.282 16.134 49.567  1.00 29.07  ? 460 MET A SD  1 
ATOM   649  C CE  . MET A 1 89  ? 44.264 17.799 50.132  1.00 21.95  ? 460 MET A CE  1 
ATOM   650  N N   . LEU A 1 90  ? 47.434 11.968 47.610  1.00 32.80  ? 461 LEU A N   1 
ATOM   651  C CA  . LEU A 1 90  ? 47.604 10.517 47.511  1.00 34.42  ? 461 LEU A CA  1 
ATOM   652  C C   . LEU A 1 90  ? 49.076 10.146 47.365  1.00 36.52  ? 461 LEU A C   1 
ATOM   653  O O   . LEU A 1 90  ? 49.511 9.134  47.897  1.00 38.51  ? 461 LEU A O   1 
ATOM   654  C CB  . LEU A 1 90  ? 46.837 9.940  46.317  1.00 31.78  ? 461 LEU A CB  1 
ATOM   655  C CG  . LEU A 1 90  ? 45.306 9.950  46.338  1.00 35.20  ? 461 LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 90  ? 44.781 9.302  45.077  1.00 30.60  ? 461 LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 90  ? 44.781 9.221  47.561  1.00 33.39  ? 461 LEU A CD2 1 
ATOM   658  N N   . LYS A 1 91  ? 49.834 10.937 46.608  1.00 41.62  ? 462 LYS A N   1 
ATOM   659  C CA  . LYS A 1 91  ? 51.267 10.675 46.426  1.00 45.22  ? 462 LYS A CA  1 
ATOM   660  C C   . LYS A 1 91  ? 52.070 10.880 47.711  1.00 48.12  ? 462 LYS A C   1 
ATOM   661  O O   . LYS A 1 91  ? 53.087 10.218 47.927  1.00 51.97  ? 462 LYS A O   1 
ATOM   662  C CB  . LYS A 1 91  ? 51.877 11.583 45.355  1.00 43.65  ? 462 LYS A CB  1 
ATOM   663  C CG  . LYS A 1 91  ? 51.849 11.060 43.953  1.00 44.45  ? 462 LYS A CG  1 
ATOM   664  C CD  . LYS A 1 91  ? 52.918 11.767 43.142  1.00 48.35  ? 462 LYS A CD  1 
ATOM   665  C CE  . LYS A 1 91  ? 52.822 11.438 41.647  1.00 52.36  ? 462 LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 91  ? 51.770 12.229 40.914  1.00 52.85  ? 462 LYS A NZ  1 
ATOM   667  N N   . SER A 1 92  ? 51.681 11.871 48.507  1.00 48.39  ? 463 SER A N   1 
ATOM   668  C CA  . SER A 1 92  ? 52.386 12.160 49.741  1.00 48.35  ? 463 SER A CA  1 
ATOM   669  C C   . SER A 1 92  ? 52.084 11.136 50.812  1.00 51.24  ? 463 SER A C   1 
ATOM   670  O O   . SER A 1 92  ? 52.687 11.169 51.889  1.00 52.00  ? 463 SER A O   1 
ATOM   671  C CB  . SER A 1 92  ? 52.031 13.554 50.240  1.00 48.28  ? 463 SER A CB  1 
ATOM   672  O OG  . SER A 1 92  ? 52.556 14.543 49.376  1.00 48.42  ? 463 SER A OG  1 
ATOM   673  N N   . GLU A 1 93  ? 51.131 10.255 50.530  1.00 52.34  ? 464 GLU A N   1 
ATOM   674  C CA  . GLU A 1 93  ? 50.748 9.213  51.470  1.00 54.78  ? 464 GLU A CA  1 
ATOM   675  C C   . GLU A 1 93  ? 51.240 7.870  50.924  1.00 57.02  ? 464 GLU A C   1 
ATOM   676  O O   . GLU A 1 93  ? 50.451 7.128  50.299  1.00 59.62  ? 464 GLU A O   1 
ATOM   677  C CB  . GLU A 1 93  ? 49.229 9.224  51.678  1.00 53.85  ? 464 GLU A CB  1 
ATOM   678  C CG  . GLU A 1 93  ? 48.668 10.586 52.085  1.00 53.58  ? 464 GLU A CG  1 
ATOM   679  C CD  . GLU A 1 93  ? 49.207 11.069 53.425  1.00 55.47  ? 464 GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 93  ? 50.261 11.742 53.462  1.00 58.67  ? 464 GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 93  ? 48.572 10.776 54.455  1.00 57.70  ? 464 GLU A OE2 1 
ATOM   682  N N   . ASN A 1 101 ? 44.369 3.019  54.046  1.00 72.95  ? 472 ASN A N   1 
ATOM   683  C CA  . ASN A 1 101 ? 42.966 2.929  53.538  1.00 70.79  ? 472 ASN A CA  1 
ATOM   684  C C   . ASN A 1 101 ? 42.660 4.032  52.534  1.00 67.32  ? 472 ASN A C   1 
ATOM   685  O O   . ASN A 1 101 ? 42.002 5.023  52.861  1.00 67.92  ? 472 ASN A O   1 
ATOM   686  C CB  . ASN A 1 101 ? 41.938 2.970  54.698  1.00 73.96  ? 472 ASN A CB  1 
ATOM   687  C CG  . ASN A 1 101 ? 42.216 4.101  55.705  1.00 76.23  ? 472 ASN A CG  1 
ATOM   688  O OD1 . ASN A 1 101 ? 43.138 3.999  56.519  1.00 78.23  ? 472 ASN A OD1 1 
ATOM   689  N ND2 . ASN A 1 101 ? 41.456 5.190  55.622  1.00 77.67  ? 472 ASN A ND2 1 
ATOM   690  N N   . PHE A 1 102 ? 43.160 3.881  51.314  1.00 63.66  ? 473 PHE A N   1 
ATOM   691  C CA  . PHE A 1 102 ? 42.861 4.873  50.297  1.00 58.05  ? 473 PHE A CA  1 
ATOM   692  C C   . PHE A 1 102 ? 41.437 4.609  49.876  1.00 55.05  ? 473 PHE A C   1 
ATOM   693  O O   . PHE A 1 102 ? 40.734 5.514  49.451  1.00 54.97  ? 473 PHE A O   1 
ATOM   694  C CB  . PHE A 1 102 ? 43.818 4.785  49.112  1.00 56.88  ? 473 PHE A CB  1 
ATOM   695  C CG  . PHE A 1 102 ? 45.114 5.530  49.323  1.00 55.23  ? 473 PHE A CG  1 
ATOM   696  C CD1 . PHE A 1 102 ? 45.397 6.140  50.552  1.00 54.44  ? 473 PHE A CD1 1 
ATOM   697  C CD2 . PHE A 1 102 ? 46.070 5.590  48.312  1.00 55.02  ? 473 PHE A CD2 1 
ATOM   698  C CE1 . PHE A 1 102 ? 46.606 6.788  50.770  1.00 52.66  ? 473 PHE A CE1 1 
ATOM   699  C CE2 . PHE A 1 102 ? 47.286 6.237  48.520  1.00 53.63  ? 473 PHE A CE2 1 
ATOM   700  C CZ  . PHE A 1 102 ? 47.553 6.835  49.752  1.00 54.69  ? 473 PHE A CZ  1 
ATOM   701  N N   . SER A 1 103 ? 40.995 3.370  50.058  1.00 51.99  ? 474 SER A N   1 
ATOM   702  C CA  . SER A 1 103 ? 39.631 2.998  49.710  1.00 49.96  ? 474 SER A CA  1 
ATOM   703  C C   . SER A 1 103 ? 38.678 3.860  50.513  1.00 46.38  ? 474 SER A C   1 
ATOM   704  O O   . SER A 1 103 ? 37.726 4.428  49.970  1.00 45.03  ? 474 SER A O   1 
ATOM   705  C CB  . SER A 1 103 ? 39.369 1.517  50.018  1.00 52.91  ? 474 SER A CB  1 
ATOM   706  O OG  . SER A 1 103 ? 40.310 0.674  49.363  1.00 58.45  ? 474 SER A OG  1 
ATOM   707  N N   . LYS A 1 104 ? 38.977 4.008  51.801  1.00 44.52  ? 475 LYS A N   1 
ATOM   708  C CA  . LYS A 1 104 ? 38.127 4.797  52.681  1.00 40.23  ? 475 LYS A CA  1 
ATOM   709  C C   . LYS A 1 104 ? 38.166 6.233  52.222  1.00 36.05  ? 475 LYS A C   1 
ATOM   710  O O   . LYS A 1 104 ? 37.122 6.805  51.905  1.00 34.91  ? 475 LYS A O   1 
ATOM   711  C CB  . LYS A 1 104 ? 38.586 4.685  54.136  1.00 43.77  ? 475 LYS A CB  1 
ATOM   712  C CG  . LYS A 1 104 ? 37.548 5.162  55.160  1.00 47.23  ? 475 LYS A CG  1 
ATOM   713  C CD  . LYS A 1 104 ? 38.055 4.903  56.563  1.00 52.05  ? 475 LYS A CD  1 
ATOM   714  C CE  . LYS A 1 104 ? 38.527 3.448  56.691  1.00 55.80  ? 475 LYS A CE  1 
ATOM   715  N NZ  . LYS A 1 104 ? 39.274 3.151  57.956  1.00 60.56  ? 475 LYS A NZ  1 
ATOM   716  N N   . LEU A 1 105 ? 39.377 6.782  52.127  1.00 31.81  ? 476 LEU A N   1 
ATOM   717  C CA  . LEU A 1 105 ? 39.572 8.158  51.700  1.00 29.36  ? 476 LEU A CA  1 
ATOM   718  C C   . LEU A 1 105 ? 38.907 8.450  50.353  1.00 29.47  ? 476 LEU A C   1 
ATOM   719  O O   . LEU A 1 105 ? 37.980 9.281  50.236  1.00 27.78  ? 476 LEU A O   1 
ATOM   720  C CB  . LEU A 1 105 ? 41.063 8.475  51.616  1.00 25.92  ? 476 LEU A CB  1 
ATOM   721  C CG  . LEU A 1 105 ? 41.346 9.922  51.182  1.00 29.31  ? 476 LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 105 ? 40.651 10.928 52.114  1.00 25.60  ? 476 LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 105 ? 42.848 10.186 51.133  1.00 29.40  ? 476 LEU A CD2 1 
ATOM   724  N N   . LEU A 1 106 ? 39.363 7.721  49.343  1.00 33.38  ? 477 LEU A N   1 
ATOM   725  C CA  . LEU A 1 106 ? 38.861 7.883  47.995  1.00 31.76  ? 477 LEU A CA  1 
ATOM   726  C C   . LEU A 1 106 ? 37.408 7.548  47.858  1.00 34.39  ? 477 LEU A C   1 
ATOM   727  O O   . LEU A 1 106 ? 36.791 7.920  46.860  1.00 35.25  ? 477 LEU A O   1 
ATOM   728  C CB  . LEU A 1 106 ? 39.716 7.118  46.988  1.00 31.60  ? 477 LEU A CB  1 
ATOM   729  C CG  . LEU A 1 106 ? 41.111 7.754  46.861  1.00 29.90  ? 477 LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 106 ? 41.983 6.942  45.924  1.00 32.18  ? 477 LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 106 ? 40.998 9.194  46.379  1.00 27.17  ? 477 LEU A CD2 1 
ATOM   732  N N   . ASN A 1 107 ? 36.832 6.876  48.850  1.00 32.91  ? 478 ASN A N   1 
ATOM   733  C CA  . ASN A 1 107 ? 35.409 6.577  48.766  1.00 31.23  ? 478 ASN A CA  1 
ATOM   734  C C   . ASN A 1 107 ? 34.577 7.500  49.634  1.00 30.87  ? 478 ASN A C   1 
ATOM   735  O O   . ASN A 1 107 ? 33.345 7.428  49.615  1.00 34.54  ? 478 ASN A O   1 
ATOM   736  C CB  . ASN A 1 107 ? 35.103 5.103  49.062  1.00 32.53  ? 478 ASN A CB  1 
ATOM   737  C CG  . ASN A 1 107 ? 35.256 4.219  47.835  1.00 28.70  ? 478 ASN A CG  1 
ATOM   738  O OD1 . ASN A 1 107 ? 34.303 4.016  47.082  1.00 28.22  ? 478 ASN A OD1 1 
ATOM   739  N ND2 . ASN A 1 107 ? 36.456 3.714  47.618  1.00 25.26  ? 478 ASN A ND2 1 
ATOM   740  N N   . ASP A 1 108 ? 35.245 8.439  50.300  1.00 31.94  ? 479 ASP A N   1 
ATOM   741  C CA  . ASP A 1 108 ? 34.571 9.386  51.171  1.00 28.58  ? 479 ASP A CA  1 
ATOM   742  C C   . ASP A 1 108 ? 33.944 10.566 50.452  1.00 29.02  ? 479 ASP A C   1 
ATOM   743  O O   . ASP A 1 108 ? 34.649 11.389 49.867  1.00 32.25  ? 479 ASP A O   1 
ATOM   744  C CB  . ASP A 1 108 ? 35.529 9.901  52.258  1.00 30.91  ? 479 ASP A CB  1 
ATOM   745  C CG  . ASP A 1 108 ? 34.838 10.866 53.243  1.00 32.54  ? 479 ASP A CG  1 
ATOM   746  O OD1 . ASP A 1 108 ? 33.712 10.583 53.701  1.00 39.42  ? 479 ASP A OD1 1 
ATOM   747  O OD2 . ASP A 1 108 ? 35.398 11.925 53.552  1.00 39.05  ? 479 ASP A OD2 1 
ATOM   748  N N   . ASN A 1 109 ? 32.624 10.690 50.585  1.00 30.17  ? 480 ASN A N   1 
ATOM   749  C CA  . ASN A 1 109 ? 31.826 11.777 49.986  1.00 31.81  ? 480 ASN A CA  1 
ATOM   750  C C   . ASN A 1 109 ? 32.281 13.179 50.404  1.00 30.23  ? 480 ASN A C   1 
ATOM   751  O O   . ASN A 1 109 ? 32.344 14.110 49.581  1.00 28.55  ? 480 ASN A O   1 
ATOM   752  C CB  . ASN A 1 109 ? 30.360 11.630 50.390  1.00 38.65  ? 480 ASN A CB  1 
ATOM   753  C CG  . ASN A 1 109 ? 29.399 11.811 49.225  1.00 44.90  ? 480 ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 109 ? 29.252 12.920 48.645  1.00 46.49  ? 480 ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 109 ? 28.704 10.724 48.891  1.00 45.12  ? 480 ASN A ND2 1 
ATOM   756  N N   . ILE A 1 110 ? 32.602 13.330 51.683  1.00 25.72  ? 481 ILE A N   1 
ATOM   757  C CA  . ILE A 1 110 ? 33.033 14.622 52.196  1.00 21.72  ? 481 ILE A CA  1 
ATOM   758  C C   . ILE A 1 110 ? 34.373 15.003 51.572  1.00 19.57  ? 481 ILE A C   1 
ATOM   759  O O   . ILE A 1 110 ? 34.567 16.147 51.191  1.00 21.97  ? 481 ILE A O   1 
ATOM   760  C CB  . ILE A 1 110 ? 33.186 14.610 53.748  1.00 22.59  ? 481 ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 110 ? 31.845 14.329 54.434  1.00 24.30  ? 481 ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 110 ? 33.723 15.954 54.221  1.00 20.35  ? 481 ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 110 ? 30.941 15.518 54.465  1.00 23.87  ? 481 ILE A CD1 1 
ATOM   764  N N   . PHE A 1 111 ? 35.291 14.043 51.484  1.00 18.77  ? 482 PHE A N   1 
ATOM   765  C CA  . PHE A 1 111 ? 36.610 14.294 50.909  1.00 21.91  ? 482 PHE A CA  1 
ATOM   766  C C   . PHE A 1 111 ? 36.491 14.909 49.503  1.00 19.44  ? 482 PHE A C   1 
ATOM   767  O O   . PHE A 1 111 ? 36.892 16.050 49.259  1.00 17.43  ? 482 PHE A O   1 
ATOM   768  C CB  . PHE A 1 111 ? 37.406 12.992 50.821  1.00 20.80  ? 482 PHE A CB  1 
ATOM   769  C CG  . PHE A 1 111 ? 38.730 13.148 50.128  1.00 22.40  ? 482 PHE A CG  1 
ATOM   770  C CD1 . PHE A 1 111 ? 39.669 14.070 50.595  1.00 22.59  ? 482 PHE A CD1 1 
ATOM   771  C CD2 . PHE A 1 111 ? 39.040 12.381 49.000  1.00 24.16  ? 482 PHE A CD2 1 
ATOM   772  C CE1 . PHE A 1 111 ? 40.898 14.227 49.958  1.00 22.83  ? 482 PHE A CE1 1 
ATOM   773  C CE2 . PHE A 1 111 ? 40.272 12.528 48.348  1.00 21.05  ? 482 PHE A CE2 1 
ATOM   774  C CZ  . PHE A 1 111 ? 41.199 13.451 48.828  1.00 23.72  ? 482 PHE A CZ  1 
ATOM   775  N N   . HIS A 1 112 ? 35.807 14.183 48.628  1.00 23.43  ? 483 HIS A N   1 
ATOM   776  C CA  . HIS A 1 112 ? 35.620 14.606 47.248  1.00 18.17  ? 483 HIS A CA  1 
ATOM   777  C C   . HIS A 1 112 ? 34.881 15.889 47.079  1.00 18.92  ? 483 HIS A C   1 
ATOM   778  O O   . HIS A 1 112 ? 35.330 16.778 46.371  1.00 20.72  ? 483 HIS A O   1 
ATOM   779  C CB  . HIS A 1 112 ? 34.930 13.501 46.477  1.00 16.18  ? 483 HIS A CB  1 
ATOM   780  C CG  . HIS A 1 112 ? 35.820 12.332 46.219  1.00 17.02  ? 483 HIS A CG  1 
ATOM   781  N ND1 . HIS A 1 112 ? 36.997 12.443 45.508  1.00 19.27  ? 483 HIS A ND1 1 
ATOM   782  C CD2 . HIS A 1 112 ? 35.738 11.042 46.612  1.00 19.48  ? 483 HIS A CD2 1 
ATOM   783  C CE1 . HIS A 1 112 ? 37.604 11.272 45.480  1.00 18.07  ? 483 HIS A CE1 1 
ATOM   784  N NE2 . HIS A 1 112 ? 36.860 10.405 46.142  1.00 18.91  ? 483 HIS A NE2 1 
ATOM   785  N N   . MET A 1 113 ? 33.765 16.035 47.777  1.00 16.80  ? 484 MET A N   1 
ATOM   786  C CA  . MET A 1 113 ? 32.991 17.247 47.616  1.00 16.36  ? 484 MET A CA  1 
ATOM   787  C C   . MET A 1 113 ? 33.714 18.471 48.162  1.00 18.17  ? 484 MET A C   1 
ATOM   788  O O   . MET A 1 113 ? 33.619 19.556 47.587  1.00 16.41  ? 484 MET A O   1 
ATOM   789  C CB  . MET A 1 113 ? 31.599 17.072 48.238  1.00 18.73  ? 484 MET A CB  1 
ATOM   790  C CG  . MET A 1 113 ? 30.547 17.930 47.607  1.00 24.88  ? 484 MET A CG  1 
ATOM   791  S SD  . MET A 1 113 ? 30.301 17.577 45.802  1.00 28.15  ? 484 MET A SD  1 
ATOM   792  C CE  . MET A 1 113 ? 28.959 16.400 45.822  1.00 24.28  ? 484 MET A CE  1 
ATOM   793  N N   . SER A 1 114 ? 34.471 18.304 49.251  1.00 18.56  ? 485 SER A N   1 
ATOM   794  C CA  . SER A 1 114 ? 35.182 19.447 49.838  1.00 17.98  ? 485 SER A CA  1 
ATOM   795  C C   . SER A 1 114 ? 36.427 19.802 49.022  1.00 10.95  ? 485 SER A C   1 
ATOM   796  O O   . SER A 1 114 ? 36.717 20.960 48.817  1.00 12.63  ? 485 SER A O   1 
ATOM   797  C CB  . SER A 1 114 ? 35.540 19.190 51.332  1.00 18.18  ? 485 SER A CB  1 
ATOM   798  O OG  . SER A 1 114 ? 36.401 18.065 51.514  1.00 17.37  ? 485 SER A OG  1 
ATOM   799  N N   . LEU A 1 115 ? 37.150 18.792 48.573  1.00 13.35  ? 486 LEU A N   1 
ATOM   800  C CA  . LEU A 1 115 ? 38.344 19.017 47.772  1.00 14.42  ? 486 LEU A CA  1 
ATOM   801  C C   . LEU A 1 115 ? 37.910 19.756 46.479  1.00 16.70  ? 486 LEU A C   1 
ATOM   802  O O   . LEU A 1 115 ? 38.488 20.786 46.107  1.00 16.12  ? 486 LEU A O   1 
ATOM   803  C CB  . LEU A 1 115 ? 38.959 17.665 47.424  1.00 14.84  ? 486 LEU A CB  1 
ATOM   804  C CG  . LEU A 1 115 ? 40.479 17.455 47.477  1.00 22.56  ? 486 LEU A CG  1 
ATOM   805  C CD1 . LEU A 1 115 ? 40.958 16.638 46.276  1.00 17.43  ? 486 LEU A CD1 1 
ATOM   806  C CD2 . LEU A 1 115 ? 41.200 18.767 47.567  1.00 20.90  ? 486 LEU A CD2 1 
ATOM   807  N N   . LEU A 1 116 ? 36.847 19.256 45.849  1.00 15.11  ? 487 LEU A N   1 
ATOM   808  C CA  . LEU A 1 116 ? 36.292 19.852 44.613  1.00 18.81  ? 487 LEU A CA  1 
ATOM   809  C C   . LEU A 1 116 ? 35.861 21.287 44.852  1.00 18.21  ? 487 LEU A C   1 
ATOM   810  O O   . LEU A 1 116 ? 36.157 22.172 44.035  1.00 16.39  ? 487 LEU A O   1 
ATOM   811  C CB  . LEU A 1 116 ? 35.070 19.026 44.096  1.00 20.84  ? 487 LEU A CB  1 
ATOM   812  C CG  . LEU A 1 116 ? 34.684 18.850 42.612  1.00 23.47  ? 487 LEU A CG  1 
ATOM   813  C CD1 . LEU A 1 116 ? 33.215 19.124 42.440  1.00 21.34  ? 487 LEU A CD1 1 
ATOM   814  C CD2 . LEU A 1 116 ? 35.541 19.679 41.643  1.00 17.73  ? 487 LEU A CD2 1 
ATOM   815  N N   . ALA A 1 117 ? 35.167 21.547 45.978  1.00 16.66  ? 488 ALA A N   1 
ATOM   816  C CA  . ALA A 1 117 ? 34.715 22.904 46.288  1.00 8.81   ? 488 ALA A CA  1 
ATOM   817  C C   . ALA A 1 117 ? 35.884 23.829 46.551  1.00 6.58   ? 488 ALA A C   1 
ATOM   818  O O   . ALA A 1 117 ? 35.811 25.011 46.235  1.00 6.90   ? 488 ALA A O   1 
ATOM   819  C CB  . ALA A 1 117 ? 33.780 22.884 47.508  1.00 18.09  ? 488 ALA A CB  1 
ATOM   820  N N   . CYS A 1 118 ? 36.933 23.295 47.177  1.00 11.43  ? 489 CYS A N   1 
ATOM   821  C CA  . CYS A 1 118 ? 38.124 24.095 47.508  1.00 10.72  ? 489 CYS A CA  1 
ATOM   822  C C   . CYS A 1 118 ? 38.863 24.445 46.204  1.00 10.51  ? 489 CYS A C   1 
ATOM   823  O O   . CYS A 1 118 ? 39.328 25.562 46.033  1.00 11.54  ? 489 CYS A O   1 
ATOM   824  C CB  . CYS A 1 118 ? 39.056 23.343 48.473  1.00 12.43  ? 489 CYS A CB  1 
ATOM   825  S SG  . CYS A 1 118 ? 40.141 24.473 49.394  1.00 16.89  ? 489 CYS A SG  1 
ATOM   826  N N   . ALA A 1 119 ? 38.948 23.479 45.302  1.00 13.55  ? 490 ALA A N   1 
ATOM   827  C CA  . ALA A 1 119 ? 39.553 23.705 43.980  1.00 15.75  ? 490 ALA A CA  1 
ATOM   828  C C   . ALA A 1 119 ? 38.745 24.806 43.276  1.00 13.49  ? 490 ALA A C   1 
ATOM   829  O O   . ALA A 1 119 ? 39.304 25.781 42.750  1.00 12.58  ? 490 ALA A O   1 
ATOM   830  C CB  . ALA A 1 119 ? 39.509 22.407 43.169  1.00 11.81  ? 490 ALA A CB  1 
ATOM   831  N N   . LEU A 1 120 ? 37.414 24.685 43.323  1.00 16.26  ? 491 LEU A N   1 
ATOM   832  C CA  . LEU A 1 120 ? 36.525 25.680 42.707  1.00 15.92  ? 491 LEU A CA  1 
ATOM   833  C C   . LEU A 1 120 ? 36.570 27.044 43.366  1.00 18.65  ? 491 LEU A C   1 
ATOM   834  O O   . LEU A 1 120 ? 36.477 28.076 42.685  1.00 16.01  ? 491 LEU A O   1 
ATOM   835  C CB  . LEU A 1 120 ? 35.092 25.153 42.606  1.00 17.15  ? 491 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 120 ? 34.919 23.982 41.623  1.00 16.68  ? 491 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 120 ? 33.611 23.289 41.916  1.00 12.18  ? 491 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 120 ? 34.962 24.492 40.141  1.00 14.90  ? 491 LEU A CD2 1 
ATOM   839  N N   . GLU A 1 121 ? 36.768 27.075 44.684  1.00 15.51  ? 492 GLU A N   1 
ATOM   840  C CA  . GLU A 1 121 ? 36.888 28.351 45.371  1.00 11.58  ? 492 GLU A CA  1 
ATOM   841  C C   . GLU A 1 121 ? 38.157 29.081 44.906  1.00 9.20   ? 492 GLU A C   1 
ATOM   842  O O   . GLU A 1 121 ? 38.176 30.305 44.766  1.00 13.88  ? 492 GLU A O   1 
ATOM   843  C CB  . GLU A 1 121 ? 36.952 28.139 46.894  1.00 16.11  ? 492 GLU A CB  1 
ATOM   844  C CG  . GLU A 1 121 ? 37.094 29.429 47.682  1.00 17.66  ? 492 GLU A CG  1 
ATOM   845  C CD  . GLU A 1 121 ? 35.977 30.435 47.386  1.00 19.50  ? 492 GLU A CD  1 
ATOM   846  O OE1 . GLU A 1 121 ? 34.842 30.005 47.068  1.00 25.90  ? 492 GLU A OE1 1 
ATOM   847  O OE2 . GLU A 1 121 ? 36.234 31.657 47.461  1.00 19.67  ? 492 GLU A OE2 1 
ATOM   848  N N   . VAL A 1 122 ? 39.243 28.345 44.746  1.00 13.04  ? 493 VAL A N   1 
ATOM   849  C CA  . VAL A 1 122 ? 40.473 28.971 44.293  1.00 13.13  ? 493 VAL A CA  1 
ATOM   850  C C   . VAL A 1 122 ? 40.250 29.600 42.888  1.00 15.47  ? 493 VAL A C   1 
ATOM   851  O O   . VAL A 1 122 ? 40.595 30.753 42.660  1.00 15.85  ? 493 VAL A O   1 
ATOM   852  C CB  . VAL A 1 122 ? 41.636 27.951 44.310  1.00 15.91  ? 493 VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 122 ? 42.868 28.519 43.541  1.00 12.99  ? 493 VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 122 ? 42.008 27.614 45.786  1.00 12.52  ? 493 VAL A CG2 1 
ATOM   855  N N   . VAL A 1 123 ? 39.601 28.875 41.982  1.00 17.26  ? 494 VAL A N   1 
ATOM   856  C CA  . VAL A 1 123 ? 39.338 29.405 40.635  1.00 18.61  ? 494 VAL A CA  1 
ATOM   857  C C   . VAL A 1 123 ? 38.398 30.616 40.681  1.00 19.74  ? 494 VAL A C   1 
ATOM   858  O O   . VAL A 1 123 ? 38.625 31.613 39.979  1.00 18.55  ? 494 VAL A O   1 
ATOM   859  C CB  . VAL A 1 123 ? 38.747 28.320 39.709  1.00 17.34  ? 494 VAL A CB  1 
ATOM   860  C CG1 . VAL A 1 123 ? 38.358 28.932 38.380  1.00 20.35  ? 494 VAL A CG1 1 
ATOM   861  C CG2 . VAL A 1 123 ? 39.742 27.198 39.512  1.00 16.46  ? 494 VAL A CG2 1 
ATOM   862  N N   . MET A 1 124 ? 37.354 30.537 41.511  1.00 20.13  ? 495 MET A N   1 
ATOM   863  C CA  . MET A 1 124 ? 36.410 31.646 41.650  1.00 18.59  ? 495 MET A CA  1 
ATOM   864  C C   . MET A 1 124 ? 37.122 32.870 42.213  1.00 19.43  ? 495 MET A C   1 
ATOM   865  O O   . MET A 1 124 ? 36.890 34.002 41.780  1.00 20.28  ? 495 MET A O   1 
ATOM   866  C CB  . MET A 1 124 ? 35.266 31.277 42.603  1.00 22.16  ? 495 MET A CB  1 
ATOM   867  C CG  . MET A 1 124 ? 34.262 30.260 42.085  1.00 27.00  ? 495 MET A CG  1 
ATOM   868  S SD  . MET A 1 124 ? 33.354 30.808 40.608  1.00 29.26  ? 495 MET A SD  1 
ATOM   869  C CE  . MET A 1 124 ? 33.989 29.606 39.492  1.00 35.80  ? 495 MET A CE  1 
ATOM   870  N N   . ALA A 1 125 ? 37.993 32.646 43.186  1.00 18.25  ? 496 ALA A N   1 
ATOM   871  C CA  . ALA A 1 125 ? 38.699 33.754 43.797  1.00 18.85  ? 496 ALA A CA  1 
ATOM   872  C C   . ALA A 1 125 ? 39.698 34.382 42.841  1.00 19.97  ? 496 ALA A C   1 
ATOM   873  O O   . ALA A 1 125 ? 39.896 35.588 42.878  1.00 21.69  ? 496 ALA A O   1 
ATOM   874  C CB  . ALA A 1 125 ? 39.385 33.314 45.114  1.00 18.31  ? 496 ALA A CB  1 
ATOM   875  N N   . THR A 1 126 ? 40.329 33.600 41.967  1.00 22.30  ? 497 THR A N   1 
ATOM   876  C CA  . THR A 1 126 ? 41.283 34.237 41.069  1.00 23.30  ? 497 THR A CA  1 
ATOM   877  C C   . THR A 1 126 ? 40.569 35.048 39.970  1.00 23.86  ? 497 THR A C   1 
ATOM   878  O O   . THR A 1 126 ? 41.002 36.157 39.633  1.00 27.28  ? 497 THR A O   1 
ATOM   879  C CB  . THR A 1 126 ? 42.392 33.287 40.505  1.00 24.42  ? 497 THR A CB  1 
ATOM   880  O OG1 . THR A 1 126 ? 42.089 32.909 39.172  1.00 28.70  ? 497 THR A OG1 1 
ATOM   881  C CG2 . THR A 1 126 ? 42.560 32.061 41.325  1.00 14.89  ? 497 THR A CG2 1 
ATOM   882  N N   . TYR A 1 127 ? 39.429 34.574 39.485  1.00 26.00  ? 498 TYR A N   1 
ATOM   883  C CA  . TYR A 1 127 ? 38.709 35.339 38.447  1.00 34.04  ? 498 TYR A CA  1 
ATOM   884  C C   . TYR A 1 127 ? 37.501 36.081 38.997  1.00 37.78  ? 498 TYR A C   1 
ATOM   885  O O   . TYR A 1 127 ? 36.460 36.167 38.346  1.00 38.92  ? 498 TYR A O   1 
ATOM   886  C CB  . TYR A 1 127 ? 38.313 34.435 37.280  1.00 30.32  ? 498 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 127 ? 39.516 33.804 36.639  1.00 27.58  ? 498 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 127 ? 40.544 34.589 36.122  1.00 25.72  ? 498 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 127 ? 39.664 32.428 36.614  1.00 26.53  ? 498 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 127 ? 41.692 34.008 35.608  1.00 22.70  ? 498 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 127 ? 40.810 31.842 36.096  1.00 25.54  ? 498 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 127 ? 41.814 32.640 35.602  1.00 22.98  ? 498 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 127 ? 42.960 32.050 35.136  1.00 30.33  ? 498 TYR A OH  1 
ATOM   894  N N   . SER A 1 128 ? 37.694 36.679 40.172  1.00 43.63  ? 499 SER A N   1 
ATOM   895  C CA  . SER A 1 128 ? 36.650 37.412 40.883  1.00 47.40  ? 499 SER A CA  1 
ATOM   896  C C   . SER A 1 128 ? 36.490 38.859 40.411  1.00 48.88  ? 499 SER A C   1 
ATOM   897  O O   . SER A 1 128 ? 37.472 39.631 40.514  1.00 51.09  ? 499 SER A O   1 
ATOM   898  C CB  . SER A 1 128 ? 36.918 37.371 42.403  1.00 47.36  ? 499 SER A CB  1 
ATOM   899  O OG  . SER A 1 128 ? 38.139 38.019 42.755  1.00 48.70  ? 499 SER A OG  1 
ATOM   900  N N   . PHE A 1 143 ? 32.516 34.187 50.440  1.00 27.64  ? 514 PHE A N   1 
ATOM   901  C CA  . PHE A 1 143 ? 32.970 33.015 49.637  1.00 29.80  ? 514 PHE A CA  1 
ATOM   902  C C   . PHE A 1 143 ? 32.030 31.886 49.842  1.00 33.80  ? 514 PHE A C   1 
ATOM   903  O O   . PHE A 1 143 ? 32.237 30.830 49.223  1.00 45.57  ? 514 PHE A O   1 
ATOM   904  C CB  . PHE A 1 143 ? 34.293 32.436 50.150  1.00 27.77  ? 514 PHE A CB  1 
ATOM   905  C CG  . PHE A 1 143 ? 34.113 31.289 51.174  1.00 28.21  ? 514 PHE A CG  1 
ATOM   906  C CD1 . PHE A 1 143 ? 33.917 31.564 52.535  1.00 24.97  ? 514 PHE A CD1 1 
ATOM   907  C CD2 . PHE A 1 143 ? 34.108 29.948 50.766  1.00 26.00  ? 514 PHE A CD2 1 
ATOM   908  C CE1 . PHE A 1 143 ? 33.724 30.533 53.451  1.00 23.99  ? 514 PHE A CE1 1 
ATOM   909  C CE2 . PHE A 1 143 ? 33.910 28.906 51.681  1.00 28.99  ? 514 PHE A CE2 1 
ATOM   910  C CZ  . PHE A 1 143 ? 33.719 29.198 53.030  1.00 26.18  ? 514 PHE A CZ  1 
ATOM   911  N N   . PRO A 1 144 ? 30.988 32.034 50.679  1.00 26.92  ? 515 PRO A N   1 
ATOM   912  C CA  . PRO A 1 144 ? 30.283 30.764 50.712  1.00 22.55  ? 515 PRO A CA  1 
ATOM   913  C C   . PRO A 1 144 ? 29.437 30.377 49.511  1.00 19.79  ? 515 PRO A C   1 
ATOM   914  O O   . PRO A 1 144 ? 28.955 29.261 49.480  1.00 22.26  ? 515 PRO A O   1 
ATOM   915  C CB  . PRO A 1 144 ? 29.521 30.835 52.031  1.00 22.97  ? 515 PRO A CB  1 
ATOM   916  C CG  . PRO A 1 144 ? 29.133 32.288 52.071  1.00 22.31  ? 515 PRO A CG  1 
ATOM   917  C CD  . PRO A 1 144 ? 30.322 33.040 51.532  1.00 26.51  ? 515 PRO A CD  1 
ATOM   918  N N   . TRP A 1 145 ? 29.363 31.226 48.487  1.00 19.10  ? 516 TRP A N   1 
ATOM   919  C CA  . TRP A 1 145 ? 28.563 30.889 47.304  1.00 18.50  ? 516 TRP A CA  1 
ATOM   920  C C   . TRP A 1 145 ? 28.793 29.471 46.840  1.00 14.98  ? 516 TRP A C   1 
ATOM   921  O O   . TRP A 1 145 ? 27.838 28.730 46.627  1.00 18.53  ? 516 TRP A O   1 
ATOM   922  C CB  . TRP A 1 145 ? 28.842 31.864 46.162  1.00 24.90  ? 516 TRP A CB  1 
ATOM   923  C CG  . TRP A 1 145 ? 28.056 31.574 44.867  1.00 30.17  ? 516 TRP A CG  1 
ATOM   924  C CD1 . TRP A 1 145 ? 26.798 32.012 44.563  1.00 32.85  ? 516 TRP A CD1 1 
ATOM   925  C CD2 . TRP A 1 145 ? 28.506 30.813 43.717  1.00 27.14  ? 516 TRP A CD2 1 
ATOM   926  N NE1 . TRP A 1 145 ? 26.439 31.579 43.301  1.00 33.11  ? 516 TRP A NE1 1 
ATOM   927  C CE2 . TRP A 1 145 ? 27.465 30.846 42.761  1.00 30.07  ? 516 TRP A CE2 1 
ATOM   928  C CE3 . TRP A 1 145 ? 29.685 30.112 43.410  1.00 26.92  ? 516 TRP A CE3 1 
ATOM   929  C CZ2 . TRP A 1 145 ? 27.565 30.205 41.507  1.00 27.19  ? 516 TRP A CZ2 1 
ATOM   930  C CZ3 . TRP A 1 145 ? 29.786 29.471 42.168  1.00 30.22  ? 516 TRP A CZ3 1 
ATOM   931  C CH2 . TRP A 1 145 ? 28.725 29.527 41.230  1.00 27.64  ? 516 TRP A CH2 1 
ATOM   932  N N   . ILE A 1 146 ? 30.047 29.047 46.753  1.00 15.40  ? 517 ILE A N   1 
ATOM   933  C CA  . ILE A 1 146 ? 30.335 27.700 46.290  1.00 14.40  ? 517 ILE A CA  1 
ATOM   934  C C   . ILE A 1 146 ? 29.758 26.581 47.168  1.00 21.11  ? 517 ILE A C   1 
ATOM   935  O O   . ILE A 1 146 ? 29.505 25.463 46.696  1.00 18.25  ? 517 ILE A O   1 
ATOM   936  C CB  . ILE A 1 146 ? 31.867 27.471 46.075  1.00 17.95  ? 517 ILE A CB  1 
ATOM   937  C CG1 . ILE A 1 146 ? 32.130 26.094 45.433  1.00 17.32  ? 517 ILE A CG1 1 
ATOM   938  C CG2 . ILE A 1 146 ? 32.641 27.565 47.411  1.00 15.89  ? 517 ILE A CG2 1 
ATOM   939  C CD1 . ILE A 1 146 ? 31.670 25.988 43.988  1.00 22.46  ? 517 ILE A CD1 1 
ATOM   940  N N   . LEU A 1 147 ? 29.546 26.860 48.450  1.00 23.04  ? 518 LEU A N   1 
ATOM   941  C CA  . LEU A 1 147 ? 29.016 25.833 49.356  1.00 22.27  ? 518 LEU A CA  1 
ATOM   942  C C   . LEU A 1 147 ? 27.561 25.532 49.028  1.00 17.90  ? 518 LEU A C   1 
ATOM   943  O O   . LEU A 1 147 ? 27.127 24.379 49.067  1.00 20.19  ? 518 LEU A O   1 
ATOM   944  C CB  . LEU A 1 147 ? 29.132 26.311 50.810  1.00 27.34  ? 518 LEU A CB  1 
ATOM   945  C CG  . LEU A 1 147 ? 30.511 26.581 51.405  1.00 26.71  ? 518 LEU A CG  1 
ATOM   946  C CD1 . LEU A 1 147 ? 30.334 27.064 52.848  1.00 29.25  ? 518 LEU A CD1 1 
ATOM   947  C CD2 . LEU A 1 147 ? 31.325 25.304 51.359  1.00 26.99  ? 518 LEU A CD2 1 
ATOM   948  N N   . ASN A 1 148 ? 26.823 26.594 48.724  1.00 20.55  ? 519 ASN A N   1 
ATOM   949  C CA  . ASN A 1 148 ? 25.413 26.499 48.371  1.00 25.05  ? 519 ASN A CA  1 
ATOM   950  C C   . ASN A 1 148 ? 25.302 25.719 47.066  1.00 25.85  ? 519 ASN A C   1 
ATOM   951  O O   . ASN A 1 148 ? 24.500 24.781 46.926  1.00 24.80  ? 519 ASN A O   1 
ATOM   952  C CB  . ASN A 1 148 ? 24.822 27.888 48.147  1.00 30.62  ? 519 ASN A CB  1 
ATOM   953  C CG  . ASN A 1 148 ? 25.041 28.834 49.325  1.00 41.49  ? 519 ASN A CG  1 
ATOM   954  O OD1 . ASN A 1 148 ? 26.038 28.744 50.059  1.00 46.66  ? 519 ASN A OD1 1 
ATOM   955  N ND2 . ASN A 1 148 ? 24.117 29.780 49.490  1.00 48.50  ? 519 ASN A ND2 1 
ATOM   956  N N   . VAL A 1 149 ? 26.174 26.074 46.131  1.00 24.44  ? 520 VAL A N   1 
ATOM   957  C CA  . VAL A 1 149 ? 26.186 25.443 44.832  1.00 20.04  ? 520 VAL A CA  1 
ATOM   958  C C   . VAL A 1 149 ? 26.383 23.955 44.944  1.00 19.40  ? 520 VAL A C   1 
ATOM   959  O O   . VAL A 1 149 ? 25.618 23.195 44.354  1.00 24.18  ? 520 VAL A O   1 
ATOM   960  C CB  . VAL A 1 149 ? 27.216 26.132 43.904  1.00 20.82  ? 520 VAL A CB  1 
ATOM   961  C CG1 . VAL A 1 149 ? 27.257 25.460 42.555  1.00 20.39  ? 520 VAL A CG1 1 
ATOM   962  C CG2 . VAL A 1 149 ? 26.821 27.588 43.724  1.00 17.93  ? 520 VAL A CG2 1 
ATOM   963  N N   . LEU A 1 150 ? 27.345 23.511 45.749  1.00 18.17  ? 521 LEU A N   1 
ATOM   964  C CA  . LEU A 1 150 ? 27.571 22.084 45.898  1.00 18.02  ? 521 LEU A CA  1 
ATOM   965  C C   . LEU A 1 150 ? 26.818 21.472 47.075  1.00 20.21  ? 521 LEU A C   1 
ATOM   966  O O   . LEU A 1 150 ? 27.087 20.323 47.425  1.00 22.54  ? 521 LEU A O   1 
ATOM   967  C CB  . LEU A 1 150 ? 29.050 21.752 46.081  1.00 21.06  ? 521 LEU A CB  1 
ATOM   968  C CG  . LEU A 1 150 ? 30.178 22.271 45.173  1.00 27.77  ? 521 LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 150 ? 31.313 21.258 45.194  1.00 21.84  ? 521 LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 150 ? 29.695 22.545 43.735  1.00 24.79  ? 521 LEU A CD2 1 
ATOM   971  N N   . ASN A 1 151 ? 25.915 22.222 47.706  1.00 21.86  ? 522 ASN A N   1 
ATOM   972  C CA  . ASN A 1 151 ? 25.150 21.703 48.864  1.00 24.32  ? 522 ASN A CA  1 
ATOM   973  C C   . ASN A 1 151 ? 26.111 21.093 49.885  1.00 21.48  ? 522 ASN A C   1 
ATOM   974  O O   . ASN A 1 151 ? 25.994 19.923 50.272  1.00 21.21  ? 522 ASN A O   1 
ATOM   975  C CB  . ASN A 1 151 ? 24.139 20.642 48.420  1.00 26.31  ? 522 ASN A CB  1 
ATOM   976  C CG  . ASN A 1 151 ? 23.105 21.189 47.444  1.00 36.38  ? 522 ASN A CG  1 
ATOM   977  O OD1 . ASN A 1 151 ? 22.711 22.378 47.498  1.00 37.33  ? 522 ASN A OD1 1 
ATOM   978  N ND2 . ASN A 1 151 ? 22.676 20.334 46.517  1.00 38.00  ? 522 ASN A ND2 1 
ATOM   979  N N   . LEU A 1 152 ? 27.107 21.884 50.255  1.00 22.70  ? 523 LEU A N   1 
ATOM   980  C CA  . LEU A 1 152 ? 28.144 21.453 51.182  1.00 23.37  ? 523 LEU A CA  1 
ATOM   981  C C   . LEU A 1 152 ? 28.054 22.253 52.494  1.00 20.02  ? 523 LEU A C   1 
ATOM   982  O O   . LEU A 1 152 ? 27.989 23.481 52.488  1.00 18.28  ? 523 LEU A O   1 
ATOM   983  C CB  . LEU A 1 152 ? 29.519 21.694 50.544  1.00 23.21  ? 523 LEU A CB  1 
ATOM   984  C CG  . LEU A 1 152 ? 30.606 20.637 50.455  1.00 25.46  ? 523 LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 152 ? 31.940 21.380 50.329  1.00 23.70  ? 523 LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 152 ? 30.629 19.732 51.659  1.00 24.07  ? 523 LEU A CD2 1 
ATOM   987  N N   . LYS A 1 153 ? 28.034 21.537 53.610  1.00 22.38  ? 524 LYS A N   1 
ATOM   988  C CA  . LYS A 1 153 ? 27.979 22.185 54.915  1.00 24.28  ? 524 LYS A CA  1 
ATOM   989  C C   . LYS A 1 153 ? 29.364 22.793 55.197  1.00 20.20  ? 524 LYS A C   1 
ATOM   990  O O   . LYS A 1 153 ? 30.386 22.138 54.980  1.00 20.87  ? 524 LYS A O   1 
ATOM   991  C CB  . LYS A 1 153 ? 27.610 21.152 55.993  1.00 22.63  ? 524 LYS A CB  1 
ATOM   992  C CG  . LYS A 1 153 ? 26.112 20.811 56.054  1.00 27.55  ? 524 LYS A CG  1 
ATOM   993  C CD  . LYS A 1 153 ? 25.280 22.041 56.445  1.00 30.52  ? 524 LYS A CD  1 
ATOM   994  C CE  . LYS A 1 153 ? 23.791 21.702 56.660  1.00 30.91  ? 524 LYS A CE  1 
ATOM   995  N NZ  . LYS A 1 153 ? 23.641 20.408 57.398  1.00 32.14  ? 524 LYS A NZ  1 
ATOM   996  N N   . ALA A 1 154 ? 29.390 24.026 55.689  1.00 20.36  ? 525 ALA A N   1 
ATOM   997  C CA  . ALA A 1 154 ? 30.646 24.702 56.020  1.00 18.81  ? 525 ALA A CA  1 
ATOM   998  C C   . ALA A 1 154 ? 31.573 23.840 56.883  1.00 20.24  ? 525 ALA A C   1 
ATOM   999  O O   . ALA A 1 154 ? 32.755 23.722 56.580  1.00 20.76  ? 525 ALA A O   1 
ATOM   1000 C CB  . ALA A 1 154 ? 30.362 26.030 56.693  1.00 16.17  ? 525 ALA A CB  1 
ATOM   1001 N N   . PHE A 1 155 ? 31.049 23.181 57.914  1.00 18.53  ? 526 PHE A N   1 
ATOM   1002 C CA  . PHE A 1 155 ? 31.898 22.349 58.757  1.00 18.93  ? 526 PHE A CA  1 
ATOM   1003 C C   . PHE A 1 155 ? 32.542 21.208 57.986  1.00 20.32  ? 526 PHE A C   1 
ATOM   1004 O O   . PHE A 1 155 ? 33.647 20.771 58.306  1.00 21.47  ? 526 PHE A O   1 
ATOM   1005 C CB  . PHE A 1 155 ? 31.108 21.767 59.936  1.00 17.93  ? 526 PHE A CB  1 
ATOM   1006 C CG  . PHE A 1 155 ? 31.946 20.948 60.888  1.00 18.59  ? 526 PHE A CG  1 
ATOM   1007 C CD1 . PHE A 1 155 ? 32.864 21.571 61.748  1.00 20.97  ? 526 PHE A CD1 1 
ATOM   1008 C CD2 . PHE A 1 155 ? 31.820 19.569 60.936  1.00 18.26  ? 526 PHE A CD2 1 
ATOM   1009 C CE1 . PHE A 1 155 ? 33.639 20.821 62.639  1.00 18.59  ? 526 PHE A CE1 1 
ATOM   1010 C CE2 . PHE A 1 155 ? 32.584 18.811 61.821  1.00 20.80  ? 526 PHE A CE2 1 
ATOM   1011 C CZ  . PHE A 1 155 ? 33.497 19.442 62.675  1.00 21.64  ? 526 PHE A CZ  1 
ATOM   1012 N N   . ASP A 1 156 ? 31.820 20.658 57.022  1.00 23.28  ? 527 ASP A N   1 
ATOM   1013 C CA  . ASP A 1 156 ? 32.373 19.548 56.258  1.00 23.81  ? 527 ASP A CA  1 
ATOM   1014 C C   . ASP A 1 156 ? 33.490 20.056 55.342  1.00 23.14  ? 527 ASP A C   1 
ATOM   1015 O O   . ASP A 1 156 ? 34.549 19.446 55.210  1.00 26.42  ? 527 ASP A O   1 
ATOM   1016 C CB  . ASP A 1 156 ? 31.274 18.857 55.458  1.00 25.82  ? 527 ASP A CB  1 
ATOM   1017 C CG  . ASP A 1 156 ? 30.241 18.180 56.344  1.00 27.73  ? 527 ASP A CG  1 
ATOM   1018 O OD1 . ASP A 1 156 ? 30.620 17.380 57.221  1.00 30.90  ? 527 ASP A OD1 1 
ATOM   1019 O OD2 . ASP A 1 156 ? 29.040 18.436 56.159  1.00 30.37  ? 527 ASP A OD2 1 
ATOM   1020 N N   . PHE A 1 157 ? 33.269 21.222 54.770  1.00 22.33  ? 528 PHE A N   1 
ATOM   1021 C CA  . PHE A 1 157 ? 34.235 21.825 53.879  1.00 24.46  ? 528 PHE A CA  1 
ATOM   1022 C C   . PHE A 1 157 ? 35.544 22.141 54.614  1.00 28.51  ? 528 PHE A C   1 
ATOM   1023 O O   . PHE A 1 157 ? 36.633 21.738 54.168  1.00 26.83  ? 528 PHE A O   1 
ATOM   1024 C CB  . PHE A 1 157 ? 33.631 23.096 53.295  1.00 21.03  ? 528 PHE A CB  1 
ATOM   1025 C CG  . PHE A 1 157 ? 34.566 23.869 52.437  1.00 23.30  ? 528 PHE A CG  1 
ATOM   1026 C CD1 . PHE A 1 157 ? 35.200 23.264 51.344  1.00 26.38  ? 528 PHE A CD1 1 
ATOM   1027 C CD2 . PHE A 1 157 ? 34.820 25.208 52.703  1.00 20.07  ? 528 PHE A CD2 1 
ATOM   1028 C CE1 . PHE A 1 157 ? 36.071 24.001 50.539  1.00 22.99  ? 528 PHE A CE1 1 
ATOM   1029 C CE2 . PHE A 1 157 ? 35.691 25.951 51.906  1.00 22.46  ? 528 PHE A CE2 1 
ATOM   1030 C CZ  . PHE A 1 157 ? 36.316 25.349 50.824  1.00 21.68  ? 528 PHE A CZ  1 
ATOM   1031 N N   . TYR A 1 158 ? 35.421 22.842 55.750  1.00 25.75  ? 529 TYR A N   1 
ATOM   1032 C CA  . TYR A 1 158 ? 36.552 23.258 56.591  1.00 22.05  ? 529 TYR A CA  1 
ATOM   1033 C C   . TYR A 1 158 ? 37.642 22.198 56.749  1.00 18.93  ? 529 TYR A C   1 
ATOM   1034 O O   . TYR A 1 158 ? 38.823 22.512 56.718  1.00 22.28  ? 529 TYR A O   1 
ATOM   1035 C CB  . TYR A 1 158 ? 36.034 23.712 57.998  1.00 22.87  ? 529 TYR A CB  1 
ATOM   1036 C CG  . TYR A 1 158 ? 36.826 23.138 59.187  1.00 23.74  ? 529 TYR A CG  1 
ATOM   1037 C CD1 . TYR A 1 158 ? 38.020 23.737 59.610  1.00 24.05  ? 529 TYR A CD1 1 
ATOM   1038 C CD2 . TYR A 1 158 ? 36.477 21.912 59.758  1.00 23.67  ? 529 TYR A CD2 1 
ATOM   1039 C CE1 . TYR A 1 158 ? 38.851 23.122 60.535  1.00 25.84  ? 529 TYR A CE1 1 
ATOM   1040 C CE2 . TYR A 1 158 ? 37.308 21.289 60.686  1.00 24.48  ? 529 TYR A CE2 1 
ATOM   1041 C CZ  . TYR A 1 158 ? 38.496 21.901 61.059  1.00 25.92  ? 529 TYR A CZ  1 
ATOM   1042 O OH  . TYR A 1 158 ? 39.370 21.266 61.912  1.00 30.88  ? 529 TYR A OH  1 
ATOM   1043 N N   . LYS A 1 159 ? 37.231 20.954 56.919  1.00 16.84  ? 530 LYS A N   1 
ATOM   1044 C CA  . LYS A 1 159 ? 38.143 19.850 57.159  1.00 22.40  ? 530 LYS A CA  1 
ATOM   1045 C C   . LYS A 1 159 ? 39.274 19.665 56.165  1.00 23.80  ? 530 LYS A C   1 
ATOM   1046 O O   . LYS A 1 159 ? 40.314 19.080 56.507  1.00 23.32  ? 530 LYS A O   1 
ATOM   1047 C CB  . LYS A 1 159 ? 37.355 18.536 57.247  1.00 29.68  ? 530 LYS A CB  1 
ATOM   1048 C CG  . LYS A 1 159 ? 36.236 18.517 58.276  1.00 32.10  ? 530 LYS A CG  1 
ATOM   1049 C CD  . LYS A 1 159 ? 35.245 17.401 57.963  1.00 36.88  ? 530 LYS A CD  1 
ATOM   1050 C CE  . LYS A 1 159 ? 34.080 17.412 58.957  1.00 40.04  ? 530 LYS A CE  1 
ATOM   1051 N NZ  . LYS A 1 159 ? 33.022 16.414 58.600  1.00 39.19  ? 530 LYS A NZ  1 
ATOM   1052 N N   . VAL A 1 160 ? 39.060 20.105 54.929  1.00 21.14  ? 531 VAL A N   1 
ATOM   1053 C CA  . VAL A 1 160 ? 40.077 19.952 53.886  1.00 21.58  ? 531 VAL A CA  1 
ATOM   1054 C C   . VAL A 1 160 ? 40.954 21.182 53.609  1.00 18.50  ? 531 VAL A C   1 
ATOM   1055 O O   . VAL A 1 160 ? 42.024 21.049 53.002  1.00 19.09  ? 531 VAL A O   1 
ATOM   1056 C CB  . VAL A 1 160 ? 39.418 19.501 52.530  1.00 20.26  ? 531 VAL A CB  1 
ATOM   1057 C CG1 . VAL A 1 160 ? 38.870 20.722 51.774  1.00 22.15  ? 531 VAL A CG1 1 
ATOM   1058 C CG2 . VAL A 1 160 ? 40.406 18.700 51.689  1.00 21.19  ? 531 VAL A CG2 1 
ATOM   1059 N N   . ILE A 1 161 ? 40.524 22.362 54.047  1.00 15.10  ? 532 ILE A N   1 
ATOM   1060 C CA  . ILE A 1 161 ? 41.275 23.566 53.758  1.00 16.84  ? 532 ILE A CA  1 
ATOM   1061 C C   . ILE A 1 161 ? 42.788 23.521 54.018  1.00 22.99  ? 532 ILE A C   1 
ATOM   1062 O O   . ILE A 1 161 ? 43.593 23.709 53.082  1.00 17.77  ? 532 ILE A O   1 
ATOM   1063 C CB  . ILE A 1 161 ? 40.655 24.759 54.430  1.00 14.81  ? 532 ILE A CB  1 
ATOM   1064 C CG1 . ILE A 1 161 ? 39.193 24.899 54.023  1.00 13.38  ? 532 ILE A CG1 1 
ATOM   1065 C CG2 . ILE A 1 161 ? 41.418 26.014 54.097  1.00 13.04  ? 532 ILE A CG2 1 
ATOM   1066 C CD1 . ILE A 1 161 ? 38.494 26.057 54.748  1.00 11.73  ? 532 ILE A CD1 1 
ATOM   1067 N N   . GLU A 1 162 ? 43.190 23.253 55.269  1.00 22.35  ? 533 GLU A N   1 
ATOM   1068 C CA  . GLU A 1 162 ? 44.610 23.199 55.622  1.00 21.17  ? 533 GLU A CA  1 
ATOM   1069 C C   . GLU A 1 162 ? 45.400 22.193 54.768  1.00 16.83  ? 533 GLU A C   1 
ATOM   1070 O O   . GLU A 1 162 ? 46.526 22.474 54.352  1.00 18.10  ? 533 GLU A O   1 
ATOM   1071 C CB  . GLU A 1 162 ? 44.772 22.886 57.122  1.00 24.11  ? 533 GLU A CB  1 
ATOM   1072 C CG  . GLU A 1 162 ? 46.174 23.100 57.633  1.00 32.25  ? 533 GLU A CG  1 
ATOM   1073 C CD  . GLU A 1 162 ? 46.287 23.068 59.151  1.00 35.29  ? 533 GLU A CD  1 
ATOM   1074 O OE1 . GLU A 1 162 ? 46.133 24.130 59.794  1.00 39.10  ? 533 GLU A OE1 1 
ATOM   1075 O OE2 . GLU A 1 162 ? 46.537 21.977 59.693  1.00 41.41  ? 533 GLU A OE2 1 
ATOM   1076 N N   . SER A 1 163 ? 44.812 21.028 54.536  1.00 17.23  ? 534 SER A N   1 
ATOM   1077 C CA  . SER A 1 163 ? 45.409 19.981 53.727  1.00 19.82  ? 534 SER A CA  1 
ATOM   1078 C C   . SER A 1 163 ? 45.610 20.428 52.281  1.00 20.36  ? 534 SER A C   1 
ATOM   1079 O O   . SER A 1 163 ? 46.643 20.155 51.678  1.00 20.98  ? 534 SER A O   1 
ATOM   1080 C CB  . SER A 1 163 ? 44.517 18.769 53.729  1.00 20.39  ? 534 SER A CB  1 
ATOM   1081 O OG  . SER A 1 163 ? 44.570 18.170 54.993  1.00 28.59  ? 534 SER A OG  1 
ATOM   1082 N N   . PHE A 1 164 ? 44.592 21.066 51.723  1.00 20.08  ? 535 PHE A N   1 
ATOM   1083 C CA  . PHE A 1 164 ? 44.645 21.588 50.362  1.00 18.90  ? 535 PHE A CA  1 
ATOM   1084 C C   . PHE A 1 164 ? 45.812 22.592 50.299  1.00 22.05  ? 535 PHE A C   1 
ATOM   1085 O O   . PHE A 1 164 ? 46.668 22.500 49.415  1.00 20.57  ? 535 PHE A O   1 
ATOM   1086 C CB  . PHE A 1 164 ? 43.320 22.285 50.047  1.00 20.58  ? 535 PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 164 ? 43.186 22.754 48.616  1.00 20.43  ? 535 PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 164 ? 43.714 23.978 48.213  1.00 19.47  ? 535 PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 164 ? 42.488 21.995 47.692  1.00 20.08  ? 535 PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 164 ? 43.544 24.432 46.911  1.00 18.54  ? 535 PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 164 ? 42.316 22.451 46.398  1.00 15.41  ? 535 PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 164 ? 42.847 23.667 46.017  1.00 14.76  ? 535 PHE A CZ  1 
ATOM   1093 N N   . ILE A 1 165 ? 45.853 23.537 51.243  1.00 20.03  ? 536 ILE A N   1 
ATOM   1094 C CA  . ILE A 1 165 ? 46.927 24.541 51.297  1.00 20.85  ? 536 ILE A CA  1 
ATOM   1095 C C   . ILE A 1 165 ? 48.288 23.880 51.327  1.00 22.01  ? 536 ILE A C   1 
ATOM   1096 O O   . ILE A 1 165 ? 49.196 24.323 50.623  1.00 24.81  ? 536 ILE A O   1 
ATOM   1097 C CB  . ILE A 1 165 ? 46.806 25.504 52.510  1.00 18.98  ? 536 ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 165 ? 45.603 26.435 52.299  1.00 21.50  ? 536 ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 165 ? 48.101 26.310 52.688  1.00 17.79  ? 536 ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 165 ? 45.306 27.388 53.456  1.00 23.39  ? 536 ILE A CD1 1 
ATOM   1101 N N   . LYS A 1 166 ? 48.410 22.810 52.113  1.00 19.71  ? 537 LYS A N   1 
ATOM   1102 C CA  . LYS A 1 166 ? 49.658 22.071 52.242  1.00 22.46  ? 537 LYS A CA  1 
ATOM   1103 C C   . LYS A 1 166 ? 49.984 21.279 50.968  1.00 22.90  ? 537 LYS A C   1 
ATOM   1104 O O   . LYS A 1 166 ? 51.146 21.130 50.607  1.00 20.40  ? 537 LYS A O   1 
ATOM   1105 C CB  . LYS A 1 166 ? 49.604 21.106 53.457  1.00 28.18  ? 537 LYS A CB  1 
ATOM   1106 C CG  . LYS A 1 166 ? 50.025 21.732 54.818  1.00 37.69  ? 537 LYS A CG  1 
ATOM   1107 C CD  . LYS A 1 166 ? 50.114 20.706 55.980  1.00 41.80  ? 537 LYS A CD  1 
ATOM   1108 C CE  . LYS A 1 166 ? 48.754 20.495 56.686  1.00 50.10  ? 537 LYS A CE  1 
ATOM   1109 N NZ  . LYS A 1 166 ? 48.636 19.329 57.663  1.00 49.84  ? 537 LYS A NZ  1 
ATOM   1110 N N   . ALA A 1 167 ? 48.959 20.784 50.289  1.00 18.30  ? 538 ALA A N   1 
ATOM   1111 C CA  . ALA A 1 167 ? 49.166 19.991 49.098  1.00 19.33  ? 538 ALA A CA  1 
ATOM   1112 C C   . ALA A 1 167 ? 49.390 20.796 47.820  1.00 20.12  ? 538 ALA A C   1 
ATOM   1113 O O   . ALA A 1 167 ? 49.845 20.230 46.831  1.00 22.20  ? 538 ALA A O   1 
ATOM   1114 C CB  . ALA A 1 167 ? 48.009 19.021 48.914  1.00 17.42  ? 538 ALA A CB  1 
ATOM   1115 N N   . GLU A 1 168 ? 49.057 22.087 47.823  1.00 17.39  ? 539 GLU A N   1 
ATOM   1116 C CA  . GLU A 1 168 ? 49.210 22.911 46.634  1.00 16.82  ? 539 GLU A CA  1 
ATOM   1117 C C   . GLU A 1 168 ? 50.313 23.956 46.743  1.00 14.97  ? 539 GLU A C   1 
ATOM   1118 O O   . GLU A 1 168 ? 50.129 25.057 47.286  1.00 15.82  ? 539 GLU A O   1 
ATOM   1119 C CB  . GLU A 1 168 ? 47.869 23.564 46.251  1.00 17.60  ? 539 GLU A CB  1 
ATOM   1120 C CG  . GLU A 1 168 ? 47.843 24.312 44.900  1.00 16.75  ? 539 GLU A CG  1 
ATOM   1121 C CD  . GLU A 1 168 ? 48.536 23.539 43.787  1.00 14.47  ? 539 GLU A CD  1 
ATOM   1122 O OE1 . GLU A 1 168 ? 48.136 22.407 43.464  1.00 18.33  ? 539 GLU A OE1 1 
ATOM   1123 O OE2 . GLU A 1 168 ? 49.537 24.048 43.273  1.00 15.46  ? 539 GLU A OE2 1 
ATOM   1124 N N   . GLY A 1 169 ? 51.443 23.622 46.132  1.00 16.80  ? 540 GLY A N   1 
ATOM   1125 C CA  . GLY A 1 169 ? 52.595 24.509 46.124  1.00 14.96  ? 540 GLY A CA  1 
ATOM   1126 C C   . GLY A 1 169 ? 52.493 25.794 45.342  1.00 15.83  ? 540 GLY A C   1 
ATOM   1127 O O   . GLY A 1 169 ? 53.300 26.703 45.558  1.00 16.79  ? 540 GLY A O   1 
ATOM   1128 N N   . ASN A 1 170 ? 51.508 25.899 44.444  1.00 18.59  ? 541 ASN A N   1 
ATOM   1129 C CA  . ASN A 1 170 ? 51.313 27.094 43.600  1.00 16.15  ? 541 ASN A CA  1 
ATOM   1130 C C   . ASN A 1 170 ? 50.412 28.189 44.113  1.00 20.52  ? 541 ASN A C   1 
ATOM   1131 O O   . ASN A 1 170 ? 50.095 29.136 43.375  1.00 20.65  ? 541 ASN A O   1 
ATOM   1132 C CB  . ASN A 1 170 ? 50.896 26.722 42.163  1.00 19.82  ? 541 ASN A CB  1 
ATOM   1133 C CG  . ASN A 1 170 ? 52.098 26.371 41.268  1.00 19.41  ? 541 ASN A CG  1 
ATOM   1134 O OD1 . ASN A 1 170 ? 52.537 27.176 40.435  1.00 25.51  ? 541 ASN A OD1 1 
ATOM   1135 N ND2 . ASN A 1 170 ? 52.623 25.171 41.439  1.00 18.58  ? 541 ASN A ND2 1 
ATOM   1136 N N   . LEU A 1 171 ? 50.018 28.107 45.385  1.00 19.64  ? 542 LEU A N   1 
ATOM   1137 C CA  . LEU A 1 171 ? 49.191 29.168 45.944  1.00 18.17  ? 542 LEU A CA  1 
ATOM   1138 C C   . LEU A 1 171 ? 50.017 30.427 46.231  1.00 18.08  ? 542 LEU A C   1 
ATOM   1139 O O   . LEU A 1 171 ? 51.182 30.333 46.627  1.00 17.98  ? 542 LEU A O   1 
ATOM   1140 C CB  . LEU A 1 171 ? 48.534 28.706 47.245  1.00 17.97  ? 542 LEU A CB  1 
ATOM   1141 C CG  . LEU A 1 171 ? 47.644 27.478 47.154  1.00 20.09  ? 542 LEU A CG  1 
ATOM   1142 C CD1 . LEU A 1 171 ? 47.044 27.206 48.541  1.00 18.26  ? 542 LEU A CD1 1 
ATOM   1143 C CD2 . LEU A 1 171 ? 46.537 27.713 46.108  1.00 14.83  ? 542 LEU A CD2 1 
ATOM   1144 N N   . THR A 1 172 ? 49.449 31.594 45.957  1.00 15.97  ? 543 THR A N   1 
ATOM   1145 C CA  . THR A 1 172 ? 50.118 32.832 46.271  1.00 16.60  ? 543 THR A CA  1 
ATOM   1146 C C   . THR A 1 172 ? 49.804 33.095 47.745  1.00 20.47  ? 543 THR A C   1 
ATOM   1147 O O   . THR A 1 172 ? 48.897 32.475 48.316  1.00 14.30  ? 543 THR A O   1 
ATOM   1148 C CB  . THR A 1 172 ? 49.535 33.989 45.506  1.00 17.36  ? 543 THR A CB  1 
ATOM   1149 O OG1 . THR A 1 172 ? 48.113 34.007 45.685  1.00 18.38  ? 543 THR A OG1 1 
ATOM   1150 C CG2 . THR A 1 172 ? 49.891 33.874 44.025  1.00 21.58  ? 543 THR A CG2 1 
ATOM   1151 N N   . ARG A 1 173 ? 50.533 34.034 48.333  1.00 17.96  ? 544 ARG A N   1 
ATOM   1152 C CA  . ARG A 1 173 ? 50.316 34.428 49.712  1.00 22.08  ? 544 ARG A CA  1 
ATOM   1153 C C   . ARG A 1 173 ? 48.889 34.955 49.851  1.00 22.63  ? 544 ARG A C   1 
ATOM   1154 O O   . ARG A 1 173 ? 48.228 34.687 50.856  1.00 24.79  ? 544 ARG A O   1 
ATOM   1155 C CB  . ARG A 1 173 ? 51.286 35.549 50.100  1.00 22.56  ? 544 ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 173 ? 50.990 36.146 51.453  1.00 27.54  ? 544 ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 173 ? 51.579 37.523 51.568  1.00 36.42  ? 544 ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 173 ? 51.205 38.362 50.432  1.00 42.89  ? 544 ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 173 ? 51.907 39.407 50.002  1.00 45.94  ? 544 ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 173 ? 53.028 39.767 50.615  1.00 49.07  ? 544 ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 173 ? 51.512 40.062 48.918  1.00 51.14  ? 544 ARG A NH2 1 
ATOM   1162 N N   . GLU A 1 174 ? 48.418 35.706 48.846  1.00 20.43  ? 545 GLU A N   1 
ATOM   1163 C CA  . GLU A 1 174 ? 47.077 36.282 48.854  1.00 19.26  ? 545 GLU A CA  1 
ATOM   1164 C C   . GLU A 1 174 ? 45.996 35.198 48.789  1.00 19.08  ? 545 GLU A C   1 
ATOM   1165 O O   . GLU A 1 174 ? 44.929 35.335 49.388  1.00 15.57  ? 545 GLU A O   1 
ATOM   1166 C CB  . GLU A 1 174 ? 46.911 37.272 47.699  1.00 26.70  ? 545 GLU A CB  1 
ATOM   1167 C CG  . GLU A 1 174 ? 48.062 38.300 47.575  1.00 35.80  ? 545 GLU A CG  1 
ATOM   1168 C CD  . GLU A 1 174 ? 49.116 37.913 46.521  1.00 40.49  ? 545 GLU A CD  1 
ATOM   1169 O OE1 . GLU A 1 174 ? 50.107 37.215 46.858  1.00 37.29  ? 545 GLU A OE1 1 
ATOM   1170 O OE2 . GLU A 1 174 ? 48.945 38.314 45.341  1.00 45.01  ? 545 GLU A OE2 1 
ATOM   1171 N N   . MET A 1 175 ? 46.262 34.113 48.068  1.00 17.89  ? 546 MET A N   1 
ATOM   1172 C CA  . MET A 1 175 ? 45.283 33.030 47.981  1.00 16.88  ? 546 MET A CA  1 
ATOM   1173 C C   . MET A 1 175 ? 45.269 32.228 49.298  1.00 17.48  ? 546 MET A C   1 
ATOM   1174 O O   . MET A 1 175 ? 44.225 31.703 49.700  1.00 14.26  ? 546 MET A O   1 
ATOM   1175 C CB  . MET A 1 175 ? 45.567 32.099 46.788  1.00 12.29  ? 546 MET A CB  1 
ATOM   1176 C CG  . MET A 1 175 ? 44.477 31.057 46.516  1.00 12.36  ? 546 MET A CG  1 
ATOM   1177 S SD  . MET A 1 175 ? 42.929 31.821 46.048  1.00 22.76  ? 546 MET A SD  1 
ATOM   1178 C CE  . MET A 1 175 ? 41.797 30.902 46.942  1.00 27.59  ? 546 MET A CE  1 
ATOM   1179 N N   . ILE A 1 176 ? 46.449 32.037 49.893  1.00 18.56  ? 547 ILE A N   1 
ATOM   1180 C CA  . ILE A 1 176 ? 46.552 31.318 51.168  1.00 17.99  ? 547 ILE A CA  1 
ATOM   1181 C C   . ILE A 1 176 ? 45.778 32.078 52.258  1.00 16.32  ? 547 ILE A C   1 
ATOM   1182 O O   . ILE A 1 176 ? 45.041 31.451 53.024  1.00 15.44  ? 547 ILE A O   1 
ATOM   1183 C CB  . ILE A 1 176 ? 48.011 31.093 51.565  1.00 17.86  ? 547 ILE A CB  1 
ATOM   1184 C CG1 . ILE A 1 176 ? 48.599 30.053 50.633  1.00 15.04  ? 547 ILE A CG1 1 
ATOM   1185 C CG2 . ILE A 1 176 ? 48.127 30.557 53.010  1.00 14.91  ? 547 ILE A CG2 1 
ATOM   1186 C CD1 . ILE A 1 176 ? 50.063 29.858 50.812  1.00 17.83  ? 547 ILE A CD1 1 
ATOM   1187 N N   . LYS A 1 177 ? 45.924 33.409 52.293  1.00 15.80  ? 548 LYS A N   1 
ATOM   1188 C CA  . LYS A 1 177 ? 45.200 34.247 53.249  1.00 19.16  ? 548 LYS A CA  1 
ATOM   1189 C C   . LYS A 1 177 ? 43.708 34.169 52.969  1.00 22.35  ? 548 LYS A C   1 
ATOM   1190 O O   . LYS A 1 177 ? 42.906 34.212 53.886  1.00 20.08  ? 548 LYS A O   1 
ATOM   1191 C CB  . LYS A 1 177 ? 45.629 35.710 53.184  1.00 18.95  ? 548 LYS A CB  1 
ATOM   1192 C CG  . LYS A 1 177 ? 47.099 35.951 53.514  1.00 27.32  ? 548 LYS A CG  1 
ATOM   1193 C CD  . LYS A 1 177 ? 47.532 35.219 54.787  1.00 35.17  ? 548 LYS A CD  1 
ATOM   1194 C CE  . LYS A 1 177 ? 46.960 35.852 56.070  1.00 42.21  ? 548 LYS A CE  1 
ATOM   1195 N NZ  . LYS A 1 177 ? 46.282 34.830 56.946  1.00 46.40  ? 548 LYS A NZ  1 
ATOM   1196 N N   . HIS A 1 178 ? 43.321 34.129 51.694  1.00 18.86  ? 549 HIS A N   1 
ATOM   1197 C CA  . HIS A 1 178 ? 41.907 34.023 51.347  1.00 16.00  ? 549 HIS A CA  1 
ATOM   1198 C C   . HIS A 1 178 ? 41.352 32.697 51.862  1.00 13.43  ? 549 HIS A C   1 
ATOM   1199 O O   . HIS A 1 178 ? 40.261 32.664 52.410  1.00 18.62  ? 549 HIS A O   1 
ATOM   1200 C CB  . HIS A 1 178 ? 41.684 34.137 49.803  1.00 18.05  ? 549 HIS A CB  1 
ATOM   1201 C CG  . HIS A 1 178 ? 40.300 33.749 49.356  1.00 14.27  ? 549 HIS A CG  1 
ATOM   1202 N ND1 . HIS A 1 178 ? 39.194 34.548 49.570  1.00 14.52  ? 549 HIS A ND1 1 
ATOM   1203 C CD2 . HIS A 1 178 ? 39.842 32.623 48.756  1.00 12.62  ? 549 HIS A CD2 1 
ATOM   1204 C CE1 . HIS A 1 178 ? 38.116 33.931 49.122  1.00 12.78  ? 549 HIS A CE1 1 
ATOM   1205 N NE2 . HIS A 1 178 ? 38.483 32.763 48.626  1.00 12.33  ? 549 HIS A NE2 1 
ATOM   1206 N N   . LEU A 1 179 ? 42.072 31.599 51.654  1.00 11.81  ? 550 LEU A N   1 
ATOM   1207 C CA  . LEU A 1 179 ? 41.623 30.284 52.110  1.00 15.38  ? 550 LEU A CA  1 
ATOM   1208 C C   . LEU A 1 179 ? 41.632 30.246 53.649  1.00 16.55  ? 550 LEU A C   1 
ATOM   1209 O O   . LEU A 1 179 ? 40.760 29.633 54.251  1.00 14.30  ? 550 LEU A O   1 
ATOM   1210 C CB  . LEU A 1 179 ? 42.509 29.153 51.550  1.00 15.63  ? 550 LEU A CB  1 
ATOM   1211 C CG  . LEU A 1 179 ? 42.411 28.839 50.035  1.00 17.24  ? 550 LEU A CG  1 
ATOM   1212 C CD1 . LEU A 1 179 ? 43.293 27.627 49.680  1.00 14.84  ? 550 LEU A CD1 1 
ATOM   1213 C CD2 . LEU A 1 179 ? 40.949 28.579 49.650  1.00 13.65  ? 550 LEU A CD2 1 
ATOM   1214 N N   . GLU A 1 180 ? 42.649 30.862 54.252  1.00 17.08  ? 551 GLU A N   1 
ATOM   1215 C CA  . GLU A 1 180 ? 42.751 30.935 55.702  1.00 20.27  ? 551 GLU A CA  1 
ATOM   1216 C C   . GLU A 1 180 ? 41.585 31.746 56.234  1.00 19.15  ? 551 GLU A C   1 
ATOM   1217 O O   . GLU A 1 180 ? 40.934 31.332 57.201  1.00 19.87  ? 551 GLU A O   1 
ATOM   1218 C CB  . GLU A 1 180 ? 44.093 31.500 56.116  1.00 21.07  ? 551 GLU A CB  1 
ATOM   1219 C CG  . GLU A 1 180 ? 45.152 30.415 56.002  1.00 30.15  ? 551 GLU A CG  1 
ATOM   1220 C CD  . GLU A 1 180 ? 46.577 30.874 56.302  1.00 35.02  ? 551 GLU A CD  1 
ATOM   1221 O OE1 . GLU A 1 180 ? 46.830 32.102 56.372  1.00 36.51  ? 551 GLU A OE1 1 
ATOM   1222 O OE2 . GLU A 1 180 ? 47.455 29.979 56.452  1.00 40.80  ? 551 GLU A OE2 1 
ATOM   1223 N N   . ARG A 1 181 ? 41.249 32.827 55.540  1.00 15.68  ? 552 ARG A N   1 
ATOM   1224 C CA  . ARG A 1 181 ? 40.102 33.645 55.920  1.00 16.06  ? 552 ARG A CA  1 
ATOM   1225 C C   . ARG A 1 181 ? 38.795 32.842 55.827  1.00 18.07  ? 552 ARG A C   1 
ATOM   1226 O O   . ARG A 1 181 ? 37.944 32.955 56.717  1.00 16.60  ? 552 ARG A O   1 
ATOM   1227 C CB  . ARG A 1 181 ? 40.026 34.921 55.088  1.00 17.75  ? 552 ARG A CB  1 
ATOM   1228 C CG  . ARG A 1 181 ? 38.829 35.819 55.420  1.00 23.70  ? 552 ARG A CG  1 
ATOM   1229 C CD  . ARG A 1 181 ? 38.738 36.158 56.952  1.00 28.97  ? 552 ARG A CD  1 
ATOM   1230 N NE  . ARG A 1 181 ? 37.476 36.816 57.327  1.00 28.19  ? 552 ARG A NE  1 
ATOM   1231 C CZ  . ARG A 1 181 ? 36.915 36.750 58.535  1.00 30.15  ? 552 ARG A CZ  1 
ATOM   1232 N NH1 . ARG A 1 181 ? 37.490 36.055 59.514  1.00 23.46  ? 552 ARG A NH1 1 
ATOM   1233 N NH2 . ARG A 1 181 ? 35.756 37.364 58.753  1.00 29.69  ? 552 ARG A NH2 1 
ATOM   1234 N N   . CYS A 1 182 ? 38.637 32.021 54.783  1.00 15.37  ? 553 CYS A N   1 
ATOM   1235 C CA  . CYS A 1 182 ? 37.450 31.174 54.621  1.00 13.11  ? 553 CYS A CA  1 
ATOM   1236 C C   . CYS A 1 182 ? 37.370 30.235 55.836  1.00 17.41  ? 553 CYS A C   1 
ATOM   1237 O O   . CYS A 1 182 ? 36.291 30.009 56.379  1.00 14.59  ? 553 CYS A O   1 
ATOM   1238 C CB  . CYS A 1 182 ? 37.522 30.319 53.340  1.00 14.19  ? 553 CYS A CB  1 
ATOM   1239 S SG  . CYS A 1 182 ? 37.424 31.283 51.800  1.00 15.82  ? 553 CYS A SG  1 
ATOM   1240 N N   . GLU A 1 183 ? 38.504 29.655 56.226  1.00 13.54  ? 554 GLU A N   1 
ATOM   1241 C CA  . GLU A 1 183 ? 38.541 28.744 57.374  1.00 18.38  ? 554 GLU A CA  1 
ATOM   1242 C C   . GLU A 1 183 ? 38.092 29.469 58.663  1.00 16.80  ? 554 GLU A C   1 
ATOM   1243 O O   . GLU A 1 183 ? 37.301 28.943 59.442  1.00 14.61  ? 554 GLU A O   1 
ATOM   1244 C CB  . GLU A 1 183 ? 39.949 28.170 57.570  1.00 13.31  ? 554 GLU A CB  1 
ATOM   1245 C CG  . GLU A 1 183 ? 39.964 26.927 58.413  1.00 16.38  ? 554 GLU A CG  1 
ATOM   1246 C CD  . GLU A 1 183 ? 41.345 26.545 58.875  1.00 18.81  ? 554 GLU A CD  1 
ATOM   1247 O OE1 . GLU A 1 183 ? 42.192 27.442 59.050  1.00 26.30  ? 554 GLU A OE1 1 
ATOM   1248 O OE2 . GLU A 1 183 ? 41.580 25.339 59.093  1.00 23.91  ? 554 GLU A OE2 1 
ATOM   1249 N N   . HIS A 1 184 ? 38.592 30.679 58.856  1.00 15.23  ? 555 HIS A N   1 
ATOM   1250 C CA  . HIS A 1 184 ? 38.252 31.472 60.023  1.00 16.26  ? 555 HIS A CA  1 
ATOM   1251 C C   . HIS A 1 184 ? 36.801 31.844 60.071  1.00 19.61  ? 555 HIS A C   1 
ATOM   1252 O O   . HIS A 1 184 ? 36.205 31.870 61.137  1.00 16.84  ? 555 HIS A O   1 
ATOM   1253 C CB  . HIS A 1 184 ? 39.106 32.724 60.074  1.00 12.33  ? 555 HIS A CB  1 
ATOM   1254 C CG  . HIS A 1 184 ? 40.540 32.439 60.380  1.00 11.03  ? 555 HIS A CG  1 
ATOM   1255 N ND1 . HIS A 1 184 ? 41.497 33.414 60.388  1.00 12.60  ? 555 HIS A ND1 1 
ATOM   1256 C CD2 . HIS A 1 184 ? 41.165 31.292 60.738  1.00 10.45  ? 555 HIS A CD2 1 
ATOM   1257 C CE1 . HIS A 1 184 ? 42.654 32.889 60.744  1.00 14.57  ? 555 HIS A CE1 1 
ATOM   1258 N NE2 . HIS A 1 184 ? 42.476 31.603 60.961  1.00 13.71  ? 555 HIS A NE2 1 
ATOM   1259 N N   . ARG A 1 185 ? 36.221 32.110 58.908  1.00 19.76  ? 556 ARG A N   1 
ATOM   1260 C CA  . ARG A 1 185 ? 34.829 32.475 58.830  1.00 15.72  ? 556 ARG A CA  1 
ATOM   1261 C C   . ARG A 1 185 ? 34.000 31.280 59.207  1.00 16.67  ? 556 ARG A C   1 
ATOM   1262 O O   . ARG A 1 185 ? 32.909 31.415 59.783  1.00 18.59  ? 556 ARG A O   1 
ATOM   1263 C CB  . ARG A 1 185 ? 34.498 32.949 57.417  1.00 18.92  ? 556 ARG A CB  1 
ATOM   1264 C CG  . ARG A 1 185 ? 35.137 34.267 57.076  1.00 18.82  ? 556 ARG A CG  1 
ATOM   1265 C CD  . ARG A 1 185 ? 34.883 34.619 55.640  1.00 21.43  ? 556 ARG A CD  1 
ATOM   1266 N NE  . ARG A 1 185 ? 33.539 35.130 55.424  1.00 28.05  ? 556 ARG A NE  1 
ATOM   1267 C CZ  . ARG A 1 185 ? 33.018 35.409 54.224  1.00 32.00  ? 556 ARG A CZ  1 
ATOM   1268 N NH1 . ARG A 1 185 ? 33.724 35.209 53.104  1.00 27.31  ? 556 ARG A NH1 1 
ATOM   1269 N NH2 . ARG A 1 185 ? 31.813 35.960 54.157  1.00 27.28  ? 556 ARG A NH2 1 
ATOM   1270 N N   . ILE A 1 186 ? 34.488 30.098 58.865  1.00 16.23  ? 557 ILE A N   1 
ATOM   1271 C CA  . ILE A 1 186 ? 33.763 28.879 59.207  1.00 19.98  ? 557 ILE A CA  1 
ATOM   1272 C C   . ILE A 1 186 ? 33.894 28.621 60.731  1.00 20.94  ? 557 ILE A C   1 
ATOM   1273 O O   . ILE A 1 186 ? 32.919 28.274 61.395  1.00 20.90  ? 557 ILE A O   1 
ATOM   1274 C CB  . ILE A 1 186 ? 34.298 27.667 58.426  1.00 15.95  ? 557 ILE A CB  1 
ATOM   1275 C CG1 . ILE A 1 186 ? 34.101 27.864 56.912  1.00 17.04  ? 557 ILE A CG1 1 
ATOM   1276 C CG2 . ILE A 1 186 ? 33.598 26.410 58.867  1.00 14.47  ? 557 ILE A CG2 1 
ATOM   1277 C CD1 . ILE A 1 186 ? 34.729 26.688 56.088  1.00 14.64  ? 557 ILE A CD1 1 
ATOM   1278 N N   . MET A 1 187 ? 35.106 28.779 61.262  1.00 22.27  ? 558 MET A N   1 
ATOM   1279 C CA  . MET A 1 187 ? 35.363 28.587 62.694  1.00 22.25  ? 558 MET A CA  1 
ATOM   1280 C C   . MET A 1 187 ? 34.624 29.613 63.548  1.00 20.21  ? 558 MET A C   1 
ATOM   1281 O O   . MET A 1 187 ? 34.145 29.274 64.635  1.00 22.30  ? 558 MET A O   1 
ATOM   1282 C CB  . MET A 1 187 ? 36.851 28.677 62.995  1.00 20.08  ? 558 MET A CB  1 
ATOM   1283 C CG  . MET A 1 187 ? 37.648 27.406 62.705  1.00 25.15  ? 558 MET A CG  1 
ATOM   1284 S SD  . MET A 1 187 ? 39.359 27.882 62.282  1.00 32.62  ? 558 MET A SD  1 
ATOM   1285 C CE  . MET A 1 187 ? 39.883 28.811 63.694  1.00 33.61  ? 558 MET A CE  1 
ATOM   1286 N N   . GLU A 1 188 ? 34.502 30.842 63.057  1.00 14.06  ? 559 GLU A N   1 
ATOM   1287 C CA  . GLU A 1 188 ? 33.827 31.898 63.802  1.00 17.39  ? 559 GLU A CA  1 
ATOM   1288 C C   . GLU A 1 188 ? 32.282 31.958 63.715  1.00 18.83  ? 559 GLU A C   1 
ATOM   1289 O O   . GLU A 1 188 ? 31.619 32.474 64.635  1.00 17.08  ? 559 GLU A O   1 
ATOM   1290 C CB  . GLU A 1 188 ? 34.434 33.261 63.453  1.00 17.07  ? 559 GLU A CB  1 
ATOM   1291 C CG  . GLU A 1 188 ? 33.886 33.864 62.141  1.00 16.57  ? 559 GLU A CG  1 
ATOM   1292 C CD  . GLU A 1 188 ? 34.644 35.080 61.668  1.00 16.95  ? 559 GLU A CD  1 
ATOM   1293 O OE1 . GLU A 1 188 ? 35.645 35.480 62.306  1.00 18.94  ? 559 GLU A OE1 1 
ATOM   1294 O OE2 . GLU A 1 188 ? 34.244 35.644 60.632  1.00 16.79  ? 559 GLU A OE2 1 
ATOM   1295 N N   . SER A 1 189 ? 31.701 31.447 62.633  1.00 17.01  ? 560 SER A N   1 
ATOM   1296 C CA  . SER A 1 189 ? 30.248 31.491 62.486  1.00 17.84  ? 560 SER A CA  1 
ATOM   1297 C C   . SER A 1 189 ? 29.587 30.411 61.623  1.00 22.50  ? 560 SER A C   1 
ATOM   1298 O O   . SER A 1 189 ? 28.693 29.701 62.108  1.00 18.61  ? 560 SER A O   1 
ATOM   1299 C CB  . SER A 1 189 ? 29.789 32.883 62.019  1.00 20.85  ? 560 SER A CB  1 
ATOM   1300 O OG  . SER A 1 189 ? 30.197 33.153 60.676  1.00 25.30  ? 560 SER A OG  1 
ATOM   1301 N N   . LEU A 1 190 ? 30.066 30.201 60.389  1.00 19.68  ? 561 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 190 ? 29.406 29.215 59.512  1.00 18.39  ? 561 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 190 ? 29.323 27.792 60.074  1.00 16.54  ? 561 LEU A C   1 
ATOM   1304 O O   . LEU A 1 190 ? 28.338 27.090 59.852  1.00 17.82  ? 561 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 190 ? 29.980 29.271 58.056  1.00 20.09  ? 561 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 190 ? 30.215 30.685 57.442  1.00 19.53  ? 561 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 190 ? 31.026 30.664 56.154  1.00 25.64  ? 561 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 190 ? 28.937 31.430 57.179  1.00 27.55  ? 561 LEU A CD2 1 
ATOM   1309 N N   . ALA A 1 191 ? 30.327 27.351 60.824  1.00 13.59  ? 562 ALA A N   1 
ATOM   1310 C CA  . ALA A 1 191 ? 30.273 26.009 61.393  1.00 14.66  ? 562 ALA A CA  1 
ATOM   1311 C C   . ALA A 1 191 ? 29.287 25.909 62.579  1.00 15.77  ? 562 ALA A C   1 
ATOM   1312 O O   . ALA A 1 191 ? 28.940 24.806 63.019  1.00 15.13  ? 562 ALA A O   1 
ATOM   1313 C CB  . ALA A 1 191 ? 31.633 25.574 61.852  1.00 17.99  ? 562 ALA A CB  1 
ATOM   1314 N N   . TRP A 1 192 ? 28.823 27.065 63.041  1.00 18.51  ? 563 TRP A N   1 
ATOM   1315 C CA  . TRP A 1 192 ? 27.916 27.164 64.181  1.00 20.63  ? 563 TRP A CA  1 
ATOM   1316 C C   . TRP A 1 192 ? 26.472 27.486 63.791  1.00 23.75  ? 563 TRP A C   1 
ATOM   1317 O O   . TRP A 1 192 ? 25.617 27.736 64.667  1.00 26.93  ? 563 TRP A O   1 
ATOM   1318 C CB  . TRP A 1 192 ? 28.462 28.229 65.153  1.00 19.47  ? 563 TRP A CB  1 
ATOM   1319 C CG  . TRP A 1 192 ? 29.889 27.940 65.616  1.00 20.69  ? 563 TRP A CG  1 
ATOM   1320 C CD1 . TRP A 1 192 ? 31.047 28.389 65.029  1.00 20.39  ? 563 TRP A CD1 1 
ATOM   1321 C CD2 . TRP A 1 192 ? 30.299 27.170 66.772  1.00 22.20  ? 563 TRP A CD2 1 
ATOM   1322 N NE1 . TRP A 1 192 ? 32.139 27.952 65.743  1.00 21.13  ? 563 TRP A NE1 1 
ATOM   1323 C CE2 . TRP A 1 192 ? 31.720 27.209 66.817  1.00 21.89  ? 563 TRP A CE2 1 
ATOM   1324 C CE3 . TRP A 1 192 ? 29.607 26.464 67.776  1.00 22.34  ? 563 TRP A CE3 1 
ATOM   1325 C CZ2 . TRP A 1 192 ? 32.471 26.572 67.833  1.00 18.70  ? 563 TRP A CZ2 1 
ATOM   1326 C CZ3 . TRP A 1 192 ? 30.368 25.821 68.797  1.00 19.93  ? 563 TRP A CZ3 1 
ATOM   1327 C CH2 . TRP A 1 192 ? 31.777 25.888 68.805  1.00 19.45  ? 563 TRP A CH2 1 
ATOM   1328 N N   . LEU A 1 193 ? 26.188 27.473 62.488  1.00 24.15  ? 564 LEU A N   1 
ATOM   1329 C CA  . LEU A 1 193 ? 24.832 27.765 61.995  1.00 22.25  ? 564 LEU A CA  1 
ATOM   1330 C C   . LEU A 1 193 ? 23.945 26.565 62.339  1.00 20.53  ? 564 LEU A C   1 
ATOM   1331 O O   . LEU A 1 193 ? 24.442 25.435 62.494  1.00 18.99  ? 564 LEU A O   1 
ATOM   1332 C CB  . LEU A 1 193 ? 24.843 28.047 60.469  1.00 19.42  ? 564 LEU A CB  1 
ATOM   1333 C CG  . LEU A 1 193 ? 25.475 29.358 59.948  1.00 16.51  ? 564 LEU A CG  1 
ATOM   1334 C CD1 . LEU A 1 193 ? 25.748 29.261 58.421  1.00 20.67  ? 564 LEU A CD1 1 
ATOM   1335 C CD2 . LEU A 1 193 ? 24.628 30.563 60.245  1.00 15.62  ? 564 LEU A CD2 1 
ATOM   1336 N N   . SER A 1 194 ? 22.649 26.801 62.539  1.00 24.01  ? 565 SER A N   1 
ATOM   1337 C CA  . SER A 1 194 ? 21.765 25.685 62.858  1.00 26.69  ? 565 SER A CA  1 
ATOM   1338 C C   . SER A 1 194 ? 21.819 24.678 61.720  1.00 29.06  ? 565 SER A C   1 
ATOM   1339 O O   . SER A 1 194 ? 21.922 25.054 60.543  1.00 27.30  ? 565 SER A O   1 
ATOM   1340 C CB  . SER A 1 194 ? 20.330 26.162 63.046  1.00 28.43  ? 565 SER A CB  1 
ATOM   1341 O OG  . SER A 1 194 ? 20.287 27.164 64.037  1.00 30.19  ? 565 SER A OG  1 
ATOM   1342 N N   . ASP A 1 195 ? 21.776 23.409 62.097  1.00 30.14  ? 566 ASP A N   1 
ATOM   1343 C CA  . ASP A 1 195 ? 21.815 22.277 61.188  1.00 33.58  ? 566 ASP A CA  1 
ATOM   1344 C C   . ASP A 1 195 ? 23.240 21.860 60.891  1.00 33.45  ? 566 ASP A C   1 
ATOM   1345 O O   . ASP A 1 195 ? 23.466 20.870 60.198  1.00 34.64  ? 566 ASP A O   1 
ATOM   1346 C CB  . ASP A 1 195 ? 21.044 22.551 59.890  1.00 39.94  ? 566 ASP A CB  1 
ATOM   1347 C CG  . ASP A 1 195 ? 19.569 22.854 60.133  1.00 46.09  ? 566 ASP A CG  1 
ATOM   1348 O OD1 . ASP A 1 195 ? 18.928 22.152 60.952  1.00 48.36  ? 566 ASP A OD1 1 
ATOM   1349 O OD2 . ASP A 1 195 ? 19.049 23.812 59.514  1.00 52.14  ? 566 ASP A OD2 1 
ATOM   1350 N N   . SER A 1 196 ? 24.206 22.561 61.471  1.00 29.43  ? 567 SER A N   1 
ATOM   1351 C CA  . SER A 1 196 ? 25.588 22.196 61.230  1.00 28.65  ? 567 SER A CA  1 
ATOM   1352 C C   . SER A 1 196 ? 25.911 20.869 61.893  1.00 29.33  ? 567 SER A C   1 
ATOM   1353 O O   . SER A 1 196 ? 25.451 20.599 63.004  1.00 32.29  ? 567 SER A O   1 
ATOM   1354 C CB  . SER A 1 196 ? 26.534 23.278 61.749  1.00 24.77  ? 567 SER A CB  1 
ATOM   1355 O OG  . SER A 1 196 ? 27.876 22.815 61.721  1.00 20.59  ? 567 SER A OG  1 
ATOM   1356 N N   . PRO A 1 197 ? 26.677 19.998 61.202  1.00 28.86  ? 568 PRO A N   1 
ATOM   1357 C CA  . PRO A 1 197 ? 27.050 18.692 61.779  1.00 27.90  ? 568 PRO A CA  1 
ATOM   1358 C C   . PRO A 1 197 ? 27.937 18.811 63.047  1.00 29.92  ? 568 PRO A C   1 
ATOM   1359 O O   . PRO A 1 197 ? 28.224 17.807 63.723  1.00 30.69  ? 568 PRO A O   1 
ATOM   1360 C CB  . PRO A 1 197 ? 27.761 17.973 60.613  1.00 27.15  ? 568 PRO A CB  1 
ATOM   1361 C CG  . PRO A 1 197 ? 28.155 19.109 59.648  1.00 26.25  ? 568 PRO A CG  1 
ATOM   1362 C CD  . PRO A 1 197 ? 27.021 20.083 59.767  1.00 26.97  ? 568 PRO A CD  1 
ATOM   1363 N N   . LEU A 1 198 ? 28.355 20.040 63.364  1.00 28.82  ? 569 LEU A N   1 
ATOM   1364 C CA  . LEU A 1 198 ? 29.176 20.330 64.551  1.00 28.67  ? 569 LEU A CA  1 
ATOM   1365 C C   . LEU A 1 198 ? 28.413 19.989 65.841  1.00 27.33  ? 569 LEU A C   1 
ATOM   1366 O O   . LEU A 1 198 ? 28.924 19.300 66.711  1.00 27.91  ? 569 LEU A O   1 
ATOM   1367 C CB  . LEU A 1 198 ? 29.513 21.815 64.606  1.00 24.96  ? 569 LEU A CB  1 
ATOM   1368 C CG  . LEU A 1 198 ? 30.863 22.269 65.161  1.00 27.62  ? 569 LEU A CG  1 
ATOM   1369 C CD1 . LEU A 1 198 ? 30.698 23.667 65.680  1.00 22.79  ? 569 LEU A CD1 1 
ATOM   1370 C CD2 . LEU A 1 198 ? 31.414 21.344 66.207  1.00 21.70  ? 569 LEU A CD2 1 
ATOM   1371 N N   . PHE A 1 199 ? 27.190 20.481 65.953  1.00 27.04  ? 570 PHE A N   1 
ATOM   1372 C CA  . PHE A 1 199 ? 26.394 20.239 67.148  1.00 28.95  ? 570 PHE A CA  1 
ATOM   1373 C C   . PHE A 1 199 ? 26.151 18.768 67.417  1.00 30.36  ? 570 PHE A C   1 
ATOM   1374 O O   . PHE A 1 199 ? 26.204 18.327 68.564  1.00 30.89  ? 570 PHE A O   1 
ATOM   1375 C CB  . PHE A 1 199 ? 25.085 20.990 67.059  1.00 26.36  ? 570 PHE A CB  1 
ATOM   1376 C CG  . PHE A 1 199 ? 25.258 22.467 66.969  1.00 29.07  ? 570 PHE A CG  1 
ATOM   1377 C CD1 . PHE A 1 199 ? 25.636 23.205 68.096  1.00 25.69  ? 570 PHE A CD1 1 
ATOM   1378 C CD2 . PHE A 1 199 ? 25.052 23.136 65.756  1.00 25.19  ? 570 PHE A CD2 1 
ATOM   1379 C CE1 . PHE A 1 199 ? 25.810 24.593 68.017  1.00 25.97  ? 570 PHE A CE1 1 
ATOM   1380 C CE2 . PHE A 1 199 ? 25.221 24.519 65.668  1.00 26.28  ? 570 PHE A CE2 1 
ATOM   1381 C CZ  . PHE A 1 199 ? 25.601 25.254 66.799  1.00 26.30  ? 570 PHE A CZ  1 
ATOM   1382 N N   . ASP A 1 200 ? 25.953 18.000 66.351  1.00 32.15  ? 571 ASP A N   1 
ATOM   1383 C CA  . ASP A 1 200 ? 25.722 16.569 66.465  1.00 33.71  ? 571 ASP A CA  1 
ATOM   1384 C C   . ASP A 1 200 ? 26.982 15.946 67.014  1.00 32.62  ? 571 ASP A C   1 
ATOM   1385 O O   . ASP A 1 200 ? 26.931 15.015 67.809  1.00 33.00  ? 571 ASP A O   1 
ATOM   1386 C CB  . ASP A 1 200 ? 25.407 15.947 65.091  1.00 42.03  ? 571 ASP A CB  1 
ATOM   1387 C CG  . ASP A 1 200 ? 24.191 16.592 64.398  1.00 50.43  ? 571 ASP A CG  1 
ATOM   1388 O OD1 . ASP A 1 200 ? 24.286 17.783 63.983  1.00 50.41  ? 571 ASP A OD1 1 
ATOM   1389 O OD2 . ASP A 1 200 ? 23.150 15.891 64.237  1.00 54.94  ? 571 ASP A OD2 1 
ATOM   1390 N N   . LEU A 1 201 ? 28.125 16.481 66.605  1.00 32.68  ? 572 LEU A N   1 
ATOM   1391 C CA  . LEU A 1 201 ? 29.421 15.960 67.056  1.00 32.56  ? 572 LEU A CA  1 
ATOM   1392 C C   . LEU A 1 201 ? 29.760 16.342 68.511  1.00 33.18  ? 572 LEU A C   1 
ATOM   1393 O O   . LEU A 1 201 ? 30.382 15.560 69.252  1.00 29.54  ? 572 LEU A O   1 
ATOM   1394 C CB  . LEU A 1 201 ? 30.529 16.438 66.114  1.00 33.35  ? 572 LEU A CB  1 
ATOM   1395 C CG  . LEU A 1 201 ? 31.982 16.060 66.403  1.00 33.06  ? 572 LEU A CG  1 
ATOM   1396 C CD1 . LEU A 1 201 ? 32.236 14.559 66.273  1.00 34.05  ? 572 LEU A CD1 1 
ATOM   1397 C CD2 . LEU A 1 201 ? 32.838 16.817 65.410  1.00 36.96  ? 572 LEU A CD2 1 
ATOM   1398 N N   . ILE A 1 202 ? 29.400 17.561 68.896  1.00 31.27  ? 573 ILE A N   1 
ATOM   1399 C CA  . ILE A 1 202 ? 29.656 18.005 70.252  1.00 32.82  ? 573 ILE A CA  1 
ATOM   1400 C C   . ILE A 1 202 ? 28.869 17.089 71.171  1.00 34.51  ? 573 ILE A C   1 
ATOM   1401 O O   . ILE A 1 202 ? 29.457 16.371 71.974  1.00 33.98  ? 573 ILE A O   1 
ATOM   1402 C CB  . ILE A 1 202 ? 29.209 19.465 70.493  1.00 32.04  ? 573 ILE A CB  1 
ATOM   1403 C CG1 . ILE A 1 202 ? 30.177 20.441 69.816  1.00 26.06  ? 573 ILE A CG1 1 
ATOM   1404 C CG2 . ILE A 1 202 ? 29.174 19.750 71.999  1.00 29.31  ? 573 ILE A CG2 1 
ATOM   1405 C CD1 . ILE A 1 202 ? 29.692 21.866 69.839  1.00 27.97  ? 573 ILE A CD1 1 
ATOM   1406 N N   . LYS A 1 203 ? 27.558 17.022 70.952  1.00 35.25  ? 574 LYS A N   1 
ATOM   1407 C CA  . LYS A 1 203 ? 26.686 16.206 71.794  1.00 39.78  ? 574 LYS A CA  1 
ATOM   1408 C C   . LYS A 1 203 ? 27.163 14.784 72.055  1.00 41.49  ? 574 LYS A C   1 
ATOM   1409 O O   . LYS A 1 203 ? 27.123 14.316 73.191  1.00 42.07  ? 574 LYS A O   1 
ATOM   1410 C CB  . LYS A 1 203 ? 25.248 16.202 71.258  1.00 39.64  ? 574 LYS A CB  1 
ATOM   1411 C CG  . LYS A 1 203 ? 24.593 17.588 71.312  1.00 45.30  ? 574 LYS A CG  1 
ATOM   1412 C CD  . LYS A 1 203 ? 23.212 17.637 70.657  1.00 46.31  ? 574 LYS A CD  1 
ATOM   1413 C CE  . LYS A 1 203 ? 22.937 19.011 70.016  1.00 49.29  ? 574 LYS A CE  1 
ATOM   1414 N NZ  . LYS A 1 203 ? 23.148 20.205 70.909  1.00 50.59  ? 574 LYS A NZ  1 
ATOM   1415 N N   . GLN A 1 204 ? 27.653 14.115 71.019  1.00 41.28  ? 575 GLN A N   1 
ATOM   1416 C CA  . GLN A 1 204 ? 28.102 12.737 71.154  1.00 41.69  ? 575 GLN A CA  1 
ATOM   1417 C C   . GLN A 1 204 ? 29.420 12.603 71.881  1.00 40.99  ? 575 GLN A C   1 
ATOM   1418 O O   . GLN A 1 204 ? 29.695 11.572 72.489  1.00 41.94  ? 575 GLN A O   1 
ATOM   1419 C CB  . GLN A 1 204 ? 28.201 12.072 69.776  1.00 43.23  ? 575 GLN A CB  1 
ATOM   1420 C CG  . GLN A 1 204 ? 28.515 10.584 69.814  1.00 46.36  ? 575 GLN A CG  1 
ATOM   1421 C CD  . GLN A 1 204 ? 27.387 9.744  70.420  1.00 47.57  ? 575 GLN A CD  1 
ATOM   1422 O OE1 . GLN A 1 204 ? 26.287 10.246 70.690  1.00 48.05  ? 575 GLN A OE1 1 
ATOM   1423 N NE2 . GLN A 1 204 ? 27.654 8.454  70.616  1.00 48.42  ? 575 GLN A NE2 1 
ATOM   1424 N N   . SER A 1 205 ? 30.267 13.613 71.763  1.00 42.97  ? 576 SER A N   1 
ATOM   1425 C CA  . SER A 1 205 ? 31.561 13.577 72.426  1.00 46.52  ? 576 SER A CA  1 
ATOM   1426 C C   . SER A 1 205 ? 31.388 13.975 73.892  1.00 47.40  ? 576 SER A C   1 
ATOM   1427 O O   . SER A 1 205 ? 31.925 13.331 74.800  1.00 47.40  ? 576 SER A O   1 
ATOM   1428 C CB  . SER A 1 205 ? 32.538 14.533 71.731  1.00 47.93  ? 576 SER A CB  1 
ATOM   1429 O OG  . SER A 1 205 ? 32.701 14.187 70.364  1.00 53.20  ? 576 SER A OG  1 
ATOM   1430 N N   . LYS A 1 206 ? 30.606 15.030 74.092  1.00 50.63  ? 577 LYS A N   1 
ATOM   1431 C CA  . LYS A 1 206 ? 30.305 15.604 75.394  1.00 51.50  ? 577 LYS A CA  1 
ATOM   1432 C C   . LYS A 1 206 ? 29.021 15.001 76.002  1.00 53.19  ? 577 LYS A C   1 
ATOM   1433 O O   . LYS A 1 206 ? 27.944 15.633 75.906  1.00 56.08  ? 577 LYS A O   1 
ATOM   1434 C CB  . LYS A 1 206 ? 30.174 17.117 75.223  1.00 48.61  ? 577 LYS A CB  1 
ATOM   1435 C CG  . LYS A 1 206 ? 30.024 17.858 76.501  1.00 50.30  ? 577 LYS A CG  1 
ATOM   1436 C CD  . LYS A 1 206 ? 30.113 19.345 76.287  1.00 51.19  ? 577 LYS A CD  1 
ATOM   1437 C CE  . LYS A 1 206 ? 30.794 19.976 77.481  1.00 54.23  ? 577 LYS A CE  1 
ATOM   1438 N NZ  . LYS A 1 206 ? 32.144 19.334 77.744  1.00 56.06  ? 577 LYS A NZ  1 
ATOM   1439 N N   . THR B 2 10  ? 38.735 13.659 68.294  1.00 53.71  ? 645 THR B N   1 
ATOM   1440 C CA  . THR B 2 10  ? 39.961 14.086 67.571  1.00 55.53  ? 645 THR B CA  1 
ATOM   1441 C C   . THR B 2 10  ? 39.644 15.173 66.549  1.00 53.05  ? 645 THR B C   1 
ATOM   1442 O O   . THR B 2 10  ? 40.269 16.232 66.548  1.00 54.87  ? 645 THR B O   1 
ATOM   1443 C CB  . THR B 2 10  ? 40.633 12.900 66.888  1.00 57.84  ? 645 THR B CB  1 
ATOM   1444 O OG1 . THR B 2 10  ? 40.411 11.722 67.676  1.00 62.50  ? 645 THR B OG1 1 
ATOM   1445 C CG2 . THR B 2 10  ? 42.133 13.142 66.779  1.00 59.44  ? 645 THR B CG2 1 
ATOM   1446 N N   . SER B 2 11  ? 38.688 14.908 65.665  1.00 52.44  ? 646 SER B N   1 
ATOM   1447 C CA  . SER B 2 11  ? 38.287 15.911 64.685  1.00 49.27  ? 646 SER B CA  1 
ATOM   1448 C C   . SER B 2 11  ? 37.801 17.106 65.500  1.00 45.25  ? 646 SER B C   1 
ATOM   1449 O O   . SER B 2 11  ? 38.342 18.199 65.381  1.00 44.36  ? 646 SER B O   1 
ATOM   1450 C CB  . SER B 2 11  ? 37.162 15.378 63.778  1.00 51.97  ? 646 SER B CB  1 
ATOM   1451 O OG  . SER B 2 11  ? 36.083 14.823 64.520  1.00 54.17  ? 646 SER B OG  1 
ATOM   1452 N N   . LEU B 2 12  ? 36.871 16.846 66.419  1.00 41.02  ? 647 LEU B N   1 
ATOM   1453 C CA  . LEU B 2 12  ? 36.313 17.884 67.285  1.00 39.18  ? 647 LEU B CA  1 
ATOM   1454 C C   . LEU B 2 12  ? 37.368 18.532 68.149  1.00 35.52  ? 647 LEU B C   1 
ATOM   1455 O O   . LEU B 2 12  ? 37.324 19.739 68.380  1.00 35.06  ? 647 LEU B O   1 
ATOM   1456 C CB  . LEU B 2 12  ? 35.208 17.320 68.182  1.00 39.45  ? 647 LEU B CB  1 
ATOM   1457 C CG  . LEU B 2 12  ? 34.369 18.352 68.951  1.00 38.78  ? 647 LEU B CG  1 
ATOM   1458 C CD1 . LEU B 2 12  ? 33.898 19.482 68.043  1.00 35.38  ? 647 LEU B CD1 1 
ATOM   1459 C CD2 . LEU B 2 12  ? 33.196 17.654 69.611  1.00 37.37  ? 647 LEU B CD2 1 
ATOM   1460 N N   . SER B 2 13  ? 38.326 17.737 68.617  1.00 34.95  ? 648 SER B N   1 
ATOM   1461 C CA  . SER B 2 13  ? 39.384 18.289 69.461  1.00 35.75  ? 648 SER B CA  1 
ATOM   1462 C C   . SER B 2 13  ? 40.274 19.217 68.647  1.00 33.26  ? 648 SER B C   1 
ATOM   1463 O O   . SER B 2 13  ? 40.729 20.248 69.146  1.00 30.88  ? 648 SER B O   1 
ATOM   1464 C CB  . SER B 2 13  ? 40.219 17.184 70.128  1.00 38.28  ? 648 SER B CB  1 
ATOM   1465 O OG  . SER B 2 13  ? 40.883 16.365 69.179  1.00 41.35  ? 648 SER B OG  1 
ATOM   1466 N N   . LEU B 2 14  ? 40.484 18.848 67.383  1.00 32.30  ? 649 LEU B N   1 
ATOM   1467 C CA  . LEU B 2 14  ? 41.299 19.619 66.463  1.00 27.59  ? 649 LEU B CA  1 
ATOM   1468 C C   . LEU B 2 14  ? 40.537 20.893 66.185  1.00 22.72  ? 649 LEU B C   1 
ATOM   1469 O O   . LEU B 2 14  ? 41.095 21.986 66.252  1.00 20.69  ? 649 LEU B O   1 
ATOM   1470 C CB  . LEU B 2 14  ? 41.514 18.833 65.162  1.00 36.43  ? 649 LEU B CB  1 
ATOM   1471 C CG  . LEU B 2 14  ? 42.525 19.349 64.119  1.00 39.04  ? 649 LEU B CG  1 
ATOM   1472 C CD1 . LEU B 2 14  ? 42.720 18.298 63.031  1.00 41.95  ? 649 LEU B CD1 1 
ATOM   1473 C CD2 . LEU B 2 14  ? 42.073 20.648 63.491  1.00 41.94  ? 649 LEU B CD2 1 
ATOM   1474 N N   . PHE B 2 15  ? 39.254 20.740 65.882  1.00 20.49  ? 650 PHE B N   1 
ATOM   1475 C CA  . PHE B 2 15  ? 38.403 21.883 65.602  1.00 23.59  ? 650 PHE B CA  1 
ATOM   1476 C C   . PHE B 2 15  ? 38.438 22.896 66.758  1.00 22.97  ? 650 PHE B C   1 
ATOM   1477 O O   . PHE B 2 15  ? 38.660 24.107 66.546  1.00 18.50  ? 650 PHE B O   1 
ATOM   1478 C CB  . PHE B 2 15  ? 36.953 21.450 65.331  1.00 22.59  ? 650 PHE B CB  1 
ATOM   1479 C CG  . PHE B 2 15  ? 36.040 22.608 64.993  1.00 26.94  ? 650 PHE B CG  1 
ATOM   1480 C CD1 . PHE B 2 15  ? 36.187 23.308 63.775  1.00 26.36  ? 650 PHE B CD1 1 
ATOM   1481 C CD2 . PHE B 2 15  ? 35.092 23.052 65.908  1.00 21.47  ? 650 PHE B CD2 1 
ATOM   1482 C CE1 . PHE B 2 15  ? 35.398 24.441 63.491  1.00 26.96  ? 650 PHE B CE1 1 
ATOM   1483 C CE2 . PHE B 2 15  ? 34.305 24.179 65.635  1.00 26.39  ? 650 PHE B CE2 1 
ATOM   1484 C CZ  . PHE B 2 15  ? 34.459 24.879 64.419  1.00 24.30  ? 650 PHE B CZ  1 
ATOM   1485 N N   . TYR B 2 16  ? 38.240 22.399 67.981  1.00 23.04  ? 651 TYR B N   1 
ATOM   1486 C CA  . TYR B 2 16  ? 38.263 23.280 69.143  1.00 17.85  ? 651 TYR B CA  1 
ATOM   1487 C C   . TYR B 2 16  ? 39.612 23.919 69.325  1.00 13.80  ? 651 TYR B C   1 
ATOM   1488 O O   . TYR B 2 16  ? 39.694 25.095 69.649  1.00 15.42  ? 651 TYR B O   1 
ATOM   1489 C CB  . TYR B 2 16  ? 37.844 22.523 70.387  1.00 22.68  ? 651 TYR B CB  1 
ATOM   1490 C CG  . TYR B 2 16  ? 36.408 22.757 70.706  1.00 21.64  ? 651 TYR B CG  1 
ATOM   1491 C CD1 . TYR B 2 16  ? 36.027 23.868 71.430  1.00 23.62  ? 651 TYR B CD1 1 
ATOM   1492 C CD2 . TYR B 2 16  ? 35.432 21.870 70.301  1.00 24.90  ? 651 TYR B CD2 1 
ATOM   1493 C CE1 . TYR B 2 16  ? 34.695 24.099 71.762  1.00 24.75  ? 651 TYR B CE1 1 
ATOM   1494 C CE2 . TYR B 2 16  ? 34.079 22.087 70.626  1.00 27.61  ? 651 TYR B CE2 1 
ATOM   1495 C CZ  . TYR B 2 16  ? 33.727 23.213 71.360  1.00 24.00  ? 651 TYR B CZ  1 
ATOM   1496 O OH  . TYR B 2 16  ? 32.417 23.475 71.677  1.00 22.66  ? 651 TYR B OH  1 
ATOM   1497 N N   . LYS B 2 17  ? 40.687 23.169 69.106  1.00 17.97  ? 652 LYS B N   1 
ATOM   1498 C CA  . LYS B 2 17  ? 42.000 23.776 69.229  1.00 20.67  ? 652 LYS B CA  1 
ATOM   1499 C C   . LYS B 2 17  ? 42.139 24.992 68.323  1.00 20.48  ? 652 LYS B C   1 
ATOM   1500 O O   . LYS B 2 17  ? 42.596 26.053 68.756  1.00 21.90  ? 652 LYS B O   1 
ATOM   1501 C CB  . LYS B 2 17  ? 43.101 22.762 68.975  1.00 26.06  ? 652 LYS B CB  1 
ATOM   1502 C CG  . LYS B 2 17  ? 43.108 21.719 70.059  1.00 33.25  ? 652 LYS B CG  1 
ATOM   1503 C CD  . LYS B 2 17  ? 44.396 20.919 70.098  1.00 39.43  ? 652 LYS B CD  1 
ATOM   1504 C CE  . LYS B 2 17  ? 44.349 19.872 71.227  1.00 43.40  ? 652 LYS B CE  1 
ATOM   1505 N NZ  . LYS B 2 17  ? 44.221 20.458 72.614  1.00 45.64  ? 652 LYS B NZ  1 
ATOM   1506 N N   . LYS B 2 18  ? 41.688 24.855 67.079  1.00 23.13  ? 653 LYS B N   1 
ATOM   1507 C CA  . LYS B 2 18  ? 41.738 25.943 66.104  1.00 19.36  ? 653 LYS B CA  1 
ATOM   1508 C C   . LYS B 2 18  ? 40.868 27.091 66.574  1.00 12.83  ? 653 LYS B C   1 
ATOM   1509 O O   . LYS B 2 18  ? 41.248 28.258 66.493  1.00 12.87  ? 653 LYS B O   1 
ATOM   1510 C CB  . LYS B 2 18  ? 41.235 25.442 64.738  1.00 23.31  ? 653 LYS B CB  1 
ATOM   1511 C CG  . LYS B 2 18  ? 42.248 24.585 63.967  1.00 28.47  ? 653 LYS B CG  1 
ATOM   1512 C CD  . LYS B 2 18  ? 41.671 24.102 62.624  1.00 32.15  ? 653 LYS B CD  1 
ATOM   1513 C CE  . LYS B 2 18  ? 42.755 23.681 61.658  1.00 30.18  ? 653 LYS B CE  1 
ATOM   1514 N NZ  . LYS B 2 18  ? 43.492 24.884 61.208  1.00 33.21  ? 653 LYS B NZ  1 
ATOM   1515 N N   . VAL B 2 19  ? 39.664 26.773 67.024  1.00 15.73  ? 654 VAL B N   1 
ATOM   1516 C CA  . VAL B 2 19  ? 38.778 27.820 67.511  1.00 13.86  ? 654 VAL B CA  1 
ATOM   1517 C C   . VAL B 2 19  ? 39.381 28.560 68.691  1.00 13.22  ? 654 VAL B C   1 
ATOM   1518 O O   . VAL B 2 19  ? 39.393 29.787 68.685  1.00 14.90  ? 654 VAL B O   1 
ATOM   1519 C CB  . VAL B 2 19  ? 37.391 27.279 67.890  1.00 14.61  ? 654 VAL B CB  1 
ATOM   1520 C CG1 . VAL B 2 19  ? 36.576 28.344 68.610  1.00 14.68  ? 654 VAL B CG1 1 
ATOM   1521 C CG2 . VAL B 2 19  ? 36.658 26.790 66.617  1.00 14.95  ? 654 VAL B CG2 1 
ATOM   1522 N N   . TYR B 2 20  ? 39.942 27.829 69.663  1.00 16.69  ? 655 TYR B N   1 
ATOM   1523 C CA  . TYR B 2 20  ? 40.537 28.476 70.845  1.00 12.75  ? 655 TYR B CA  1 
ATOM   1524 C C   . TYR B 2 20  ? 41.692 29.364 70.463  1.00 16.80  ? 655 TYR B C   1 
ATOM   1525 O O   . TYR B 2 20  ? 41.845 30.454 71.008  1.00 15.47  ? 655 TYR B O   1 
ATOM   1526 C CB  . TYR B 2 20  ? 41.029 27.446 71.856  1.00 15.88  ? 655 TYR B CB  1 
ATOM   1527 C CG  . TYR B 2 20  ? 39.966 26.609 72.540  1.00 13.88  ? 655 TYR B CG  1 
ATOM   1528 C CD1 . TYR B 2 20  ? 38.694 27.106 72.794  1.00 18.74  ? 655 TYR B CD1 1 
ATOM   1529 C CD2 . TYR B 2 20  ? 40.260 25.330 72.969  1.00 17.01  ? 655 TYR B CD2 1 
ATOM   1530 C CE1 . TYR B 2 20  ? 37.749 26.332 73.459  1.00 17.56  ? 655 TYR B CE1 1 
ATOM   1531 C CE2 . TYR B 2 20  ? 39.331 24.557 73.635  1.00 19.16  ? 655 TYR B CE2 1 
ATOM   1532 C CZ  . TYR B 2 20  ? 38.081 25.056 73.867  1.00 17.47  ? 655 TYR B CZ  1 
ATOM   1533 O OH  . TYR B 2 20  ? 37.144 24.218 74.423  1.00 24.82  ? 655 TYR B OH  1 
ATOM   1534 N N   . ARG B 2 21  ? 42.533 28.902 69.524  1.00 21.15  ? 656 ARG B N   1 
ATOM   1535 C CA  . ARG B 2 21  ? 43.673 29.705 69.085  1.00 19.38  ? 656 ARG B CA  1 
ATOM   1536 C C   . ARG B 2 21  ? 43.215 31.028 68.498  1.00 19.68  ? 656 ARG B C   1 
ATOM   1537 O O   . ARG B 2 21  ? 43.724 32.093 68.877  1.00 21.14  ? 656 ARG B O   1 
ATOM   1538 C CB  . ARG B 2 21  ? 44.533 28.949 68.087  1.00 25.18  ? 656 ARG B CB  1 
ATOM   1539 C CG  . ARG B 2 21  ? 45.333 27.868 68.715  1.00 33.08  ? 656 ARG B CG  1 
ATOM   1540 C CD  . ARG B 2 21  ? 46.333 27.292 67.720  1.00 42.86  ? 656 ARG B CD  1 
ATOM   1541 N NE  . ARG B 2 21  ? 45.884 26.070 67.042  1.00 46.38  ? 656 ARG B NE  1 
ATOM   1542 C CZ  . ARG B 2 21  ? 46.649 24.991 66.870  1.00 46.41  ? 656 ARG B CZ  1 
ATOM   1543 N NH1 . ARG B 2 21  ? 47.905 24.977 67.331  1.00 48.61  ? 656 ARG B NH1 1 
ATOM   1544 N NH2 . ARG B 2 21  ? 46.166 23.934 66.228  1.00 46.52  ? 656 ARG B NH2 1 
ATOM   1545 N N   . LEU B 2 22  ? 42.212 30.971 67.623  1.00 18.45  ? 657 LEU B N   1 
ATOM   1546 C CA  . LEU B 2 22  ? 41.646 32.179 66.982  1.00 18.12  ? 657 LEU B CA  1 
ATOM   1547 C C   . LEU B 2 22  ? 41.070 33.107 68.046  1.00 13.35  ? 657 LEU B C   1 
ATOM   1548 O O   . LEU B 2 22  ? 41.324 34.311 68.061  1.00 13.89  ? 657 LEU B O   1 
ATOM   1549 C CB  . LEU B 2 22  ? 40.478 31.795 66.048  1.00 20.08  ? 657 LEU B CB  1 
ATOM   1550 C CG  . LEU B 2 22  ? 40.331 32.338 64.614  1.00 24.77  ? 657 LEU B CG  1 
ATOM   1551 C CD1 . LEU B 2 22  ? 38.860 32.334 64.227  1.00 20.36  ? 657 LEU B CD1 1 
ATOM   1552 C CD2 . LEU B 2 22  ? 40.935 33.701 64.435  1.00 21.90  ? 657 LEU B CD2 1 
ATOM   1553 N N   . ALA B 2 23  ? 40.211 32.531 68.875  1.00 16.33  ? 658 ALA B N   1 
ATOM   1554 C CA  . ALA B 2 23  ? 39.548 33.261 69.942  1.00 14.08  ? 658 ALA B CA  1 
ATOM   1555 C C   . ALA B 2 23  ? 40.555 33.990 70.866  1.00 14.59  ? 658 ALA B C   1 
ATOM   1556 O O   . ALA B 2 23  ? 40.453 35.203 71.114  1.00 14.91  ? 658 ALA B O   1 
ATOM   1557 C CB  . ALA B 2 23  ? 38.707 32.292 70.712  1.00 15.41  ? 658 ALA B CB  1 
ATOM   1558 N N   . TYR B 2 24  ? 41.585 33.269 71.303  1.00 15.07  ? 659 TYR B N   1 
ATOM   1559 C CA  . TYR B 2 24  ? 42.563 33.857 72.194  1.00 14.02  ? 659 TYR B CA  1 
ATOM   1560 C C   . TYR B 2 24  ? 43.372 34.958 71.524  1.00 16.79  ? 659 TYR B C   1 
ATOM   1561 O O   . TYR B 2 24  ? 43.668 35.995 72.127  1.00 15.90  ? 659 TYR B O   1 
ATOM   1562 C CB  . TYR B 2 24  ? 43.462 32.760 72.803  1.00 13.74  ? 659 TYR B CB  1 
ATOM   1563 C CG  . TYR B 2 24  ? 44.505 33.335 73.693  1.00 17.29  ? 659 TYR B CG  1 
ATOM   1564 C CD1 . TYR B 2 24  ? 44.195 33.721 75.006  1.00 17.95  ? 659 TYR B CD1 1 
ATOM   1565 C CD2 . TYR B 2 24  ? 45.758 33.671 73.182  1.00 19.74  ? 659 TYR B CD2 1 
ATOM   1566 C CE1 . TYR B 2 24  ? 45.092 34.441 75.768  1.00 17.48  ? 659 TYR B CE1 1 
ATOM   1567 C CE2 . TYR B 2 24  ? 46.660 34.388 73.937  1.00 23.12  ? 659 TYR B CE2 1 
ATOM   1568 C CZ  . TYR B 2 24  ? 46.311 34.773 75.230  1.00 21.67  ? 659 TYR B CZ  1 
ATOM   1569 O OH  . TYR B 2 24  ? 47.201 35.517 75.944  1.00 26.64  ? 659 TYR B OH  1 
ATOM   1570 N N   . LEU B 2 25  ? 43.742 34.741 70.267  1.00 18.76  ? 660 LEU B N   1 
ATOM   1571 C CA  . LEU B 2 25  ? 44.510 35.753 69.573  1.00 15.99  ? 660 LEU B CA  1 
ATOM   1572 C C   . LEU B 2 25  ? 43.755 37.041 69.514  1.00 14.11  ? 660 LEU B C   1 
ATOM   1573 O O   . LEU B 2 25  ? 44.323 38.118 69.721  1.00 15.46  ? 660 LEU B O   1 
ATOM   1574 C CB  . LEU B 2 25  ? 44.850 35.282 68.164  1.00 24.12  ? 660 LEU B CB  1 
ATOM   1575 C CG  . LEU B 2 25  ? 45.945 34.240 68.244  1.00 29.24  ? 660 LEU B CG  1 
ATOM   1576 C CD1 . LEU B 2 25  ? 46.151 33.564 66.897  1.00 31.44  ? 660 LEU B CD1 1 
ATOM   1577 C CD2 . LEU B 2 25  ? 47.219 34.911 68.770  1.00 34.66  ? 660 LEU B CD2 1 
ATOM   1578 N N   . ARG B 2 26  ? 42.473 36.956 69.186  1.00 14.90  ? 661 ARG B N   1 
ATOM   1579 C CA  . ARG B 2 26  ? 41.643 38.161 69.100  1.00 16.87  ? 661 ARG B CA  1 
ATOM   1580 C C   . ARG B 2 26  ? 41.469 38.784 70.504  1.00 16.09  ? 661 ARG B C   1 
ATOM   1581 O O   . ARG B 2 26  ? 41.545 40.017 70.674  1.00 13.69  ? 661 ARG B O   1 
ATOM   1582 C CB  . ARG B 2 26  ? 40.281 37.841 68.443  1.00 18.89  ? 661 ARG B CB  1 
ATOM   1583 C CG  . ARG B 2 26  ? 40.406 37.346 66.979  1.00 19.95  ? 661 ARG B CG  1 
ATOM   1584 C CD  . ARG B 2 26  ? 39.056 36.882 66.385  1.00 21.61  ? 661 ARG B CD  1 
ATOM   1585 N NE  . ARG B 2 26  ? 39.158 36.577 64.947  1.00 19.32  ? 661 ARG B NE  1 
ATOM   1586 C CZ  . ARG B 2 26  ? 38.178 36.089 64.184  1.00 21.14  ? 661 ARG B CZ  1 
ATOM   1587 N NH1 . ARG B 2 26  ? 36.984 35.841 64.694  1.00 14.45  ? 661 ARG B NH1 1 
ATOM   1588 N NH2 . ARG B 2 26  ? 38.424 35.765 62.909  1.00 21.15  ? 661 ARG B NH2 1 
ATOM   1589 N N   . LEU B 2 27  ? 41.306 37.917 71.508  1.00 19.06  ? 662 LEU B N   1 
ATOM   1590 C CA  . LEU B 2 27  ? 41.155 38.355 72.915  1.00 17.41  ? 662 LEU B CA  1 
ATOM   1591 C C   . LEU B 2 27  ? 42.378 39.167 73.326  1.00 15.24  ? 662 LEU B C   1 
ATOM   1592 O O   . LEU B 2 27  ? 42.264 40.292 73.821  1.00 16.40  ? 662 LEU B O   1 
ATOM   1593 C CB  . LEU B 2 27  ? 41.086 37.125 73.821  1.00 18.50  ? 662 LEU B CB  1 
ATOM   1594 C CG  . LEU B 2 27  ? 40.356 37.203 75.162  1.00 21.77  ? 662 LEU B CG  1 
ATOM   1595 C CD1 . LEU B 2 27  ? 41.149 36.513 76.226  1.00 19.75  ? 662 LEU B CD1 1 
ATOM   1596 C CD2 . LEU B 2 27  ? 39.988 38.623 75.512  1.00 21.09  ? 662 LEU B CD2 1 
ATOM   1597 N N   . ASN B 2 28  ? 43.551 38.572 73.104  1.00 19.58  ? 663 ASN B N   1 
ATOM   1598 C CA  . ASN B 2 28  ? 44.828 39.174 73.448  1.00 18.06  ? 663 ASN B CA  1 
ATOM   1599 C C   . ASN B 2 28  ? 45.027 40.542 72.827  1.00 22.22  ? 663 ASN B C   1 
ATOM   1600 O O   . ASN B 2 28  ? 45.534 41.463 73.492  1.00 22.31  ? 663 ASN B O   1 
ATOM   1601 C CB  . ASN B 2 28  ? 45.965 38.232 73.067  1.00 21.23  ? 663 ASN B CB  1 
ATOM   1602 C CG  . ASN B 2 28  ? 47.332 38.831 73.359  1.00 27.89  ? 663 ASN B CG  1 
ATOM   1603 O OD1 . ASN B 2 28  ? 48.038 39.259 72.448  1.00 34.19  ? 663 ASN B OD1 1 
ATOM   1604 N ND2 . ASN B 2 28  ? 47.710 38.870 74.628  1.00 26.90  ? 663 ASN B ND2 1 
ATOM   1605 N N   . THR B 2 29  ? 44.596 40.701 71.570  1.00 20.91  ? 664 THR B N   1 
ATOM   1606 C CA  . THR B 2 29  ? 44.712 41.991 70.889  1.00 20.39  ? 664 THR B CA  1 
ATOM   1607 C C   . THR B 2 29  ? 43.858 43.066 71.569  1.00 20.43  ? 664 THR B C   1 
ATOM   1608 O O   . THR B 2 29  ? 44.321 44.185 71.798  1.00 20.46  ? 664 THR B O   1 
ATOM   1609 C CB  . THR B 2 29  ? 44.306 41.898 69.374  1.00 22.50  ? 664 THR B CB  1 
ATOM   1610 O OG1 . THR B 2 29  ? 45.182 40.989 68.690  1.00 23.40  ? 664 THR B OG1 1 
ATOM   1611 C CG2 . THR B 2 29  ? 44.403 43.272 68.712  1.00 21.17  ? 664 THR B CG2 1 
ATOM   1612 N N   . LEU B 2 30  ? 42.602 42.748 71.854  1.00 19.23  ? 665 LEU B N   1 
ATOM   1613 C CA  . LEU B 2 30  ? 41.733 43.717 72.516  1.00 23.08  ? 665 LEU B CA  1 
ATOM   1614 C C   . LEU B 2 30  ? 42.265 44.048 73.925  1.00 24.43  ? 665 LEU B C   1 
ATOM   1615 O O   . LEU B 2 30  ? 42.336 45.214 74.312  1.00 24.51  ? 665 LEU B O   1 
ATOM   1616 C CB  . LEU B 2 30  ? 40.288 43.190 72.606  1.00 20.34  ? 665 LEU B CB  1 
ATOM   1617 C CG  . LEU B 2 30  ? 39.542 43.048 71.267  1.00 24.69  ? 665 LEU B CG  1 
ATOM   1618 C CD1 . LEU B 2 30  ? 38.156 42.503 71.465  1.00 20.09  ? 665 LEU B CD1 1 
ATOM   1619 C CD2 . LEU B 2 30  ? 39.478 44.401 70.573  1.00 25.37  ? 665 LEU B CD2 1 
ATOM   1620 N N   . CYS B 2 31  ? 42.688 43.024 74.667  1.00 25.12  ? 666 CYS B N   1 
ATOM   1621 C CA  . CYS B 2 31  ? 43.185 43.226 76.023  1.00 27.15  ? 666 CYS B CA  1 
ATOM   1622 C C   . CYS B 2 31  ? 44.473 44.040 76.091  1.00 30.06  ? 666 CYS B C   1 
ATOM   1623 O O   . CYS B 2 31  ? 44.600 44.958 76.921  1.00 29.06  ? 666 CYS B O   1 
ATOM   1624 C CB  . CYS B 2 31  ? 43.362 41.888 76.749  1.00 25.12  ? 666 CYS B CB  1 
ATOM   1625 S SG  . CYS B 2 31  ? 41.840 41.054 77.173  1.00 25.07  ? 666 CYS B SG  1 
ATOM   1626 N N   . GLU B 2 32  ? 45.422 43.731 75.217  1.00 30.60  ? 667 GLU B N   1 
ATOM   1627 C CA  . GLU B 2 32  ? 46.668 44.473 75.237  1.00 33.86  ? 667 GLU B CA  1 
ATOM   1628 C C   . GLU B 2 32  ? 46.397 45.939 74.958  1.00 34.04  ? 667 GLU B C   1 
ATOM   1629 O O   . GLU B 2 32  ? 47.072 46.814 75.498  1.00 34.36  ? 667 GLU B O   1 
ATOM   1630 C CB  . GLU B 2 32  ? 47.697 43.868 74.272  1.00 34.11  ? 667 GLU B CB  1 
ATOM   1631 C CG  . GLU B 2 32  ? 48.325 42.590 74.851  1.00 40.10  ? 667 GLU B CG  1 
ATOM   1632 C CD  . GLU B 2 32  ? 49.571 42.079 74.119  1.00 42.63  ? 667 GLU B CD  1 
ATOM   1633 O OE1 . GLU B 2 32  ? 50.151 42.828 73.294  1.00 46.81  ? 667 GLU B OE1 1 
ATOM   1634 O OE2 . GLU B 2 32  ? 49.977 40.917 74.394  1.00 43.44  ? 667 GLU B OE2 1 
ATOM   1635 N N   . ARG B 2 33  ? 45.309 46.198 74.250  1.00 32.78  ? 668 ARG B N   1 
ATOM   1636 C CA  . ARG B 2 33  ? 44.928 47.554 73.894  1.00 36.15  ? 668 ARG B CA  1 
ATOM   1637 C C   . ARG B 2 33  ? 44.013 48.283 74.894  1.00 35.40  ? 668 ARG B C   1 
ATOM   1638 O O   . ARG B 2 33  ? 44.143 49.488 75.080  1.00 36.12  ? 668 ARG B O   1 
ATOM   1639 C CB  . ARG B 2 33  ? 44.258 47.536 72.513  1.00 41.16  ? 668 ARG B CB  1 
ATOM   1640 C CG  . ARG B 2 33  ? 43.922 48.901 71.910  1.00 45.78  ? 668 ARG B CG  1 
ATOM   1641 C CD  . ARG B 2 33  ? 42.937 48.753 70.755  1.00 51.98  ? 668 ARG B CD  1 
ATOM   1642 N NE  . ARG B 2 33  ? 43.393 47.811 69.719  1.00 57.25  ? 668 ARG B NE  1 
ATOM   1643 C CZ  . ARG B 2 33  ? 42.624 47.338 68.733  1.00 55.95  ? 668 ARG B CZ  1 
ATOM   1644 N NH1 . ARG B 2 33  ? 41.359 47.710 68.633  1.00 51.90  ? 668 ARG B NH1 1 
ATOM   1645 N NH2 . ARG B 2 33  ? 43.122 46.488 67.841  1.00 58.11  ? 668 ARG B NH2 1 
ATOM   1646 N N   . LEU B 2 34  ? 43.076 47.578 75.515  1.00 32.84  ? 669 LEU B N   1 
ATOM   1647 C CA  . LEU B 2 34  ? 42.136 48.217 76.437  1.00 30.67  ? 669 LEU B CA  1 
ATOM   1648 C C   . LEU B 2 34  ? 42.413 47.977 77.928  1.00 31.81  ? 669 LEU B C   1 
ATOM   1649 O O   . LEU B 2 34  ? 42.033 48.782 78.771  1.00 31.64  ? 669 LEU B O   1 
ATOM   1650 C CB  . LEU B 2 34  ? 40.709 47.754 76.105  1.00 31.06  ? 669 LEU B CB  1 
ATOM   1651 C CG  . LEU B 2 34  ? 39.762 48.499 75.142  1.00 34.43  ? 669 LEU B CG  1 
ATOM   1652 C CD1 . LEU B 2 34  ? 40.496 49.361 74.151  1.00 31.80  ? 669 LEU B CD1 1 
ATOM   1653 C CD2 . LEU B 2 34  ? 38.847 47.496 74.439  1.00 28.75  ? 669 LEU B CD2 1 
ATOM   1654 N N   . LEU B 2 35  ? 43.103 46.888 78.236  1.00 30.41  ? 670 LEU B N   1 
ATOM   1655 C CA  . LEU B 2 35  ? 43.383 46.499 79.602  1.00 30.98  ? 670 LEU B CA  1 
ATOM   1656 C C   . LEU B 2 35  ? 44.870 46.427 79.810  1.00 33.40  ? 670 LEU B C   1 
ATOM   1657 O O   . LEU B 2 35  ? 45.397 45.471 80.393  1.00 35.53  ? 670 LEU B O   1 
ATOM   1658 C CB  . LEU B 2 35  ? 42.740 45.137 79.868  1.00 28.79  ? 670 LEU B CB  1 
ATOM   1659 C CG  . LEU B 2 35  ? 41.219 45.104 79.717  1.00 25.55  ? 670 LEU B CG  1 
ATOM   1660 C CD1 . LEU B 2 35  ? 40.722 43.683 79.840  1.00 24.73  ? 670 LEU B CD1 1 
ATOM   1661 C CD2 . LEU B 2 35  ? 40.568 46.005 80.773  1.00 24.08  ? 670 LEU B CD2 1 
ATOM   1662 N N   . SER B 2 36  ? 45.535 47.437 79.265  1.00 39.53  ? 671 SER B N   1 
ATOM   1663 C CA  . SER B 2 36  ? 46.985 47.631 79.321  1.00 43.95  ? 671 SER B CA  1 
ATOM   1664 C C   . SER B 2 36  ? 47.389 47.451 80.788  1.00 46.53  ? 671 SER B C   1 
ATOM   1665 O O   . SER B 2 36  ? 48.267 46.649 81.130  1.00 46.75  ? 671 SER B O   1 
ATOM   1666 C CB  . SER B 2 36  ? 47.259 49.055 78.826  1.00 47.69  ? 671 SER B CB  1 
ATOM   1667 O OG  . SER B 2 36  ? 46.112 49.541 78.094  1.00 49.96  ? 671 SER B OG  1 
ATOM   1668 N N   . GLU B 2 37  ? 46.733 48.229 81.638  1.00 47.76  ? 672 GLU B N   1 
ATOM   1669 C CA  . GLU B 2 37  ? 46.880 48.142 83.080  1.00 53.12  ? 672 GLU B CA  1 
ATOM   1670 C C   . GLU B 2 37  ? 45.794 47.082 83.350  1.00 53.16  ? 672 GLU B C   1 
ATOM   1671 O O   . GLU B 2 37  ? 44.809 47.019 82.611  1.00 57.16  ? 672 GLU B O   1 
ATOM   1672 C CB  . GLU B 2 37  ? 46.514 49.477 83.731  1.00 57.55  ? 672 GLU B CB  1 
ATOM   1673 C CG  . GLU B 2 37  ? 45.089 49.991 83.431  1.00 65.39  ? 672 GLU B CG  1 
ATOM   1674 C CD  . GLU B 2 37  ? 44.856 50.381 81.963  1.00 68.63  ? 672 GLU B CD  1 
ATOM   1675 O OE1 . GLU B 2 37  ? 45.391 51.433 81.537  1.00 72.11  ? 672 GLU B OE1 1 
ATOM   1676 O OE2 . GLU B 2 37  ? 44.138 49.639 81.242  1.00 67.48  ? 672 GLU B OE2 1 
ATOM   1677 N N   . HIS B 2 38  ? 45.934 46.293 84.406  1.00 49.25  ? 673 HIS B N   1 
ATOM   1678 C CA  . HIS B 2 38  ? 45.002 45.200 84.722  1.00 43.19  ? 673 HIS B CA  1 
ATOM   1679 C C   . HIS B 2 38  ? 45.323 43.966 83.869  1.00 40.35  ? 673 HIS B C   1 
ATOM   1680 O O   . HIS B 2 38  ? 44.433 43.308 83.362  1.00 40.15  ? 673 HIS B O   1 
ATOM   1681 C CB  . HIS B 2 38  ? 43.538 45.575 84.484  1.00 43.23  ? 673 HIS B CB  1 
ATOM   1682 C CG  . HIS B 2 38  ? 43.146 46.897 85.053  1.00 45.99  ? 673 HIS B CG  1 
ATOM   1683 N ND1 . HIS B 2 38  ? 42.551 47.882 84.295  1.00 48.04  ? 673 HIS B ND1 1 
ATOM   1684 C CD2 . HIS B 2 38  ? 43.260 47.402 86.303  1.00 48.23  ? 673 HIS B CD2 1 
ATOM   1685 C CE1 . HIS B 2 38  ? 42.313 48.938 85.052  1.00 49.06  ? 673 HIS B CE1 1 
ATOM   1686 N NE2 . HIS B 2 38  ? 42.733 48.671 86.274  1.00 50.08  ? 673 HIS B NE2 1 
ATOM   1687 N N   . PRO B 2 39  ? 46.604 43.600 83.762  1.00 40.41  ? 674 PRO B N   1 
ATOM   1688 C CA  . PRO B 2 39  ? 47.052 42.439 82.978  1.00 39.76  ? 674 PRO B CA  1 
ATOM   1689 C C   . PRO B 2 39  ? 46.601 41.064 83.486  1.00 38.41  ? 674 PRO B C   1 
ATOM   1690 O O   . PRO B 2 39  ? 46.792 40.036 82.812  1.00 37.44  ? 674 PRO B O   1 
ATOM   1691 C CB  . PRO B 2 39  ? 48.569 42.540 83.085  1.00 38.43  ? 674 PRO B CB  1 
ATOM   1692 C CG  . PRO B 2 39  ? 48.799 44.004 83.326  1.00 41.55  ? 674 PRO B CG  1 
ATOM   1693 C CD  . PRO B 2 39  ? 47.764 44.305 84.329  1.00 39.22  ? 674 PRO B CD  1 
ATOM   1694 N N   . GLU B 2 40  ? 46.056 41.027 84.696  1.00 38.00  ? 675 GLU B N   1 
ATOM   1695 C CA  . GLU B 2 40  ? 45.632 39.753 85.290  1.00 37.01  ? 675 GLU B CA  1 
ATOM   1696 C C   . GLU B 2 40  ? 44.293 39.301 84.754  1.00 29.28  ? 675 GLU B C   1 
ATOM   1697 O O   . GLU B 2 40  ? 43.960 38.117 84.799  1.00 27.43  ? 675 GLU B O   1 
ATOM   1698 C CB  . GLU B 2 40  ? 45.566 39.855 86.822  1.00 40.04  ? 675 GLU B CB  1 
ATOM   1699 C CG  . GLU B 2 40  ? 44.474 40.786 87.373  1.00 44.41  ? 675 GLU B CG  1 
ATOM   1700 C CD  . GLU B 2 40  ? 44.778 42.274 87.205  1.00 47.39  ? 675 GLU B CD  1 
ATOM   1701 O OE1 . GLU B 2 40  ? 45.937 42.634 86.886  1.00 48.77  ? 675 GLU B OE1 1 
ATOM   1702 O OE2 . GLU B 2 40  ? 43.849 43.092 87.422  1.00 51.41  ? 675 GLU B OE2 1 
ATOM   1703 N N   . LEU B 2 41  ? 43.552 40.260 84.215  1.00 26.51  ? 676 LEU B N   1 
ATOM   1704 C CA  . LEU B 2 41  ? 42.221 40.025 83.679  1.00 24.04  ? 676 LEU B CA  1 
ATOM   1705 C C   . LEU B 2 41  ? 42.111 39.139 82.431  1.00 17.62  ? 676 LEU B C   1 
ATOM   1706 O O   . LEU B 2 41  ? 41.209 38.331 82.328  1.00 17.53  ? 676 LEU B O   1 
ATOM   1707 C CB  . LEU B 2 41  ? 41.539 41.376 83.412  1.00 26.85  ? 676 LEU B CB  1 
ATOM   1708 C CG  . LEU B 2 41  ? 41.299 42.357 84.559  1.00 27.14  ? 676 LEU B CG  1 
ATOM   1709 C CD1 . LEU B 2 41  ? 40.669 43.621 84.018  1.00 28.02  ? 676 LEU B CD1 1 
ATOM   1710 C CD2 . LEU B 2 41  ? 40.388 41.714 85.604  1.00 27.89  ? 676 LEU B CD2 1 
ATOM   1711 N N   . GLU B 2 42  ? 43.008 39.327 81.466  1.00 23.69  ? 677 GLU B N   1 
ATOM   1712 C CA  . GLU B 2 42  ? 42.973 38.567 80.206  1.00 19.74  ? 677 GLU B CA  1 
ATOM   1713 C C   . GLU B 2 42  ? 42.873 37.076 80.399  1.00 16.69  ? 677 GLU B C   1 
ATOM   1714 O O   . GLU B 2 42  ? 42.066 36.429 79.759  1.00 15.82  ? 677 GLU B O   1 
ATOM   1715 C CB  . GLU B 2 42  ? 44.195 38.887 79.336  1.00 20.18  ? 677 GLU B CB  1 
ATOM   1716 C CG  . GLU B 2 42  ? 44.240 38.030 78.067  1.00 22.91  ? 677 GLU B CG  1 
ATOM   1717 C CD  . GLU B 2 42  ? 45.558 38.109 77.346  1.00 24.94  ? 677 GLU B CD  1 
ATOM   1718 O OE1 . GLU B 2 42  ? 45.800 39.096 76.623  1.00 23.22  ? 677 GLU B OE1 1 
ATOM   1719 O OE2 . GLU B 2 42  ? 46.351 37.169 77.516  1.00 25.23  ? 677 GLU B OE2 1 
ATOM   1720 N N   . HIS B 2 43  ? 43.647 36.542 81.352  1.00 18.62  ? 678 HIS B N   1 
ATOM   1721 C CA  . HIS B 2 43  ? 43.667 35.111 81.615  1.00 13.24  ? 678 HIS B CA  1 
ATOM   1722 C C   . HIS B 2 43  ? 42.334 34.703 82.283  1.00 13.18  ? 678 HIS B C   1 
ATOM   1723 O O   . HIS B 2 43  ? 41.838 33.582 82.089  1.00 12.83  ? 678 HIS B O   1 
ATOM   1724 C CB  . HIS B 2 43  ? 44.917 34.765 82.463  1.00 15.53  ? 678 HIS B CB  1 
ATOM   1725 C CG  . HIS B 2 43  ? 45.389 33.337 82.356  1.00 12.58  ? 678 HIS B CG  1 
ATOM   1726 N ND1 . HIS B 2 43  ? 44.589 32.297 81.929  1.00 15.03  ? 678 HIS B ND1 1 
ATOM   1727 C CD2 . HIS B 2 43  ? 46.581 32.776 82.672  1.00 14.18  ? 678 HIS B CD2 1 
ATOM   1728 C CE1 . HIS B 2 43  ? 45.261 31.161 81.992  1.00 10.33  ? 678 HIS B CE1 1 
ATOM   1729 N NE2 . HIS B 2 43  ? 46.474 31.424 82.438  1.00 18.20  ? 678 HIS B NE2 1 
ATOM   1730 N N   . ILE B 2 44  ? 41.709 35.637 82.991  1.00 15.36  ? 679 ILE B N   1 
ATOM   1731 C CA  . ILE B 2 44  ? 40.419 35.347 83.631  1.00 16.36  ? 679 ILE B CA  1 
ATOM   1732 C C   . ILE B 2 44  ? 39.320 35.397 82.563  1.00 12.57  ? 679 ILE B C   1 
ATOM   1733 O O   . ILE B 2 44  ? 38.432 34.543 82.515  1.00 13.56  ? 679 ILE B O   1 
ATOM   1734 C CB  . ILE B 2 44  ? 40.126 36.361 84.746  1.00 17.84  ? 679 ILE B CB  1 
ATOM   1735 C CG1 . ILE B 2 44  ? 41.157 36.183 85.882  1.00 17.03  ? 679 ILE B CG1 1 
ATOM   1736 C CG2 . ILE B 2 44  ? 38.707 36.164 85.246  1.00 18.18  ? 679 ILE B CG2 1 
ATOM   1737 C CD1 . ILE B 2 44  ? 41.134 37.298 86.919  1.00 17.82  ? 679 ILE B CD1 1 
ATOM   1738 N N   . ILE B 2 45  ? 39.352 36.449 81.756  1.00 14.76  ? 680 ILE B N   1 
ATOM   1739 C CA  . ILE B 2 45  ? 38.415 36.606 80.633  1.00 16.86  ? 680 ILE B CA  1 
ATOM   1740 C C   . ILE B 2 45  ? 38.528 35.361 79.745  1.00 17.92  ? 680 ILE B C   1 
ATOM   1741 O O   . ILE B 2 45  ? 37.502 34.786 79.337  1.00 16.63  ? 680 ILE B O   1 
ATOM   1742 C CB  . ILE B 2 45  ? 38.792 37.834 79.775  1.00 20.15  ? 680 ILE B CB  1 
ATOM   1743 C CG1 . ILE B 2 45  ? 38.597 39.121 80.589  1.00 19.49  ? 680 ILE B CG1 1 
ATOM   1744 C CG2 . ILE B 2 45  ? 37.978 37.844 78.488  1.00 17.32  ? 680 ILE B CG2 1 
ATOM   1745 C CD1 . ILE B 2 45  ? 39.289 40.345 80.015  1.00 18.27  ? 680 ILE B CD1 1 
ATOM   1746 N N   . TRP B 2 46  ? 39.776 34.908 79.506  1.00 15.70  ? 681 TRP B N   1 
ATOM   1747 C CA  . TRP B 2 46  ? 40.024 33.736 78.685  1.00 12.12  ? 681 TRP B CA  1 
ATOM   1748 C C   . TRP B 2 46  ? 39.362 32.529 79.283  1.00 16.76  ? 681 TRP B C   1 
ATOM   1749 O O   . TRP B 2 46  ? 38.717 31.747 78.573  1.00 14.59  ? 681 TRP B O   1 
ATOM   1750 C CB  . TRP B 2 46  ? 41.517 33.468 78.482  1.00 11.62  ? 681 TRP B CB  1 
ATOM   1751 C CG  . TRP B 2 46  ? 41.747 32.128 77.838  1.00 13.56  ? 681 TRP B CG  1 
ATOM   1752 C CD1 . TRP B 2 46  ? 42.424 31.068 78.370  1.00 11.00  ? 681 TRP B CD1 1 
ATOM   1753 C CD2 . TRP B 2 46  ? 41.209 31.668 76.564  1.00 17.10  ? 681 TRP B CD2 1 
ATOM   1754 N NE1 . TRP B 2 46  ? 42.330 29.979 77.532  1.00 15.51  ? 681 TRP B NE1 1 
ATOM   1755 C CE2 . TRP B 2 46  ? 41.593 30.314 76.417  1.00 18.81  ? 681 TRP B CE2 1 
ATOM   1756 C CE3 . TRP B 2 46  ? 40.448 32.281 75.534  1.00 19.19  ? 681 TRP B CE3 1 
ATOM   1757 C CZ2 . TRP B 2 46  ? 41.236 29.531 75.262  1.00 16.86  ? 681 TRP B CZ2 1 
ATOM   1758 C CZ3 . TRP B 2 46  ? 40.096 31.501 74.374  1.00 16.26  ? 681 TRP B CZ3 1 
ATOM   1759 C CH2 . TRP B 2 46  ? 40.494 30.151 74.265  1.00 15.35  ? 681 TRP B CH2 1 
ATOM   1760 N N   . THR B 2 47  ? 39.475 32.369 80.599  1.00 13.76  ? 682 THR B N   1 
ATOM   1761 C CA  . THR B 2 47  ? 38.846 31.233 81.245  1.00 10.81  ? 682 THR B CA  1 
ATOM   1762 C C   . THR B 2 47  ? 37.319 31.219 81.057  1.00 5.60   ? 682 THR B C   1 
ATOM   1763 O O   . THR B 2 47  ? 36.722 30.168 80.778  1.00 11.73  ? 682 THR B O   1 
ATOM   1764 C CB  . THR B 2 47  ? 39.250 31.196 82.763  1.00 12.48  ? 682 THR B CB  1 
ATOM   1765 O OG1 . THR B 2 47  ? 40.679 31.158 82.834  1.00 13.28  ? 682 THR B OG1 1 
ATOM   1766 C CG2 . THR B 2 47  ? 38.675 29.967 83.439  1.00 12.50  ? 682 THR B CG2 1 
ATOM   1767 N N   . LEU B 2 48  ? 36.686 32.384 81.161  1.00 10.40  ? 683 LEU B N   1 
ATOM   1768 C CA  . LEU B 2 48  ? 35.239 32.491 80.984  1.00 12.47  ? 683 LEU B CA  1 
ATOM   1769 C C   . LEU B 2 48  ? 34.865 32.168 79.514  1.00 14.49  ? 683 LEU B C   1 
ATOM   1770 O O   . LEU B 2 48  ? 33.917 31.424 79.258  1.00 13.76  ? 683 LEU B O   1 
ATOM   1771 C CB  . LEU B 2 48  ? 34.811 33.921 81.269  1.00 13.93  ? 683 LEU B CB  1 
ATOM   1772 C CG  . LEU B 2 48  ? 33.374 34.263 81.694  1.00 18.27  ? 683 LEU B CG  1 
ATOM   1773 C CD1 . LEU B 2 48  ? 32.970 35.503 81.005  1.00 14.47  ? 683 LEU B CD1 1 
ATOM   1774 C CD2 . LEU B 2 48  ? 32.381 33.155 81.542  1.00 14.84  ? 683 LEU B CD2 1 
ATOM   1775 N N   . PHE B 2 49  ? 35.619 32.754 78.583  1.00 14.19  ? 684 PHE B N   1 
ATOM   1776 C CA  . PHE B 2 49  ? 35.431 32.591 77.120  1.00 13.08  ? 684 PHE B CA  1 
ATOM   1777 C C   . PHE B 2 49  ? 35.532 31.123 76.747  1.00 9.71   ? 684 PHE B C   1 
ATOM   1778 O O   . PHE B 2 49  ? 34.594 30.550 76.199  1.00 12.46  ? 684 PHE B O   1 
ATOM   1779 C CB  . PHE B 2 49  ? 36.496 33.465 76.436  1.00 16.17  ? 684 PHE B CB  1 
ATOM   1780 C CG  . PHE B 2 49  ? 36.332 33.652 74.936  1.00 16.03  ? 684 PHE B CG  1 
ATOM   1781 C CD1 . PHE B 2 49  ? 35.260 33.101 74.233  1.00 13.74  ? 684 PHE B CD1 1 
ATOM   1782 C CD2 . PHE B 2 49  ? 37.286 34.404 74.240  1.00 14.97  ? 684 PHE B CD2 1 
ATOM   1783 C CE1 . PHE B 2 49  ? 35.140 33.302 72.847  1.00 16.54  ? 684 PHE B CE1 1 
ATOM   1784 C CE2 . PHE B 2 49  ? 37.174 34.604 72.866  1.00 15.74  ? 684 PHE B CE2 1 
ATOM   1785 C CZ  . PHE B 2 49  ? 36.095 34.052 72.171  1.00 13.22  ? 684 PHE B CZ  1 
ATOM   1786 N N   . GLN B 2 50  ? 36.606 30.466 77.175  1.00 14.26  ? 685 GLN B N   1 
ATOM   1787 C CA  . GLN B 2 50  ? 36.809 29.045 76.906  1.00 14.77  ? 685 GLN B CA  1 
ATOM   1788 C C   . GLN B 2 50  ? 35.724 28.190 77.567  1.00 16.68  ? 685 GLN B C   1 
ATOM   1789 O O   . GLN B 2 50  ? 35.240 27.212 76.983  1.00 17.45  ? 685 GLN B O   1 
ATOM   1790 C CB  . GLN B 2 50  ? 38.217 28.621 77.357  1.00 12.89  ? 685 GLN B CB  1 
ATOM   1791 C CG  . GLN B 2 50  ? 38.668 27.218 76.972  1.00 17.35  ? 685 GLN B CG  1 
ATOM   1792 C CD  . GLN B 2 50  ? 38.077 26.133 77.853  1.00 25.31  ? 685 GLN B CD  1 
ATOM   1793 O OE1 . GLN B 2 50  ? 37.541 25.129 77.368  1.00 27.68  ? 685 GLN B OE1 1 
ATOM   1794 N NE2 . GLN B 2 50  ? 38.184 26.318 79.157  1.00 26.28  ? 685 GLN B NE2 1 
ATOM   1795 N N   . HIS B 2 51  ? 35.340 28.529 78.792  1.00 15.13  ? 686 HIS B N   1 
ATOM   1796 C CA  . HIS B 2 51  ? 34.283 27.772 79.478  1.00 14.90  ? 686 HIS B CA  1 
ATOM   1797 C C   . HIS B 2 51  ? 32.964 27.827 78.650  1.00 12.60  ? 686 HIS B C   1 
ATOM   1798 O O   . HIS B 2 51  ? 32.226 26.827 78.523  1.00 14.21  ? 686 HIS B O   1 
ATOM   1799 C CB  . HIS B 2 51  ? 34.048 28.354 80.888  1.00 14.48  ? 686 HIS B CB  1 
ATOM   1800 C CG  . HIS B 2 51  ? 32.756 27.927 81.494  1.00 11.52  ? 686 HIS B CG  1 
ATOM   1801 N ND1 . HIS B 2 51  ? 32.541 26.638 81.933  1.00 13.69  ? 686 HIS B ND1 1 
ATOM   1802 C CD2 . HIS B 2 51  ? 31.566 28.563 81.593  1.00 14.28  ? 686 HIS B CD2 1 
ATOM   1803 C CE1 . HIS B 2 51  ? 31.269 26.492 82.255  1.00 13.46  ? 686 HIS B CE1 1 
ATOM   1804 N NE2 . HIS B 2 51  ? 30.659 27.645 82.063  1.00 16.51  ? 686 HIS B NE2 1 
ATOM   1805 N N   . THR B 2 52  ? 32.673 29.011 78.112  1.00 16.75  ? 687 THR B N   1 
ATOM   1806 C CA  . THR B 2 52  ? 31.477 29.229 77.303  1.00 17.03  ? 687 THR B CA  1 
ATOM   1807 C C   . THR B 2 52  ? 31.458 28.369 76.029  1.00 16.34  ? 687 THR B C   1 
ATOM   1808 O O   . THR B 2 52  ? 30.452 27.748 75.698  1.00 15.63  ? 687 THR B O   1 
ATOM   1809 C CB  . THR B 2 52  ? 31.353 30.707 76.928  1.00 19.30  ? 687 THR B CB  1 
ATOM   1810 O OG1 . THR B 2 52  ? 31.392 31.501 78.124  1.00 22.00  ? 687 THR B OG1 1 
ATOM   1811 C CG2 . THR B 2 52  ? 30.027 30.977 76.190  1.00 18.06  ? 687 THR B CG2 1 
ATOM   1812 N N   . LEU B 2 53  ? 32.603 28.289 75.356  1.00 18.55  ? 688 LEU B N   1 
ATOM   1813 C CA  . LEU B 2 53  ? 32.720 27.522 74.119  1.00 15.50  ? 688 LEU B CA  1 
ATOM   1814 C C   . LEU B 2 53  ? 32.619 26.046 74.360  1.00 16.88  ? 688 LEU B C   1 
ATOM   1815 O O   . LEU B 2 53  ? 32.014 25.322 73.576  1.00 15.55  ? 688 LEU B O   1 
ATOM   1816 C CB  . LEU B 2 53  ? 34.050 27.849 73.425  1.00 13.74  ? 688 LEU B CB  1 
ATOM   1817 C CG  . LEU B 2 53  ? 34.231 29.332 73.087  1.00 11.76  ? 688 LEU B CG  1 
ATOM   1818 C CD1 . LEU B 2 53  ? 35.672 29.588 72.634  1.00 14.29  ? 688 LEU B CD1 1 
ATOM   1819 C CD2 . LEU B 2 53  ? 33.217 29.775 72.011  1.00 19.68  ? 688 LEU B CD2 1 
ATOM   1820 N N   . GLN B 2 54  ? 33.224 25.574 75.446  1.00 19.59  ? 689 GLN B N   1 
ATOM   1821 C CA  . GLN B 2 54  ? 33.161 24.157 75.745  1.00 21.21  ? 689 GLN B CA  1 
ATOM   1822 C C   . GLN B 2 54  ? 31.869 23.744 76.442  1.00 22.44  ? 689 GLN B C   1 
ATOM   1823 O O   . GLN B 2 54  ? 31.221 22.771 76.036  1.00 24.22  ? 689 GLN B O   1 
ATOM   1824 C CB  . GLN B 2 54  ? 34.349 23.735 76.605  1.00 23.02  ? 689 GLN B CB  1 
ATOM   1825 C CG  . GLN B 2 54  ? 34.281 22.285 77.064  1.00 27.82  ? 689 GLN B CG  1 
ATOM   1826 C CD  . GLN B 2 54  ? 35.474 21.859 77.923  1.00 34.08  ? 689 GLN B CD  1 
ATOM   1827 O OE1 . GLN B 2 54  ? 35.704 20.667 78.138  1.00 39.99  ? 689 GLN B OE1 1 
ATOM   1828 N NE2 . GLN B 2 54  ? 36.241 22.824 78.405  1.00 34.11  ? 689 GLN B NE2 1 
ATOM   1829 N N   . ASN B 2 55  ? 31.443 24.526 77.433  1.00 25.54  ? 690 ASN B N   1 
ATOM   1830 C CA  . ASN B 2 55  ? 30.257 24.162 78.214  1.00 24.39  ? 690 ASN B CA  1 
ATOM   1831 C C   . ASN B 2 55  ? 28.923 24.786 77.904  1.00 22.27  ? 690 ASN B C   1 
ATOM   1832 O O   . ASN B 2 55  ? 27.904 24.200 78.227  1.00 27.09  ? 690 ASN B O   1 
ATOM   1833 C CB  . ASN B 2 55  ? 30.585 24.281 79.704  1.00 22.32  ? 690 ASN B CB  1 
ATOM   1834 C CG  . ASN B 2 55  ? 31.777 23.438 80.075  1.00 24.52  ? 690 ASN B CG  1 
ATOM   1835 O OD1 . ASN B 2 55  ? 31.771 22.242 79.850  1.00 28.07  ? 690 ASN B OD1 1 
ATOM   1836 N ND2 . ASN B 2 55  ? 32.852 24.068 80.536  1.00 27.57  ? 690 ASN B ND2 1 
ATOM   1837 N N   . GLU B 2 56  ? 28.918 25.967 77.295  1.00 19.95  ? 691 GLU B N   1 
ATOM   1838 C CA  . GLU B 2 56  ? 27.681 26.683 76.963  1.00 19.61  ? 691 GLU B CA  1 
ATOM   1839 C C   . GLU B 2 56  ? 27.631 26.941 75.459  1.00 19.62  ? 691 GLU B C   1 
ATOM   1840 O O   . GLU B 2 56  ? 27.142 27.988 75.018  1.00 17.31  ? 691 GLU B O   1 
ATOM   1841 C CB  . GLU B 2 56  ? 27.632 28.034 77.695  1.00 18.44  ? 691 GLU B CB  1 
ATOM   1842 C CG  . GLU B 2 56  ? 27.813 27.956 79.223  1.00 23.49  ? 691 GLU B CG  1 
ATOM   1843 C CD  . GLU B 2 56  ? 26.668 27.256 79.959  1.00 28.01  ? 691 GLU B CD  1 
ATOM   1844 O OE1 . GLU B 2 56  ? 25.584 27.039 79.376  1.00 28.57  ? 691 GLU B OE1 1 
ATOM   1845 O OE2 . GLU B 2 56  ? 26.847 26.935 81.152  1.00 35.04  ? 691 GLU B OE2 1 
ATOM   1846 N N   . TYR B 2 57  ? 28.148 25.980 74.693  1.00 24.87  ? 692 TYR B N   1 
ATOM   1847 C CA  . TYR B 2 57  ? 28.242 26.071 73.231  1.00 26.26  ? 692 TYR B CA  1 
ATOM   1848 C C   . TYR B 2 57  ? 26.960 26.410 72.446  1.00 28.57  ? 692 TYR B C   1 
ATOM   1849 O O   . TYR B 2 57  ? 27.064 26.889 71.308  1.00 26.63  ? 692 TYR B O   1 
ATOM   1850 C CB  . TYR B 2 57  ? 28.872 24.805 72.679  1.00 27.02  ? 692 TYR B CB  1 
ATOM   1851 C CG  . TYR B 2 57  ? 28.047 23.568 72.900  1.00 30.17  ? 692 TYR B CG  1 
ATOM   1852 C CD1 . TYR B 2 57  ? 26.968 23.282 72.076  1.00 32.15  ? 692 TYR B CD1 1 
ATOM   1853 C CD2 . TYR B 2 57  ? 28.353 22.668 73.921  1.00 31.87  ? 692 TYR B CD2 1 
ATOM   1854 C CE1 . TYR B 2 57  ? 26.210 22.134 72.248  1.00 36.13  ? 692 TYR B CE1 1 
ATOM   1855 C CE2 . TYR B 2 57  ? 27.597 21.504 74.103  1.00 36.36  ? 692 TYR B CE2 1 
ATOM   1856 C CZ  . TYR B 2 57  ? 26.527 21.245 73.253  1.00 36.71  ? 692 TYR B CZ  1 
ATOM   1857 O OH  . TYR B 2 57  ? 25.795 20.080 73.349  1.00 40.13  ? 692 TYR B OH  1 
ATOM   1858 N N   . GLU B 2 58  ? 25.770 26.168 73.031  1.00 25.38  ? 693 GLU B N   1 
ATOM   1859 C CA  . GLU B 2 58  ? 24.498 26.488 72.368  1.00 25.09  ? 693 GLU B CA  1 
ATOM   1860 C C   . GLU B 2 58  ? 24.366 27.995 72.225  1.00 25.20  ? 693 GLU B C   1 
ATOM   1861 O O   . GLU B 2 58  ? 23.513 28.486 71.484  1.00 23.47  ? 693 GLU B O   1 
ATOM   1862 C CB  . GLU B 2 58  ? 23.283 25.947 73.127  1.00 29.58  ? 693 GLU B CB  1 
ATOM   1863 C CG  . GLU B 2 58  ? 23.127 24.433 73.135  1.00 39.30  ? 693 GLU B CG  1 
ATOM   1864 C CD  . GLU B 2 58  ? 22.757 23.820 71.774  1.00 44.75  ? 693 GLU B CD  1 
ATOM   1865 O OE1 . GLU B 2 58  ? 23.568 23.893 70.825  1.00 49.66  ? 693 GLU B OE1 1 
ATOM   1866 O OE2 . GLU B 2 58  ? 21.671 23.215 71.664  1.00 45.34  ? 693 GLU B OE2 1 
ATOM   1867 N N   . LEU B 2 59  ? 25.216 28.734 72.939  1.00 22.39  ? 694 LEU B N   1 
ATOM   1868 C CA  . LEU B 2 59  ? 25.214 30.195 72.840  1.00 20.96  ? 694 LEU B CA  1 
ATOM   1869 C C   . LEU B 2 59  ? 25.857 30.591 71.486  1.00 20.93  ? 694 LEU B C   1 
ATOM   1870 O O   . LEU B 2 59  ? 25.668 31.722 71.003  1.00 18.12  ? 694 LEU B O   1 
ATOM   1871 C CB  . LEU B 2 59  ? 25.999 30.804 73.997  1.00 23.53  ? 694 LEU B CB  1 
ATOM   1872 C CG  . LEU B 2 59  ? 25.317 31.611 75.112  1.00 28.40  ? 694 LEU B CG  1 
ATOM   1873 C CD1 . LEU B 2 59  ? 23.819 31.480 75.118  1.00 22.83  ? 694 LEU B CD1 1 
ATOM   1874 C CD2 . LEU B 2 59  ? 25.925 31.218 76.412  1.00 22.62  ? 694 LEU B CD2 1 
ATOM   1875 N N   . MET B 2 60  ? 26.609 29.651 70.896  1.00 20.00  ? 695 MET B N   1 
ATOM   1876 C CA  . MET B 2 60  ? 27.250 29.856 69.587  1.00 20.33  ? 695 MET B CA  1 
ATOM   1877 C C   . MET B 2 60  ? 26.311 29.620 68.381  1.00 19.04  ? 695 MET B C   1 
ATOM   1878 O O   . MET B 2 60  ? 26.555 30.154 67.300  1.00 21.36  ? 695 MET B O   1 
ATOM   1879 C CB  . MET B 2 60  ? 28.507 28.989 69.440  1.00 17.11  ? 695 MET B CB  1 
ATOM   1880 C CG  . MET B 2 60  ? 29.771 29.549 70.122  1.00 15.35  ? 695 MET B CG  1 
ATOM   1881 S SD  . MET B 2 60  ? 30.315 31.112 69.515  1.00 17.38  ? 695 MET B SD  1 
ATOM   1882 C CE  . MET B 2 60  ? 31.073 30.550 67.916  1.00 23.39  ? 695 MET B CE  1 
ATOM   1883 N N   . ARG B 2 61  ? 25.222 28.887 68.586  1.00 18.04  ? 696 ARG B N   1 
ATOM   1884 C CA  . ARG B 2 61  ? 24.300 28.599 67.508  1.00 19.14  ? 696 ARG B CA  1 
ATOM   1885 C C   . ARG B 2 61  ? 23.767 29.846 66.825  1.00 21.34  ? 696 ARG B C   1 
ATOM   1886 O O   . ARG B 2 61  ? 23.083 30.666 67.447  1.00 19.51  ? 696 ARG B O   1 
ATOM   1887 C CB  . ARG B 2 61  ? 23.149 27.724 67.979  1.00 22.04  ? 696 ARG B CB  1 
ATOM   1888 C CG  . ARG B 2 61  ? 22.161 27.487 66.837  1.00 24.40  ? 696 ARG B CG  1 
ATOM   1889 C CD  . ARG B 2 61  ? 20.953 26.678 67.187  1.00 23.83  ? 696 ARG B CD  1 
ATOM   1890 N NE  . ARG B 2 61  ? 21.300 25.269 67.259  1.00 28.38  ? 696 ARG B NE  1 
ATOM   1891 C CZ  . ARG B 2 61  ? 21.504 24.640 68.404  1.00 26.94  ? 696 ARG B CZ  1 
ATOM   1892 N NH1 . ARG B 2 61  ? 21.385 25.314 69.543  1.00 32.94  ? 696 ARG B NH1 1 
ATOM   1893 N NH2 . ARG B 2 61  ? 21.833 23.362 68.414  1.00 24.11  ? 696 ARG B NH2 1 
ATOM   1894 N N   . ASP B 2 62  ? 24.067 29.963 65.525  1.00 19.05  ? 697 ASP B N   1 
ATOM   1895 C CA  . ASP B 2 62  ? 23.683 31.104 64.695  1.00 16.95  ? 697 ASP B CA  1 
ATOM   1896 C C   . ASP B 2 62  ? 24.282 32.405 65.176  1.00 17.62  ? 697 ASP B C   1 
ATOM   1897 O O   . ASP B 2 62  ? 23.761 33.505 64.899  1.00 18.37  ? 697 ASP B O   1 
ATOM   1898 C CB  . ASP B 2 62  ? 22.168 31.238 64.533  1.00 21.92  ? 697 ASP B CB  1 
ATOM   1899 C CG  . ASP B 2 62  ? 21.567 30.118 63.701  1.00 27.45  ? 697 ASP B CG  1 
ATOM   1900 O OD1 . ASP B 2 62  ? 22.186 29.692 62.703  1.00 27.00  ? 697 ASP B OD1 1 
ATOM   1901 O OD2 . ASP B 2 62  ? 20.470 29.647 64.050  1.00 27.45  ? 697 ASP B OD2 1 
ATOM   1902 N N   . ARG B 2 63  ? 25.366 32.291 65.935  1.00 16.31  ? 698 ARG B N   1 
ATOM   1903 C CA  . ARG B 2 63  ? 26.028 33.471 66.427  1.00 15.44  ? 698 ARG B CA  1 
ATOM   1904 C C   . ARG B 2 63  ? 27.514 33.473 65.998  1.00 17.88  ? 698 ARG B C   1 
ATOM   1905 O O   . ARG B 2 63  ? 27.948 32.608 65.225  1.00 18.47  ? 698 ARG B O   1 
ATOM   1906 C CB  . ARG B 2 63  ? 25.799 33.644 67.937  1.00 18.53  ? 698 ARG B CB  1 
ATOM   1907 C CG  . ARG B 2 63  ? 24.372 34.181 68.207  1.00 18.92  ? 698 ARG B CG  1 
ATOM   1908 C CD  . ARG B 2 63  ? 24.094 34.675 69.623  1.00 17.23  ? 698 ARG B CD  1 
ATOM   1909 N NE  . ARG B 2 63  ? 23.656 33.519 70.363  1.00 26.48  ? 698 ARG B NE  1 
ATOM   1910 C CZ  . ARG B 2 63  ? 22.446 33.331 70.861  1.00 18.82  ? 698 ARG B CZ  1 
ATOM   1911 N NH1 . ARG B 2 63  ? 21.482 34.231 70.771  1.00 18.00  ? 698 ARG B NH1 1 
ATOM   1912 N NH2 . ARG B 2 63  ? 22.165 32.137 71.308  1.00 29.20  ? 698 ARG B NH2 1 
ATOM   1913 N N   . HIS B 2 64  ? 28.254 34.472 66.467  1.00 17.84  ? 699 HIS B N   1 
ATOM   1914 C CA  . HIS B 2 64  ? 29.646 34.684 66.092  1.00 17.65  ? 699 HIS B CA  1 
ATOM   1915 C C   . HIS B 2 64  ? 30.526 34.636 67.305  1.00 17.82  ? 699 HIS B C   1 
ATOM   1916 O O   . HIS B 2 64  ? 30.251 35.283 68.308  1.00 20.48  ? 699 HIS B O   1 
ATOM   1917 C CB  . HIS B 2 64  ? 29.747 36.085 65.484  1.00 15.32  ? 699 HIS B CB  1 
ATOM   1918 C CG  . HIS B 2 64  ? 30.964 36.336 64.643  1.00 20.57  ? 699 HIS B CG  1 
ATOM   1919 N ND1 . HIS B 2 64  ? 32.191 36.676 65.173  1.00 19.88  ? 699 HIS B ND1 1 
ATOM   1920 C CD2 . HIS B 2 64  ? 31.093 36.466 63.300  1.00 20.87  ? 699 HIS B CD2 1 
ATOM   1921 C CE1 . HIS B 2 64  ? 33.017 37.014 64.201  1.00 21.92  ? 699 HIS B CE1 1 
ATOM   1922 N NE2 . HIS B 2 64  ? 32.373 36.895 63.054  1.00 21.54  ? 699 HIS B NE2 1 
ATOM   1923 N N   . LEU B 2 65  ? 31.638 33.933 67.165  1.00 18.91  ? 700 LEU B N   1 
ATOM   1924 C CA  . LEU B 2 65  ? 32.655 33.788 68.202  1.00 16.63  ? 700 LEU B CA  1 
ATOM   1925 C C   . LEU B 2 65  ? 33.022 35.132 68.866  1.00 16.59  ? 700 LEU B C   1 
ATOM   1926 O O   . LEU B 2 65  ? 33.212 35.202 70.081  1.00 18.59  ? 700 LEU B O   1 
ATOM   1927 C CB  . LEU B 2 65  ? 33.916 33.227 67.540  1.00 17.73  ? 700 LEU B CB  1 
ATOM   1928 C CG  . LEU B 2 65  ? 34.804 32.084 68.028  1.00 24.63  ? 700 LEU B CG  1 
ATOM   1929 C CD1 . LEU B 2 65  ? 36.257 32.400 67.525  1.00 19.92  ? 700 LEU B CD1 1 
ATOM   1930 C CD2 . LEU B 2 65  ? 34.764 31.871 69.520  1.00 15.10  ? 700 LEU B CD2 1 
ATOM   1931 N N   . ASP B 2 66  ? 33.152 36.200 68.082  1.00 14.26  ? 701 ASP B N   1 
ATOM   1932 C CA  . ASP B 2 66  ? 33.541 37.494 68.637  1.00 13.16  ? 701 ASP B CA  1 
ATOM   1933 C C   . ASP B 2 66  ? 32.496 38.117 69.511  1.00 12.86  ? 701 ASP B C   1 
ATOM   1934 O O   . ASP B 2 66  ? 32.750 39.107 70.184  1.00 14.36  ? 701 ASP B O   1 
ATOM   1935 C CB  . ASP B 2 66  ? 33.916 38.494 67.547  1.00 15.57  ? 701 ASP B CB  1 
ATOM   1936 C CG  . ASP B 2 66  ? 35.077 38.022 66.707  1.00 17.70  ? 701 ASP B CG  1 
ATOM   1937 O OD1 . ASP B 2 66  ? 35.753 37.024 67.081  1.00 13.00  ? 701 ASP B OD1 1 
ATOM   1938 O OD2 . ASP B 2 66  ? 35.306 38.672 65.665  1.00 19.59  ? 701 ASP B OD2 1 
ATOM   1939 N N   . GLN B 2 67  ? 31.291 37.600 69.423  1.00 16.40  ? 702 GLN B N   1 
ATOM   1940 C CA  . GLN B 2 67  ? 30.211 38.132 70.240  1.00 20.07  ? 702 GLN B CA  1 
ATOM   1941 C C   . GLN B 2 67  ? 30.403 37.551 71.654  1.00 15.85  ? 702 GLN B C   1 
ATOM   1942 O O   . GLN B 2 67  ? 30.294 38.264 72.651  1.00 18.67  ? 702 GLN B O   1 
ATOM   1943 C CB  . GLN B 2 67  ? 28.865 37.772 69.615  1.00 17.88  ? 702 GLN B CB  1 
ATOM   1944 C CG  . GLN B 2 67  ? 28.589 38.590 68.359  1.00 13.69  ? 702 GLN B CG  1 
ATOM   1945 C CD  . GLN B 2 67  ? 27.505 37.984 67.505  1.00 14.19  ? 702 GLN B CD  1 
ATOM   1946 O OE1 . GLN B 2 67  ? 27.067 36.842 67.727  1.00 15.65  ? 702 GLN B OE1 1 
ATOM   1947 N NE2 . GLN B 2 67  ? 27.057 38.741 66.518  1.00 16.71  ? 702 GLN B NE2 1 
ATOM   1948 N N   . ILE B 2 68  ? 30.745 36.274 71.710  1.00 15.62  ? 703 ILE B N   1 
ATOM   1949 C CA  . ILE B 2 68  ? 31.030 35.617 72.964  1.00 17.27  ? 703 ILE B CA  1 
ATOM   1950 C C   . ILE B 2 68  ? 32.281 36.274 73.571  1.00 19.17  ? 703 ILE B C   1 
ATOM   1951 O O   . ILE B 2 68  ? 32.329 36.570 74.758  1.00 16.42  ? 703 ILE B O   1 
ATOM   1952 C CB  . ILE B 2 68  ? 31.271 34.138 72.730  1.00 16.88  ? 703 ILE B CB  1 
ATOM   1953 C CG1 . ILE B 2 68  ? 30.044 33.525 72.068  1.00 16.05  ? 703 ILE B CG1 1 
ATOM   1954 C CG2 . ILE B 2 68  ? 31.662 33.420 74.046  1.00 17.23  ? 703 ILE B CG2 1 
ATOM   1955 C CD1 . ILE B 2 68  ? 28.699 33.845 72.718  1.00 15.19  ? 703 ILE B CD1 1 
ATOM   1956 N N   . MET B 2 69  ? 33.272 36.583 72.738  1.00 19.14  ? 704 MET B N   1 
ATOM   1957 C CA  . MET B 2 69  ? 34.495 37.214 73.205  1.00 13.43  ? 704 MET B CA  1 
ATOM   1958 C C   . MET B 2 69  ? 34.279 38.539 73.885  1.00 16.75  ? 704 MET B C   1 
ATOM   1959 O O   . MET B 2 69  ? 34.845 38.801 74.948  1.00 19.25  ? 704 MET B O   1 
ATOM   1960 C CB  . MET B 2 69  ? 35.472 37.437 72.042  1.00 14.26  ? 704 MET B CB  1 
ATOM   1961 C CG  . MET B 2 69  ? 36.729 38.193 72.438  1.00 15.48  ? 704 MET B CG  1 
ATOM   1962 S SD  . MET B 2 69  ? 37.872 38.547 71.089  1.00 17.57  ? 704 MET B SD  1 
ATOM   1963 C CE  . MET B 2 69  ? 36.899 39.715 70.225  1.00 14.96  ? 704 MET B CE  1 
ATOM   1964 N N   . MET B 2 70  ? 33.516 39.413 73.246  1.00 16.73  ? 705 MET B N   1 
ATOM   1965 C CA  . MET B 2 70  ? 33.283 40.746 73.785  1.00 16.10  ? 705 MET B CA  1 
ATOM   1966 C C   . MET B 2 70  ? 32.449 40.715 75.045  1.00 13.13  ? 705 MET B C   1 
ATOM   1967 O O   . MET B 2 70  ? 32.674 41.514 75.952  1.00 16.17  ? 705 MET B O   1 
ATOM   1968 C CB  . MET B 2 70  ? 32.634 41.665 72.741  1.00 18.47  ? 705 MET B CB  1 
ATOM   1969 C CG  . MET B 2 70  ? 33.598 42.060 71.602  1.00 19.51  ? 705 MET B CG  1 
ATOM   1970 S SD  . MET B 2 70  ? 32.845 43.192 70.414  1.00 23.32  ? 705 MET B SD  1 
ATOM   1971 C CE  . MET B 2 70  ? 32.052 42.001 69.331  1.00 16.47  ? 705 MET B CE  1 
ATOM   1972 N N   . CYS B 2 71  ? 31.491 39.804 75.076  1.00 13.66  ? 706 CYS B N   1 
ATOM   1973 C CA  . CYS B 2 71  ? 30.610 39.622 76.235  1.00 17.06  ? 706 CYS B CA  1 
ATOM   1974 C C   . CYS B 2 71  ? 31.428 39.117 77.440  1.00 18.68  ? 706 CYS B C   1 
ATOM   1975 O O   . CYS B 2 71  ? 31.197 39.554 78.563  1.00 18.02  ? 706 CYS B O   1 
ATOM   1976 C CB  . CYS B 2 71  ? 29.491 38.642 75.893  1.00 14.42  ? 706 CYS B CB  1 
ATOM   1977 S SG  . CYS B 2 71  ? 28.139 39.387 74.927  1.00 14.64  ? 706 CYS B SG  1 
ATOM   1978 N N   . SER B 2 72  ? 32.391 38.224 77.185  1.00 15.89  ? 707 SER B N   1 
ATOM   1979 C CA  . SER B 2 72  ? 33.276 37.694 78.221  1.00 16.94  ? 707 SER B CA  1 
ATOM   1980 C C   . SER B 2 72  ? 34.152 38.826 78.814  1.00 19.32  ? 707 SER B C   1 
ATOM   1981 O O   . SER B 2 72  ? 34.303 38.932 80.048  1.00 18.57  ? 707 SER B O   1 
ATOM   1982 C CB  . SER B 2 72  ? 34.157 36.566 77.660  1.00 10.56  ? 707 SER B CB  1 
ATOM   1983 O OG  . SER B 2 72  ? 33.386 35.422 77.371  1.00 14.07  ? 707 SER B OG  1 
ATOM   1984 N N   . MET B 2 73  ? 34.687 39.689 77.945  1.00 15.31  ? 708 MET B N   1 
ATOM   1985 C CA  . MET B 2 73  ? 35.523 40.792 78.383  1.00 16.14  ? 708 MET B CA  1 
ATOM   1986 C C   . MET B 2 73  ? 34.697 41.695 79.268  1.00 20.28  ? 708 MET B C   1 
ATOM   1987 O O   . MET B 2 73  ? 35.098 42.030 80.381  1.00 21.09  ? 708 MET B O   1 
ATOM   1988 C CB  . MET B 2 73  ? 36.053 41.646 77.204  1.00 18.95  ? 708 MET B CB  1 
ATOM   1989 C CG  . MET B 2 73  ? 37.102 40.971 76.331  1.00 26.99  ? 708 MET B CG  1 
ATOM   1990 S SD  . MET B 2 73  ? 37.582 41.952 74.875  1.00 34.00  ? 708 MET B SD  1 
ATOM   1991 C CE  . MET B 2 73  ? 38.286 43.380 75.699  1.00 19.43  ? 708 MET B CE  1 
ATOM   1992 N N   . TYR B 2 74  ? 33.541 42.104 78.764  1.00 20.41  ? 709 TYR B N   1 
ATOM   1993 C CA  . TYR B 2 74  ? 32.691 43.012 79.517  1.00 19.85  ? 709 TYR B CA  1 
ATOM   1994 C C   . TYR B 2 74  ? 32.255 42.465 80.900  1.00 19.33  ? 709 TYR B C   1 
ATOM   1995 O O   . TYR B 2 74  ? 32.287 43.202 81.879  1.00 18.12  ? 709 TYR B O   1 
ATOM   1996 C CB  . TYR B 2 74  ? 31.484 43.426 78.679  1.00 16.05  ? 709 TYR B CB  1 
ATOM   1997 C CG  . TYR B 2 74  ? 30.624 44.451 79.364  1.00 16.20  ? 709 TYR B CG  1 
ATOM   1998 C CD1 . TYR B 2 74  ? 30.957 45.794 79.342  1.00 15.10  ? 709 TYR B CD1 1 
ATOM   1999 C CD2 . TYR B 2 74  ? 29.543 44.054 80.131  1.00 18.97  ? 709 TYR B CD2 1 
ATOM   2000 C CE1 . TYR B 2 74  ? 30.247 46.721 80.079  1.00 18.46  ? 709 TYR B CE1 1 
ATOM   2001 C CE2 . TYR B 2 74  ? 28.824 44.970 80.876  1.00 18.96  ? 709 TYR B CE2 1 
ATOM   2002 C CZ  . TYR B 2 74  ? 29.170 46.291 80.855  1.00 20.06  ? 709 TYR B CZ  1 
ATOM   2003 O OH  . TYR B 2 74  ? 28.418 47.180 81.624  1.00 22.86  ? 709 TYR B OH  1 
ATOM   2004 N N   . GLY B 2 75  ? 31.836 41.197 80.940  1.00 20.92  ? 710 GLY B N   1 
ATOM   2005 C CA  . GLY B 2 75  ? 31.395 40.534 82.162  1.00 20.72  ? 710 GLY B CA  1 
ATOM   2006 C C   . GLY B 2 75  ? 32.459 40.425 83.251  1.00 22.43  ? 710 GLY B C   1 
ATOM   2007 O O   . GLY B 2 75  ? 32.173 40.685 84.429  1.00 23.67  ? 710 GLY B O   1 
ATOM   2008 N N   . ILE B 2 76  ? 33.670 40.012 82.886  1.00 18.88  ? 711 ILE B N   1 
ATOM   2009 C CA  . ILE B 2 76  ? 34.759 39.924 83.850  1.00 18.92  ? 711 ILE B CA  1 
ATOM   2010 C C   . ILE B 2 76  ? 35.080 41.321 84.397  1.00 21.67  ? 711 ILE B C   1 
ATOM   2011 O O   . ILE B 2 76  ? 35.119 41.518 85.617  1.00 23.22  ? 711 ILE B O   1 
ATOM   2012 C CB  . ILE B 2 76  ? 36.035 39.255 83.232  1.00 19.18  ? 711 ILE B CB  1 
ATOM   2013 C CG1 . ILE B 2 76  ? 35.761 37.780 82.951  1.00 16.42  ? 711 ILE B CG1 1 
ATOM   2014 C CG2 . ILE B 2 76  ? 37.243 39.374 84.174  1.00 19.16  ? 711 ILE B CG2 1 
ATOM   2015 C CD1 . ILE B 2 76  ? 35.240 36.962 84.170  1.00 20.07  ? 711 ILE B CD1 1 
ATOM   2016 N N   . CYS B 2 77  ? 35.307 42.296 83.523  1.00 19.68  ? 712 CYS B N   1 
ATOM   2017 C CA  . CYS B 2 77  ? 35.592 43.648 83.976  1.00 23.39  ? 712 CYS B CA  1 
ATOM   2018 C C   . CYS B 2 77  ? 34.453 44.214 84.843  1.00 26.76  ? 712 CYS B C   1 
ATOM   2019 O O   . CYS B 2 77  ? 34.653 45.154 85.626  1.00 28.58  ? 712 CYS B O   1 
ATOM   2020 C CB  . CYS B 2 77  ? 35.885 44.564 82.793  1.00 24.18  ? 712 CYS B CB  1 
ATOM   2021 S SG  . CYS B 2 77  ? 37.418 44.167 81.972  1.00 27.10  ? 712 CYS B SG  1 
ATOM   2022 N N   . LYS B 2 78  ? 33.253 43.665 84.674  1.00 29.29  ? 713 LYS B N   1 
ATOM   2023 C CA  . LYS B 2 78  ? 32.107 44.063 85.483  1.00 32.44  ? 713 LYS B CA  1 
ATOM   2024 C C   . LYS B 2 78  ? 32.315 43.572 86.931  1.00 32.77  ? 713 LYS B C   1 
ATOM   2025 O O   . LYS B 2 78  ? 32.238 44.396 87.850  1.00 36.22  ? 713 LYS B O   1 
ATOM   2026 C CB  . LYS B 2 78  ? 30.804 43.491 84.932  1.00 32.92  ? 713 LYS B CB  1 
ATOM   2027 C CG  . LYS B 2 78  ? 30.034 44.449 84.087  1.00 37.60  ? 713 LYS B CG  1 
ATOM   2028 C CD  . LYS B 2 78  ? 29.739 45.716 84.851  1.00 37.14  ? 713 LYS B CD  1 
ATOM   2029 C CE  . LYS B 2 78  ? 28.283 46.115 84.715  1.00 35.89  ? 713 LYS B CE  1 
ATOM   2030 N NZ  . LYS B 2 78  ? 28.106 47.591 84.840  1.00 34.37  ? 713 LYS B NZ  1 
ATOM   2031 N N   . VAL B 2 79  ? 32.552 42.265 87.151  1.00 30.16  ? 714 VAL B N   1 
ATOM   2032 C CA  . VAL B 2 79  ? 32.798 41.770 88.533  1.00 32.53  ? 714 VAL B CA  1 
ATOM   2033 C C   . VAL B 2 79  ? 34.021 42.447 89.148  1.00 32.23  ? 714 VAL B C   1 
ATOM   2034 O O   . VAL B 2 79  ? 33.984 42.866 90.293  1.00 35.51  ? 714 VAL B O   1 
ATOM   2035 C CB  . VAL B 2 79  ? 33.058 40.216 88.694  1.00 32.58  ? 714 VAL B CB  1 
ATOM   2036 C CG1 . VAL B 2 79  ? 31.799 39.483 89.066  1.00 26.16  ? 714 VAL B CG1 1 
ATOM   2037 C CG2 . VAL B 2 79  ? 33.759 39.607 87.487  1.00 28.94  ? 714 VAL B CG2 1 
ATOM   2038 N N   . LYS B 2 80  ? 35.093 42.566 88.368  1.00 31.41  ? 715 LYS B N   1 
ATOM   2039 C CA  . LYS B 2 80  ? 36.323 43.177 88.824  1.00 29.55  ? 715 LYS B CA  1 
ATOM   2040 C C   . LYS B 2 80  ? 36.215 44.666 89.004  1.00 30.72  ? 715 LYS B C   1 
ATOM   2041 O O   . LYS B 2 80  ? 37.194 45.316 89.339  1.00 32.74  ? 715 LYS B O   1 
ATOM   2042 C CB  . LYS B 2 80  ? 37.463 42.864 87.868  1.00 27.56  ? 715 LYS B CB  1 
ATOM   2043 C CG  . LYS B 2 80  ? 37.760 41.400 87.769  1.00 31.22  ? 715 LYS B CG  1 
ATOM   2044 C CD  . LYS B 2 80  ? 38.153 40.804 89.114  1.00 35.59  ? 715 LYS B CD  1 
ATOM   2045 C CE  . LYS B 2 80  ? 38.492 39.320 88.981  1.00 37.55  ? 715 LYS B CE  1 
ATOM   2046 N NZ  . LYS B 2 80  ? 38.867 38.650 90.273  1.00 38.83  ? 715 LYS B NZ  1 
ATOM   2047 N N   . ASN B 2 81  ? 35.030 45.209 88.777  1.00 34.00  ? 716 ASN B N   1 
ATOM   2048 C CA  . ASN B 2 81  ? 34.785 46.637 88.917  1.00 37.20  ? 716 ASN B CA  1 
ATOM   2049 C C   . ASN B 2 81  ? 35.884 47.473 88.316  1.00 40.43  ? 716 ASN B C   1 
ATOM   2050 O O   . ASN B 2 81  ? 36.477 48.337 88.976  1.00 41.39  ? 716 ASN B O   1 
ATOM   2051 C CB  . ASN B 2 81  ? 34.528 47.009 90.377  1.00 41.86  ? 716 ASN B CB  1 
ATOM   2052 C CG  . ASN B 2 81  ? 33.282 46.333 90.930  1.00 43.57  ? 716 ASN B CG  1 
ATOM   2053 O OD1 . ASN B 2 81  ? 33.354 45.257 91.527  1.00 47.55  ? 716 ASN B OD1 1 
ATOM   2054 N ND2 . ASN B 2 81  ? 32.125 46.952 90.712  1.00 47.33  ? 716 ASN B ND2 1 
ATOM   2055 N N   . ILE B 2 82  ? 36.194 47.132 87.067  1.00 43.74  ? 717 ILE B N   1 
ATOM   2056 C CA  . ILE B 2 82  ? 37.194 47.816 86.250  1.00 44.51  ? 717 ILE B CA  1 
ATOM   2057 C C   . ILE B 2 82  ? 36.311 48.584 85.282  1.00 46.94  ? 717 ILE B C   1 
ATOM   2058 O O   . ILE B 2 82  ? 35.421 48.008 84.646  1.00 49.78  ? 717 ILE B O   1 
ATOM   2059 C CB  . ILE B 2 82  ? 38.062 46.816 85.404  1.00 41.87  ? 717 ILE B CB  1 
ATOM   2060 C CG1 . ILE B 2 82  ? 38.876 45.883 86.306  1.00 42.23  ? 717 ILE B CG1 1 
ATOM   2061 C CG2 . ILE B 2 82  ? 38.985 47.571 84.446  1.00 39.88  ? 717 ILE B CG2 1 
ATOM   2062 C CD1 . ILE B 2 82  ? 40.179 46.451 86.785  1.00 37.87  ? 717 ILE B CD1 1 
ATOM   2063 N N   . ASP B 2 83  ? 36.498 49.890 85.235  1.00 50.49  ? 718 ASP B N   1 
ATOM   2064 C CA  . ASP B 2 83  ? 35.743 50.757 84.330  1.00 53.49  ? 718 ASP B CA  1 
ATOM   2065 C C   . ASP B 2 83  ? 36.073 50.464 82.859  1.00 49.81  ? 718 ASP B C   1 
ATOM   2066 O O   . ASP B 2 83  ? 37.128 50.872 82.369  1.00 51.41  ? 718 ASP B O   1 
ATOM   2067 C CB  . ASP B 2 83  ? 36.069 52.224 84.643  1.00 61.16  ? 718 ASP B CB  1 
ATOM   2068 C CG  . ASP B 2 83  ? 37.548 52.436 85.085  1.00 68.75  ? 718 ASP B CG  1 
ATOM   2069 O OD1 . ASP B 2 83  ? 38.450 51.620 84.740  1.00 71.64  ? 718 ASP B OD1 1 
ATOM   2070 O OD2 . ASP B 2 83  ? 37.804 53.433 85.803  1.00 72.90  ? 718 ASP B OD2 1 
ATOM   2071 N N   . LEU B 2 84  ? 35.206 49.725 82.172  1.00 45.23  ? 719 LEU B N   1 
ATOM   2072 C CA  . LEU B 2 84  ? 35.418 49.414 80.757  1.00 36.85  ? 719 LEU B CA  1 
ATOM   2073 C C   . LEU B 2 84  ? 34.093 49.290 80.050  1.00 31.77  ? 719 LEU B C   1 
ATOM   2074 O O   . LEU B 2 84  ? 33.453 48.241 80.089  1.00 27.84  ? 719 LEU B O   1 
ATOM   2075 C CB  . LEU B 2 84  ? 36.190 48.114 80.574  1.00 37.32  ? 719 LEU B CB  1 
ATOM   2076 C CG  . LEU B 2 84  ? 36.482 47.845 79.096  1.00 37.40  ? 719 LEU B CG  1 
ATOM   2077 C CD1 . LEU B 2 84  ? 37.495 48.863 78.589  1.00 35.42  ? 719 LEU B CD1 1 
ATOM   2078 C CD2 . LEU B 2 84  ? 36.974 46.412 78.896  1.00 37.32  ? 719 LEU B CD2 1 
ATOM   2079 N N   . LYS B 2 85  ? 33.687 50.373 79.406  1.00 30.55  ? 720 LYS B N   1 
ATOM   2080 C CA  . LYS B 2 85  ? 32.418 50.412 78.685  1.00 30.71  ? 720 LYS B CA  1 
ATOM   2081 C C   . LYS B 2 85  ? 32.377 49.485 77.472  1.00 27.33  ? 720 LYS B C   1 
ATOM   2082 O O   . LYS B 2 85  ? 33.400 49.264 76.800  1.00 24.55  ? 720 LYS B O   1 
ATOM   2083 C CB  . LYS B 2 85  ? 32.097 51.841 78.248  1.00 34.41  ? 720 LYS B CB  1 
ATOM   2084 C CG  . LYS B 2 85  ? 31.470 52.714 79.333  1.00 42.41  ? 720 LYS B CG  1 
ATOM   2085 C CD  . LYS B 2 85  ? 30.645 53.861 78.720  1.00 48.69  ? 720 LYS B CD  1 
ATOM   2086 C CE  . LYS B 2 85  ? 29.728 54.527 79.756  1.00 53.97  ? 720 LYS B CE  1 
ATOM   2087 N NZ  . LYS B 2 85  ? 28.769 55.536 79.166  1.00 56.14  ? 720 LYS B NZ  1 
ATOM   2088 N N   . PHE B 2 86  ? 31.196 48.913 77.229  1.00 24.69  ? 721 PHE B N   1 
ATOM   2089 C CA  . PHE B 2 86  ? 30.971 48.033 76.089  1.00 28.74  ? 721 PHE B CA  1 
ATOM   2090 C C   . PHE B 2 86  ? 31.234 48.843 74.798  1.00 29.68  ? 721 PHE B C   1 
ATOM   2091 O O   . PHE B 2 86  ? 31.874 48.354 73.880  1.00 28.03  ? 721 PHE B O   1 
ATOM   2092 C CB  . PHE B 2 86  ? 29.543 47.471 76.118  1.00 25.73  ? 721 PHE B CB  1 
ATOM   2093 C CG  . PHE B 2 86  ? 29.451 45.991 75.771  1.00 27.81  ? 721 PHE B CG  1 
ATOM   2094 C CD1 . PHE B 2 86  ? 30.126 45.467 74.654  1.00 24.58  ? 721 PHE B CD1 1 
ATOM   2095 C CD2 . PHE B 2 86  ? 28.685 45.120 76.563  1.00 22.03  ? 721 PHE B CD2 1 
ATOM   2096 C CE1 . PHE B 2 86  ? 30.039 44.108 74.340  1.00 21.82  ? 721 PHE B CE1 1 
ATOM   2097 C CE2 . PHE B 2 86  ? 28.593 43.757 76.255  1.00 22.53  ? 721 PHE B CE2 1 
ATOM   2098 C CZ  . PHE B 2 86  ? 29.274 43.248 75.140  1.00 21.30  ? 721 PHE B CZ  1 
ATOM   2099 N N   . LYS B 2 87  ? 30.828 50.111 74.783  1.00 31.88  ? 722 LYS B N   1 
ATOM   2100 C CA  . LYS B 2 87  ? 31.051 50.978 73.628  1.00 33.82  ? 722 LYS B CA  1 
ATOM   2101 C C   . LYS B 2 87  ? 32.538 51.067 73.282  1.00 35.02  ? 722 LYS B C   1 
ATOM   2102 O O   . LYS B 2 87  ? 32.920 51.113 72.112  1.00 36.82  ? 722 LYS B O   1 
ATOM   2103 C CB  . LYS B 2 87  ? 30.545 52.390 73.902  1.00 38.74  ? 722 LYS B CB  1 
ATOM   2104 C CG  . LYS B 2 87  ? 30.737 53.332 72.713  1.00 42.74  ? 722 LYS B CG  1 
ATOM   2105 C CD  . LYS B 2 87  ? 31.009 54.754 73.159  1.00 47.36  ? 722 LYS B CD  1 
ATOM   2106 C CE  . LYS B 2 87  ? 32.358 54.874 73.849  1.00 50.34  ? 722 LYS B CE  1 
ATOM   2107 N NZ  . LYS B 2 87  ? 32.690 56.298 74.155  1.00 52.85  ? 722 LYS B NZ  1 
ATOM   2108 N N   . ILE B 2 88  ? 33.360 51.137 74.315  1.00 30.99  ? 723 ILE B N   1 
ATOM   2109 C CA  . ILE B 2 88  ? 34.799 51.225 74.174  1.00 29.46  ? 723 ILE B CA  1 
ATOM   2110 C C   . ILE B 2 88  ? 35.344 49.914 73.593  1.00 28.42  ? 723 ILE B C   1 
ATOM   2111 O O   . ILE B 2 88  ? 36.321 49.902 72.844  1.00 26.54  ? 723 ILE B O   1 
ATOM   2112 C CB  . ILE B 2 88  ? 35.427 51.459 75.578  1.00 30.85  ? 723 ILE B CB  1 
ATOM   2113 C CG1 . ILE B 2 88  ? 35.013 52.830 76.123  1.00 32.84  ? 723 ILE B CG1 1 
ATOM   2114 C CG2 . ILE B 2 88  ? 36.939 51.256 75.545  1.00 32.93  ? 723 ILE B CG2 1 
ATOM   2115 C CD1 . ILE B 2 88  ? 35.426 54.000 75.266  1.00 30.50  ? 723 ILE B CD1 1 
ATOM   2116 N N   . ILE B 2 89  ? 34.733 48.807 73.997  1.00 26.46  ? 724 ILE B N   1 
ATOM   2117 C CA  . ILE B 2 89  ? 35.137 47.482 73.564  1.00 25.48  ? 724 ILE B CA  1 
ATOM   2118 C C   . ILE B 2 89  ? 34.835 47.340 72.084  1.00 26.59  ? 724 ILE B C   1 
ATOM   2119 O O   . ILE B 2 89  ? 35.692 46.970 71.298  1.00 27.23  ? 724 ILE B O   1 
ATOM   2120 C CB  . ILE B 2 89  ? 34.354 46.395 74.349  1.00 25.10  ? 724 ILE B CB  1 
ATOM   2121 C CG1 . ILE B 2 89  ? 34.766 46.408 75.833  1.00 24.22  ? 724 ILE B CG1 1 
ATOM   2122 C CG2 . ILE B 2 89  ? 34.559 45.006 73.728  1.00 23.49  ? 724 ILE B CG2 1 
ATOM   2123 C CD1 . ILE B 2 89  ? 33.919 45.484 76.712  1.00 20.18  ? 724 ILE B CD1 1 
ATOM   2124 N N   . VAL B 2 90  ? 33.604 47.675 71.738  1.00 26.41  ? 725 VAL B N   1 
ATOM   2125 C CA  . VAL B 2 90  ? 33.038 47.615 70.393  1.00 26.71  ? 725 VAL B CA  1 
ATOM   2126 C C   . VAL B 2 90  ? 33.805 48.527 69.399  1.00 28.84  ? 725 VAL B C   1 
ATOM   2127 O O   . VAL B 2 90  ? 34.042 48.169 68.235  1.00 26.27  ? 725 VAL B O   1 
ATOM   2128 C CB  . VAL B 2 90  ? 31.533 47.943 70.565  1.00 28.64  ? 725 VAL B CB  1 
ATOM   2129 C CG1 . VAL B 2 90  ? 31.042 48.960 69.587  1.00 32.20  ? 725 VAL B CG1 1 
ATOM   2130 C CG2 . VAL B 2 90  ? 30.712 46.658 70.622  1.00 22.94  ? 725 VAL B CG2 1 
ATOM   2131 N N   . THR B 2 91  ? 34.222 49.690 69.889  1.00 28.62  ? 726 THR B N   1 
ATOM   2132 C CA  . THR B 2 91  ? 35.013 50.637 69.119  1.00 28.37  ? 726 THR B CA  1 
ATOM   2133 C C   . THR B 2 91  ? 36.407 50.054 68.874  1.00 30.09  ? 726 THR B C   1 
ATOM   2134 O O   . THR B 2 91  ? 36.972 50.221 67.797  1.00 32.75  ? 726 THR B O   1 
ATOM   2135 C CB  . THR B 2 91  ? 35.151 51.977 69.853  1.00 27.90  ? 726 THR B CB  1 
ATOM   2136 O OG1 . THR B 2 91  ? 33.895 52.660 69.831  1.00 32.09  ? 726 THR B OG1 1 
ATOM   2137 C CG2 . THR B 2 91  ? 36.208 52.853 69.202  1.00 29.72  ? 726 THR B CG2 1 
ATOM   2138 N N   . ALA B 2 92  ? 36.972 49.387 69.874  1.00 26.99  ? 727 ALA B N   1 
ATOM   2139 C CA  . ALA B 2 92  ? 38.284 48.779 69.719  1.00 25.98  ? 727 ALA B CA  1 
ATOM   2140 C C   . ALA B 2 92  ? 38.151 47.567 68.803  1.00 25.63  ? 727 ALA B C   1 
ATOM   2141 O O   . ALA B 2 92  ? 39.006 47.327 67.952  1.00 29.15  ? 727 ALA B O   1 
ATOM   2142 C CB  . ALA B 2 92  ? 38.855 48.358 71.075  1.00 26.40  ? 727 ALA B CB  1 
ATOM   2143 N N   . TYR B 2 93  ? 37.049 46.841 68.942  1.00 22.82  ? 728 TYR B N   1 
ATOM   2144 C CA  . TYR B 2 93  ? 36.786 45.658 68.134  1.00 24.16  ? 728 TYR B CA  1 
ATOM   2145 C C   . TYR B 2 93  ? 36.837 45.985 66.631  1.00 26.54  ? 728 TYR B C   1 
ATOM   2146 O O   . TYR B 2 93  ? 37.348 45.193 65.832  1.00 25.74  ? 728 TYR B O   1 
ATOM   2147 C CB  . TYR B 2 93  ? 35.415 45.057 68.504  1.00 21.38  ? 728 TYR B CB  1 
ATOM   2148 C CG  . TYR B 2 93  ? 35.019 43.893 67.640  1.00 18.30  ? 728 TYR B CG  1 
ATOM   2149 C CD1 . TYR B 2 93  ? 35.759 42.719 67.647  1.00 18.36  ? 728 TYR B CD1 1 
ATOM   2150 C CD2 . TYR B 2 93  ? 33.959 43.997 66.744  1.00 20.35  ? 728 TYR B CD2 1 
ATOM   2151 C CE1 . TYR B 2 93  ? 35.468 41.678 66.779  1.00 19.64  ? 728 TYR B CE1 1 
ATOM   2152 C CE2 . TYR B 2 93  ? 33.657 42.953 65.861  1.00 19.39  ? 728 TYR B CE2 1 
ATOM   2153 C CZ  . TYR B 2 93  ? 34.421 41.800 65.888  1.00 17.49  ? 728 TYR B CZ  1 
ATOM   2154 O OH  . TYR B 2 93  ? 34.144 40.770 65.026  1.00 18.15  ? 728 TYR B OH  1 
ATOM   2155 N N   . LYS B 2 94  ? 36.298 47.139 66.255  1.00 27.65  ? 729 LYS B N   1 
ATOM   2156 C CA  . LYS B 2 94  ? 36.298 47.568 64.855  1.00 31.43  ? 729 LYS B CA  1 
ATOM   2157 C C   . LYS B 2 94  ? 37.693 47.642 64.207  1.00 32.37  ? 729 LYS B C   1 
ATOM   2158 O O   . LYS B 2 94  ? 37.814 47.556 62.989  1.00 36.31  ? 729 LYS B O   1 
ATOM   2159 C CB  . LYS B 2 94  ? 35.589 48.912 64.700  1.00 27.60  ? 729 LYS B CB  1 
ATOM   2160 C CG  . LYS B 2 94  ? 34.115 48.807 64.654  1.00 26.46  ? 729 LYS B CG  1 
ATOM   2161 C CD  . LYS B 2 94  ? 33.536 50.163 64.606  1.00 32.23  ? 729 LYS B CD  1 
ATOM   2162 C CE  . LYS B 2 94  ? 33.965 50.947 65.824  1.00 38.69  ? 729 LYS B CE  1 
ATOM   2163 N NZ  . LYS B 2 94  ? 33.481 52.373 65.804  1.00 45.11  ? 729 LYS B NZ  1 
ATOM   2164 N N   . ASP B 2 95  ? 38.746 47.820 64.992  1.00 32.37  ? 730 ASP B N   1 
ATOM   2165 C CA  . ASP B 2 95  ? 40.061 47.872 64.385  1.00 32.44  ? 730 ASP B CA  1 
ATOM   2166 C C   . ASP B 2 95  ? 40.678 46.522 64.064  1.00 32.29  ? 730 ASP B C   1 
ATOM   2167 O O   . ASP B 2 95  ? 41.800 46.463 63.555  1.00 34.72  ? 730 ASP B O   1 
ATOM   2168 C CB  . ASP B 2 95  ? 41.011 48.707 65.223  1.00 37.38  ? 730 ASP B CB  1 
ATOM   2169 C CG  . ASP B 2 95  ? 40.707 50.176 65.130  1.00 39.72  ? 730 ASP B CG  1 
ATOM   2170 O OD1 . ASP B 2 95  ? 39.821 50.547 64.330  1.00 43.44  ? 730 ASP B OD1 1 
ATOM   2171 O OD2 . ASP B 2 95  ? 41.354 50.962 65.854  1.00 43.69  ? 730 ASP B OD2 1 
ATOM   2172 N N   . LEU B 2 96  ? 39.991 45.433 64.402  1.00 30.02  ? 731 LEU B N   1 
ATOM   2173 C CA  . LEU B 2 96  ? 40.524 44.112 64.077  1.00 30.24  ? 731 LEU B CA  1 
ATOM   2174 C C   . LEU B 2 96  ? 40.355 44.061 62.555  1.00 32.00  ? 731 LEU B C   1 
ATOM   2175 O O   . LEU B 2 96  ? 39.308 44.460 62.043  1.00 30.54  ? 731 LEU B O   1 
ATOM   2176 C CB  . LEU B 2 96  ? 39.737 42.985 64.773  1.00 27.19  ? 731 LEU B CB  1 
ATOM   2177 C CG  . LEU B 2 96  ? 39.730 42.999 66.311  1.00 27.59  ? 731 LEU B CG  1 
ATOM   2178 C CD1 . LEU B 2 96  ? 39.421 41.604 66.829  1.00 25.31  ? 731 LEU B CD1 1 
ATOM   2179 C CD2 . LEU B 2 96  ? 41.073 43.472 66.868  1.00 26.74  ? 731 LEU B CD2 1 
ATOM   2180 N N   . PRO B 2 97  ? 41.352 43.524 61.822  1.00 33.47  ? 732 PRO B N   1 
ATOM   2181 C CA  . PRO B 2 97  ? 41.321 43.431 60.349  1.00 33.74  ? 732 PRO B CA  1 
ATOM   2182 C C   . PRO B 2 97  ? 40.033 42.920 59.715  1.00 32.69  ? 732 PRO B C   1 
ATOM   2183 O O   . PRO B 2 97  ? 39.484 43.540 58.804  1.00 35.80  ? 732 PRO B O   1 
ATOM   2184 C CB  . PRO B 2 97  ? 42.533 42.539 60.025  1.00 34.33  ? 732 PRO B CB  1 
ATOM   2185 C CG  . PRO B 2 97  ? 42.737 41.735 61.280  1.00 37.12  ? 732 PRO B CG  1 
ATOM   2186 C CD  . PRO B 2 97  ? 42.487 42.755 62.368  1.00 33.19  ? 732 PRO B CD  1 
ATOM   2187 N N   . HIS B 2 98  ? 39.539 41.804 60.223  1.00 30.78  ? 733 HIS B N   1 
ATOM   2188 C CA  . HIS B 2 98  ? 38.320 41.190 59.721  1.00 28.42  ? 733 HIS B CA  1 
ATOM   2189 C C   . HIS B 2 98  ? 37.029 41.793 60.305  1.00 28.77  ? 733 HIS B C   1 
ATOM   2190 O O   . HIS B 2 98  ? 35.937 41.459 59.840  1.00 25.89  ? 733 HIS B O   1 
ATOM   2191 C CB  . HIS B 2 98  ? 38.336 39.746 60.154  1.00 30.74  ? 733 HIS B CB  1 
ATOM   2192 C CG  . HIS B 2 98  ? 38.233 39.609 61.638  1.00 34.01  ? 733 HIS B CG  1 
ATOM   2193 N ND1 . HIS B 2 98  ? 37.103 39.117 62.261  1.00 35.25  ? 733 HIS B ND1 1 
ATOM   2194 C CD2 . HIS B 2 98  ? 39.044 40.063 62.626  1.00 29.83  ? 733 HIS B CD2 1 
ATOM   2195 C CE1 . HIS B 2 98  ? 37.220 39.288 63.566  1.00 30.17  ? 733 HIS B CE1 1 
ATOM   2196 N NE2 . HIS B 2 98  ? 38.387 39.859 63.812  1.00 33.69  ? 733 HIS B NE2 1 
ATOM   2197 N N   . ALA B 2 99  ? 37.150 42.597 61.363  1.00 27.09  ? 734 ALA B N   1 
ATOM   2198 C CA  . ALA B 2 99  ? 35.990 43.159 62.073  1.00 25.53  ? 734 ALA B CA  1 
ATOM   2199 C C   . ALA B 2 99  ? 34.986 43.931 61.260  1.00 28.01  ? 734 ALA B C   1 
ATOM   2200 O O   . ALA B 2 99  ? 35.333 44.819 60.488  1.00 31.39  ? 734 ALA B O   1 
ATOM   2201 C CB  . ALA B 2 99  ? 36.441 43.995 63.244  1.00 22.84  ? 734 ALA B CB  1 
ATOM   2202 N N   . VAL B 2 100 ? 33.719 43.628 61.496  1.00 30.45  ? 735 VAL B N   1 
ATOM   2203 C CA  . VAL B 2 100 ? 32.612 44.273 60.798  1.00 30.73  ? 735 VAL B CA  1 
ATOM   2204 C C   . VAL B 2 100 ? 31.583 44.711 61.857  1.00 32.30  ? 735 VAL B C   1 
ATOM   2205 O O   . VAL B 2 100 ? 31.228 43.936 62.743  1.00 31.30  ? 735 VAL B O   1 
ATOM   2206 C CB  . VAL B 2 100 ? 32.092 43.289 59.738  1.00 30.18  ? 735 VAL B CB  1 
ATOM   2207 C CG1 . VAL B 2 100 ? 30.620 43.113 59.799  1.00 32.09  ? 735 VAL B CG1 1 
ATOM   2208 C CG2 . VAL B 2 100 ? 32.593 43.728 58.372  1.00 30.36  ? 735 VAL B CG2 1 
ATOM   2209 N N   . GLN B 2 101 ? 31.122 45.955 61.800  1.00 33.10  ? 736 GLN B N   1 
ATOM   2210 C CA  . GLN B 2 101 ? 30.199 46.418 62.836  1.00 32.40  ? 736 GLN B CA  1 
ATOM   2211 C C   . GLN B 2 101 ? 28.882 45.679 62.957  1.00 32.47  ? 736 GLN B C   1 
ATOM   2212 O O   . GLN B 2 101 ? 28.259 45.707 64.022  1.00 35.36  ? 736 GLN B O   1 
ATOM   2213 C CB  . GLN B 2 101 ? 29.975 47.934 62.798  1.00 33.06  ? 736 GLN B CB  1 
ATOM   2214 C CG  . GLN B 2 101 ? 29.230 48.456 61.586  1.00 37.08  ? 736 GLN B CG  1 
ATOM   2215 C CD  . GLN B 2 101 ? 28.853 49.931 61.720  1.00 40.07  ? 736 GLN B CD  1 
ATOM   2216 O OE1 . GLN B 2 101 ? 27.672 50.277 61.674  1.00 43.56  ? 736 GLN B OE1 1 
ATOM   2217 N NE2 . GLN B 2 101 ? 29.852 50.805 61.894  1.00 41.04  ? 736 GLN B NE2 1 
ATOM   2218 N N   . GLU B 2 102 ? 28.457 44.990 61.907  1.00 27.80  ? 737 GLU B N   1 
ATOM   2219 C CA  . GLU B 2 102 ? 27.206 44.249 61.981  1.00 26.50  ? 737 GLU B CA  1 
ATOM   2220 C C   . GLU B 2 102 ? 27.292 43.186 63.071  1.00 26.38  ? 737 GLU B C   1 
ATOM   2221 O O   . GLU B 2 102 ? 26.273 42.785 63.650  1.00 23.00  ? 737 GLU B O   1 
ATOM   2222 C CB  . GLU B 2 102 ? 26.915 43.551 60.661  1.00 27.25  ? 737 GLU B CB  1 
ATOM   2223 C CG  . GLU B 2 102 ? 25.508 42.969 60.587  1.00 35.57  ? 737 GLU B CG  1 
ATOM   2224 C CD  . GLU B 2 102 ? 25.293 42.039 59.392  1.00 38.85  ? 737 GLU B CD  1 
ATOM   2225 O OE1 . GLU B 2 102 ? 26.251 41.858 58.606  1.00 42.85  ? 737 GLU B OE1 1 
ATOM   2226 O OE2 . GLU B 2 102 ? 24.180 41.467 59.262  1.00 39.28  ? 737 GLU B OE2 1 
ATOM   2227 N N   . THR B 2 103 ? 28.512 42.711 63.328  1.00 25.03  ? 738 THR B N   1 
ATOM   2228 C CA  . THR B 2 103 ? 28.739 41.669 64.330  1.00 24.51  ? 738 THR B CA  1 
ATOM   2229 C C   . THR B 2 103 ? 28.291 42.109 65.725  1.00 21.18  ? 738 THR B C   1 
ATOM   2230 O O   . THR B 2 103 ? 27.910 41.267 66.533  1.00 23.71  ? 738 THR B O   1 
ATOM   2231 C CB  . THR B 2 103 ? 30.220 41.175 64.334  1.00 24.36  ? 738 THR B CB  1 
ATOM   2232 O OG1 . THR B 2 103 ? 30.538 40.632 63.044  1.00 24.91  ? 738 THR B OG1 1 
ATOM   2233 C CG2 . THR B 2 103 ? 30.457 40.078 65.401  1.00 20.03  ? 738 THR B CG2 1 
ATOM   2234 N N   . PHE B 2 104 ? 28.358 43.404 66.016  1.00 19.41  ? 739 PHE B N   1 
ATOM   2235 C CA  . PHE B 2 104 ? 27.913 43.875 67.324  1.00 24.61  ? 739 PHE B CA  1 
ATOM   2236 C C   . PHE B 2 104 ? 26.618 44.637 67.245  1.00 26.09  ? 739 PHE B C   1 
ATOM   2237 O O   . PHE B 2 104 ? 25.907 44.754 68.236  1.00 25.65  ? 739 PHE B O   1 
ATOM   2238 C CB  . PHE B 2 104 ? 28.989 44.673 68.106  1.00 23.90  ? 739 PHE B CB  1 
ATOM   2239 C CG  . PHE B 2 104 ? 29.565 45.875 67.374  1.00 26.09  ? 739 PHE B CG  1 
ATOM   2240 C CD1 . PHE B 2 104 ? 28.881 47.084 67.329  1.00 25.99  ? 739 PHE B CD1 1 
ATOM   2241 C CD2 . PHE B 2 104 ? 30.824 45.807 66.796  1.00 24.35  ? 739 PHE B CD2 1 
ATOM   2242 C CE1 . PHE B 2 104 ? 29.442 48.194 66.730  1.00 28.87  ? 739 PHE B CE1 1 
ATOM   2243 C CE2 . PHE B 2 104 ? 31.393 46.915 66.197  1.00 25.47  ? 739 PHE B CE2 1 
ATOM   2244 C CZ  . PHE B 2 104 ? 30.704 48.111 66.162  1.00 26.22  ? 739 PHE B CZ  1 
ATOM   2245 N N   . LYS B 2 105 ? 26.281 45.124 66.059  1.00 26.45  ? 740 LYS B N   1 
ATOM   2246 C CA  . LYS B 2 105 ? 25.047 45.872 65.913  1.00 25.50  ? 740 LYS B CA  1 
ATOM   2247 C C   . LYS B 2 105 ? 23.883 44.965 65.648  1.00 23.80  ? 740 LYS B C   1 
ATOM   2248 O O   . LYS B 2 105 ? 22.746 45.311 65.993  1.00 26.44  ? 740 LYS B O   1 
ATOM   2249 C CB  . LYS B 2 105 ? 25.167 46.931 64.816  1.00 30.61  ? 740 LYS B CB  1 
ATOM   2250 C CG  . LYS B 2 105 ? 26.121 48.056 65.188  1.00 38.81  ? 740 LYS B CG  1 
ATOM   2251 C CD  . LYS B 2 105 ? 25.859 49.321 64.396  1.00 44.59  ? 740 LYS B CD  1 
ATOM   2252 C CE  . LYS B 2 105 ? 26.457 50.519 65.118  1.00 49.09  ? 740 LYS B CE  1 
ATOM   2253 N NZ  . LYS B 2 105 ? 25.996 50.625 66.557  1.00 52.69  ? 740 LYS B NZ  1 
ATOM   2254 N N   . ARG B 2 106 ? 24.160 43.776 65.108  1.00 25.36  ? 741 ARG B N   1 
ATOM   2255 C CA  . ARG B 2 106 ? 23.096 42.814 64.772  1.00 26.85  ? 741 ARG B CA  1 
ATOM   2256 C C   . ARG B 2 106 ? 23.410 41.438 65.310  1.00 26.17  ? 741 ARG B C   1 
ATOM   2257 O O   . ARG B 2 106 ? 24.164 40.682 64.705  1.00 27.31  ? 741 ARG B O   1 
ATOM   2258 C CB  . ARG B 2 106 ? 22.880 42.753 63.248  1.00 29.90  ? 741 ARG B CB  1 
ATOM   2259 C CG  . ARG B 2 106 ? 21.744 41.829 62.808  1.00 33.39  ? 741 ARG B CG  1 
ATOM   2260 C CD  . ARG B 2 106 ? 21.290 42.097 61.355  1.00 35.04  ? 741 ARG B CD  1 
ATOM   2261 N NE  . ARG B 2 106 ? 19.934 41.587 61.123  1.00 35.82  ? 741 ARG B NE  1 
ATOM   2262 C CZ  . ARG B 2 106 ? 19.654 40.315 60.853  1.00 37.40  ? 741 ARG B CZ  1 
ATOM   2263 N NH1 . ARG B 2 106 ? 20.638 39.422 60.766  1.00 42.01  ? 741 ARG B NH1 1 
ATOM   2264 N NH2 . ARG B 2 106 ? 18.391 39.920 60.720  1.00 36.27  ? 741 ARG B NH2 1 
ATOM   2265 N N   . VAL B 2 107 ? 22.766 41.087 66.417  1.00 24.88  ? 742 VAL B N   1 
ATOM   2266 C CA  . VAL B 2 107 ? 23.018 39.823 67.084  1.00 18.62  ? 742 VAL B CA  1 
ATOM   2267 C C   . VAL B 2 107 ? 21.708 39.108 67.339  1.00 19.22  ? 742 VAL B C   1 
ATOM   2268 O O   . VAL B 2 107 ? 20.713 39.746 67.704  1.00 22.30  ? 742 VAL B O   1 
ATOM   2269 C CB  . VAL B 2 107 ? 23.726 40.110 68.452  1.00 18.24  ? 742 VAL B CB  1 
ATOM   2270 C CG1 . VAL B 2 107 ? 24.217 38.802 69.095  1.00 17.63  ? 742 VAL B CG1 1 
ATOM   2271 C CG2 . VAL B 2 107 ? 24.852 41.162 68.270  1.00 17.18  ? 742 VAL B CG2 1 
ATOM   2272 N N   . LEU B 2 108 ? 21.705 37.795 67.136  1.00 17.13  ? 743 LEU B N   1 
ATOM   2273 C CA  . LEU B 2 108 ? 20.524 36.973 67.366  1.00 23.16  ? 743 LEU B CA  1 
ATOM   2274 C C   . LEU B 2 108 ? 20.206 36.984 68.867  1.00 27.99  ? 743 LEU B C   1 
ATOM   2275 O O   . LEU B 2 108 ? 21.064 36.647 69.693  1.00 26.14  ? 743 LEU B O   1 
ATOM   2276 C CB  . LEU B 2 108 ? 20.786 35.522 66.965  1.00 19.69  ? 743 LEU B CB  1 
ATOM   2277 C CG  . LEU B 2 108 ? 19.626 34.548 66.702  1.00 24.65  ? 743 LEU B CG  1 
ATOM   2278 C CD1 . LEU B 2 108 ? 19.845 33.253 67.412  1.00 22.68  ? 743 LEU B CD1 1 
ATOM   2279 C CD2 . LEU B 2 108 ? 18.257 35.142 66.999  1.00 25.26  ? 743 LEU B CD2 1 
ATOM   2280 N N   . ILE B 2 109 ? 18.995 37.404 69.208  1.00 29.60  ? 744 ILE B N   1 
ATOM   2281 C CA  . ILE B 2 109 ? 18.569 37.422 70.593  1.00 30.70  ? 744 ILE B CA  1 
ATOM   2282 C C   . ILE B 2 109 ? 17.770 36.160 70.864  1.00 32.98  ? 744 ILE B C   1 
ATOM   2283 O O   . ILE B 2 109 ? 18.348 35.125 71.175  1.00 32.03  ? 744 ILE B O   1 
ATOM   2284 C CB  . ILE B 2 109 ? 17.751 38.693 70.947  1.00 27.06  ? 744 ILE B CB  1 
ATOM   2285 C CG1 . ILE B 2 109 ? 18.527 39.953 70.555  1.00 22.85  ? 744 ILE B CG1 1 
ATOM   2286 C CG2 . ILE B 2 109 ? 17.484 38.743 72.481  1.00 29.54  ? 744 ILE B CG2 1 
ATOM   2287 C CD1 . ILE B 2 109 ? 19.932 40.059 71.141  1.00 20.05  ? 744 ILE B CD1 1 
ATOM   2288 N N   . LYS B 2 110 ? 16.456 36.206 70.661  1.00 43.23  ? 745 LYS B N   1 
ATOM   2289 C CA  . LYS B 2 110 ? 15.633 35.039 70.942  1.00 51.62  ? 745 LYS B CA  1 
ATOM   2290 C C   . LYS B 2 110 ? 15.385 34.049 69.805  1.00 57.36  ? 745 LYS B C   1 
ATOM   2291 O O   . LYS B 2 110 ? 16.286 33.278 69.469  1.00 63.85  ? 745 LYS B O   1 
ATOM   2292 C CB  . LYS B 2 110 ? 14.334 35.433 71.637  1.00 53.10  ? 745 LYS B CB  1 
ATOM   2293 C CG  . LYS B 2 110 ? 14.064 34.533 72.828  1.00 58.29  ? 745 LYS B CG  1 
ATOM   2294 C CD  . LYS B 2 110 ? 12.666 34.718 73.410  1.00 64.00  ? 745 LYS B CD  1 
ATOM   2295 C CE  . LYS B 2 110 ? 12.342 33.613 74.431  1.00 64.48  ? 745 LYS B CE  1 
ATOM   2296 N NZ  . LYS B 2 110 ? 10.900 33.624 74.832  1.00 66.11  ? 745 LYS B NZ  1 
ATOM   2297 N N   . GLU B 2 111 ? 14.184 34.013 69.229  1.00 61.52  ? 746 GLU B N   1 
ATOM   2298 C CA  . GLU B 2 111 ? 13.919 33.041 68.154  1.00 62.89  ? 746 GLU B CA  1 
ATOM   2299 C C   . GLU B 2 111 ? 14.403 33.520 66.804  1.00 61.21  ? 746 GLU B C   1 
ATOM   2300 O O   . GLU B 2 111 ? 15.085 32.793 66.082  1.00 64.40  ? 746 GLU B O   1 
ATOM   2301 C CB  . GLU B 2 111 ? 12.440 32.623 68.078  1.00 63.05  ? 746 GLU B CB  1 
ATOM   2302 C CG  . GLU B 2 111 ? 11.421 33.723 68.326  1.00 68.76  ? 746 GLU B CG  1 
ATOM   2303 C CD  . GLU B 2 111 ? 10.994 33.815 69.796  1.00 71.67  ? 746 GLU B CD  1 
ATOM   2304 O OE1 . GLU B 2 111 ? 10.853 32.749 70.449  1.00 73.27  ? 746 GLU B OE1 1 
ATOM   2305 O OE2 . GLU B 2 111 ? 10.798 34.952 70.296  1.00 72.59  ? 746 GLU B OE2 1 
ATOM   2306 N N   . GLU B 2 112 ? 14.029 34.743 66.461  1.00 59.43  ? 747 GLU B N   1 
ATOM   2307 C CA  . GLU B 2 112 ? 14.441 35.345 65.204  1.00 56.67  ? 747 GLU B CA  1 
ATOM   2308 C C   . GLU B 2 112 ? 14.432 36.852 65.377  1.00 52.31  ? 747 GLU B C   1 
ATOM   2309 O O   . GLU B 2 112 ? 14.225 37.602 64.423  1.00 52.37  ? 747 GLU B O   1 
ATOM   2310 C CB  . GLU B 2 112 ? 13.527 34.895 64.061  1.00 63.33  ? 747 GLU B CB  1 
ATOM   2311 C CG  . GLU B 2 112 ? 13.925 33.524 63.504  1.00 68.92  ? 747 GLU B CG  1 
ATOM   2312 C CD  . GLU B 2 112 ? 12.820 32.824 62.737  1.00 71.59  ? 747 GLU B CD  1 
ATOM   2313 O OE1 . GLU B 2 112 ? 12.247 33.446 61.809  1.00 73.49  ? 747 GLU B OE1 1 
ATOM   2314 O OE2 . GLU B 2 112 ? 12.545 31.639 63.055  1.00 72.87  ? 747 GLU B OE2 1 
ATOM   2315 N N   . GLU B 2 113 ? 14.624 37.269 66.628  1.00 44.05  ? 748 GLU B N   1 
ATOM   2316 C CA  . GLU B 2 113 ? 14.672 38.670 66.999  1.00 37.95  ? 748 GLU B CA  1 
ATOM   2317 C C   . GLU B 2 113 ? 16.153 39.025 66.983  1.00 32.74  ? 748 GLU B C   1 
ATOM   2318 O O   . GLU B 2 113 ? 16.981 38.211 67.389  1.00 31.01  ? 748 GLU B O   1 
ATOM   2319 C CB  . GLU B 2 113 ? 14.085 38.846 68.420  1.00 41.57  ? 748 GLU B CB  1 
ATOM   2320 C CG  . GLU B 2 113 ? 14.037 40.302 68.980  1.00 43.84  ? 748 GLU B CG  1 
ATOM   2321 C CD  . GLU B 2 113 ? 12.895 41.178 68.416  1.00 45.47  ? 748 GLU B CD  1 
ATOM   2322 O OE1 . GLU B 2 113 ? 11.882 40.640 67.885  1.00 43.44  ? 748 GLU B OE1 1 
ATOM   2323 O OE2 . GLU B 2 113 ? 13.013 42.423 68.530  1.00 45.19  ? 748 GLU B OE2 1 
ATOM   2324 N N   . TYR B 2 114 ? 16.490 40.205 66.476  1.00 26.95  ? 749 TYR B N   1 
ATOM   2325 C CA  . TYR B 2 114 ? 17.870 40.638 66.431  1.00 24.72  ? 749 TYR B CA  1 
ATOM   2326 C C   . TYR B 2 114 ? 18.001 41.973 67.110  1.00 23.35  ? 749 TYR B C   1 
ATOM   2327 O O   . TYR B 2 114 ? 17.111 42.807 67.000  1.00 23.42  ? 749 TYR B O   1 
ATOM   2328 C CB  . TYR B 2 114 ? 18.368 40.736 64.982  1.00 23.43  ? 749 TYR B CB  1 
ATOM   2329 C CG  . TYR B 2 114 ? 18.621 39.387 64.356  1.00 25.40  ? 749 TYR B CG  1 
ATOM   2330 C CD1 . TYR B 2 114 ? 17.562 38.596 63.915  1.00 26.98  ? 749 TYR B CD1 1 
ATOM   2331 C CD2 . TYR B 2 114 ? 19.917 38.855 64.303  1.00 25.00  ? 749 TYR B CD2 1 
ATOM   2332 C CE1 . TYR B 2 114 ? 17.782 37.299 63.450  1.00 28.79  ? 749 TYR B CE1 1 
ATOM   2333 C CE2 . TYR B 2 114 ? 20.156 37.556 63.842  1.00 25.80  ? 749 TYR B CE2 1 
ATOM   2334 C CZ  . TYR B 2 114 ? 19.083 36.782 63.421  1.00 28.22  ? 749 TYR B CZ  1 
ATOM   2335 O OH  . TYR B 2 114 ? 19.299 35.481 62.992  1.00 32.64  ? 749 TYR B OH  1 
ATOM   2336 N N   . ASP B 2 115 ? 19.123 42.200 67.782  1.00 22.81  ? 750 ASP B N   1 
ATOM   2337 C CA  . ASP B 2 115 ? 19.353 43.470 68.465  1.00 23.97  ? 750 ASP B CA  1 
ATOM   2338 C C   . ASP B 2 115 ? 20.870 43.688 68.664  1.00 23.23  ? 750 ASP B C   1 
ATOM   2339 O O   . ASP B 2 115 ? 21.665 42.893 68.155  1.00 26.34  ? 750 ASP B O   1 
ATOM   2340 C CB  . ASP B 2 115 ? 18.587 43.476 69.805  1.00 25.20  ? 750 ASP B CB  1 
ATOM   2341 C CG  . ASP B 2 115 ? 17.861 44.781 70.061  1.00 24.67  ? 750 ASP B CG  1 
ATOM   2342 O OD1 . ASP B 2 115 ? 18.466 45.862 69.925  1.00 25.99  ? 750 ASP B OD1 1 
ATOM   2343 O OD2 . ASP B 2 115 ? 16.671 44.723 70.426  1.00 35.31  ? 750 ASP B OD2 1 
ATOM   2344 N N   . SER B 2 116 ? 21.278 44.728 69.394  1.00 19.70  ? 751 SER B N   1 
ATOM   2345 C CA  . SER B 2 116 ? 22.693 44.976 69.583  1.00 19.63  ? 751 SER B CA  1 
ATOM   2346 C C   . SER B 2 116 ? 23.311 43.940 70.489  1.00 17.02  ? 751 SER B C   1 
ATOM   2347 O O   . SER B 2 116 ? 22.608 43.126 71.081  1.00 17.97  ? 751 SER B O   1 
ATOM   2348 C CB  . SER B 2 116 ? 22.967 46.391 70.106  1.00 24.38  ? 751 SER B CB  1 
ATOM   2349 O OG  . SER B 2 116 ? 22.759 46.498 71.496  1.00 25.96  ? 751 SER B OG  1 
ATOM   2350 N N   . ILE B 2 117 ? 24.636 43.940 70.552  1.00 17.55  ? 752 ILE B N   1 
ATOM   2351 C CA  . ILE B 2 117 ? 25.362 42.981 71.388  1.00 20.69  ? 752 ILE B CA  1 
ATOM   2352 C C   . ILE B 2 117 ? 25.065 43.217 72.887  1.00 18.97  ? 752 ILE B C   1 
ATOM   2353 O O   . ILE B 2 117 ? 25.077 42.275 73.696  1.00 19.88  ? 752 ILE B O   1 
ATOM   2354 C CB  . ILE B 2 117 ? 26.883 43.006 71.108  1.00 15.27  ? 752 ILE B CB  1 
ATOM   2355 C CG1 . ILE B 2 117 ? 27.545 41.771 71.749  1.00 14.50  ? 752 ILE B CG1 1 
ATOM   2356 C CG2 . ILE B 2 117 ? 27.480 44.343 71.547  1.00 17.05  ? 752 ILE B CG2 1 
ATOM   2357 C CD1 . ILE B 2 117 ? 28.998 41.611 71.440  1.00 12.31  ? 752 ILE B CD1 1 
ATOM   2358 N N   . ILE B 2 118 ? 24.755 44.463 73.232  1.00 18.95  ? 753 ILE B N   1 
ATOM   2359 C CA  . ILE B 2 118 ? 24.418 44.798 74.606  1.00 22.54  ? 753 ILE B CA  1 
ATOM   2360 C C   . ILE B 2 118 ? 23.116 44.081 74.973  1.00 23.73  ? 753 ILE B C   1 
ATOM   2361 O O   . ILE B 2 118 ? 22.998 43.555 76.077  1.00 28.63  ? 753 ILE B O   1 
ATOM   2362 C CB  . ILE B 2 118 ? 24.319 46.303 74.799  1.00 19.70  ? 753 ILE B CB  1 
ATOM   2363 C CG1 . ILE B 2 118 ? 25.713 46.902 74.687  1.00 21.19  ? 753 ILE B CG1 1 
ATOM   2364 C CG2 . ILE B 2 118 ? 23.717 46.633 76.145  1.00 26.15  ? 753 ILE B CG2 1 
ATOM   2365 C CD1 . ILE B 2 118 ? 25.759 48.406 74.787  1.00 22.65  ? 753 ILE B CD1 1 
ATOM   2366 N N   . VAL B 2 119 ? 22.177 43.967 74.032  1.00 22.71  ? 754 VAL B N   1 
ATOM   2367 C CA  . VAL B 2 119 ? 20.921 43.278 74.306  1.00 18.71  ? 754 VAL B CA  1 
ATOM   2368 C C   . VAL B 2 119 ? 21.189 41.795 74.453  1.00 19.77  ? 754 VAL B C   1 
ATOM   2369 O O   . VAL B 2 119 ? 20.597 41.116 75.300  1.00 21.99  ? 754 VAL B O   1 
ATOM   2370 C CB  . VAL B 2 119 ? 19.833 43.555 73.220  1.00 19.51  ? 754 VAL B CB  1 
ATOM   2371 C CG1 . VAL B 2 119 ? 18.586 42.778 73.521  1.00 17.83  ? 754 VAL B CG1 1 
ATOM   2372 C CG2 . VAL B 2 119 ? 19.496 45.021 73.181  1.00 19.34  ? 754 VAL B CG2 1 
ATOM   2373 N N   . PHE B 2 120 ? 22.065 41.267 73.605  1.00 17.38  ? 755 PHE B N   1 
ATOM   2374 C CA  . PHE B 2 120 ? 22.418 39.866 73.692  1.00 14.57  ? 755 PHE B CA  1 
ATOM   2375 C C   . PHE B 2 120 ? 23.106 39.599 75.063  1.00 14.15  ? 755 PHE B C   1 
ATOM   2376 O O   . PHE B 2 120 ? 22.903 38.546 75.638  1.00 17.48  ? 755 PHE B O   1 
ATOM   2377 C CB  . PHE B 2 120 ? 23.376 39.484 72.548  1.00 12.72  ? 755 PHE B CB  1 
ATOM   2378 C CG  . PHE B 2 120 ? 24.039 38.156 72.729  1.00 9.71   ? 755 PHE B CG  1 
ATOM   2379 C CD1 . PHE B 2 120 ? 23.312 36.992 72.646  1.00 6.76   ? 755 PHE B CD1 1 
ATOM   2380 C CD2 . PHE B 2 120 ? 25.397 38.073 73.014  1.00 11.89  ? 755 PHE B CD2 1 
ATOM   2381 C CE1 . PHE B 2 120 ? 23.921 35.755 72.847  1.00 10.50  ? 755 PHE B CE1 1 
ATOM   2382 C CE2 . PHE B 2 120 ? 26.017 36.836 73.217  1.00 5.47   ? 755 PHE B CE2 1 
ATOM   2383 C CZ  . PHE B 2 120 ? 25.266 35.672 73.131  1.00 8.50   ? 755 PHE B CZ  1 
ATOM   2384 N N   . TYR B 2 121 ? 23.972 40.509 75.505  1.00 12.56  ? 756 TYR B N   1 
ATOM   2385 C CA  . TYR B 2 121 ? 24.671 40.378 76.787  1.00 19.45  ? 756 TYR B CA  1 
ATOM   2386 C C   . TYR B 2 121 ? 23.678 40.344 77.986  1.00 19.13  ? 756 TYR B C   1 
ATOM   2387 O O   . TYR B 2 121 ? 23.548 39.328 78.669  1.00 21.06  ? 756 TYR B O   1 
ATOM   2388 C CB  . TYR B 2 121 ? 25.670 41.532 76.964  1.00 18.21  ? 756 TYR B CB  1 
ATOM   2389 C CG  . TYR B 2 121 ? 26.332 41.548 78.325  1.00 24.58  ? 756 TYR B CG  1 
ATOM   2390 C CD1 . TYR B 2 121 ? 27.353 40.638 78.637  1.00 24.98  ? 756 TYR B CD1 1 
ATOM   2391 C CD2 . TYR B 2 121 ? 25.889 42.428 79.338  1.00 24.30  ? 756 TYR B CD2 1 
ATOM   2392 C CE1 . TYR B 2 121 ? 27.918 40.596 79.941  1.00 27.43  ? 756 TYR B CE1 1 
ATOM   2393 C CE2 . TYR B 2 121 ? 26.440 42.401 80.646  1.00 23.14  ? 756 TYR B CE2 1 
ATOM   2394 C CZ  . TYR B 2 121 ? 27.452 41.486 80.946  1.00 28.28  ? 756 TYR B CZ  1 
ATOM   2395 O OH  . TYR B 2 121 ? 28.011 41.461 82.221  1.00 21.65  ? 756 TYR B OH  1 
ATOM   2396 N N   . ASN B 2 122 ? 22.934 41.428 78.176  1.00 20.65  ? 757 ASN B N   1 
ATOM   2397 C CA  . ASN B 2 122 ? 21.984 41.535 79.281  1.00 23.29  ? 757 ASN B CA  1 
ATOM   2398 C C   . ASN B 2 122 ? 20.908 40.478 79.300  1.00 24.19  ? 757 ASN B C   1 
ATOM   2399 O O   . ASN B 2 122 ? 20.637 39.896 80.351  1.00 27.32  ? 757 ASN B O   1 
ATOM   2400 C CB  . ASN B 2 122 ? 21.317 42.906 79.286  1.00 21.02  ? 757 ASN B CB  1 
ATOM   2401 C CG  . ASN B 2 122 ? 22.278 44.005 79.607  1.00 21.34  ? 757 ASN B CG  1 
ATOM   2402 O OD1 . ASN B 2 122 ? 23.261 43.791 80.305  1.00 24.23  ? 757 ASN B OD1 1 
ATOM   2403 N ND2 . ASN B 2 122 ? 22.004 45.202 79.108  1.00 22.79  ? 757 ASN B ND2 1 
ATOM   2404 N N   . SER B 2 123 ? 20.352 40.169 78.129  1.00 24.58  ? 758 SER B N   1 
ATOM   2405 C CA  . SER B 2 123 ? 19.261 39.208 78.025  1.00 22.10  ? 758 SER B CA  1 
ATOM   2406 C C   . SER B 2 123 ? 19.554 37.758 77.802  1.00 21.09  ? 758 SER B C   1 
ATOM   2407 O O   . SER B 2 123 ? 18.682 36.927 78.050  1.00 24.06  ? 758 SER B O   1 
ATOM   2408 C CB  . SER B 2 123 ? 18.243 39.654 76.955  1.00 26.98  ? 758 SER B CB  1 
ATOM   2409 O OG  . SER B 2 123 ? 17.668 40.923 77.270  1.00 34.37  ? 758 SER B OG  1 
ATOM   2410 N N   . VAL B 2 124 ? 20.731 37.418 77.283  1.00 23.06  ? 759 VAL B N   1 
ATOM   2411 C CA  . VAL B 2 124 ? 21.032 36.001 77.014  1.00 22.60  ? 759 VAL B CA  1 
ATOM   2412 C C   . VAL B 2 124 ? 22.340 35.540 77.679  1.00 22.99  ? 759 VAL B C   1 
ATOM   2413 O O   . VAL B 2 124 ? 22.342 34.704 78.580  1.00 23.95  ? 759 VAL B O   1 
ATOM   2414 C CB  . VAL B 2 124 ? 21.160 35.719 75.455  1.00 21.89  ? 759 VAL B CB  1 
ATOM   2415 C CG1 . VAL B 2 124 ? 21.180 34.224 75.170  1.00 15.69  ? 759 VAL B CG1 1 
ATOM   2416 C CG2 . VAL B 2 124 ? 20.047 36.408 74.684  1.00 21.96  ? 759 VAL B CG2 1 
ATOM   2417 N N   . PHE B 2 125 ? 23.449 36.100 77.214  1.00 23.13  ? 760 PHE B N   1 
ATOM   2418 C CA  . PHE B 2 125 ? 24.759 35.725 77.710  1.00 21.76  ? 760 PHE B CA  1 
ATOM   2419 C C   . PHE B 2 125 ? 24.877 35.821 79.230  1.00 21.23  ? 760 PHE B C   1 
ATOM   2420 O O   . PHE B 2 125 ? 25.147 34.816 79.890  1.00 19.54  ? 760 PHE B O   1 
ATOM   2421 C CB  . PHE B 2 125 ? 25.847 36.588 77.050  1.00 18.16  ? 760 PHE B CB  1 
ATOM   2422 C CG  . PHE B 2 125 ? 27.241 36.263 77.510  1.00 16.54  ? 760 PHE B CG  1 
ATOM   2423 C CD1 . PHE B 2 125 ? 27.993 35.290 76.855  1.00 17.02  ? 760 PHE B CD1 1 
ATOM   2424 C CD2 . PHE B 2 125 ? 27.824 36.969 78.566  1.00 14.33  ? 760 PHE B CD2 1 
ATOM   2425 C CE1 . PHE B 2 125 ? 29.315 35.029 77.244  1.00 16.67  ? 760 PHE B CE1 1 
ATOM   2426 C CE2 . PHE B 2 125 ? 29.135 36.722 78.963  1.00 16.42  ? 760 PHE B CE2 1 
ATOM   2427 C CZ  . PHE B 2 125 ? 29.893 35.758 78.308  1.00 15.59  ? 760 PHE B CZ  1 
ATOM   2428 N N   . MET B 2 126 ? 24.676 37.022 79.766  1.00 21.40  ? 761 MET B N   1 
ATOM   2429 C CA  . MET B 2 126 ? 24.840 37.242 81.202  1.00 23.87  ? 761 MET B CA  1 
ATOM   2430 C C   . MET B 2 126 ? 23.881 36.414 82.077  1.00 25.77  ? 761 MET B C   1 
ATOM   2431 O O   . MET B 2 126 ? 24.261 35.919 83.159  1.00 23.95  ? 761 MET B O   1 
ATOM   2432 C CB  . MET B 2 126 ? 24.803 38.732 81.492  1.00 24.01  ? 761 MET B CB  1 
ATOM   2433 C CG  . MET B 2 126 ? 25.072 39.098 82.933  1.00 25.69  ? 761 MET B CG  1 
ATOM   2434 S SD  . MET B 2 126 ? 23.522 39.210 83.788  1.00 30.45  ? 761 MET B SD  1 
ATOM   2435 C CE  . MET B 2 126 ? 22.919 40.738 83.135  1.00 20.73  ? 761 MET B CE  1 
ATOM   2436 N N   . GLN B 2 127 ? 22.693 36.142 81.545  1.00 25.68  ? 762 GLN B N   1 
ATOM   2437 C CA  . GLN B 2 127 ? 21.720 35.323 82.255  1.00 26.68  ? 762 GLN B CA  1 
ATOM   2438 C C   . GLN B 2 127 ? 22.282 33.924 82.405  1.00 26.54  ? 762 GLN B C   1 
ATOM   2439 O O   . GLN B 2 127 ? 22.352 33.377 83.511  1.00 28.58  ? 762 GLN B O   1 
ATOM   2440 C CB  . GLN B 2 127 ? 20.377 35.270 81.501  1.00 25.89  ? 762 GLN B CB  1 
ATOM   2441 C CG  . GLN B 2 127 ? 19.694 36.633 81.353  1.00 28.35  ? 762 GLN B CG  1 
ATOM   2442 C CD  . GLN B 2 127 ? 19.546 37.403 82.683  1.00 31.74  ? 762 GLN B CD  1 
ATOM   2443 O OE1 . GLN B 2 127 ? 19.265 36.814 83.719  1.00 33.39  ? 762 GLN B OE1 1 
ATOM   2444 N NE2 . GLN B 2 127 ? 19.736 38.718 82.643  1.00 31.79  ? 762 GLN B NE2 1 
ATOM   2445 N N   . ARG B 2 128 ? 22.793 33.406 81.293  1.00 25.84  ? 763 ARG B N   1 
ATOM   2446 C CA  . ARG B 2 128 ? 23.352 32.061 81.201  1.00 24.02  ? 763 ARG B CA  1 
ATOM   2447 C C   . ARG B 2 128 ? 24.666 31.864 81.987  1.00 21.95  ? 763 ARG B C   1 
ATOM   2448 O O   . ARG B 2 128 ? 24.934 30.798 82.540  1.00 22.20  ? 763 ARG B O   1 
ATOM   2449 C CB  . ARG B 2 128 ? 23.590 31.740 79.713  1.00 25.75  ? 763 ARG B CB  1 
ATOM   2450 C CG  . ARG B 2 128 ? 23.918 30.295 79.372  1.00 32.17  ? 763 ARG B CG  1 
ATOM   2451 C CD  . ARG B 2 128 ? 22.658 29.456 79.085  1.00 38.74  ? 763 ARG B CD  1 
ATOM   2452 N NE  . ARG B 2 128 ? 21.665 30.122 78.220  1.00 44.12  ? 763 ARG B NE  1 
ATOM   2453 C CZ  . ARG B 2 128 ? 21.515 29.940 76.902  1.00 46.32  ? 763 ARG B CZ  1 
ATOM   2454 N NH1 . ARG B 2 128 ? 22.293 29.102 76.215  1.00 45.90  ? 763 ARG B NH1 1 
ATOM   2455 N NH2 . ARG B 2 128 ? 20.569 30.614 76.262  1.00 44.26  ? 763 ARG B NH2 1 
ATOM   2456 N N   . LEU B 2 129 ? 25.500 32.882 82.000  1.00 19.59  ? 764 LEU B N   1 
ATOM   2457 C CA  . LEU B 2 129 ? 26.763 32.764 82.664  1.00 20.12  ? 764 LEU B CA  1 
ATOM   2458 C C   . LEU B 2 129 ? 26.922 33.494 83.987  1.00 21.45  ? 764 LEU B C   1 
ATOM   2459 O O   . LEU B 2 129 ? 28.011 33.465 84.549  1.00 21.66  ? 764 LEU B O   1 
ATOM   2460 C CB  . LEU B 2 129 ? 27.865 33.172 81.694  1.00 23.58  ? 764 LEU B CB  1 
ATOM   2461 C CG  . LEU B 2 129 ? 28.035 32.029 80.684  1.00 28.29  ? 764 LEU B CG  1 
ATOM   2462 C CD1 . LEU B 2 129 ? 27.876 32.538 79.270  1.00 24.71  ? 764 LEU B CD1 1 
ATOM   2463 C CD2 . LEU B 2 129 ? 29.383 31.327 80.917  1.00 26.16  ? 764 LEU B CD2 1 
ATOM   2464 N N   . LYS B 2 130 ? 25.868 34.136 84.490  1.00 18.92  ? 765 LYS B N   1 
ATOM   2465 C CA  . LYS B 2 130 ? 25.950 34.873 85.759  1.00 21.87  ? 765 LYS B CA  1 
ATOM   2466 C C   . LYS B 2 130 ? 26.710 34.165 86.917  1.00 15.11  ? 765 LYS B C   1 
ATOM   2467 O O   . LYS B 2 130 ? 27.676 34.724 87.452  1.00 16.43  ? 765 LYS B O   1 
ATOM   2468 C CB  . LYS B 2 130 ? 24.553 35.280 86.230  1.00 23.46  ? 765 LYS B CB  1 
ATOM   2469 C CG  . LYS B 2 130 ? 24.590 36.281 87.351  1.00 30.22  ? 765 LYS B CG  1 
ATOM   2470 C CD  . LYS B 2 130 ? 23.285 36.274 88.108  1.00 39.36  ? 765 LYS B CD  1 
ATOM   2471 C CE  . LYS B 2 130 ? 22.124 36.864 87.284  1.00 46.30  ? 765 LYS B CE  1 
ATOM   2472 N NZ  . LYS B 2 130 ? 22.059 38.374 87.329  1.00 50.86  ? 765 LYS B NZ  1 
ATOM   2473 N N   . THR B 2 131 ? 26.315 32.942 87.257  1.00 17.61  ? 766 THR B N   1 
ATOM   2474 C CA  . THR B 2 131 ? 26.984 32.228 88.351  1.00 20.49  ? 766 THR B CA  1 
ATOM   2475 C C   . THR B 2 131 ? 28.447 31.946 88.039  1.00 25.05  ? 766 THR B C   1 
ATOM   2476 O O   . THR B 2 131 ? 29.310 32.064 88.926  1.00 22.84  ? 766 THR B O   1 
ATOM   2477 C CB  . THR B 2 131 ? 26.271 30.926 88.790  1.00 20.21  ? 766 THR B CB  1 
ATOM   2478 O OG1 . THR B 2 131 ? 26.358 29.937 87.763  1.00 25.18  ? 766 THR B OG1 1 
ATOM   2479 C CG2 . THR B 2 131 ? 24.819 31.175 89.093  1.00 17.49  ? 766 THR B CG2 1 
ATOM   2480 N N   . ASN B 2 132 ? 28.746 31.607 86.782  1.00 23.31  ? 767 ASN B N   1 
ATOM   2481 C CA  . ASN B 2 132 ? 30.125 31.348 86.404  1.00 20.16  ? 767 ASN B CA  1 
ATOM   2482 C C   . ASN B 2 132 ? 30.942 32.633 86.512  1.00 19.32  ? 767 ASN B C   1 
ATOM   2483 O O   . ASN B 2 132 ? 32.036 32.629 87.076  1.00 22.98  ? 767 ASN B O   1 
ATOM   2484 C CB  . ASN B 2 132 ? 30.218 30.734 84.992  1.00 24.79  ? 767 ASN B CB  1 
ATOM   2485 C CG  . ASN B 2 132 ? 31.633 30.289 84.653  1.00 26.93  ? 767 ASN B CG  1 
ATOM   2486 O OD1 . ASN B 2 132 ? 32.452 31.085 84.185  1.00 31.80  ? 767 ASN B OD1 1 
ATOM   2487 N ND2 . ASN B 2 132 ? 31.946 29.034 84.938  1.00 27.47  ? 767 ASN B ND2 1 
ATOM   2488 N N   . ILE B 2 133 ? 30.366 33.748 86.067  1.00 18.62  ? 768 ILE B N   1 
ATOM   2489 C CA  . ILE B 2 133 ? 31.023 35.054 86.098  1.00 19.02  ? 768 ILE B CA  1 
ATOM   2490 C C   . ILE B 2 133 ? 31.233 35.557 87.527  1.00 22.35  ? 768 ILE B C   1 
ATOM   2491 O O   . ILE B 2 133 ? 32.267 36.156 87.847  1.00 18.03  ? 768 ILE B O   1 
ATOM   2492 C CB  . ILE B 2 133 ? 30.192 36.139 85.334  1.00 21.37  ? 768 ILE B CB  1 
ATOM   2493 C CG1 . ILE B 2 133 ? 30.153 35.851 83.815  1.00 20.47  ? 768 ILE B CG1 1 
ATOM   2494 C CG2 . ILE B 2 133 ? 30.768 37.544 85.583  1.00 19.79  ? 768 ILE B CG2 1 
ATOM   2495 C CD1 . ILE B 2 133 ? 29.288 36.847 83.029  1.00 18.33  ? 768 ILE B CD1 1 
ATOM   2496 N N   . LEU B 2 134 ? 30.206 35.383 88.350  1.00 22.99  ? 769 LEU B N   1 
ATOM   2497 C CA  . LEU B 2 134 ? 30.253 35.825 89.744  1.00 27.14  ? 769 LEU B CA  1 
ATOM   2498 C C   . LEU B 2 134 ? 31.341 35.124 90.560  1.00 27.36  ? 769 LEU B C   1 
ATOM   2499 O O   . LEU B 2 134 ? 31.860 35.689 91.544  1.00 30.67  ? 769 LEU B O   1 
ATOM   2500 C CB  . LEU B 2 134 ? 28.879 35.627 90.396  1.00 23.47  ? 769 LEU B CB  1 
ATOM   2501 C CG  . LEU B 2 134 ? 28.047 36.880 90.603  1.00 23.26  ? 769 LEU B CG  1 
ATOM   2502 C CD1 . LEU B 2 134 ? 28.668 38.053 89.911  1.00 26.90  ? 769 LEU B CD1 1 
ATOM   2503 C CD2 . LEU B 2 134 ? 26.632 36.658 90.175  1.00 21.89  ? 769 LEU B CD2 1 
ATOM   2504 N N   . GLN B 2 135 ? 31.728 33.920 90.145  1.00 24.80  ? 770 GLN B N   1 
ATOM   2505 C CA  . GLN B 2 135 ? 32.750 33.226 90.895  1.00 29.44  ? 770 GLN B CA  1 
ATOM   2506 C C   . GLN B 2 135 ? 34.061 34.036 90.946  1.00 30.40  ? 770 GLN B C   1 
ATOM   2507 O O   . GLN B 2 135 ? 34.883 33.865 91.859  1.00 29.96  ? 770 GLN B O   1 
ATOM   2508 C CB  . GLN B 2 135 ? 32.912 31.790 90.395  1.00 29.53  ? 770 GLN B CB  1 
ATOM   2509 C CG  . GLN B 2 135 ? 33.835 31.587 89.247  1.00 36.27  ? 770 GLN B CG  1 
ATOM   2510 C CD  . GLN B 2 135 ? 33.671 30.200 88.657  1.00 40.56  ? 770 GLN B CD  1 
ATOM   2511 O OE1 . GLN B 2 135 ? 33.653 29.190 89.372  1.00 40.58  ? 770 GLN B OE1 1 
ATOM   2512 N NE2 . GLN B 2 135 ? 33.499 30.144 87.346  1.00 41.35  ? 770 GLN B NE2 1 
ATOM   2513 N N   . TYR B 2 136 ? 34.177 35.014 90.048  1.00 27.49  ? 771 TYR B N   1 
ATOM   2514 C CA  . TYR B 2 136 ? 35.346 35.889 89.971  1.00 27.73  ? 771 TYR B CA  1 
ATOM   2515 C C   . TYR B 2 136 ? 35.274 37.082 90.927  1.00 29.08  ? 771 TYR B C   1 
ATOM   2516 O O   . TYR B 2 136 ? 36.168 37.919 90.947  1.00 27.18  ? 771 TYR B O   1 
ATOM   2517 C CB  . TYR B 2 136 ? 35.588 36.332 88.509  1.00 26.76  ? 771 TYR B CB  1 
ATOM   2518 C CG  . TYR B 2 136 ? 35.952 35.138 87.656  1.00 25.06  ? 771 TYR B CG  1 
ATOM   2519 C CD1 . TYR B 2 136 ? 37.156 34.449 87.864  1.00 26.77  ? 771 TYR B CD1 1 
ATOM   2520 C CD2 . TYR B 2 136 ? 35.041 34.593 86.762  1.00 25.78  ? 771 TYR B CD2 1 
ATOM   2521 C CE1 . TYR B 2 136 ? 37.427 33.227 87.209  1.00 25.97  ? 771 TYR B CE1 1 
ATOM   2522 C CE2 . TYR B 2 136 ? 35.302 33.381 86.106  1.00 23.25  ? 771 TYR B CE2 1 
ATOM   2523 C CZ  . TYR B 2 136 ? 36.483 32.713 86.341  1.00 24.30  ? 771 TYR B CZ  1 
ATOM   2524 O OH  . TYR B 2 136 ? 36.693 31.502 85.759  1.00 28.18  ? 771 TYR B OH  1 
ATOM   2525 N N   . ALA B 2 137 ? 34.201 37.151 91.716  1.00 34.97  ? 772 ALA B N   1 
ATOM   2526 C CA  . ALA B 2 137 ? 34.019 38.223 92.702  1.00 38.25  ? 772 ALA B CA  1 
ATOM   2527 C C   . ALA B 2 137 ? 34.871 37.903 93.944  1.00 42.81  ? 772 ALA B C   1 
ATOM   2528 O O   . ALA B 2 137 ? 35.187 38.788 94.757  1.00 44.13  ? 772 ALA B O   1 
ATOM   2529 C CB  . ALA B 2 137 ? 32.549 38.343 93.085  1.00 32.45  ? 772 ALA B CB  1 
ATOM   2530 N N   . SER B 2 138 ? 35.233 36.628 94.082  1.00 43.31  ? 773 SER B N   1 
ATOM   2531 C CA  . SER B 2 138 ? 36.028 36.173 95.207  1.00 43.05  ? 773 SER B CA  1 
ATOM   2532 C C   . SER B 2 138 ? 37.489 36.555 95.104  1.00 44.08  ? 773 SER B C   1 
ATOM   2533 O O   . SER B 2 138 ? 38.051 36.672 94.014  1.00 44.44  ? 773 SER B O   1 
ATOM   2534 C CB  . SER B 2 138 ? 35.929 34.665 95.359  1.00 41.71  ? 773 SER B CB  1 
ATOM   2535 O OG  . SER B 2 138 ? 36.849 34.203 96.335  1.00 43.55  ? 773 SER B OG  1 
ATOM   2536 N N   . THR B 2 139 ? 38.109 36.669 96.269  1.00 45.79  ? 774 THR B N   1 
ATOM   2537 C CA  . THR B 2 139 ? 39.510 37.020 96.381  1.00 47.33  ? 774 THR B CA  1 
ATOM   2538 C C   . THR B 2 139 ? 40.438 35.802 96.331  1.00 47.22  ? 774 THR B C   1 
ATOM   2539 O O   . THR B 2 139 ? 41.658 35.952 96.384  1.00 44.82  ? 774 THR B O   1 
ATOM   2540 C CB  . THR B 2 139 ? 39.755 37.810 97.675  1.00 48.09  ? 774 THR B CB  1 
ATOM   2541 O OG1 . THR B 2 139 ? 39.009 37.222 98.754  1.00 48.52  ? 774 THR B OG1 1 
ATOM   2542 C CG2 . THR B 2 139 ? 39.304 39.236 97.490  1.00 51.12  ? 774 THR B CG2 1 
ATOM   2543 N N   . ARG B 2 140 ? 39.869 34.603 96.215  1.00 47.31  ? 775 ARG B N   1 
ATOM   2544 C CA  . ARG B 2 140 ? 40.686 33.400 96.170  1.00 48.15  ? 775 ARG B CA  1 
ATOM   2545 C C   . ARG B 2 140 ? 41.356 33.305 94.822  1.00 50.31  ? 775 ARG B C   1 
ATOM   2546 O O   . ARG B 2 140 ? 40.939 33.984 93.875  1.00 50.37  ? 775 ARG B O   1 
ATOM   2547 C CB  . ARG B 2 140 ? 39.848 32.153 96.413  1.00 47.18  ? 775 ARG B CB  1 
ATOM   2548 C CG  . ARG B 2 140 ? 38.982 31.705 95.262  1.00 49.07  ? 775 ARG B CG  1 
ATOM   2549 C CD  . ARG B 2 140 ? 37.861 30.863 95.823  1.00 51.72  ? 775 ARG B CD  1 
ATOM   2550 N NE  . ARG B 2 140 ? 37.211 31.571 96.927  1.00 53.69  ? 775 ARG B NE  1 
ATOM   2551 C CZ  . ARG B 2 140 ? 35.899 31.623 97.147  1.00 56.24  ? 775 ARG B CZ  1 
ATOM   2552 N NH1 . ARG B 2 140 ? 35.037 30.989 96.352  1.00 57.26  ? 775 ARG B NH1 1 
ATOM   2553 N NH2 . ARG B 2 140 ? 35.444 32.401 98.122  1.00 54.64  ? 775 ARG B NH2 1 
ATOM   2554 N N   . PRO B 2 141 ? 42.433 32.496 94.726  1.00 51.80  ? 776 PRO B N   1 
ATOM   2555 C CA  . PRO B 2 141 ? 43.175 32.307 93.472  1.00 50.70  ? 776 PRO B CA  1 
ATOM   2556 C C   . PRO B 2 141 ? 42.249 31.680 92.434  1.00 49.57  ? 776 PRO B C   1 
ATOM   2557 O O   . PRO B 2 141 ? 41.577 30.678 92.711  1.00 51.48  ? 776 PRO B O   1 
ATOM   2558 C CB  . PRO B 2 141 ? 44.277 31.321 93.871  1.00 51.43  ? 776 PRO B CB  1 
ATOM   2559 C CG  . PRO B 2 141 ? 44.479 31.600 95.329  1.00 52.53  ? 776 PRO B CG  1 
ATOM   2560 C CD  . PRO B 2 141 ? 43.063 31.733 95.820  1.00 50.43  ? 776 PRO B CD  1 
ATOM   2561 N N   . PRO B 2 142 ? 42.120 32.312 91.261  1.00 49.28  ? 777 PRO B N   1 
ATOM   2562 C CA  . PRO B 2 142 ? 41.224 31.670 90.291  1.00 47.31  ? 777 PRO B CA  1 
ATOM   2563 C C   . PRO B 2 142 ? 41.894 30.457 89.641  1.00 44.70  ? 777 PRO B C   1 
ATOM   2564 O O   . PRO B 2 142 ? 43.131 30.435 89.475  1.00 44.90  ? 777 PRO B O   1 
ATOM   2565 C CB  . PRO B 2 142 ? 40.940 32.797 89.292  1.00 46.50  ? 777 PRO B CB  1 
ATOM   2566 C CG  . PRO B 2 142 ? 42.212 33.623 89.343  1.00 47.92  ? 777 PRO B CG  1 
ATOM   2567 C CD  . PRO B 2 142 ? 42.544 33.654 90.812  1.00 48.08  ? 777 PRO B CD  1 
ATOM   2568 N N   . THR B 2 143 ? 41.091 29.425 89.368  1.00 40.74  ? 778 THR B N   1 
ATOM   2569 C CA  . THR B 2 143 ? 41.558 28.205 88.699  1.00 40.60  ? 778 THR B CA  1 
ATOM   2570 C C   . THR B 2 143 ? 41.385 28.501 87.182  1.00 36.16  ? 778 THR B C   1 
ATOM   2571 O O   . THR B 2 143 ? 40.304 28.364 86.612  1.00 37.01  ? 778 THR B O   1 
ATOM   2572 C CB  . THR B 2 143 ? 40.705 27.010 89.130  1.00 41.06  ? 778 THR B CB  1 
ATOM   2573 O OG1 . THR B 2 143 ? 39.552 27.479 89.862  1.00 45.38  ? 778 THR B OG1 1 
ATOM   2574 C CG2 . THR B 2 143 ? 41.534 26.045 89.976  1.00 44.16  ? 778 THR B CG2 1 
ATOM   2575 N N   . LEU B 2 144 ? 42.451 28.967 86.553  1.00 32.64  ? 779 LEU B N   1 
ATOM   2576 C CA  . LEU B 2 144 ? 42.386 29.388 85.160  1.00 26.15  ? 779 LEU B CA  1 
ATOM   2577 C C   . LEU B 2 144 ? 42.602 28.341 84.067  1.00 24.92  ? 779 LEU B C   1 
ATOM   2578 O O   . LEU B 2 144 ? 43.212 27.291 84.308  1.00 22.46  ? 779 LEU B O   1 
ATOM   2579 C CB  . LEU B 2 144 ? 43.287 30.616 84.973  1.00 23.74  ? 779 LEU B CB  1 
ATOM   2580 C CG  . LEU B 2 144 ? 42.946 31.735 85.974  1.00 20.75  ? 779 LEU B CG  1 
ATOM   2581 C CD1 . LEU B 2 144 ? 43.831 32.937 85.824  1.00 25.25  ? 779 LEU B CD1 1 
ATOM   2582 C CD2 . LEU B 2 144 ? 41.500 32.147 85.812  1.00 27.00  ? 779 LEU B CD2 1 
ATOM   2583 N N   . SER B 2 145 ? 42.015 28.603 82.892  1.00 20.27  ? 780 SER B N   1 
ATOM   2584 C CA  . SER B 2 145 ? 42.134 27.708 81.747  1.00 20.61  ? 780 SER B CA  1 
ATOM   2585 C C   . SER B 2 145 ? 43.487 27.980 81.098  1.00 12.79  ? 780 SER B C   1 
ATOM   2586 O O   . SER B 2 145 ? 43.932 29.124 81.055  1.00 13.64  ? 780 SER B O   1 
ATOM   2587 C CB  . SER B 2 145 ? 40.996 27.961 80.757  1.00 19.65  ? 780 SER B CB  1 
ATOM   2588 O OG  . SER B 2 145 ? 39.800 27.349 81.204  1.00 26.53  ? 780 SER B OG  1 
ATOM   2589 N N   . PRO B 2 146 ? 44.191 26.922 80.662  1.00 15.85  ? 781 PRO B N   1 
ATOM   2590 C CA  . PRO B 2 146 ? 45.509 27.079 80.023  1.00 16.78  ? 781 PRO B CA  1 
ATOM   2591 C C   . PRO B 2 146 ? 45.394 27.943 78.783  1.00 15.99  ? 781 PRO B C   1 
ATOM   2592 O O   . PRO B 2 146 ? 44.455 27.794 78.009  1.00 15.14  ? 781 PRO B O   1 
ATOM   2593 C CB  . PRO B 2 146 ? 45.884 25.652 79.631  1.00 14.93  ? 781 PRO B CB  1 
ATOM   2594 C CG  . PRO B 2 146 ? 45.150 24.814 80.586  1.00 21.35  ? 781 PRO B CG  1 
ATOM   2595 C CD  . PRO B 2 146 ? 43.792 25.513 80.673  1.00 15.31  ? 781 PRO B CD  1 
ATOM   2596 N N   . ILE B 2 147 ? 46.329 28.861 78.619  1.00 16.60  ? 782 ILE B N   1 
ATOM   2597 C CA  . ILE B 2 147 ? 46.344 29.722 77.456  1.00 23.54  ? 782 ILE B CA  1 
ATOM   2598 C C   . ILE B 2 147 ? 46.625 28.806 76.243  1.00 27.45  ? 782 ILE B C   1 
ATOM   2599 O O   . ILE B 2 147 ? 47.534 27.971 76.280  1.00 24.66  ? 782 ILE B O   1 
ATOM   2600 C CB  . ILE B 2 147 ? 47.376 30.815 77.653  1.00 25.02  ? 782 ILE B CB  1 
ATOM   2601 C CG1 . ILE B 2 147 ? 46.852 31.780 78.722  1.00 22.70  ? 782 ILE B CG1 1 
ATOM   2602 C CG2 . ILE B 2 147 ? 47.645 31.530 76.331  1.00 27.40  ? 782 ILE B CG2 1 
ATOM   2603 C CD1 . ILE B 2 147 ? 47.789 32.872 79.055  1.00 28.21  ? 782 ILE B CD1 1 
ATOM   2604 N N   . PRO B 2 148 ? 45.773 28.877 75.200  1.00 28.82  ? 783 PRO B N   1 
ATOM   2605 C CA  . PRO B 2 148 ? 45.960 28.027 74.023  1.00 32.32  ? 783 PRO B CA  1 
ATOM   2606 C C   . PRO B 2 148 ? 47.264 28.221 73.235  1.00 35.63  ? 783 PRO B C   1 
ATOM   2607 O O   . PRO B 2 148 ? 47.722 29.347 73.006  1.00 33.82  ? 783 PRO B O   1 
ATOM   2608 C CB  . PRO B 2 148 ? 44.688 28.292 73.217  1.00 28.44  ? 783 PRO B CB  1 
ATOM   2609 C CG  . PRO B 2 148 ? 44.408 29.689 73.498  1.00 26.90  ? 783 PRO B CG  1 
ATOM   2610 C CD  . PRO B 2 148 ? 44.682 29.839 74.975  1.00 27.37  ? 783 PRO B CD  1 
ATOM   2611 N N   . HIS B 2 149 ? 47.882 27.086 72.914  1.00 45.97  ? 784 HIS B N   1 
ATOM   2612 C CA  . HIS B 2 149 ? 49.143 27.013 72.174  1.00 54.76  ? 784 HIS B CA  1 
ATOM   2613 C C   . HIS B 2 149 ? 49.142 27.753 70.839  1.00 56.03  ? 784 HIS B C   1 
ATOM   2614 O O   . HIS B 2 149 ? 48.294 27.485 69.989  1.00 57.41  ? 784 HIS B O   1 
ATOM   2615 C CB  . HIS B 2 149 ? 49.553 25.543 71.963  1.00 61.88  ? 784 HIS B CB  1 
ATOM   2616 C CG  . HIS B 2 149 ? 48.567 24.716 71.178  1.00 69.97  ? 784 HIS B CG  1 
ATOM   2617 N ND1 . HIS B 2 149 ? 47.416 25.232 70.610  1.00 71.39  ? 784 HIS B ND1 1 
ATOM   2618 C CD2 . HIS B 2 149 ? 48.570 23.393 70.871  1.00 72.16  ? 784 HIS B CD2 1 
ATOM   2619 C CE1 . HIS B 2 149 ? 46.755 24.265 69.995  1.00 72.40  ? 784 HIS B CE1 1 
ATOM   2620 N NE2 . HIS B 2 149 ? 47.434 23.140 70.137  1.00 72.58  ? 784 HIS B NE2 1 
ATOM   2621 N N   . ILE B 2 150 ? 50.128 28.641 70.678  1.00 57.18  ? 785 ILE B N   1 
ATOM   2622 C CA  . ILE B 2 150 ? 50.369 29.499 69.501  1.00 56.68  ? 785 ILE B CA  1 
ATOM   2623 C C   . ILE B 2 150 ? 49.365 30.644 69.253  1.00 54.02  ? 785 ILE B C   1 
ATOM   2624 O O   . ILE B 2 150 ? 48.133 30.455 69.363  1.00 52.74  ? 785 ILE B O   1 
ATOM   2625 C CB  . ILE B 2 150 ? 50.719 28.677 68.167  1.00 57.18  ? 785 ILE B CB  1 
ATOM   2626 C CG1 . ILE B 2 150 ? 51.291 29.609 67.092  1.00 56.91  ? 785 ILE B CG1 1 
ATOM   2627 C CG2 . ILE B 2 150 ? 49.503 27.982 67.579  1.00 59.77  ? 785 ILE B CG2 1 
ATOM   2628 C CD1 . ILE B 2 150 ? 51.310 29.007 65.701  1.00 53.09  ? 785 ILE B CD1 1 
ATOM   2629 N N   . ASP C 3 1   ? 26.262 45.280 89.818  1.00 42.91  ? 1   ASP E N   1 
ATOM   2630 C CA  . ASP C 3 1   ? 25.804 43.955 89.312  1.00 38.10  ? 1   ASP E CA  1 
ATOM   2631 C C   . ASP C 3 1   ? 26.461 43.722 87.945  1.00 38.26  ? 1   ASP E C   1 
ATOM   2632 O O   . ASP C 3 1   ? 27.448 44.403 87.619  1.00 38.49  ? 1   ASP E O   1 
ATOM   2633 C CB  . ASP C 3 1   ? 24.260 43.874 89.265  1.00 36.73  ? 1   ASP E CB  1 
ATOM   2634 C CG  . ASP C 3 1   ? 23.610 44.853 88.280  1.00 34.91  ? 1   ASP E CG  1 
ATOM   2635 O OD1 . ASP C 3 1   ? 24.261 45.769 87.723  1.00 34.04  ? 1   ASP E OD1 1 
ATOM   2636 O OD2 . ASP C 3 1   ? 22.388 44.688 88.075  1.00 40.65  ? 1   ASP E OD2 1 
ATOM   2637 N N   . LEU C 3 2   ? 25.961 42.776 87.157  1.00 31.96  ? 2   LEU E N   1 
ATOM   2638 C CA  . LEU C 3 2   ? 26.593 42.541 85.871  1.00 29.41  ? 2   LEU E CA  1 
ATOM   2639 C C   . LEU C 3 2   ? 25.890 43.229 84.703  1.00 29.56  ? 2   LEU E C   1 
ATOM   2640 O O   . LEU C 3 2   ? 26.398 43.187 83.582  1.00 27.20  ? 2   LEU E O   1 
ATOM   2641 C CB  . LEU C 3 2   ? 26.721 41.041 85.610  1.00 25.92  ? 2   LEU E CB  1 
ATOM   2642 C CG  . LEU C 3 2   ? 27.409 40.198 86.693  1.00 25.13  ? 2   LEU E CG  1 
ATOM   2643 C CD1 . LEU C 3 2   ? 27.377 38.738 86.300  1.00 24.39  ? 2   LEU E CD1 1 
ATOM   2644 C CD2 . LEU C 3 2   ? 28.823 40.681 86.954  1.00 22.20  ? 2   LEU E CD2 1 
ATOM   2645 N N   . TYR C 3 3   ? 24.758 43.886 84.964  1.00 26.76  ? 3   TYR E N   1 
ATOM   2646 C CA  . TYR C 3 3   ? 23.988 44.546 83.906  1.00 25.93  ? 3   TYR E CA  1 
ATOM   2647 C C   . TYR C 3 3   ? 24.730 45.664 83.215  1.00 24.84  ? 3   TYR E C   1 
ATOM   2648 O O   . TYR C 3 3   ? 25.473 46.389 83.854  1.00 24.20  ? 3   TYR E O   1 
ATOM   2649 C CB  . TYR C 3 3   ? 22.671 45.094 84.449  1.00 28.35  ? 3   TYR E CB  1 
ATOM   2650 C CG  . TYR C 3 3   ? 21.525 45.006 83.456  1.00 29.72  ? 3   TYR E CG  1 
ATOM   2651 C CD1 . TYR C 3 3   ? 20.740 43.861 83.384  1.00 29.74  ? 3   TYR E CD1 1 
ATOM   2652 C CD2 . TYR C 3 3   ? 21.255 46.046 82.555  1.00 31.40  ? 3   TYR E CD2 1 
ATOM   2653 C CE1 . TYR C 3 3   ? 19.717 43.741 82.439  1.00 31.31  ? 3   TYR E CE1 1 
ATOM   2654 C CE2 . TYR C 3 3   ? 20.228 45.931 81.597  1.00 28.74  ? 3   TYR E CE2 1 
ATOM   2655 C CZ  . TYR C 3 3   ? 19.471 44.777 81.549  1.00 28.45  ? 3   TYR E CZ  1 
ATOM   2656 O OH  . TYR C 3 3   ? 18.473 44.608 80.613  1.00 31.29  ? 3   TYR E OH  1 
ATOM   2657 N N   . CYS C 3 4   ? 24.520 45.805 81.908  1.00 21.29  ? 4   CYS E N   1 
ATOM   2658 C CA  . CYS C 3 4   ? 25.170 46.860 81.148  1.00 25.82  ? 4   CYS E CA  1 
ATOM   2659 C C   . CYS C 3 4   ? 24.139 47.944 80.910  1.00 25.37  ? 4   CYS E C   1 
ATOM   2660 O O   . CYS C 3 4   ? 23.068 47.669 80.356  1.00 26.76  ? 4   CYS E O   1 
ATOM   2661 C CB  . CYS C 3 4   ? 25.667 46.348 79.779  1.00 25.20  ? 4   CYS E CB  1 
ATOM   2662 S SG  . CYS C 3 4   ? 26.553 47.607 78.836  1.00 23.95  ? 4   CYS E SG  1 
ATOM   2663 N N   . TYR C 3 5   ? 24.448 49.162 81.340  1.00 27.40  ? 5   TYR E N   1 
ATOM   2664 C CA  . TYR C 3 5   ? 23.535 50.282 81.150  1.00 33.12  ? 5   TYR E CA  1 
ATOM   2665 C C   . TYR C 3 5   ? 24.098 51.154 80.054  1.00 34.12  ? 5   TYR E C   1 
ATOM   2666 O O   . TYR C 3 5   ? 24.587 52.266 80.286  1.00 36.70  ? 5   TYR E O   1 
ATOM   2667 C CB  . TYR C 3 5   ? 23.314 51.062 82.456  1.00 33.18  ? 5   TYR E CB  1 
ATOM   2668 C CG  . TYR C 3 5   ? 22.639 50.218 83.517  1.00 31.38  ? 5   TYR E CG  1 
ATOM   2669 C CD1 . TYR C 3 5   ? 21.282 49.925 83.437  1.00 29.62  ? 5   TYR E CD1 1 
ATOM   2670 C CD2 . TYR C 3 5   ? 23.379 49.643 84.556  1.00 30.64  ? 5   TYR E CD2 1 
ATOM   2671 C CE1 . TYR C 3 5   ? 20.673 49.075 84.361  1.00 30.57  ? 5   TYR E CE1 1 
ATOM   2672 C CE2 . TYR C 3 5   ? 22.773 48.790 85.481  1.00 30.56  ? 5   TYR E CE2 1 
ATOM   2673 C CZ  . TYR C 3 5   ? 21.427 48.513 85.375  1.00 27.62  ? 5   TYR E CZ  1 
ATOM   2674 O OH  . TYR C 3 5   ? 20.837 47.665 86.269  1.00 30.75  ? 5   TYR E OH  1 
ATOM   2675 N N   . GLU C 3 6   ? 24.081 50.588 78.853  1.00 35.47  ? 6   GLU E N   1 
ATOM   2676 C CA  . GLU C 3 6   ? 24.577 51.261 77.663  1.00 33.31  ? 6   GLU E CA  1 
ATOM   2677 C C   . GLU C 3 6   ? 23.653 51.009 76.487  1.00 32.11  ? 6   GLU E C   1 
ATOM   2678 O O   . GLU C 3 6   ? 22.856 50.064 76.491  1.00 31.75  ? 6   GLU E O   1 
ATOM   2679 C CB  . GLU C 3 6   ? 26.003 50.809 77.339  1.00 32.58  ? 6   GLU E CB  1 
ATOM   2680 C CG  . GLU C 3 6   ? 27.016 51.350 78.287  1.00 29.25  ? 6   GLU E CG  1 
ATOM   2681 C CD  . GLU C 3 6   ? 28.388 50.896 77.947  1.00 34.94  ? 6   GLU E CD  1 
ATOM   2682 O OE1 . GLU C 3 6   ? 28.969 51.458 76.991  1.00 32.36  ? 6   GLU E OE1 1 
ATOM   2683 O OE2 . GLU C 3 6   ? 28.886 49.970 78.628  1.00 34.13  ? 6   GLU E OE2 1 
ATOM   2684 N N   . GLN C 3 7   ? 23.693 51.929 75.534  1.00 32.46  ? 7   GLN E N   1 
ATOM   2685 C CA  . GLN C 3 7   ? 22.878 51.844 74.336  1.00 37.48  ? 7   GLN E CA  1 
ATOM   2686 C C   . GLN C 3 7   ? 23.905 52.020 73.239  1.00 39.27  ? 7   GLN E C   1 
ATOM   2687 O O   . GLN C 3 7   ? 24.709 52.967 73.287  1.00 37.77  ? 7   GLN E O   1 
ATOM   2688 C CB  . GLN C 3 7   ? 21.847 52.972 74.299  1.00 36.52  ? 7   GLN E CB  1 
ATOM   2689 C CG  . GLN C 3 7   ? 20.921 53.011 75.532  1.00 44.65  ? 7   GLN E CG  1 
ATOM   2690 C CD  . GLN C 3 7   ? 21.427 53.911 76.650  1.00 44.15  ? 7   GLN E CD  1 
ATOM   2691 O OE1 . GLN C 3 7   ? 21.853 55.048 76.407  1.00 42.12  ? 7   GLN E OE1 1 
ATOM   2692 N NE2 . GLN C 3 7   ? 21.358 53.418 77.888  1.00 48.47  ? 7   GLN E NE2 1 
ATOM   2693 N N   . LEU C 3 8   ? 23.944 51.058 72.313  1.00 42.92  ? 8   LEU E N   1 
ATOM   2694 C CA  . LEU C 3 8   ? 24.916 51.119 71.242  1.00 47.89  ? 8   LEU E CA  1 
ATOM   2695 C C   . LEU C 3 8   ? 24.816 52.263 70.263  1.00 52.40  ? 8   LEU E C   1 
ATOM   2696 O O   . LEU C 3 8   ? 24.014 52.272 69.309  1.00 52.99  ? 8   LEU E O   1 
ATOM   2697 C CB  . LEU C 3 8   ? 25.157 49.769 70.571  1.00 45.43  ? 8   LEU E CB  1 
ATOM   2698 C CG  . LEU C 3 8   ? 26.261 49.064 71.373  1.00 43.68  ? 8   LEU E CG  1 
ATOM   2699 C CD1 . LEU C 3 8   ? 26.849 47.931 70.568  1.00 42.66  ? 8   LEU E CD1 1 
ATOM   2700 C CD2 . LEU C 3 8   ? 27.367 50.059 71.766  1.00 41.72  ? 8   LEU E CD2 1 
ATOM   2701 N N   . ASN C 3 9   ? 25.623 53.258 70.630  1.00 55.44  ? 9   ASN E N   1 
ATOM   2702 C CA  . ASN C 3 9   ? 25.844 54.533 69.976  1.00 55.53  ? 9   ASN E CA  1 
ATOM   2703 C C   . ASN C 3 9   ? 26.836 55.238 70.936  1.00 57.91  ? 9   ASN E C   1 
ATOM   2704 O O   . ASN C 3 9   ? 26.611 56.383 71.377  1.00 60.12  ? 9   ASN E O   1 
ATOM   2705 C CB  . ASN C 3 9   ? 24.521 55.317 69.749  1.00 52.18  ? 9   ASN E CB  1 
ATOM   2706 C CG  . ASN C 3 9   ? 23.643 55.431 71.001  1.00 49.31  ? 9   ASN E CG  1 
ATOM   2707 O OD1 . ASN C 3 9   ? 22.632 54.723 71.153  1.00 40.72  ? 9   ASN E OD1 1 
ATOM   2708 N ND2 . ASN C 3 9   ? 23.971 56.384 71.849  1.00 50.96  ? 9   ASN E ND2 1 
ATOM   2709 O OXT . ASN C 3 9   ? 27.840 54.576 71.296  1.00 58.28  ? 9   ASN E OXT 1 
HETATM 2710 O O   . HOH D 4 .   ? 28.448 23.277 58.907  1.00 19.62  ? 590 HOH A O   1 
HETATM 2711 O O   . HOH D 4 .   ? 41.301 23.089 57.597  1.00 16.88  ? 591 HOH A O   1 
HETATM 2712 O O   . HOH D 4 .   ? 26.419 30.996 63.146  1.00 18.80  ? 592 HOH A O   1 
HETATM 2713 O O   . HOH D 4 .   ? 27.981 35.976 30.929  1.00 24.86  ? 593 HOH A O   1 
HETATM 2714 O O   . HOH D 4 .   ? 32.375 30.870 46.268  1.00 15.60  ? 594 HOH A O   1 
HETATM 2715 O O   . HOH D 4 .   ? 52.852 34.811 46.618  1.00 24.07  ? 595 HOH A O   1 
HETATM 2716 O O   . HOH D 4 .   ? 43.790 35.151 56.256  1.00 20.51  ? 596 HOH A O   1 
HETATM 2717 O O   . HOH D 4 .   ? 44.922 18.083 36.484  1.00 20.77  ? 597 HOH A O   1 
HETATM 2718 O O   . HOH D 4 .   ? 53.339 28.895 46.930  1.00 30.45  ? 598 HOH A O   1 
HETATM 2719 O O   . HOH D 4 .   ? 36.502 34.308 52.833  1.00 25.72  ? 599 HOH A O   1 
HETATM 2720 O O   . HOH D 4 .   ? 21.669 22.015 64.824  1.00 32.12  ? 600 HOH A O   1 
HETATM 2721 O O   . HOH D 4 .   ? 49.296 19.633 37.348  1.00 24.84  ? 601 HOH A O   1 
HETATM 2722 O O   . HOH D 4 .   ? 50.974 18.841 42.032  1.00 28.08  ? 602 HOH A O   1 
HETATM 2723 O O   . HOH D 4 .   ? 25.818 33.187 61.775  1.00 25.53  ? 603 HOH A O   1 
HETATM 2724 O O   . HOH D 4 .   ? 51.015 32.323 54.283  1.00 33.34  ? 604 HOH A O   1 
HETATM 2725 O O   . HOH D 4 .   ? 47.617 27.159 28.769  1.00 31.79  ? 605 HOH A O   1 
HETATM 2726 O O   . HOH D 4 .   ? 48.175 18.038 52.362  1.00 25.79  ? 606 HOH A O   1 
HETATM 2727 O O   . HOH D 4 .   ? 51.951 27.137 49.324  1.00 26.30  ? 607 HOH A O   1 
HETATM 2728 O O   . HOH D 4 .   ? 35.903 1.176  50.670  1.00 33.09  ? 608 HOH A O   1 
HETATM 2729 O O   . HOH D 4 .   ? 26.822 35.963 63.048  1.00 28.07  ? 609 HOH A O   1 
HETATM 2730 O O   . HOH D 4 .   ? 31.633 33.535 44.590  1.00 32.60  ? 610 HOH A O   1 
HETATM 2731 O O   . HOH D 4 .   ? 41.415 36.724 47.007  1.00 49.98  ? 611 HOH A O   1 
HETATM 2732 O O   . HOH D 4 .   ? 34.511 35.089 40.501  1.00 27.31  ? 612 HOH A O   1 
HETATM 2733 O O   . HOH D 4 .   ? 52.066 21.685 44.154  1.00 21.88  ? 613 HOH A O   1 
HETATM 2734 O O   . HOH D 4 .   ? 34.339 13.074 42.318  1.00 22.67  ? 614 HOH A O   1 
HETATM 2735 O O   . HOH D 4 .   ? 26.873 25.161 58.422  1.00 31.28  ? 615 HOH A O   1 
HETATM 2736 O O   . HOH D 4 .   ? 29.884 35.690 44.050  1.00 47.64  ? 616 HOH A O   1 
HETATM 2737 O O   . HOH D 4 .   ? 27.111 25.671 55.662  1.00 24.33  ? 617 HOH A O   1 
HETATM 2738 O O   . HOH D 4 .   ? 52.440 23.791 49.716  1.00 31.44  ? 618 HOH A O   1 
HETATM 2739 O O   . HOH D 4 .   ? 43.175 16.611 35.137  1.00 41.14  ? 619 HOH A O   1 
HETATM 2740 O O   . HOH D 4 .   ? 29.052 34.334 41.423  1.00 42.12  ? 620 HOH A O   1 
HETATM 2741 O O   . HOH D 4 .   ? 26.137 25.023 52.284  1.00 33.78  ? 621 HOH A O   1 
HETATM 2742 O O   . HOH D 4 .   ? 40.223 35.897 60.624  1.00 28.97  ? 622 HOH A O   1 
HETATM 2743 O O   . HOH D 4 .   ? 47.337 19.440 35.503  1.00 35.36  ? 623 HOH A O   1 
HETATM 2744 O O   . HOH D 4 .   ? 24.190 24.301 58.638  1.00 31.33  ? 624 HOH A O   1 
HETATM 2745 O O   . HOH D 4 .   ? 23.137 8.911  69.284  1.00 37.81  ? 625 HOH A O   1 
HETATM 2746 O O   . HOH D 4 .   ? 56.378 28.879 40.063  1.00 29.24  ? 626 HOH A O   1 
HETATM 2747 O O   . HOH D 4 .   ? 23.756 20.345 52.929  1.00 37.36  ? 627 HOH A O   1 
HETATM 2748 O O   . HOH D 4 .   ? 27.562 28.457 33.284  1.00 39.71  ? 628 HOH A O   1 
HETATM 2749 O O   . HOH D 4 .   ? 43.145 22.887 26.872  1.00 49.85  ? 629 HOH A O   1 
HETATM 2750 O O   . HOH D 4 .   ? 46.752 35.803 43.750  1.00 26.07  ? 630 HOH A O   1 
HETATM 2751 O O   . HOH D 4 .   ? 33.992 37.271 38.516  1.00 36.45  ? 631 HOH A O   1 
HETATM 2752 O O   . HOH D 4 .   ? 43.602 37.562 50.215  1.00 32.04  ? 632 HOH A O   1 
HETATM 2753 O O   . HOH D 4 .   ? 27.618 33.282 59.461  1.00 28.29  ? 633 HOH A O   1 
HETATM 2754 O O   . HOH D 4 .   ? 20.432 30.539 31.833  1.00 42.46  ? 634 HOH A O   1 
HETATM 2755 O O   . HOH D 4 .   ? 21.205 27.137 59.071  1.00 35.55  ? 635 HOH A O   1 
HETATM 2756 O O   . HOH D 4 .   ? 36.937 39.933 37.205  1.00 43.24  ? 636 HOH A O   1 
HETATM 2757 O O   . HOH D 4 .   ? 28.885 14.963 58.733  1.00 37.74  ? 637 HOH A O   1 
HETATM 2758 O O   . HOH D 4 .   ? 41.506 37.519 52.741  1.00 34.84  ? 638 HOH A O   1 
HETATM 2759 O O   . HOH D 4 .   ? 54.107 26.820 38.154  1.00 70.55  ? 639 HOH A O   1 
HETATM 2760 O O   . HOH D 4 .   ? 42.501 21.144 59.267  1.00 51.02  ? 640 HOH A O   1 
HETATM 2761 O O   . HOH D 4 .   ? 23.958 23.241 33.050  1.00 44.98  ? 641 HOH A O   1 
HETATM 2762 O O   . HOH D 4 .   ? 31.865 3.869  47.872  1.00 43.46  ? 642 HOH A O   1 
HETATM 2763 O O   . HOH D 4 .   ? 34.004 4.040  34.598  1.00 65.61  ? 643 HOH A O   1 
HETATM 2764 O O   . HOH D 4 .   ? 25.512 18.506 46.146  1.00 82.71  ? 644 HOH A O   1 
HETATM 2765 O O   . HOH D 4 .   ? 38.986 1.223  36.602  1.00 41.75  ? 645 HOH A O   1 
HETATM 2766 O O   . HOH D 4 .   ? 20.606 21.206 41.425  1.00 58.71  ? 646 HOH A O   1 
HETATM 2767 O O   . HOH D 4 .   ? 52.954 14.840 46.137  1.00 29.05  ? 647 HOH A O   1 
HETATM 2768 O O   . HOH D 4 .   ? 20.858 28.330 34.194  1.00 44.72  ? 648 HOH A O   1 
HETATM 2769 O O   . HOH D 4 .   ? 43.667 28.062 61.793  1.00 45.05  ? 649 HOH A O   1 
HETATM 2770 O O   . HOH D 4 .   ? 44.907 13.864 37.534  1.00 35.86  ? 650 HOH A O   1 
HETATM 2771 O O   . HOH D 4 .   ? 24.150 17.419 49.082  1.00 46.61  ? 651 HOH A O   1 
HETATM 2772 O O   . HOH D 4 .   ? 39.108 36.440 51.843  1.00 32.81  ? 652 HOH A O   1 
HETATM 2773 O O   . HOH D 4 .   ? 32.912 22.075 32.222  1.00 41.15  ? 653 HOH A O   1 
HETATM 2774 O O   . HOH D 4 .   ? 27.324 18.031 48.905  1.00 39.30  ? 654 HOH A O   1 
HETATM 2775 O O   . HOH D 4 .   ? 35.068 26.262 28.132  1.00 75.16  ? 655 HOH A O   1 
HETATM 2776 O O   . HOH D 4 .   ? 32.770 18.916 33.091  1.00 61.99  ? 656 HOH A O   1 
HETATM 2777 O O   . HOH D 4 .   ? 51.223 14.672 42.016  1.00 36.43  ? 657 HOH A O   1 
HETATM 2778 O O   . HOH D 4 .   ? 47.537 30.093 59.443  1.00 78.63  ? 658 HOH A O   1 
HETATM 2779 O O   . HOH D 4 .   ? 32.922 4.150  44.811  1.00 34.24  ? 659 HOH A O   1 
HETATM 2780 O O   . HOH D 4 .   ? 46.303 19.244 62.107  1.00 47.43  ? 660 HOH A O   1 
HETATM 2781 O O   . HOH D 4 .   ? 31.418 36.043 56.864  1.00 32.87  ? 661 HOH A O   1 
HETATM 2782 O O   . HOH D 4 .   ? 22.918 23.760 44.144  1.00 39.25  ? 662 HOH A O   1 
HETATM 2783 O O   . HOH D 4 .   ? 23.419 17.050 38.154  1.00 32.44  ? 663 HOH A O   1 
HETATM 2784 O O   . HOH D 4 .   ? 50.517 7.173  40.140  1.00 54.06  ? 664 HOH A O   1 
HETATM 2785 O O   . HOH D 4 .   ? 48.157 23.723 62.551  1.00 45.04  ? 665 HOH A O   1 
HETATM 2786 O O   . HOH D 4 .   ? 27.683 18.675 53.755  1.00 18.00  ? 666 HOH A O   1 
HETATM 2787 O O   . HOH D 4 .   ? 49.575 16.731 41.274  1.00 27.91  ? 667 HOH A O   1 
HETATM 2788 O O   . HOH D 4 .   ? 55.327 27.922 44.238  1.00 30.78  ? 668 HOH A O   1 
HETATM 2789 O O   . HOH D 4 .   ? 30.821 7.282  35.850  1.00 34.00  ? 669 HOH A O   1 
HETATM 2790 O O   . HOH D 4 .   ? 54.293 36.515 48.047  1.00 29.01  ? 670 HOH A O   1 
HETATM 2791 O O   . HOH D 4 .   ? 49.148 20.169 44.112  1.00 22.32  ? 671 HOH A O   1 
HETATM 2792 O O   . HOH D 4 .   ? 44.879 33.880 34.815  1.00 35.76  ? 672 HOH A O   1 
HETATM 2793 O O   . HOH D 4 .   ? 53.832 22.228 48.046  1.00 40.97  ? 673 HOH A O   1 
HETATM 2794 O O   . HOH D 4 .   ? 33.504 8.492  45.265  1.00 24.19  ? 674 HOH A O   1 
HETATM 2795 O O   . HOH D 4 .   ? 48.467 39.243 51.317  1.00 44.81  ? 675 HOH A O   1 
HETATM 2796 O O   . HOH D 4 .   ? 43.318 35.720 45.439  1.00 52.84  ? 676 HOH A O   1 
HETATM 2797 O O   . HOH D 4 .   ? 49.196 16.976 38.352  1.00 41.25  ? 677 HOH A O   1 
HETATM 2798 O O   . HOH D 4 .   ? 33.703 7.288  54.545  1.00 32.12  ? 678 HOH A O   1 
HETATM 2799 O O   . HOH D 4 .   ? 31.321 8.569  48.470  1.00 26.49  ? 679 HOH A O   1 
HETATM 2800 O O   . HOH D 4 .   ? 22.307 24.786 48.029  1.00 40.11  ? 680 HOH A O   1 
HETATM 2801 O O   . HOH D 4 .   ? 35.172 35.505 49.593  1.00 45.37  ? 681 HOH A O   1 
HETATM 2802 O O   . HOH D 4 .   ? 46.493 16.200 37.489  1.00 43.11  ? 682 HOH A O   1 
HETATM 2803 O O   . HOH D 4 .   ? 24.490 37.824 28.344  1.00 49.08  ? 683 HOH A O   1 
HETATM 2804 O O   . HOH D 4 .   ? 51.112 35.814 54.557  1.00 50.95  ? 684 HOH A O   1 
HETATM 2805 O O   . HOH D 4 .   ? 40.283 15.951 28.073  1.00 41.94  ? 685 HOH A O   1 
HETATM 2806 O O   . HOH D 4 .   ? 23.435 11.671 40.823  1.00 35.09  ? 686 HOH A O   1 
HETATM 2807 O O   . HOH D 4 .   ? 46.728 14.726 34.032  1.00 50.30  ? 687 HOH A O   1 
HETATM 2808 O O   . HOH D 4 .   ? 42.175 35.275 58.743  1.00 43.09  ? 688 HOH A O   1 
HETATM 2809 O O   . HOH D 4 .   ? 25.691 33.488 57.083  1.00 35.21  ? 689 HOH A O   1 
HETATM 2810 O O   . HOH D 4 .   ? 34.042 2.448  39.571  1.00 45.59  ? 690 HOH A O   1 
HETATM 2811 O O   . HOH D 4 .   ? 52.772 17.631 43.740  1.00 38.82  ? 691 HOH A O   1 
HETATM 2812 O O   . HOH D 4 .   ? 33.929 -1.675 42.810  1.00 46.19  ? 692 HOH A O   1 
HETATM 2813 O O   . HOH D 4 .   ? 55.573 21.906 45.693  1.00 41.48  ? 693 HOH A O   1 
HETATM 2814 O O   . HOH D 4 .   ? 45.117 19.468 59.442  1.00 41.10  ? 694 HOH A O   1 
HETATM 2815 O O   . HOH D 4 .   ? 32.855 3.953  41.695  1.00 37.38  ? 695 HOH A O   1 
HETATM 2816 O O   . HOH D 4 .   ? 32.708 15.534 32.995  1.00 61.05  ? 696 HOH A O   1 
HETATM 2817 O O   . HOH D 4 .   ? 41.811 12.679 59.338  1.00 52.43  ? 697 HOH A O   1 
HETATM 2818 O O   . HOH D 4 .   ? 46.879 16.716 31.805  1.00 81.85  ? 698 HOH A O   1 
HETATM 2819 O O   . HOH D 4 .   ? 45.960 0.815  36.987  1.00 61.65  ? 699 HOH A O   1 
HETATM 2820 O O   . HOH D 4 .   ? 31.465 36.733 50.695  1.00 52.68  ? 700 HOH A O   1 
HETATM 2821 O O   . HOH D 4 .   ? 30.015 11.877 78.121  1.00 62.06  ? 701 HOH A O   1 
HETATM 2822 O O   . HOH D 4 .   ? 33.614 38.055 56.549  1.00 41.94  ? 702 HOH A O   1 
HETATM 2823 O O   . HOH D 4 .   ? 40.840 18.388 59.148  1.00 48.56  ? 703 HOH A O   1 
HETATM 2824 O O   . HOH D 4 .   ? 31.741 7.931  69.535  1.00 33.95  ? 704 HOH A O   1 
HETATM 2825 O O   . HOH D 4 .   ? 26.903 13.854 80.235  1.00 61.60  ? 705 HOH A O   1 
HETATM 2826 O O   . HOH D 4 .   ? 36.156 38.556 55.444  1.00 57.52  ? 706 HOH A O   1 
HETATM 2827 O O   . HOH D 4 .   ? 51.886 19.644 35.909  1.00 42.08  ? 707 HOH A O   1 
HETATM 2828 O O   . HOH D 4 .   ? 48.498 24.071 55.462  1.00 77.98  ? 708 HOH A O   1 
HETATM 2829 O O   . HOH D 4 .   ? 33.019 36.879 41.634  1.00 49.38  ? 709 HOH A O   1 
HETATM 2830 O O   . HOH D 4 .   ? 48.609 27.559 56.564  1.00 51.13  ? 710 HOH A O   1 
HETATM 2831 O O   . HOH D 4 .   ? 17.387 26.952 65.201  1.00 82.46  ? 711 HOH A O   1 
HETATM 2832 O O   . HOH D 4 .   ? 22.294 26.637 44.016  1.00 73.59  ? 712 HOH A O   1 
HETATM 2833 O O   . HOH D 4 .   ? 43.430 -0.172 49.153  1.00 49.62  ? 713 HOH A O   1 
HETATM 2834 O O   . HOH D 4 .   ? 58.218 21.899 46.531  1.00 61.70  ? 714 HOH A O   1 
HETATM 2835 O O   . HOH D 4 .   ? 25.722 31.044 52.136  1.00 62.65  ? 715 HOH A O   1 
HETATM 2836 O O   . HOH D 4 .   ? 25.854 32.515 48.436  1.00 48.93  ? 716 HOH A O   1 
HETATM 2837 O O   . HOH D 4 .   ? 31.337 26.164 21.852  1.00 53.14  ? 717 HOH A O   1 
HETATM 2838 O O   . HOH D 4 .   ? 26.848 37.738 39.676  1.00 55.47  ? 718 HOH A O   1 
HETATM 2839 O O   . HOH D 4 .   ? 30.282 -6.819 46.183  1.00 62.25  ? 719 HOH A O   1 
HETATM 2840 O O   . HOH D 4 .   ? 27.468 16.595 79.236  1.00 60.36  ? 720 HOH A O   1 
HETATM 2841 O O   . HOH D 4 .   ? 29.299 32.173 27.584  1.00 22.61  ? 721 HOH A O   1 
HETATM 2842 O O   . HOH D 4 .   ? 53.905 23.341 39.014  1.00 35.90  ? 722 HOH A O   1 
HETATM 2843 O O   . HOH D 4 .   ? 27.943 34.075 48.850  1.00 77.64  ? 723 HOH A O   1 
HETATM 2844 O O   . HOH D 4 .   ? 25.760 12.424 34.858  1.00 54.60  ? 724 HOH A O   1 
HETATM 2845 O O   . HOH D 4 .   ? 36.812 36.687 46.004  1.00 61.48  ? 725 HOH A O   1 
HETATM 2846 O O   . HOH D 4 .   ? 50.198 16.896 51.104  1.00 56.75  ? 726 HOH A O   1 
HETATM 2847 O O   . HOH D 4 .   ? 27.488 35.187 53.913  1.00 41.62  ? 727 HOH A O   1 
HETATM 2848 O O   . HOH D 4 .   ? 32.954 10.245 68.647  1.00 48.43  ? 728 HOH A O   1 
HETATM 2849 O O   . HOH D 4 .   ? 28.089 11.060 75.642  1.00 62.18  ? 729 HOH A O   1 
HETATM 2850 O O   . HOH D 4 .   ? 43.374 17.556 27.253  1.00 57.80  ? 730 HOH A O   1 
HETATM 2851 O O   . HOH D 4 .   ? 35.796 -0.407 37.647  1.00 57.94  ? 731 HOH A O   1 
HETATM 2852 O O   . HOH D 4 .   ? 20.964 37.508 34.158  1.00 51.44  ? 732 HOH A O   1 
HETATM 2853 O O   . HOH D 4 .   ? 47.034 2.018  47.467  1.00 56.10  ? 733 HOH A O   1 
HETATM 2854 O O   . HOH D 4 .   ? 24.455 16.115 61.613  1.00 62.06  ? 734 HOH A O   1 
HETATM 2855 O O   . HOH D 4 .   ? 39.575 -1.079 42.443  1.00 48.76  ? 735 HOH A O   1 
HETATM 2856 O O   . HOH D 4 .   ? 23.388 32.721 46.242  1.00 54.21  ? 736 HOH A O   1 
HETATM 2857 O O   . HOH D 4 .   ? 45.380 33.616 62.538  1.00 54.51  ? 737 HOH A O   1 
HETATM 2858 O O   . HOH D 4 .   ? 17.820 34.495 37.190  1.00 52.55  ? 738 HOH A O   1 
HETATM 2859 O O   . HOH D 4 .   ? 45.390 39.791 50.380  1.00 41.25  ? 739 HOH A O   1 
HETATM 2860 O O   . HOH D 4 .   ? 26.596 40.998 27.383  1.00 54.28  ? 740 HOH A O   1 
HETATM 2861 O O   . HOH D 4 .   ? 52.850 19.877 46.974  1.00 47.10  ? 741 HOH A O   1 
HETATM 2862 O O   . HOH D 4 .   ? 31.971 35.759 37.690  1.00 101.37 ? 742 HOH A O   1 
HETATM 2863 O O   . HOH D 4 .   ? 20.760 24.900 33.136  1.00 49.41  ? 743 HOH A O   1 
HETATM 2864 O O   . HOH D 4 .   ? 30.744 5.462  70.400  1.00 38.17  ? 744 HOH A O   1 
HETATM 2865 O O   . HOH D 4 .   ? 22.649 18.372 67.004  1.00 60.50  ? 745 HOH A O   1 
HETATM 2866 O O   . HOH D 4 .   ? 19.935 21.951 47.660  1.00 74.15  ? 746 HOH A O   1 
HETATM 2867 O O   . HOH D 4 .   ? 54.747 19.381 44.731  1.00 51.88  ? 747 HOH A O   1 
HETATM 2868 O O   . HOH D 4 .   ? 21.436 38.052 36.997  1.00 59.83  ? 748 HOH A O   1 
HETATM 2869 O O   . HOH D 4 .   ? 54.720 12.617 47.340  1.00 62.00  ? 749 HOH A O   1 
HETATM 2870 O O   . HOH D 4 .   ? 31.527 34.103 47.419  1.00 42.92  ? 750 HOH A O   1 
HETATM 2871 O O   . HOH D 4 .   ? 58.212 19.845 44.023  1.00 49.89  ? 751 HOH A O   1 
HETATM 2872 O O   . HOH D 4 .   ? 33.856 14.536 76.341  1.00 78.39  ? 752 HOH A O   1 
HETATM 2873 O O   . HOH D 4 .   ? 40.839 -3.984 44.023  1.00 76.82  ? 753 HOH A O   1 
HETATM 2874 O O   . HOH D 4 .   ? 17.566 22.995 34.763  1.00 55.27  ? 754 HOH A O   1 
HETATM 2875 O O   . HOH D 4 .   ? 46.634 24.761 26.574  1.00 60.85  ? 755 HOH A O   1 
HETATM 2876 O O   . HOH D 4 .   ? 35.564 17.648 27.531  1.00 65.38  ? 756 HOH A O   1 
HETATM 2877 O O   . HOH D 4 .   ? 40.170 2.069  34.384  1.00 66.49  ? 757 HOH A O   1 
HETATM 2878 O O   . HOH D 4 .   ? 42.841 19.825 56.361  1.00 26.45  ? 758 HOH A O   1 
HETATM 2879 O O   . HOH D 4 .   ? 33.487 13.153 34.635  1.00 27.12  ? 759 HOH A O   1 
HETATM 2880 O O   . HOH D 4 .   ? 48.269 16.974 55.885  1.00 52.03  ? 760 HOH A O   1 
HETATM 2881 O O   . HOH D 4 .   ? 39.860 11.007 56.078  1.00 45.50  ? 761 HOH A O   1 
HETATM 2882 O O   . HOH D 4 .   ? 26.944 28.586 54.754  1.00 47.37  ? 762 HOH A O   1 
HETATM 2883 O O   . HOH D 4 .   ? 34.968 34.430 46.803  1.00 48.52  ? 763 HOH A O   1 
HETATM 2884 O O   . HOH D 4 .   ? 40.219 13.744 56.416  1.00 46.20  ? 764 HOH A O   1 
HETATM 2885 O O   . HOH D 4 .   ? 49.105 32.983 57.910  1.00 48.69  ? 765 HOH A O   1 
HETATM 2886 O O   . HOH D 4 .   ? 23.205 33.756 60.663  1.00 44.99  ? 766 HOH A O   1 
HETATM 2887 O O   . HOH D 4 .   ? 55.813 8.221  52.160  1.00 62.49  ? 767 HOH A O   1 
HETATM 2888 O O   . HOH D 4 .   ? 46.235 0.229  39.622  1.00 49.34  ? 768 HOH A O   1 
HETATM 2889 O O   . HOH D 4 .   ? 27.219 4.065  36.685  1.00 51.63  ? 769 HOH A O   1 
HETATM 2890 O O   . HOH D 4 .   ? 44.203 3.822  46.124  1.00 42.22  ? 770 HOH A O   1 
HETATM 2891 O O   . HOH D 4 .   ? 28.161 40.538 35.406  1.00 56.72  ? 771 HOH A O   1 
HETATM 2892 O O   . HOH D 4 .   ? 24.961 36.792 43.111  1.00 57.73  ? 772 HOH A O   1 
HETATM 2893 O O   . HOH D 4 .   ? 29.026 5.977  37.724  1.00 79.67  ? 773 HOH A O   1 
HETATM 2894 O O   . HOH D 4 .   ? 43.858 13.681 54.498  1.00 48.06  ? 774 HOH A O   1 
HETATM 2895 O O   . HOH D 4 .   ? 16.904 21.783 38.380  1.00 82.85  ? 775 HOH A O   1 
HETATM 2896 O O   . HOH D 4 .   ? 38.602 -5.300 45.477  1.00 81.74  ? 776 HOH A O   1 
HETATM 2897 O O   . HOH D 4 .   ? 20.190 21.240 57.092  1.00 78.87  ? 777 HOH A O   1 
HETATM 2898 O O   . HOH D 4 .   ? 19.101 28.332 28.608  1.00 65.57  ? 778 HOH A O   1 
HETATM 2899 O O   . HOH D 4 .   ? 40.408 5.581  59.011  1.00 51.81  ? 779 HOH A O   1 
HETATM 2900 O O   . HOH D 4 .   ? 32.747 10.916 57.013  1.00 63.77  ? 780 HOH A O   1 
HETATM 2901 O O   . HOH D 4 .   ? 48.473 10.083 32.917  1.00 55.23  ? 781 HOH A O   1 
HETATM 2902 O O   . HOH D 4 .   ? 51.168 35.839 34.043  1.00 54.10  ? 782 HOH A O   1 
HETATM 2903 O O   . HOH D 4 .   ? 39.657 38.208 49.515  1.00 51.84  ? 783 HOH A O   1 
HETATM 2904 O O   . HOH D 4 .   ? 24.515 30.302 46.310  1.00 67.83  ? 784 HOH A O   1 
HETATM 2905 O O   . HOH D 4 .   ? 38.654 8.544  32.588  1.00 54.32  ? 785 HOH A O   1 
HETATM 2906 O O   . HOH D 4 .   ? 38.099 30.315 35.366  1.00 71.84  ? 786 HOH A O   1 
HETATM 2907 O O   . HOH D 4 .   ? 46.051 39.980 45.891  1.00 106.01 ? 787 HOH A O   1 
HETATM 2908 O O   . HOH D 4 .   ? 22.379 13.166 36.999  1.00 78.63  ? 788 HOH A O   1 
HETATM 2909 O O   . HOH D 4 .   ? 22.250 15.790 32.720  1.00 73.09  ? 789 HOH A O   1 
HETATM 2910 O O   . HOH D 4 .   ? 44.487 36.170 59.891  1.00 73.54  ? 790 HOH A O   1 
HETATM 2911 O O   . HOH D 4 .   ? 32.432 -3.864 44.145  1.00 49.67  ? 791 HOH A O   1 
HETATM 2912 O O   . HOH D 4 .   ? 27.472 25.523 27.026  1.00 56.14  ? 792 HOH A O   1 
HETATM 2913 O O   . HOH D 4 .   ? 48.487 38.759 39.765  1.00 62.67  ? 793 HOH A O   1 
HETATM 2914 O O   . HOH D 4 .   ? 50.856 16.997 33.516  1.00 69.98  ? 794 HOH A O   1 
HETATM 2915 O O   . HOH D 4 .   ? 15.439 22.892 59.174  1.00 58.42  ? 795 HOH A O   1 
HETATM 2916 O O   . HOH D 4 .   ? 45.337 42.455 47.436  1.00 60.79  ? 796 HOH A O   1 
HETATM 2917 O O   . HOH D 4 .   ? 31.717 -1.083 40.257  1.00 63.52  ? 797 HOH A O   1 
HETATM 2918 O O   . HOH D 4 .   ? 45.775 32.002 59.288  1.00 54.48  ? 798 HOH A O   1 
HETATM 2919 O O   . HOH D 4 .   ? 27.948 6.490  35.382  1.00 48.30  ? 799 HOH A O   1 
HETATM 2920 O O   . HOH D 4 .   ? 23.357 23.106 51.135  1.00 55.93  ? 800 HOH A O   1 
HETATM 2921 O O   . HOH D 4 .   ? 34.467 -1.666 39.666  1.00 54.44  ? 801 HOH A O   1 
HETATM 2922 O O   . HOH D 4 .   ? 31.649 13.088 30.667  1.00 94.18  ? 802 HOH A O   1 
HETATM 2923 O O   . HOH D 4 .   ? 40.527 8.088  55.593  1.00 48.68  ? 803 HOH A O   1 
HETATM 2924 O O   . HOH D 4 .   ? 30.682 21.284 29.647  1.00 51.23  ? 804 HOH A O   1 
HETATM 2925 O O   . HOH D 4 .   ? 32.387 14.873 61.653  1.00 50.51  ? 805 HOH A O   1 
HETATM 2926 O O   . HOH D 4 .   ? 22.439 32.536 25.231  1.00 51.64  ? 806 HOH A O   1 
HETATM 2927 O O   . HOH D 4 .   ? 50.796 4.323  40.222  1.00 56.82  ? 807 HOH A O   1 
HETATM 2928 O O   . HOH D 4 .   ? 22.140 16.636 30.058  1.00 105.97 ? 808 HOH A O   1 
HETATM 2929 O O   . HOH D 4 .   ? 47.690 12.641 32.770  1.00 73.47  ? 809 HOH A O   1 
HETATM 2930 O O   . HOH D 4 .   ? 22.872 15.229 40.416  1.00 86.80  ? 810 HOH A O   1 
HETATM 2931 O O   . HOH D 4 .   ? 18.050 17.144 67.150  1.00 59.68  ? 811 HOH A O   1 
HETATM 2932 O O   . HOH D 4 .   ? 34.833 12.848 30.562  1.00 53.45  ? 812 HOH A O   1 
HETATM 2933 O O   . HOH D 4 .   ? 47.938 33.952 28.351  1.00 92.71  ? 813 HOH A O   1 
HETATM 2934 O O   . HOH D 4 .   ? 27.004 22.668 30.079  1.00 81.60  ? 814 HOH A O   1 
HETATM 2935 O O   . HOH D 4 .   ? 23.965 40.472 43.763  1.00 91.19  ? 815 HOH A O   1 
HETATM 2936 O O   . HOH D 4 .   ? 20.105 35.033 34.433  1.00 56.86  ? 816 HOH A O   1 
HETATM 2937 O O   . HOH D 4 .   ? 49.418 40.471 37.190  1.00 88.82  ? 817 HOH A O   1 
HETATM 2938 O O   . HOH E 4 .   ? 37.106 35.755 69.183  1.00 10.45  ? 2   HOH B O   1 
HETATM 2939 O O   . HOH E 4 .   ? 25.132 24.724 75.728  1.00 26.39  ? 7   HOH B O   1 
HETATM 2940 O O   . HOH E 4 .   ? 42.972 29.022 64.435  1.00 25.80  ? 10  HOH B O   1 
HETATM 2941 O O   . HOH E 4 .   ? 21.911 48.433 67.409  1.00 33.86  ? 15  HOH B O   1 
HETATM 2942 O O   . HOH E 4 .   ? 25.966 39.497 63.073  1.00 31.92  ? 18  HOH B O   1 
HETATM 2943 O O   . HOH E 4 .   ? 21.811 48.904 72.330  1.00 26.42  ? 20  HOH B O   1 
HETATM 2944 O O   . HOH E 4 .   ? 18.209 43.992 77.192  1.00 32.65  ? 22  HOH B O   1 
HETATM 2945 O O   . HOH E 4 .   ? 45.502 42.483 79.545  1.00 44.90  ? 23  HOH B O   1 
HETATM 2946 O O   . HOH E 4 .   ? 20.502 45.518 62.776  1.00 30.74  ? 24  HOH B O   1 
HETATM 2947 O O   . HOH E 4 .   ? 24.060 36.715 66.017  1.00 32.56  ? 26  HOH B O   1 
HETATM 2948 O O   . HOH E 4 .   ? 34.041 39.433 60.421  1.00 34.53  ? 28  HOH B O   1 
HETATM 2949 O O   . HOH E 4 .   ? 28.481 39.530 61.558  1.00 29.24  ? 34  HOH B O   1 
HETATM 2950 O O   . HOH E 4 .   ? 20.702 30.389 68.816  1.00 24.29  ? 35  HOH B O   1 
HETATM 2951 O O   . HOH E 4 .   ? 32.001 21.086 73.831  1.00 30.57  ? 40  HOH B O   1 
HETATM 2952 O O   . HOH E 4 .   ? 47.813 34.353 84.831  1.00 25.84  ? 42  HOH B O   1 
HETATM 2953 O O   . HOH E 4 .   ? 43.876 39.887 65.923  1.00 37.56  ? 43  HOH B O   1 
HETATM 2954 O O   . HOH E 4 .   ? 35.705 52.547 79.647  1.00 38.78  ? 45  HOH B O   1 
HETATM 2955 O O   . HOH E 4 .   ? 34.647 31.335 93.316  1.00 33.75  ? 47  HOH B O   1 
HETATM 2956 O O   . HOH E 4 .   ? 15.100 43.176 61.823  1.00 41.33  ? 48  HOH B O   1 
HETATM 2957 O O   . HOH E 4 .   ? 20.864 31.049 73.087  1.00 32.05  ? 49  HOH B O   1 
HETATM 2958 O O   . HOH E 4 .   ? 26.956 30.133 84.635  1.00 43.57  ? 52  HOH B O   1 
HETATM 2959 O O   . HOH E 4 .   ? 18.590 46.508 65.989  1.00 33.65  ? 55  HOH B O   1 
HETATM 2960 O O   . HOH E 4 .   ? 26.360 52.584 59.838  1.00 35.36  ? 65  HOH B O   1 
HETATM 2961 O O   . HOH E 4 .   ? 38.493 18.869 62.810  1.00 40.88  ? 66  HOH B O   1 
HETATM 2962 O O   . HOH E 4 .   ? 37.523 52.087 65.930  1.00 40.71  ? 67  HOH B O   1 
HETATM 2963 O O   . HOH E 4 .   ? 23.093 41.151 87.194  1.00 39.67  ? 69  HOH B O   1 
HETATM 2964 O O   . HOH E 4 .   ? 14.411 41.870 65.192  1.00 29.51  ? 72  HOH B O   1 
HETATM 2965 O O   . HOH E 4 .   ? 40.665 49.749 89.293  1.00 53.53  ? 74  HOH B O   1 
HETATM 2966 O O   . HOH E 4 .   ? 32.989 47.796 83.889  1.00 34.16  ? 75  HOH B O   1 
HETATM 2967 O O   . HOH E 4 .   ? 16.660 49.859 65.588  1.00 29.22  ? 77  HOH B O   1 
HETATM 2968 O O   . HOH E 4 .   ? 23.826 27.297 77.308  1.00 32.76  ? 78  HOH B O   1 
HETATM 2969 O O   . HOH E 4 .   ? 19.123 29.919 66.598  1.00 36.91  ? 81  HOH B O   1 
HETATM 2970 O O   . HOH E 4 .   ? 37.158 46.284 92.861  1.00 37.28  ? 82  HOH B O   1 
HETATM 2971 O O   . HOH E 4 .   ? 23.872 31.843 85.458  1.00 38.08  ? 83  HOH B O   1 
HETATM 2972 O O   . HOH E 4 .   ? 35.819 41.072 56.811  1.00 41.33  ? 85  HOH B O   1 
HETATM 2973 O O   . HOH E 4 .   ? 15.233 44.832 67.367  1.00 50.15  ? 91  HOH B O   1 
HETATM 2974 O O   . HOH E 4 .   ? 41.209 50.374 68.960  1.00 34.03  ? 93  HOH B O   1 
HETATM 2975 O O   . HOH E 4 .   ? 46.915 38.329 69.501  1.00 37.84  ? 95  HOH B O   1 
HETATM 2976 O O   . HOH E 4 .   ? 46.705 45.152 71.575  1.00 46.17  ? 96  HOH B O   1 
HETATM 2977 O O   . HOH E 4 .   ? 34.625 22.458 82.163  1.00 46.27  ? 107 HOH B O   1 
HETATM 2978 O O   . HOH E 4 .   ? 42.038 26.282 77.698  1.00 50.06  ? 109 HOH B O   1 
HETATM 2979 O O   . HOH E 4 .   ? 18.320 31.704 69.940  1.00 40.39  ? 112 HOH B O   1 
HETATM 2980 O O   . HOH E 4 .   ? 17.939 32.258 63.525  1.00 47.60  ? 115 HOH B O   1 
HETATM 2981 O O   . HOH E 4 .   ? 42.839 36.593 90.420  1.00 39.99  ? 116 HOH B O   1 
HETATM 2982 O O   . HOH E 4 .   ? 18.764 40.894 85.036  1.00 67.33  ? 117 HOH B O   1 
HETATM 2983 O O   . HOH E 4 .   ? 22.210 35.091 63.040  1.00 34.06  ? 118 HOH B O   1 
HETATM 2984 O O   . HOH E 4 .   ? 31.790 42.903 91.706  1.00 47.94  ? 119 HOH B O   1 
HETATM 2985 O O   . HOH E 4 .   ? 48.266 44.299 79.610  1.00 57.12  ? 120 HOH B O   1 
HETATM 2986 O O   . HOH E 4 .   ? 39.804 47.472 91.076  1.00 54.32  ? 121 HOH B O   1 
HETATM 2987 O O   . HOH E 4 .   ? 24.303 47.404 61.005  1.00 38.64  ? 123 HOH B O   1 
HETATM 2988 O O   . HOH E 4 .   ? 38.273 44.108 92.155  1.00 44.75  ? 124 HOH B O   1 
HETATM 2989 O O   . HOH E 4 .   ? 29.419 55.936 76.317  1.00 43.59  ? 129 HOH B O   1 
HETATM 2990 O O   . HOH E 4 .   ? 28.514 45.228 58.861  1.00 44.67  ? 131 HOH B O   1 
HETATM 2991 O O   . HOH E 4 .   ? 16.191 46.399 60.964  1.00 35.73  ? 133 HOH B O   1 
HETATM 2992 O O   . HOH E 4 .   ? 41.775 37.003 62.732  1.00 52.36  ? 134 HOH B O   1 
HETATM 2993 O O   . HOH E 4 .   ? 43.587 17.447 68.464  1.00 35.10  ? 135 HOH B O   1 
HETATM 2994 O O   . HOH E 4 .   ? 15.121 43.535 75.403  1.00 51.41  ? 136 HOH B O   1 
HETATM 2995 O O   . HOH E 4 .   ? 34.873 30.524 83.881  1.00 27.59  ? 143 HOH B O   1 
HETATM 2996 O O   . HOH E 4 .   ? 44.962 36.066 86.093  1.00 40.30  ? 148 HOH B O   1 
HETATM 2997 O O   . HOH E 4 .   ? 36.907 21.561 74.750  1.00 34.60  ? 149 HOH B O   1 
HETATM 2998 O O   . HOH E 4 .   ? 34.713 25.460 83.030  1.00 32.77  ? 152 HOH B O   1 
HETATM 2999 O O   . HOH E 4 .   ? 28.358 51.881 68.058  1.00 39.71  ? 158 HOH B O   1 
HETATM 3000 O O   . HOH E 4 .   ? 45.453 35.846 88.815  1.00 71.97  ? 161 HOH B O   1 
HETATM 3001 O O   . HOH E 4 .   ? 20.757 28.289 70.636  1.00 32.42  ? 162 HOH B O   1 
HETATM 3002 O O   . HOH E 4 .   ? 44.275 45.029 64.835  1.00 41.76  ? 164 HOH B O   1 
HETATM 3003 O O   . HOH E 4 .   ? 49.619 25.899 75.599  1.00 40.05  ? 165 HOH B O   1 
HETATM 3004 O O   . HOH E 4 .   ? 36.313 13.472 67.756  1.00 52.14  ? 166 HOH B O   1 
HETATM 3005 O O   . HOH E 4 .   ? 40.483 39.639 57.755  1.00 50.92  ? 171 HOH B O   1 
HETATM 3006 O O   . HOH E 4 .   ? 35.243 28.287 85.835  1.00 58.43  ? 175 HOH B O   1 
HETATM 3007 O O   . HOH E 4 .   ? 33.003 45.943 81.777  1.00 40.22  ? 176 HOH B O   1 
HETATM 3008 O O   . HOH E 4 .   ? 20.056 36.835 59.830  1.00 52.50  ? 177 HOH B O   1 
HETATM 3009 O O   . HOH E 4 .   ? 18.786 32.821 72.618  1.00 54.67  ? 179 HOH B O   1 
HETATM 3010 O O   . HOH E 4 .   ? 28.642 24.699 84.340  1.00 62.10  ? 180 HOH B O   1 
HETATM 3011 O O   . HOH E 4 .   ? 22.405 28.717 86.254  1.00 54.40  ? 182 HOH B O   1 
HETATM 3012 O O   . HOH E 4 .   ? 37.956 45.615 59.939  1.00 40.01  ? 183 HOH B O   1 
HETATM 3013 O O   . HOH E 4 .   ? 44.587 26.029 75.433  1.00 47.93  ? 185 HOH B O   1 
HETATM 3014 O O   . HOH E 4 .   ? 40.550 20.495 72.754  1.00 54.60  ? 186 HOH B O   1 
HETATM 3015 O O   . HOH E 4 .   ? 34.709 48.004 60.618  1.00 44.47  ? 188 HOH B O   1 
HETATM 3016 O O   . HOH E 4 .   ? 36.531 13.873 60.701  1.00 53.98  ? 191 HOH B O   1 
HETATM 3017 O O   . HOH E 4 .   ? 31.080 22.885 83.576  1.00 47.14  ? 192 HOH B O   1 
HETATM 3018 O O   . HOH E 4 .   ? 14.178 48.730 65.290  1.00 38.93  ? 194 HOH B O   1 
HETATM 3019 O O   . HOH E 4 .   ? 49.058 31.212 65.857  1.00 61.69  ? 195 HOH B O   1 
HETATM 3020 O O   . HOH E 4 .   ? 36.889 27.045 82.150  1.00 54.60  ? 196 HOH B O   1 
HETATM 3021 O O   . HOH E 4 .   ? 26.520 21.006 77.467  1.00 49.43  ? 197 HOH B O   1 
HETATM 3022 O O   . HOH E 4 .   ? 25.172 27.459 87.885  1.00 58.33  ? 201 HOH B O   1 
HETATM 3023 O O   . HOH E 4 .   ? 18.396 24.094 68.848  1.00 52.01  ? 203 HOH B O   1 
HETATM 3024 O O   . HOH E 4 .   ? 26.715 22.818 80.293  1.00 46.49  ? 204 HOH B O   1 
HETATM 3025 O O   . HOH E 4 .   ? 36.842 11.834 65.123  1.00 48.32  ? 207 HOH B O   1 
HETATM 3026 O O   . HOH E 4 .   ? 18.839 49.196 63.954  1.00 45.27  ? 212 HOH B O   1 
HETATM 3027 O O   . HOH E 4 .   ? 27.830 28.037 83.254  1.00 27.91  ? 214 HOH B O   1 
HETATM 3028 O O   . HOH E 4 .   ? 49.956 45.882 76.300  1.00 70.20  ? 216 HOH B O   1 
HETATM 3029 O O   . HOH E 4 .   ? 31.810 42.156 96.520  1.00 40.51  ? 217 HOH B O   1 
HETATM 3030 O O   . HOH E 4 .   ? 37.234 18.813 72.580  1.00 76.90  ? 218 HOH B O   1 
HETATM 3031 O O   . HOH E 4 .   ? 47.448 20.398 70.080  1.00 49.47  ? 224 HOH B O   1 
HETATM 3032 O O   . HOH E 4 .   ? 24.593 24.383 79.388  1.00 50.68  ? 231 HOH B O   1 
HETATM 3033 O O   . HOH E 4 .   ? 48.918 49.171 75.694  1.00 77.01  ? 235 HOH B O   1 
HETATM 3034 O O   . HOH E 4 .   ? 38.657 46.054 57.473  1.00 82.62  ? 236 HOH B O   1 
HETATM 3035 O O   . HOH E 4 .   ? 23.619 28.427 83.187  1.00 63.09  ? 237 HOH B O   1 
HETATM 3036 O O   . HOH E 4 .   ? 34.804 34.912 98.345  1.00 52.26  ? 238 HOH B O   1 
HETATM 3037 O O   . HOH E 4 .   ? 48.578 36.538 83.687  1.00 24.43  ? 240 HOH B O   1 
HETATM 3038 O O   . HOH E 4 .   ? 37.982 32.435 91.039  1.00 58.62  ? 241 HOH B O   1 
HETATM 3039 O O   . HOH E 4 .   ? 16.357 45.321 64.145  1.00 40.84  ? 243 HOH B O   1 
HETATM 3040 O O   . HOH E 4 .   ? 36.223 42.395 92.359  1.00 46.28  ? 246 HOH B O   1 
HETATM 3041 O O   . HOH E 4 .   ? 31.937 47.850 59.366  1.00 50.14  ? 250 HOH B O   1 
HETATM 3042 O O   . HOH E 4 .   ? 20.976 29.935 60.464  1.00 46.77  ? 252 HOH B O   1 
HETATM 3043 O O   . HOH E 4 .   ? 36.360 44.566 57.867  1.00 63.95  ? 253 HOH B O   1 
HETATM 3044 O O   . HOH E 4 .   ? 31.784 52.454 67.810  1.00 55.98  ? 259 HOH B O   1 
HETATM 3045 O O   . HOH E 4 .   ? 46.192 40.832 90.530  1.00 68.24  ? 264 HOH B O   1 
HETATM 3046 O O   . HOH E 4 .   ? 31.278 45.545 97.652  1.00 52.60  ? 265 HOH B O   1 
HETATM 3047 O O   . HOH E 4 .   ? 34.666 51.149 87.502  1.00 59.50  ? 268 HOH B O   1 
HETATM 3048 O O   . HOH E 4 .   ? 14.622 49.406 67.938  1.00 43.37  ? 269 HOH B O   1 
HETATM 3049 O O   . HOH E 4 .   ? 29.070 21.522 80.841  1.00 47.86  ? 270 HOH B O   1 
HETATM 3050 O O   . HOH E 4 .   ? 42.441 45.948 58.373  1.00 54.96  ? 271 HOH B O   1 
HETATM 3051 O O   . HOH E 4 .   ? 39.733 22.584 77.203  1.00 93.51  ? 276 HOH B O   1 
HETATM 3052 O O   . HOH E 4 .   ? 31.921 41.244 100.502 1.00 66.04  ? 277 HOH B O   1 
HETATM 3053 O O   . HOH E 4 .   ? 46.619 49.581 69.477  1.00 49.31  ? 278 HOH B O   1 
HETATM 3054 O O   . HOH E 4 .   ? 23.587 38.705 60.902  1.00 52.92  ? 283 HOH B O   1 
HETATM 3055 O O   . HOH E 4 .   ? 40.031 25.465 83.668  1.00 57.48  ? 287 HOH B O   1 
HETATM 3056 O O   . HOH E 4 .   ? 34.380 47.044 94.653  1.00 59.34  ? 288 HOH B O   1 
HETATM 3057 O O   . HOH E 4 .   ? 40.116 44.582 90.330  1.00 65.24  ? 292 HOH B O   1 
HETATM 3058 O O   . HOH E 4 .   ? 45.512 26.488 63.255  1.00 50.55  ? 294 HOH B O   1 
HETATM 3059 O O   . HOH E 4 .   ? 38.229 54.442 82.609  1.00 60.04  ? 295 HOH B O   1 
HETATM 3060 O O   . HOH E 4 .   ? 48.109 21.234 72.901  1.00 59.28  ? 299 HOH B O   1 
HETATM 3061 O O   . HOH E 4 .   ? 44.437 25.511 71.038  1.00 41.64  ? 303 HOH B O   1 
HETATM 3062 O O   . HOH E 4 .   ? 41.811 36.326 93.146  1.00 47.88  ? 304 HOH B O   1 
HETATM 3063 O O   . HOH E 4 .   ? 41.663 38.695 60.554  1.00 61.45  ? 311 HOH B O   1 
HETATM 3064 O O   . HOH E 4 .   ? 36.412 24.084 81.173  1.00 62.18  ? 313 HOH B O   1 
HETATM 3065 O O   . HOH E 4 .   ? 50.658 26.093 65.998  1.00 46.79  ? 321 HOH B O   1 
HETATM 3066 O O   . HOH E 4 .   ? 30.202 52.046 65.323  1.00 49.75  ? 322 HOH B O   1 
HETATM 3067 O O   . HOH E 4 .   ? 48.525 39.881 86.773  1.00 46.75  ? 325 HOH B O   1 
HETATM 3068 O O   . HOH E 4 .   ? 46.352 30.143 65.181  1.00 76.48  ? 328 HOH B O   1 
HETATM 3069 O O   . HOH E 4 .   ? 17.923 31.814 60.889  1.00 123.55 ? 330 HOH B O   1 
HETATM 3070 O O   . HOH E 4 .   ? 35.523 37.386 98.764  1.00 57.14  ? 331 HOH B O   1 
HETATM 3071 O O   . HOH E 4 .   ? 40.730 49.977 82.767  1.00 62.55  ? 334 HOH B O   1 
HETATM 3072 O O   . HOH E 4 .   ? 26.046 37.747 59.305  1.00 105.67 ? 335 HOH B O   1 
HETATM 3073 O O   . HOH E 4 .   ? 11.619 37.019 67.405  1.00 71.18  ? 338 HOH B O   1 
HETATM 3074 O O   . HOH E 4 .   ? 50.121 38.896 84.299  1.00 57.47  ? 342 HOH B O   1 
HETATM 3075 O O   . HOH E 4 .   ? 49.468 39.729 67.972  1.00 54.47  ? 344 HOH B O   1 
HETATM 3076 O O   . HOH E 4 .   ? 21.930 25.552 80.103  1.00 48.31  ? 346 HOH B O   1 
HETATM 3077 O O   . HOH E 4 .   ? 13.981 38.818 71.996  1.00 79.32  ? 349 HOH B O   1 
HETATM 3078 O O   . HOH E 4 .   ? 50.231 43.173 87.154  1.00 57.65  ? 351 HOH B O   1 
HETATM 3079 O O   . HOH E 4 .   ? 25.163 25.955 84.576  1.00 76.01  ? 354 HOH B O   1 
HETATM 3080 O O   . HOH E 4 .   ? 34.448 42.185 95.648  1.00 52.30  ? 360 HOH B O   1 
HETATM 3081 O O   . HOH E 4 .   ? 14.592 29.581 64.490  1.00 78.03  ? 366 HOH B O   1 
HETATM 3082 O O   . HOH E 4 .   ? 15.349 31.231 61.429  1.00 54.55  ? 373 HOH B O   1 
HETATM 3083 O O   . HOH E 4 .   ? 43.243 15.437 64.878  1.00 56.66  ? 376 HOH B O   1 
HETATM 3084 O O   . HOH E 4 .   ? 33.481 48.348 86.489  1.00 69.62  ? 380 HOH B O   1 
HETATM 3085 O O   . HOH E 4 .   ? 39.625 42.105 56.042  1.00 62.65  ? 382 HOH B O   1 
HETATM 3086 O O   . HOH E 4 .   ? 39.056 16.110 61.526  1.00 89.09  ? 385 HOH B O   1 
HETATM 3087 O O   . HOH E 4 .   ? 41.100 14.079 63.995  1.00 65.13  ? 386 HOH B O   1 
HETATM 3088 O O   . HOH E 4 .   ? 50.316 46.577 85.262  1.00 69.39  ? 388 HOH B O   1 
HETATM 3089 O O   . HOH F 4 .   ? 25.427 54.064 75.878  1.00 25.76  ? 16  HOH E O   1 
HETATM 3090 O O   . HOH F 4 .   ? 23.420 52.892 85.660  1.00 39.59  ? 19  HOH E O   1 
HETATM 3091 O O   . HOH F 4 .   ? 26.679 49.887 82.819  1.00 30.61  ? 29  HOH E O   1 
HETATM 3092 O O   . HOH F 4 .   ? 31.403 50.124 82.848  1.00 35.33  ? 62  HOH E O   1 
HETATM 3093 O O   . HOH F 4 .   ? 27.990 53.779 76.044  1.00 35.81  ? 64  HOH E O   1 
HETATM 3094 O O   . HOH F 4 .   ? 24.997 56.403 74.082  1.00 40.57  ? 146 HOH E O   1 
HETATM 3095 O O   . HOH F 4 .   ? 26.908 51.703 84.923  1.00 52.81  ? 229 HOH E O   1 
HETATM 3096 O O   . HOH F 4 .   ? 29.152 49.788 81.203  1.00 33.90  ? 316 HOH E O   1 
HETATM 3097 O O   . HOH F 4 .   ? 26.776 53.298 81.657  1.00 56.43  ? 333 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   372 ?   ?   ?   A . n 
A 1 2   THR 2   373 ?   ?   ?   A . n 
A 1 3   PRO 3   374 ?   ?   ?   A . n 
A 1 4   VAL 4   375 ?   ?   ?   A . n 
A 1 5   ARG 5   376 ?   ?   ?   A . n 
A 1 6   THR 6   377 ?   ?   ?   A . n 
A 1 7   VAL 7   378 ?   ?   ?   A . n 
A 1 8   MET 8   379 ?   ?   ?   A . n 
A 1 9   ASN 9   380 380 ASN ASN A . n 
A 1 10  THR 10  381 381 THR THR A . n 
A 1 11  ILE 11  382 382 ILE ILE A . n 
A 1 12  GLN 12  383 383 GLN GLN A . n 
A 1 13  GLN 13  384 384 GLN GLN A . n 
A 1 14  LEU 14  385 385 LEU LEU A . n 
A 1 15  MET 15  386 386 MET MET A . n 
A 1 16  MET 16  387 387 MET MET A . n 
A 1 17  ILE 17  388 388 ILE ILE A . n 
A 1 18  LEU 18  389 389 LEU LEU A . n 
A 1 19  ASN 19  390 390 ASN ASN A . n 
A 1 20  SER 20  391 391 SER SER A . n 
A 1 21  ALA 21  392 392 ALA ALA A . n 
A 1 22  SER 22  393 393 SER SER A . n 
A 1 23  ASP 23  394 394 ASP ASP A . n 
A 1 24  GLN 24  395 395 GLN GLN A . n 
A 1 25  PRO 25  396 396 PRO PRO A . n 
A 1 26  SER 26  397 397 SER SER A . n 
A 1 27  GLU 27  398 398 GLU GLU A . n 
A 1 28  ASN 28  399 399 ASN ASN A . n 
A 1 29  LEU 29  400 400 LEU LEU A . n 
A 1 30  ILE 30  401 401 ILE ILE A . n 
A 1 31  SER 31  402 402 SER SER A . n 
A 1 32  TYR 32  403 403 TYR TYR A . n 
A 1 33  PHE 33  404 404 PHE PHE A . n 
A 1 34  ASN 34  405 405 ASN ASN A . n 
A 1 35  ASN 35  406 406 ASN ASN A . n 
A 1 36  CYS 36  407 407 CYS CYS A . n 
A 1 37  THR 37  408 408 THR THR A . n 
A 1 38  VAL 38  409 409 VAL VAL A . n 
A 1 39  ASN 39  410 410 ASN ASN A . n 
A 1 40  PRO 40  411 411 PRO PRO A . n 
A 1 41  LYS 41  412 412 LYS LYS A . n 
A 1 42  GLU 42  413 413 GLU GLU A . n 
A 1 43  SER 43  414 414 SER SER A . n 
A 1 44  ILE 44  415 415 ILE ILE A . n 
A 1 45  LEU 45  416 416 LEU LEU A . n 
A 1 46  LYS 46  417 417 LYS LYS A . n 
A 1 47  ARG 47  418 418 ARG ARG A . n 
A 1 48  VAL 48  419 419 VAL VAL A . n 
A 1 49  LYS 49  420 420 LYS LYS A . n 
A 1 50  ASP 50  421 421 ASP ASP A . n 
A 1 51  ILE 51  422 422 ILE ILE A . n 
A 1 52  GLY 52  423 423 GLY GLY A . n 
A 1 53  TYR 53  424 424 TYR TYR A . n 
A 1 54  ILE 54  425 425 ILE ILE A . n 
A 1 55  PHE 55  426 426 PHE PHE A . n 
A 1 56  LYS 56  427 427 LYS LYS A . n 
A 1 57  GLU 57  428 428 GLU GLU A . n 
A 1 58  LYS 58  429 429 LYS LYS A . n 
A 1 59  PHE 59  430 430 PHE PHE A . n 
A 1 60  ALA 60  431 431 ALA ALA A . n 
A 1 61  LYS 61  432 432 LYS LYS A . n 
A 1 62  ALA 62  433 433 ALA ALA A . n 
A 1 63  VAL 63  434 434 VAL VAL A . n 
A 1 64  GLY 64  435 435 GLY GLY A . n 
A 1 65  GLN 65  436 436 GLN GLN A . n 
A 1 66  GLY 66  437 437 GLY GLY A . n 
A 1 67  CYS 67  438 438 CYS CYS A . n 
A 1 68  VAL 68  439 439 VAL VAL A . n 
A 1 69  GLU 69  440 440 GLU GLU A . n 
A 1 70  ILE 70  441 441 ILE ILE A . n 
A 1 71  GLY 71  442 442 GLY GLY A . n 
A 1 72  SER 72  443 443 SER SER A . n 
A 1 73  GLN 73  444 444 GLN GLN A . n 
A 1 74  ARG 74  445 445 ARG ARG A . n 
A 1 75  TYR 75  446 446 TYR TYR A . n 
A 1 76  LYS 76  447 447 LYS LYS A . n 
A 1 77  LEU 77  448 448 LEU LEU A . n 
A 1 78  GLY 78  449 449 GLY GLY A . n 
A 1 79  VAL 79  450 450 VAL VAL A . n 
A 1 80  ARG 80  451 451 ARG ARG A . n 
A 1 81  LEU 81  452 452 LEU LEU A . n 
A 1 82  TYR 82  453 453 TYR TYR A . n 
A 1 83  TYR 83  454 454 TYR TYR A . n 
A 1 84  ARG 84  455 455 ARG ARG A . n 
A 1 85  VAL 85  456 456 VAL VAL A . n 
A 1 86  MET 86  457 457 MET MET A . n 
A 1 87  GLU 87  458 458 GLU GLU A . n 
A 1 88  SER 88  459 459 SER SER A . n 
A 1 89  MET 89  460 460 MET MET A . n 
A 1 90  LEU 90  461 461 LEU LEU A . n 
A 1 91  LYS 91  462 462 LYS LYS A . n 
A 1 92  SER 92  463 463 SER SER A . n 
A 1 93  GLU 93  464 464 GLU GLU A . n 
A 1 94  GLU 94  465 ?   ?   ?   A . n 
A 1 95  GLU 95  466 ?   ?   ?   A . n 
A 1 96  ARG 96  467 ?   ?   ?   A . n 
A 1 97  LEU 97  468 ?   ?   ?   A . n 
A 1 98  SER 98  469 ?   ?   ?   A . n 
A 1 99  ILE 99  470 ?   ?   ?   A . n 
A 1 100 GLN 100 471 ?   ?   ?   A . n 
A 1 101 ASN 101 472 472 ASN ASN A . n 
A 1 102 PHE 102 473 473 PHE PHE A . n 
A 1 103 SER 103 474 474 SER SER A . n 
A 1 104 LYS 104 475 475 LYS LYS A . n 
A 1 105 LEU 105 476 476 LEU LEU A . n 
A 1 106 LEU 106 477 477 LEU LEU A . n 
A 1 107 ASN 107 478 478 ASN ASN A . n 
A 1 108 ASP 108 479 479 ASP ASP A . n 
A 1 109 ASN 109 480 480 ASN ASN A . n 
A 1 110 ILE 110 481 481 ILE ILE A . n 
A 1 111 PHE 111 482 482 PHE PHE A . n 
A 1 112 HIS 112 483 483 HIS HIS A . n 
A 1 113 MET 113 484 484 MET MET A . n 
A 1 114 SER 114 485 485 SER SER A . n 
A 1 115 LEU 115 486 486 LEU LEU A . n 
A 1 116 LEU 116 487 487 LEU LEU A . n 
A 1 117 ALA 117 488 488 ALA ALA A . n 
A 1 118 CYS 118 489 489 CYS CYS A . n 
A 1 119 ALA 119 490 490 ALA ALA A . n 
A 1 120 LEU 120 491 491 LEU LEU A . n 
A 1 121 GLU 121 492 492 GLU GLU A . n 
A 1 122 VAL 122 493 493 VAL VAL A . n 
A 1 123 VAL 123 494 494 VAL VAL A . n 
A 1 124 MET 124 495 495 MET MET A . n 
A 1 125 ALA 125 496 496 ALA ALA A . n 
A 1 126 THR 126 497 497 THR THR A . n 
A 1 127 TYR 127 498 498 TYR TYR A . n 
A 1 128 SER 128 499 499 SER SER A . n 
A 1 129 ARG 129 500 ?   ?   ?   A . n 
A 1 130 SER 130 501 ?   ?   ?   A . n 
A 1 131 THR 131 502 ?   ?   ?   A . n 
A 1 132 SER 132 503 ?   ?   ?   A . n 
A 1 133 GLN 133 504 ?   ?   ?   A . n 
A 1 134 ASN 134 505 ?   ?   ?   A . n 
A 1 135 LEU 135 506 ?   ?   ?   A . n 
A 1 136 ASP 136 507 ?   ?   ?   A . n 
A 1 137 SER 137 508 ?   ?   ?   A . n 
A 1 138 GLY 138 509 ?   ?   ?   A . n 
A 1 139 THR 139 510 ?   ?   ?   A . n 
A 1 140 ASP 140 511 ?   ?   ?   A . n 
A 1 141 LEU 141 512 ?   ?   ?   A . n 
A 1 142 SER 142 513 ?   ?   ?   A . n 
A 1 143 PHE 143 514 514 PHE PHE A . n 
A 1 144 PRO 144 515 515 PRO PRO A . n 
A 1 145 TRP 145 516 516 TRP TRP A . n 
A 1 146 ILE 146 517 517 ILE ILE A . n 
A 1 147 LEU 147 518 518 LEU LEU A . n 
A 1 148 ASN 148 519 519 ASN ASN A . n 
A 1 149 VAL 149 520 520 VAL VAL A . n 
A 1 150 LEU 150 521 521 LEU LEU A . n 
A 1 151 ASN 151 522 522 ASN ASN A . n 
A 1 152 LEU 152 523 523 LEU LEU A . n 
A 1 153 LYS 153 524 524 LYS LYS A . n 
A 1 154 ALA 154 525 525 ALA ALA A . n 
A 1 155 PHE 155 526 526 PHE PHE A . n 
A 1 156 ASP 156 527 527 ASP ASP A . n 
A 1 157 PHE 157 528 528 PHE PHE A . n 
A 1 158 TYR 158 529 529 TYR TYR A . n 
A 1 159 LYS 159 530 530 LYS LYS A . n 
A 1 160 VAL 160 531 531 VAL VAL A . n 
A 1 161 ILE 161 532 532 ILE ILE A . n 
A 1 162 GLU 162 533 533 GLU GLU A . n 
A 1 163 SER 163 534 534 SER SER A . n 
A 1 164 PHE 164 535 535 PHE PHE A . n 
A 1 165 ILE 165 536 536 ILE ILE A . n 
A 1 166 LYS 166 537 537 LYS LYS A . n 
A 1 167 ALA 167 538 538 ALA ALA A . n 
A 1 168 GLU 168 539 539 GLU GLU A . n 
A 1 169 GLY 169 540 540 GLY GLY A . n 
A 1 170 ASN 170 541 541 ASN ASN A . n 
A 1 171 LEU 171 542 542 LEU LEU A . n 
A 1 172 THR 172 543 543 THR THR A . n 
A 1 173 ARG 173 544 544 ARG ARG A . n 
A 1 174 GLU 174 545 545 GLU GLU A . n 
A 1 175 MET 175 546 546 MET MET A . n 
A 1 176 ILE 176 547 547 ILE ILE A . n 
A 1 177 LYS 177 548 548 LYS LYS A . n 
A 1 178 HIS 178 549 549 HIS HIS A . n 
A 1 179 LEU 179 550 550 LEU LEU A . n 
A 1 180 GLU 180 551 551 GLU GLU A . n 
A 1 181 ARG 181 552 552 ARG ARG A . n 
A 1 182 CYS 182 553 553 CYS CYS A . n 
A 1 183 GLU 183 554 554 GLU GLU A . n 
A 1 184 HIS 184 555 555 HIS HIS A . n 
A 1 185 ARG 185 556 556 ARG ARG A . n 
A 1 186 ILE 186 557 557 ILE ILE A . n 
A 1 187 MET 187 558 558 MET MET A . n 
A 1 188 GLU 188 559 559 GLU GLU A . n 
A 1 189 SER 189 560 560 SER SER A . n 
A 1 190 LEU 190 561 561 LEU LEU A . n 
A 1 191 ALA 191 562 562 ALA ALA A . n 
A 1 192 TRP 192 563 563 TRP TRP A . n 
A 1 193 LEU 193 564 564 LEU LEU A . n 
A 1 194 SER 194 565 565 SER SER A . n 
A 1 195 ASP 195 566 566 ASP ASP A . n 
A 1 196 SER 196 567 567 SER SER A . n 
A 1 197 PRO 197 568 568 PRO PRO A . n 
A 1 198 LEU 198 569 569 LEU LEU A . n 
A 1 199 PHE 199 570 570 PHE PHE A . n 
A 1 200 ASP 200 571 571 ASP ASP A . n 
A 1 201 LEU 201 572 572 LEU LEU A . n 
A 1 202 ILE 202 573 573 ILE ILE A . n 
A 1 203 LYS 203 574 574 LYS LYS A . n 
A 1 204 GLN 204 575 575 GLN GLN A . n 
A 1 205 SER 205 576 576 SER SER A . n 
A 1 206 LYS 206 577 577 LYS LYS A . n 
A 1 207 ASP 207 578 ?   ?   ?   A . n 
A 1 208 ARG 208 579 ?   ?   ?   A . n 
A 1 209 GLU 209 580 ?   ?   ?   A . n 
A 1 210 GLY 210 581 ?   ?   ?   A . n 
A 1 211 PRO 211 582 ?   ?   ?   A . n 
A 1 212 THR 212 583 ?   ?   ?   A . n 
A 1 213 ASP 213 584 ?   ?   ?   A . n 
A 1 214 HIS 214 585 ?   ?   ?   A . n 
A 1 215 LEU 215 586 ?   ?   ?   A . n 
A 1 216 GLU 216 587 ?   ?   ?   A . n 
A 1 217 SER 217 588 ?   ?   ?   A . n 
A 1 218 ALA 218 589 ?   ?   ?   A . n 
B 2 1   PHE 1   636 ?   ?   ?   B . n 
B 2 2   GLN 2   637 ?   ?   ?   B . n 
B 2 3   THR 3   638 ?   ?   ?   B . n 
B 2 4   GLN 4   639 ?   ?   ?   B . n 
B 2 5   LYS 5   640 ?   ?   ?   B . n 
B 2 6   PRO 6   641 ?   ?   ?   B . n 
B 2 7   LEU 7   642 ?   ?   ?   B . n 
B 2 8   LYS 8   643 ?   ?   ?   B . n 
B 2 9   SER 9   644 ?   ?   ?   B . n 
B 2 10  THR 10  645 645 THR THR B . n 
B 2 11  SER 11  646 646 SER SER B . n 
B 2 12  LEU 12  647 647 LEU LEU B . n 
B 2 13  SER 13  648 648 SER SER B . n 
B 2 14  LEU 14  649 649 LEU LEU B . n 
B 2 15  PHE 15  650 650 PHE PHE B . n 
B 2 16  TYR 16  651 651 TYR TYR B . n 
B 2 17  LYS 17  652 652 LYS LYS B . n 
B 2 18  LYS 18  653 653 LYS LYS B . n 
B 2 19  VAL 19  654 654 VAL VAL B . n 
B 2 20  TYR 20  655 655 TYR TYR B . n 
B 2 21  ARG 21  656 656 ARG ARG B . n 
B 2 22  LEU 22  657 657 LEU LEU B . n 
B 2 23  ALA 23  658 658 ALA ALA B . n 
B 2 24  TYR 24  659 659 TYR TYR B . n 
B 2 25  LEU 25  660 660 LEU LEU B . n 
B 2 26  ARG 26  661 661 ARG ARG B . n 
B 2 27  LEU 27  662 662 LEU LEU B . n 
B 2 28  ASN 28  663 663 ASN ASN B . n 
B 2 29  THR 29  664 664 THR THR B . n 
B 2 30  LEU 30  665 665 LEU LEU B . n 
B 2 31  CYS 31  666 666 CYS CYS B . n 
B 2 32  GLU 32  667 667 GLU GLU B . n 
B 2 33  ARG 33  668 668 ARG ARG B . n 
B 2 34  LEU 34  669 669 LEU LEU B . n 
B 2 35  LEU 35  670 670 LEU LEU B . n 
B 2 36  SER 36  671 671 SER SER B . n 
B 2 37  GLU 37  672 672 GLU GLU B . n 
B 2 38  HIS 38  673 673 HIS HIS B . n 
B 2 39  PRO 39  674 674 PRO PRO B . n 
B 2 40  GLU 40  675 675 GLU GLU B . n 
B 2 41  LEU 41  676 676 LEU LEU B . n 
B 2 42  GLU 42  677 677 GLU GLU B . n 
B 2 43  HIS 43  678 678 HIS HIS B . n 
B 2 44  ILE 44  679 679 ILE ILE B . n 
B 2 45  ILE 45  680 680 ILE ILE B . n 
B 2 46  TRP 46  681 681 TRP TRP B . n 
B 2 47  THR 47  682 682 THR THR B . n 
B 2 48  LEU 48  683 683 LEU LEU B . n 
B 2 49  PHE 49  684 684 PHE PHE B . n 
B 2 50  GLN 50  685 685 GLN GLN B . n 
B 2 51  HIS 51  686 686 HIS HIS B . n 
B 2 52  THR 52  687 687 THR THR B . n 
B 2 53  LEU 53  688 688 LEU LEU B . n 
B 2 54  GLN 54  689 689 GLN GLN B . n 
B 2 55  ASN 55  690 690 ASN ASN B . n 
B 2 56  GLU 56  691 691 GLU GLU B . n 
B 2 57  TYR 57  692 692 TYR TYR B . n 
B 2 58  GLU 58  693 693 GLU GLU B . n 
B 2 59  LEU 59  694 694 LEU LEU B . n 
B 2 60  MET 60  695 695 MET MET B . n 
B 2 61  ARG 61  696 696 ARG ARG B . n 
B 2 62  ASP 62  697 697 ASP ASP B . n 
B 2 63  ARG 63  698 698 ARG ARG B . n 
B 2 64  HIS 64  699 699 HIS HIS B . n 
B 2 65  LEU 65  700 700 LEU LEU B . n 
B 2 66  ASP 66  701 701 ASP ASP B . n 
B 2 67  GLN 67  702 702 GLN GLN B . n 
B 2 68  ILE 68  703 703 ILE ILE B . n 
B 2 69  MET 69  704 704 MET MET B . n 
B 2 70  MET 70  705 705 MET MET B . n 
B 2 71  CYS 71  706 706 CYS CYS B . n 
B 2 72  SER 72  707 707 SER SER B . n 
B 2 73  MET 73  708 708 MET MET B . n 
B 2 74  TYR 74  709 709 TYR TYR B . n 
B 2 75  GLY 75  710 710 GLY GLY B . n 
B 2 76  ILE 76  711 711 ILE ILE B . n 
B 2 77  CYS 77  712 712 CYS CYS B . n 
B 2 78  LYS 78  713 713 LYS LYS B . n 
B 2 79  VAL 79  714 714 VAL VAL B . n 
B 2 80  LYS 80  715 715 LYS LYS B . n 
B 2 81  ASN 81  716 716 ASN ASN B . n 
B 2 82  ILE 82  717 717 ILE ILE B . n 
B 2 83  ASP 83  718 718 ASP ASP B . n 
B 2 84  LEU 84  719 719 LEU LEU B . n 
B 2 85  LYS 85  720 720 LYS LYS B . n 
B 2 86  PHE 86  721 721 PHE PHE B . n 
B 2 87  LYS 87  722 722 LYS LYS B . n 
B 2 88  ILE 88  723 723 ILE ILE B . n 
B 2 89  ILE 89  724 724 ILE ILE B . n 
B 2 90  VAL 90  725 725 VAL VAL B . n 
B 2 91  THR 91  726 726 THR THR B . n 
B 2 92  ALA 92  727 727 ALA ALA B . n 
B 2 93  TYR 93  728 728 TYR TYR B . n 
B 2 94  LYS 94  729 729 LYS LYS B . n 
B 2 95  ASP 95  730 730 ASP ASP B . n 
B 2 96  LEU 96  731 731 LEU LEU B . n 
B 2 97  PRO 97  732 732 PRO PRO B . n 
B 2 98  HIS 98  733 733 HIS HIS B . n 
B 2 99  ALA 99  734 734 ALA ALA B . n 
B 2 100 VAL 100 735 735 VAL VAL B . n 
B 2 101 GLN 101 736 736 GLN GLN B . n 
B 2 102 GLU 102 737 737 GLU GLU B . n 
B 2 103 THR 103 738 738 THR THR B . n 
B 2 104 PHE 104 739 739 PHE PHE B . n 
B 2 105 LYS 105 740 740 LYS LYS B . n 
B 2 106 ARG 106 741 741 ARG ARG B . n 
B 2 107 VAL 107 742 742 VAL VAL B . n 
B 2 108 LEU 108 743 743 LEU LEU B . n 
B 2 109 ILE 109 744 744 ILE ILE B . n 
B 2 110 LYS 110 745 745 LYS LYS B . n 
B 2 111 GLU 111 746 746 GLU GLU B . n 
B 2 112 GLU 112 747 747 GLU GLU B . n 
B 2 113 GLU 113 748 748 GLU GLU B . n 
B 2 114 TYR 114 749 749 TYR TYR B . n 
B 2 115 ASP 115 750 750 ASP ASP B . n 
B 2 116 SER 116 751 751 SER SER B . n 
B 2 117 ILE 117 752 752 ILE ILE B . n 
B 2 118 ILE 118 753 753 ILE ILE B . n 
B 2 119 VAL 119 754 754 VAL VAL B . n 
B 2 120 PHE 120 755 755 PHE PHE B . n 
B 2 121 TYR 121 756 756 TYR TYR B . n 
B 2 122 ASN 122 757 757 ASN ASN B . n 
B 2 123 SER 123 758 758 SER SER B . n 
B 2 124 VAL 124 759 759 VAL VAL B . n 
B 2 125 PHE 125 760 760 PHE PHE B . n 
B 2 126 MET 126 761 761 MET MET B . n 
B 2 127 GLN 127 762 762 GLN GLN B . n 
B 2 128 ARG 128 763 763 ARG ARG B . n 
B 2 129 LEU 129 764 764 LEU LEU B . n 
B 2 130 LYS 130 765 765 LYS LYS B . n 
B 2 131 THR 131 766 766 THR THR B . n 
B 2 132 ASN 132 767 767 ASN ASN B . n 
B 2 133 ILE 133 768 768 ILE ILE B . n 
B 2 134 LEU 134 769 769 LEU LEU B . n 
B 2 135 GLN 135 770 770 GLN GLN B . n 
B 2 136 TYR 136 771 771 TYR TYR B . n 
B 2 137 ALA 137 772 772 ALA ALA B . n 
B 2 138 SER 138 773 773 SER SER B . n 
B 2 139 THR 139 774 774 THR THR B . n 
B 2 140 ARG 140 775 775 ARG ARG B . n 
B 2 141 PRO 141 776 776 PRO PRO B . n 
B 2 142 PRO 142 777 777 PRO PRO B . n 
B 2 143 THR 143 778 778 THR THR B . n 
B 2 144 LEU 144 779 779 LEU LEU B . n 
B 2 145 SER 145 780 780 SER SER B . n 
B 2 146 PRO 146 781 781 PRO PRO B . n 
B 2 147 ILE 147 782 782 ILE ILE B . n 
B 2 148 PRO 148 783 783 PRO PRO B . n 
B 2 149 HIS 149 784 784 HIS HIS B . n 
B 2 150 ILE 150 785 785 ILE ILE B . n 
B 2 151 PRO 151 786 ?   ?   ?   B . n 
B 2 152 ARG 152 787 ?   ?   ?   B . n 
C 3 1   ASP 1   1   1   ASP ASP E . n 
C 3 2   LEU 2   2   2   LEU LEU E . n 
C 3 3   TYR 3   3   3   TYR TYR E . n 
C 3 4   CYS 4   4   4   CYS CYS E . n 
C 3 5   TYR 5   5   5   TYR TYR E . n 
C 3 6   GLU 6   6   6   GLU GLU E . n 
C 3 7   GLN 7   7   7   GLN GLN E . n 
C 3 8   LEU 8   8   8   LEU LEU E . n 
C 3 9   ASN 9   9   9   ASN ASN E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   590 1   HOH HOH A . 
D 4 HOH 2   591 3   HOH HOH A . 
D 4 HOH 3   592 4   HOH HOH A . 
D 4 HOH 4   593 5   HOH HOH A . 
D 4 HOH 5   594 6   HOH HOH A . 
D 4 HOH 6   595 8   HOH HOH A . 
D 4 HOH 7   596 9   HOH HOH A . 
D 4 HOH 8   597 11  HOH HOH A . 
D 4 HOH 9   598 12  HOH HOH A . 
D 4 HOH 10  599 13  HOH HOH A . 
D 4 HOH 11  600 14  HOH HOH A . 
D 4 HOH 12  601 17  HOH HOH A . 
D 4 HOH 13  602 21  HOH HOH A . 
D 4 HOH 14  603 25  HOH HOH A . 
D 4 HOH 15  604 27  HOH HOH A . 
D 4 HOH 16  605 30  HOH HOH A . 
D 4 HOH 17  606 31  HOH HOH A . 
D 4 HOH 18  607 32  HOH HOH A . 
D 4 HOH 19  608 33  HOH HOH A . 
D 4 HOH 20  609 36  HOH HOH A . 
D 4 HOH 21  610 37  HOH HOH A . 
D 4 HOH 22  611 38  HOH HOH A . 
D 4 HOH 23  612 39  HOH HOH A . 
D 4 HOH 24  613 41  HOH HOH A . 
D 4 HOH 25  614 44  HOH HOH A . 
D 4 HOH 26  615 46  HOH HOH A . 
D 4 HOH 27  616 50  HOH HOH A . 
D 4 HOH 28  617 51  HOH HOH A . 
D 4 HOH 29  618 53  HOH HOH A . 
D 4 HOH 30  619 54  HOH HOH A . 
D 4 HOH 31  620 56  HOH HOH A . 
D 4 HOH 32  621 57  HOH HOH A . 
D 4 HOH 33  622 58  HOH HOH A . 
D 4 HOH 34  623 59  HOH HOH A . 
D 4 HOH 35  624 60  HOH HOH A . 
D 4 HOH 36  625 61  HOH HOH A . 
D 4 HOH 37  626 63  HOH HOH A . 
D 4 HOH 38  627 68  HOH HOH A . 
D 4 HOH 39  628 70  HOH HOH A . 
D 4 HOH 40  629 71  HOH HOH A . 
D 4 HOH 41  630 73  HOH HOH A . 
D 4 HOH 42  631 76  HOH HOH A . 
D 4 HOH 43  632 79  HOH HOH A . 
D 4 HOH 44  633 80  HOH HOH A . 
D 4 HOH 45  634 84  HOH HOH A . 
D 4 HOH 46  635 86  HOH HOH A . 
D 4 HOH 47  636 87  HOH HOH A . 
D 4 HOH 48  637 88  HOH HOH A . 
D 4 HOH 49  638 89  HOH HOH A . 
D 4 HOH 50  639 90  HOH HOH A . 
D 4 HOH 51  640 92  HOH HOH A . 
D 4 HOH 52  641 94  HOH HOH A . 
D 4 HOH 53  642 97  HOH HOH A . 
D 4 HOH 54  643 98  HOH HOH A . 
D 4 HOH 55  644 99  HOH HOH A . 
D 4 HOH 56  645 100 HOH HOH A . 
D 4 HOH 57  646 101 HOH HOH A . 
D 4 HOH 58  647 102 HOH HOH A . 
D 4 HOH 59  648 103 HOH HOH A . 
D 4 HOH 60  649 104 HOH HOH A . 
D 4 HOH 61  650 105 HOH HOH A . 
D 4 HOH 62  651 106 HOH HOH A . 
D 4 HOH 63  652 108 HOH HOH A . 
D 4 HOH 64  653 110 HOH HOH A . 
D 4 HOH 65  654 111 HOH HOH A . 
D 4 HOH 66  655 113 HOH HOH A . 
D 4 HOH 67  656 114 HOH HOH A . 
D 4 HOH 68  657 122 HOH HOH A . 
D 4 HOH 69  658 125 HOH HOH A . 
D 4 HOH 70  659 126 HOH HOH A . 
D 4 HOH 71  660 127 HOH HOH A . 
D 4 HOH 72  661 128 HOH HOH A . 
D 4 HOH 73  662 130 HOH HOH A . 
D 4 HOH 74  663 132 HOH HOH A . 
D 4 HOH 75  664 137 HOH HOH A . 
D 4 HOH 76  665 138 HOH HOH A . 
D 4 HOH 77  666 139 HOH HOH A . 
D 4 HOH 78  667 140 HOH HOH A . 
D 4 HOH 79  668 141 HOH HOH A . 
D 4 HOH 80  669 142 HOH HOH A . 
D 4 HOH 81  670 144 HOH HOH A . 
D 4 HOH 82  671 145 HOH HOH A . 
D 4 HOH 83  672 147 HOH HOH A . 
D 4 HOH 84  673 150 HOH HOH A . 
D 4 HOH 85  674 151 HOH HOH A . 
D 4 HOH 86  675 153 HOH HOH A . 
D 4 HOH 87  676 154 HOH HOH A . 
D 4 HOH 88  677 155 HOH HOH A . 
D 4 HOH 89  678 156 HOH HOH A . 
D 4 HOH 90  679 157 HOH HOH A . 
D 4 HOH 91  680 159 HOH HOH A . 
D 4 HOH 92  681 160 HOH HOH A . 
D 4 HOH 93  682 163 HOH HOH A . 
D 4 HOH 94  683 167 HOH HOH A . 
D 4 HOH 95  684 168 HOH HOH A . 
D 4 HOH 96  685 169 HOH HOH A . 
D 4 HOH 97  686 170 HOH HOH A . 
D 4 HOH 98  687 172 HOH HOH A . 
D 4 HOH 99  688 173 HOH HOH A . 
D 4 HOH 100 689 174 HOH HOH A . 
D 4 HOH 101 690 178 HOH HOH A . 
D 4 HOH 102 691 181 HOH HOH A . 
D 4 HOH 103 692 184 HOH HOH A . 
D 4 HOH 104 693 187 HOH HOH A . 
D 4 HOH 105 694 189 HOH HOH A . 
D 4 HOH 106 695 190 HOH HOH A . 
D 4 HOH 107 696 193 HOH HOH A . 
D 4 HOH 108 697 198 HOH HOH A . 
D 4 HOH 109 698 199 HOH HOH A . 
D 4 HOH 110 699 200 HOH HOH A . 
D 4 HOH 111 700 202 HOH HOH A . 
D 4 HOH 112 701 205 HOH HOH A . 
D 4 HOH 113 702 206 HOH HOH A . 
D 4 HOH 114 703 208 HOH HOH A . 
D 4 HOH 115 704 209 HOH HOH A . 
D 4 HOH 116 705 210 HOH HOH A . 
D 4 HOH 117 706 211 HOH HOH A . 
D 4 HOH 118 707 213 HOH HOH A . 
D 4 HOH 119 708 215 HOH HOH A . 
D 4 HOH 120 709 219 HOH HOH A . 
D 4 HOH 121 710 220 HOH HOH A . 
D 4 HOH 122 711 221 HOH HOH A . 
D 4 HOH 123 712 222 HOH HOH A . 
D 4 HOH 124 713 223 HOH HOH A . 
D 4 HOH 125 714 225 HOH HOH A . 
D 4 HOH 126 715 226 HOH HOH A . 
D 4 HOH 127 716 228 HOH HOH A . 
D 4 HOH 128 717 230 HOH HOH A . 
D 4 HOH 129 718 232 HOH HOH A . 
D 4 HOH 130 719 233 HOH HOH A . 
D 4 HOH 131 720 234 HOH HOH A . 
D 4 HOH 132 721 239 HOH HOH A . 
D 4 HOH 133 722 242 HOH HOH A . 
D 4 HOH 134 723 244 HOH HOH A . 
D 4 HOH 135 724 245 HOH HOH A . 
D 4 HOH 136 725 247 HOH HOH A . 
D 4 HOH 137 726 248 HOH HOH A . 
D 4 HOH 138 727 249 HOH HOH A . 
D 4 HOH 139 728 251 HOH HOH A . 
D 4 HOH 140 729 254 HOH HOH A . 
D 4 HOH 141 730 255 HOH HOH A . 
D 4 HOH 142 731 256 HOH HOH A . 
D 4 HOH 143 732 257 HOH HOH A . 
D 4 HOH 144 733 258 HOH HOH A . 
D 4 HOH 145 734 260 HOH HOH A . 
D 4 HOH 146 735 261 HOH HOH A . 
D 4 HOH 147 736 262 HOH HOH A . 
D 4 HOH 148 737 263 HOH HOH A . 
D 4 HOH 149 738 266 HOH HOH A . 
D 4 HOH 150 739 267 HOH HOH A . 
D 4 HOH 151 740 272 HOH HOH A . 
D 4 HOH 152 741 273 HOH HOH A . 
D 4 HOH 153 742 274 HOH HOH A . 
D 4 HOH 154 743 275 HOH HOH A . 
D 4 HOH 155 744 279 HOH HOH A . 
D 4 HOH 156 745 280 HOH HOH A . 
D 4 HOH 157 746 281 HOH HOH A . 
D 4 HOH 158 747 282 HOH HOH A . 
D 4 HOH 159 748 284 HOH HOH A . 
D 4 HOH 160 749 285 HOH HOH A . 
D 4 HOH 161 750 286 HOH HOH A . 
D 4 HOH 162 751 289 HOH HOH A . 
D 4 HOH 163 752 290 HOH HOH A . 
D 4 HOH 164 753 291 HOH HOH A . 
D 4 HOH 165 754 293 HOH HOH A . 
D 4 HOH 166 755 296 HOH HOH A . 
D 4 HOH 167 756 297 HOH HOH A . 
D 4 HOH 168 757 298 HOH HOH A . 
D 4 HOH 169 758 300 HOH HOH A . 
D 4 HOH 170 759 301 HOH HOH A . 
D 4 HOH 171 760 302 HOH HOH A . 
D 4 HOH 172 761 305 HOH HOH A . 
D 4 HOH 173 762 306 HOH HOH A . 
D 4 HOH 174 763 307 HOH HOH A . 
D 4 HOH 175 764 308 HOH HOH A . 
D 4 HOH 176 765 309 HOH HOH A . 
D 4 HOH 177 766 310 HOH HOH A . 
D 4 HOH 178 767 312 HOH HOH A . 
D 4 HOH 179 768 314 HOH HOH A . 
D 4 HOH 180 769 315 HOH HOH A . 
D 4 HOH 181 770 317 HOH HOH A . 
D 4 HOH 182 771 318 HOH HOH A . 
D 4 HOH 183 772 319 HOH HOH A . 
D 4 HOH 184 773 320 HOH HOH A . 
D 4 HOH 185 774 323 HOH HOH A . 
D 4 HOH 186 775 324 HOH HOH A . 
D 4 HOH 187 776 326 HOH HOH A . 
D 4 HOH 188 777 327 HOH HOH A . 
D 4 HOH 189 778 329 HOH HOH A . 
D 4 HOH 190 779 332 HOH HOH A . 
D 4 HOH 191 780 336 HOH HOH A . 
D 4 HOH 192 781 337 HOH HOH A . 
D 4 HOH 193 782 339 HOH HOH A . 
D 4 HOH 194 783 340 HOH HOH A . 
D 4 HOH 195 784 341 HOH HOH A . 
D 4 HOH 196 785 343 HOH HOH A . 
D 4 HOH 197 786 345 HOH HOH A . 
D 4 HOH 198 787 347 HOH HOH A . 
D 4 HOH 199 788 348 HOH HOH A . 
D 4 HOH 200 789 350 HOH HOH A . 
D 4 HOH 201 790 352 HOH HOH A . 
D 4 HOH 202 791 353 HOH HOH A . 
D 4 HOH 203 792 355 HOH HOH A . 
D 4 HOH 204 793 356 HOH HOH A . 
D 4 HOH 205 794 357 HOH HOH A . 
D 4 HOH 206 795 358 HOH HOH A . 
D 4 HOH 207 796 359 HOH HOH A . 
D 4 HOH 208 797 361 HOH HOH A . 
D 4 HOH 209 798 362 HOH HOH A . 
D 4 HOH 210 799 363 HOH HOH A . 
D 4 HOH 211 800 364 HOH HOH A . 
D 4 HOH 212 801 365 HOH HOH A . 
D 4 HOH 213 802 367 HOH HOH A . 
D 4 HOH 214 803 368 HOH HOH A . 
D 4 HOH 215 804 369 HOH HOH A . 
D 4 HOH 216 805 370 HOH HOH A . 
D 4 HOH 217 806 371 HOH HOH A . 
D 4 HOH 218 807 372 HOH HOH A . 
D 4 HOH 219 808 374 HOH HOH A . 
D 4 HOH 220 809 375 HOH HOH A . 
D 4 HOH 221 810 377 HOH HOH A . 
D 4 HOH 222 811 378 HOH HOH A . 
D 4 HOH 223 812 379 HOH HOH A . 
D 4 HOH 224 813 381 HOH HOH A . 
D 4 HOH 225 814 383 HOH HOH A . 
D 4 HOH 226 815 384 HOH HOH A . 
D 4 HOH 227 816 387 HOH HOH A . 
D 4 HOH 228 817 389 HOH HOH A . 
E 4 HOH 1   2   2   HOH HOH B . 
E 4 HOH 2   7   7   HOH HOH B . 
E 4 HOH 3   10  10  HOH HOH B . 
E 4 HOH 4   15  15  HOH HOH B . 
E 4 HOH 5   18  18  HOH HOH B . 
E 4 HOH 6   20  20  HOH HOH B . 
E 4 HOH 7   22  22  HOH HOH B . 
E 4 HOH 8   23  23  HOH HOH B . 
E 4 HOH 9   24  24  HOH HOH B . 
E 4 HOH 10  26  26  HOH HOH B . 
E 4 HOH 11  28  28  HOH HOH B . 
E 4 HOH 12  34  34  HOH HOH B . 
E 4 HOH 13  35  35  HOH HOH B . 
E 4 HOH 14  40  40  HOH HOH B . 
E 4 HOH 15  42  42  HOH HOH B . 
E 4 HOH 16  43  43  HOH HOH B . 
E 4 HOH 17  45  45  HOH HOH B . 
E 4 HOH 18  47  47  HOH HOH B . 
E 4 HOH 19  48  48  HOH HOH B . 
E 4 HOH 20  49  49  HOH HOH B . 
E 4 HOH 21  52  52  HOH HOH B . 
E 4 HOH 22  55  55  HOH HOH B . 
E 4 HOH 23  65  65  HOH HOH B . 
E 4 HOH 24  66  66  HOH HOH B . 
E 4 HOH 25  67  67  HOH HOH B . 
E 4 HOH 26  69  69  HOH HOH B . 
E 4 HOH 27  72  72  HOH HOH B . 
E 4 HOH 28  74  74  HOH HOH B . 
E 4 HOH 29  75  75  HOH HOH B . 
E 4 HOH 30  77  77  HOH HOH B . 
E 4 HOH 31  78  78  HOH HOH B . 
E 4 HOH 32  81  81  HOH HOH B . 
E 4 HOH 33  82  82  HOH HOH B . 
E 4 HOH 34  83  83  HOH HOH B . 
E 4 HOH 35  85  85  HOH HOH B . 
E 4 HOH 36  91  91  HOH HOH B . 
E 4 HOH 37  93  93  HOH HOH B . 
E 4 HOH 38  95  95  HOH HOH B . 
E 4 HOH 39  96  96  HOH HOH B . 
E 4 HOH 40  107 107 HOH HOH B . 
E 4 HOH 41  109 109 HOH HOH B . 
E 4 HOH 42  112 112 HOH HOH B . 
E 4 HOH 43  115 115 HOH HOH B . 
E 4 HOH 44  116 116 HOH HOH B . 
E 4 HOH 45  117 117 HOH HOH B . 
E 4 HOH 46  118 118 HOH HOH B . 
E 4 HOH 47  119 119 HOH HOH B . 
E 4 HOH 48  120 120 HOH HOH B . 
E 4 HOH 49  121 121 HOH HOH B . 
E 4 HOH 50  123 123 HOH HOH B . 
E 4 HOH 51  124 124 HOH HOH B . 
E 4 HOH 52  129 129 HOH HOH B . 
E 4 HOH 53  131 131 HOH HOH B . 
E 4 HOH 54  133 133 HOH HOH B . 
E 4 HOH 55  134 134 HOH HOH B . 
E 4 HOH 56  135 135 HOH HOH B . 
E 4 HOH 57  136 136 HOH HOH B . 
E 4 HOH 58  143 143 HOH HOH B . 
E 4 HOH 59  148 148 HOH HOH B . 
E 4 HOH 60  149 149 HOH HOH B . 
E 4 HOH 61  152 152 HOH HOH B . 
E 4 HOH 62  158 158 HOH HOH B . 
E 4 HOH 63  161 161 HOH HOH B . 
E 4 HOH 64  162 162 HOH HOH B . 
E 4 HOH 65  164 164 HOH HOH B . 
E 4 HOH 66  165 165 HOH HOH B . 
E 4 HOH 67  166 166 HOH HOH B . 
E 4 HOH 68  171 171 HOH HOH B . 
E 4 HOH 69  175 175 HOH HOH B . 
E 4 HOH 70  176 176 HOH HOH B . 
E 4 HOH 71  177 177 HOH HOH B . 
E 4 HOH 72  179 179 HOH HOH B . 
E 4 HOH 73  180 180 HOH HOH B . 
E 4 HOH 74  182 182 HOH HOH B . 
E 4 HOH 75  183 183 HOH HOH B . 
E 4 HOH 76  185 185 HOH HOH B . 
E 4 HOH 77  186 186 HOH HOH B . 
E 4 HOH 78  188 188 HOH HOH B . 
E 4 HOH 79  191 191 HOH HOH B . 
E 4 HOH 80  192 192 HOH HOH B . 
E 4 HOH 81  194 194 HOH HOH B . 
E 4 HOH 82  195 195 HOH HOH B . 
E 4 HOH 83  196 196 HOH HOH B . 
E 4 HOH 84  197 197 HOH HOH B . 
E 4 HOH 85  201 201 HOH HOH B . 
E 4 HOH 86  203 203 HOH HOH B . 
E 4 HOH 87  204 204 HOH HOH B . 
E 4 HOH 88  207 207 HOH HOH B . 
E 4 HOH 89  212 212 HOH HOH B . 
E 4 HOH 90  214 214 HOH HOH B . 
E 4 HOH 91  216 216 HOH HOH B . 
E 4 HOH 92  217 217 HOH HOH B . 
E 4 HOH 93  218 218 HOH HOH B . 
E 4 HOH 94  224 224 HOH HOH B . 
E 4 HOH 95  231 231 HOH HOH B . 
E 4 HOH 96  235 235 HOH HOH B . 
E 4 HOH 97  236 236 HOH HOH B . 
E 4 HOH 98  237 237 HOH HOH B . 
E 4 HOH 99  238 238 HOH HOH B . 
E 4 HOH 100 240 240 HOH HOH B . 
E 4 HOH 101 241 241 HOH HOH B . 
E 4 HOH 102 243 243 HOH HOH B . 
E 4 HOH 103 246 246 HOH HOH B . 
E 4 HOH 104 250 250 HOH HOH B . 
E 4 HOH 105 252 252 HOH HOH B . 
E 4 HOH 106 253 253 HOH HOH B . 
E 4 HOH 107 259 259 HOH HOH B . 
E 4 HOH 108 264 264 HOH HOH B . 
E 4 HOH 109 265 265 HOH HOH B . 
E 4 HOH 110 268 268 HOH HOH B . 
E 4 HOH 111 269 269 HOH HOH B . 
E 4 HOH 112 270 270 HOH HOH B . 
E 4 HOH 113 271 271 HOH HOH B . 
E 4 HOH 114 276 276 HOH HOH B . 
E 4 HOH 115 277 277 HOH HOH B . 
E 4 HOH 116 278 278 HOH HOH B . 
E 4 HOH 117 283 283 HOH HOH B . 
E 4 HOH 118 287 287 HOH HOH B . 
E 4 HOH 119 288 288 HOH HOH B . 
E 4 HOH 120 292 292 HOH HOH B . 
E 4 HOH 121 294 294 HOH HOH B . 
E 4 HOH 122 295 295 HOH HOH B . 
E 4 HOH 123 299 299 HOH HOH B . 
E 4 HOH 124 303 303 HOH HOH B . 
E 4 HOH 125 304 304 HOH HOH B . 
E 4 HOH 126 311 311 HOH HOH B . 
E 4 HOH 127 313 313 HOH HOH B . 
E 4 HOH 128 321 321 HOH HOH B . 
E 4 HOH 129 322 322 HOH HOH B . 
E 4 HOH 130 325 325 HOH HOH B . 
E 4 HOH 131 328 328 HOH HOH B . 
E 4 HOH 132 330 330 HOH HOH B . 
E 4 HOH 133 331 331 HOH HOH B . 
E 4 HOH 134 334 334 HOH HOH B . 
E 4 HOH 135 335 335 HOH HOH B . 
E 4 HOH 136 338 338 HOH HOH B . 
E 4 HOH 137 342 342 HOH HOH B . 
E 4 HOH 138 344 344 HOH HOH B . 
E 4 HOH 139 346 346 HOH HOH B . 
E 4 HOH 140 349 349 HOH HOH B . 
E 4 HOH 141 351 351 HOH HOH B . 
E 4 HOH 142 354 354 HOH HOH B . 
E 4 HOH 143 360 360 HOH HOH B . 
E 4 HOH 144 366 366 HOH HOH B . 
E 4 HOH 145 373 373 HOH HOH B . 
E 4 HOH 146 376 376 HOH HOH B . 
E 4 HOH 147 380 380 HOH HOH B . 
E 4 HOH 148 382 382 HOH HOH B . 
E 4 HOH 149 385 385 HOH HOH B . 
E 4 HOH 150 386 386 HOH HOH B . 
E 4 HOH 151 388 388 HOH HOH B . 
F 4 HOH 1   16  16  HOH HOH E . 
F 4 HOH 2   19  19  HOH HOH E . 
F 4 HOH 3   29  29  HOH HOH E . 
F 4 HOH 4   62  62  HOH HOH E . 
F 4 HOH 5   64  64  HOH HOH E . 
F 4 HOH 6   146 146 HOH HOH E . 
F 4 HOH 7   229 229 HOH HOH E . 
F 4 HOH 8   316 316 HOH HOH E . 
F 4 HOH 9   333 333 HOH HOH E . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2980  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  16040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-12-02 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A PHE 514 ? ? N  A PRO 515 ? ? CA  A PRO 515 ? ? 107.09 119.30 -12.21 1.50 Y 
2 1 C  A PHE 514 ? ? N  A PRO 515 ? ? CD  A PRO 515 ? ? 141.59 128.40 13.19  2.10 Y 
3 1 NE B ARG 698 ? ? CZ B ARG 698 ? ? NH2 B ARG 698 ? ? 117.13 120.30 -3.17  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 436 ? ? 62.98   66.68   
2  1 CYS A 438 ? ? 67.20   61.64   
3  1 TYR A 498 ? ? -103.43 42.02   
4  1 SER A 560 ? ? -153.28 -51.24  
5  1 ASP A 566 ? ? 87.87   -0.36   
6  1 HIS B 673 ? ? 80.40   45.52   
7  1 ILE B 744 ? ? -97.08  -89.92  
8  1 LYS B 745 ? ? -91.27  -106.61 
9  1 GLU B 747 ? ? -153.95 26.75   
10 1 VAL B 759 ? ? -125.88 -66.13  
11 1 TYR E 5   ? ? -105.94 68.05   
12 1 LEU E 8   ? ? -64.19  94.98   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 529 ? ? 0.075 'SIDE CHAIN' 
2 1 TYR B 659 ? ? 0.064 'SIDE CHAIN' 
3 1 TYR B 771 ? ? 0.065 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 372 ? A HIS 1   
2  1 Y 1 A THR 373 ? A THR 2   
3  1 Y 1 A PRO 374 ? A PRO 3   
4  1 Y 1 A VAL 375 ? A VAL 4   
5  1 Y 1 A ARG 376 ? A ARG 5   
6  1 Y 1 A THR 377 ? A THR 6   
7  1 Y 1 A VAL 378 ? A VAL 7   
8  1 Y 1 A MET 379 ? A MET 8   
9  1 Y 1 A GLU 465 ? A GLU 94  
10 1 Y 1 A GLU 466 ? A GLU 95  
11 1 Y 1 A ARG 467 ? A ARG 96  
12 1 Y 1 A LEU 468 ? A LEU 97  
13 1 Y 1 A SER 469 ? A SER 98  
14 1 Y 1 A ILE 470 ? A ILE 99  
15 1 Y 1 A GLN 471 ? A GLN 100 
16 1 Y 1 A ARG 500 ? A ARG 129 
17 1 Y 1 A SER 501 ? A SER 130 
18 1 Y 1 A THR 502 ? A THR 131 
19 1 Y 1 A SER 503 ? A SER 132 
20 1 Y 1 A GLN 504 ? A GLN 133 
21 1 Y 1 A ASN 505 ? A ASN 134 
22 1 Y 1 A LEU 506 ? A LEU 135 
23 1 Y 1 A ASP 507 ? A ASP 136 
24 1 Y 1 A SER 508 ? A SER 137 
25 1 Y 1 A GLY 509 ? A GLY 138 
26 1 Y 1 A THR 510 ? A THR 139 
27 1 Y 1 A ASP 511 ? A ASP 140 
28 1 Y 1 A LEU 512 ? A LEU 141 
29 1 Y 1 A SER 513 ? A SER 142 
30 1 Y 1 A ASP 578 ? A ASP 207 
31 1 Y 1 A ARG 579 ? A ARG 208 
32 1 Y 1 A GLU 580 ? A GLU 209 
33 1 Y 1 A GLY 581 ? A GLY 210 
34 1 Y 1 A PRO 582 ? A PRO 211 
35 1 Y 1 A THR 583 ? A THR 212 
36 1 Y 1 A ASP 584 ? A ASP 213 
37 1 Y 1 A HIS 585 ? A HIS 214 
38 1 Y 1 A LEU 586 ? A LEU 215 
39 1 Y 1 A GLU 587 ? A GLU 216 
40 1 Y 1 A SER 588 ? A SER 217 
41 1 Y 1 A ALA 589 ? A ALA 218 
42 1 Y 1 B PHE 636 ? B PHE 1   
43 1 Y 1 B GLN 637 ? B GLN 2   
44 1 Y 1 B THR 638 ? B THR 3   
45 1 Y 1 B GLN 639 ? B GLN 4   
46 1 Y 1 B LYS 640 ? B LYS 5   
47 1 Y 1 B PRO 641 ? B PRO 6   
48 1 Y 1 B LEU 642 ? B LEU 7   
49 1 Y 1 B LYS 643 ? B LYS 8   
50 1 Y 1 B SER 644 ? B SER 9   
51 1 Y 1 B PRO 786 ? B PRO 151 
52 1 Y 1 B ARG 787 ? B ARG 152 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#