data_1GWP
# 
_entry.id   1GWP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GWP         
PDBE  EBI-9544     
WWPDB D_1290009544 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2004-03-26 
_pdbx_database_PDB_obs_spr.pdb_id           1GWP 
_pdbx_database_PDB_obs_spr.replace_pdb_id   '1GDS 1GDY 1GDZ' 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A43 unspecified 'STRUCTURE OF THE HIV-1 CAPSID PROTEIN DIMERIZATION DOMAINAT 2.6A RESOLUTION' 
PDB 1A8O unspecified 'HIV CAPSID C-TERMINAL DOMAIN'                                                
PDB 1AFV unspecified 'HIV-1 CAPSID PROTEIN (P24) COMPLEX WITH FAB25.3'                             
PDB 1AK4 unspecified 'HUMAN CYCLOPHILIN A BOUND TO THE AMINO- TERMINAL DOMAIN OF HIV-1 CAPSID'     
PDB 1AUM unspecified 'HIV CAPSID C-TERMINAL DOMAIN (CAC146)'                                       
PDB 1BAJ unspecified 'HIV-1 CAPSID PROTEIN C-TERMINAL FRAGMENT PLUS GAG P2 DOMAIN'                 
PDB 1HIW unspecified 'TRIMERIC HIV-1 MATRIX PROTEIN'                                               
PDB 2HMX unspecified 'HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN 2HMX 3'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GWP 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-03-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tang, C.'        1 
'Gitti, R.K.'     2 
'Lee, B.M.'       3 
'Walker, J.'      4 
'Summers, M.F.'   5 
'Yoo, S.'         6 
'Sundquist, W.I.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the N-Terminal 283-Residue Fragment of the Immature HIV-1 Gag Polyprotein' Nat.Struct.Biol. 9   537 ? 2002 
NSBIEW US 1072-8368 2024 ? 12032547 10.1038/NSB806               
1       'Structure of the Amino-Terminal Core Domain of the HIV-1 Capsid Protein.'               Science          273 231 ? 1996 
SCIEAS US 0036-8075 0038 ? 8662505  10.1126/SCIENCE.273.5272.231 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tang, C.'        1 
primary 'Ndassa, Y.'      2 
primary 'Summers, M.F.'   3 
1       'Gitti, R.K.'     4 
1       'Lee, B.M.'       5 
1       'Walker, J.'      6 
1       'Summers, M.F.'   7 
1       'Yoo, S.'         8 
1       'Sundquist, W.I.' 9 
# 
_cell.entry_id           1GWP 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GWP 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'GAG POLYPROTEIN' 
_entity.formula_weight             16716.189 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'AMINO-TERMINAL CORE DOMAIN RESIDUES 132 - 282' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW
DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW
DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   VAL n 
1 4   GLN n 
1 5   ASN n 
1 6   LEU n 
1 7   GLN n 
1 8   GLY n 
1 9   GLN n 
1 10  MET n 
1 11  VAL n 
1 12  HIS n 
1 13  GLN n 
1 14  ALA n 
1 15  ILE n 
1 16  SER n 
1 17  PRO n 
1 18  ARG n 
1 19  THR n 
1 20  LEU n 
1 21  ASN n 
1 22  ALA n 
1 23  TRP n 
1 24  VAL n 
1 25  LYS n 
1 26  VAL n 
1 27  VAL n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ALA n 
1 32  PHE n 
1 33  SER n 
1 34  PRO n 
1 35  GLU n 
1 36  VAL n 
1 37  ILE n 
1 38  PRO n 
1 39  MET n 
1 40  PHE n 
1 41  SER n 
1 42  ALA n 
1 43  LEU n 
1 44  SER n 
1 45  GLU n 
1 46  GLY n 
1 47  ALA n 
1 48  THR n 
1 49  PRO n 
1 50  GLN n 
1 51  ASP n 
1 52  LEU n 
1 53  ASN n 
1 54  THR n 
1 55  MET n 
1 56  LEU n 
1 57  ASN n 
1 58  THR n 
1 59  VAL n 
1 60  GLY n 
1 61  GLY n 
1 62  HIS n 
1 63  GLN n 
1 64  ALA n 
1 65  ALA n 
1 66  MET n 
1 67  GLN n 
1 68  MET n 
1 69  LEU n 
1 70  LYS n 
1 71  GLU n 
1 72  THR n 
1 73  ILE n 
1 74  ASN n 
1 75  GLU n 
1 76  GLU n 
1 77  ALA n 
1 78  ALA n 
1 79  GLU n 
1 80  TRP n 
1 81  ASP n 
1 82  ARG n 
1 83  LEU n 
1 84  HIS n 
1 85  PRO n 
1 86  VAL n 
1 87  HIS n 
1 88  ALA n 
1 89  GLY n 
1 90  PRO n 
1 91  ILE n 
1 92  ALA n 
1 93  PRO n 
1 94  GLY n 
1 95  GLN n 
1 96  MET n 
1 97  ARG n 
1 98  GLU n 
1 99  PRO n 
1 100 ARG n 
1 101 GLY n 
1 102 SER n 
1 103 ASP n 
1 104 ILE n 
1 105 ALA n 
1 106 GLY n 
1 107 THR n 
1 108 THR n 
1 109 SER n 
1 110 THR n 
1 111 LEU n 
1 112 GLN n 
1 113 GLU n 
1 114 GLN n 
1 115 ILE n 
1 116 GLY n 
1 117 TRP n 
1 118 MET n 
1 119 THR n 
1 120 HIS n 
1 121 ASN n 
1 122 PRO n 
1 123 PRO n 
1 124 ILE n 
1 125 PRO n 
1 126 VAL n 
1 127 GLY n 
1 128 GLU n 
1 129 ILE n 
1 130 TYR n 
1 131 LYS n 
1 132 ARG n 
1 133 TRP n 
1 134 ILE n 
1 135 ILE n 
1 136 LEU n 
1 137 GLY n 
1 138 LEU n 
1 139 ASN n 
1 140 LYS n 
1 141 ILE n 
1 142 VAL n 
1 143 ARG n 
1 144 MET n 
1 145 TYR n 
1 146 SER n 
1 147 PRO n 
1 148 THR n 
1 149 SER n 
1 150 ILE n 
1 151 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PNL4-3 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (NEW YORK-5 ISOLATE)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11698 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            'CLONE 12' 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GAG_HV1N5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P12493 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GWP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 151 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12493 
_struct_ref_seq.db_align_beg                  132 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  282 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       151 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 HMQC-NOESY-HSQC        1 
2 1 'HSQC HNCA'            1 
3 1 'HN(CO)CA'             1 
4 1 HNCO                   1 
5 1 'HNHA HMQC-NOESY-HSQC' 1 
6 1 HSQC-NOESY-HSQC        1 
7 1 HMQC-NOESY-HMQC        1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     5.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         10 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1GWP 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            
;TORSION ANGLE DYNAMICS FOLLOWED BY ENERGY MINIMIZATION. GUNTERT, P., MUMENTHALER, C. WUTHRICH, K. (1997). TORSION ANGLE DYNAMICS FOR NMR STRUCTURE CALCULATION WITH THE NEW PROGRAM DYANA. J. MOL. BIOL. 273, 283-298.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1GWP 
_pdbx_nmr_details.text       'HSQC HNCA, HN(CO)CA, HNCO, HNHA HMQC-NOESY-HSQC, HSQC-NOESY-HSQC, HMQC-NOESY-HMQC' 
# 
_pdbx_nmr_ensemble.entry_id                             1GWP 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST TARGET FUNCTION' 
# 
_pdbx_nmr_representative.entry_id             1GWP 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           DYANA ? GUNTERT,WUTHRICH 1 
'structure solution' DYANA ? ?                2 
# 
_exptl.entry_id          1GWP 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1GWP 
_struct.title                     'STRUCTURE OF THE N-TERMINAL DOMAIN OF THE MATURE HIV-1 CAPSID PROTEIN' 
_struct.pdbx_descriptor           'GAG POLYPROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GWP 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            
;HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 CAPSID PROTEIN, AMIMO-TERMINAL CORE DOMAIN, HIV-1 CA-151, VIRUS CAPSID PROTEIN, VIRUS MATURATION, VIRAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 16  ? LYS A 30  ? SER A 16  LYS A 30  1 ? 15 
HELX_P HELX_P2 2 SER A 33  ? SER A 44  ? SER A 33  SER A 44  1 ? 12 
HELX_P HELX_P3 3 THR A 48  ? VAL A 59  ? THR A 48  VAL A 59  1 ? 12 
HELX_P HELX_P4 4 HIS A 62  ? HIS A 84  ? HIS A 62  HIS A 84  1 ? 23 
HELX_P HELX_P5 5 ARG A 100 ? ALA A 105 ? ARG A 100 ALA A 105 1 ? 6  
HELX_P HELX_P6 6 THR A 110 ? THR A 119 ? THR A 110 THR A 119 1 ? 10 
HELX_P HELX_P7 7 VAL A 126 ? SER A 146 ? VAL A 126 SER A 146 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 1  0.00  
2  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 2  -0.02 
3  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 3  -0.01 
4  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 4  0.01  
5  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 5  0.09  
6  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 6  -0.04 
7  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 7  -0.02 
8  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 8  -0.02 
9  ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 9  -0.03 
10 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 10 0.04  
11 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 11 -0.04 
12 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 12 -0.03 
13 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 13 -0.02 
14 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 14 -0.07 
15 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 15 0.03  
16 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 16 -0.06 
17 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 17 0.07  
18 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 18 -0.05 
19 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 19 -0.10 
20 ASN 121 A . ? ASN 121 A PRO 122 A ? PRO 122 A 20 0.00  
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PRO A 1 ? ASN A 5  ? PRO A 1 ASN A 5  
AA 2 GLN A 9 ? GLN A 13 ? GLN A 9 GLN A 13 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    3 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     3 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    11 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     11 
# 
_database_PDB_matrix.entry_id          1GWP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GWP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PRO A 1 1   ? 1.360   0.000   0.000   1.00 0.00 ? 1   PRO A N    1  
ATOM 2     C CA   . PRO A 1 1   ? 2.108   0.000   -1.245  1.00 0.00 ? 1   PRO A CA   1  
ATOM 3     C C    . PRO A 1 1   ? 2.074   -1.380  -1.906  1.00 0.00 ? 1   PRO A C    1  
ATOM 4     O O    . PRO A 1 1   ? 2.547   -2.359  -1.331  1.00 0.00 ? 1   PRO A O    1  
ATOM 5     C CB   . PRO A 1 1   ? 3.512   0.440   -0.861  1.00 0.00 ? 1   PRO A CB   1  
ATOM 6     C CG   . PRO A 1 1   ? 3.621   0.221   0.639   1.00 0.00 ? 1   PRO A CG   1  
ATOM 7     C CD   . PRO A 1 1   ? 2.218   0.000   1.181   1.00 0.00 ? 1   PRO A CD   1  
ATOM 8     H HA   . PRO A 1 1   ? 1.690   0.628   -1.902  1.00 0.00 ? 1   PRO A HA   1  
ATOM 9     H HB2  . PRO A 1 1   ? 4.263   -0.141  -1.396  1.00 0.00 ? 1   PRO A HB2  1  
ATOM 10    H HB3  . PRO A 1 1   ? 3.677   1.486   -1.116  1.00 0.00 ? 1   PRO A HB3  1  
ATOM 11    H HG2  . PRO A 1 1   ? 4.253   -0.640  0.854   1.00 0.00 ? 1   PRO A HG2  1  
ATOM 12    H HG3  . PRO A 1 1   ? 4.083   1.084   1.118   1.00 0.00 ? 1   PRO A HG3  1  
ATOM 13    H HD2  . PRO A 1 1   ? 2.147   -0.944  1.722   1.00 0.00 ? 1   PRO A HD2  1  
ATOM 14    H HD3  . PRO A 1 1   ? 1.934   0.789   1.877   1.00 0.00 ? 1   PRO A HD3  1  
ATOM 15    N N    . ILE A 1 2   ? 1.510   -1.413  -3.104  1.00 0.00 ? 2   ILE A N    1  
ATOM 16    C CA   . ILE A 1 2   ? 1.407   -2.656  -3.849  1.00 0.00 ? 2   ILE A CA   1  
ATOM 17    C C    . ILE A 1 2   ? 2.321   -2.588  -5.074  1.00 0.00 ? 2   ILE A C    1  
ATOM 18    O O    . ILE A 1 2   ? 2.461   -1.533  -5.691  1.00 0.00 ? 2   ILE A O    1  
ATOM 19    C CB   . ILE A 1 2   ? -0.054  -2.960  -4.187  1.00 0.00 ? 2   ILE A CB   1  
ATOM 20    C CG1  . ILE A 1 2   ? -0.745  -3.685  -3.031  1.00 0.00 ? 2   ILE A CG1  1  
ATOM 21    C CG2  . ILE A 1 2   ? -0.162  -3.739  -5.499  1.00 0.00 ? 2   ILE A CG2  1  
ATOM 22    C CD1  . ILE A 1 2   ? -2.259  -3.470  -3.075  1.00 0.00 ? 2   ILE A CD1  1  
ATOM 23    H H    . ILE A 1 2   ? 1.127   -0.612  -3.565  1.00 0.00 ? 2   ILE A H    1  
ATOM 24    H HA   . ILE A 1 2   ? 1.760   -3.457  -3.199  1.00 0.00 ? 2   ILE A HA   1  
ATOM 25    H HB   . ILE A 1 2   ? -0.575  -2.013  -4.331  1.00 0.00 ? 2   ILE A HB   1  
ATOM 26    H HG12 . ILE A 1 2   ? -0.524  -4.751  -3.082  1.00 0.00 ? 2   ILE A HG12 1  
ATOM 27    H HG13 . ILE A 1 2   ? -0.350  -3.323  -2.082  1.00 0.00 ? 2   ILE A HG13 1  
ATOM 28    H HG21 . ILE A 1 2   ? 0.718   -4.369  -5.622  1.00 0.00 ? 2   ILE A HG21 1  
ATOM 29    H HG22 . ILE A 1 2   ? -1.056  -4.362  -5.479  1.00 0.00 ? 2   ILE A HG22 1  
ATOM 30    H HG23 . ILE A 1 2   ? -0.227  -3.039  -6.333  1.00 0.00 ? 2   ILE A HG23 1  
ATOM 31    H HD11 . ILE A 1 2   ? -2.487  -2.622  -3.721  1.00 0.00 ? 2   ILE A HD11 1  
ATOM 32    H HD12 . ILE A 1 2   ? -2.742  -4.365  -3.467  1.00 0.00 ? 2   ILE A HD12 1  
ATOM 33    H HD13 . ILE A 1 2   ? -2.627  -3.269  -2.069  1.00 0.00 ? 2   ILE A HD13 1  
ATOM 34    N N    . VAL A 1 3   ? 2.918   -3.728  -5.391  1.00 0.00 ? 3   VAL A N    1  
ATOM 35    C CA   . VAL A 1 3   ? 3.814   -3.811  -6.532  1.00 0.00 ? 3   VAL A CA   1  
ATOM 36    C C    . VAL A 1 3   ? 3.512   -5.087  -7.321  1.00 0.00 ? 3   VAL A C    1  
ATOM 37    O O    . VAL A 1 3   ? 2.853   -5.993  -6.813  1.00 0.00 ? 3   VAL A O    1  
ATOM 38    C CB   . VAL A 1 3   ? 5.268   -3.728  -6.063  1.00 0.00 ? 3   VAL A CB   1  
ATOM 39    C CG1  . VAL A 1 3   ? 5.559   -2.373  -5.415  1.00 0.00 ? 3   VAL A CG1  1  
ATOM 40    C CG2  . VAL A 1 3   ? 5.602   -4.876  -5.107  1.00 0.00 ? 3   VAL A CG2  1  
ATOM 41    H H    . VAL A 1 3   ? 2.798   -4.582  -4.885  1.00 0.00 ? 3   VAL A H    1  
ATOM 42    H HA   . VAL A 1 3   ? 3.616   -2.949  -7.170  1.00 0.00 ? 3   VAL A HA   1  
ATOM 43    H HB   . VAL A 1 3   ? 5.909   -3.825  -6.939  1.00 0.00 ? 3   VAL A HB   1  
ATOM 44    H HG11 . VAL A 1 3   ? 5.228   -1.574  -6.079  1.00 0.00 ? 3   VAL A HG11 1  
ATOM 45    H HG12 . VAL A 1 3   ? 5.026   -2.301  -4.467  1.00 0.00 ? 3   VAL A HG12 1  
ATOM 46    H HG13 . VAL A 1 3   ? 6.630   -2.277  -5.238  1.00 0.00 ? 3   VAL A HG13 1  
ATOM 47    H HG21 . VAL A 1 3   ? 4.821   -4.958  -4.351  1.00 0.00 ? 3   VAL A HG21 1  
ATOM 48    H HG22 . VAL A 1 3   ? 5.664   -5.808  -5.667  1.00 0.00 ? 3   VAL A HG22 1  
ATOM 49    H HG23 . VAL A 1 3   ? 6.558   -4.678  -4.622  1.00 0.00 ? 3   VAL A HG23 1  
ATOM 50    N N    . GLN A 1 4   ? 4.008   -5.117  -8.549  1.00 0.00 ? 4   GLN A N    1  
ATOM 51    C CA   . GLN A 1 4   ? 3.800   -6.267  -9.412  1.00 0.00 ? 4   GLN A CA   1  
ATOM 52    C C    . GLN A 1 4   ? 5.072   -7.114  -9.484  1.00 0.00 ? 4   GLN A C    1  
ATOM 53    O O    . GLN A 1 4   ? 6.130   -6.620  -9.870  1.00 0.00 ? 4   GLN A O    1  
ATOM 54    C CB   . GLN A 1 4   ? 3.352   -5.830  -10.808 1.00 0.00 ? 4   GLN A CB   1  
ATOM 55    C CG   . GLN A 1 4   ? 1.827   -5.862  -10.930 1.00 0.00 ? 4   GLN A CG   1  
ATOM 56    C CD   . GLN A 1 4   ? 1.328   -4.753  -11.859 1.00 0.00 ? 4   GLN A CD   1  
ATOM 57    O OE1  . GLN A 1 4   ? 2.087   -3.939  -12.361 1.00 0.00 ? 4   GLN A OE1  1  
ATOM 58    N NE2  . GLN A 1 4   ? 0.014   -4.767  -12.060 1.00 0.00 ? 4   GLN A NE2  1  
ATOM 59    H H    . GLN A 1 4   ? 4.543   -4.376  -8.954  1.00 0.00 ? 4   GLN A H    1  
ATOM 60    H HA   . GLN A 1 4   ? 3.000   -6.840  -8.944  1.00 0.00 ? 4   GLN A HA   1  
ATOM 61    H HB2  . GLN A 1 4   ? 3.716   -4.823  -11.012 1.00 0.00 ? 4   GLN A HB2  1  
ATOM 62    H HB3  . GLN A 1 4   ? 3.794   -6.486  -11.558 1.00 0.00 ? 4   GLN A HB3  1  
ATOM 63    H HG2  . GLN A 1 4   ? 1.510   -6.832  -11.313 1.00 0.00 ? 4   GLN A HG2  1  
ATOM 64    H HG3  . GLN A 1 4   ? 1.378   -5.745  -9.945  1.00 0.00 ? 4   GLN A HG3  1  
ATOM 65    H HE21 . GLN A 1 4   ? -0.552  -5.463  -11.618 1.00 0.00 ? 4   GLN A HE21 1  
ATOM 66    H HE22 . GLN A 1 4   ? -0.409  -4.081  -12.653 1.00 0.00 ? 4   GLN A HE22 1  
ATOM 67    N N    . ASN A 1 5   ? 4.926   -8.376  -9.107  1.00 0.00 ? 5   ASN A N    1  
ATOM 68    C CA   . ASN A 1 5   ? 6.050   -9.296  -9.124  1.00 0.00 ? 5   ASN A CA   1  
ATOM 69    C C    . ASN A 1 5   ? 6.758   -9.206  -10.477 1.00 0.00 ? 5   ASN A C    1  
ATOM 70    O O    . ASN A 1 5   ? 6.318   -8.475  -11.364 1.00 0.00 ? 5   ASN A O    1  
ATOM 71    C CB   . ASN A 1 5   ? 5.583   -10.740 -8.931  1.00 0.00 ? 5   ASN A CB   1  
ATOM 72    C CG   . ASN A 1 5   ? 5.534   -11.107 -7.446  1.00 0.00 ? 5   ASN A CG   1  
ATOM 73    O OD1  . ASN A 1 5   ? 6.531   -11.452 -6.833  1.00 0.00 ? 5   ASN A OD1  1  
ATOM 74    N ND2  . ASN A 1 5   ? 4.323   -11.014 -6.905  1.00 0.00 ? 5   ASN A ND2  1  
ATOM 75    H H    . ASN A 1 5   ? 4.062   -8.770  -8.794  1.00 0.00 ? 5   ASN A H    1  
ATOM 76    H HA   . ASN A 1 5   ? 6.689   -8.984  -8.297  1.00 0.00 ? 5   ASN A HA   1  
ATOM 77    H HB2  . ASN A 1 5   ? 4.595   -10.869 -9.373  1.00 0.00 ? 5   ASN A HB2  1  
ATOM 78    H HB3  . ASN A 1 5   ? 6.257   -11.418 -9.455  1.00 0.00 ? 5   ASN A HB3  1  
ATOM 79    H HD21 . ASN A 1 5   ? 3.546   -10.724 -7.465  1.00 0.00 ? 5   ASN A HD21 1  
ATOM 80    H HD22 . ASN A 1 5   ? 4.189   -11.233 -5.939  1.00 0.00 ? 5   ASN A HD22 1  
ATOM 81    N N    . LEU A 1 6   ? 7.842   -9.958  -10.594 1.00 0.00 ? 6   LEU A N    1  
ATOM 82    C CA   . LEU A 1 6   ? 8.615   -9.972  -11.824 1.00 0.00 ? 6   LEU A CA   1  
ATOM 83    C C    . LEU A 1 6   ? 7.954   -10.922 -12.826 1.00 0.00 ? 6   LEU A C    1  
ATOM 84    O O    . LEU A 1 6   ? 7.809   -10.588 -14.000 1.00 0.00 ? 6   LEU A O    1  
ATOM 85    C CB   . LEU A 1 6   ? 10.079  -10.306 -11.534 1.00 0.00 ? 6   LEU A CB   1  
ATOM 86    C CG   . LEU A 1 6   ? 11.119  -9.514  -12.329 1.00 0.00 ? 6   LEU A CG   1  
ATOM 87    C CD1  . LEU A 1 6   ? 12.218  -8.976  -11.411 1.00 0.00 ? 6   LEU A CD1  1  
ATOM 88    C CD2  . LEU A 1 6   ? 11.688  -10.352 -13.475 1.00 0.00 ? 6   LEU A CD2  1  
ATOM 89    H H    . LEU A 1 6   ? 8.193   -10.550 -9.868  1.00 0.00 ? 6   LEU A H    1  
ATOM 90    H HA   . LEU A 1 6   ? 8.590   -8.963  -12.237 1.00 0.00 ? 6   LEU A HA   1  
ATOM 91    H HB2  . LEU A 1 6   ? 10.264  -10.146 -10.471 1.00 0.00 ? 6   LEU A HB2  1  
ATOM 92    H HB3  . LEU A 1 6   ? 10.234  -11.367 -11.727 1.00 0.00 ? 6   LEU A HB3  1  
ATOM 93    H HG   . LEU A 1 6   ? 10.623  -8.652  -12.776 1.00 0.00 ? 6   LEU A HG   1  
ATOM 94    H HD11 . LEU A 1 6   ? 11.806  -8.795  -10.418 1.00 0.00 ? 6   LEU A HD11 1  
ATOM 95    H HD12 . LEU A 1 6   ? 13.024  -9.707  -11.342 1.00 0.00 ? 6   LEU A HD12 1  
ATOM 96    H HD13 . LEU A 1 6   ? 12.608  -8.043  -11.818 1.00 0.00 ? 6   LEU A HD13 1  
ATOM 97    H HD21 . LEU A 1 6   ? 11.683  -11.405 -13.193 1.00 0.00 ? 6   LEU A HD21 1  
ATOM 98    H HD22 . LEU A 1 6   ? 11.076  -10.212 -14.366 1.00 0.00 ? 6   LEU A HD22 1  
ATOM 99    H HD23 . LEU A 1 6   ? 12.711  -10.037 -13.683 1.00 0.00 ? 6   LEU A HD23 1  
ATOM 100   N N    . GLN A 1 7   ? 7.572   -12.087 -12.324 1.00 0.00 ? 7   GLN A N    1  
ATOM 101   C CA   . GLN A 1 7   ? 6.931   -13.088 -13.160 1.00 0.00 ? 7   GLN A CA   1  
ATOM 102   C C    . GLN A 1 7   ? 5.625   -12.538 -13.738 1.00 0.00 ? 7   GLN A C    1  
ATOM 103   O O    . GLN A 1 7   ? 5.471   -12.445 -14.955 1.00 0.00 ? 7   GLN A O    1  
ATOM 104   C CB   . GLN A 1 7   ? 6.684   -14.379 -12.378 1.00 0.00 ? 7   GLN A CB   1  
ATOM 105   C CG   . GLN A 1 7   ? 7.923   -15.276 -12.396 1.00 0.00 ? 7   GLN A CG   1  
ATOM 106   C CD   . GLN A 1 7   ? 9.140   -14.543 -11.827 1.00 0.00 ? 7   GLN A CD   1  
ATOM 107   O OE1  . GLN A 1 7   ? 10.044  -14.141 -12.540 1.00 0.00 ? 7   GLN A OE1  1  
ATOM 108   N NE2  . GLN A 1 7   ? 9.111   -14.393 -10.506 1.00 0.00 ? 7   GLN A NE2  1  
ATOM 109   H H    . GLN A 1 7   ? 7.695   -12.351 -11.367 1.00 0.00 ? 7   GLN A H    1  
ATOM 110   H HA   . GLN A 1 7   ? 7.637   -13.287 -13.966 1.00 0.00 ? 7   GLN A HA   1  
ATOM 111   H HB2  . GLN A 1 7   ? 6.419   -14.140 -11.348 1.00 0.00 ? 7   GLN A HB2  1  
ATOM 112   H HB3  . GLN A 1 7   ? 5.838   -14.914 -12.809 1.00 0.00 ? 7   GLN A HB3  1  
ATOM 113   H HG2  . GLN A 1 7   ? 7.733   -16.178 -11.815 1.00 0.00 ? 7   GLN A HG2  1  
ATOM 114   H HG3  . GLN A 1 7   ? 8.132   -15.594 -13.418 1.00 0.00 ? 7   GLN A HG3  1  
ATOM 115   H HE21 . GLN A 1 7   ? 8.338   -14.747 -9.979  1.00 0.00 ? 7   GLN A HE21 1  
ATOM 116   H HE22 . GLN A 1 7   ? 9.862   -13.926 -10.039 1.00 0.00 ? 7   GLN A HE22 1  
ATOM 117   N N    . GLY A 1 8   ? 4.718   -12.189 -12.838 1.00 0.00 ? 8   GLY A N    1  
ATOM 118   C CA   . GLY A 1 8   ? 3.430   -11.652 -13.243 1.00 0.00 ? 8   GLY A CA   1  
ATOM 119   C C    . GLY A 1 8   ? 2.367   -11.909 -12.172 1.00 0.00 ? 8   GLY A C    1  
ATOM 120   O O    . GLY A 1 8   ? 1.536   -12.803 -12.320 1.00 0.00 ? 8   GLY A O    1  
ATOM 121   H H    . GLY A 1 8   ? 4.851   -12.268 -11.850 1.00 0.00 ? 8   GLY A H    1  
ATOM 122   H HA2  . GLY A 1 8   ? 3.519   -10.580 -13.422 1.00 0.00 ? 8   GLY A HA2  1  
ATOM 123   H HA3  . GLY A 1 8   ? 3.121   -12.107 -14.183 1.00 0.00 ? 8   GLY A HA3  1  
ATOM 124   N N    . GLN A 1 9   ? 2.429   -11.109 -11.118 1.00 0.00 ? 9   GLN A N    1  
ATOM 125   C CA   . GLN A 1 9   ? 1.483   -11.238 -10.023 1.00 0.00 ? 9   GLN A CA   1  
ATOM 126   C C    . GLN A 1 9   ? 1.445   -9.950  -9.199  1.00 0.00 ? 9   GLN A C    1  
ATOM 127   O O    . GLN A 1 9   ? 2.394   -9.168  -9.219  1.00 0.00 ? 9   GLN A O    1  
ATOM 128   C CB   . GLN A 1 9   ? 1.823   -12.443 -9.144  1.00 0.00 ? 9   GLN A CB   1  
ATOM 129   C CG   . GLN A 1 9   ? 1.096   -13.699 -9.629  1.00 0.00 ? 9   GLN A CG   1  
ATOM 130   C CD   . GLN A 1 9   ? 0.706   -14.595 -8.452  1.00 0.00 ? 9   GLN A CD   1  
ATOM 131   O OE1  . GLN A 1 9   ? -0.459  -14.791 -8.147  1.00 0.00 ? 9   GLN A OE1  1  
ATOM 132   N NE2  . GLN A 1 9   ? 1.742   -15.127 -7.809  1.00 0.00 ? 9   GLN A NE2  1  
ATOM 133   H H    . GLN A 1 9   ? 3.109   -10.384 -11.006 1.00 0.00 ? 9   GLN A H    1  
ATOM 134   H HA   . GLN A 1 9   ? 0.514   -11.404 -10.496 1.00 0.00 ? 9   GLN A HA   1  
ATOM 135   H HB2  . GLN A 1 9   ? 2.900   -12.614 -9.156  1.00 0.00 ? 9   GLN A HB2  1  
ATOM 136   H HB3  . GLN A 1 9   ? 1.546   -12.234 -8.111  1.00 0.00 ? 9   GLN A HB3  1  
ATOM 137   H HG2  . GLN A 1 9   ? 0.204   -13.415 -10.186 1.00 0.00 ? 9   GLN A HG2  1  
ATOM 138   H HG3  . GLN A 1 9   ? 1.737   -14.252 -10.315 1.00 0.00 ? 9   GLN A HG3  1  
ATOM 139   H HE21 . GLN A 1 9   ? 2.674   -14.925 -8.111  1.00 0.00 ? 9   GLN A HE21 1  
ATOM 140   H HE22 . GLN A 1 9   ? 1.589   -15.728 -7.025  1.00 0.00 ? 9   GLN A HE22 1  
ATOM 141   N N    . MET A 1 10  ? 0.339   -9.769  -8.493  1.00 0.00 ? 10  MET A N    1  
ATOM 142   C CA   . MET A 1 10  ? 0.165   -8.590  -7.662  1.00 0.00 ? 10  MET A CA   1  
ATOM 143   C C    . MET A 1 10  ? 0.340   -8.931  -6.181  1.00 0.00 ? 10  MET A C    1  
ATOM 144   O O    . MET A 1 10  ? -0.375  -9.778  -5.647  1.00 0.00 ? 10  MET A O    1  
ATOM 145   C CB   . MET A 1 10  ? -1.230  -8.005  -7.891  1.00 0.00 ? 10  MET A CB   1  
ATOM 146   C CG   . MET A 1 10  ? -1.173  -6.804  -8.837  1.00 0.00 ? 10  MET A CG   1  
ATOM 147   S SD   . MET A 1 10  ? -1.368  -5.289  -7.913  1.00 0.00 ? 10  MET A SD   1  
ATOM 148   C CE   . MET A 1 10  ? -0.059  -4.314  -8.636  1.00 0.00 ? 10  MET A CE   1  
ATOM 149   H H    . MET A 1 10  ? -0.429  -10.410 -8.482  1.00 0.00 ? 10  MET A H    1  
ATOM 150   H HA   . MET A 1 10  ? 0.943   -7.894  -7.976  1.00 0.00 ? 10  MET A HA   1  
ATOM 151   H HB2  . MET A 1 10  ? -1.885  -8.770  -8.308  1.00 0.00 ? 10  MET A HB2  1  
ATOM 152   H HB3  . MET A 1 10  ? -1.662  -7.701  -6.937  1.00 0.00 ? 10  MET A HB3  1  
ATOM 153   H HG2  . MET A 1 10  ? -0.222  -6.795  -9.370  1.00 0.00 ? 10  MET A HG2  1  
ATOM 154   H HG3  . MET A 1 10  ? -1.958  -6.885  -9.589  1.00 0.00 ? 10  MET A HG3  1  
ATOM 155   H HE1  . MET A 1 10  ? -0.108  -4.389  -9.723  1.00 0.00 ? 10  MET A HE1  1  
ATOM 156   H HE2  . MET A 1 10  ? -0.175  -3.272  -8.338  1.00 0.00 ? 10  MET A HE2  1  
ATOM 157   H HE3  . MET A 1 10  ? 0.905   -4.686  -8.290  1.00 0.00 ? 10  MET A HE3  1  
ATOM 158   N N    . VAL A 1 11  ? 1.293   -8.254  -5.559  1.00 0.00 ? 11  VAL A N    1  
ATOM 159   C CA   . VAL A 1 11  ? 1.571   -8.475  -4.150  1.00 0.00 ? 11  VAL A CA   1  
ATOM 160   C C    . VAL A 1 11  ? 1.878   -7.135  -3.479  1.00 0.00 ? 11  VAL A C    1  
ATOM 161   O O    . VAL A 1 11  ? 2.314   -6.192  -4.138  1.00 0.00 ? 11  VAL A O    1  
ATOM 162   C CB   . VAL A 1 11  ? 2.700   -9.495  -3.992  1.00 0.00 ? 11  VAL A CB   1  
ATOM 163   C CG1  . VAL A 1 11  ? 2.262   -10.877 -4.482  1.00 0.00 ? 11  VAL A CG1  1  
ATOM 164   C CG2  . VAL A 1 11  ? 3.964   -9.031  -4.720  1.00 0.00 ? 11  VAL A CG2  1  
ATOM 165   H H    . VAL A 1 11  ? 1.870   -7.566  -6.000  1.00 0.00 ? 11  VAL A H    1  
ATOM 166   H HA   . VAL A 1 11  ? 0.671   -8.894  -3.700  1.00 0.00 ? 11  VAL A HA   1  
ATOM 167   H HB   . VAL A 1 11  ? 2.934   -9.574  -2.931  1.00 0.00 ? 11  VAL A HB   1  
ATOM 168   H HG11 . VAL A 1 11  ? 1.241   -11.072 -4.153  1.00 0.00 ? 11  VAL A HG11 1  
ATOM 169   H HG12 . VAL A 1 11  ? 2.306   -10.908 -5.570  1.00 0.00 ? 11  VAL A HG12 1  
ATOM 170   H HG13 . VAL A 1 11  ? 2.927   -11.636 -4.069  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 171   H HG21 . VAL A 1 11  ? 4.205   -8.013  -4.415  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 172   H HG22 . VAL A 1 11  ? 4.792   -9.693  -4.466  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 173   H HG23 . VAL A 1 11  ? 3.794   -9.058  -5.796  1.00 0.00 ? 11  VAL A HG23 1  
ATOM 174   N N    . HIS A 1 12  ? 1.639   -7.093  -2.176  1.00 0.00 ? 12  HIS A N    1  
ATOM 175   C CA   . HIS A 1 12  ? 1.885   -5.884  -1.409  1.00 0.00 ? 12  HIS A CA   1  
ATOM 176   C C    . HIS A 1 12  ? 3.171   -6.045  -0.595  1.00 0.00 ? 12  HIS A C    1  
ATOM 177   O O    . HIS A 1 12  ? 3.622   -7.164  -0.357  1.00 0.00 ? 12  HIS A O    1  
ATOM 178   C CB   . HIS A 1 12  ? 0.674   -5.535  -0.541  1.00 0.00 ? 12  HIS A CB   1  
ATOM 179   C CG   . HIS A 1 12  ? 0.259   -6.637  0.405   1.00 0.00 ? 12  HIS A CG   1  
ATOM 180   N ND1  . HIS A 1 12  ? 1.036   -7.036  1.478   1.00 0.00 ? 12  HIS A ND1  1  
ATOM 181   C CD2  . HIS A 1 12  ? -0.859  -7.418  0.427   1.00 0.00 ? 12  HIS A CD2  1  
ATOM 182   C CE1  . HIS A 1 12  ? 0.405   -8.014  2.111   1.00 0.00 ? 12  HIS A CE1  1  
ATOM 183   N NE2  . HIS A 1 12  ? -0.769  -8.249  1.458   1.00 0.00 ? 12  HIS A NE2  1  
ATOM 184   H H    . HIS A 1 12  ? 1.284   -7.864  -1.648  1.00 0.00 ? 12  HIS A H    1  
ATOM 185   H HA   . HIS A 1 12  ? 2.020   -5.077  -2.130  1.00 0.00 ? 12  HIS A HA   1  
ATOM 186   H HB2  . HIS A 1 12  ? 0.900   -4.640  0.038   1.00 0.00 ? 12  HIS A HB2  1  
ATOM 187   H HB3  . HIS A 1 12  ? -0.167  -5.291  -1.190  1.00 0.00 ? 12  HIS A HB3  1  
ATOM 188   H HD1  . HIS A 1 12  ? 1.923   -6.651  1.733   1.00 0.00 ? 12  HIS A HD1  1  
ATOM 189   H HD2  . HIS A 1 12  ? -1.686  -7.367  -0.281  1.00 0.00 ? 12  HIS A HD2  1  
ATOM 190   H HE1  . HIS A 1 12  ? 0.761   -8.538  2.997   1.00 0.00 ? 12  HIS A HE1  1  
ATOM 191   H HE2  . HIS A 1 12  ? -1.475  -8.896  1.746   1.00 0.00 ? 12  HIS A HE2  1  
ATOM 192   N N    . GLN A 1 13  ? 3.724   -4.910  -0.192  1.00 0.00 ? 13  GLN A N    1  
ATOM 193   C CA   . GLN A 1 13  ? 4.949   -4.911  0.590   1.00 0.00 ? 13  GLN A CA   1  
ATOM 194   C C    . GLN A 1 13  ? 4.724   -4.207  1.929   1.00 0.00 ? 13  GLN A C    1  
ATOM 195   O O    . GLN A 1 13  ? 5.583   -3.458  2.392   1.00 0.00 ? 13  GLN A O    1  
ATOM 196   C CB   . GLN A 1 13  ? 6.095   -4.261  -0.187  1.00 0.00 ? 13  GLN A CB   1  
ATOM 197   C CG   . GLN A 1 13  ? 5.758   -2.814  -0.552  1.00 0.00 ? 13  GLN A CG   1  
ATOM 198   C CD   . GLN A 1 13  ? 6.702   -2.287  -1.635  1.00 0.00 ? 13  GLN A CD   1  
ATOM 199   O OE1  . GLN A 1 13  ? 7.348   -1.263  -1.487  1.00 0.00 ? 13  GLN A OE1  1  
ATOM 200   N NE2  . GLN A 1 13  ? 6.745   -3.043  -2.729  1.00 0.00 ? 13  GLN A NE2  1  
ATOM 201   H H    . GLN A 1 13  ? 3.350   -4.004  -0.390  1.00 0.00 ? 13  GLN A H    1  
ATOM 202   H HA   . GLN A 1 13  ? 5.183   -5.962  0.759   1.00 0.00 ? 13  GLN A HA   1  
ATOM 203   H HB2  . GLN A 1 13  ? 7.005   -4.285  0.413   1.00 0.00 ? 13  GLN A HB2  1  
ATOM 204   H HB3  . GLN A 1 13  ? 6.295   -4.831  -1.093  1.00 0.00 ? 13  GLN A HB3  1  
ATOM 205   H HG2  . GLN A 1 13  ? 4.728   -2.754  -0.902  1.00 0.00 ? 13  GLN A HG2  1  
ATOM 206   H HG3  . GLN A 1 13  ? 5.830   -2.185  0.336   1.00 0.00 ? 13  GLN A HG3  1  
ATOM 207   H HE21 . GLN A 1 13  ? 6.189   -3.872  -2.786  1.00 0.00 ? 13  GLN A HE21 1  
ATOM 208   H HE22 . GLN A 1 13  ? 7.334   -2.781  -3.494  1.00 0.00 ? 13  GLN A HE22 1  
ATOM 209   N N    . ALA A 1 14  ? 3.565   -4.473  2.514   1.00 0.00 ? 14  ALA A N    1  
ATOM 210   C CA   . ALA A 1 14  ? 3.217   -3.874  3.791   1.00 0.00 ? 14  ALA A CA   1  
ATOM 211   C C    . ALA A 1 14  ? 3.515   -2.374  3.744   1.00 0.00 ? 14  ALA A C    1  
ATOM 212   O O    . ALA A 1 14  ? 3.884   -1.843  2.698   1.00 0.00 ? 14  ALA A O    1  
ATOM 213   C CB   . ALA A 1 14  ? 3.977   -4.584  4.913   1.00 0.00 ? 14  ALA A CB   1  
ATOM 214   H H    . ALA A 1 14  ? 2.872   -5.083  2.131   1.00 0.00 ? 14  ALA A H    1  
ATOM 215   H HA   . ALA A 1 14  ? 2.148   -4.019  3.945   1.00 0.00 ? 14  ALA A HA   1  
ATOM 216   H HB1  . ALA A 1 14  ? 4.484   -5.461  4.510   1.00 0.00 ? 14  ALA A HB1  1  
ATOM 217   H HB2  . ALA A 1 14  ? 3.276   -4.894  5.688   1.00 0.00 ? 14  ALA A HB2  1  
ATOM 218   H HB3  . ALA A 1 14  ? 4.714   -3.904  5.340   1.00 0.00 ? 14  ALA A HB3  1  
ATOM 219   N N    . ILE A 1 15  ? 3.343   -1.732  4.891   1.00 0.00 ? 15  ILE A N    1  
ATOM 220   C CA   . ILE A 1 15  ? 3.589   -0.304  4.994   1.00 0.00 ? 15  ILE A CA   1  
ATOM 221   C C    . ILE A 1 15  ? 5.092   -0.059  5.142   1.00 0.00 ? 15  ILE A C    1  
ATOM 222   O O    . ILE A 1 15  ? 5.886   -0.996  5.078   1.00 0.00 ? 15  ILE A O    1  
ATOM 223   C CB   . ILE A 1 15  ? 2.752   0.304   6.121   1.00 0.00 ? 15  ILE A CB   1  
ATOM 224   C CG1  . ILE A 1 15  ? 2.377   1.753   5.806   1.00 0.00 ? 15  ILE A CG1  1  
ATOM 225   C CG2  . ILE A 1 15  ? 3.470   0.178   7.466   1.00 0.00 ? 15  ILE A CG2  1  
ATOM 226   C CD1  . ILE A 1 15  ? 0.914   2.030   6.156   1.00 0.00 ? 15  ILE A CD1  1  
ATOM 227   H H    . ILE A 1 15  ? 3.043   -2.172  5.738   1.00 0.00 ? 15  ILE A H    1  
ATOM 228   H HA   . ILE A 1 15  ? 3.255   0.153   4.062   1.00 0.00 ? 15  ILE A HA   1  
ATOM 229   H HB   . ILE A 1 15  ? 1.822   -0.260  6.199   1.00 0.00 ? 15  ILE A HB   1  
ATOM 230   H HG12 . ILE A 1 15  ? 3.023   2.430   6.365   1.00 0.00 ? 15  ILE A HG12 1  
ATOM 231   H HG13 . ILE A 1 15  ? 2.545   1.954   4.748   1.00 0.00 ? 15  ILE A HG13 1  
ATOM 232   H HG21 . ILE A 1 15  ? 4.155   -0.670  7.435   1.00 0.00 ? 15  ILE A HG21 1  
ATOM 233   H HG22 . ILE A 1 15  ? 4.031   1.090   7.666   1.00 0.00 ? 15  ILE A HG22 1  
ATOM 234   H HG23 . ILE A 1 15  ? 2.736   0.022   8.257   1.00 0.00 ? 15  ILE A HG23 1  
ATOM 235   H HD11 . ILE A 1 15  ? 0.529   1.219   6.775   1.00 0.00 ? 15  ILE A HD11 1  
ATOM 236   H HD12 . ILE A 1 15  ? 0.843   2.970   6.704   1.00 0.00 ? 15  ILE A HD12 1  
ATOM 237   H HD13 . ILE A 1 15  ? 0.327   2.097   5.240   1.00 0.00 ? 15  ILE A HD13 1  
ATOM 238   N N    . SER A 1 16  ? 5.436   1.205   5.338   1.00 0.00 ? 16  SER A N    1  
ATOM 239   C CA   . SER A 1 16  ? 6.830   1.586   5.497   1.00 0.00 ? 16  SER A CA   1  
ATOM 240   C C    . SER A 1 16  ? 7.001   2.429   6.761   1.00 0.00 ? 16  SER A C    1  
ATOM 241   O O    . SER A 1 16  ? 6.095   3.164   7.149   1.00 0.00 ? 16  SER A O    1  
ATOM 242   C CB   . SER A 1 16  ? 7.333   2.354   4.273   1.00 0.00 ? 16  SER A CB   1  
ATOM 243   O OG   . SER A 1 16  ? 8.304   3.337   4.623   1.00 0.00 ? 16  SER A OG   1  
ATOM 244   H H    . SER A 1 16  ? 4.784   1.961   5.389   1.00 0.00 ? 16  SER A H    1  
ATOM 245   H HA   . SER A 1 16  ? 7.376   0.647   5.586   1.00 0.00 ? 16  SER A HA   1  
ATOM 246   H HB2  . SER A 1 16  ? 7.767   1.654   3.559   1.00 0.00 ? 16  SER A HB2  1  
ATOM 247   H HB3  . SER A 1 16  ? 6.492   2.836   3.776   1.00 0.00 ? 16  SER A HB3  1  
ATOM 248   H HG   . SER A 1 16  ? 9.172   3.138   4.168   1.00 0.00 ? 16  SER A HG   1  
ATOM 249   N N    . PRO A 1 17  ? 8.202   2.292   7.385   1.00 0.00 ? 17  PRO A N    1  
ATOM 250   C CA   . PRO A 1 17  ? 8.504   3.033   8.598   1.00 0.00 ? 17  PRO A CA   1  
ATOM 251   C C    . PRO A 1 17  ? 8.796   4.502   8.285   1.00 0.00 ? 17  PRO A C    1  
ATOM 252   O O    . PRO A 1 17  ? 8.407   5.390   9.040   1.00 0.00 ? 17  PRO A O    1  
ATOM 253   C CB   . PRO A 1 17  ? 9.690   2.310   9.215   1.00 0.00 ? 17  PRO A CB   1  
ATOM 254   C CG   . PRO A 1 17  ? 10.300  1.479   8.098   1.00 0.00 ? 17  PRO A CG   1  
ATOM 255   C CD   . PRO A 1 17  ? 9.299   1.431   6.954   1.00 0.00 ? 17  PRO A CD   1  
ATOM 256   H HA   . PRO A 1 17  ? 7.713   3.036   9.209   1.00 0.00 ? 17  PRO A HA   1  
ATOM 257   H HB2  . PRO A 1 17  ? 10.416  3.019   9.614   1.00 0.00 ? 17  PRO A HB2  1  
ATOM 258   H HB3  . PRO A 1 17  ? 9.374   1.677   10.045  1.00 0.00 ? 17  PRO A HB3  1  
ATOM 259   H HG2  . PRO A 1 17  ? 11.240  1.918   7.764   1.00 0.00 ? 17  PRO A HG2  1  
ATOM 260   H HG3  . PRO A 1 17  ? 10.525  0.472   8.450   1.00 0.00 ? 17  PRO A HG3  1  
ATOM 261   H HD2  . PRO A 1 17  ? 9.743   1.789   6.025   1.00 0.00 ? 17  PRO A HD2  1  
ATOM 262   H HD3  . PRO A 1 17  ? 8.956   0.413   6.771   1.00 0.00 ? 17  PRO A HD3  1  
ATOM 263   N N    . ARG A 1 18  ? 9.480   4.711   7.169   1.00 0.00 ? 18  ARG A N    1  
ATOM 264   C CA   . ARG A 1 18  ? 9.828   6.057   6.747   1.00 0.00 ? 18  ARG A CA   1  
ATOM 265   C C    . ARG A 1 18  ? 8.568   6.837   6.368   1.00 0.00 ? 18  ARG A C    1  
ATOM 266   O O    . ARG A 1 18  ? 8.497   8.048   6.575   1.00 0.00 ? 18  ARG A O    1  
ATOM 267   C CB   . ARG A 1 18  ? 10.782  6.029   5.550   1.00 0.00 ? 18  ARG A CB   1  
ATOM 268   C CG   . ARG A 1 18  ? 11.797  7.171   5.631   1.00 0.00 ? 18  ARG A CG   1  
ATOM 269   C CD   . ARG A 1 18  ? 11.327  8.381   4.821   1.00 0.00 ? 18  ARG A CD   1  
ATOM 270   N NE   . ARG A 1 18  ? 11.484  8.112   3.374   1.00 0.00 ? 18  ARG A NE   1  
ATOM 271   C CZ   . ARG A 1 18  ? 12.654  8.168   2.723   1.00 0.00 ? 18  ARG A CZ   1  
ATOM 272   N NH1  . ARG A 1 18  ? 13.776  8.482   3.386   1.00 0.00 ? 18  ARG A NH1  1  
ATOM 273   N NH2  . ARG A 1 18  ? 12.703  7.909   1.409   1.00 0.00 ? 18  ARG A NH2  1  
ATOM 274   H H    . ARG A 1 18  ? 9.793   3.982   6.560   1.00 0.00 ? 18  ARG A H    1  
ATOM 275   H HA   . ARG A 1 18  ? 10.320  6.502   7.612   1.00 0.00 ? 18  ARG A HA   1  
ATOM 276   H HB2  . ARG A 1 18  ? 11.306  5.074   5.521   1.00 0.00 ? 18  ARG A HB2  1  
ATOM 277   H HB3  . ARG A 1 18  ? 10.212  6.109   4.625   1.00 0.00 ? 18  ARG A HB3  1  
ATOM 278   H HG2  . ARG A 1 18  ? 11.941  7.461   6.672   1.00 0.00 ? 18  ARG A HG2  1  
ATOM 279   H HG3  . ARG A 1 18  ? 12.762  6.831   5.258   1.00 0.00 ? 18  ARG A HG3  1  
ATOM 280   H HD2  . ARG A 1 18  ? 10.283  8.597   5.047   1.00 0.00 ? 18  ARG A HD2  1  
ATOM 281   H HD3  . ARG A 1 18  ? 11.903  9.263   5.100   1.00 0.00 ? 18  ARG A HD3  1  
ATOM 282   H HE   . ARG A 1 18  ? 10.667  7.875   2.849   1.00 0.00 ? 18  ARG A HE   1  
ATOM 283   H HH11 . ARG A 1 18  ? 13.740  8.675   4.366   1.00 0.00 ? 18  ARG A HH11 1  
ATOM 284   H HH12 . ARG A 1 18  ? 14.649  8.523   2.900   1.00 0.00 ? 18  ARG A HH12 1  
ATOM 285   H HH21 . ARG A 1 18  ? 11.866  7.675   0.914   1.00 0.00 ? 18  ARG A HH21 1  
ATOM 286   H HH22 . ARG A 1 18  ? 13.576  7.950   0.923   1.00 0.00 ? 18  ARG A HH22 1  
ATOM 287   N N    . THR A 1 19  ? 7.604   6.113   5.819   1.00 0.00 ? 19  THR A N    1  
ATOM 288   C CA   . THR A 1 19  ? 6.351   6.722   5.409   1.00 0.00 ? 19  THR A CA   1  
ATOM 289   C C    . THR A 1 19  ? 5.495   7.056   6.632   1.00 0.00 ? 19  THR A C    1  
ATOM 290   O O    . THR A 1 19  ? 5.025   8.183   6.777   1.00 0.00 ? 19  THR A O    1  
ATOM 291   C CB   . THR A 1 19  ? 5.662   5.772   4.426   1.00 0.00 ? 19  THR A CB   1  
ATOM 292   O OG1  . THR A 1 19  ? 5.717   6.462   3.181   1.00 0.00 ? 19  THR A OG1  1  
ATOM 293   C CG2  . THR A 1 19  ? 4.165   5.625   4.706   1.00 0.00 ? 19  THR A CG2  1  
ATOM 294   H H    . THR A 1 19  ? 7.670   5.129   5.653   1.00 0.00 ? 19  THR A H    1  
ATOM 295   H HA   . THR A 1 19  ? 6.574   7.664   4.908   1.00 0.00 ? 19  THR A HA   1  
ATOM 296   H HB   . THR A 1 19  ? 6.154   4.800   4.416   1.00 0.00 ? 19  THR A HB   1  
ATOM 297   H HG1  . THR A 1 19  ? 5.126   7.268   3.210   1.00 0.00 ? 19  THR A HG1  1  
ATOM 298   H HG21 . THR A 1 19  ? 4.019   5.271   5.726   1.00 0.00 ? 19  THR A HG21 1  
ATOM 299   H HG22 . THR A 1 19  ? 3.676   6.591   4.583   1.00 0.00 ? 19  THR A HG22 1  
ATOM 300   H HG23 . THR A 1 19  ? 3.734   4.908   4.007   1.00 0.00 ? 19  THR A HG23 1  
ATOM 301   N N    . LEU A 1 20  ? 5.318   6.054   7.482   1.00 0.00 ? 20  LEU A N    1  
ATOM 302   C CA   . LEU A 1 20  ? 4.527   6.228   8.688   1.00 0.00 ? 20  LEU A CA   1  
ATOM 303   C C    . LEU A 1 20  ? 5.183   7.287   9.575   1.00 0.00 ? 20  LEU A C    1  
ATOM 304   O O    . LEU A 1 20  ? 4.495   8.107   10.182  1.00 0.00 ? 20  LEU A O    1  
ATOM 305   C CB   . LEU A 1 20  ? 4.316   4.884   9.388   1.00 0.00 ? 20  LEU A CB   1  
ATOM 306   C CG   . LEU A 1 20  ? 3.177   4.017   8.848   1.00 0.00 ? 20  LEU A CG   1  
ATOM 307   C CD1  . LEU A 1 20  ? 3.272   2.588   9.387   1.00 0.00 ? 20  LEU A CD1  1  
ATOM 308   C CD2  . LEU A 1 20  ? 1.817   4.652   9.144   1.00 0.00 ? 20  LEU A CD2  1  
ATOM 309   H H    . LEU A 1 20  ? 5.703   5.140   7.356   1.00 0.00 ? 20  LEU A H    1  
ATOM 310   H HA   . LEU A 1 20  ? 3.545   6.590   8.385   1.00 0.00 ? 20  LEU A HA   1  
ATOM 311   H HB2  . LEU A 1 20  ? 5.243   4.313   9.323   1.00 0.00 ? 20  LEU A HB2  1  
ATOM 312   H HB3  . LEU A 1 20  ? 4.133   5.072   10.446  1.00 0.00 ? 20  LEU A HB3  1  
ATOM 313   H HG   . LEU A 1 20  ? 3.277   3.959   7.764   1.00 0.00 ? 20  LEU A HG   1  
ATOM 314   H HD11 . LEU A 1 20  ? 4.296   2.228   9.284   1.00 0.00 ? 20  LEU A HD11 1  
ATOM 315   H HD12 . LEU A 1 20  ? 2.988   2.577   10.439  1.00 0.00 ? 20  LEU A HD12 1  
ATOM 316   H HD13 . LEU A 1 20  ? 2.601   1.941   8.822   1.00 0.00 ? 20  LEU A HD13 1  
ATOM 317   H HD21 . LEU A 1 20  ? 1.814   5.683   8.792   1.00 0.00 ? 20  LEU A HD21 1  
ATOM 318   H HD22 . LEU A 1 20  ? 1.035   4.090   8.632   1.00 0.00 ? 20  LEU A HD22 1  
ATOM 319   H HD23 . LEU A 1 20  ? 1.634   4.634   10.218  1.00 0.00 ? 20  LEU A HD23 1  
ATOM 320   N N    . ASN A 1 21  ? 6.506   7.236   9.623   1.00 0.00 ? 21  ASN A N    1  
ATOM 321   C CA   . ASN A 1 21  ? 7.263   8.182   10.426  1.00 0.00 ? 21  ASN A CA   1  
ATOM 322   C C    . ASN A 1 21  ? 6.980   9.603   9.935   1.00 0.00 ? 21  ASN A C    1  
ATOM 323   O O    . ASN A 1 21  ? 6.489   10.439  10.692  1.00 0.00 ? 21  ASN A O    1  
ATOM 324   C CB   . ASN A 1 21  ? 8.767   7.930   10.303  1.00 0.00 ? 21  ASN A CB   1  
ATOM 325   C CG   . ASN A 1 21  ? 9.555   8.847   11.239  1.00 0.00 ? 21  ASN A CG   1  
ATOM 326   O OD1  . ASN A 1 21  ? 9.169   9.106   12.367  1.00 0.00 ? 21  ASN A OD1  1  
ATOM 327   N ND2  . ASN A 1 21  ? 10.679  9.322   10.711  1.00 0.00 ? 21  ASN A ND2  1  
ATOM 328   H H    . ASN A 1 21  ? 7.058   6.566   9.127   1.00 0.00 ? 21  ASN A H    1  
ATOM 329   H HA   . ASN A 1 21  ? 6.927   8.020   11.451  1.00 0.00 ? 21  ASN A HA   1  
ATOM 330   H HB2  . ASN A 1 21  ? 8.985   6.888   10.539  1.00 0.00 ? 21  ASN A HB2  1  
ATOM 331   H HB3  . ASN A 1 21  ? 9.084   8.096   9.273   1.00 0.00 ? 21  ASN A HB3  1  
ATOM 332   H HD21 . ASN A 1 21  ? 10.939  9.070   9.779   1.00 0.00 ? 21  ASN A HD21 1  
ATOM 333   H HD22 . ASN A 1 21  ? 11.265  9.931   11.246  1.00 0.00 ? 21  ASN A HD22 1  
ATOM 334   N N    . ALA A 1 22  ? 7.301   9.832   8.670   1.00 0.00 ? 22  ALA A N    1  
ATOM 335   C CA   . ALA A 1 22  ? 7.087   11.138  8.069   1.00 0.00 ? 22  ALA A CA   1  
ATOM 336   C C    . ALA A 1 22  ? 5.633   11.562  8.285   1.00 0.00 ? 22  ALA A C    1  
ATOM 337   O O    . ALA A 1 22  ? 5.365   12.701  8.666   1.00 0.00 ? 22  ALA A O    1  
ATOM 338   C CB   . ALA A 1 22  ? 7.465   11.086  6.588   1.00 0.00 ? 22  ALA A CB   1  
ATOM 339   H H    . ALA A 1 22  ? 7.699   9.147   8.061   1.00 0.00 ? 22  ALA A H    1  
ATOM 340   H HA   . ALA A 1 22  ? 7.743   11.847  8.574   1.00 0.00 ? 22  ALA A HA   1  
ATOM 341   H HB1  . ALA A 1 22  ? 7.167   12.016  6.104   1.00 0.00 ? 22  ALA A HB1  1  
ATOM 342   H HB2  . ALA A 1 22  ? 8.543   10.957  6.492   1.00 0.00 ? 22  ALA A HB2  1  
ATOM 343   H HB3  . ALA A 1 22  ? 6.956   10.248  6.112   1.00 0.00 ? 22  ALA A HB3  1  
ATOM 344   N N    . TRP A 1 23  ? 4.732   10.624  8.033   1.00 0.00 ? 23  TRP A N    1  
ATOM 345   C CA   . TRP A 1 23  ? 3.313   10.886  8.195   1.00 0.00 ? 23  TRP A CA   1  
ATOM 346   C C    . TRP A 1 23  ? 3.091   11.437  9.605   1.00 0.00 ? 23  TRP A C    1  
ATOM 347   O O    . TRP A 1 23  ? 2.628   12.565  9.769   1.00 0.00 ? 23  TRP A O    1  
ATOM 348   C CB   . TRP A 1 23  ? 2.487   9.631   7.907   1.00 0.00 ? 23  TRP A CB   1  
ATOM 349   C CG   . TRP A 1 23  ? 1.006   9.764   8.268   1.00 0.00 ? 23  TRP A CG   1  
ATOM 350   C CD1  . TRP A 1 23  ? 0.338   9.146   9.251   1.00 0.00 ? 23  TRP A CD1  1  
ATOM 351   C CD2  . TRP A 1 23  ? 0.031   10.596  7.605   1.00 0.00 ? 23  TRP A CD2  1  
ATOM 352   N NE1  . TRP A 1 23  ? -0.991  9.517   9.271   1.00 0.00 ? 23  TRP A NE1  1  
ATOM 353   C CE2  . TRP A 1 23  ? -1.184  10.427  8.238   1.00 0.00 ? 23  TRP A CE2  1  
ATOM 354   C CE3  . TRP A 1 23  ? 0.170   11.463  6.508   1.00 0.00 ? 23  TRP A CE3  1  
ATOM 355   C CZ2  . TRP A 1 23  ? -2.352  11.092  7.846   1.00 0.00 ? 23  TRP A CZ2  1  
ATOM 356   C CZ3  . TRP A 1 23  ? -1.006  12.120  6.128   1.00 0.00 ? 23  TRP A CZ3  1  
ATOM 357   C CH2  . TRP A 1 23  ? -2.237  11.961  6.754   1.00 0.00 ? 23  TRP A CH2  1  
ATOM 358   H H    . TRP A 1 23  ? 4.959   9.700   7.724   1.00 0.00 ? 23  TRP A H    1  
ATOM 359   H HA   . TRP A 1 23  ? 3.025   11.632  7.454   1.00 0.00 ? 23  TRP A HA   1  
ATOM 360   H HB2  . TRP A 1 23  ? 2.571   9.387   6.848   1.00 0.00 ? 23  TRP A HB2  1  
ATOM 361   H HB3  . TRP A 1 23  ? 2.911   8.794   8.461   1.00 0.00 ? 23  TRP A HB3  1  
ATOM 362   H HD1  . TRP A 1 23  ? 0.787   8.438   9.948   1.00 0.00 ? 23  TRP A HD1  1  
ATOM 363   H HE1  . TRP A 1 23  ? -1.750  9.162   9.968   1.00 0.00 ? 23  TRP A HE1  1  
ATOM 364   H HE3  . TRP A 1 23  ? 1.118   11.614  5.991   1.00 0.00 ? 23  TRP A HE3  1  
ATOM 365   H HZ2  . TRP A 1 23  ? -3.300  10.941  8.362   1.00 0.00 ? 23  TRP A HZ2  1  
ATOM 366   H HZ3  . TRP A 1 23  ? -0.953  12.805  5.281   1.00 0.00 ? 23  TRP A HZ3  1  
ATOM 367   H HH2  . TRP A 1 23  ? -3.108  12.510  6.397   1.00 0.00 ? 23  TRP A HH2  1  
ATOM 368   N N    . VAL A 1 24  ? 3.433   10.616  10.587  1.00 0.00 ? 24  VAL A N    1  
ATOM 369   C CA   . VAL A 1 24  ? 3.277   11.006  11.978  1.00 0.00 ? 24  VAL A CA   1  
ATOM 370   C C    . VAL A 1 24  ? 3.813   12.427  12.167  1.00 0.00 ? 24  VAL A C    1  
ATOM 371   O O    . VAL A 1 24  ? 3.196   13.241  12.851  1.00 0.00 ? 24  VAL A O    1  
ATOM 372   C CB   . VAL A 1 24  ? 3.961   9.984   12.888  1.00 0.00 ? 24  VAL A CB   1  
ATOM 373   C CG1  . VAL A 1 24  ? 4.002   10.479  14.335  1.00 0.00 ? 24  VAL A CG1  1  
ATOM 374   C CG2  . VAL A 1 24  ? 3.273   8.621   12.795  1.00 0.00 ? 24  VAL A CG2  1  
ATOM 375   H H    . VAL A 1 24  ? 3.809   9.700   10.445  1.00 0.00 ? 24  VAL A H    1  
ATOM 376   H HA   . VAL A 1 24  ? 2.211   11.001  12.204  1.00 0.00 ? 24  VAL A HA   1  
ATOM 377   H HB   . VAL A 1 24  ? 4.988   9.864   12.546  1.00 0.00 ? 24  VAL A HB   1  
ATOM 378   H HG11 . VAL A 1 24  ? 4.258   11.539  14.349  1.00 0.00 ? 24  VAL A HG11 1  
ATOM 379   H HG12 . VAL A 1 24  ? 3.024   10.336  14.796  1.00 0.00 ? 24  VAL A HG12 1  
ATOM 380   H HG13 . VAL A 1 24  ? 4.751   9.916   14.891  1.00 0.00 ? 24  VAL A HG13 1  
ATOM 381   H HG21 . VAL A 1 24  ? 2.350   8.718   12.222  1.00 0.00 ? 24  VAL A HG21 1  
ATOM 382   H HG22 . VAL A 1 24  ? 3.936   7.912   12.298  1.00 0.00 ? 24  VAL A HG22 1  
ATOM 383   H HG23 . VAL A 1 24  ? 3.042   8.260   13.797  1.00 0.00 ? 24  VAL A HG23 1  
ATOM 384   N N    . LYS A 1 25  ? 4.957   12.681  11.548  1.00 0.00 ? 25  LYS A N    1  
ATOM 385   C CA   . LYS A 1 25  ? 5.583   13.989  11.639  1.00 0.00 ? 25  LYS A CA   1  
ATOM 386   C C    . LYS A 1 25  ? 4.644   15.042  11.046  1.00 0.00 ? 25  LYS A C    1  
ATOM 387   O O    . LYS A 1 25  ? 4.484   16.124  11.608  1.00 0.00 ? 25  LYS A O    1  
ATOM 388   C CB   . LYS A 1 25  ? 6.969   13.967  10.992  1.00 0.00 ? 25  LYS A CB   1  
ATOM 389   C CG   . LYS A 1 25  ? 7.918   14.941  11.693  1.00 0.00 ? 25  LYS A CG   1  
ATOM 390   C CD   . LYS A 1 25  ? 8.718   15.755  10.675  1.00 0.00 ? 25  LYS A CD   1  
ATOM 391   C CE   . LYS A 1 25  ? 8.726   17.240  11.044  1.00 0.00 ? 25  LYS A CE   1  
ATOM 392   N NZ   . LYS A 1 25  ? 9.932   17.571  11.835  1.00 0.00 ? 25  LYS A NZ   1  
ATOM 393   H H    . LYS A 1 25  ? 5.453   12.013  10.993  1.00 0.00 ? 25  LYS A H    1  
ATOM 394   H HA   . LYS A 1 25  ? 5.725   14.210  12.697  1.00 0.00 ? 25  LYS A HA   1  
ATOM 395   H HB2  . LYS A 1 25  ? 7.379   12.958  11.036  1.00 0.00 ? 25  LYS A HB2  1  
ATOM 396   H HB3  . LYS A 1 25  ? 6.886   14.230  9.937   1.00 0.00 ? 25  LYS A HB3  1  
ATOM 397   H HG2  . LYS A 1 25  ? 7.346   15.613  12.333  1.00 0.00 ? 25  LYS A HG2  1  
ATOM 398   H HG3  . LYS A 1 25  ? 8.600   14.388  12.339  1.00 0.00 ? 25  LYS A HG3  1  
ATOM 399   H HD2  . LYS A 1 25  ? 9.742   15.383  10.630  1.00 0.00 ? 25  LYS A HD2  1  
ATOM 400   H HD3  . LYS A 1 25  ? 8.288   15.626  9.682   1.00 0.00 ? 25  LYS A HD3  1  
ATOM 401   H HE2  . LYS A 1 25  ? 8.699   17.846  10.139  1.00 0.00 ? 25  LYS A HE2  1  
ATOM 402   H HE3  . LYS A 1 25  ? 7.830   17.482  11.617  1.00 0.00 ? 25  LYS A HE3  1  
ATOM 403   H HZ1  . LYS A 1 25  ? 10.748  17.284  11.334  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 404   H HZ2  . LYS A 1 25  ? 9.967   18.558  11.992  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 405   H HZ3  . LYS A 1 25  ? 9.895   17.095  12.714  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 406   N N    . VAL A 1 26  ? 4.047   14.687  9.917   1.00 0.00 ? 26  VAL A N    1  
ATOM 407   C CA   . VAL A 1 26  ? 3.129   15.587  9.241   1.00 0.00 ? 26  VAL A CA   1  
ATOM 408   C C    . VAL A 1 26  ? 1.922   15.851  10.145  1.00 0.00 ? 26  VAL A C    1  
ATOM 409   O O    . VAL A 1 26  ? 1.696   16.983  10.570  1.00 0.00 ? 26  VAL A O    1  
ATOM 410   C CB   . VAL A 1 26  ? 2.740   15.012  7.878   1.00 0.00 ? 26  VAL A CB   1  
ATOM 411   C CG1  . VAL A 1 26  ? 1.682   15.882  7.197   1.00 0.00 ? 26  VAL A CG1  1  
ATOM 412   C CG2  . VAL A 1 26  ? 3.970   14.844  6.983   1.00 0.00 ? 26  VAL A CG2  1  
ATOM 413   H H    . VAL A 1 26  ? 4.183   13.805  9.466   1.00 0.00 ? 26  VAL A H    1  
ATOM 414   H HA   . VAL A 1 26  ? 3.653   16.528  9.074   1.00 0.00 ? 26  VAL A HA   1  
ATOM 415   H HB   . VAL A 1 26  ? 2.308   14.025  8.042   1.00 0.00 ? 26  VAL A HB   1  
ATOM 416   H HG11 . VAL A 1 26  ? 0.996   16.275  7.948   1.00 0.00 ? 26  VAL A HG11 1  
ATOM 417   H HG12 . VAL A 1 26  ? 2.169   16.710  6.681   1.00 0.00 ? 26  VAL A HG12 1  
ATOM 418   H HG13 . VAL A 1 26  ? 1.126   15.282  6.477   1.00 0.00 ? 26  VAL A HG13 1  
ATOM 419   H HG21 . VAL A 1 26  ? 4.852   14.689  7.604   1.00 0.00 ? 26  VAL A HG21 1  
ATOM 420   H HG22 . VAL A 1 26  ? 3.829   13.982  6.331   1.00 0.00 ? 26  VAL A HG22 1  
ATOM 421   H HG23 . VAL A 1 26  ? 4.104   15.740  6.378   1.00 0.00 ? 26  VAL A HG23 1  
ATOM 422   N N    . VAL A 1 27  ? 1.180   14.786  10.412  1.00 0.00 ? 27  VAL A N    1  
ATOM 423   C CA   . VAL A 1 27  ? 0.002   14.888  11.257  1.00 0.00 ? 27  VAL A CA   1  
ATOM 424   C C    . VAL A 1 27  ? 0.320   15.776  12.462  1.00 0.00 ? 27  VAL A C    1  
ATOM 425   O O    . VAL A 1 27  ? -0.513  16.575  12.886  1.00 0.00 ? 27  VAL A O    1  
ATOM 426   C CB   . VAL A 1 27  ? -0.480  13.491  11.654  1.00 0.00 ? 27  VAL A CB   1  
ATOM 427   C CG1  . VAL A 1 27  ? -1.709  13.572  12.561  1.00 0.00 ? 27  VAL A CG1  1  
ATOM 428   C CG2  . VAL A 1 27  ? -0.767  12.638  10.417  1.00 0.00 ? 27  VAL A CG2  1  
ATOM 429   H H    . VAL A 1 27  ? 1.371   13.869  10.062  1.00 0.00 ? 27  VAL A H    1  
ATOM 430   H HA   . VAL A 1 27  ? -0.784  15.362  10.670  1.00 0.00 ? 27  VAL A HA   1  
ATOM 431   H HB   . VAL A 1 27  ? 0.320   13.008  12.215  1.00 0.00 ? 27  VAL A HB   1  
ATOM 432   H HG11 . VAL A 1 27  ? -2.465  14.203  12.093  1.00 0.00 ? 27  VAL A HG11 1  
ATOM 433   H HG12 . VAL A 1 27  ? -2.114  12.572  12.715  1.00 0.00 ? 27  VAL A HG12 1  
ATOM 434   H HG13 . VAL A 1 27  ? -1.423  14.000  13.522  1.00 0.00 ? 27  VAL A HG13 1  
ATOM 435   H HG21 . VAL A 1 27  ? -1.102  13.281  9.602   1.00 0.00 ? 27  VAL A HG21 1  
ATOM 436   H HG22 . VAL A 1 27  ? 0.142   12.116  10.116  1.00 0.00 ? 27  VAL A HG22 1  
ATOM 437   H HG23 . VAL A 1 27  ? -1.545  11.911  10.649  1.00 0.00 ? 27  VAL A HG23 1  
ATOM 438   N N    . GLU A 1 28  ? 1.528   15.605  12.980  1.00 0.00 ? 28  GLU A N    1  
ATOM 439   C CA   . GLU A 1 28  ? 1.966   16.381  14.128  1.00 0.00 ? 28  GLU A CA   1  
ATOM 440   C C    . GLU A 1 28  ? 2.004   17.870  13.779  1.00 0.00 ? 28  GLU A C    1  
ATOM 441   O O    . GLU A 1 28  ? 1.480   18.699  14.522  1.00 0.00 ? 28  GLU A O    1  
ATOM 442   C CB   . GLU A 1 28  ? 3.329   15.899  14.627  1.00 0.00 ? 28  GLU A CB   1  
ATOM 443   C CG   . GLU A 1 28  ? 3.279   15.558  16.117  1.00 0.00 ? 28  GLU A CG   1  
ATOM 444   C CD   . GLU A 1 28  ? 4.688   15.447  16.703  1.00 0.00 ? 28  GLU A CD   1  
ATOM 445   O OE1  . GLU A 1 28  ? 5.394   14.494  16.308  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 446   O OE2  . GLU A 1 28  ? 5.028   16.318  17.532  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 447   H H    . GLU A 1 28  ? 2.199   14.953  12.629  1.00 0.00 ? 28  GLU A H    1  
ATOM 448   H HA   . GLU A 1 28  ? 1.219   16.201  14.901  1.00 0.00 ? 28  GLU A HA   1  
ATOM 449   H HB2  . GLU A 1 28  ? 3.639   15.022  14.059  1.00 0.00 ? 28  GLU A HB2  1  
ATOM 450   H HB3  . GLU A 1 28  ? 4.078   16.672  14.453  1.00 0.00 ? 28  GLU A HB3  1  
ATOM 451   H HG2  . GLU A 1 28  ? 2.718   16.325  16.651  1.00 0.00 ? 28  GLU A HG2  1  
ATOM 452   H HG3  . GLU A 1 28  ? 2.747   14.617  16.261  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 453   N N    . GLU A 1 29  ? 2.630   18.164  12.649  1.00 0.00 ? 29  GLU A N    1  
ATOM 454   C CA   . GLU A 1 29  ? 2.743   19.539  12.192  1.00 0.00 ? 29  GLU A CA   1  
ATOM 455   C C    . GLU A 1 29  ? 1.527   19.920  11.346  1.00 0.00 ? 29  GLU A C    1  
ATOM 456   O O    . GLU A 1 29  ? 1.495   20.993  10.745  1.00 0.00 ? 29  GLU A O    1  
ATOM 457   C CB   . GLU A 1 29  ? 4.042   19.752  11.412  1.00 0.00 ? 29  GLU A CB   1  
ATOM 458   C CG   . GLU A 1 29  ? 4.402   21.237  11.343  1.00 0.00 ? 29  GLU A CG   1  
ATOM 459   C CD   . GLU A 1 29  ? 4.856   21.756  12.709  1.00 0.00 ? 29  GLU A CD   1  
ATOM 460   O OE1  . GLU A 1 29  ? 6.073   21.662  12.976  1.00 0.00 ? 29  GLU A OE1  1  
ATOM 461   O OE2  . GLU A 1 29  ? 3.974   22.234  13.455  1.00 0.00 ? 29  GLU A OE2  1  
ATOM 462   H H    . GLU A 1 29  ? 3.053   17.484  12.050  1.00 0.00 ? 29  GLU A H    1  
ATOM 463   H HA   . GLU A 1 29  ? 2.768   20.144  13.098  1.00 0.00 ? 29  GLU A HA   1  
ATOM 464   H HB2  . GLU A 1 29  ? 4.852   19.200  11.889  1.00 0.00 ? 29  GLU A HB2  1  
ATOM 465   H HB3  . GLU A 1 29  ? 3.934   19.353  10.403  1.00 0.00 ? 29  GLU A HB3  1  
ATOM 466   H HG2  . GLU A 1 29  ? 5.196   21.389  10.611  1.00 0.00 ? 29  GLU A HG2  1  
ATOM 467   H HG3  . GLU A 1 29  ? 3.540   21.809  11.001  1.00 0.00 ? 29  GLU A HG3  1  
ATOM 468   N N    . LYS A 1 30  ? 0.555   19.019  11.326  1.00 0.00 ? 30  LYS A N    1  
ATOM 469   C CA   . LYS A 1 30  ? -0.661  19.247  10.563  1.00 0.00 ? 30  LYS A CA   1  
ATOM 470   C C    . LYS A 1 30  ? -1.860  19.252  11.513  1.00 0.00 ? 30  LYS A C    1  
ATOM 471   O O    . LYS A 1 30  ? -2.385  20.312  11.850  1.00 0.00 ? 30  LYS A O    1  
ATOM 472   C CB   . LYS A 1 30  ? -0.780  18.229  9.427   1.00 0.00 ? 30  LYS A CB   1  
ATOM 473   C CG   . LYS A 1 30  ? -0.068  18.727  8.168   1.00 0.00 ? 30  LYS A CG   1  
ATOM 474   C CD   . LYS A 1 30  ? -0.793  19.935  7.569   1.00 0.00 ? 30  LYS A CD   1  
ATOM 475   C CE   . LYS A 1 30  ? 0.205   20.991  7.091   1.00 0.00 ? 30  LYS A CE   1  
ATOM 476   N NZ   . LYS A 1 30  ? 0.867   21.639  8.245   1.00 0.00 ? 30  LYS A NZ   1  
ATOM 477   H H    . LYS A 1 30  ? 0.589   18.149  11.817  1.00 0.00 ? 30  LYS A H    1  
ATOM 478   H HA   . LYS A 1 30  ? -0.579  20.233  10.105  1.00 0.00 ? 30  LYS A HA   1  
ATOM 479   H HB2  . LYS A 1 30  ? -0.350  17.277  9.740   1.00 0.00 ? 30  LYS A HB2  1  
ATOM 480   H HB3  . LYS A 1 30  ? -1.831  18.046  9.207   1.00 0.00 ? 30  LYS A HB3  1  
ATOM 481   H HG2  . LYS A 1 30  ? 0.960   18.998  8.410   1.00 0.00 ? 30  LYS A HG2  1  
ATOM 482   H HG3  . LYS A 1 30  ? -0.021  17.925  7.431   1.00 0.00 ? 30  LYS A HG3  1  
ATOM 483   H HD2  . LYS A 1 30  ? -1.416  19.613  6.735   1.00 0.00 ? 30  LYS A HD2  1  
ATOM 484   H HD3  . LYS A 1 30  ? -1.459  20.369  8.315   1.00 0.00 ? 30  LYS A HD3  1  
ATOM 485   H HE2  . LYS A 1 30  ? 0.953   20.528  6.447   1.00 0.00 ? 30  LYS A HE2  1  
ATOM 486   H HE3  . LYS A 1 30  ? -0.310  21.741  6.491   1.00 0.00 ? 30  LYS A HE3  1  
ATOM 487   H HZ1  . LYS A 1 30  ? 1.200   20.938  8.875   1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 488   H HZ2  . LYS A 1 30  ? 1.637   22.189  7.921   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 489   H HZ3  . LYS A 1 30  ? 0.212   22.229  8.717   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 490   N N    . ALA A 1 31  ? -2.259  18.055  11.917  1.00 0.00 ? 31  ALA A N    1  
ATOM 491   C CA   . ALA A 1 31  ? -3.386  17.907  12.822  1.00 0.00 ? 31  ALA A CA   1  
ATOM 492   C C    . ALA A 1 31  ? -4.686  17.914  12.014  1.00 0.00 ? 31  ALA A C    1  
ATOM 493   O O    . ALA A 1 31  ? -5.536  18.783  12.207  1.00 0.00 ? 31  ALA A O    1  
ATOM 494   C CB   . ALA A 1 31  ? -3.347  19.019  13.873  1.00 0.00 ? 31  ALA A CB   1  
ATOM 495   H H    . ALA A 1 31  ? -1.826  17.197  11.638  1.00 0.00 ? 31  ALA A H    1  
ATOM 496   H HA   . ALA A 1 31  ? -3.286  16.945  13.324  1.00 0.00 ? 31  ALA A HA   1  
ATOM 497   H HB1  . ALA A 1 31  ? -3.841  19.908  13.480  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 498   H HB2  . ALA A 1 31  ? -2.310  19.255  14.113  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 499   H HB3  . ALA A 1 31  ? -3.861  18.685  14.774  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 500   N N    . PHE A 1 32  ? -4.800  16.936  11.128  1.00 0.00 ? 32  PHE A N    1  
ATOM 501   C CA   . PHE A 1 32  ? -5.982  16.819  10.291  1.00 0.00 ? 32  PHE A CA   1  
ATOM 502   C C    . PHE A 1 32  ? -6.265  18.130  9.554   1.00 0.00 ? 32  PHE A C    1  
ATOM 503   O O    . PHE A 1 32  ? -7.378  18.648  9.608   1.00 0.00 ? 32  PHE A O    1  
ATOM 504   C CB   . PHE A 1 32  ? -7.158  16.505  11.219  1.00 0.00 ? 32  PHE A CB   1  
ATOM 505   C CG   . PHE A 1 32  ? -7.383  15.010  11.453  1.00 0.00 ? 32  PHE A CG   1  
ATOM 506   C CD1  . PHE A 1 32  ? -6.458  14.281  12.133  1.00 0.00 ? 32  PHE A CD1  1  
ATOM 507   C CD2  . PHE A 1 32  ? -8.510  14.410  10.983  1.00 0.00 ? 32  PHE A CD2  1  
ATOM 508   C CE1  . PHE A 1 32  ? -6.668  12.894  12.351  1.00 0.00 ? 32  PHE A CE1  1  
ATOM 509   C CE2  . PHE A 1 32  ? -8.719  13.023  11.201  1.00 0.00 ? 32  PHE A CE2  1  
ATOM 510   C CZ   . PHE A 1 32  ? -7.794  12.294  11.880  1.00 0.00 ? 32  PHE A CZ   1  
ATOM 511   H H    . PHE A 1 32  ? -4.104  16.234  10.978  1.00 0.00 ? 32  PHE A H    1  
ATOM 512   H HA   . PHE A 1 32  ? -5.786  16.030  9.564   1.00 0.00 ? 32  PHE A HA   1  
ATOM 513   H HB2  . PHE A 1 32  ? -6.989  16.992  12.179  1.00 0.00 ? 32  PHE A HB2  1  
ATOM 514   H HB3  . PHE A 1 32  ? -8.065  16.937  10.797  1.00 0.00 ? 32  PHE A HB3  1  
ATOM 515   H HD1  . PHE A 1 32  ? -5.556  14.762  12.510  1.00 0.00 ? 32  PHE A HD1  1  
ATOM 516   H HD2  . PHE A 1 32  ? -9.251  14.994  10.438  1.00 0.00 ? 32  PHE A HD2  1  
ATOM 517   H HE1  . PHE A 1 32  ? -5.926  12.309  12.896  1.00 0.00 ? 32  PHE A HE1  1  
ATOM 518   H HE2  . PHE A 1 32  ? -9.622  12.542  10.823  1.00 0.00 ? 32  PHE A HE2  1  
ATOM 519   H HZ   . PHE A 1 32  ? -7.954  11.229  12.048  1.00 0.00 ? 32  PHE A HZ   1  
ATOM 520   N N    . SER A 1 33  ? -5.237  18.627  8.883   1.00 0.00 ? 33  SER A N    1  
ATOM 521   C CA   . SER A 1 33  ? -5.360  19.868  8.136   1.00 0.00 ? 33  SER A CA   1  
ATOM 522   C C    . SER A 1 33  ? -5.666  19.566  6.668   1.00 0.00 ? 33  SER A C    1  
ATOM 523   O O    . SER A 1 33  ? -5.620  18.412  6.245   1.00 0.00 ? 33  SER A O    1  
ATOM 524   C CB   . SER A 1 33  ? -4.088  20.709  8.252   1.00 0.00 ? 33  SER A CB   1  
ATOM 525   O OG   . SER A 1 33  ? -4.350  22.001  8.795   1.00 0.00 ? 33  SER A OG   1  
ATOM 526   H H    . SER A 1 33  ? -4.334  18.199  8.844   1.00 0.00 ? 33  SER A H    1  
ATOM 527   H HA   . SER A 1 33  ? -6.191  20.401  8.598   1.00 0.00 ? 33  SER A HA   1  
ATOM 528   H HB2  . SER A 1 33  ? -3.366  20.190  8.883   1.00 0.00 ? 33  SER A HB2  1  
ATOM 529   H HB3  . SER A 1 33  ? -3.633  20.815  7.267   1.00 0.00 ? 33  SER A HB3  1  
ATOM 530   H HG   . SER A 1 33  ? -3.498  22.417  9.112   1.00 0.00 ? 33  SER A HG   1  
ATOM 531   N N    . PRO A 1 34  ? -5.979  20.652  5.911   1.00 0.00 ? 34  PRO A N    1  
ATOM 532   C CA   . PRO A 1 34  ? -6.292  20.515  4.499   1.00 0.00 ? 34  PRO A CA   1  
ATOM 533   C C    . PRO A 1 34  ? -5.025  20.266  3.678   1.00 0.00 ? 34  PRO A C    1  
ATOM 534   O O    . PRO A 1 34  ? -5.092  20.100  2.461   1.00 0.00 ? 34  PRO A O    1  
ATOM 535   C CB   . PRO A 1 34  ? -6.997  21.809  4.125   1.00 0.00 ? 34  PRO A CB   1  
ATOM 536   C CG   . PRO A 1 34  ? -6.641  22.807  5.214   1.00 0.00 ? 34  PRO A CG   1  
ATOM 537   C CD   . PRO A 1 34  ? -6.043  22.034  6.378   1.00 0.00 ? 34  PRO A CD   1  
ATOM 538   H HA   . PRO A 1 34  ? -6.876  19.718  4.348   1.00 0.00 ? 34  PRO A HA   1  
ATOM 539   H HB2  . PRO A 1 34  ? -6.669  22.164  3.148   1.00 0.00 ? 34  PRO A HB2  1  
ATOM 540   H HB3  . PRO A 1 34  ? -8.075  21.663  4.065   1.00 0.00 ? 34  PRO A HB3  1  
ATOM 541   H HG2  . PRO A 1 34  ? -5.930  23.544  4.840   1.00 0.00 ? 34  PRO A HG2  1  
ATOM 542   H HG3  . PRO A 1 34  ? -7.528  23.354  5.535   1.00 0.00 ? 34  PRO A HG3  1  
ATOM 543   H HD2  . PRO A 1 34  ? -5.054  22.410  6.638   1.00 0.00 ? 34  PRO A HD2  1  
ATOM 544   H HD3  . PRO A 1 34  ? -6.662  22.121  7.271   1.00 0.00 ? 34  PRO A HD3  1  
ATOM 545   N N    . GLU A 1 35  ? -3.899  20.247  4.377   1.00 0.00 ? 35  GLU A N    1  
ATOM 546   C CA   . GLU A 1 35  ? -2.619  20.020  3.729   1.00 0.00 ? 35  GLU A CA   1  
ATOM 547   C C    . GLU A 1 35  ? -2.133  18.595  3.998   1.00 0.00 ? 35  GLU A C    1  
ATOM 548   O O    . GLU A 1 35  ? -1.050  18.211  3.558   1.00 0.00 ? 35  GLU A O    1  
ATOM 549   C CB   . GLU A 1 35  ? -1.583  21.049  4.187   1.00 0.00 ? 35  GLU A CB   1  
ATOM 550   C CG   . GLU A 1 35  ? -0.890  21.700  2.988   1.00 0.00 ? 35  GLU A CG   1  
ATOM 551   C CD   . GLU A 1 35  ? -1.888  22.493  2.142   1.00 0.00 ? 35  GLU A CD   1  
ATOM 552   O OE1  . GLU A 1 35  ? -2.320  23.561  2.627   1.00 0.00 ? 35  GLU A OE1  1  
ATOM 553   O OE2  . GLU A 1 35  ? -2.196  22.013  1.029   1.00 0.00 ? 35  GLU A OE2  1  
ATOM 554   H H    . GLU A 1 35  ? -3.854  20.382  5.367   1.00 0.00 ? 35  GLU A H    1  
ATOM 555   H HA   . GLU A 1 35  ? -2.807  20.152  2.663   1.00 0.00 ? 35  GLU A HA   1  
ATOM 556   H HB2  . GLU A 1 35  ? -2.069  21.815  4.791   1.00 0.00 ? 35  GLU A HB2  1  
ATOM 557   H HB3  . GLU A 1 35  ? -0.841  20.565  4.822   1.00 0.00 ? 35  GLU A HB3  1  
ATOM 558   H HG2  . GLU A 1 35  ? -0.097  22.361  3.337   1.00 0.00 ? 35  GLU A HG2  1  
ATOM 559   H HG3  . GLU A 1 35  ? -0.418  20.932  2.376   1.00 0.00 ? 35  GLU A HG3  1  
ATOM 560   N N    . VAL A 1 36  ? -2.957  17.849  4.719   1.00 0.00 ? 36  VAL A N    1  
ATOM 561   C CA   . VAL A 1 36  ? -2.624  16.474  5.051   1.00 0.00 ? 36  VAL A CA   1  
ATOM 562   C C    . VAL A 1 36  ? -3.552  15.529  4.285   1.00 0.00 ? 36  VAL A C    1  
ATOM 563   O O    . VAL A 1 36  ? -3.208  14.372  4.050   1.00 0.00 ? 36  VAL A O    1  
ATOM 564   C CB   . VAL A 1 36  ? -2.685  16.273  6.567   1.00 0.00 ? 36  VAL A CB   1  
ATOM 565   C CG1  . VAL A 1 36  ? -4.114  15.970  7.022   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 566   C CG2  . VAL A 1 36  ? -1.722  15.171  7.013   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 567   H H    . VAL A 1 36  ? -3.835  18.168  5.073   1.00 0.00 ? 36  VAL A H    1  
ATOM 568   H HA   . VAL A 1 36  ? -1.598  16.296  4.729   1.00 0.00 ? 36  VAL A HA   1  
ATOM 569   H HB   . VAL A 1 36  ? -2.373  17.203  7.041   1.00 0.00 ? 36  VAL A HB   1  
ATOM 570   H HG11 . VAL A 1 36  ? -4.819  16.353  6.285   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 571   H HG12 . VAL A 1 36  ? -4.243  14.892  7.122   1.00 0.00 ? 36  VAL A HG12 1  
ATOM 572   H HG13 . VAL A 1 36  ? -4.298  16.448  7.984   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 573   H HG21 . VAL A 1 36  ? -1.672  14.399  6.245   1.00 0.00 ? 36  VAL A HG21 1  
ATOM 574   H HG22 . VAL A 1 36  ? -0.730  15.595  7.166   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 575   H HG23 . VAL A 1 36  ? -2.078  14.733  7.946   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 576   N N    . ILE A 1 37  ? -4.709  16.058  3.916   1.00 0.00 ? 37  ILE A N    1  
ATOM 577   C CA   . ILE A 1 37  ? -5.689  15.277  3.181   1.00 0.00 ? 37  ILE A CA   1  
ATOM 578   C C    . ILE A 1 37  ? -5.096  14.861  1.834   1.00 0.00 ? 37  ILE A C    1  
ATOM 579   O O    . ILE A 1 37  ? -5.281  13.727  1.393   1.00 0.00 ? 37  ILE A O    1  
ATOM 580   C CB   . ILE A 1 37  ? -7.007  16.045  3.063   1.00 0.00 ? 37  ILE A CB   1  
ATOM 581   C CG1  . ILE A 1 37  ? -7.656  16.235  4.435   1.00 0.00 ? 37  ILE A CG1  1  
ATOM 582   C CG2  . ILE A 1 37  ? -7.952  15.362  2.071   1.00 0.00 ? 37  ILE A CG2  1  
ATOM 583   C CD1  . ILE A 1 37  ? -9.018  16.921  4.307   1.00 0.00 ? 37  ILE A CD1  1  
ATOM 584   H H    . ILE A 1 37  ? -4.981  17.001  4.112   1.00 0.00 ? 37  ILE A H    1  
ATOM 585   H HA   . ILE A 1 37  ? -5.891  14.377  3.762   1.00 0.00 ? 37  ILE A HA   1  
ATOM 586   H HB   . ILE A 1 37  ? -6.789  17.037  2.669   1.00 0.00 ? 37  ILE A HB   1  
ATOM 587   H HG12 . ILE A 1 37  ? -7.777  15.267  4.922   1.00 0.00 ? 37  ILE A HG12 1  
ATOM 588   H HG13 . ILE A 1 37  ? -7.002  16.832  5.071   1.00 0.00 ? 37  ILE A HG13 1  
ATOM 589   H HG21 . ILE A 1 37  ? -7.442  14.519  1.605   1.00 0.00 ? 37  ILE A HG21 1  
ATOM 590   H HG22 . ILE A 1 37  ? -8.836  15.005  2.599   1.00 0.00 ? 37  ILE A HG22 1  
ATOM 591   H HG23 . ILE A 1 37  ? -8.250  16.076  1.304   1.00 0.00 ? 37  ILE A HG23 1  
ATOM 592   H HD11 . ILE A 1 37  ? -9.394  16.795  3.292   1.00 0.00 ? 37  ILE A HD11 1  
ATOM 593   H HD12 . ILE A 1 37  ? -9.717  16.474  5.013   1.00 0.00 ? 37  ILE A HD12 1  
ATOM 594   H HD13 . ILE A 1 37  ? -8.911  17.984  4.525   1.00 0.00 ? 37  ILE A HD13 1  
ATOM 595   N N    . PRO A 1 38  ? -4.377  15.826  1.200   1.00 0.00 ? 38  PRO A N    1  
ATOM 596   C CA   . PRO A 1 38  ? -3.756  15.571  -0.089  1.00 0.00 ? 38  PRO A CA   1  
ATOM 597   C C    . PRO A 1 38  ? -2.510  14.696  0.066   1.00 0.00 ? 38  PRO A C    1  
ATOM 598   O O    . PRO A 1 38  ? -2.241  13.839  -0.774  1.00 0.00 ? 38  PRO A O    1  
ATOM 599   C CB   . PRO A 1 38  ? -3.448  16.947  -0.656  1.00 0.00 ? 38  PRO A CB   1  
ATOM 600   C CG   . PRO A 1 38  ? -3.481  17.902  0.526   1.00 0.00 ? 38  PRO A CG   1  
ATOM 601   C CD   . PRO A 1 38  ? -4.137  17.179  1.691   1.00 0.00 ? 38  PRO A CD   1  
ATOM 602   H HA   . PRO A 1 38  ? -4.379  15.057  -0.679  1.00 0.00 ? 38  PRO A HA   1  
ATOM 603   H HB2  . PRO A 1 38  ? -2.472  16.960  -1.142  1.00 0.00 ? 38  PRO A HB2  1  
ATOM 604   H HB3  . PRO A 1 38  ? -4.183  17.232  -1.409  1.00 0.00 ? 38  PRO A HB3  1  
ATOM 605   H HG2  . PRO A 1 38  ? -2.471  18.216  0.791   1.00 0.00 ? 38  PRO A HG2  1  
ATOM 606   H HG3  . PRO A 1 38  ? -4.039  18.804  0.273   1.00 0.00 ? 38  PRO A HG3  1  
ATOM 607   H HD2  . PRO A 1 38  ? -3.491  17.173  2.568   1.00 0.00 ? 38  PRO A HD2  1  
ATOM 608   H HD3  . PRO A 1 38  ? -5.068  17.665  1.984   1.00 0.00 ? 38  PRO A HD3  1  
ATOM 609   N N    . MET A 1 39  ? -1.784  14.942  1.147   1.00 0.00 ? 39  MET A N    1  
ATOM 610   C CA   . MET A 1 39  ? -0.573  14.188  1.423   1.00 0.00 ? 39  MET A CA   1  
ATOM 611   C C    . MET A 1 39  ? -0.900  12.730  1.756   1.00 0.00 ? 39  MET A C    1  
ATOM 612   O O    . MET A 1 39  ? -0.133  11.827  1.423   1.00 0.00 ? 39  MET A O    1  
ATOM 613   C CB   . MET A 1 39  ? 0.169   14.826  2.598   1.00 0.00 ? 39  MET A CB   1  
ATOM 614   C CG   . MET A 1 39  ? 1.658   14.989  2.283   1.00 0.00 ? 39  MET A CG   1  
ATOM 615   S SD   . MET A 1 39  ? 2.598   15.067  3.798   1.00 0.00 ? 39  MET A SD   1  
ATOM 616   C CE   . MET A 1 39  ? 2.163   13.491  4.515   1.00 0.00 ? 39  MET A CE   1  
ATOM 617   H H    . MET A 1 39  ? -2.010  15.641  1.825   1.00 0.00 ? 39  MET A H    1  
ATOM 618   H HA   . MET A 1 39  ? 0.016   14.235  0.507   1.00 0.00 ? 39  MET A HA   1  
ATOM 619   H HB2  . MET A 1 39  ? -0.267  15.799  2.823   1.00 0.00 ? 39  MET A HB2  1  
ATOM 620   H HB3  . MET A 1 39  ? 0.048   14.209  3.488   1.00 0.00 ? 39  MET A HB3  1  
ATOM 621   H HG2  . MET A 1 39  ? 2.003   14.153  1.674   1.00 0.00 ? 39  MET A HG2  1  
ATOM 622   H HG3  . MET A 1 39  ? 1.817   15.895  1.698   1.00 0.00 ? 39  MET A HG3  1  
ATOM 623   H HE1  . MET A 1 39  ? 1.584   12.912  3.795   1.00 0.00 ? 39  MET A HE1  1  
ATOM 624   H HE2  . MET A 1 39  ? 3.071   12.947  4.773   1.00 0.00 ? 39  MET A HE2  1  
ATOM 625   H HE3  . MET A 1 39  ? 1.568   13.653  5.414   1.00 0.00 ? 39  MET A HE3  1  
ATOM 626   N N    . PHE A 1 40  ? -2.038  12.546  2.408   1.00 0.00 ? 40  PHE A N    1  
ATOM 627   C CA   . PHE A 1 40  ? -2.475  11.214  2.789   1.00 0.00 ? 40  PHE A CA   1  
ATOM 628   C C    . PHE A 1 40  ? -3.012  10.446  1.580   1.00 0.00 ? 40  PHE A C    1  
ATOM 629   O O    . PHE A 1 40  ? -2.690  9.274   1.391   1.00 0.00 ? 40  PHE A O    1  
ATOM 630   C CB   . PHE A 1 40  ? -3.603  11.388  3.809   1.00 0.00 ? 40  PHE A CB   1  
ATOM 631   C CG   . PHE A 1 40  ? -3.831  10.164  4.698   1.00 0.00 ? 40  PHE A CG   1  
ATOM 632   C CD1  . PHE A 1 40  ? -2.793  9.621   5.388   1.00 0.00 ? 40  PHE A CD1  1  
ATOM 633   C CD2  . PHE A 1 40  ? -5.074  9.620   4.800   1.00 0.00 ? 40  PHE A CD2  1  
ATOM 634   C CE1  . PHE A 1 40  ? -3.005  8.485   6.213   1.00 0.00 ? 40  PHE A CE1  1  
ATOM 635   C CE2  . PHE A 1 40  ? -5.286  8.484   5.625   1.00 0.00 ? 40  PHE A CE2  1  
ATOM 636   C CZ   . PHE A 1 40  ? -4.247  7.941   6.315   1.00 0.00 ? 40  PHE A CZ   1  
ATOM 637   H H    . PHE A 1 40  ? -2.656  13.286  2.674   1.00 0.00 ? 40  PHE A H    1  
ATOM 638   H HA   . PHE A 1 40  ? -1.608  10.692  3.193   1.00 0.00 ? 40  PHE A HA   1  
ATOM 639   H HB2  . PHE A 1 40  ? -3.377  12.247  4.441   1.00 0.00 ? 40  PHE A HB2  1  
ATOM 640   H HB3  . PHE A 1 40  ? -4.527  11.617  3.278   1.00 0.00 ? 40  PHE A HB3  1  
ATOM 641   H HD1  . PHE A 1 40  ? -1.797  10.057  5.306   1.00 0.00 ? 40  PHE A HD1  1  
ATOM 642   H HD2  . PHE A 1 40  ? -5.906  10.056  4.247   1.00 0.00 ? 40  PHE A HD2  1  
ATOM 643   H HE1  . PHE A 1 40  ? -2.172  8.050   6.766   1.00 0.00 ? 40  PHE A HE1  1  
ATOM 644   H HE2  . PHE A 1 40  ? -6.282  8.048   5.707   1.00 0.00 ? 40  PHE A HE2  1  
ATOM 645   H HZ   . PHE A 1 40  ? -4.410  7.069   6.948   1.00 0.00 ? 40  PHE A HZ   1  
ATOM 646   N N    . SER A 1 41  ? -3.822  11.137  0.792   1.00 0.00 ? 41  SER A N    1  
ATOM 647   C CA   . SER A 1 41  ? -4.407  10.535  -0.394  1.00 0.00 ? 41  SER A CA   1  
ATOM 648   C C    . SER A 1 41  ? -3.301  10.075  -1.347  1.00 0.00 ? 41  SER A C    1  
ATOM 649   O O    . SER A 1 41  ? -3.372  8.980   -1.903  1.00 0.00 ? 41  SER A O    1  
ATOM 650   C CB   . SER A 1 41  ? -5.345  11.513  -1.104  1.00 0.00 ? 41  SER A CB   1  
ATOM 651   O OG   . SER A 1 41  ? -4.636  12.417  -1.947  1.00 0.00 ? 41  SER A OG   1  
ATOM 652   H H    . SER A 1 41  ? -4.080  12.090  0.952   1.00 0.00 ? 41  SER A H    1  
ATOM 653   H HA   . SER A 1 41  ? -4.979  9.681   -0.032  1.00 0.00 ? 41  SER A HA   1  
ATOM 654   H HB2  . SER A 1 41  ? -6.069  10.955  -1.698  1.00 0.00 ? 41  SER A HB2  1  
ATOM 655   H HB3  . SER A 1 41  ? -5.909  12.077  -0.361  1.00 0.00 ? 41  SER A HB3  1  
ATOM 656   H HG   . SER A 1 41  ? -5.151  13.268  -2.047  1.00 0.00 ? 41  SER A HG   1  
ATOM 657   N N    . ALA A 1 42  ? -2.305  10.934  -1.505  1.00 0.00 ? 42  ALA A N    1  
ATOM 658   C CA   . ALA A 1 42  ? -1.186  10.629  -2.380  1.00 0.00 ? 42  ALA A CA   1  
ATOM 659   C C    . ALA A 1 42  ? -0.381  9.470   -1.788  1.00 0.00 ? 42  ALA A C    1  
ATOM 660   O O    . ALA A 1 42  ? -0.033  8.526   -2.495  1.00 0.00 ? 42  ALA A O    1  
ATOM 661   C CB   . ALA A 1 42  ? -0.337  11.886  -2.580  1.00 0.00 ? 42  ALA A CB   1  
ATOM 662   H H    . ALA A 1 42  ? -2.255  11.822  -1.048  1.00 0.00 ? 42  ALA A H    1  
ATOM 663   H HA   . ALA A 1 42  ? -1.592  10.323  -3.344  1.00 0.00 ? 42  ALA A HA   1  
ATOM 664   H HB1  . ALA A 1 42  ? 0.031   12.233  -1.614  1.00 0.00 ? 42  ALA A HB1  1  
ATOM 665   H HB2  . ALA A 1 42  ? 0.508   11.654  -3.228  1.00 0.00 ? 42  ALA A HB2  1  
ATOM 666   H HB3  . ALA A 1 42  ? -0.944  12.666  -3.039  1.00 0.00 ? 42  ALA A HB3  1  
ATOM 667   N N    . LEU A 1 43  ? -0.110  9.580   -0.496  1.00 0.00 ? 43  LEU A N    1  
ATOM 668   C CA   . LEU A 1 43  ? 0.647   8.552   0.200   1.00 0.00 ? 43  LEU A CA   1  
ATOM 669   C C    . LEU A 1 43  ? -0.104  7.222   0.109   1.00 0.00 ? 43  LEU A C    1  
ATOM 670   O O    . LEU A 1 43  ? 0.510   6.157   0.127   1.00 0.00 ? 43  LEU A O    1  
ATOM 671   C CB   . LEU A 1 43  ? 0.951   8.990   1.634   1.00 0.00 ? 43  LEU A CB   1  
ATOM 672   C CG   . LEU A 1 43  ? 2.326   9.621   1.865   1.00 0.00 ? 43  LEU A CG   1  
ATOM 673   C CD1  . LEU A 1 43  ? 2.191   11.031  2.444   1.00 0.00 ? 43  LEU A CD1  1  
ATOM 674   C CD2  . LEU A 1 43  ? 3.202   8.723   2.741   1.00 0.00 ? 43  LEU A CD2  1  
ATOM 675   H H    . LEU A 1 43  ? -0.397  10.351  0.073   1.00 0.00 ? 43  LEU A H    1  
ATOM 676   H HA   . LEU A 1 43  ? 1.602   8.446   -0.314  1.00 0.00 ? 43  LEU A HA   1  
ATOM 677   H HB2  . LEU A 1 43  ? 0.189   9.704   1.945   1.00 0.00 ? 43  LEU A HB2  1  
ATOM 678   H HB3  . LEU A 1 43  ? 0.859   8.121   2.285   1.00 0.00 ? 43  LEU A HB3  1  
ATOM 679   H HG   . LEU A 1 43  ? 2.825   9.716   0.901   1.00 0.00 ? 43  LEU A HG   1  
ATOM 680   H HD11 . LEU A 1 43  ? 1.254   11.109  2.995   1.00 0.00 ? 43  LEU A HD11 1  
ATOM 681   H HD12 . LEU A 1 43  ? 3.025   11.228  3.117   1.00 0.00 ? 43  LEU A HD12 1  
ATOM 682   H HD13 . LEU A 1 43  ? 2.198   11.759  1.633   1.00 0.00 ? 43  LEU A HD13 1  
ATOM 683   H HD21 . LEU A 1 43  ? 3.019   7.679   2.487   1.00 0.00 ? 43  LEU A HD21 1  
ATOM 684   H HD22 . LEU A 1 43  ? 4.251   8.960   2.569   1.00 0.00 ? 43  LEU A HD22 1  
ATOM 685   H HD23 . LEU A 1 43  ? 2.959   8.890   3.790   1.00 0.00 ? 43  LEU A HD23 1  
ATOM 686   N N    . SER A 1 44  ? -1.421  7.328   0.013   1.00 0.00 ? 44  SER A N    1  
ATOM 687   C CA   . SER A 1 44  ? -2.262  6.147   -0.081  1.00 0.00 ? 44  SER A CA   1  
ATOM 688   C C    . SER A 1 44  ? -2.817  6.011   -1.500  1.00 0.00 ? 44  SER A C    1  
ATOM 689   O O    . SER A 1 44  ? -3.971  5.627   -1.685  1.00 0.00 ? 44  SER A O    1  
ATOM 690   C CB   . SER A 1 44  ? -3.406  6.203   0.934   1.00 0.00 ? 44  SER A CB   1  
ATOM 691   O OG   . SER A 1 44  ? -4.223  5.037   0.882   1.00 0.00 ? 44  SER A OG   1  
ATOM 692   H H    . SER A 1 44  ? -1.913  8.199   -0.001  1.00 0.00 ? 44  SER A H    1  
ATOM 693   H HA   . SER A 1 44  ? -1.608  5.308   0.156   1.00 0.00 ? 44  SER A HA   1  
ATOM 694   H HB2  . SER A 1 44  ? -2.995  6.314   1.937   1.00 0.00 ? 44  SER A HB2  1  
ATOM 695   H HB3  . SER A 1 44  ? -4.018  7.084   0.741   1.00 0.00 ? 44  SER A HB3  1  
ATOM 696   H HG   . SER A 1 44  ? -5.116  5.261   0.493   1.00 0.00 ? 44  SER A HG   1  
ATOM 697   N N    . GLU A 1 45  ? -1.971  6.335   -2.466  1.00 0.00 ? 45  GLU A N    1  
ATOM 698   C CA   . GLU A 1 45  ? -2.362  6.254   -3.863  1.00 0.00 ? 45  GLU A CA   1  
ATOM 699   C C    . GLU A 1 45  ? -2.995  4.893   -4.159  1.00 0.00 ? 45  GLU A C    1  
ATOM 700   O O    . GLU A 1 45  ? -4.073  4.820   -4.748  1.00 0.00 ? 45  GLU A O    1  
ATOM 701   C CB   . GLU A 1 45  ? -1.169  6.516   -4.784  1.00 0.00 ? 45  GLU A CB   1  
ATOM 702   C CG   . GLU A 1 45  ? -1.553  7.459   -5.925  1.00 0.00 ? 45  GLU A CG   1  
ATOM 703   C CD   . GLU A 1 45  ? -1.435  6.757   -7.280  1.00 0.00 ? 45  GLU A CD   1  
ATOM 704   O OE1  . GLU A 1 45  ? -0.299  6.712   -7.799  1.00 0.00 ? 45  GLU A OE1  1  
ATOM 705   O OE2  . GLU A 1 45  ? -2.484  6.281   -7.765  1.00 0.00 ? 45  GLU A OE2  1  
ATOM 706   H H    . GLU A 1 45  ? -1.034  6.647   -2.308  1.00 0.00 ? 45  GLU A H    1  
ATOM 707   H HA   . GLU A 1 45  ? -3.101  7.044   -4.003  1.00 0.00 ? 45  GLU A HA   1  
ATOM 708   H HB2  . GLU A 1 45  ? -0.350  6.949   -4.209  1.00 0.00 ? 45  GLU A HB2  1  
ATOM 709   H HB3  . GLU A 1 45  ? -0.807  5.572   -5.192  1.00 0.00 ? 45  GLU A HB3  1  
ATOM 710   H HG2  . GLU A 1 45  ? -2.574  7.812   -5.782  1.00 0.00 ? 45  GLU A HG2  1  
ATOM 711   H HG3  . GLU A 1 45  ? -0.907  8.337   -5.910  1.00 0.00 ? 45  GLU A HG3  1  
ATOM 712   N N    . GLY A 1 46  ? -2.299  3.848   -3.737  1.00 0.00 ? 46  GLY A N    1  
ATOM 713   C CA   . GLY A 1 46  ? -2.779  2.493   -3.949  1.00 0.00 ? 46  GLY A CA   1  
ATOM 714   C C    . GLY A 1 46  ? -2.317  1.565   -2.824  1.00 0.00 ? 46  GLY A C    1  
ATOM 715   O O    . GLY A 1 46  ? -1.642  0.568   -3.074  1.00 0.00 ? 46  GLY A O    1  
ATOM 716   H H    . GLY A 1 46  ? -1.423  3.916   -3.259  1.00 0.00 ? 46  GLY A H    1  
ATOM 717   H HA2  . GLY A 1 46  ? -3.868  2.494   -4.002  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 718   H HA3  . GLY A 1 46  ? -2.414  2.120   -4.906  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 719   N N    . ALA A 1 47  ? -2.701  1.926   -1.608  1.00 0.00 ? 47  ALA A N    1  
ATOM 720   C CA   . ALA A 1 47  ? -2.335  1.139   -0.443  1.00 0.00 ? 47  ALA A CA   1  
ATOM 721   C C    . ALA A 1 47  ? -3.426  0.102   -0.170  1.00 0.00 ? 47  ALA A C    1  
ATOM 722   O O    . ALA A 1 47  ? -4.530  0.203   -0.704  1.00 0.00 ? 47  ALA A O    1  
ATOM 723   C CB   . ALA A 1 47  ? -2.102  2.068   0.750   1.00 0.00 ? 47  ALA A CB   1  
ATOM 724   H H    . ALA A 1 47  ? -3.250  2.739   -1.413  1.00 0.00 ? 47  ALA A H    1  
ATOM 725   H HA   . ALA A 1 47  ? -1.403  0.621   -0.672  1.00 0.00 ? 47  ALA A HA   1  
ATOM 726   H HB1  . ALA A 1 47  ? -1.639  2.993   0.405   1.00 0.00 ? 47  ALA A HB1  1  
ATOM 727   H HB2  . ALA A 1 47  ? -3.057  2.295   1.225   1.00 0.00 ? 47  ALA A HB2  1  
ATOM 728   H HB3  . ALA A 1 47  ? -1.446  1.579   1.469   1.00 0.00 ? 47  ALA A HB3  1  
ATOM 729   N N    . THR A 1 48  ? -3.080  -0.871  0.660   1.00 0.00 ? 48  THR A N    1  
ATOM 730   C CA   . THR A 1 48  ? -4.017  -1.925  1.010   1.00 0.00 ? 48  THR A CA   1  
ATOM 731   C C    . THR A 1 48  ? -4.854  -1.514  2.222   1.00 0.00 ? 48  THR A C    1  
ATOM 732   O O    . THR A 1 48  ? -4.804  -0.363  2.654   1.00 0.00 ? 48  THR A O    1  
ATOM 733   C CB   . THR A 1 48  ? -3.219  -3.212  1.230   1.00 0.00 ? 48  THR A CB   1  
ATOM 734   O OG1  . THR A 1 48  ? -2.948  -3.217  2.629   1.00 0.00 ? 48  THR A OG1  1  
ATOM 735   C CG2  . THR A 1 48  ? -1.834  -3.161  0.583   1.00 0.00 ? 48  THR A CG2  1  
ATOM 736   H H    . THR A 1 48  ? -2.180  -0.945  1.089   1.00 0.00 ? 48  THR A H    1  
ATOM 737   H HA   . THR A 1 48  ? -4.706  -2.063  0.177   1.00 0.00 ? 48  THR A HA   1  
ATOM 738   H HB   . THR A 1 48  ? -3.779  -4.081  0.884   1.00 0.00 ? 48  THR A HB   1  
ATOM 739   H HG1  . THR A 1 48  ? -2.807  -4.155  2.947   1.00 0.00 ? 48  THR A HG1  1  
ATOM 740   H HG21 . THR A 1 48  ? -1.873  -2.536  -0.310  1.00 0.00 ? 48  THR A HG21 1  
ATOM 741   H HG22 . THR A 1 48  ? -1.118  -2.741  1.289   1.00 0.00 ? 48  THR A HG22 1  
ATOM 742   H HG23 . THR A 1 48  ? -1.524  -4.169  0.307   1.00 0.00 ? 48  THR A HG23 1  
ATOM 743   N N    . PRO A 1 49  ? -5.624  -2.502  2.751   1.00 0.00 ? 49  PRO A N    1  
ATOM 744   C CA   . PRO A 1 49  ? -6.471  -2.255  3.905   1.00 0.00 ? 49  PRO A CA   1  
ATOM 745   C C    . PRO A 1 49  ? -5.640  -2.169  5.187   1.00 0.00 ? 49  PRO A C    1  
ATOM 746   O O    . PRO A 1 49  ? -5.947  -1.379  6.078   1.00 0.00 ? 49  PRO A O    1  
ATOM 747   C CB   . PRO A 1 49  ? -7.465  -3.404  3.917   1.00 0.00 ? 49  PRO A CB   1  
ATOM 748   C CG   . PRO A 1 49  ? -6.853  -4.494  3.052   1.00 0.00 ? 49  PRO A CG   1  
ATOM 749   C CD   . PRO A 1 49  ? -5.709  -3.877  2.265   1.00 0.00 ? 49  PRO A CD   1  
ATOM 750   H HA   . PRO A 1 49  ? -6.929  -1.370  3.816   1.00 0.00 ? 49  PRO A HA   1  
ATOM 751   H HB2  . PRO A 1 49  ? -7.637  -3.762  4.933   1.00 0.00 ? 49  PRO A HB2  1  
ATOM 752   H HB3  . PRO A 1 49  ? -8.432  -3.089  3.523   1.00 0.00 ? 49  PRO A HB3  1  
ATOM 753   H HG2  . PRO A 1 49  ? -6.492  -5.315  3.671   1.00 0.00 ? 49  PRO A HG2  1  
ATOM 754   H HG3  . PRO A 1 49  ? -7.601  -4.910  2.376   1.00 0.00 ? 49  PRO A HG3  1  
ATOM 755   H HD2  . PRO A 1 49  ? -4.776  -4.414  2.435   1.00 0.00 ? 49  PRO A HD2  1  
ATOM 756   H HD3  . PRO A 1 49  ? -5.903  -3.907  1.193   1.00 0.00 ? 49  PRO A HD3  1  
ATOM 757   N N    . GLN A 1 50  ? -4.604  -2.994  5.238   1.00 0.00 ? 50  GLN A N    1  
ATOM 758   C CA   . GLN A 1 50  ? -3.727  -3.021  6.396   1.00 0.00 ? 50  GLN A CA   1  
ATOM 759   C C    . GLN A 1 50  ? -2.861  -1.760  6.437   1.00 0.00 ? 50  GLN A C    1  
ATOM 760   O O    . GLN A 1 50  ? -2.517  -1.273  7.512   1.00 0.00 ? 50  GLN A O    1  
ATOM 761   C CB   . GLN A 1 50  ? -2.859  -4.281  6.397   1.00 0.00 ? 50  GLN A CB   1  
ATOM 762   C CG   . GLN A 1 50  ? -3.108  -5.118  7.653   1.00 0.00 ? 50  GLN A CG   1  
ATOM 763   C CD   . GLN A 1 50  ? -3.133  -6.611  7.322   1.00 0.00 ? 50  GLN A CD   1  
ATOM 764   O OE1  . GLN A 1 50  ? -2.251  -7.370  7.689   1.00 0.00 ? 50  GLN A OE1  1  
ATOM 765   N NE2  . GLN A 1 50  ? -4.191  -6.989  6.609   1.00 0.00 ? 50  GLN A NE2  1  
ATOM 766   H H    . GLN A 1 50  ? -4.361  -3.633  4.509   1.00 0.00 ? 50  GLN A H    1  
ATOM 767   H HA   . GLN A 1 50  ? -4.389  -3.043  7.261   1.00 0.00 ? 50  GLN A HA   1  
ATOM 768   H HB2  . GLN A 1 50  ? -3.076  -4.877  5.510   1.00 0.00 ? 50  GLN A HB2  1  
ATOM 769   H HB3  . GLN A 1 50  ? -1.807  -4.003  6.343   1.00 0.00 ? 50  GLN A HB3  1  
ATOM 770   H HG2  . GLN A 1 50  ? -2.328  -4.918  8.388   1.00 0.00 ? 50  GLN A HG2  1  
ATOM 771   H HG3  . GLN A 1 50  ? -4.055  -4.826  8.107   1.00 0.00 ? 50  GLN A HG3  1  
ATOM 772   H HE21 . GLN A 1 50  ? -4.879  -6.316  6.340   1.00 0.00 ? 50  GLN A HE21 1  
ATOM 773   H HE22 . GLN A 1 50  ? -4.297  -7.947  6.343   1.00 0.00 ? 50  GLN A HE22 1  
ATOM 774   N N    . ASP A 1 51  ? -2.535  -1.267  5.251   1.00 0.00 ? 51  ASP A N    1  
ATOM 775   C CA   . ASP A 1 51  ? -1.716  -0.071  5.137   1.00 0.00 ? 51  ASP A CA   1  
ATOM 776   C C    . ASP A 1 51  ? -2.541  1.148   5.554   1.00 0.00 ? 51  ASP A C    1  
ATOM 777   O O    . ASP A 1 51  ? -2.187  1.848   6.501   1.00 0.00 ? 51  ASP A O    1  
ATOM 778   C CB   . ASP A 1 51  ? -1.251  0.143   3.696   1.00 0.00 ? 51  ASP A CB   1  
ATOM 779   C CG   . ASP A 1 51  ? -0.131  -0.791  3.232   1.00 0.00 ? 51  ASP A CG   1  
ATOM 780   O OD1  . ASP A 1 51  ? 0.597   -1.287  4.119   1.00 0.00 ? 51  ASP A OD1  1  
ATOM 781   O OD2  . ASP A 1 51  ? -0.028  -0.987  2.002   1.00 0.00 ? 51  ASP A OD2  1  
ATOM 782   H H    . ASP A 1 51  ? -2.819  -1.669  4.381   1.00 0.00 ? 51  ASP A H    1  
ATOM 783   H HA   . ASP A 1 51  ? -0.865  -0.244  5.796   1.00 0.00 ? 51  ASP A HA   1  
ATOM 784   H HB2  . ASP A 1 51  ? -2.106  0.017   3.031   1.00 0.00 ? 51  ASP A HB2  1  
ATOM 785   H HB3  . ASP A 1 51  ? -0.913  1.173   3.588   1.00 0.00 ? 51  ASP A HB3  1  
ATOM 786   N N    . LEU A 1 52  ? -3.627  1.365   4.826   1.00 0.00 ? 52  LEU A N    1  
ATOM 787   C CA   . LEU A 1 52  ? -4.505  2.487   5.108   1.00 0.00 ? 52  LEU A CA   1  
ATOM 788   C C    . LEU A 1 52  ? -4.965  2.416   6.565   1.00 0.00 ? 52  LEU A C    1  
ATOM 789   O O    . LEU A 1 52  ? -5.128  3.445   7.220   1.00 0.00 ? 52  LEU A O    1  
ATOM 790   C CB   . LEU A 1 52  ? -5.657  2.533   4.101   1.00 0.00 ? 52  LEU A CB   1  
ATOM 791   C CG   . LEU A 1 52  ? -5.505  3.534   2.954   1.00 0.00 ? 52  LEU A CG   1  
ATOM 792   C CD1  . LEU A 1 52  ? -6.529  3.261   1.850   1.00 0.00 ? 52  LEU A CD1  1  
ATOM 793   C CD2  . LEU A 1 52  ? -5.585  4.973   3.467   1.00 0.00 ? 52  LEU A CD2  1  
ATOM 794   H H    . LEU A 1 52  ? -3.908  0.791   4.057   1.00 0.00 ? 52  LEU A H    1  
ATOM 795   H HA   . LEU A 1 52  ? -3.923  3.399   4.974   1.00 0.00 ? 52  LEU A HA   1  
ATOM 796   H HB2  . LEU A 1 52  ? -5.780  1.538   3.675   1.00 0.00 ? 52  LEU A HB2  1  
ATOM 797   H HB3  . LEU A 1 52  ? -6.575  2.765   4.640   1.00 0.00 ? 52  LEU A HB3  1  
ATOM 798   H HG   . LEU A 1 52  ? -4.516  3.403   2.515   1.00 0.00 ? 52  LEU A HG   1  
ATOM 799   H HD11 . LEU A 1 52  ? -7.011  2.301   2.031   1.00 0.00 ? 52  LEU A HD11 1  
ATOM 800   H HD12 . LEU A 1 52  ? -7.280  4.051   1.848   1.00 0.00 ? 52  LEU A HD12 1  
ATOM 801   H HD13 . LEU A 1 52  ? -6.024  3.238   0.884   1.00 0.00 ? 52  LEU A HD13 1  
ATOM 802   H HD21 . LEU A 1 52  ? -5.538  4.973   4.556   1.00 0.00 ? 52  LEU A HD21 1  
ATOM 803   H HD22 . LEU A 1 52  ? -4.749  5.548   3.068   1.00 0.00 ? 52  LEU A HD22 1  
ATOM 804   H HD23 . LEU A 1 52  ? -6.523  5.423   3.143   1.00 0.00 ? 52  LEU A HD23 1  
ATOM 805   N N    . ASN A 1 53  ? -5.161  1.191   7.031   1.00 0.00 ? 53  ASN A N    1  
ATOM 806   C CA   . ASN A 1 53  ? -5.599  0.972   8.399   1.00 0.00 ? 53  ASN A CA   1  
ATOM 807   C C    . ASN A 1 53  ? -4.482  1.383   9.360   1.00 0.00 ? 53  ASN A C    1  
ATOM 808   O O    . ASN A 1 53  ? -4.738  2.020   10.380  1.00 0.00 ? 53  ASN A O    1  
ATOM 809   C CB   . ASN A 1 53  ? -5.916  -0.504  8.646   1.00 0.00 ? 53  ASN A CB   1  
ATOM 810   C CG   . ASN A 1 53  ? -6.260  -0.753  10.116  1.00 0.00 ? 53  ASN A CG   1  
ATOM 811   O OD1  . ASN A 1 53  ? -7.165  -0.157  10.678  1.00 0.00 ? 53  ASN A OD1  1  
ATOM 812   N ND2  . ASN A 1 53  ? -5.491  -1.663  10.706  1.00 0.00 ? 53  ASN A ND2  1  
ATOM 813   H H    . ASN A 1 53  ? -5.026  0.360   6.492   1.00 0.00 ? 53  ASN A H    1  
ATOM 814   H HA   . ASN A 1 53  ? -6.494  1.583   8.515   1.00 0.00 ? 53  ASN A HA   1  
ATOM 815   H HB2  . ASN A 1 53  ? -6.751  -0.811  8.016   1.00 0.00 ? 53  ASN A HB2  1  
ATOM 816   H HB3  . ASN A 1 53  ? -5.060  -1.116  8.361   1.00 0.00 ? 53  ASN A HB3  1  
ATOM 817   H HD21 . ASN A 1 53  ? -4.765  -2.116  10.188  1.00 0.00 ? 53  ASN A HD21 1  
ATOM 818   H HD22 . ASN A 1 53  ? -5.638  -1.895  11.667  1.00 0.00 ? 53  ASN A HD22 1  
ATOM 819   N N    . THR A 1 54  ? -3.265  1.001   9.000   1.00 0.00 ? 54  THR A N    1  
ATOM 820   C CA   . THR A 1 54  ? -2.107  1.322   9.817   1.00 0.00 ? 54  THR A CA   1  
ATOM 821   C C    . THR A 1 54  ? -1.946  2.839   9.941   1.00 0.00 ? 54  THR A C    1  
ATOM 822   O O    . THR A 1 54  ? -1.763  3.360   11.040  1.00 0.00 ? 54  THR A O    1  
ATOM 823   C CB   . THR A 1 54  ? -0.889  0.629   9.204   1.00 0.00 ? 54  THR A CB   1  
ATOM 824   O OG1  . THR A 1 54  ? -0.848  -0.639  9.853   1.00 0.00 ? 54  THR A OG1  1  
ATOM 825   C CG2  . THR A 1 54  ? 0.428   1.296   9.606   1.00 0.00 ? 54  THR A CG2  1  
ATOM 826   H H    . THR A 1 54  ? -3.065  0.483   8.168   1.00 0.00 ? 54  THR A H    1  
ATOM 827   H HA   . THR A 1 54  ? -2.279  0.936   10.822  1.00 0.00 ? 54  THR A HA   1  
ATOM 828   H HB   . THR A 1 54  ? -0.980  0.569   8.120   1.00 0.00 ? 54  THR A HB   1  
ATOM 829   H HG1  . THR A 1 54  ? 0.012   -1.103  9.643   1.00 0.00 ? 54  THR A HG1  1  
ATOM 830   H HG21 . THR A 1 54  ? 0.361   1.640   10.639  1.00 0.00 ? 54  THR A HG21 1  
ATOM 831   H HG22 . THR A 1 54  ? 1.242   0.578   9.514   1.00 0.00 ? 54  THR A HG22 1  
ATOM 832   H HG23 . THR A 1 54  ? 0.619   2.147   8.952   1.00 0.00 ? 54  THR A HG23 1  
ATOM 833   N N    . MET A 1 55  ? -2.019  3.504   8.797   1.00 0.00 ? 55  MET A N    1  
ATOM 834   C CA   . MET A 1 55  ? -1.883  4.951   8.764   1.00 0.00 ? 55  MET A CA   1  
ATOM 835   C C    . MET A 1 55  ? -3.043  5.628   9.496   1.00 0.00 ? 55  MET A C    1  
ATOM 836   O O    . MET A 1 55  ? -2.868  6.686   10.099  1.00 0.00 ? 55  MET A O    1  
ATOM 837   C CB   . MET A 1 55  ? -1.849  5.427   7.310   1.00 0.00 ? 55  MET A CB   1  
ATOM 838   C CG   . MET A 1 55  ? -0.506  6.079   6.977   1.00 0.00 ? 55  MET A CG   1  
ATOM 839   S SD   . MET A 1 55  ? -0.229  6.042   5.214   1.00 0.00 ? 55  MET A SD   1  
ATOM 840   C CE   . MET A 1 55  ? -0.437  7.773   4.831   1.00 0.00 ? 55  MET A CE   1  
ATOM 841   H H    . MET A 1 55  ? -2.167  3.073   7.908   1.00 0.00 ? 55  MET A H    1  
ATOM 842   H HA   . MET A 1 55  ? -0.944  5.168   9.274   1.00 0.00 ? 55  MET A HA   1  
ATOM 843   H HB2  . MET A 1 55  ? -2.023  4.582   6.643   1.00 0.00 ? 55  MET A HB2  1  
ATOM 844   H HB3  . MET A 1 55  ? -2.656  6.139   7.138   1.00 0.00 ? 55  MET A HB3  1  
ATOM 845   H HG2  . MET A 1 55  ? -0.494  7.109   7.334   1.00 0.00 ? 55  MET A HG2  1  
ATOM 846   H HG3  . MET A 1 55  ? 0.300   5.554   7.491   1.00 0.00 ? 55  MET A HG3  1  
ATOM 847   H HE1  . MET A 1 55  ? -0.477  8.347   5.757   1.00 0.00 ? 55  MET A HE1  1  
ATOM 848   H HE2  . MET A 1 55  ? 0.404   8.115   4.228   1.00 0.00 ? 55  MET A HE2  1  
ATOM 849   H HE3  . MET A 1 55  ? -1.364  7.913   4.276   1.00 0.00 ? 55  MET A HE3  1  
ATOM 850   N N    . LEU A 1 56  ? -4.201  4.990   9.420   1.00 0.00 ? 56  LEU A N    1  
ATOM 851   C CA   . LEU A 1 56  ? -5.390  5.518   10.069  1.00 0.00 ? 56  LEU A CA   1  
ATOM 852   C C    . LEU A 1 56  ? -5.231  5.403   11.586  1.00 0.00 ? 56  LEU A C    1  
ATOM 853   O O    . LEU A 1 56  ? -5.527  6.347   12.318  1.00 0.00 ? 56  LEU A O    1  
ATOM 854   C CB   . LEU A 1 56  ? -6.645  4.830   9.528   1.00 0.00 ? 56  LEU A CB   1  
ATOM 855   C CG   . LEU A 1 56  ? -7.449  5.619   8.493   1.00 0.00 ? 56  LEU A CG   1  
ATOM 856   C CD1  . LEU A 1 56  ? -6.778  5.564   7.119   1.00 0.00 ? 56  LEU A CD1  1  
ATOM 857   C CD2  . LEU A 1 56  ? -8.900  5.136   8.441   1.00 0.00 ? 56  LEU A CD2  1  
ATOM 858   H H    . LEU A 1 56  ? -4.335  4.130   8.928   1.00 0.00 ? 56  LEU A H    1  
ATOM 859   H HA   . LEU A 1 56  ? -5.463  6.573   9.807   1.00 0.00 ? 56  LEU A HA   1  
ATOM 860   H HB2  . LEU A 1 56  ? -6.351  3.879   9.083   1.00 0.00 ? 56  LEU A HB2  1  
ATOM 861   H HB3  . LEU A 1 56  ? -7.300  4.599   10.369  1.00 0.00 ? 56  LEU A HB3  1  
ATOM 862   H HG   . LEU A 1 56  ? -7.469  6.665   8.800   1.00 0.00 ? 56  LEU A HG   1  
ATOM 863   H HD11 . LEU A 1 56  ? -5.695  5.572   7.243   1.00 0.00 ? 56  LEU A HD11 1  
ATOM 864   H HD12 . LEU A 1 56  ? -7.078  4.651   6.604   1.00 0.00 ? 56  LEU A HD12 1  
ATOM 865   H HD13 . LEU A 1 56  ? -7.083  6.429   6.531   1.00 0.00 ? 56  LEU A HD13 1  
ATOM 866   H HD21 . LEU A 1 56  ? -9.204  4.793   9.430   1.00 0.00 ? 56  LEU A HD21 1  
ATOM 867   H HD22 . LEU A 1 56  ? -9.545  5.957   8.128   1.00 0.00 ? 56  LEU A HD22 1  
ATOM 868   H HD23 . LEU A 1 56  ? -8.985  4.315   7.730   1.00 0.00 ? 56  LEU A HD23 1  
ATOM 869   N N    . ASN A 1 57  ? -4.764  4.239   12.014  1.00 0.00 ? 57  ASN A N    1  
ATOM 870   C CA   . ASN A 1 57  ? -4.562  3.989   13.431  1.00 0.00 ? 57  ASN A CA   1  
ATOM 871   C C    . ASN A 1 57  ? -3.402  4.849   13.936  1.00 0.00 ? 57  ASN A C    1  
ATOM 872   O O    . ASN A 1 57  ? -3.372  5.234   15.104  1.00 0.00 ? 57  ASN A O    1  
ATOM 873   C CB   . ASN A 1 57  ? -4.211  2.523   13.687  1.00 0.00 ? 57  ASN A CB   1  
ATOM 874   C CG   . ASN A 1 57  ? -5.015  1.963   14.862  1.00 0.00 ? 57  ASN A CG   1  
ATOM 875   O OD1  . ASN A 1 57  ? -6.173  1.599   14.738  1.00 0.00 ? 57  ASN A OD1  1  
ATOM 876   N ND2  . ASN A 1 57  ? -4.339  1.915   16.006  1.00 0.00 ? 57  ASN A ND2  1  
ATOM 877   H H    . ASN A 1 57  ? -4.526  3.477   11.412  1.00 0.00 ? 57  ASN A H    1  
ATOM 878   H HA   . ASN A 1 57  ? -5.509  4.247   13.905  1.00 0.00 ? 57  ASN A HA   1  
ATOM 879   H HB2  . ASN A 1 57  ? -4.412  1.935   12.791  1.00 0.00 ? 57  ASN A HB2  1  
ATOM 880   H HB3  . ASN A 1 57  ? -3.145  2.431   13.895  1.00 0.00 ? 57  ASN A HB3  1  
ATOM 881   H HD21 . ASN A 1 57  ? -3.390  2.229   16.040  1.00 0.00 ? 57  ASN A HD21 1  
ATOM 882   H HD22 . ASN A 1 57  ? -4.779  1.564   16.833  1.00 0.00 ? 57  ASN A HD22 1  
ATOM 883   N N    . THR A 1 58  ? -2.474  5.124   13.031  1.00 0.00 ? 58  THR A N    1  
ATOM 884   C CA   . THR A 1 58  ? -1.314  5.931   13.370  1.00 0.00 ? 58  THR A CA   1  
ATOM 885   C C    . THR A 1 58  ? -1.747  7.335   13.795  1.00 0.00 ? 58  THR A C    1  
ATOM 886   O O    . THR A 1 58  ? -1.161  7.921   14.705  1.00 0.00 ? 58  THR A O    1  
ATOM 887   C CB   . THR A 1 58  ? -0.366  5.924   12.169  1.00 0.00 ? 58  THR A CB   1  
ATOM 888   O OG1  . THR A 1 58  ? 0.647   4.990   12.531  1.00 0.00 ? 58  THR A OG1  1  
ATOM 889   C CG2  . THR A 1 58  ? 0.387   7.247   12.010  1.00 0.00 ? 58  THR A CG2  1  
ATOM 890   H H    . THR A 1 58  ? -2.505  4.806   12.083  1.00 0.00 ? 58  THR A H    1  
ATOM 891   H HA   . THR A 1 58  ? -0.818  5.476   14.228  1.00 0.00 ? 58  THR A HA   1  
ATOM 892   H HB   . THR A 1 58  ? -0.899  5.667   11.254  1.00 0.00 ? 58  THR A HB   1  
ATOM 893   H HG1  . THR A 1 58  ? 0.233   4.113   12.774  1.00 0.00 ? 58  THR A HG1  1  
ATOM 894   H HG21 . THR A 1 58  ? 0.729   7.590   12.986  1.00 0.00 ? 58  THR A HG21 1  
ATOM 895   H HG22 . THR A 1 58  ? 1.246   7.099   11.355  1.00 0.00 ? 58  THR A HG22 1  
ATOM 896   H HG23 . THR A 1 58  ? -0.278  7.993   11.575  1.00 0.00 ? 58  THR A HG23 1  
ATOM 897   N N    . VAL A 1 59  ? -2.769  7.835   13.116  1.00 0.00 ? 59  VAL A N    1  
ATOM 898   C CA   . VAL A 1 59  ? -3.287  9.160   13.412  1.00 0.00 ? 59  VAL A CA   1  
ATOM 899   C C    . VAL A 1 59  ? -3.402  9.331   14.928  1.00 0.00 ? 59  VAL A C    1  
ATOM 900   O O    . VAL A 1 59  ? -3.293  8.361   15.676  1.00 0.00 ? 59  VAL A O    1  
ATOM 901   C CB   . VAL A 1 59  ? -4.614  9.377   12.683  1.00 0.00 ? 59  VAL A CB   1  
ATOM 902   C CG1  . VAL A 1 59  ? -5.779  9.441   13.673  1.00 0.00 ? 59  VAL A CG1  1  
ATOM 903   C CG2  . VAL A 1 59  ? -4.563  10.636  11.814  1.00 0.00 ? 59  VAL A CG2  1  
ATOM 904   H H    . VAL A 1 59  ? -3.239  7.352   12.378  1.00 0.00 ? 59  VAL A H    1  
ATOM 905   H HA   . VAL A 1 59  ? -2.569  9.887   13.030  1.00 0.00 ? 59  VAL A HA   1  
ATOM 906   H HB   . VAL A 1 59  ? -4.780  8.523   12.026  1.00 0.00 ? 59  VAL A HB   1  
ATOM 907   H HG11 . VAL A 1 59  ? -5.698  8.619   14.383  1.00 0.00 ? 59  VAL A HG11 1  
ATOM 908   H HG12 . VAL A 1 59  ? -5.748  10.389  14.210  1.00 0.00 ? 59  VAL A HG12 1  
ATOM 909   H HG13 . VAL A 1 59  ? -6.722  9.361   13.131  1.00 0.00 ? 59  VAL A HG13 1  
ATOM 910   H HG21 . VAL A 1 59  ? -4.129  11.455  12.387  1.00 0.00 ? 59  VAL A HG21 1  
ATOM 911   H HG22 . VAL A 1 59  ? -3.952  10.444  10.932  1.00 0.00 ? 59  VAL A HG22 1  
ATOM 912   H HG23 . VAL A 1 59  ? -5.573  10.905  11.505  1.00 0.00 ? 59  VAL A HG23 1  
ATOM 913   N N    . GLY A 1 60  ? -3.620  10.573  15.336  1.00 0.00 ? 60  GLY A N    1  
ATOM 914   C CA   . GLY A 1 60  ? -3.751  10.884  16.749  1.00 0.00 ? 60  GLY A CA   1  
ATOM 915   C C    . GLY A 1 60  ? -4.623  9.847   17.460  1.00 0.00 ? 60  GLY A C    1  
ATOM 916   O O    . GLY A 1 60  ? -4.210  9.264   18.462  1.00 0.00 ? 60  GLY A O    1  
ATOM 917   H H    . GLY A 1 60  ? -3.707  11.357  14.721  1.00 0.00 ? 60  GLY A H    1  
ATOM 918   H HA2  . GLY A 1 60  ? -2.765  10.913  17.212  1.00 0.00 ? 60  GLY A HA2  1  
ATOM 919   H HA3  . GLY A 1 60  ? -4.189  11.875  16.868  1.00 0.00 ? 60  GLY A HA3  1  
ATOM 920   N N    . GLY A 1 61  ? -5.814  9.647   16.914  1.00 0.00 ? 61  GLY A N    1  
ATOM 921   C CA   . GLY A 1 61  ? -6.748  8.691   17.484  1.00 0.00 ? 61  GLY A CA   1  
ATOM 922   C C    . GLY A 1 61  ? -7.964  9.401   18.082  1.00 0.00 ? 61  GLY A C    1  
ATOM 923   O O    . GLY A 1 61  ? -8.279  9.218   19.257  1.00 0.00 ? 61  GLY A O    1  
ATOM 924   H H    . GLY A 1 61  ? -6.143  10.125  16.100  1.00 0.00 ? 61  GLY A H    1  
ATOM 925   H HA2  . GLY A 1 61  ? -7.073  7.992   16.713  1.00 0.00 ? 61  GLY A HA2  1  
ATOM 926   H HA3  . GLY A 1 61  ? -6.249  8.105   18.256  1.00 0.00 ? 61  GLY A HA3  1  
ATOM 927   N N    . HIS A 1 62  ? -8.614  10.198  17.246  1.00 0.00 ? 62  HIS A N    1  
ATOM 928   C CA   . HIS A 1 62  ? -9.789  10.936  17.677  1.00 0.00 ? 62  HIS A CA   1  
ATOM 929   C C    . HIS A 1 62  ? -11.052 10.169  17.281  1.00 0.00 ? 62  HIS A C    1  
ATOM 930   O O    . HIS A 1 62  ? -11.320 9.978   16.096  1.00 0.00 ? 62  HIS A O    1  
ATOM 931   C CB   . HIS A 1 62  ? -9.765  12.364  17.127  1.00 0.00 ? 62  HIS A CB   1  
ATOM 932   C CG   . HIS A 1 62  ? -8.385  12.973  17.059  1.00 0.00 ? 62  HIS A CG   1  
ATOM 933   N ND1  . HIS A 1 62  ? -7.998  13.842  16.054  1.00 0.00 ? 62  HIS A ND1  1  
ATOM 934   C CD2  . HIS A 1 62  ? -7.306  12.830  17.881  1.00 0.00 ? 62  HIS A CD2  1  
ATOM 935   C CE1  . HIS A 1 62  ? -6.741  14.199  16.271  1.00 0.00 ? 62  HIS A CE1  1  
ATOM 936   N NE2  . HIS A 1 62  ? -6.313  13.570  17.404  1.00 0.00 ? 62  HIS A NE2  1  
ATOM 937   H H    . HIS A 1 62  ? -8.351  10.341  16.292  1.00 0.00 ? 62  HIS A H    1  
ATOM 938   H HA   . HIS A 1 62  ? -9.738  10.998  18.764  1.00 0.00 ? 62  HIS A HA   1  
ATOM 939   H HB2  . HIS A 1 62  ? -10.201 12.365  16.129  1.00 0.00 ? 62  HIS A HB2  1  
ATOM 940   H HB3  . HIS A 1 62  ? -10.398 12.993  17.752  1.00 0.00 ? 62  HIS A HB3  1  
ATOM 941   H HD1  . HIS A 1 62  ? -8.570  14.149  15.293  1.00 0.00 ? 62  HIS A HD1  1  
ATOM 942   H HD2  . HIS A 1 62  ? -7.266  12.212  18.778  1.00 0.00 ? 62  HIS A HD2  1  
ATOM 943   H HE1  . HIS A 1 62  ? -6.151  14.876  15.653  1.00 0.00 ? 62  HIS A HE1  1  
ATOM 944   H HE2  . HIS A 1 62  ? -5.422  13.698  17.838  1.00 0.00 ? 62  HIS A HE2  1  
ATOM 945   N N    . GLN A 1 63  ? -11.794 9.750   18.295  1.00 0.00 ? 63  GLN A N    1  
ATOM 946   C CA   . GLN A 1 63  ? -13.022 9.008   18.068  1.00 0.00 ? 63  GLN A CA   1  
ATOM 947   C C    . GLN A 1 63  ? -13.978 9.820   17.192  1.00 0.00 ? 63  GLN A C    1  
ATOM 948   O O    . GLN A 1 63  ? -14.755 9.254   16.425  1.00 0.00 ? 63  GLN A O    1  
ATOM 949   C CB   . GLN A 1 63  ? -13.684 8.623   19.393  1.00 0.00 ? 63  GLN A CB   1  
ATOM 950   C CG   . GLN A 1 63  ? -14.134 9.867   20.162  1.00 0.00 ? 63  GLN A CG   1  
ATOM 951   C CD   . GLN A 1 63  ? -14.696 9.490   21.534  1.00 0.00 ? 63  GLN A CD   1  
ATOM 952   O OE1  . GLN A 1 63  ? -14.641 8.349   21.963  1.00 0.00 ? 63  GLN A OE1  1  
ATOM 953   N NE2  . GLN A 1 63  ? -15.237 10.509  22.196  1.00 0.00 ? 63  GLN A NE2  1  
ATOM 954   H H    . GLN A 1 63  ? -11.568 9.909   19.257  1.00 0.00 ? 63  GLN A H    1  
ATOM 955   H HA   . GLN A 1 63  ? -12.720 8.101   17.543  1.00 0.00 ? 63  GLN A HA   1  
ATOM 956   H HB2  . GLN A 1 63  ? -14.542 7.979   19.201  1.00 0.00 ? 63  GLN A HB2  1  
ATOM 957   H HB3  . GLN A 1 63  ? -12.984 8.049   20.000  1.00 0.00 ? 63  GLN A HB3  1  
ATOM 958   H HG2  . GLN A 1 63  ? -13.291 10.548  20.284  1.00 0.00 ? 63  GLN A HG2  1  
ATOM 959   H HG3  . GLN A 1 63  ? -14.893 10.399  19.588  1.00 0.00 ? 63  GLN A HG3  1  
ATOM 960   H HE21 . GLN A 1 63  ? -15.249 11.421  21.786  1.00 0.00 ? 63  GLN A HE21 1  
ATOM 961   H HE22 . GLN A 1 63  ? -15.631 10.362  23.103  1.00 0.00 ? 63  GLN A HE22 1  
ATOM 962   N N    . ALA A 1 64  ? -13.890 11.134  17.336  1.00 0.00 ? 64  ALA A N    1  
ATOM 963   C CA   . ALA A 1 64  ? -14.738 12.030  16.568  1.00 0.00 ? 64  ALA A CA   1  
ATOM 964   C C    . ALA A 1 64  ? -14.335 11.966  15.093  1.00 0.00 ? 64  ALA A C    1  
ATOM 965   O O    . ALA A 1 64  ? -15.184 11.786  14.221  1.00 0.00 ? 64  ALA A O    1  
ATOM 966   C CB   . ALA A 1 64  ? -14.636 13.445  17.140  1.00 0.00 ? 64  ALA A CB   1  
ATOM 967   H H    . ALA A 1 64  ? -13.255 11.586  17.962  1.00 0.00 ? 64  ALA A H    1  
ATOM 968   H HA   . ALA A 1 64  ? -15.766 11.683  16.670  1.00 0.00 ? 64  ALA A HA   1  
ATOM 969   H HB1  . ALA A 1 64  ? -14.331 13.393  18.185  1.00 0.00 ? 64  ALA A HB1  1  
ATOM 970   H HB2  . ALA A 1 64  ? -13.898 14.013  16.574  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 971   H HB3  . ALA A 1 64  ? -15.606 13.937  17.068  1.00 0.00 ? 64  ALA A HB3  1  
ATOM 972   N N    . ALA A 1 65  ? -13.040 12.118  14.859  1.00 0.00 ? 65  ALA A N    1  
ATOM 973   C CA   . ALA A 1 65  ? -12.514 12.080  13.505  1.00 0.00 ? 65  ALA A CA   1  
ATOM 974   C C    . ALA A 1 65  ? -12.831 10.722  12.877  1.00 0.00 ? 65  ALA A C    1  
ATOM 975   O O    . ALA A 1 65  ? -13.427 10.654  11.803  1.00 0.00 ? 65  ALA A O    1  
ATOM 976   C CB   . ALA A 1 65  ? -11.013 12.374  13.532  1.00 0.00 ? 65  ALA A CB   1  
ATOM 977   H H    . ALA A 1 65  ? -12.356 12.264  15.574  1.00 0.00 ? 65  ALA A H    1  
ATOM 978   H HA   . ALA A 1 65  ? -13.015 12.862  12.933  1.00 0.00 ? 65  ALA A HA   1  
ATOM 979   H HB1  . ALA A 1 65  ? -10.525 11.709  14.244  1.00 0.00 ? 65  ALA A HB1  1  
ATOM 980   H HB2  . ALA A 1 65  ? -10.594 12.213  12.539  1.00 0.00 ? 65  ALA A HB2  1  
ATOM 981   H HB3  . ALA A 1 65  ? -10.850 13.409  13.831  1.00 0.00 ? 65  ALA A HB3  1  
ATOM 982   N N    . MET A 1 66  ? -12.419 9.673   13.574  1.00 0.00 ? 66  MET A N    1  
ATOM 983   C CA   . MET A 1 66  ? -12.652 8.320   13.098  1.00 0.00 ? 66  MET A CA   1  
ATOM 984   C C    . MET A 1 66  ? -14.147 8.055   12.910  1.00 0.00 ? 66  MET A C    1  
ATOM 985   O O    . MET A 1 66  ? -14.546 7.363   11.975  1.00 0.00 ? 66  MET A O    1  
ATOM 986   C CB   . MET A 1 66  ? -12.078 7.319   14.103  1.00 0.00 ? 66  MET A CB   1  
ATOM 987   C CG   . MET A 1 66  ? -10.589 7.078   13.847  1.00 0.00 ? 66  MET A CG   1  
ATOM 988   S SD   . MET A 1 66  ? -10.355 6.373   12.224  1.00 0.00 ? 66  MET A SD   1  
ATOM 989   C CE   . MET A 1 66  ? -8.977  7.356   11.655  1.00 0.00 ? 66  MET A CE   1  
ATOM 990   H H    . MET A 1 66  ? -11.936 9.736   14.447  1.00 0.00 ? 66  MET A H    1  
ATOM 991   H HA   . MET A 1 66  ? -12.141 8.256   12.138  1.00 0.00 ? 66  MET A HA   1  
ATOM 992   H HB2  . MET A 1 66  ? -12.221 7.694   15.117  1.00 0.00 ? 66  MET A HB2  1  
ATOM 993   H HB3  . MET A 1 66  ? -12.620 6.376   14.033  1.00 0.00 ? 66  MET A HB3  1  
ATOM 994   H HG2  . MET A 1 66  ? -10.041 8.017   13.927  1.00 0.00 ? 66  MET A HG2  1  
ATOM 995   H HG3  . MET A 1 66  ? -10.185 6.408   14.606  1.00 0.00 ? 66  MET A HG3  1  
ATOM 996   H HE1  . MET A 1 66  ? -8.451  7.775   12.513  1.00 0.00 ? 66  MET A HE1  1  
ATOM 997   H HE2  . MET A 1 66  ? -8.296  6.728   11.082  1.00 0.00 ? 66  MET A HE2  1  
ATOM 998   H HE3  . MET A 1 66  ? -9.345  8.165   11.024  1.00 0.00 ? 66  MET A HE3  1  
ATOM 999   N N    . GLN A 1 67  ? -14.934 8.619   13.815  1.00 0.00 ? 67  GLN A N    1  
ATOM 1000  C CA   . GLN A 1 67  ? -16.377 8.452   13.761  1.00 0.00 ? 67  GLN A CA   1  
ATOM 1001  C C    . GLN A 1 67  ? -16.920 8.960   12.424  1.00 0.00 ? 67  GLN A C    1  
ATOM 1002  O O    . GLN A 1 67  ? -17.628 8.238   11.723  1.00 0.00 ? 67  GLN A O    1  
ATOM 1003  C CB   . GLN A 1 67  ? -17.055 9.162   14.934  1.00 0.00 ? 67  GLN A CB   1  
ATOM 1004  C CG   . GLN A 1 67  ? -18.576 9.173   14.762  1.00 0.00 ? 67  GLN A CG   1  
ATOM 1005  C CD   . GLN A 1 67  ? -19.269 8.560   15.980  1.00 0.00 ? 67  GLN A CD   1  
ATOM 1006  O OE1  . GLN A 1 67  ? -19.593 7.384   16.016  1.00 0.00 ? 67  GLN A OE1  1  
ATOM 1007  N NE2  . GLN A 1 67  ? -19.480 9.420   16.973  1.00 0.00 ? 67  GLN A NE2  1  
ATOM 1008  H H    . GLN A 1 67  ? -14.602 9.180   14.573  1.00 0.00 ? 67  GLN A H    1  
ATOM 1009  H HA   . GLN A 1 67  ? -16.547 7.378   13.846  1.00 0.00 ? 67  GLN A HA   1  
ATOM 1010  H HB2  . GLN A 1 67  ? -16.795 8.662   15.866  1.00 0.00 ? 67  GLN A HB2  1  
ATOM 1011  H HB3  . GLN A 1 67  ? -16.686 10.185  15.007  1.00 0.00 ? 67  GLN A HB3  1  
ATOM 1012  H HG2  . GLN A 1 67  ? -18.921 10.197  14.619  1.00 0.00 ? 67  GLN A HG2  1  
ATOM 1013  H HG3  . GLN A 1 67  ? -18.848 8.617   13.865  1.00 0.00 ? 67  GLN A HG3  1  
ATOM 1014  H HE21 . GLN A 1 67  ? -19.190 10.372  16.879  1.00 0.00 ? 67  GLN A HE21 1  
ATOM 1015  H HE22 . GLN A 1 67  ? -19.928 9.113   17.813  1.00 0.00 ? 67  GLN A HE22 1  
ATOM 1016  N N    . MET A 1 68  ? -16.568 10.198  12.110  1.00 0.00 ? 68  MET A N    1  
ATOM 1017  C CA   . MET A 1 68  ? -17.011 10.811  10.870  1.00 0.00 ? 68  MET A CA   1  
ATOM 1018  C C    . MET A 1 68  ? -16.527 10.010  9.659   1.00 0.00 ? 68  MET A C    1  
ATOM 1019  O O    . MET A 1 68  ? -17.277 9.807   8.705   1.00 0.00 ? 68  MET A O    1  
ATOM 1020  C CB   . MET A 1 68  ? -16.472 12.240  10.785  1.00 0.00 ? 68  MET A CB   1  
ATOM 1021  C CG   . MET A 1 68  ? -17.582 13.224  10.412  1.00 0.00 ? 68  MET A CG   1  
ATOM 1022  S SD   . MET A 1 68  ? -16.872 14.763  9.853   1.00 0.00 ? 68  MET A SD   1  
ATOM 1023  C CE   . MET A 1 68  ? -15.972 15.240  11.319  1.00 0.00 ? 68  MET A CE   1  
ATOM 1024  H H    . MET A 1 68  ? -15.991 10.778  12.686  1.00 0.00 ? 68  MET A H    1  
ATOM 1025  H HA   . MET A 1 68  ? -18.100 10.799  10.910  1.00 0.00 ? 68  MET A HA   1  
ATOM 1026  H HB2  . MET A 1 68  ? -16.035 12.525  11.742  1.00 0.00 ? 68  MET A HB2  1  
ATOM 1027  H HB3  . MET A 1 68  ? -15.674 12.288  10.043  1.00 0.00 ? 68  MET A HB3  1  
ATOM 1028  H HG2  . MET A 1 68  ? -18.209 12.798  9.628   1.00 0.00 ? 68  MET A HG2  1  
ATOM 1029  H HG3  . MET A 1 68  ? -18.226 13.402  11.273  1.00 0.00 ? 68  MET A HG3  1  
ATOM 1030  H HE1  . MET A 1 68  ? -16.633 15.185  12.184  1.00 0.00 ? 68  MET A HE1  1  
ATOM 1031  H HE2  . MET A 1 68  ? -15.128 14.565  11.463  1.00 0.00 ? 68  MET A HE2  1  
ATOM 1032  H HE3  . MET A 1 68  ? -15.607 16.260  11.205  1.00 0.00 ? 68  MET A HE3  1  
ATOM 1033  N N    . LEU A 1 69  ? -15.278 9.576   9.737   1.00 0.00 ? 69  LEU A N    1  
ATOM 1034  C CA   . LEU A 1 69  ? -14.686 8.802   8.660   1.00 0.00 ? 69  LEU A CA   1  
ATOM 1035  C C    . LEU A 1 69  ? -15.477 7.505   8.475   1.00 0.00 ? 69  LEU A C    1  
ATOM 1036  O O    . LEU A 1 69  ? -15.629 7.021   7.354   1.00 0.00 ? 69  LEU A O    1  
ATOM 1037  C CB   . LEU A 1 69  ? -13.194 8.580   8.917   1.00 0.00 ? 69  LEU A CB   1  
ATOM 1038  C CG   . LEU A 1 69  ? -12.361 8.156   7.706   1.00 0.00 ? 69  LEU A CG   1  
ATOM 1039  C CD1  . LEU A 1 69  ? -11.109 9.025   7.569   1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1040  C CD2  . LEU A 1 69  ? -12.020 6.666   7.770   1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1041  H H    . LEU A 1 69  ? -14.675 9.745   10.517  1.00 0.00 ? 69  LEU A H    1  
ATOM 1042  H HA   . LEU A 1 69  ? -14.772 9.392   7.748   1.00 0.00 ? 69  LEU A HA   1  
ATOM 1043  H HB2  . LEU A 1 69  ? -12.773 9.503   9.316   1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1044  H HB3  . LEU A 1 69  ? -13.087 7.820   9.690   1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1045  H HG   . LEU A 1 69  ? -12.959 8.310   6.808   1.00 0.00 ? 69  LEU A HG   1  
ATOM 1046  H HD11 . LEU A 1 69  ? -11.379 10.073  7.695   1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1047  H HD12 . LEU A 1 69  ? -10.385 8.742   8.334   1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1048  H HD13 . LEU A 1 69  ? -10.670 8.878   6.582   1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1049  H HD21 . LEU A 1 69  ? -11.671 6.416   8.772   1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1050  H HD22 . LEU A 1 69  ? -12.909 6.079   7.538   1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1051  H HD23 . LEU A 1 69  ? -11.236 6.440   7.046   1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1052  N N    . LYS A 1 70  ? -15.960 6.980   9.591   1.00 0.00 ? 70  LYS A N    1  
ATOM 1053  C CA   . LYS A 1 70  ? -16.732 5.749   9.566   1.00 0.00 ? 70  LYS A CA   1  
ATOM 1054  C C    . LYS A 1 70  ? -18.052 5.995   8.833   1.00 0.00 ? 70  LYS A C    1  
ATOM 1055  O O    . LYS A 1 70  ? -18.423 5.232   7.942   1.00 0.00 ? 70  LYS A O    1  
ATOM 1056  C CB   . LYS A 1 70  ? -16.908 5.198   10.982  1.00 0.00 ? 70  LYS A CB   1  
ATOM 1057  C CG   . LYS A 1 70  ? -16.878 3.668   10.983  1.00 0.00 ? 70  LYS A CG   1  
ATOM 1058  C CD   . LYS A 1 70  ? -17.880 3.101   11.990  1.00 0.00 ? 70  LYS A CD   1  
ATOM 1059  C CE   . LYS A 1 70  ? -17.724 1.585   12.125  1.00 0.00 ? 70  LYS A CE   1  
ATOM 1060  N NZ   . LYS A 1 70  ? -17.755 1.185   13.549  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 1061  H H    . LYS A 1 70  ? -15.832 7.380   10.498  1.00 0.00 ? 70  LYS A H    1  
ATOM 1062  H HA   . LYS A 1 70  ? -16.156 5.014   9.004   1.00 0.00 ? 70  LYS A HA   1  
ATOM 1063  H HB2  . LYS A 1 70  ? -16.117 5.581   11.627  1.00 0.00 ? 70  LYS A HB2  1  
ATOM 1064  H HB3  . LYS A 1 70  ? -17.853 5.547   11.397  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 1065  H HG2  . LYS A 1 70  ? -17.109 3.296   9.985   1.00 0.00 ? 70  LYS A HG2  1  
ATOM 1066  H HG3  . LYS A 1 70  ? -15.874 3.321   11.229  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 1067  H HD2  . LYS A 1 70  ? -17.732 3.573   12.962  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 1068  H HD3  . LYS A 1 70  ? -18.895 3.338   11.672  1.00 0.00 ? 70  LYS A HD3  1  
ATOM 1069  H HE2  . LYS A 1 70  ? -18.524 1.081   11.582  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 1070  H HE3  . LYS A 1 70  ? -16.784 1.269   11.673  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 1071  H HZ1  . LYS A 1 70  ? -18.154 1.923   14.094  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 1072  H HZ2  . LYS A 1 70  ? -18.309 0.358   13.652  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 1073  H HZ3  . LYS A 1 70  ? -16.824 1.003   13.865  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 1074  N N    . GLU A 1 71  ? -18.726 7.062   9.235   1.00 0.00 ? 71  GLU A N    1  
ATOM 1075  C CA   . GLU A 1 71  ? -19.997 7.418   8.628   1.00 0.00 ? 71  GLU A CA   1  
ATOM 1076  C C    . GLU A 1 71  ? -19.813 7.691   7.134   1.00 0.00 ? 71  GLU A C    1  
ATOM 1077  O O    . GLU A 1 71  ? -20.618 7.250   6.315   1.00 0.00 ? 71  GLU A O    1  
ATOM 1078  C CB   . GLU A 1 71  ? -20.623 8.623   9.333   1.00 0.00 ? 71  GLU A CB   1  
ATOM 1079  C CG   . GLU A 1 71  ? -21.899 8.222   10.075  1.00 0.00 ? 71  GLU A CG   1  
ATOM 1080  C CD   . GLU A 1 71  ? -22.694 9.457   10.505  1.00 0.00 ? 71  GLU A CD   1  
ATOM 1081  O OE1  . GLU A 1 71  ? -22.357 10.004  11.577  1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1082  O OE2  . GLU A 1 71  ? -23.621 9.825   9.752   1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1083  H H    . GLU A 1 71  ? -18.417 7.678   9.961   1.00 0.00 ? 71  GLU A H    1  
ATOM 1084  H HA   . GLU A 1 71  ? -20.639 6.549   8.769   1.00 0.00 ? 71  GLU A HA   1  
ATOM 1085  H HB2  . GLU A 1 71  ? -19.907 9.050   10.036  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1086  H HB3  . GLU A 1 71  ? -20.852 9.398   8.601   1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1087  H HG2  . GLU A 1 71  ? -22.515 7.593   9.433   1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1088  H HG3  . GLU A 1 71  ? -21.642 7.627   10.952  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1089  N N    . THR A 1 72  ? -18.749 8.417   6.824   1.00 0.00 ? 72  THR A N    1  
ATOM 1090  C CA   . THR A 1 72  ? -18.449 8.753   5.442   1.00 0.00 ? 72  THR A CA   1  
ATOM 1091  C C    . THR A 1 72  ? -18.276 7.482   4.609   1.00 0.00 ? 72  THR A C    1  
ATOM 1092  O O    . THR A 1 72  ? -19.013 7.259   3.650   1.00 0.00 ? 72  THR A O    1  
ATOM 1093  C CB   . THR A 1 72  ? -17.216 9.659   5.433   1.00 0.00 ? 72  THR A CB   1  
ATOM 1094  O OG1  . THR A 1 72  ? -17.751 10.973  5.300   1.00 0.00 ? 72  THR A OG1  1  
ATOM 1095  C CG2  . THR A 1 72  ? -16.363 9.474   4.176   1.00 0.00 ? 72  THR A CG2  1  
ATOM 1096  H H    . THR A 1 72  ? -18.099 8.771   7.496   1.00 0.00 ? 72  THR A H    1  
ATOM 1097  H HA   . THR A 1 72  ? -19.300 9.294   5.028   1.00 0.00 ? 72  THR A HA   1  
ATOM 1098  H HB   . THR A 1 72  ? -16.619 9.513   6.334   1.00 0.00 ? 72  THR A HB   1  
ATOM 1099  H HG1  . THR A 1 72  ? -17.008 11.641  5.248   1.00 0.00 ? 72  THR A HG1  1  
ATOM 1100  H HG21 . THR A 1 72  ? -16.975 9.048   3.381   1.00 0.00 ? 72  THR A HG21 1  
ATOM 1101  H HG22 . THR A 1 72  ? -15.974 10.441  3.856   1.00 0.00 ? 72  THR A HG22 1  
ATOM 1102  H HG23 . THR A 1 72  ? -15.533 8.802   4.395   1.00 0.00 ? 72  THR A HG23 1  
ATOM 1103  N N    . ILE A 1 73  ? -17.297 6.682   5.005   1.00 0.00 ? 73  ILE A N    1  
ATOM 1104  C CA   . ILE A 1 73  ? -17.018 5.439   4.307   1.00 0.00 ? 73  ILE A CA   1  
ATOM 1105  C C    . ILE A 1 73  ? -18.330 4.692   4.058   1.00 0.00 ? 73  ILE A C    1  
ATOM 1106  O O    . ILE A 1 73  ? -18.592 4.245   2.943   1.00 0.00 ? 73  ILE A O    1  
ATOM 1107  C CB   . ILE A 1 73  ? -15.978 4.617   5.071   1.00 0.00 ? 73  ILE A CB   1  
ATOM 1108  C CG1  . ILE A 1 73  ? -14.572 5.185   4.868   1.00 0.00 ? 73  ILE A CG1  1  
ATOM 1109  C CG2  . ILE A 1 73  ? -16.060 3.137   4.689   1.00 0.00 ? 73  ILE A CG2  1  
ATOM 1110  C CD1  . ILE A 1 73  ? -13.541 4.062   4.736   1.00 0.00 ? 73  ILE A CD1  1  
ATOM 1111  H H    . ILE A 1 73  ? -16.702 6.871   5.787   1.00 0.00 ? 73  ILE A H    1  
ATOM 1112  H HA   . ILE A 1 73  ? -16.579 5.697   3.343   1.00 0.00 ? 73  ILE A HA   1  
ATOM 1113  H HB   . ILE A 1 73  ? -16.203 4.687   6.136   1.00 0.00 ? 73  ILE A HB   1  
ATOM 1114  H HG12 . ILE A 1 73  ? -14.554 5.807   3.973   1.00 0.00 ? 73  ILE A HG12 1  
ATOM 1115  H HG13 . ILE A 1 73  ? -14.310 5.827   5.708   1.00 0.00 ? 73  ILE A HG13 1  
ATOM 1116  H HG21 . ILE A 1 73  ? -17.062 2.763   4.896   1.00 0.00 ? 73  ILE A HG21 1  
ATOM 1117  H HG22 . ILE A 1 73  ? -15.841 3.024   3.627   1.00 0.00 ? 73  ILE A HG22 1  
ATOM 1118  H HG23 . ILE A 1 73  ? -15.333 2.571   5.272   1.00 0.00 ? 73  ILE A HG23 1  
ATOM 1119  H HD11 . ILE A 1 73  ? -13.562 3.443   5.633   1.00 0.00 ? 73  ILE A HD11 1  
ATOM 1120  H HD12 . ILE A 1 73  ? -13.779 3.450   3.866   1.00 0.00 ? 73  ILE A HD12 1  
ATOM 1121  H HD13 . ILE A 1 73  ? -12.547 4.494   4.616   1.00 0.00 ? 73  ILE A HD13 1  
ATOM 1122  N N    . ASN A 1 74  ? -19.120 4.581   5.116   1.00 0.00 ? 74  ASN A N    1  
ATOM 1123  C CA   . ASN A 1 74  ? -20.398 3.896   5.026   1.00 0.00 ? 74  ASN A CA   1  
ATOM 1124  C C    . ASN A 1 74  ? -21.244 4.546   3.930   1.00 0.00 ? 74  ASN A C    1  
ATOM 1125  O O    . ASN A 1 74  ? -21.967 3.859   3.210   1.00 0.00 ? 74  ASN A O    1  
ATOM 1126  C CB   . ASN A 1 74  ? -21.171 3.999   6.343   1.00 0.00 ? 74  ASN A CB   1  
ATOM 1127  C CG   . ASN A 1 74  ? -22.284 2.950   6.409   1.00 0.00 ? 74  ASN A CG   1  
ATOM 1128  O OD1  . ASN A 1 74  ? -23.164 2.887   5.566   1.00 0.00 ? 74  ASN A OD1  1  
ATOM 1129  N ND2  . ASN A 1 74  ? -22.195 2.133   7.454   1.00 0.00 ? 74  ASN A ND2  1  
ATOM 1130  H H    . ASN A 1 74  ? -18.899 4.947   6.020   1.00 0.00 ? 74  ASN A H    1  
ATOM 1131  H HA   . ASN A 1 74  ? -20.152 2.858   4.804   1.00 0.00 ? 74  ASN A HA   1  
ATOM 1132  H HB2  . ASN A 1 74  ? -20.489 3.863   7.181   1.00 0.00 ? 74  ASN A HB2  1  
ATOM 1133  H HB3  . ASN A 1 74  ? -21.601 4.996   6.440   1.00 0.00 ? 74  ASN A HB3  1  
ATOM 1134  H HD21 . ASN A 1 74  ? -21.447 2.238   8.109   1.00 0.00 ? 74  ASN A HD21 1  
ATOM 1135  H HD22 . ASN A 1 74  ? -22.877 1.413   7.585   1.00 0.00 ? 74  ASN A HD22 1  
ATOM 1136  N N    . GLU A 1 75  ? -21.125 5.862   3.837   1.00 0.00 ? 75  GLU A N    1  
ATOM 1137  C CA   . GLU A 1 75  ? -21.870 6.612   2.840   1.00 0.00 ? 75  GLU A CA   1  
ATOM 1138  C C    . GLU A 1 75  ? -21.445 6.191   1.431   1.00 0.00 ? 75  GLU A C    1  
ATOM 1139  O O    . GLU A 1 75  ? -22.286 5.852   0.601   1.00 0.00 ? 75  GLU A O    1  
ATOM 1140  C CB   . GLU A 1 75  ? -21.689 8.119   3.039   1.00 0.00 ? 75  GLU A CB   1  
ATOM 1141  C CG   . GLU A 1 75  ? -22.997 8.867   2.776   1.00 0.00 ? 75  GLU A CG   1  
ATOM 1142  C CD   . GLU A 1 75  ? -22.806 10.377  2.935   1.00 0.00 ? 75  GLU A CD   1  
ATOM 1143  O OE1  . GLU A 1 75  ? -22.266 10.772  3.990   1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1144  O OE2  . GLU A 1 75  ? -23.206 11.102  1.998   1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1145  H H    . GLU A 1 75  ? -20.534 6.413   4.426   1.00 0.00 ? 75  GLU A H    1  
ATOM 1146  H HA   . GLU A 1 75  ? -22.916 6.353   3.004   1.00 0.00 ? 75  GLU A HA   1  
ATOM 1147  H HB2  . GLU A 1 75  ? -21.351 8.317   4.056   1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1148  H HB3  . GLU A 1 75  ? -20.913 8.488   2.368   1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1149  H HG2  . GLU A 1 75  ? -23.351 8.646   1.768   1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1150  H HG3  . GLU A 1 75  ? -23.765 8.519   3.466   1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1151  N N    . GLU A 1 76  ? -20.140 6.226   1.206   1.00 0.00 ? 76  GLU A N    1  
ATOM 1152  C CA   . GLU A 1 76  ? -19.593 5.851   -0.087  1.00 0.00 ? 76  GLU A CA   1  
ATOM 1153  C C    . GLU A 1 76  ? -20.127 4.482   -0.513  1.00 0.00 ? 76  GLU A C    1  
ATOM 1154  O O    . GLU A 1 76  ? -20.518 4.296   -1.664  1.00 0.00 ? 76  GLU A O    1  
ATOM 1155  C CB   . GLU A 1 76  ? -18.063 5.858   -0.058  1.00 0.00 ? 76  GLU A CB   1  
ATOM 1156  C CG   . GLU A 1 76  ? -17.504 6.991   -0.921  1.00 0.00 ? 76  GLU A CG   1  
ATOM 1157  C CD   . GLU A 1 76  ? -17.517 6.610   -2.402  1.00 0.00 ? 76  GLU A CD   1  
ATOM 1158  O OE1  . GLU A 1 76  ? -18.490 5.939   -2.807  1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1159  O OE2  . GLU A 1 76  ? -16.553 6.999   -3.097  1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1160  H H    . GLU A 1 76  ? -19.462 6.503   1.888   1.00 0.00 ? 76  GLU A H    1  
ATOM 1161  H HA   . GLU A 1 76  ? -19.940 6.617   -0.781  1.00 0.00 ? 76  GLU A HA   1  
ATOM 1162  H HB2  . GLU A 1 76  ? -17.716 5.972   0.969   1.00 0.00 ? 76  GLU A HB2  1  
ATOM 1163  H HB3  . GLU A 1 76  ? -17.685 4.902   -0.418  1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1164  H HG2  . GLU A 1 76  ? -18.095 7.895   -0.769  1.00 0.00 ? 76  GLU A HG2  1  
ATOM 1165  H HG3  . GLU A 1 76  ? -16.485 7.221   -0.609  1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1166  N N    . ALA A 1 77  ? -20.126 3.560   0.439   1.00 0.00 ? 77  ALA A N    1  
ATOM 1167  C CA   . ALA A 1 77  ? -20.606 2.214   0.176   1.00 0.00 ? 77  ALA A CA   1  
ATOM 1168  C C    . ALA A 1 77  ? -22.062 2.278   -0.289  1.00 0.00 ? 77  ALA A C    1  
ATOM 1169  O O    . ALA A 1 77  ? -22.421 1.677   -1.300  1.00 0.00 ? 77  ALA A O    1  
ATOM 1170  C CB   . ALA A 1 77  ? -20.432 1.356   1.431   1.00 0.00 ? 77  ALA A CB   1  
ATOM 1171  H H    . ALA A 1 77  ? -19.807 3.720   1.372   1.00 0.00 ? 77  ALA A H    1  
ATOM 1172  H HA   . ALA A 1 77  ? -19.996 1.794   -0.623  1.00 0.00 ? 77  ALA A HA   1  
ATOM 1173  H HB1  . ALA A 1 77  ? -19.449 1.540   1.864   1.00 0.00 ? 77  ALA A HB1  1  
ATOM 1174  H HB2  . ALA A 1 77  ? -21.203 1.615   2.157   1.00 0.00 ? 77  ALA A HB2  1  
ATOM 1175  H HB3  . ALA A 1 77  ? -20.521 0.303   1.166   1.00 0.00 ? 77  ALA A HB3  1  
ATOM 1176  N N    . ALA A 1 78  ? -22.861 3.012   0.471   1.00 0.00 ? 78  ALA A N    1  
ATOM 1177  C CA   . ALA A 1 78  ? -24.270 3.162   0.149   1.00 0.00 ? 78  ALA A CA   1  
ATOM 1178  C C    . ALA A 1 78  ? -24.411 3.632   -1.301  1.00 0.00 ? 78  ALA A C    1  
ATOM 1179  O O    . ALA A 1 78  ? -25.195 3.073   -2.065  1.00 0.00 ? 78  ALA A O    1  
ATOM 1180  C CB   . ALA A 1 78  ? -24.921 4.129   1.141   1.00 0.00 ? 78  ALA A CB   1  
ATOM 1181  H H    . ALA A 1 78  ? -22.561 3.498   1.292   1.00 0.00 ? 78  ALA A H    1  
ATOM 1182  H HA   . ALA A 1 78  ? -24.741 2.184   0.252   1.00 0.00 ? 78  ALA A HA   1  
ATOM 1183  H HB1  . ALA A 1 78  ? -25.999 3.969   1.151   1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1184  H HB2  . ALA A 1 78  ? -24.709 5.155   0.840   1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1185  H HB3  . ALA A 1 78  ? -24.518 3.952   2.138   1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1186  N N    . GLU A 1 79  ? -23.638 4.655   -1.635  1.00 0.00 ? 79  GLU A N    1  
ATOM 1187  C CA   . GLU A 1 79  ? -23.666 5.206   -2.979  1.00 0.00 ? 79  GLU A CA   1  
ATOM 1188  C C    . GLU A 1 79  ? -23.291 4.131   -4.002  1.00 0.00 ? 79  GLU A C    1  
ATOM 1189  O O    . GLU A 1 79  ? -23.826 4.110   -5.109  1.00 0.00 ? 79  GLU A O    1  
ATOM 1190  C CB   . GLU A 1 79  ? -22.740 6.418   -3.094  1.00 0.00 ? 79  GLU A CB   1  
ATOM 1191  C CG   . GLU A 1 79  ? -23.522 7.723   -2.929  1.00 0.00 ? 79  GLU A CG   1  
ATOM 1192  C CD   . GLU A 1 79  ? -22.587 8.933   -2.984  1.00 0.00 ? 79  GLU A CD   1  
ATOM 1193  O OE1  . GLU A 1 79  ? -21.991 9.141   -4.063  1.00 0.00 ? 79  GLU A OE1  1  
ATOM 1194  O OE2  . GLU A 1 79  ? -22.491 9.623   -1.947  1.00 0.00 ? 79  GLU A OE2  1  
ATOM 1195  H H    . GLU A 1 79  ? -23.002 5.104   -1.007  1.00 0.00 ? 79  GLU A H    1  
ATOM 1196  H HA   . GLU A 1 79  ? -24.695 5.526   -3.139  1.00 0.00 ? 79  GLU A HA   1  
ATOM 1197  H HB2  . GLU A 1 79  ? -21.961 6.359   -2.334  1.00 0.00 ? 79  GLU A HB2  1  
ATOM 1198  H HB3  . GLU A 1 79  ? -22.241 6.409   -4.063  1.00 0.00 ? 79  GLU A HB3  1  
ATOM 1199  H HG2  . GLU A 1 79  ? -24.273 7.803   -3.715  1.00 0.00 ? 79  GLU A HG2  1  
ATOM 1200  H HG3  . GLU A 1 79  ? -24.055 7.714   -1.978  1.00 0.00 ? 79  GLU A HG3  1  
ATOM 1201  N N    . TRP A 1 80  ? -22.375 3.265   -3.593  1.00 0.00 ? 80  TRP A N    1  
ATOM 1202  C CA   . TRP A 1 80  ? -21.923 2.190   -4.460  1.00 0.00 ? 80  TRP A CA   1  
ATOM 1203  C C    . TRP A 1 80  ? -23.134 1.322   -4.809  1.00 0.00 ? 80  TRP A C    1  
ATOM 1204  O O    . TRP A 1 80  ? -23.342 0.980   -5.972  1.00 0.00 ? 80  TRP A O    1  
ATOM 1205  C CB   . TRP A 1 80  ? -20.789 1.398   -3.806  1.00 0.00 ? 80  TRP A CB   1  
ATOM 1206  C CG   . TRP A 1 80  ? -19.639 1.058   -4.755  1.00 0.00 ? 80  TRP A CG   1  
ATOM 1207  C CD1  . TRP A 1 80  ? -19.358 -0.123  -5.322  1.00 0.00 ? 80  TRP A CD1  1  
ATOM 1208  C CD2  . TRP A 1 80  ? -18.619 1.963   -5.230  1.00 0.00 ? 80  TRP A CD2  1  
ATOM 1209  N NE1  . TRP A 1 80  ? -18.237 -0.047  -6.123  1.00 0.00 ? 80  TRP A NE1  1  
ATOM 1210  C CE2  . TRP A 1 80  ? -17.774 1.262   -6.065  1.00 0.00 ? 80  TRP A CE2  1  
ATOM 1211  C CE3  . TRP A 1 80  ? -18.419 3.329   -4.962  1.00 0.00 ? 80  TRP A CE3  1  
ATOM 1212  C CZ2  . TRP A 1 80  ? -16.670 1.843   -6.701  1.00 0.00 ? 80  TRP A CZ2  1  
ATOM 1213  C CZ3  . TRP A 1 80  ? -17.311 3.894   -5.605  1.00 0.00 ? 80  TRP A CZ3  1  
ATOM 1214  C CH2  . TRP A 1 80  ? -16.450 3.202   -6.449  1.00 0.00 ? 80  TRP A CH2  1  
ATOM 1215  H H    . TRP A 1 80  ? -21.946 3.289   -2.691  1.00 0.00 ? 80  TRP A H    1  
ATOM 1216  H HA   . TRP A 1 80  ? -21.515 2.641   -5.365  1.00 0.00 ? 80  TRP A HA   1  
ATOM 1217  H HB2  . TRP A 1 80  ? -20.396 1.973   -2.966  1.00 0.00 ? 80  TRP A HB2  1  
ATOM 1218  H HB3  . TRP A 1 80  ? -21.195 0.473   -3.397  1.00 0.00 ? 80  TRP A HB3  1  
ATOM 1219  H HD1  . TRP A 1 80  ? -19.942 -1.031  -5.168  1.00 0.00 ? 80  TRP A HD1  1  
ATOM 1220  H HE1  . TRP A 1 80  ? -17.796 -0.863  -6.695  1.00 0.00 ? 80  TRP A HE1  1  
ATOM 1221  H HE3  . TRP A 1 80  ? -19.072 3.904   -4.306  1.00 0.00 ? 80  TRP A HE3  1  
ATOM 1222  H HZ2  . TRP A 1 80  ? -16.016 1.267   -7.357  1.00 0.00 ? 80  TRP A HZ2  1  
ATOM 1223  H HZ3  . TRP A 1 80  ? -17.109 4.951   -5.431  1.00 0.00 ? 80  TRP A HZ3  1  
ATOM 1224  H HH2  . TRP A 1 80  ? -15.607 3.716   -6.912  1.00 0.00 ? 80  TRP A HH2  1  
ATOM 1225  N N    . ASP A 1 81  ? -23.901 0.992   -3.780  1.00 0.00 ? 81  ASP A N    1  
ATOM 1226  C CA   . ASP A 1 81  ? -25.085 0.171   -3.963  1.00 0.00 ? 81  ASP A CA   1  
ATOM 1227  C C    . ASP A 1 81  ? -26.119 0.949   -4.780  1.00 0.00 ? 81  ASP A C    1  
ATOM 1228  O O    . ASP A 1 81  ? -26.759 0.392   -5.670  1.00 0.00 ? 81  ASP A O    1  
ATOM 1229  C CB   . ASP A 1 81  ? -25.720 -0.189  -2.618  1.00 0.00 ? 81  ASP A CB   1  
ATOM 1230  C CG   . ASP A 1 81  ? -26.628 -1.420  -2.640  1.00 0.00 ? 81  ASP A CG   1  
ATOM 1231  O OD1  . ASP A 1 81  ? -27.042 -1.800  -3.756  1.00 0.00 ? 81  ASP A OD1  1  
ATOM 1232  O OD2  . ASP A 1 81  ? -26.886 -1.954  -1.539  1.00 0.00 ? 81  ASP A OD2  1  
ATOM 1233  H H    . ASP A 1 81  ? -23.724 1.275   -2.837  1.00 0.00 ? 81  ASP A H    1  
ATOM 1234  H HA   . ASP A 1 81  ? -24.736 -0.725  -4.477  1.00 0.00 ? 81  ASP A HA   1  
ATOM 1235  H HB2  . ASP A 1 81  ? -24.924 -0.355  -1.891  1.00 0.00 ? 81  ASP A HB2  1  
ATOM 1236  H HB3  . ASP A 1 81  ? -26.299 0.665   -2.267  1.00 0.00 ? 81  ASP A HB3  1  
ATOM 1237  N N    . ARG A 1 82  ? -26.249 2.225   -4.448  1.00 0.00 ? 82  ARG A N    1  
ATOM 1238  C CA   . ARG A 1 82  ? -27.194 3.085   -5.140  1.00 0.00 ? 82  ARG A CA   1  
ATOM 1239  C C    . ARG A 1 82  ? -26.878 3.125   -6.637  1.00 0.00 ? 82  ARG A C    1  
ATOM 1240  O O    . ARG A 1 82  ? -27.781 3.042   -7.467  1.00 0.00 ? 82  ARG A O    1  
ATOM 1241  C CB   . ARG A 1 82  ? -27.155 4.509   -4.580  1.00 0.00 ? 82  ARG A CB   1  
ATOM 1242  C CG   . ARG A 1 82  ? -28.554 4.976   -4.172  1.00 0.00 ? 82  ARG A CG   1  
ATOM 1243  C CD   . ARG A 1 82  ? -29.444 5.177   -5.399  1.00 0.00 ? 82  ARG A CD   1  
ATOM 1244  N NE   . ARG A 1 82  ? -29.590 6.622   -5.687  1.00 0.00 ? 82  ARG A NE   1  
ATOM 1245  C CZ   . ARG A 1 82  ? -30.385 7.449   -4.993  1.00 0.00 ? 82  ARG A CZ   1  
ATOM 1246  N NH1  . ARG A 1 82  ? -31.109 6.980   -3.968  1.00 0.00 ? 82  ARG A NH1  1  
ATOM 1247  N NH2  . ARG A 1 82  ? -30.455 8.745   -5.325  1.00 0.00 ? 82  ARG A NH2  1  
ATOM 1248  H H    . ARG A 1 82  ? -25.724 2.671   -3.723  1.00 0.00 ? 82  ARG A H    1  
ATOM 1249  H HA   . ARG A 1 82  ? -28.169 2.633   -4.956  1.00 0.00 ? 82  ARG A HA   1  
ATOM 1250  H HB2  . ARG A 1 82  ? -26.489 4.546   -3.717  1.00 0.00 ? 82  ARG A HB2  1  
ATOM 1251  H HB3  . ARG A 1 82  ? -26.745 5.187   -5.328  1.00 0.00 ? 82  ARG A HB3  1  
ATOM 1252  H HG2  . ARG A 1 82  ? -29.007 4.241   -3.506  1.00 0.00 ? 82  ARG A HG2  1  
ATOM 1253  H HG3  . ARG A 1 82  ? -28.481 5.909   -3.613  1.00 0.00 ? 82  ARG A HG3  1  
ATOM 1254  H HD2  . ARG A 1 82  ? -29.011 4.669   -6.261  1.00 0.00 ? 82  ARG A HD2  1  
ATOM 1255  H HD3  . ARG A 1 82  ? -30.424 4.732   -5.226  1.00 0.00 ? 82  ARG A HD3  1  
ATOM 1256  H HE   . ARG A 1 82  ? -29.064 7.005   -6.445  1.00 0.00 ? 82  ARG A HE   1  
ATOM 1257  H HH11 . ARG A 1 82  ? -31.057 6.012   -3.721  1.00 0.00 ? 82  ARG A HH11 1  
ATOM 1258  H HH12 . ARG A 1 82  ? -31.702 7.597   -3.451  1.00 0.00 ? 82  ARG A HH12 1  
ATOM 1259  H HH21 . ARG A 1 82  ? -29.914 9.096   -6.090  1.00 0.00 ? 82  ARG A HH21 1  
ATOM 1260  H HH22 . ARG A 1 82  ? -31.048 9.363   -4.808  1.00 0.00 ? 82  ARG A HH22 1  
ATOM 1261  N N    . LEU A 1 83  ? -25.594 3.252   -6.935  1.00 0.00 ? 83  LEU A N    1  
ATOM 1262  C CA   . LEU A 1 83  ? -25.148 3.304   -8.317  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1263  C C    . LEU A 1 83  ? -25.303 1.919   -8.950  1.00 0.00 ? 83  LEU A C    1  
ATOM 1264  O O    . LEU A 1 83  ? -26.260 1.671   -9.682  1.00 0.00 ? 83  LEU A O    1  
ATOM 1265  C CB   . LEU A 1 83  ? -23.726 3.862   -8.400  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1266  C CG   . LEU A 1 83  ? -23.574 5.357   -8.110  1.00 0.00 ? 83  LEU A CG   1  
ATOM 1267  C CD1  . LEU A 1 83  ? -22.307 5.632   -7.299  1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1268  C CD2  . LEU A 1 83  ? -23.616 6.174   -9.403  1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1269  H H    . LEU A 1 83  ? -24.865 3.319   -6.253  1.00 0.00 ? 83  LEU A H    1  
ATOM 1270  H HA   . LEU A 1 83  ? -25.799 4.000   -8.844  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1271  H HB2  . LEU A 1 83  ? -23.098 3.311   -7.700  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1272  H HB3  . LEU A 1 83  ? -23.338 3.665   -9.400  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1273  H HG   . LEU A 1 83  ? -24.421 5.674   -7.501  1.00 0.00 ? 83  LEU A HG   1  
ATOM 1274  H HD11 . LEU A 1 83  ? -21.506 4.978   -7.643  1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1275  H HD12 . LEU A 1 83  ? -22.009 6.672   -7.432  1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1276  H HD13 . LEU A 1 83  ? -22.502 5.442   -6.243  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1277  H HD21 . LEU A 1 83  ? -23.525 5.504   -10.259 1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1278  H HD22 . LEU A 1 83  ? -24.562 6.712   -9.462  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1279  H HD23 . LEU A 1 83  ? -22.791 6.886   -9.410  1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1280  N N    . HIS A 1 84  ? -24.347 1.054   -8.646  1.00 0.00 ? 84  HIS A N    1  
ATOM 1281  C CA   . HIS A 1 84  ? -24.365 -0.299  -9.176  1.00 0.00 ? 84  HIS A CA   1  
ATOM 1282  C C    . HIS A 1 84  ? -25.064 -1.230  -8.183  1.00 0.00 ? 84  HIS A C    1  
ATOM 1283  O O    . HIS A 1 84  ? -24.546 -1.488  -7.098  1.00 0.00 ? 84  HIS A O    1  
ATOM 1284  C CB   . HIS A 1 84  ? -22.951 -0.763  -9.529  1.00 0.00 ? 84  HIS A CB   1  
ATOM 1285  C CG   . HIS A 1 84  ? -21.939 0.355   -9.606  1.00 0.00 ? 84  HIS A CG   1  
ATOM 1286  N ND1  . HIS A 1 84  ? -21.415 0.811   -10.803 1.00 0.00 ? 84  HIS A ND1  1  
ATOM 1287  C CD2  . HIS A 1 84  ? -21.361 1.103   -8.623  1.00 0.00 ? 84  HIS A CD2  1  
ATOM 1288  C CE1  . HIS A 1 84  ? -20.560 1.789   -10.540 1.00 0.00 ? 84  HIS A CE1  1  
ATOM 1289  N NE2  . HIS A 1 84  ? -20.528 1.969   -9.188  1.00 0.00 ? 84  HIS A NE2  1  
ATOM 1290  H H    . HIS A 1 84  ? -23.572 1.264   -8.050  1.00 0.00 ? 84  HIS A H    1  
ATOM 1291  H HA   . HIS A 1 84  ? -24.944 -0.265  -10.099 1.00 0.00 ? 84  HIS A HA   1  
ATOM 1292  H HB2  . HIS A 1 84  ? -22.621 -1.487  -8.785  1.00 0.00 ? 84  HIS A HB2  1  
ATOM 1293  H HB3  . HIS A 1 84  ? -22.978 -1.281  -10.488 1.00 0.00 ? 84  HIS A HB3  1  
ATOM 1294  H HD1  . HIS A 1 84  ? -21.642 0.462   -11.712 1.00 0.00 ? 84  HIS A HD1  1  
ATOM 1295  H HD2  . HIS A 1 84  ? -21.551 1.007   -7.554  1.00 0.00 ? 84  HIS A HD2  1  
ATOM 1296  H HE1  . HIS A 1 84  ? -19.985 2.352   -11.275 1.00 0.00 ? 84  HIS A HE1  1  
ATOM 1297  H HE2  . HIS A 1 84  ? -20.013 2.678   -8.708  1.00 0.00 ? 84  HIS A HE2  1  
ATOM 1298  N N    . PRO A 1 85  ? -26.261 -1.721  -8.602  1.00 0.00 ? 85  PRO A N    1  
ATOM 1299  C CA   . PRO A 1 85  ? -27.037 -2.618  -7.762  1.00 0.00 ? 85  PRO A CA   1  
ATOM 1300  C C    . PRO A 1 85  ? -26.426 -4.021  -7.748  1.00 0.00 ? 85  PRO A C    1  
ATOM 1301  O O    . PRO A 1 85  ? -25.370 -4.248  -8.336  1.00 0.00 ? 85  PRO A O    1  
ATOM 1302  C CB   . PRO A 1 85  ? -28.440 -2.587  -8.344  1.00 0.00 ? 85  PRO A CB   1  
ATOM 1303  C CG   . PRO A 1 85  ? -28.294 -2.043  -9.756  1.00 0.00 ? 85  PRO A CG   1  
ATOM 1304  C CD   . PRO A 1 85  ? -26.906 -1.437  -9.881  1.00 0.00 ? 85  PRO A CD   1  
ATOM 1305  H HA   . PRO A 1 85  ? -27.022 -2.304  -6.813  1.00 0.00 ? 85  PRO A HA   1  
ATOM 1306  H HB2  . PRO A 1 85  ? -28.882 -3.583  -8.353  1.00 0.00 ? 85  PRO A HB2  1  
ATOM 1307  H HB3  . PRO A 1 85  ? -29.097 -1.953  -7.748  1.00 0.00 ? 85  PRO A HB3  1  
ATOM 1308  H HG2  . PRO A 1 85  ? -28.430 -2.840  -10.488 1.00 0.00 ? 85  PRO A HG2  1  
ATOM 1309  H HG3  . PRO A 1 85  ? -29.058 -1.292  -9.957  1.00 0.00 ? 85  PRO A HG3  1  
ATOM 1310  H HD2  . PRO A 1 85  ? -26.353 -1.880  -10.709 1.00 0.00 ? 85  PRO A HD2  1  
ATOM 1311  H HD3  . PRO A 1 85  ? -26.957 -0.365  -10.069 1.00 0.00 ? 85  PRO A HD3  1  
ATOM 1312  N N    . VAL A 1 86  ? -27.118 -4.926  -7.070  1.00 0.00 ? 86  VAL A N    1  
ATOM 1313  C CA   . VAL A 1 86  ? -26.657 -6.300  -6.972  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1314  C C    . VAL A 1 86  ? -27.690 -7.126  -6.203  1.00 0.00 ? 86  VAL A C    1  
ATOM 1315  O O    . VAL A 1 86  ? -28.141 -6.722  -5.132  1.00 0.00 ? 86  VAL A O    1  
ATOM 1316  C CB   . VAL A 1 86  ? -25.266 -6.342  -6.337  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1317  C CG1  . VAL A 1 86  ? -25.361 -6.469  -4.815  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 1318  C CG2  . VAL A 1 86  ? -24.425 -7.474  -6.930  1.00 0.00 ? 86  VAL A CG2  1  
ATOM 1319  H H    . VAL A 1 86  ? -27.976 -4.733  -6.595  1.00 0.00 ? 86  VAL A H    1  
ATOM 1320  H HA   . VAL A 1 86  ? -26.577 -6.694  -7.986  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1321  H HB   . VAL A 1 86  ? -24.766 -5.400  -6.563  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1322  H HG11 . VAL A 1 86  ? -25.967 -5.654  -4.420  1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1323  H HG12 . VAL A 1 86  ? -25.823 -7.423  -4.559  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1324  H HG13 . VAL A 1 86  ? -24.362 -6.422  -4.383  1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1325  H HG21 . VAL A 1 86  ? -24.552 -7.492  -8.013  1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1326  H HG22 . VAL A 1 86  ? -23.375 -7.311  -6.690  1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1327  H HG23 . VAL A 1 86  ? -24.751 -8.426  -6.511  1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1328  N N    . HIS A 1 87  ? -28.035 -8.268  -6.779  1.00 0.00 ? 87  HIS A N    1  
ATOM 1329  C CA   . HIS A 1 87  ? -29.007 -9.154  -6.162  1.00 0.00 ? 87  HIS A CA   1  
ATOM 1330  C C    . HIS A 1 87  ? -28.304 -10.418 -5.662  1.00 0.00 ? 87  HIS A C    1  
ATOM 1331  O O    . HIS A 1 87  ? -28.076 -11.351 -6.430  1.00 0.00 ? 87  HIS A O    1  
ATOM 1332  C CB   . HIS A 1 87  ? -30.156 -9.457  -7.125  1.00 0.00 ? 87  HIS A CB   1  
ATOM 1333  C CG   . HIS A 1 87  ? -30.981 -8.248  -7.495  1.00 0.00 ? 87  HIS A CG   1  
ATOM 1334  N ND1  . HIS A 1 87  ? -32.310 -8.107  -7.132  1.00 0.00 ? 87  HIS A ND1  1  
ATOM 1335  C CD2  . HIS A 1 87  ? -30.653 -7.126  -8.198  1.00 0.00 ? 87  HIS A CD2  1  
ATOM 1336  C CE1  . HIS A 1 87  ? -32.751 -6.950  -7.602  1.00 0.00 ? 87  HIS A CE1  1  
ATOM 1337  N NE2  . HIS A 1 87  ? -31.723 -6.343  -8.263  1.00 0.00 ? 87  HIS A NE2  1  
ATOM 1338  H H    . HIS A 1 87  ? -27.664 -8.590  -7.650  1.00 0.00 ? 87  HIS A H    1  
ATOM 1339  H HA   . HIS A 1 87  ? -29.421 -8.618  -5.308  1.00 0.00 ? 87  HIS A HA   1  
ATOM 1340  H HB2  . HIS A 1 87  ? -29.748 -9.898  -8.035  1.00 0.00 ? 87  HIS A HB2  1  
ATOM 1341  H HB3  . HIS A 1 87  ? -30.808 -10.205 -6.674  1.00 0.00 ? 87  HIS A HB3  1  
ATOM 1342  H HD1  . HIS A 1 87  ? -32.845 -8.767  -6.605  1.00 0.00 ? 87  HIS A HD1  1  
ATOM 1343  H HD2  . HIS A 1 87  ? -29.678 -6.910  -8.633  1.00 0.00 ? 87  HIS A HD2  1  
ATOM 1344  H HE1  . HIS A 1 87  ? -33.759 -6.552  -7.481  1.00 0.00 ? 87  HIS A HE1  1  
ATOM 1345  H HE2  . HIS A 1 87  ? -31.752 -5.431  -8.671  1.00 0.00 ? 87  HIS A HE2  1  
ATOM 1346  N N    . ALA A 1 88  ? -27.980 -10.408 -4.377  1.00 0.00 ? 88  ALA A N    1  
ATOM 1347  C CA   . ALA A 1 88  ? -27.308 -11.542 -3.766  1.00 0.00 ? 88  ALA A CA   1  
ATOM 1348  C C    . ALA A 1 88  ? -28.146 -12.803 -3.982  1.00 0.00 ? 88  ALA A C    1  
ATOM 1349  O O    . ALA A 1 88  ? -29.074 -13.073 -3.222  1.00 0.00 ? 88  ALA A O    1  
ATOM 1350  C CB   . ALA A 1 88  ? -27.062 -11.251 -2.284  1.00 0.00 ? 88  ALA A CB   1  
ATOM 1351  H H    . ALA A 1 88  ? -28.169 -9.645  -3.759  1.00 0.00 ? 88  ALA A H    1  
ATOM 1352  H HA   . ALA A 1 88  ? -26.346 -11.665 -4.263  1.00 0.00 ? 88  ALA A HA   1  
ATOM 1353  H HB1  . ALA A 1 88  ? -26.740 -10.217 -2.165  1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1354  H HB2  . ALA A 1 88  ? -27.984 -11.411 -1.725  1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1355  H HB3  . ALA A 1 88  ? -26.288 -11.919 -1.906  1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1356  N N    . GLY A 1 89  ? -27.788 -13.542 -5.021  1.00 0.00 ? 89  GLY A N    1  
ATOM 1357  C CA   . GLY A 1 89  ? -28.495 -14.769 -5.347  1.00 0.00 ? 89  GLY A CA   1  
ATOM 1358  C C    . GLY A 1 89  ? -27.522 -15.940 -5.495  1.00 0.00 ? 89  GLY A C    1  
ATOM 1359  O O    . GLY A 1 89  ? -26.580 -16.071 -4.715  1.00 0.00 ? 89  GLY A O    1  
ATOM 1360  H H    . GLY A 1 89  ? -27.031 -13.315 -5.635  1.00 0.00 ? 89  GLY A H    1  
ATOM 1361  H HA2  . GLY A 1 89  ? -29.222 -14.992 -4.566  1.00 0.00 ? 89  GLY A HA2  1  
ATOM 1362  H HA3  . GLY A 1 89  ? -29.053 -14.636 -6.274  1.00 0.00 ? 89  GLY A HA3  1  
ATOM 1363  N N    . PRO A 1 90  ? -27.791 -16.784 -6.527  1.00 0.00 ? 90  PRO A N    1  
ATOM 1364  C CA   . PRO A 1 90  ? -26.950 -17.941 -6.786  1.00 0.00 ? 90  PRO A CA   1  
ATOM 1365  C C    . PRO A 1 90  ? -25.626 -17.522 -7.428  1.00 0.00 ? 90  PRO A C    1  
ATOM 1366  O O    . PRO A 1 90  ? -25.527 -16.442 -8.007  1.00 0.00 ? 90  PRO A O    1  
ATOM 1367  C CB   . PRO A 1 90  ? -27.786 -18.841 -7.681  1.00 0.00 ? 90  PRO A CB   1  
ATOM 1368  C CG   . PRO A 1 90  ? -28.873 -17.955 -8.267  1.00 0.00 ? 90  PRO A CG   1  
ATOM 1369  C CD   . PRO A 1 90  ? -28.899 -16.661 -7.470  1.00 0.00 ? 90  PRO A CD   1  
ATOM 1370  H HA   . PRO A 1 90  ? -26.707 -18.393 -5.928  1.00 0.00 ? 90  PRO A HA   1  
ATOM 1371  H HB2  . PRO A 1 90  ? -27.176 -19.283 -8.469  1.00 0.00 ? 90  PRO A HB2  1  
ATOM 1372  H HB3  . PRO A 1 90  ? -28.218 -19.665 -7.113  1.00 0.00 ? 90  PRO A HB3  1  
ATOM 1373  H HG2  . PRO A 1 90  ? -28.674 -17.751 -9.319  1.00 0.00 ? 90  PRO A HG2  1  
ATOM 1374  H HG3  . PRO A 1 90  ? -29.841 -18.454 -8.216  1.00 0.00 ? 90  PRO A HG3  1  
ATOM 1375  H HD2  . PRO A 1 90  ? -28.772 -15.794 -8.118  1.00 0.00 ? 90  PRO A HD2  1  
ATOM 1376  H HD3  . PRO A 1 90  ? -29.849 -16.534 -6.951  1.00 0.00 ? 90  PRO A HD3  1  
ATOM 1377  N N    . ILE A 1 91  ? -24.642 -18.400 -7.304  1.00 0.00 ? 91  ILE A N    1  
ATOM 1378  C CA   . ILE A 1 91  ? -23.328 -18.136 -7.865  1.00 0.00 ? 91  ILE A CA   1  
ATOM 1379  C C    . ILE A 1 91  ? -22.545 -19.447 -7.959  1.00 0.00 ? 91  ILE A C    1  
ATOM 1380  O O    . ILE A 1 91  ? -22.437 -20.181 -6.978  1.00 0.00 ? 91  ILE A O    1  
ATOM 1381  C CB   . ILE A 1 91  ? -22.611 -17.048 -7.062  1.00 0.00 ? 91  ILE A CB   1  
ATOM 1382  C CG1  . ILE A 1 91  ? -21.534 -16.363 -7.906  1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1383  C CG2  . ILE A 1 91  ? -22.045 -17.613 -5.758  1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1384  C CD1  . ILE A 1 91  ? -21.476 -14.864 -7.608  1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1385  H H    . ILE A 1 91  ? -24.731 -19.277 -6.831  1.00 0.00 ? 91  ILE A H    1  
ATOM 1386  H HA   . ILE A 1 91  ? -23.475 -17.748 -8.873  1.00 0.00 ? 91  ILE A HA   1  
ATOM 1387  H HB   . ILE A 1 91  ? -23.342 -16.286 -6.792  1.00 0.00 ? 91  ILE A HB   1  
ATOM 1388  H HG12 . ILE A 1 91  ? -20.564 -16.816 -7.701  1.00 0.00 ? 91  ILE A HG12 1  
ATOM 1389  H HG13 . ILE A 1 91  ? -21.742 -16.520 -8.964  1.00 0.00 ? 91  ILE A HG13 1  
ATOM 1390  H HG21 . ILE A 1 91  ? -22.849 -18.069 -5.180  1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1391  H HG22 . ILE A 1 91  ? -21.290 -18.365 -5.985  1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1392  H HG23 . ILE A 1 91  ? -21.593 -16.807 -5.179  1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1393  H HD11 . ILE A 1 91  ? -22.270 -14.601 -6.909  1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1394  H HD12 . ILE A 1 91  ? -20.509 -14.617 -7.169  1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1395  H HD13 . ILE A 1 91  ? -21.608 -14.304 -8.534  1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1396  N N    . ALA A 1 92  ? -22.018 -19.701 -9.148  1.00 0.00 ? 92  ALA A N    1  
ATOM 1397  C CA   . ALA A 1 92  ? -21.249 -20.910 -9.383  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1398  C C    . ALA A 1 92  ? -20.363 -21.190 -8.168  1.00 0.00 ? 92  ALA A C    1  
ATOM 1399  O O    . ALA A 1 92  ? -20.005 -20.272 -7.431  1.00 0.00 ? 92  ALA A O    1  
ATOM 1400  C CB   . ALA A 1 92  ? -20.439 -20.758 -10.672 1.00 0.00 ? 92  ALA A CB   1  
ATOM 1401  H H    . ALA A 1 92  ? -22.111 -19.098 -9.941  1.00 0.00 ? 92  ALA A H    1  
ATOM 1402  H HA   . ALA A 1 92  ? -21.953 -21.733 -9.507  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1403  H HB1  . ALA A 1 92  ? -20.879 -19.973 -11.288 1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1404  H HB2  . ALA A 1 92  ? -19.411 -20.492 -10.426 1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1405  H HB3  . ALA A 1 92  ? -20.449 -21.699 -11.221 1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1406  N N    . PRO A 1 93  ? -20.025 -22.496 -7.991  1.00 0.00 ? 93  PRO A N    1  
ATOM 1407  C CA   . PRO A 1 93  ? -19.188 -22.908 -6.877  1.00 0.00 ? 93  PRO A CA   1  
ATOM 1408  C C    . PRO A 1 93  ? -17.726 -22.527 -7.120  1.00 0.00 ? 93  PRO A C    1  
ATOM 1409  O O    . PRO A 1 93  ? -16.946 -23.334 -7.622  1.00 0.00 ? 93  PRO A O    1  
ATOM 1410  C CB   . PRO A 1 93  ? -19.399 -24.409 -6.761  1.00 0.00 ? 93  PRO A CB   1  
ATOM 1411  C CG   . PRO A 1 93  ? -19.979 -24.853 -8.094  1.00 0.00 ? 93  PRO A CG   1  
ATOM 1412  C CD   . PRO A 1 93  ? -20.430 -23.610 -8.843  1.00 0.00 ? 93  PRO A CD   1  
ATOM 1413  H HA   . PRO A 1 93  ? -19.460 -22.429 -6.042  1.00 0.00 ? 93  PRO A HA   1  
ATOM 1414  H HB2  . PRO A 1 93  ? -18.459 -24.920 -6.553  1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1415  H HB3  . PRO A 1 93  ? -20.078 -24.645 -5.941  1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1416  H HG2  . PRO A 1 93  ? -19.232 -25.397 -8.672  1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1417  H HG3  . PRO A 1 93  ? -20.818 -25.531 -7.938  1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1418  H HD2  . PRO A 1 93  ? -19.962 -23.547 -9.825  1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1419  H HD3  . PRO A 1 93  ? -21.508 -23.614 -9.004  1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1420  N N    . GLY A 1 94  ? -17.399 -21.297 -6.751  1.00 0.00 ? 94  GLY A N    1  
ATOM 1421  C CA   . GLY A 1 94  ? -16.045 -20.799 -6.923  1.00 0.00 ? 94  GLY A CA   1  
ATOM 1422  C C    . GLY A 1 94  ? -16.045 -19.446 -7.636  1.00 0.00 ? 94  GLY A C    1  
ATOM 1423  O O    . GLY A 1 94  ? -14.989 -18.849 -7.843  1.00 0.00 ? 94  GLY A O    1  
ATOM 1424  H H    . GLY A 1 94  ? -18.040 -20.647 -6.343  1.00 0.00 ? 94  GLY A H    1  
ATOM 1425  H HA2  . GLY A 1 94  ? -15.564 -20.702 -5.950  1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1426  H HA3  . GLY A 1 94  ? -15.460 -21.517 -7.497  1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1427  N N    . GLN A 1 95  ? -17.240 -19.000 -7.992  1.00 0.00 ? 95  GLN A N    1  
ATOM 1428  C CA   . GLN A 1 95  ? -17.391 -17.728 -8.678  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1429  C C    . GLN A 1 95  ? -17.376 -16.577 -7.670  1.00 0.00 ? 95  GLN A C    1  
ATOM 1430  O O    . GLN A 1 95  ? -18.068 -16.627 -6.655  1.00 0.00 ? 95  GLN A O    1  
ATOM 1431  C CB   . GLN A 1 95  ? -18.671 -17.705 -9.517  1.00 0.00 ? 95  GLN A CB   1  
ATOM 1432  C CG   . GLN A 1 95  ? -18.415 -18.257 -10.921 1.00 0.00 ? 95  GLN A CG   1  
ATOM 1433  C CD   . GLN A 1 95  ? -17.935 -17.153 -11.865 1.00 0.00 ? 95  GLN A CD   1  
ATOM 1434  O OE1  . GLN A 1 95  ? -17.123 -16.312 -11.516 1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1435  N NE2  . GLN A 1 95  ? -18.480 -17.203 -13.077 1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1436  H H    . GLN A 1 95  ? -18.094 -19.491 -7.820  1.00 0.00 ? 95  GLN A H    1  
ATOM 1437  H HA   . GLN A 1 95  ? -16.529 -17.652 -9.340  1.00 0.00 ? 95  GLN A HA   1  
ATOM 1438  H HB2  . GLN A 1 95  ? -19.443 -18.296 -9.024  1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1439  H HB3  . GLN A 1 95  ? -19.046 -16.684 -9.586  1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1440  H HG2  . GLN A 1 95  ? -17.669 -19.050 -10.874 1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1441  H HG3  . GLN A 1 95  ? -19.330 -18.702 -11.312 1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1442  H HE21 . GLN A 1 95  ? -19.141 -17.920 -13.299 1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1443  H HE22 . GLN A 1 95  ? -18.229 -16.523 -13.766 1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1444  N N    . MET A 1 96  ? -16.579 -15.566 -7.986  1.00 0.00 ? 96  MET A N    1  
ATOM 1445  C CA   . MET A 1 96  ? -16.464 -14.405 -7.121  1.00 0.00 ? 96  MET A CA   1  
ATOM 1446  C C    . MET A 1 96  ? -17.735 -13.554 -7.174  1.00 0.00 ? 96  MET A C    1  
ATOM 1447  O O    . MET A 1 96  ? -18.475 -13.598 -8.155  1.00 0.00 ? 96  MET A O    1  
ATOM 1448  C CB   . MET A 1 96  ? -15.265 -13.560 -7.557  1.00 0.00 ? 96  MET A CB   1  
ATOM 1449  C CG   . MET A 1 96  ? -14.742 -12.712 -6.396  1.00 0.00 ? 96  MET A CG   1  
ATOM 1450  S SD   . MET A 1 96  ? -12.957 -12.704 -6.403  1.00 0.00 ? 96  MET A SD   1  
ATOM 1451  C CE   . MET A 1 96  ? -12.654 -10.967 -6.121  1.00 0.00 ? 96  MET A CE   1  
ATOM 1452  H H    . MET A 1 96  ? -16.019 -15.534 -8.814  1.00 0.00 ? 96  MET A H    1  
ATOM 1453  H HA   . MET A 1 96  ? -16.326 -14.801 -6.115  1.00 0.00 ? 96  MET A HA   1  
ATOM 1454  H HB2  . MET A 1 96  ? -14.472 -14.210 -7.924  1.00 0.00 ? 96  MET A HB2  1  
ATOM 1455  H HB3  . MET A 1 96  ? -15.554 -12.912 -8.384  1.00 0.00 ? 96  MET A HB3  1  
ATOM 1456  H HG2  . MET A 1 96  ? -15.118 -11.692 -6.480  1.00 0.00 ? 96  MET A HG2  1  
ATOM 1457  H HG3  . MET A 1 96  ? -15.108 -13.110 -5.450  1.00 0.00 ? 96  MET A HG3  1  
ATOM 1458  H HE1  . MET A 1 96  ? -13.323 -10.603 -5.342  1.00 0.00 ? 96  MET A HE1  1  
ATOM 1459  H HE2  . MET A 1 96  ? -11.620 -10.825 -5.807  1.00 0.00 ? 96  MET A HE2  1  
ATOM 1460  H HE3  . MET A 1 96  ? -12.833 -10.413 -7.043  1.00 0.00 ? 96  MET A HE3  1  
ATOM 1461  N N    . ARG A 1 97  ? -17.948 -12.799 -6.107  1.00 0.00 ? 97  ARG A N    1  
ATOM 1462  C CA   . ARG A 1 97  ? -19.117 -11.940 -6.019  1.00 0.00 ? 97  ARG A CA   1  
ATOM 1463  C C    . ARG A 1 97  ? -18.704 -10.521 -5.620  1.00 0.00 ? 97  ARG A C    1  
ATOM 1464  O O    . ARG A 1 97  ? -17.568 -10.295 -5.204  1.00 0.00 ? 97  ARG A O    1  
ATOM 1465  C CB   . ARG A 1 97  ? -20.121 -12.477 -4.998  1.00 0.00 ? 97  ARG A CB   1  
ATOM 1466  C CG   . ARG A 1 97  ? -21.550 -12.389 -5.536  1.00 0.00 ? 97  ARG A CG   1  
ATOM 1467  C CD   . ARG A 1 97  ? -22.466 -13.388 -4.825  1.00 0.00 ? 97  ARG A CD   1  
ATOM 1468  N NE   . ARG A 1 97  ? -22.588 -13.033 -3.394  1.00 0.00 ? 97  ARG A NE   1  
ATOM 1469  C CZ   . ARG A 1 97  ? -23.365 -12.046 -2.928  1.00 0.00 ? 97  ARG A CZ   1  
ATOM 1470  N NH1  . ARG A 1 97  ? -24.094 -11.309 -3.778  1.00 0.00 ? 97  ARG A NH1  1  
ATOM 1471  N NH2  . ARG A 1 97  ? -23.414 -11.795 -1.613  1.00 0.00 ? 97  ARG A NH2  1  
ATOM 1472  H H    . ARG A 1 97  ? -17.341 -12.769 -5.313  1.00 0.00 ? 97  ARG A H    1  
ATOM 1473  H HA   . ARG A 1 97  ? -19.550 -11.955 -7.019  1.00 0.00 ? 97  ARG A HA   1  
ATOM 1474  H HB2  . ARG A 1 97  ? -19.882 -13.513 -4.758  1.00 0.00 ? 97  ARG A HB2  1  
ATOM 1475  H HB3  . ARG A 1 97  ? -20.042 -11.909 -4.071  1.00 0.00 ? 97  ARG A HB3  1  
ATOM 1476  H HG2  . ARG A 1 97  ? -21.933 -11.378 -5.398  1.00 0.00 ? 97  ARG A HG2  1  
ATOM 1477  H HG3  . ARG A 1 97  ? -21.552 -12.587 -6.608  1.00 0.00 ? 97  ARG A HG3  1  
ATOM 1478  H HD2  . ARG A 1 97  ? -23.450 -13.389 -5.294  1.00 0.00 ? 97  ARG A HD2  1  
ATOM 1479  H HD3  . ARG A 1 97  ? -22.065 -14.397 -4.925  1.00 0.00 ? 97  ARG A HD3  1  
ATOM 1480  H HE   . ARG A 1 97  ? -22.058 -13.563 -2.732  1.00 0.00 ? 97  ARG A HE   1  
ATOM 1481  H HH11 . ARG A 1 97  ? -24.057 -11.496 -4.760  1.00 0.00 ? 97  ARG A HH11 1  
ATOM 1482  H HH12 . ARG A 1 97  ? -24.674 -10.572 -3.431  1.00 0.00 ? 97  ARG A HH12 1  
ATOM 1483  H HH21 . ARG A 1 97  ? -22.870 -12.345 -0.978  1.00 0.00 ? 97  ARG A HH21 1  
ATOM 1484  H HH22 . ARG A 1 97  ? -23.994 -11.058 -1.265  1.00 0.00 ? 97  ARG A HH22 1  
ATOM 1485  N N    . GLU A 1 98  ? -19.648 -9.603  -5.761  1.00 0.00 ? 98  GLU A N    1  
ATOM 1486  C CA   . GLU A 1 98  ? -19.396 -8.213  -5.421  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1487  C C    . GLU A 1 98  ? -20.439 -7.715  -4.418  1.00 0.00 ? 98  GLU A C    1  
ATOM 1488  O O    . GLU A 1 98  ? -21.512 -7.258  -4.808  1.00 0.00 ? 98  GLU A O    1  
ATOM 1489  C CB   . GLU A 1 98  ? -19.378 -7.336  -6.675  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1490  C CG   . GLU A 1 98  ? -17.944 -6.996  -7.086  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1491  C CD   . GLU A 1 98  ? -17.924 -5.888  -8.140  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1492  O OE1  . GLU A 1 98  ? -18.232 -6.209  -9.308  1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1493  O OE2  . GLU A 1 98  ? -17.602 -4.743  -7.755  1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1494  H H    . GLU A 1 98  ? -20.569 -9.795  -6.100  1.00 0.00 ? 98  GLU A H    1  
ATOM 1495  H HA   . GLU A 1 98  ? -18.407 -8.201  -4.963  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1496  H HB2  . GLU A 1 98  ? -19.882 -7.852  -7.491  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1497  H HB3  . GLU A 1 98  ? -19.934 -6.417  -6.488  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1498  H HG2  . GLU A 1 98  ? -17.376 -6.681  -6.211  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1499  H HG3  . GLU A 1 98  ? -17.455 -7.887  -7.481  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1500  N N    . PRO A 1 99  ? -20.077 -7.822  -3.112  1.00 0.00 ? 99  PRO A N    1  
ATOM 1501  C CA   . PRO A 1 99  ? -20.969 -7.388  -2.050  1.00 0.00 ? 99  PRO A CA   1  
ATOM 1502  C C    . PRO A 1 99  ? -21.002 -5.861  -1.951  1.00 0.00 ? 99  PRO A C    1  
ATOM 1503  O O    . PRO A 1 99  ? -20.807 -5.301  -0.874  1.00 0.00 ? 99  PRO A O    1  
ATOM 1504  C CB   . PRO A 1 99  ? -20.435 -8.053  -0.791  1.00 0.00 ? 99  PRO A CB   1  
ATOM 1505  C CG   . PRO A 1 99  ? -19.004 -8.455  -1.108  1.00 0.00 ? 99  PRO A CG   1  
ATOM 1506  C CD   . PRO A 1 99  ? -18.813 -8.357  -2.612  1.00 0.00 ? 99  PRO A CD   1  
ATOM 1507  H HA   . PRO A 1 99  ? -21.907 -7.669  -2.248  1.00 0.00 ? 99  PRO A HA   1  
ATOM 1508  H HB2  . PRO A 1 99  ? -20.470 -7.369  0.057   1.00 0.00 ? 99  PRO A HB2  1  
ATOM 1509  H HB3  . PRO A 1 99  ? -21.036 -8.922  -0.525  1.00 0.00 ? 99  PRO A HB3  1  
ATOM 1510  H HG2  . PRO A 1 99  ? -18.300 -7.802  -0.590  1.00 0.00 ? 99  PRO A HG2  1  
ATOM 1511  H HG3  . PRO A 1 99  ? -18.808 -9.471  -0.764  1.00 0.00 ? 99  PRO A HG3  1  
ATOM 1512  H HD2  . PRO A 1 99  ? -17.979 -7.702  -2.864  1.00 0.00 ? 99  PRO A HD2  1  
ATOM 1513  H HD3  . PRO A 1 99  ? -18.597 -9.332  -3.049  1.00 0.00 ? 99  PRO A HD3  1  
ATOM 1514  N N    . ARG A 1 100 ? -21.250 -5.232  -3.091  1.00 0.00 ? 100 ARG A N    1  
ATOM 1515  C CA   . ARG A 1 100 ? -21.311 -3.781  -3.146  1.00 0.00 ? 100 ARG A CA   1  
ATOM 1516  C C    . ARG A 1 100 ? -20.133 -3.171  -2.384  1.00 0.00 ? 100 ARG A C    1  
ATOM 1517  O O    . ARG A 1 100 ? -19.238 -3.888  -1.940  1.00 0.00 ? 100 ARG A O    1  
ATOM 1518  C CB   . ARG A 1 100 ? -22.620 -3.262  -2.549  1.00 0.00 ? 100 ARG A CB   1  
ATOM 1519  C CG   . ARG A 1 100 ? -23.812 -3.632  -3.435  1.00 0.00 ? 100 ARG A CG   1  
ATOM 1520  C CD   . ARG A 1 100 ? -23.576 -3.194  -4.882  1.00 0.00 ? 100 ARG A CD   1  
ATOM 1521  N NE   . ARG A 1 100 ? -22.968 -4.300  -5.654  1.00 0.00 ? 100 ARG A NE   1  
ATOM 1522  C CZ   . ARG A 1 100 ? -22.173 -4.126  -6.718  1.00 0.00 ? 100 ARG A CZ   1  
ATOM 1523  N NH1  . ARG A 1 100 ? -21.884 -2.889  -7.143  1.00 0.00 ? 100 ARG A NH1  1  
ATOM 1524  N NH2  . ARG A 1 100 ? -21.666 -5.189  -7.357  1.00 0.00 ? 100 ARG A NH2  1  
ATOM 1525  H H    . ARG A 1 100 ? -21.407 -5.695  -3.963  1.00 0.00 ? 100 ARG A H    1  
ATOM 1526  H HA   . ARG A 1 100 ? -21.258 -3.540  -4.208  1.00 0.00 ? 100 ARG A HA   1  
ATOM 1527  H HB2  . ARG A 1 100 ? -22.760 -3.679  -1.552  1.00 0.00 ? 100 ARG A HB2  1  
ATOM 1528  H HB3  . ARG A 1 100 ? -22.569 -2.179  -2.437  1.00 0.00 ? 100 ARG A HB3  1  
ATOM 1529  H HG2  . ARG A 1 100 ? -23.975 -4.709  -3.400  1.00 0.00 ? 100 ARG A HG2  1  
ATOM 1530  H HG3  . ARG A 1 100 ? -24.716 -3.160  -3.051  1.00 0.00 ? 100 ARG A HG3  1  
ATOM 1531  H HD2  . ARG A 1 100 ? -24.520 -2.896  -5.339  1.00 0.00 ? 100 ARG A HD2  1  
ATOM 1532  H HD3  . ARG A 1 100 ? -22.923 -2.322  -4.905  1.00 0.00 ? 100 ARG A HD3  1  
ATOM 1533  H HE   . ARG A 1 100 ? -23.164 -5.237  -5.363  1.00 0.00 ? 100 ARG A HE   1  
ATOM 1534  H HH11 . ARG A 1 100 ? -22.262 -2.095  -6.666  1.00 0.00 ? 100 ARG A HH11 1  
ATOM 1535  H HH12 . ARG A 1 100 ? -21.290 -2.759  -7.937  1.00 0.00 ? 100 ARG A HH12 1  
ATOM 1536  H HH21 . ARG A 1 100 ? -21.881 -6.113  -7.039  1.00 0.00 ? 100 ARG A HH21 1  
ATOM 1537  H HH22 . ARG A 1 100 ? -21.072 -5.059  -8.151  1.00 0.00 ? 100 ARG A HH22 1  
ATOM 1538  N N    . GLY A 1 101 ? -20.173 -1.853  -2.255  1.00 0.00 ? 101 GLY A N    1  
ATOM 1539  C CA   . GLY A 1 101 ? -19.120 -1.138  -1.553  1.00 0.00 ? 101 GLY A CA   1  
ATOM 1540  C C    . GLY A 1 101 ? -18.730 -1.862  -0.264  1.00 0.00 ? 101 GLY A C    1  
ATOM 1541  O O    . GLY A 1 101 ? -17.552 -1.928  0.084   1.00 0.00 ? 101 GLY A O    1  
ATOM 1542  H H    . GLY A 1 101 ? -20.905 -1.277  -2.618  1.00 0.00 ? 101 GLY A H    1  
ATOM 1543  H HA2  . GLY A 1 101 ? -18.247 -1.043  -2.200  1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1544  H HA3  . GLY A 1 101 ? -19.455 -0.127  -1.320  1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1545  N N    . SER A 1 102 ? -19.742 -2.388  0.411   1.00 0.00 ? 102 SER A N    1  
ATOM 1546  C CA   . SER A 1 102 ? -19.519 -3.106  1.655   1.00 0.00 ? 102 SER A CA   1  
ATOM 1547  C C    . SER A 1 102 ? -18.269 -3.980  1.538   1.00 0.00 ? 102 SER A C    1  
ATOM 1548  O O    . SER A 1 102 ? -17.580 -4.219  2.529   1.00 0.00 ? 102 SER A O    1  
ATOM 1549  C CB   . SER A 1 102 ? -20.733 -3.962  2.021   1.00 0.00 ? 102 SER A CB   1  
ATOM 1550  O OG   . SER A 1 102 ? -21.959 -3.337  1.651   1.00 0.00 ? 102 SER A OG   1  
ATOM 1551  H H    . SER A 1 102 ? -20.697 -2.330  0.122   1.00 0.00 ? 102 SER A H    1  
ATOM 1552  H HA   . SER A 1 102 ? -19.377 -2.334  2.412   1.00 0.00 ? 102 SER A HA   1  
ATOM 1553  H HB2  . SER A 1 102 ? -20.656 -4.930  1.527   1.00 0.00 ? 102 SER A HB2  1  
ATOM 1554  H HB3  . SER A 1 102 ? -20.733 -4.151  3.095   1.00 0.00 ? 102 SER A HB3  1  
ATOM 1555  H HG   . SER A 1 102 ? -22.308 -2.791  2.412   1.00 0.00 ? 102 SER A HG   1  
ATOM 1556  N N    . ASP A 1 103 ? -18.015 -4.434  0.320   1.00 0.00 ? 103 ASP A N    1  
ATOM 1557  C CA   . ASP A 1 103 ? -16.860 -5.277  0.061   1.00 0.00 ? 103 ASP A CA   1  
ATOM 1558  C C    . ASP A 1 103 ? -15.585 -4.439  0.182   1.00 0.00 ? 103 ASP A C    1  
ATOM 1559  O O    . ASP A 1 103 ? -14.655 -4.816  0.893   1.00 0.00 ? 103 ASP A O    1  
ATOM 1560  C CB   . ASP A 1 103 ? -16.910 -5.861  -1.352  1.00 0.00 ? 103 ASP A CB   1  
ATOM 1561  C CG   . ASP A 1 103 ? -16.047 -7.106  -1.568  1.00 0.00 ? 103 ASP A CG   1  
ATOM 1562  O OD1  . ASP A 1 103 ? -16.086 -7.985  -0.681  1.00 0.00 ? 103 ASP A OD1  1  
ATOM 1563  O OD2  . ASP A 1 103 ? -15.367 -7.150  -2.616  1.00 0.00 ? 103 ASP A OD2  1  
ATOM 1564  H H    . ASP A 1 103 ? -18.581 -4.235  -0.480  1.00 0.00 ? 103 ASP A H    1  
ATOM 1565  H HA   . ASP A 1 103 ? -16.910 -6.069  0.808   1.00 0.00 ? 103 ASP A HA   1  
ATOM 1566  H HB2  . ASP A 1 103 ? -17.944 -6.109  -1.591  1.00 0.00 ? 103 ASP A HB2  1  
ATOM 1567  H HB3  . ASP A 1 103 ? -16.595 -5.092  -2.058  1.00 0.00 ? 103 ASP A HB3  1  
ATOM 1568  N N    . ILE A 1 104 ? -15.583 -3.318  -0.525  1.00 0.00 ? 104 ILE A N    1  
ATOM 1569  C CA   . ILE A 1 104 ? -14.438 -2.423  -0.506  1.00 0.00 ? 104 ILE A CA   1  
ATOM 1570  C C    . ILE A 1 104 ? -14.296 -1.813  0.890   1.00 0.00 ? 104 ILE A C    1  
ATOM 1571  O O    . ILE A 1 104 ? -13.270 -1.215  1.208   1.00 0.00 ? 104 ILE A O    1  
ATOM 1572  C CB   . ILE A 1 104 ? -14.552 -1.384  -1.623  1.00 0.00 ? 104 ILE A CB   1  
ATOM 1573  C CG1  . ILE A 1 104 ? -14.904 -2.048  -2.956  1.00 0.00 ? 104 ILE A CG1  1  
ATOM 1574  C CG2  . ILE A 1 104 ? -13.278 -0.543  -1.720  1.00 0.00 ? 104 ILE A CG2  1  
ATOM 1575  C CD1  . ILE A 1 104 ? -15.863 -1.174  -3.767  1.00 0.00 ? 104 ILE A CD1  1  
ATOM 1576  H H    . ILE A 1 104 ? -16.344 -3.018  -1.101  1.00 0.00 ? 104 ILE A H    1  
ATOM 1577  H HA   . ILE A 1 104 ? -13.552 -3.023  -0.712  1.00 0.00 ? 104 ILE A HA   1  
ATOM 1578  H HB   . ILE A 1 104 ? -15.368 -0.705  -1.375  1.00 0.00 ? 104 ILE A HB   1  
ATOM 1579  H HG12 . ILE A 1 104 ? -13.994 -2.225  -3.529  1.00 0.00 ? 104 ILE A HG12 1  
ATOM 1580  H HG13 . ILE A 1 104 ? -15.360 -3.020  -2.772  1.00 0.00 ? 104 ILE A HG13 1  
ATOM 1581  H HG21 . ILE A 1 104 ? -12.466 -1.050  -1.199  1.00 0.00 ? 104 ILE A HG21 1  
ATOM 1582  H HG22 . ILE A 1 104 ? -13.009 -0.410  -2.768  1.00 0.00 ? 104 ILE A HG22 1  
ATOM 1583  H HG23 . ILE A 1 104 ? -13.450 0.432   -1.263  1.00 0.00 ? 104 ILE A HG23 1  
ATOM 1584  H HD11 . ILE A 1 104 ? -16.060 -0.250  -3.223  1.00 0.00 ? 104 ILE A HD11 1  
ATOM 1585  H HD12 . ILE A 1 104 ? -15.412 -0.939  -4.731  1.00 0.00 ? 104 ILE A HD12 1  
ATOM 1586  H HD13 . ILE A 1 104 ? -16.799 -1.710  -3.924  1.00 0.00 ? 104 ILE A HD13 1  
ATOM 1587  N N    . ALA A 1 105 ? -15.342 -1.986  1.686   1.00 0.00 ? 105 ALA A N    1  
ATOM 1588  C CA   . ALA A 1 105 ? -15.347 -1.459  3.040   1.00 0.00 ? 105 ALA A CA   1  
ATOM 1589  C C    . ALA A 1 105 ? -14.452 -2.330  3.924   1.00 0.00 ? 105 ALA A C    1  
ATOM 1590  O O    . ALA A 1 105 ? -13.955 -1.873  4.952   1.00 0.00 ? 105 ALA A O    1  
ATOM 1591  C CB   . ALA A 1 105 ? -16.785 -1.390  3.556   1.00 0.00 ? 105 ALA A CB   1  
ATOM 1592  H H    . ALA A 1 105 ? -16.173 -2.474  1.419   1.00 0.00 ? 105 ALA A H    1  
ATOM 1593  H HA   . ALA A 1 105 ? -14.937 -0.450  3.005   1.00 0.00 ? 105 ALA A HA   1  
ATOM 1594  H HB1  . ALA A 1 105 ? -17.404 -0.854  2.836   1.00 0.00 ? 105 ALA A HB1  1  
ATOM 1595  H HB2  . ALA A 1 105 ? -17.173 -2.400  3.687   1.00 0.00 ? 105 ALA A HB2  1  
ATOM 1596  H HB3  . ALA A 1 105 ? -16.804 -0.866  4.512   1.00 0.00 ? 105 ALA A HB3  1  
ATOM 1597  N N    . GLY A 1 106 ? -14.273 -3.570  3.491   1.00 0.00 ? 106 GLY A N    1  
ATOM 1598  C CA   . GLY A 1 106 ? -13.447 -4.509  4.231   1.00 0.00 ? 106 GLY A CA   1  
ATOM 1599  C C    . GLY A 1 106 ? -14.280 -5.291  5.248   1.00 0.00 ? 106 GLY A C    1  
ATOM 1600  O O    . GLY A 1 106 ? -13.734 -5.911  6.159   1.00 0.00 ? 106 GLY A O    1  
ATOM 1601  H H    . GLY A 1 106 ? -14.681 -3.934  2.654   1.00 0.00 ? 106 GLY A H    1  
ATOM 1602  H HA2  . GLY A 1 106 ? -12.968 -5.201  3.538   1.00 0.00 ? 106 GLY A HA2  1  
ATOM 1603  H HA3  . GLY A 1 106 ? -12.650 -3.971  4.745   1.00 0.00 ? 106 GLY A HA3  1  
ATOM 1604  N N    . THR A 1 107 ? -15.591 -5.236  5.058   1.00 0.00 ? 107 THR A N    1  
ATOM 1605  C CA   . THR A 1 107 ? -16.505 -5.931  5.947   1.00 0.00 ? 107 THR A CA   1  
ATOM 1606  C C    . THR A 1 107 ? -16.568 -7.418  5.592   1.00 0.00 ? 107 THR A C    1  
ATOM 1607  O O    . THR A 1 107 ? -16.641 -8.269  6.477   1.00 0.00 ? 107 THR A O    1  
ATOM 1608  C CB   . THR A 1 107 ? -17.863 -5.230  5.871   1.00 0.00 ? 107 THR A CB   1  
ATOM 1609  O OG1  . THR A 1 107 ? -18.255 -5.380  4.509   1.00 0.00 ? 107 THR A OG1  1  
ATOM 1610  C CG2  . THR A 1 107 ? -17.753 -3.716  6.062   1.00 0.00 ? 107 THR A CG2  1  
ATOM 1611  H H    . THR A 1 107 ? -16.027 -4.729  4.314   1.00 0.00 ? 107 THR A H    1  
ATOM 1612  H HA   . THR A 1 107 ? -16.117 -5.861  6.963   1.00 0.00 ? 107 THR A HA   1  
ATOM 1613  H HB   . THR A 1 107 ? -18.565 -5.663  6.584   1.00 0.00 ? 107 THR A HB   1  
ATOM 1614  H HG1  . THR A 1 107 ? -19.235 -5.573  4.454   1.00 0.00 ? 107 THR A HG1  1  
ATOM 1615  H HG21 . THR A 1 107 ? -16.703 -3.437  6.153   1.00 0.00 ? 107 THR A HG21 1  
ATOM 1616  H HG22 . THR A 1 107 ? -18.190 -3.208  5.203   1.00 0.00 ? 107 THR A HG22 1  
ATOM 1617  H HG23 . THR A 1 107 ? -18.286 -3.425  6.967   1.00 0.00 ? 107 THR A HG23 1  
ATOM 1618  N N    . THR A 1 108 ? -16.537 -7.685  4.294   1.00 0.00 ? 108 THR A N    1  
ATOM 1619  C CA   . THR A 1 108 ? -16.590 -9.054  3.811   1.00 0.00 ? 108 THR A CA   1  
ATOM 1620  C C    . THR A 1 108 ? -15.283 -9.420  3.103   1.00 0.00 ? 108 THR A C    1  
ATOM 1621  O O    . THR A 1 108 ? -15.006 -10.596 2.874   1.00 0.00 ? 108 THR A O    1  
ATOM 1622  C CB   . THR A 1 108 ? -17.824 -9.193  2.918   1.00 0.00 ? 108 THR A CB   1  
ATOM 1623  O OG1  . THR A 1 108 ? -17.542 -10.333 2.110   1.00 0.00 ? 108 THR A OG1  1  
ATOM 1624  C CG2  . THR A 1 108 ? -17.952 -8.047  1.913   1.00 0.00 ? 108 THR A CG2  1  
ATOM 1625  H H    . THR A 1 108 ? -16.478 -6.987  3.581   1.00 0.00 ? 108 THR A H    1  
ATOM 1626  H HA   . THR A 1 108 ? -16.685 -9.718  4.670   1.00 0.00 ? 108 THR A HA   1  
ATOM 1627  H HB   . THR A 1 108 ? -18.729 -9.289  3.517   1.00 0.00 ? 108 THR A HB   1  
ATOM 1628  H HG1  . THR A 1 108 ? -16.846 -10.105 1.429   1.00 0.00 ? 108 THR A HG1  1  
ATOM 1629  H HG21 . THR A 1 108 ? -17.061 -8.012  1.286   1.00 0.00 ? 108 THR A HG21 1  
ATOM 1630  H HG22 . THR A 1 108 ? -18.831 -8.208  1.288   1.00 0.00 ? 108 THR A HG22 1  
ATOM 1631  H HG23 . THR A 1 108 ? -18.056 -7.104  2.449   1.00 0.00 ? 108 THR A HG23 1  
ATOM 1632  N N    . SER A 1 109 ? -14.516 -8.391  2.777   1.00 0.00 ? 109 SER A N    1  
ATOM 1633  C CA   . SER A 1 109 ? -13.246 -8.589  2.100   1.00 0.00 ? 109 SER A CA   1  
ATOM 1634  C C    . SER A 1 109 ? -12.092 -8.223  3.035   1.00 0.00 ? 109 SER A C    1  
ATOM 1635  O O    . SER A 1 109 ? -12.195 -7.275  3.813   1.00 0.00 ? 109 SER A O    1  
ATOM 1636  C CB   . SER A 1 109 ? -13.171 -7.762  0.815   1.00 0.00 ? 109 SER A CB   1  
ATOM 1637  O OG   . SER A 1 109 ? -12.893 -6.389  1.080   1.00 0.00 ? 109 SER A OG   1  
ATOM 1638  H H    . SER A 1 109 ? -14.749 -7.437  2.967   1.00 0.00 ? 109 SER A H    1  
ATOM 1639  H HA   . SER A 1 109 ? -13.214 -9.650  1.851   1.00 0.00 ? 109 SER A HA   1  
ATOM 1640  H HB2  . SER A 1 109 ? -12.396 -8.170  0.166   1.00 0.00 ? 109 SER A HB2  1  
ATOM 1641  H HB3  . SER A 1 109 ? -14.114 -7.844  0.276   1.00 0.00 ? 109 SER A HB3  1  
ATOM 1642  H HG   . SER A 1 109 ? -13.670 -5.967  1.547   1.00 0.00 ? 109 SER A HG   1  
ATOM 1643  N N    . THR A 1 110 ? -11.018 -8.993  2.929   1.00 0.00 ? 110 THR A N    1  
ATOM 1644  C CA   . THR A 1 110 ? -9.846  -8.761  3.756   1.00 0.00 ? 110 THR A CA   1  
ATOM 1645  C C    . THR A 1 110 ? -8.659  -8.333  2.890   1.00 0.00 ? 110 THR A C    1  
ATOM 1646  O O    . THR A 1 110 ? -8.837  -7.661  1.875   1.00 0.00 ? 110 THR A O    1  
ATOM 1647  C CB   . THR A 1 110 ? -9.581  -10.031 4.566   1.00 0.00 ? 110 THR A CB   1  
ATOM 1648  O OG1  . THR A 1 110 ? -8.459  -9.696  5.378   1.00 0.00 ? 110 THR A OG1  1  
ATOM 1649  C CG2  . THR A 1 110 ? -9.080  -11.186 3.697   1.00 0.00 ? 110 THR A CG2  1  
ATOM 1650  H H    . THR A 1 110 ? -10.943 -9.761  2.294   1.00 0.00 ? 110 THR A H    1  
ATOM 1651  H HA   . THR A 1 110 ? -10.062 -7.935  4.433   1.00 0.00 ? 110 THR A HA   1  
ATOM 1652  H HB   . THR A 1 110 ? -10.465 -10.324 5.131   1.00 0.00 ? 110 THR A HB   1  
ATOM 1653  H HG1  . THR A 1 110 ? -8.589  -10.049 6.305   1.00 0.00 ? 110 THR A HG1  1  
ATOM 1654  H HG21 . THR A 1 110 ? -8.372  -10.807 2.960   1.00 0.00 ? 110 THR A HG21 1  
ATOM 1655  H HG22 . THR A 1 110 ? -8.587  -11.927 4.326   1.00 0.00 ? 110 THR A HG22 1  
ATOM 1656  H HG23 . THR A 1 110 ? -9.924  -11.648 3.185   1.00 0.00 ? 110 THR A HG23 1  
ATOM 1657  N N    . LEU A 1 111 ? -7.475  -8.740  3.323   1.00 0.00 ? 111 LEU A N    1  
ATOM 1658  C CA   . LEU A 1 111 ? -6.259  -8.407  2.600   1.00 0.00 ? 111 LEU A CA   1  
ATOM 1659  C C    . LEU A 1 111 ? -6.166  -9.273  1.342   1.00 0.00 ? 111 LEU A C    1  
ATOM 1660  O O    . LEU A 1 111 ? -6.041  -8.753  0.234   1.00 0.00 ? 111 LEU A O    1  
ATOM 1661  C CB   . LEU A 1 111 ? -5.041  -8.524  3.518   1.00 0.00 ? 111 LEU A CB   1  
ATOM 1662  C CG   . LEU A 1 111 ? -3.680  -8.296  2.859   1.00 0.00 ? 111 LEU A CG   1  
ATOM 1663  C CD1  . LEU A 1 111 ? -3.564  -6.869  2.319   1.00 0.00 ? 111 LEU A CD1  1  
ATOM 1664  C CD2  . LEU A 1 111 ? -2.540  -8.638  3.821   1.00 0.00 ? 111 LEU A CD2  1  
ATOM 1665  H H    . LEU A 1 111 ? -7.339  -9.286  4.149   1.00 0.00 ? 111 LEU A H    1  
ATOM 1666  H HA   . LEU A 1 111 ? -6.335  -7.363  2.296   1.00 0.00 ? 111 LEU A HA   1  
ATOM 1667  H HB2  . LEU A 1 111 ? -5.154  -7.807  4.331   1.00 0.00 ? 111 LEU A HB2  1  
ATOM 1668  H HB3  . LEU A 1 111 ? -5.043  -9.518  3.967   1.00 0.00 ? 111 LEU A HB3  1  
ATOM 1669  H HG   . LEU A 1 111 ? -3.595  -8.970  2.007   1.00 0.00 ? 111 LEU A HG   1  
ATOM 1670  H HD11 . LEU A 1 111 ? -4.551  -6.512  2.022   1.00 0.00 ? 111 LEU A HD11 1  
ATOM 1671  H HD12 . LEU A 1 111 ? -3.161  -6.218  3.095   1.00 0.00 ? 111 LEU A HD12 1  
ATOM 1672  H HD13 . LEU A 1 111 ? -2.899  -6.860  1.455   1.00 0.00 ? 111 LEU A HD13 1  
ATOM 1673  H HD21 . LEU A 1 111 ? -2.897  -8.566  4.848   1.00 0.00 ? 111 LEU A HD21 1  
ATOM 1674  H HD22 . LEU A 1 111 ? -2.194  -9.654  3.627   1.00 0.00 ? 111 LEU A HD22 1  
ATOM 1675  H HD23 . LEU A 1 111 ? -1.717  -7.940  3.672   1.00 0.00 ? 111 LEU A HD23 1  
ATOM 1676  N N    . GLN A 1 112 ? -6.231  -10.579 1.555   1.00 0.00 ? 112 GLN A N    1  
ATOM 1677  C CA   . GLN A 1 112 ? -6.156  -11.522 0.451   1.00 0.00 ? 112 GLN A CA   1  
ATOM 1678  C C    . GLN A 1 112 ? -7.370  -11.363 -0.466  1.00 0.00 ? 112 GLN A C    1  
ATOM 1679  O O    . GLN A 1 112 ? -7.225  -11.284 -1.685  1.00 0.00 ? 112 GLN A O    1  
ATOM 1680  C CB   . GLN A 1 112 ? -6.040  -12.958 0.964   1.00 0.00 ? 112 GLN A CB   1  
ATOM 1681  C CG   . GLN A 1 112 ? -4.577  -13.341 1.198   1.00 0.00 ? 112 GLN A CG   1  
ATOM 1682  C CD   . GLN A 1 112 ? -4.471  -14.625 2.022   1.00 0.00 ? 112 GLN A CD   1  
ATOM 1683  O OE1  . GLN A 1 112 ? -5.457  -15.196 2.460   1.00 0.00 ? 112 GLN A OE1  1  
ATOM 1684  N NE2  . GLN A 1 112 ? -3.223  -15.047 2.209   1.00 0.00 ? 112 GLN A NE2  1  
ATOM 1685  H H    . GLN A 1 112 ? -6.333  -10.994 2.459   1.00 0.00 ? 112 GLN A H    1  
ATOM 1686  H HA   . GLN A 1 112 ? -5.246  -11.261 -0.090  1.00 0.00 ? 112 GLN A HA   1  
ATOM 1687  H HB2  . GLN A 1 112 ? -6.600  -13.062 1.894   1.00 0.00 ? 112 GLN A HB2  1  
ATOM 1688  H HB3  . GLN A 1 112 ? -6.488  -13.643 0.244   1.00 0.00 ? 112 GLN A HB3  1  
ATOM 1689  H HG2  . GLN A 1 112 ? -4.076  -13.477 0.240   1.00 0.00 ? 112 GLN A HG2  1  
ATOM 1690  H HG3  . GLN A 1 112 ? -4.063  -12.530 1.714   1.00 0.00 ? 112 GLN A HG3  1  
ATOM 1691  H HE21 . GLN A 1 112 ? -2.459  -14.532 1.823   1.00 0.00 ? 112 GLN A HE21 1  
ATOM 1692  H HE22 . GLN A 1 112 ? -3.051  -15.879 2.736   1.00 0.00 ? 112 GLN A HE22 1  
ATOM 1693  N N    . GLU A 1 113 ? -8.539  -11.321 0.155   1.00 0.00 ? 113 GLU A N    1  
ATOM 1694  C CA   . GLU A 1 113 ? -9.778  -11.174 -0.590  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1695  C C    . GLU A 1 113 ? -9.731  -9.911  -1.453  1.00 0.00 ? 113 GLU A C    1  
ATOM 1696  O O    . GLU A 1 113 ? -10.019 -9.960  -2.648  1.00 0.00 ? 113 GLU A O    1  
ATOM 1697  C CB   . GLU A 1 113 ? -10.985 -11.151 0.350   1.00 0.00 ? 113 GLU A CB   1  
ATOM 1698  C CG   . GLU A 1 113 ? -12.052 -12.149 -0.103  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1699  C CD   . GLU A 1 113 ? -12.648 -12.895 1.093   1.00 0.00 ? 113 GLU A CD   1  
ATOM 1700  O OE1  . GLU A 1 113 ? -12.932 -12.214 2.102   1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1701  O OE2  . GLU A 1 113 ? -12.807 -14.128 0.970   1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1702  H H    . GLU A 1 113 ? -8.648  -11.386 1.147   1.00 0.00 ? 113 GLU A H    1  
ATOM 1703  H HA   . GLU A 1 113 ? -9.839  -12.056 -1.228  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1704  H HB2  . GLU A 1 113 ? -10.664 -11.391 1.364   1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1705  H HB3  . GLU A 1 113 ? -11.409 -10.147 0.379   1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1706  H HG2  . GLU A 1 113 ? -12.842 -11.623 -0.639  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1707  H HG3  . GLU A 1 113 ? -11.615 -12.863 -0.800  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1708  N N    . GLN A 1 114 ? -9.366  -8.810  -0.814  1.00 0.00 ? 114 GLN A N    1  
ATOM 1709  C CA   . GLN A 1 114 ? -9.277  -7.536  -1.508  1.00 0.00 ? 114 GLN A CA   1  
ATOM 1710  C C    . GLN A 1 114 ? -8.249  -7.618  -2.638  1.00 0.00 ? 114 GLN A C    1  
ATOM 1711  O O    . GLN A 1 114 ? -8.434  -7.016  -3.695  1.00 0.00 ? 114 GLN A O    1  
ATOM 1712  C CB   . GLN A 1 114 ? -8.936  -6.405  -0.536  1.00 0.00 ? 114 GLN A CB   1  
ATOM 1713  C CG   . GLN A 1 114 ? -10.149 -6.028  0.315   1.00 0.00 ? 114 GLN A CG   1  
ATOM 1714  C CD   . GLN A 1 114 ? -9.767  -5.018  1.399   1.00 0.00 ? 114 GLN A CD   1  
ATOM 1715  O OE1  . GLN A 1 114 ? -9.335  -3.910  1.126   1.00 0.00 ? 114 GLN A OE1  1  
ATOM 1716  N NE2  . GLN A 1 114 ? -9.949  -5.460  2.640   1.00 0.00 ? 114 GLN A NE2  1  
ATOM 1717  H H    . GLN A 1 114 ? -9.133  -8.778  0.158   1.00 0.00 ? 114 GLN A H    1  
ATOM 1718  H HA   . GLN A 1 114 ? -10.270 -7.363  -1.923  1.00 0.00 ? 114 GLN A HA   1  
ATOM 1719  H HB2  . GLN A 1 114 ? -8.114  -6.712  0.111   1.00 0.00 ? 114 GLN A HB2  1  
ATOM 1720  H HB3  . GLN A 1 114 ? -8.593  -5.533  -1.094  1.00 0.00 ? 114 GLN A HB3  1  
ATOM 1721  H HG2  . GLN A 1 114 ? -10.928 -5.607  -0.321  1.00 0.00 ? 114 GLN A HG2  1  
ATOM 1722  H HG3  . GLN A 1 114 ? -10.565 -6.923  0.778   1.00 0.00 ? 114 GLN A HG3  1  
ATOM 1723  H HE21 . GLN A 1 114 ? -10.308 -6.381  2.795   1.00 0.00 ? 114 GLN A HE21 1  
ATOM 1724  H HE22 . GLN A 1 114 ? -9.728  -4.872  3.418   1.00 0.00 ? 114 GLN A HE22 1  
ATOM 1725  N N    . ILE A 1 115 ? -7.188  -8.367  -2.377  1.00 0.00 ? 115 ILE A N    1  
ATOM 1726  C CA   . ILE A 1 115 ? -6.130  -8.535  -3.358  1.00 0.00 ? 115 ILE A CA   1  
ATOM 1727  C C    . ILE A 1 115 ? -6.705  -9.196  -4.613  1.00 0.00 ? 115 ILE A C    1  
ATOM 1728  O O    . ILE A 1 115 ? -6.362  -8.816  -5.731  1.00 0.00 ? 115 ILE A O    1  
ATOM 1729  C CB   . ILE A 1 115 ? -4.949  -9.294  -2.749  1.00 0.00 ? 115 ILE A CB   1  
ATOM 1730  C CG1  . ILE A 1 115 ? -3.704  -8.408  -2.682  1.00 0.00 ? 115 ILE A CG1  1  
ATOM 1731  C CG2  . ILE A 1 115 ? -4.686  -10.597 -3.507  1.00 0.00 ? 115 ILE A CG2  1  
ATOM 1732  C CD1  . ILE A 1 115 ? -3.826  -7.373  -1.562  1.00 0.00 ? 115 ILE A CD1  1  
ATOM 1733  H H    . ILE A 1 115 ? -7.045  -8.852  -1.514  1.00 0.00 ? 115 ILE A H    1  
ATOM 1734  H HA   . ILE A 1 115 ? -5.771  -7.541  -3.625  1.00 0.00 ? 115 ILE A HA   1  
ATOM 1735  H HB   . ILE A 1 115 ? -5.208  -9.563  -1.726  1.00 0.00 ? 115 ILE A HB   1  
ATOM 1736  H HG12 . ILE A 1 115 ? -2.822  -9.026  -2.517  1.00 0.00 ? 115 ILE A HG12 1  
ATOM 1737  H HG13 . ILE A 1 115 ? -3.562  -7.900  -3.637  1.00 0.00 ? 115 ILE A HG13 1  
ATOM 1738  H HG21 . ILE A 1 115 ? -5.618  -11.152 -3.609  1.00 0.00 ? 115 ILE A HG21 1  
ATOM 1739  H HG22 . ILE A 1 115 ? -4.289  -10.368 -4.496  1.00 0.00 ? 115 ILE A HG22 1  
ATOM 1740  H HG23 . ILE A 1 115 ? -3.963  -11.198 -2.955  1.00 0.00 ? 115 ILE A HG23 1  
ATOM 1741  H HD11 . ILE A 1 115 ? -4.787  -6.865  -1.640  1.00 0.00 ? 115 ILE A HD11 1  
ATOM 1742  H HD12 . ILE A 1 115 ? -3.758  -7.874  -0.596  1.00 0.00 ? 115 ILE A HD12 1  
ATOM 1743  H HD13 . ILE A 1 115 ? -3.021  -6.644  -1.651  1.00 0.00 ? 115 ILE A HD13 1  
ATOM 1744  N N    . GLY A 1 116 ? -7.570  -10.173 -4.385  1.00 0.00 ? 116 GLY A N    1  
ATOM 1745  C CA   . GLY A 1 116 ? -8.195  -10.890 -5.482  1.00 0.00 ? 116 GLY A CA   1  
ATOM 1746  C C    . GLY A 1 116 ? -9.103  -9.965  -6.295  1.00 0.00 ? 116 GLY A C    1  
ATOM 1747  O O    . GLY A 1 116 ? -9.012  -9.920  -7.521  1.00 0.00 ? 116 GLY A O    1  
ATOM 1748  H H    . GLY A 1 116 ? -7.843  -10.476 -3.472  1.00 0.00 ? 116 GLY A H    1  
ATOM 1749  H HA2  . GLY A 1 116 ? -7.427  -11.313 -6.130  1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1750  H HA3  . GLY A 1 116 ? -8.777  -11.725 -5.091  1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1751  N N    . TRP A 1 117 ? -9.959  -9.250  -5.579  1.00 0.00 ? 117 TRP A N    1  
ATOM 1752  C CA   . TRP A 1 117 ? -10.882 -8.329  -6.219  1.00 0.00 ? 117 TRP A CA   1  
ATOM 1753  C C    . TRP A 1 117 ? -10.066 -7.363  -7.081  1.00 0.00 ? 117 TRP A C    1  
ATOM 1754  O O    . TRP A 1 117 ? -10.494 -6.984  -8.170  1.00 0.00 ? 117 TRP A O    1  
ATOM 1755  C CB   . TRP A 1 117 ? -11.751 -7.615  -5.181  1.00 0.00 ? 117 TRP A CB   1  
ATOM 1756  C CG   . TRP A 1 117 ? -13.122 -8.260  -4.968  1.00 0.00 ? 117 TRP A CG   1  
ATOM 1757  C CD1  . TRP A 1 117 ? -14.112 -8.407  -5.859  1.00 0.00 ? 117 TRP A CD1  1  
ATOM 1758  C CD2  . TRP A 1 117 ? -13.617 -8.843  -3.744  1.00 0.00 ? 117 TRP A CD2  1  
ATOM 1759  N NE1  . TRP A 1 117 ? -15.205 -9.039  -5.301  1.00 0.00 ? 117 TRP A NE1  1  
ATOM 1760  C CE2  . TRP A 1 117 ? -14.894 -9.313  -3.975  1.00 0.00 ? 117 TRP A CE2  1  
ATOM 1761  C CE3  . TRP A 1 117 ? -13.006 -8.970  -2.485  1.00 0.00 ? 117 TRP A CE3  1  
ATOM 1762  C CZ2  . TRP A 1 117 ? -15.669 -9.941  -2.992  1.00 0.00 ? 117 TRP A CZ2  1  
ATOM 1763  C CZ3  . TRP A 1 117 ? -13.793 -9.600  -1.513  1.00 0.00 ? 117 TRP A CZ3  1  
ATOM 1764  C CH2  . TRP A 1 117 ? -15.080 -10.078 -1.729  1.00 0.00 ? 117 TRP A CH2  1  
ATOM 1765  H H    . TRP A 1 117 ? -10.027 -9.293  -4.583  1.00 0.00 ? 117 TRP A H    1  
ATOM 1766  H HA   . TRP A 1 117 ? -11.554 -8.913  -6.848  1.00 0.00 ? 117 TRP A HA   1  
ATOM 1767  H HB2  . TRP A 1 117 ? -11.220 -7.594  -4.230  1.00 0.00 ? 117 TRP A HB2  1  
ATOM 1768  H HB3  . TRP A 1 117 ? -11.893 -6.580  -5.491  1.00 0.00 ? 117 TRP A HB3  1  
ATOM 1769  H HD1  . TRP A 1 117 ? -14.061 -8.069  -6.894  1.00 0.00 ? 117 TRP A HD1  1  
ATOM 1770  H HE1  . TRP A 1 117 ? -16.139 -9.280  -5.808  1.00 0.00 ? 117 TRP A HE1  1  
ATOM 1771  H HE3  . TRP A 1 117 ? -11.999 -8.607  -2.278  1.00 0.00 ? 117 TRP A HE3  1  
ATOM 1772  H HZ2  . TRP A 1 117 ? -16.675 -10.304 -3.199  1.00 0.00 ? 117 TRP A HZ2  1  
ATOM 1773  H HZ3  . TRP A 1 117 ? -13.367 -9.723  -0.518  1.00 0.00 ? 117 TRP A HZ3  1  
ATOM 1774  H HH2  . TRP A 1 117 ? -15.629 -10.558 -0.918  1.00 0.00 ? 117 TRP A HH2  1  
ATOM 1775  N N    . MET A 1 118 ? -8.905  -6.993  -6.561  1.00 0.00 ? 118 MET A N    1  
ATOM 1776  C CA   . MET A 1 118 ? -8.026  -6.078  -7.269  1.00 0.00 ? 118 MET A CA   1  
ATOM 1777  C C    . MET A 1 118 ? -7.130  -6.832  -8.253  1.00 0.00 ? 118 MET A C    1  
ATOM 1778  O O    . MET A 1 118 ? -6.541  -6.230  -9.149  1.00 0.00 ? 118 MET A O    1  
ATOM 1779  C CB   . MET A 1 118 ? -7.156  -5.323  -6.262  1.00 0.00 ? 118 MET A CB   1  
ATOM 1780  C CG   . MET A 1 118 ? -6.988  -3.859  -6.672  1.00 0.00 ? 118 MET A CG   1  
ATOM 1781  S SD   . MET A 1 118 ? -5.303  -3.337  -6.396  1.00 0.00 ? 118 MET A SD   1  
ATOM 1782  C CE   . MET A 1 118 ? -5.309  -3.201  -4.616  1.00 0.00 ? 118 MET A CE   1  
ATOM 1783  H H    . MET A 1 118 ? -8.565  -7.305  -5.674  1.00 0.00 ? 118 MET A H    1  
ATOM 1784  H HA   . MET A 1 118 ? -8.684  -5.400  -7.812  1.00 0.00 ? 118 MET A HA   1  
ATOM 1785  H HB2  . MET A 1 118 ? -7.609  -5.378  -5.272  1.00 0.00 ? 118 MET A HB2  1  
ATOM 1786  H HB3  . MET A 1 118 ? -6.178  -5.799  -6.191  1.00 0.00 ? 118 MET A HB3  1  
ATOM 1787  H HG2  . MET A 1 118 ? -7.248  -3.735  -7.723  1.00 0.00 ? 118 MET A HG2  1  
ATOM 1788  H HG3  . MET A 1 118 ? -7.670  -3.231  -6.099  1.00 0.00 ? 118 MET A HG3  1  
ATOM 1789  H HE1  . MET A 1 118 ? -6.269  -3.541  -4.229  1.00 0.00 ? 118 MET A HE1  1  
ATOM 1790  H HE2  . MET A 1 118 ? -4.511  -3.818  -4.202  1.00 0.00 ? 118 MET A HE2  1  
ATOM 1791  H HE3  . MET A 1 118 ? -5.149  -2.162  -4.331  1.00 0.00 ? 118 MET A HE3  1  
ATOM 1792  N N    . THR A 1 119 ? -7.055  -8.140  -8.054  1.00 0.00 ? 119 THR A N    1  
ATOM 1793  C CA   . THR A 1 119 ? -6.240  -8.983  -8.913  1.00 0.00 ? 119 THR A CA   1  
ATOM 1794  C C    . THR A 1 119 ? -7.127  -9.908  -9.748  1.00 0.00 ? 119 THR A C    1  
ATOM 1795  O O    . THR A 1 119 ? -6.672  -10.947 -10.224 1.00 0.00 ? 119 THR A O    1  
ATOM 1796  C CB   . THR A 1 119 ? -5.241  -9.733  -8.030  1.00 0.00 ? 119 THR A CB   1  
ATOM 1797  O OG1  . THR A 1 119 ? -4.396  -8.708  -7.514  1.00 0.00 ? 119 THR A OG1  1  
ATOM 1798  C CG2  . THR A 1 119 ? -4.296  -10.622 -8.840  1.00 0.00 ? 119 THR A CG2  1  
ATOM 1799  H H    . THR A 1 119 ? -7.537  -8.623  -7.323  1.00 0.00 ? 119 THR A H    1  
ATOM 1800  H HA   . THR A 1 119 ? -5.700  -8.342  -9.610  1.00 0.00 ? 119 THR A HA   1  
ATOM 1801  H HB   . THR A 1 119 ? -5.757  -10.310 -7.262  1.00 0.00 ? 119 THR A HB   1  
ATOM 1802  H HG1  . THR A 1 119 ? -4.949  -7.965  -7.138  1.00 0.00 ? 119 THR A HG1  1  
ATOM 1803  H HG21 . THR A 1 119 ? -3.938  -10.074 -9.711  1.00 0.00 ? 119 THR A HG21 1  
ATOM 1804  H HG22 . THR A 1 119 ? -3.448  -10.911 -8.219  1.00 0.00 ? 119 THR A HG22 1  
ATOM 1805  H HG23 . THR A 1 119 ? -4.829  -11.516 -9.166  1.00 0.00 ? 119 THR A HG23 1  
ATOM 1806  N N    . HIS A 1 120 ? -8.378  -9.498  -9.900  1.00 0.00 ? 120 HIS A N    1  
ATOM 1807  C CA   . HIS A 1 120 ? -9.333  -10.278 -10.669 1.00 0.00 ? 120 HIS A CA   1  
ATOM 1808  C C    . HIS A 1 120 ? -9.722  -9.510  -11.934 1.00 0.00 ? 120 HIS A C    1  
ATOM 1809  O O    . HIS A 1 120 ? -9.406  -8.329  -12.069 1.00 0.00 ? 120 HIS A O    1  
ATOM 1810  C CB   . HIS A 1 120 ? -10.541 -10.657 -9.811  1.00 0.00 ? 120 HIS A CB   1  
ATOM 1811  C CG   . HIS A 1 120 ? -10.477 -12.055 -9.243  1.00 0.00 ? 120 HIS A CG   1  
ATOM 1812  N ND1  . HIS A 1 120 ? -10.425 -13.186 -10.039 1.00 0.00 ? 120 HIS A ND1  1  
ATOM 1813  C CD2  . HIS A 1 120 ? -10.457 -12.492 -7.951  1.00 0.00 ? 120 HIS A CD2  1  
ATOM 1814  C CE1  . HIS A 1 120 ? -10.376 -14.250 -9.251  1.00 0.00 ? 120 HIS A CE1  1  
ATOM 1815  N NE2  . HIS A 1 120 ? -10.396 -13.818 -7.957  1.00 0.00 ? 120 HIS A NE2  1  
ATOM 1816  H H    . HIS A 1 120 ? -8.740  -8.652  -9.509  1.00 0.00 ? 120 HIS A H    1  
ATOM 1817  H HA   . HIS A 1 120 ? -8.826  -11.200 -10.955 1.00 0.00 ? 120 HIS A HA   1  
ATOM 1818  H HB2  . HIS A 1 120 ? -10.628 -9.946  -8.989  1.00 0.00 ? 120 HIS A HB2  1  
ATOM 1819  H HB3  . HIS A 1 120 ? -11.445 -10.561 -10.412 1.00 0.00 ? 120 HIS A HB3  1  
ATOM 1820  H HD1  . HIS A 1 120 ? -10.423 -13.198 -11.039 1.00 0.00 ? 120 HIS A HD1  1  
ATOM 1821  H HD2  . HIS A 1 120 ? -10.485 -11.859 -7.064  1.00 0.00 ? 120 HIS A HD2  1  
ATOM 1822  H HE1  . HIS A 1 120 ? -10.328 -15.288 -9.579  1.00 0.00 ? 120 HIS A HE1  1  
ATOM 1823  H HE2  . HIS A 1 120 ? -10.313 -14.400 -7.149  1.00 0.00 ? 120 HIS A HE2  1  
ATOM 1824  N N    . ASN A 1 121 ? -10.401 -10.213 -12.829 1.00 0.00 ? 121 ASN A N    1  
ATOM 1825  C CA   . ASN A 1 121 ? -10.836 -9.612  -14.078 1.00 0.00 ? 121 ASN A CA   1  
ATOM 1826  C C    . ASN A 1 121 ? -12.364 -9.545  -14.102 1.00 0.00 ? 121 ASN A C    1  
ATOM 1827  O O    . ASN A 1 121 ? -13.035 -10.573 -14.027 1.00 0.00 ? 121 ASN A O    1  
ATOM 1828  C CB   . ASN A 1 121 ? -10.381 -10.446 -15.278 1.00 0.00 ? 121 ASN A CB   1  
ATOM 1829  C CG   . ASN A 1 121 ? -8.854  -10.495 -15.364 1.00 0.00 ? 121 ASN A CG   1  
ATOM 1830  O OD1  . ASN A 1 121 ? -8.212  -9.643  -15.955 1.00 0.00 ? 121 ASN A OD1  1  
ATOM 1831  N ND2  . ASN A 1 121 ? -8.311  -11.538 -14.742 1.00 0.00 ? 121 ASN A ND2  1  
ATOM 1832  H H    . ASN A 1 121 ? -10.653 -11.173 -12.711 1.00 0.00 ? 121 ASN A H    1  
ATOM 1833  H HA   . ASN A 1 121 ? -10.374 -8.625  -14.097 1.00 0.00 ? 121 ASN A HA   1  
ATOM 1834  H HB2  . ASN A 1 121 ? -10.777 -11.458 -15.193 1.00 0.00 ? 121 ASN A HB2  1  
ATOM 1835  H HB3  . ASN A 1 121 ? -10.786 -10.020 -16.196 1.00 0.00 ? 121 ASN A HB3  1  
ATOM 1836  H HD21 . ASN A 1 121 ? -8.895  -12.202 -14.275 1.00 0.00 ? 121 ASN A HD21 1  
ATOM 1837  H HD22 . ASN A 1 121 ? -7.318  -11.658 -14.742 1.00 0.00 ? 121 ASN A HD22 1  
ATOM 1838  N N    . PRO A 1 122 ? -12.882 -8.292  -14.209 1.00 0.00 ? 122 PRO A N    1  
ATOM 1839  C CA   . PRO A 1 122 ? -12.017 -7.128  -14.292 1.00 0.00 ? 122 PRO A CA   1  
ATOM 1840  C C    . PRO A 1 122 ? -11.409 -6.798  -12.928 1.00 0.00 ? 122 PRO A C    1  
ATOM 1841  O O    . PRO A 1 122 ? -11.899 -7.258  -11.898 1.00 0.00 ? 122 PRO A O    1  
ATOM 1842  C CB   . PRO A 1 122 ? -12.902 -6.017  -14.834 1.00 0.00 ? 122 PRO A CB   1  
ATOM 1843  C CG   . PRO A 1 122 ? -14.333 -6.471  -14.595 1.00 0.00 ? 122 PRO A CG   1  
ATOM 1844  C CD   . PRO A 1 122 ? -14.301 -7.952  -14.253 1.00 0.00 ? 122 PRO A CD   1  
ATOM 1845  H HA   . PRO A 1 122 ? -11.243 -7.314  -14.898 1.00 0.00 ? 122 PRO A HA   1  
ATOM 1846  H HB2  . PRO A 1 122 ? -12.700 -5.075  -14.325 1.00 0.00 ? 122 PRO A HB2  1  
ATOM 1847  H HB3  . PRO A 1 122 ? -12.716 -5.852  -15.895 1.00 0.00 ? 122 PRO A HB3  1  
ATOM 1848  H HG2  . PRO A 1 122 ? -14.783 -5.901  -13.782 1.00 0.00 ? 122 PRO A HG2  1  
ATOM 1849  H HG3  . PRO A 1 122 ? -14.941 -6.297  -15.482 1.00 0.00 ? 122 PRO A HG3  1  
ATOM 1850  H HD2  . PRO A 1 122 ? -14.786 -8.148  -13.296 1.00 0.00 ? 122 PRO A HD2  1  
ATOM 1851  H HD3  . PRO A 1 122 ? -14.827 -8.542  -15.003 1.00 0.00 ? 122 PRO A HD3  1  
ATOM 1852  N N    . PRO A 1 123 ? -10.323 -5.981  -12.965 1.00 0.00 ? 123 PRO A N    1  
ATOM 1853  C CA   . PRO A 1 123 ? -9.643  -5.583  -11.744 1.00 0.00 ? 123 PRO A CA   1  
ATOM 1854  C C    . PRO A 1 123 ? -10.452 -4.529  -10.984 1.00 0.00 ? 123 PRO A C    1  
ATOM 1855  O O    . PRO A 1 123 ? -10.683 -3.433  -11.492 1.00 0.00 ? 123 PRO A O    1  
ATOM 1856  C CB   . PRO A 1 123 ? -8.284  -5.075  -12.197 1.00 0.00 ? 123 PRO A CB   1  
ATOM 1857  C CG   . PRO A 1 123 ? -8.426  -4.772  -13.680 1.00 0.00 ? 123 PRO A CG   1  
ATOM 1858  C CD   . PRO A 1 123 ? -9.714  -5.416  -14.166 1.00 0.00 ? 123 PRO A CD   1  
ATOM 1859  H HA   . PRO A 1 123 ? -9.559  -6.363  -11.123 1.00 0.00 ? 123 PRO A HA   1  
ATOM 1860  H HB2  . PRO A 1 123 ? -7.996  -4.182  -11.642 1.00 0.00 ? 123 PRO A HB2  1  
ATOM 1861  H HB3  . PRO A 1 123 ? -7.510  -5.822  -12.023 1.00 0.00 ? 123 PRO A HB3  1  
ATOM 1862  H HG2  . PRO A 1 123 ? -8.449  -3.696  -13.850 1.00 0.00 ? 123 PRO A HG2  1  
ATOM 1863  H HG3  . PRO A 1 123 ? -7.572  -5.163  -14.233 1.00 0.00 ? 123 PRO A HG3  1  
ATOM 1864  H HD2  . PRO A 1 123 ? -10.371 -4.683  -14.635 1.00 0.00 ? 123 PRO A HD2  1  
ATOM 1865  H HD3  . PRO A 1 123 ? -9.516  -6.188  -14.909 1.00 0.00 ? 123 PRO A HD3  1  
ATOM 1866  N N    . ILE A 1 124 ? -10.862 -4.899  -9.780  1.00 0.00 ? 124 ILE A N    1  
ATOM 1867  C CA   . ILE A 1 124 ? -11.640 -4.000  -8.945  1.00 0.00 ? 124 ILE A CA   1  
ATOM 1868  C C    . ILE A 1 124 ? -10.695 -3.055  -8.201  1.00 0.00 ? 124 ILE A C    1  
ATOM 1869  O O    . ILE A 1 124 ? -9.800  -3.503  -7.486  1.00 0.00 ? 124 ILE A O    1  
ATOM 1870  C CB   . ILE A 1 124 ? -12.568 -4.793  -8.023  1.00 0.00 ? 124 ILE A CB   1  
ATOM 1871  C CG1  . ILE A 1 124 ? -13.610 -5.570  -8.830  1.00 0.00 ? 124 ILE A CG1  1  
ATOM 1872  C CG2  . ILE A 1 124 ? -13.216 -3.881  -6.980  1.00 0.00 ? 124 ILE A CG2  1  
ATOM 1873  C CD1  . ILE A 1 124 ? -13.250 -7.056  -8.904  1.00 0.00 ? 124 ILE A CD1  1  
ATOM 1874  H H    . ILE A 1 124 ? -10.670 -5.793  -9.374  1.00 0.00 ? 124 ILE A H    1  
ATOM 1875  H HA   . ILE A 1 124 ? -12.273 -3.407  -9.606  1.00 0.00 ? 124 ILE A HA   1  
ATOM 1876  H HB   . ILE A 1 124 ? -11.968 -5.525  -7.482  1.00 0.00 ? 124 ILE A HB   1  
ATOM 1877  H HG12 . ILE A 1 124 ? -14.592 -5.453  -8.372  1.00 0.00 ? 124 ILE A HG12 1  
ATOM 1878  H HG13 . ILE A 1 124 ? -13.677 -5.158  -9.837  1.00 0.00 ? 124 ILE A HG13 1  
ATOM 1879  H HG21 . ILE A 1 124 ? -12.471 -3.185  -6.593  1.00 0.00 ? 124 ILE A HG21 1  
ATOM 1880  H HG22 . ILE A 1 124 ? -14.030 -3.321  -7.441  1.00 0.00 ? 124 ILE A HG22 1  
ATOM 1881  H HG23 . ILE A 1 124 ? -13.608 -4.485  -6.162  1.00 0.00 ? 124 ILE A HG23 1  
ATOM 1882  H HD11 . ILE A 1 124 ? -12.636 -7.324  -8.045  1.00 0.00 ? 124 ILE A HD11 1  
ATOM 1883  H HD12 . ILE A 1 124 ? -14.163 -7.651  -8.898  1.00 0.00 ? 124 ILE A HD12 1  
ATOM 1884  H HD13 . ILE A 1 124 ? -12.696 -7.250  -9.823  1.00 0.00 ? 124 ILE A HD13 1  
ATOM 1885  N N    . PRO A 1 125 ? -10.932 -1.731  -8.400  1.00 0.00 ? 125 PRO A N    1  
ATOM 1886  C CA   . PRO A 1 125 ? -10.112 -0.719  -7.756  1.00 0.00 ? 125 PRO A CA   1  
ATOM 1887  C C    . PRO A 1 125 ? -10.461 -0.594  -6.271  1.00 0.00 ? 125 PRO A C    1  
ATOM 1888  O O    . PRO A 1 125 ? -10.666 0.510   -5.769  1.00 0.00 ? 125 PRO A O    1  
ATOM 1889  C CB   . PRO A 1 125 ? -10.376 0.558   -8.537  1.00 0.00 ? 125 PRO A CB   1  
ATOM 1890  C CG   . PRO A 1 125 ? -11.676 0.324   -9.290  1.00 0.00 ? 125 PRO A CG   1  
ATOM 1891  C CD   . PRO A 1 125 ? -11.983 -1.164  -9.240  1.00 0.00 ? 125 PRO A CD   1  
ATOM 1892  H HA   . PRO A 1 125 ? -9.147  -0.981  -7.789  1.00 0.00 ? 125 PRO A HA   1  
ATOM 1893  H HB2  . PRO A 1 125 ? -10.460 1.415   -7.869  1.00 0.00 ? 125 PRO A HB2  1  
ATOM 1894  H HB3  . PRO A 1 125 ? -9.559  0.770   -9.226  1.00 0.00 ? 125 PRO A HB3  1  
ATOM 1895  H HG2  . PRO A 1 125 ? -12.487 0.897   -8.839  1.00 0.00 ? 125 PRO A HG2  1  
ATOM 1896  H HG3  . PRO A 1 125 ? -11.585 0.661   -10.323 1.00 0.00 ? 125 PRO A HG3  1  
ATOM 1897  H HD2  . PRO A 1 125 ? -12.971 -1.350  -8.818  1.00 0.00 ? 125 PRO A HD2  1  
ATOM 1898  H HD3  . PRO A 1 125 ? -11.973 -1.604  -10.237 1.00 0.00 ? 125 PRO A HD3  1  
ATOM 1899  N N    . VAL A 1 126 ? -10.517 -1.741  -5.611  1.00 0.00 ? 126 VAL A N    1  
ATOM 1900  C CA   . VAL A 1 126 ? -10.837 -1.773  -4.194  1.00 0.00 ? 126 VAL A CA   1  
ATOM 1901  C C    . VAL A 1 126 ? -9.880  -0.849  -3.437  1.00 0.00 ? 126 VAL A C    1  
ATOM 1902  O O    . VAL A 1 126 ? -10.249 -0.269  -2.418  1.00 0.00 ? 126 VAL A O    1  
ATOM 1903  C CB   . VAL A 1 126 ? -10.804 -3.215  -3.683  1.00 0.00 ? 126 VAL A CB   1  
ATOM 1904  C CG1  . VAL A 1 126 ? -9.530  -3.929  -4.139  1.00 0.00 ? 126 VAL A CG1  1  
ATOM 1905  C CG2  . VAL A 1 126 ? -10.944 -3.261  -2.160  1.00 0.00 ? 126 VAL A CG2  1  
ATOM 1906  H H    . VAL A 1 126 ? -10.348 -2.634  -6.026  1.00 0.00 ? 126 VAL A H    1  
ATOM 1907  H HA   . VAL A 1 126 ? -11.853 -1.397  -4.077  1.00 0.00 ? 126 VAL A HA   1  
ATOM 1908  H HB   . VAL A 1 126 ? -11.655 -3.743  -4.113  1.00 0.00 ? 126 VAL A HB   1  
ATOM 1909  H HG11 . VAL A 1 126 ? -8.679  -3.256  -4.034  1.00 0.00 ? 126 VAL A HG11 1  
ATOM 1910  H HG12 . VAL A 1 126 ? -9.370  -4.815  -3.523  1.00 0.00 ? 126 VAL A HG12 1  
ATOM 1911  H HG13 . VAL A 1 126 ? -9.633  -4.226  -5.182  1.00 0.00 ? 126 VAL A HG13 1  
ATOM 1912  H HG21 . VAL A 1 126 ? -10.167 -2.646  -1.705  1.00 0.00 ? 126 VAL A HG21 1  
ATOM 1913  H HG22 . VAL A 1 126 ? -11.923 -2.879  -1.873  1.00 0.00 ? 126 VAL A HG22 1  
ATOM 1914  H HG23 . VAL A 1 126 ? -10.839 -4.290  -1.816  1.00 0.00 ? 126 VAL A HG23 1  
ATOM 1915  N N    . GLY A 1 127 ? -8.670  -0.742  -3.967  1.00 0.00 ? 127 GLY A N    1  
ATOM 1916  C CA   . GLY A 1 127 ? -7.658  0.102   -3.354  1.00 0.00 ? 127 GLY A CA   1  
ATOM 1917  C C    . GLY A 1 127 ? -8.007  1.582   -3.516  1.00 0.00 ? 127 GLY A C    1  
ATOM 1918  O O    . GLY A 1 127 ? -8.358  2.251   -2.544  1.00 0.00 ? 127 GLY A O    1  
ATOM 1919  H H    . GLY A 1 127 ? -8.378  -1.218  -4.796  1.00 0.00 ? 127 GLY A H    1  
ATOM 1920  H HA2  . GLY A 1 127 ? -7.569  -0.141  -2.296  1.00 0.00 ? 127 GLY A HA2  1  
ATOM 1921  H HA3  . GLY A 1 127 ? -6.688  -0.099  -3.810  1.00 0.00 ? 127 GLY A HA3  1  
ATOM 1922  N N    . GLU A 1 128 ? -7.899  2.052   -4.750  1.00 0.00 ? 128 GLU A N    1  
ATOM 1923  C CA   . GLU A 1 128 ? -8.199  3.441   -5.051  1.00 0.00 ? 128 GLU A CA   1  
ATOM 1924  C C    . GLU A 1 128 ? -9.566  3.825   -4.479  1.00 0.00 ? 128 GLU A C    1  
ATOM 1925  O O    . GLU A 1 128 ? -9.771  4.965   -4.065  1.00 0.00 ? 128 GLU A O    1  
ATOM 1926  C CB   . GLU A 1 128 ? -8.143  3.700   -6.558  1.00 0.00 ? 128 GLU A CB   1  
ATOM 1927  C CG   . GLU A 1 128 ? -8.333  5.187   -6.866  1.00 0.00 ? 128 GLU A CG   1  
ATOM 1928  C CD   . GLU A 1 128 ? -7.750  5.542   -8.235  1.00 0.00 ? 128 GLU A CD   1  
ATOM 1929  O OE1  . GLU A 1 128 ? -8.466  5.311   -9.234  1.00 0.00 ? 128 GLU A OE1  1  
ATOM 1930  O OE2  . GLU A 1 128 ? -6.602  6.036   -8.253  1.00 0.00 ? 128 GLU A OE2  1  
ATOM 1931  H H    . GLU A 1 128 ? -7.613  1.502   -5.534  1.00 0.00 ? 128 GLU A H    1  
ATOM 1932  H HA   . GLU A 1 128 ? -7.417  4.020   -4.560  1.00 0.00 ? 128 GLU A HA   1  
ATOM 1933  H HB2  . GLU A 1 128 ? -7.185  3.363   -6.953  1.00 0.00 ? 128 GLU A HB2  1  
ATOM 1934  H HB3  . GLU A 1 128 ? -8.918  3.120   -7.059  1.00 0.00 ? 128 GLU A HB3  1  
ATOM 1935  H HG2  . GLU A 1 128 ? -9.394  5.434   -6.843  1.00 0.00 ? 128 GLU A HG2  1  
ATOM 1936  H HG3  . GLU A 1 128 ? -7.849  5.787   -6.095  1.00 0.00 ? 128 GLU A HG3  1  
ATOM 1937  N N    . ILE A 1 129 ? -10.464 2.852   -4.474  1.00 0.00 ? 129 ILE A N    1  
ATOM 1938  C CA   . ILE A 1 129 ? -11.805 3.073   -3.960  1.00 0.00 ? 129 ILE A CA   1  
ATOM 1939  C C    . ILE A 1 129 ? -11.725 3.417   -2.471  1.00 0.00 ? 129 ILE A C    1  
ATOM 1940  O O    . ILE A 1 129 ? -12.199 4.470   -2.047  1.00 0.00 ? 129 ILE A O    1  
ATOM 1941  C CB   . ILE A 1 129 ? -12.702 1.872   -4.266  1.00 0.00 ? 129 ILE A CB   1  
ATOM 1942  C CG1  . ILE A 1 129 ? -12.963 1.752   -5.769  1.00 0.00 ? 129 ILE A CG1  1  
ATOM 1943  C CG2  . ILE A 1 129 ? -14.002 1.939   -3.462  1.00 0.00 ? 129 ILE A CG2  1  
ATOM 1944  C CD1  . ILE A 1 129 ? -13.213 0.297   -6.168  1.00 0.00 ? 129 ILE A CD1  1  
ATOM 1945  H H    . ILE A 1 129 ? -10.289 1.927   -4.813  1.00 0.00 ? 129 ILE A H    1  
ATOM 1946  H HA   . ILE A 1 129 ? -12.221 3.930   -4.490  1.00 0.00 ? 129 ILE A HA   1  
ATOM 1947  H HB   . ILE A 1 129 ? -12.178 0.967   -3.958  1.00 0.00 ? 129 ILE A HB   1  
ATOM 1948  H HG12 . ILE A 1 129 ? -13.826 2.361   -6.041  1.00 0.00 ? 129 ILE A HG12 1  
ATOM 1949  H HG13 . ILE A 1 129 ? -12.110 2.144   -6.323  1.00 0.00 ? 129 ILE A HG13 1  
ATOM 1950  H HG21 . ILE A 1 129 ? -13.768 2.040   -2.402  1.00 0.00 ? 129 ILE A HG21 1  
ATOM 1951  H HG22 . ILE A 1 129 ? -14.588 2.798   -3.789  1.00 0.00 ? 129 ILE A HG22 1  
ATOM 1952  H HG23 . ILE A 1 129 ? -14.575 1.026   -3.622  1.00 0.00 ? 129 ILE A HG23 1  
ATOM 1953  H HD11 . ILE A 1 129 ? -12.938 -0.359  -5.342  1.00 0.00 ? 129 ILE A HD11 1  
ATOM 1954  H HD12 . ILE A 1 129 ? -14.268 0.160   -6.404  1.00 0.00 ? 129 ILE A HD12 1  
ATOM 1955  H HD13 . ILE A 1 129 ? -12.611 0.051   -7.043  1.00 0.00 ? 129 ILE A HD13 1  
ATOM 1956  N N    . TYR A 1 130 ? -11.122 2.509   -1.718  1.00 0.00 ? 130 TYR A N    1  
ATOM 1957  C CA   . TYR A 1 130 ? -10.974 2.703   -0.286  1.00 0.00 ? 130 TYR A CA   1  
ATOM 1958  C C    . TYR A 1 130 ? -10.209 3.993   0.017   1.00 0.00 ? 130 TYR A C    1  
ATOM 1959  O O    . TYR A 1 130 ? -10.554 4.720   0.947   1.00 0.00 ? 130 TYR A O    1  
ATOM 1960  C CB   . TYR A 1 130 ? -10.160 1.510   0.219   1.00 0.00 ? 130 TYR A CB   1  
ATOM 1961  C CG   . TYR A 1 130 ? -10.501 1.084   1.648   1.00 0.00 ? 130 TYR A CG   1  
ATOM 1962  C CD1  . TYR A 1 130 ? -11.820 0.969   2.038   1.00 0.00 ? 130 TYR A CD1  1  
ATOM 1963  C CD2  . TYR A 1 130 ? -9.490  0.815   2.548   1.00 0.00 ? 130 TYR A CD2  1  
ATOM 1964  C CE1  . TYR A 1 130 ? -12.142 0.568   3.383   1.00 0.00 ? 130 TYR A CE1  1  
ATOM 1965  C CE2  . TYR A 1 130 ? -9.811  0.414   3.893   1.00 0.00 ? 130 TYR A CE2  1  
ATOM 1966  C CZ   . TYR A 1 130 ? -11.121 0.310   4.244   1.00 0.00 ? 130 TYR A CZ   1  
ATOM 1967  O OH   . TYR A 1 130 ? -11.425 -0.069  5.515   1.00 0.00 ? 130 TYR A OH   1  
ATOM 1968  H H    . TYR A 1 130 ? -10.739 1.655   -2.071  1.00 0.00 ? 130 TYR A H    1  
ATOM 1969  H HA   . TYR A 1 130 ? -11.971 2.770   0.149   1.00 0.00 ? 130 TYR A HA   1  
ATOM 1970  H HB2  . TYR A 1 130 ? -10.320 0.664   -0.449  1.00 0.00 ? 130 TYR A HB2  1  
ATOM 1971  H HB3  . TYR A 1 130 ? -9.100  1.759   0.169   1.00 0.00 ? 130 TYR A HB3  1  
ATOM 1972  H HD1  . TYR A 1 130 ? -12.619 1.182   1.327   1.00 0.00 ? 130 TYR A HD1  1  
ATOM 1973  H HD2  . TYR A 1 130 ? -8.448  0.906   2.241   1.00 0.00 ? 130 TYR A HD2  1  
ATOM 1974  H HE1  . TYR A 1 130 ? -13.179 0.473   3.703   1.00 0.00 ? 130 TYR A HE1  1  
ATOM 1975  H HE2  . TYR A 1 130 ? -9.023  0.198   4.614   1.00 0.00 ? 130 TYR A HE2  1  
ATOM 1976  H HH   . TYR A 1 130 ? -10.660 0.138   6.125   1.00 0.00 ? 130 TYR A HH   1  
ATOM 1977  N N    . LYS A 1 131 ? -9.184  4.237   -0.786  1.00 0.00 ? 131 LYS A N    1  
ATOM 1978  C CA   . LYS A 1 131 ? -8.367  5.426   -0.616  1.00 0.00 ? 131 LYS A CA   1  
ATOM 1979  C C    . LYS A 1 131 ? -9.253  6.668   -0.725  1.00 0.00 ? 131 LYS A C    1  
ATOM 1980  O O    . LYS A 1 131 ? -9.108  7.609   0.055   1.00 0.00 ? 131 LYS A O    1  
ATOM 1981  C CB   . LYS A 1 131 ? -7.196  5.418   -1.602  1.00 0.00 ? 131 LYS A CB   1  
ATOM 1982  C CG   . LYS A 1 131 ? -6.435  6.745   -1.561  1.00 0.00 ? 131 LYS A CG   1  
ATOM 1983  C CD   . LYS A 1 131 ? -5.795  7.052   -2.916  1.00 0.00 ? 131 LYS A CD   1  
ATOM 1984  C CE   . LYS A 1 131 ? -6.563  8.154   -3.648  1.00 0.00 ? 131 LYS A CE   1  
ATOM 1985  N NZ   . LYS A 1 131 ? -7.390  7.578   -4.732  1.00 0.00 ? 131 LYS A NZ   1  
ATOM 1986  H H    . LYS A 1 131 ? -8.909  3.640   -1.541  1.00 0.00 ? 131 LYS A H    1  
ATOM 1987  H HA   . LYS A 1 131 ? -7.943  5.391   0.387   1.00 0.00 ? 131 LYS A HA   1  
ATOM 1988  H HB2  . LYS A 1 131 ? -6.519  4.598   -1.362  1.00 0.00 ? 131 LYS A HB2  1  
ATOM 1989  H HB3  . LYS A 1 131 ? -7.568  5.238   -2.611  1.00 0.00 ? 131 LYS A HB3  1  
ATOM 1990  H HG2  . LYS A 1 131 ? -7.116  7.550   -1.285  1.00 0.00 ? 131 LYS A HG2  1  
ATOM 1991  H HG3  . LYS A 1 131 ? -5.664  6.702   -0.792  1.00 0.00 ? 131 LYS A HG3  1  
ATOM 1992  H HD2  . LYS A 1 131 ? -4.760  7.359   -2.772  1.00 0.00 ? 131 LYS A HD2  1  
ATOM 1993  H HD3  . LYS A 1 131 ? -5.778  6.149   -3.527  1.00 0.00 ? 131 LYS A HD3  1  
ATOM 1994  H HE2  . LYS A 1 131 ? -7.199  8.692   -2.944  1.00 0.00 ? 131 LYS A HE2  1  
ATOM 1995  H HE3  . LYS A 1 131 ? -5.863  8.880   -4.063  1.00 0.00 ? 131 LYS A HE3  1  
ATOM 1996  H HZ1  . LYS A 1 131 ? -7.856  6.760   -4.396  1.00 0.00 ? 131 LYS A HZ1  1  
ATOM 1997  H HZ2  . LYS A 1 131 ? -8.069  8.251   -5.027  1.00 0.00 ? 131 LYS A HZ2  1  
ATOM 1998  H HZ3  . LYS A 1 131 ? -6.804  7.335   -5.505  1.00 0.00 ? 131 LYS A HZ3  1  
ATOM 1999  N N    . ARG A 1 132 ? -10.152 6.632   -1.697  1.00 0.00 ? 132 ARG A N    1  
ATOM 2000  C CA   . ARG A 1 132 ? -11.062 7.743   -1.918  1.00 0.00 ? 132 ARG A CA   1  
ATOM 2001  C C    . ARG A 1 132 ? -12.046 7.862   -0.752  1.00 0.00 ? 132 ARG A C    1  
ATOM 2002  O O    . ARG A 1 132 ? -12.418 8.967   -0.359  1.00 0.00 ? 132 ARG A O    1  
ATOM 2003  C CB   . ARG A 1 132 ? -11.844 7.565   -3.221  1.00 0.00 ? 132 ARG A CB   1  
ATOM 2004  C CG   . ARG A 1 132 ? -12.270 8.918   -3.794  1.00 0.00 ? 132 ARG A CG   1  
ATOM 2005  C CD   . ARG A 1 132 ? -13.243 8.737   -4.961  1.00 0.00 ? 132 ARG A CD   1  
ATOM 2006  N NE   . ARG A 1 132 ? -13.866 10.034  -5.305  1.00 0.00 ? 132 ARG A NE   1  
ATOM 2007  C CZ   . ARG A 1 132 ? -13.294 10.957  -6.090  1.00 0.00 ? 132 ARG A CZ   1  
ATOM 2008  N NH1  . ARG A 1 132 ? -12.083 10.732  -6.616  1.00 0.00 ? 132 ARG A NH1  1  
ATOM 2009  N NH2  . ARG A 1 132 ? -13.934 12.106  -6.349  1.00 0.00 ? 132 ARG A NH2  1  
ATOM 2010  H H    . ARG A 1 132 ? -10.264 5.863   -2.327  1.00 0.00 ? 132 ARG A H    1  
ATOM 2011  H HA   . ARG A 1 132 ? -10.419 8.621   -1.980  1.00 0.00 ? 132 ARG A HA   1  
ATOM 2012  H HB2  . ARG A 1 132 ? -11.229 7.034   -3.948  1.00 0.00 ? 132 ARG A HB2  1  
ATOM 2013  H HB3  . ARG A 1 132 ? -12.725 6.949   -3.039  1.00 0.00 ? 132 ARG A HB3  1  
ATOM 2014  H HG2  . ARG A 1 132 ? -12.739 9.516   -3.013  1.00 0.00 ? 132 ARG A HG2  1  
ATOM 2015  H HG3  . ARG A 1 132 ? -11.390 9.467   -4.131  1.00 0.00 ? 132 ARG A HG3  1  
ATOM 2016  H HD2  . ARG A 1 132 ? -12.716 8.336   -5.826  1.00 0.00 ? 132 ARG A HD2  1  
ATOM 2017  H HD3  . ARG A 1 132 ? -14.013 8.013   -4.694  1.00 0.00 ? 132 ARG A HD3  1  
ATOM 2018  H HE   . ARG A 1 132 ? -14.771 10.234  -4.929  1.00 0.00 ? 132 ARG A HE   1  
ATOM 2019  H HH11 . ARG A 1 132 ? -11.605 9.875   -6.423  1.00 0.00 ? 132 ARG A HH11 1  
ATOM 2020  H HH12 . ARG A 1 132 ? -11.656 11.421  -7.202  1.00 0.00 ? 132 ARG A HH12 1  
ATOM 2021  H HH21 . ARG A 1 132 ? -14.838 12.274  -5.956  1.00 0.00 ? 132 ARG A HH21 1  
ATOM 2022  H HH22 . ARG A 1 132 ? -13.507 12.795  -6.935  1.00 0.00 ? 132 ARG A HH22 1  
ATOM 2023  N N    . TRP A 1 133 ? -12.441 6.709   -0.232  1.00 0.00 ? 133 TRP A N    1  
ATOM 2024  C CA   . TRP A 1 133 ? -13.375 6.670   0.880   1.00 0.00 ? 133 TRP A CA   1  
ATOM 2025  C C    . TRP A 1 133 ? -12.698 7.319   2.089   1.00 0.00 ? 133 TRP A C    1  
ATOM 2026  O O    . TRP A 1 133 ? -13.139 8.364   2.565   1.00 0.00 ? 133 TRP A O    1  
ATOM 2027  C CB   . TRP A 1 133 ? -13.842 5.239   1.154   1.00 0.00 ? 133 TRP A CB   1  
ATOM 2028  C CG   . TRP A 1 133 ? -14.658 4.622   0.016   1.00 0.00 ? 133 TRP A CG   1  
ATOM 2029  C CD1  . TRP A 1 133 ? -14.928 5.150   -1.186  1.00 0.00 ? 133 TRP A CD1  1  
ATOM 2030  C CD2  . TRP A 1 133 ? -15.303 3.331   0.023   1.00 0.00 ? 133 TRP A CD2  1  
ATOM 2031  N NE1  . TRP A 1 133 ? -15.697 4.297   -1.951  1.00 0.00 ? 133 TRP A NE1  1  
ATOM 2032  C CE2  . TRP A 1 133 ? -15.932 3.156   -1.193  1.00 0.00 ? 133 TRP A CE2  1  
ATOM 2033  C CE3  . TRP A 1 133 ? -15.353 2.344   1.023   1.00 0.00 ? 133 TRP A CE3  1  
ATOM 2034  C CZ2  . TRP A 1 133 ? -16.657 2.004   -1.522  1.00 0.00 ? 133 TRP A CZ2  1  
ATOM 2035  C CZ3  . TRP A 1 133 ? -16.081 1.199   0.678   1.00 0.00 ? 133 TRP A CZ3  1  
ATOM 2036  C CH2  . TRP A 1 133 ? -16.721 1.007   -0.541  1.00 0.00 ? 133 TRP A CH2  1  
ATOM 2037  H H    . TRP A 1 133 ? -12.133 5.815   -0.558  1.00 0.00 ? 133 TRP A H    1  
ATOM 2038  H HA   . TRP A 1 133 ? -14.257 7.243   0.594   1.00 0.00 ? 133 TRP A HA   1  
ATOM 2039  H HB2  . TRP A 1 133 ? -12.970 4.613   1.343   1.00 0.00 ? 133 TRP A HB2  1  
ATOM 2040  H HB3  . TRP A 1 133 ? -14.442 5.232   2.064   1.00 0.00 ? 133 TRP A HB3  1  
ATOM 2041  H HD1  . TRP A 1 133 ? -14.584 6.130   -1.517  1.00 0.00 ? 133 TRP A HD1  1  
ATOM 2042  H HE1  . TRP A 1 133 ? -16.054 4.484   -2.964  1.00 0.00 ? 133 TRP A HE1  1  
ATOM 2043  H HE3  . TRP A 1 133 ? -14.865 2.459   1.990   1.00 0.00 ? 133 TRP A HE3  1  
ATOM 2044  H HZ2  . TRP A 1 133 ? -17.145 1.890   -2.490  1.00 0.00 ? 133 TRP A HZ2  1  
ATOM 2045  H HZ3  . TRP A 1 133 ? -16.152 0.402   1.418   1.00 0.00 ? 133 TRP A HZ3  1  
ATOM 2046  H HH2  . TRP A 1 133 ? -17.269 0.085   -0.733  1.00 0.00 ? 133 TRP A HH2  1  
ATOM 2047  N N    . ILE A 1 134 ? -11.637 6.674   2.550   1.00 0.00 ? 134 ILE A N    1  
ATOM 2048  C CA   . ILE A 1 134 ? -10.895 7.175   3.694   1.00 0.00 ? 134 ILE A CA   1  
ATOM 2049  C C    . ILE A 1 134 ? -10.692 8.684   3.544   1.00 0.00 ? 134 ILE A C    1  
ATOM 2050  O O    . ILE A 1 134 ? -10.955 9.446   4.473   1.00 0.00 ? 134 ILE A O    1  
ATOM 2051  C CB   . ILE A 1 134 ? -9.591  6.395   3.872   1.00 0.00 ? 134 ILE A CB   1  
ATOM 2052  C CG1  . ILE A 1 134 ? -9.857  5.010   4.465   1.00 0.00 ? 134 ILE A CG1  1  
ATOM 2053  C CG2  . ILE A 1 134 ? -8.584  7.191   4.704   1.00 0.00 ? 134 ILE A CG2  1  
ATOM 2054  C CD1  . ILE A 1 134 ? -8.608  4.131   4.389   1.00 0.00 ? 134 ILE A CD1  1  
ATOM 2055  H H    . ILE A 1 134 ? -11.284 5.824   2.158   1.00 0.00 ? 134 ILE A H    1  
ATOM 2056  H HA   . ILE A 1 134 ? -11.501 6.995   4.582   1.00 0.00 ? 134 ILE A HA   1  
ATOM 2057  H HB   . ILE A 1 134 ? -9.147  6.243   2.888   1.00 0.00 ? 134 ILE A HB   1  
ATOM 2058  H HG12 . ILE A 1 134 ? -10.173 5.110   5.504   1.00 0.00 ? 134 ILE A HG12 1  
ATOM 2059  H HG13 . ILE A 1 134 ? -10.676 4.531   3.928   1.00 0.00 ? 134 ILE A HG13 1  
ATOM 2060  H HG21 . ILE A 1 134 ? -8.517  8.208   4.318   1.00 0.00 ? 134 ILE A HG21 1  
ATOM 2061  H HG22 . ILE A 1 134 ? -8.912  7.218   5.743   1.00 0.00 ? 134 ILE A HG22 1  
ATOM 2062  H HG23 . ILE A 1 134 ? -7.605  6.714   4.644   1.00 0.00 ? 134 ILE A HG23 1  
ATOM 2063  H HD11 . ILE A 1 134 ? -7.727  4.731   4.620   1.00 0.00 ? 134 ILE A HD11 1  
ATOM 2064  H HD12 . ILE A 1 134 ? -8.691  3.317   5.110   1.00 0.00 ? 134 ILE A HD12 1  
ATOM 2065  H HD13 . ILE A 1 134 ? -8.514  3.719   3.385   1.00 0.00 ? 134 ILE A HD13 1  
ATOM 2066  N N    . ILE A 1 135 ? -10.226 9.072   2.365   1.00 0.00 ? 135 ILE A N    1  
ATOM 2067  C CA   . ILE A 1 135 ? -9.986  10.476  2.081   1.00 0.00 ? 135 ILE A CA   1  
ATOM 2068  C C    . ILE A 1 135 ? -11.302 11.248  2.192   1.00 0.00 ? 135 ILE A C    1  
ATOM 2069  O O    . ILE A 1 135 ? -11.320 12.390  2.647   1.00 0.00 ? 135 ILE A O    1  
ATOM 2070  C CB   . ILE A 1 135 ? -9.291  10.637  0.727   1.00 0.00 ? 135 ILE A CB   1  
ATOM 2071  C CG1  . ILE A 1 135 ? -7.769  10.643  0.889   1.00 0.00 ? 135 ILE A CG1  1  
ATOM 2072  C CG2  . ILE A 1 135 ? -9.795  11.884  -0.003  1.00 0.00 ? 135 ILE A CG2  1  
ATOM 2073  C CD1  . ILE A 1 135 ? -7.305  9.470   1.755   1.00 0.00 ? 135 ILE A CD1  1  
ATOM 2074  H H    . ILE A 1 135 ? -10.015 8.446   1.614   1.00 0.00 ? 135 ILE A H    1  
ATOM 2075  H HA   . ILE A 1 135 ? -9.300  10.851  2.841   1.00 0.00 ? 135 ILE A HA   1  
ATOM 2076  H HB   . ILE A 1 135 ? -9.546  9.777   0.108   1.00 0.00 ? 135 ILE A HB   1  
ATOM 2077  H HG12 . ILE A 1 135 ? -7.296  10.586  -0.092  1.00 0.00 ? 135 ILE A HG12 1  
ATOM 2078  H HG13 . ILE A 1 135 ? -7.452  11.582  1.342   1.00 0.00 ? 135 ILE A HG13 1  
ATOM 2079  H HG21 . ILE A 1 135 ? -9.815  12.726  0.688   1.00 0.00 ? 135 ILE A HG21 1  
ATOM 2080  H HG22 . ILE A 1 135 ? -9.128  12.112  -0.835  1.00 0.00 ? 135 ILE A HG22 1  
ATOM 2081  H HG23 . ILE A 1 135 ? -10.800 11.701  -0.383  1.00 0.00 ? 135 ILE A HG23 1  
ATOM 2082  H HD11 . ILE A 1 135 ? -8.012  8.646   1.658   1.00 0.00 ? 135 ILE A HD11 1  
ATOM 2083  H HD12 . ILE A 1 135 ? -6.319  9.144   1.426   1.00 0.00 ? 135 ILE A HD12 1  
ATOM 2084  H HD13 . ILE A 1 135 ? -7.255  9.786   2.797   1.00 0.00 ? 135 ILE A HD13 1  
ATOM 2085  N N    . LEU A 1 136 ? -12.373 10.592  1.768   1.00 0.00 ? 136 LEU A N    1  
ATOM 2086  C CA   . LEU A 1 136 ? -13.691 11.203  1.814   1.00 0.00 ? 136 LEU A CA   1  
ATOM 2087  C C    . LEU A 1 136 ? -13.991 11.648  3.246   1.00 0.00 ? 136 LEU A C    1  
ATOM 2088  O O    . LEU A 1 136 ? -14.442 12.771  3.469   1.00 0.00 ? 136 LEU A O    1  
ATOM 2089  C CB   . LEU A 1 136 ? -14.741 10.254  1.232   1.00 0.00 ? 136 LEU A CB   1  
ATOM 2090  C CG   . LEU A 1 136 ? -15.696 10.862  0.202   1.00 0.00 ? 136 LEU A CG   1  
ATOM 2091  C CD1  . LEU A 1 136 ? -16.004 9.864   -0.915  1.00 0.00 ? 136 LEU A CD1  1  
ATOM 2092  C CD2  . LEU A 1 136 ? -16.968 11.382  0.874   1.00 0.00 ? 136 LEU A CD2  1  
ATOM 2093  H H    . LEU A 1 136 ? -12.350 9.663   1.399   1.00 0.00 ? 136 LEU A H    1  
ATOM 2094  H HA   . LEU A 1 136 ? -13.664 12.086  1.175   1.00 0.00 ? 136 LEU A HA   1  
ATOM 2095  H HB2  . LEU A 1 136 ? -14.225 9.414   0.768   1.00 0.00 ? 136 LEU A HB2  1  
ATOM 2096  H HB3  . LEU A 1 136 ? -15.333 9.851   2.053   1.00 0.00 ? 136 LEU A HB3  1  
ATOM 2097  H HG   . LEU A 1 136 ? -15.202 11.718  -0.258  1.00 0.00 ? 136 LEU A HG   1  
ATOM 2098  H HD11 . LEU A 1 136 ? -15.407 8.963   -0.773  1.00 0.00 ? 136 LEU A HD11 1  
ATOM 2099  H HD12 . LEU A 1 136 ? -17.063 9.605   -0.890  1.00 0.00 ? 136 LEU A HD12 1  
ATOM 2100  H HD13 . LEU A 1 136 ? -15.763 10.311  -1.880  1.00 0.00 ? 136 LEU A HD13 1  
ATOM 2101  H HD21 . LEU A 1 136 ? -16.776 11.552  1.933   1.00 0.00 ? 136 LEU A HD21 1  
ATOM 2102  H HD22 . LEU A 1 136 ? -17.271 12.317  0.404   1.00 0.00 ? 136 LEU A HD22 1  
ATOM 2103  H HD23 . LEU A 1 136 ? -17.764 10.645  0.763   1.00 0.00 ? 136 LEU A HD23 1  
ATOM 2104  N N    . GLY A 1 137 ? -13.730 10.746  4.180   1.00 0.00 ? 137 GLY A N    1  
ATOM 2105  C CA   . GLY A 1 137 ? -13.968 11.032  5.585   1.00 0.00 ? 137 GLY A CA   1  
ATOM 2106  C C    . GLY A 1 137 ? -13.065 12.167  6.073   1.00 0.00 ? 137 GLY A C    1  
ATOM 2107  O O    . GLY A 1 137 ? -13.540 13.122  6.687   1.00 0.00 ? 137 GLY A O    1  
ATOM 2108  H H    . GLY A 1 137 ? -13.364 9.835   3.991   1.00 0.00 ? 137 GLY A H    1  
ATOM 2109  H HA2  . GLY A 1 137 ? -15.013 11.304  5.733   1.00 0.00 ? 137 GLY A HA2  1  
ATOM 2110  H HA3  . GLY A 1 137 ? -13.784 10.136  6.178   1.00 0.00 ? 137 GLY A HA3  1  
ATOM 2111  N N    . LEU A 1 138 ? -11.781 12.026  5.782   1.00 0.00 ? 138 LEU A N    1  
ATOM 2112  C CA   . LEU A 1 138 ? -10.808 13.028  6.183   1.00 0.00 ? 138 LEU A CA   1  
ATOM 2113  C C    . LEU A 1 138 ? -11.264 14.402  5.690   1.00 0.00 ? 138 LEU A C    1  
ATOM 2114  O O    . LEU A 1 138 ? -11.183 15.387  6.423   1.00 0.00 ? 138 LEU A O    1  
ATOM 2115  C CB   . LEU A 1 138 ? -9.408  12.637  5.706   1.00 0.00 ? 138 LEU A CB   1  
ATOM 2116  C CG   . LEU A 1 138 ? -8.620  11.705  6.628   1.00 0.00 ? 138 LEU A CG   1  
ATOM 2117  C CD1  . LEU A 1 138 ? -7.541  10.948  5.852   1.00 0.00 ? 138 LEU A CD1  1  
ATOM 2118  C CD2  . LEU A 1 138 ? -8.038  12.473  7.817   1.00 0.00 ? 138 LEU A CD2  1  
ATOM 2119  H H    . LEU A 1 138 ? -11.403 11.247  5.282   1.00 0.00 ? 138 LEU A H    1  
ATOM 2120  H HA   . LEU A 1 138 ? -10.784 13.042  7.273   1.00 0.00 ? 138 LEU A HA   1  
ATOM 2121  H HB2  . LEU A 1 138 ? -9.499  12.159  4.730   1.00 0.00 ? 138 LEU A HB2  1  
ATOM 2122  H HB3  . LEU A 1 138 ? -8.828  13.548  5.561   1.00 0.00 ? 138 LEU A HB3  1  
ATOM 2123  H HG   . LEU A 1 138 ? -9.308  10.962  7.031   1.00 0.00 ? 138 LEU A HG   1  
ATOM 2124  H HD11 . LEU A 1 138 ? -7.672  11.122  4.784   1.00 0.00 ? 138 LEU A HD11 1  
ATOM 2125  H HD12 . LEU A 1 138 ? -6.557  11.301  6.159   1.00 0.00 ? 138 LEU A HD12 1  
ATOM 2126  H HD13 . LEU A 1 138 ? -7.625  9.881   6.059   1.00 0.00 ? 138 LEU A HD13 1  
ATOM 2127  H HD21 . LEU A 1 138 ? -8.056  13.542  7.602   1.00 0.00 ? 138 LEU A HD21 1  
ATOM 2128  H HD22 . LEU A 1 138 ? -8.633  12.271  8.707   1.00 0.00 ? 138 LEU A HD22 1  
ATOM 2129  H HD23 . LEU A 1 138 ? -7.010  12.155  7.987   1.00 0.00 ? 138 LEU A HD23 1  
ATOM 2130  N N    . ASN A 1 139 ? -11.735 14.425  4.452   1.00 0.00 ? 139 ASN A N    1  
ATOM 2131  C CA   . ASN A 1 139 ? -12.204 15.663  3.852   1.00 0.00 ? 139 ASN A CA   1  
ATOM 2132  C C    . ASN A 1 139 ? -13.380 16.205  4.668   1.00 0.00 ? 139 ASN A C    1  
ATOM 2133  O O    . ASN A 1 139 ? -13.426 17.394  4.982   1.00 0.00 ? 139 ASN A O    1  
ATOM 2134  C CB   . ASN A 1 139 ? -12.689 15.432  2.420   1.00 0.00 ? 139 ASN A CB   1  
ATOM 2135  C CG   . ASN A 1 139 ? -12.894 16.760  1.689   1.00 0.00 ? 139 ASN A CG   1  
ATOM 2136  O OD1  . ASN A 1 139 ? -12.172 17.723  1.884   1.00 0.00 ? 139 ASN A OD1  1  
ATOM 2137  N ND2  . ASN A 1 139 ? -13.917 16.758  0.839   1.00 0.00 ? 139 ASN A ND2  1  
ATOM 2138  H H    . ASN A 1 139 ? -11.797 13.620  3.863   1.00 0.00 ? 139 ASN A H    1  
ATOM 2139  H HA   . ASN A 1 139 ? -11.344 16.332  3.865   1.00 0.00 ? 139 ASN A HA   1  
ATOM 2140  H HB2  . ASN A 1 139 ? -11.963 14.824  1.880   1.00 0.00 ? 139 ASN A HB2  1  
ATOM 2141  H HB3  . ASN A 1 139 ? -13.625 14.872  2.435   1.00 0.00 ? 139 ASN A HB3  1  
ATOM 2142  H HD21 . ASN A 1 139 ? -14.471 15.933  0.726   1.00 0.00 ? 139 ASN A HD21 1  
ATOM 2143  H HD22 . ASN A 1 139 ? -14.132 17.581  0.313   1.00 0.00 ? 139 ASN A HD22 1  
ATOM 2144  N N    . LYS A 1 140 ? -14.301 15.308  4.988   1.00 0.00 ? 140 LYS A N    1  
ATOM 2145  C CA   . LYS A 1 140 ? -15.473 15.682  5.760   1.00 0.00 ? 140 LYS A CA   1  
ATOM 2146  C C    . LYS A 1 140 ? -15.032 16.193  7.134   1.00 0.00 ? 140 LYS A C    1  
ATOM 2147  O O    . LYS A 1 140 ? -15.634 17.116  7.680   1.00 0.00 ? 140 LYS A O    1  
ATOM 2148  C CB   . LYS A 1 140 ? -16.465 14.519  5.826   1.00 0.00 ? 140 LYS A CB   1  
ATOM 2149  C CG   . LYS A 1 140 ? -17.759 14.859  5.083   1.00 0.00 ? 140 LYS A CG   1  
ATOM 2150  C CD   . LYS A 1 140 ? -18.763 13.709  5.178   1.00 0.00 ? 140 LYS A CD   1  
ATOM 2151  C CE   . LYS A 1 140 ? -20.189 14.239  5.343   1.00 0.00 ? 140 LYS A CE   1  
ATOM 2152  N NZ   . LYS A 1 140 ? -20.647 14.071  6.740   1.00 0.00 ? 140 LYS A NZ   1  
ATOM 2153  H H    . LYS A 1 140 ? -14.256 14.344  4.728   1.00 0.00 ? 140 LYS A H    1  
ATOM 2154  H HA   . LYS A 1 140 ? -15.967 16.497  5.231   1.00 0.00 ? 140 LYS A HA   1  
ATOM 2155  H HB2  . LYS A 1 140 ? -16.015 13.627  5.391   1.00 0.00 ? 140 LYS A HB2  1  
ATOM 2156  H HB3  . LYS A 1 140 ? -16.689 14.287  6.867   1.00 0.00 ? 140 LYS A HB3  1  
ATOM 2157  H HG2  . LYS A 1 140 ? -18.196 15.765  5.503   1.00 0.00 ? 140 LYS A HG2  1  
ATOM 2158  H HG3  . LYS A 1 140 ? -17.537 15.068  4.037   1.00 0.00 ? 140 LYS A HG3  1  
ATOM 2159  H HD2  . LYS A 1 140 ? -18.702 13.093  4.281   1.00 0.00 ? 140 LYS A HD2  1  
ATOM 2160  H HD3  . LYS A 1 140 ? -18.510 13.069  6.023   1.00 0.00 ? 140 LYS A HD3  1  
ATOM 2161  H HE2  . LYS A 1 140 ? -20.226 15.293  5.066   1.00 0.00 ? 140 LYS A HE2  1  
ATOM 2162  H HE3  . LYS A 1 140 ? -20.861 13.709  4.668   1.00 0.00 ? 140 LYS A HE3  1  
ATOM 2163  H HZ1  . LYS A 1 140 ? -19.972 14.469  7.362   1.00 0.00 ? 140 LYS A HZ1  1  
ATOM 2164  H HZ2  . LYS A 1 140 ? -21.525 14.533  6.862   1.00 0.00 ? 140 LYS A HZ2  1  
ATOM 2165  H HZ3  . LYS A 1 140 ? -20.752 13.097  6.942   1.00 0.00 ? 140 LYS A HZ3  1  
ATOM 2166  N N    . ILE A 1 141 ? -13.984 15.570  7.652   1.00 0.00 ? 141 ILE A N    1  
ATOM 2167  C CA   . ILE A 1 141 ? -13.455 15.950  8.951   1.00 0.00 ? 141 ILE A CA   1  
ATOM 2168  C C    . ILE A 1 141 ? -12.878 17.364  8.869   1.00 0.00 ? 141 ILE A C    1  
ATOM 2169  O O    . ILE A 1 141 ? -13.176 18.210  9.711   1.00 0.00 ? 141 ILE A O    1  
ATOM 2170  C CB   . ILE A 1 141 ? -12.453 14.905  9.448   1.00 0.00 ? 141 ILE A CB   1  
ATOM 2171  C CG1  . ILE A 1 141 ? -13.135 13.554  9.673   1.00 0.00 ? 141 ILE A CG1  1  
ATOM 2172  C CG2  . ILE A 1 141 ? -11.726 15.396  10.701  1.00 0.00 ? 141 ILE A CG2  1  
ATOM 2173  C CD1  . ILE A 1 141 ? -12.162 12.400  9.423   1.00 0.00 ? 141 ILE A CD1  1  
ATOM 2174  H H    . ILE A 1 141 ? -13.499 14.820  7.201   1.00 0.00 ? 141 ILE A H    1  
ATOM 2175  H HA   . ILE A 1 141 ? -14.288 15.957  9.654   1.00 0.00 ? 141 ILE A HA   1  
ATOM 2176  H HB   . ILE A 1 141 ? -11.699 14.760  8.674   1.00 0.00 ? 141 ILE A HB   1  
ATOM 2177  H HG12 . ILE A 1 141 ? -13.515 13.500  10.693  1.00 0.00 ? 141 ILE A HG12 1  
ATOM 2178  H HG13 . ILE A 1 141 ? -13.994 13.461  9.008   1.00 0.00 ? 141 ILE A HG13 1  
ATOM 2179  H HG21 . ILE A 1 141 ? -12.457 15.683  11.457  1.00 0.00 ? 141 ILE A HG21 1  
ATOM 2180  H HG22 . ILE A 1 141 ? -11.095 14.597  11.091  1.00 0.00 ? 141 ILE A HG22 1  
ATOM 2181  H HG23 . ILE A 1 141 ? -11.107 16.257  10.449  1.00 0.00 ? 141 ILE A HG23 1  
ATOM 2182  H HD11 . ILE A 1 141 ? -11.139 12.755  9.545   1.00 0.00 ? 141 ILE A HD11 1  
ATOM 2183  H HD12 . ILE A 1 141 ? -12.357 11.600  10.137  1.00 0.00 ? 141 ILE A HD12 1  
ATOM 2184  H HD13 . ILE A 1 141 ? -12.297 12.024  8.409   1.00 0.00 ? 141 ILE A HD13 1  
ATOM 2185  N N    . VAL A 1 142 ? -12.063 17.578  7.846   1.00 0.00 ? 142 VAL A N    1  
ATOM 2186  C CA   . VAL A 1 142 ? -11.442 18.876  7.643   1.00 0.00 ? 142 VAL A CA   1  
ATOM 2187  C C    . VAL A 1 142 ? -12.527 19.917  7.360   1.00 0.00 ? 142 VAL A C    1  
ATOM 2188  O O    . VAL A 1 142 ? -12.396 21.076  7.750   1.00 0.00 ? 142 VAL A O    1  
ATOM 2189  C CB   . VAL A 1 142 ? -10.396 18.787  6.530   1.00 0.00 ? 142 VAL A CB   1  
ATOM 2190  C CG1  . VAL A 1 142 ? -10.028 20.178  6.010   1.00 0.00 ? 142 VAL A CG1  1  
ATOM 2191  C CG2  . VAL A 1 142 ? -9.152  18.033  7.006   1.00 0.00 ? 142 VAL A CG2  1  
ATOM 2192  H H    . VAL A 1 142 ? -11.826 16.885  7.166   1.00 0.00 ? 142 VAL A H    1  
ATOM 2193  H HA   . VAL A 1 142 ? -10.930 19.144  8.567   1.00 0.00 ? 142 VAL A HA   1  
ATOM 2194  H HB   . VAL A 1 142 ? -10.832 18.225  5.704   1.00 0.00 ? 142 VAL A HB   1  
ATOM 2195  H HG11 . VAL A 1 142 ? -10.481 20.936  6.649   1.00 0.00 ? 142 VAL A HG11 1  
ATOM 2196  H HG12 . VAL A 1 142 ? -8.944  20.295  6.020   1.00 0.00 ? 142 VAL A HG12 1  
ATOM 2197  H HG13 . VAL A 1 142 ? -10.397 20.294  4.991   1.00 0.00 ? 142 VAL A HG13 1  
ATOM 2198  H HG21 . VAL A 1 142 ? -8.953  18.283  8.048   1.00 0.00 ? 142 VAL A HG21 1  
ATOM 2199  H HG22 . VAL A 1 142 ? -9.321  16.960  6.915   1.00 0.00 ? 142 VAL A HG22 1  
ATOM 2200  H HG23 . VAL A 1 142 ? -8.297  18.319  6.393   1.00 0.00 ? 142 VAL A HG23 1  
ATOM 2201  N N    . ARG A 1 143 ? -13.574 19.466  6.686   1.00 0.00 ? 143 ARG A N    1  
ATOM 2202  C CA   . ARG A 1 143 ? -14.681 20.344  6.347   1.00 0.00 ? 143 ARG A CA   1  
ATOM 2203  C C    . ARG A 1 143 ? -15.407 20.797  7.616   1.00 0.00 ? 143 ARG A C    1  
ATOM 2204  O O    . ARG A 1 143 ? -15.673 21.985  7.792   1.00 0.00 ? 143 ARG A O    1  
ATOM 2205  C CB   . ARG A 1 143 ? -15.678 19.642  5.422   1.00 0.00 ? 143 ARG A CB   1  
ATOM 2206  C CG   . ARG A 1 143 ? -15.924 20.466  4.156   1.00 0.00 ? 143 ARG A CG   1  
ATOM 2207  C CD   . ARG A 1 143 ? -16.761 19.681  3.145   1.00 0.00 ? 143 ARG A CD   1  
ATOM 2208  N NE   . ARG A 1 143 ? -18.186 20.064  3.261   1.00 0.00 ? 143 ARG A NE   1  
ATOM 2209  C CZ   . ARG A 1 143 ? -19.047 19.501  4.120   1.00 0.00 ? 143 ARG A CZ   1  
ATOM 2210  N NH1  . ARG A 1 143 ? -18.633 18.528  4.943   1.00 0.00 ? 143 ARG A NH1  1  
ATOM 2211  N NH2  . ARG A 1 143 ? -20.322 19.913  4.157   1.00 0.00 ? 143 ARG A NH2  1  
ATOM 2212  H H    . ARG A 1 143 ? -13.673 18.521  6.373   1.00 0.00 ? 143 ARG A H    1  
ATOM 2213  H HA   . ARG A 1 143 ? -14.221 21.189  5.836   1.00 0.00 ? 143 ARG A HA   1  
ATOM 2214  H HB2  . ARG A 1 143 ? -15.296 18.658  5.151   1.00 0.00 ? 143 ARG A HB2  1  
ATOM 2215  H HB3  . ARG A 1 143 ? -16.620 19.486  5.947   1.00 0.00 ? 143 ARG A HB3  1  
ATOM 2216  H HG2  . ARG A 1 143 ? -16.435 21.393  4.415   1.00 0.00 ? 143 ARG A HG2  1  
ATOM 2217  H HG3  . ARG A 1 143 ? -14.970 20.743  3.707   1.00 0.00 ? 143 ARG A HG3  1  
ATOM 2218  H HD2  . ARG A 1 143 ? -16.405 19.878  2.134   1.00 0.00 ? 143 ARG A HD2  1  
ATOM 2219  H HD3  . ARG A 1 143 ? -16.648 18.611  3.320   1.00 0.00 ? 143 ARG A HD3  1  
ATOM 2220  H HE   . ARG A 1 143 ? -18.527 20.788  2.662   1.00 0.00 ? 143 ARG A HE   1  
ATOM 2221  H HH11 . ARG A 1 143 ? -17.682 18.221  4.915   1.00 0.00 ? 143 ARG A HH11 1  
ATOM 2222  H HH12 . ARG A 1 143 ? -19.276 18.108  5.584   1.00 0.00 ? 143 ARG A HH12 1  
ATOM 2223  H HH21 . ARG A 1 143 ? -20.631 20.639  3.543   1.00 0.00 ? 143 ARG A HH21 1  
ATOM 2224  H HH22 . ARG A 1 143 ? -20.965 19.493  4.797   1.00 0.00 ? 143 ARG A HH22 1  
ATOM 2225  N N    . MET A 1 144 ? -15.706 19.827  8.467   1.00 0.00 ? 144 MET A N    1  
ATOM 2226  C CA   . MET A 1 144 ? -16.395 20.111  9.714   1.00 0.00 ? 144 MET A CA   1  
ATOM 2227  C C    . MET A 1 144 ? -15.599 21.101  10.567  1.00 0.00 ? 144 MET A C    1  
ATOM 2228  O O    . MET A 1 144 ? -16.160 22.056  11.101  1.00 0.00 ? 144 MET A O    1  
ATOM 2229  C CB   . MET A 1 144 ? -16.596 18.810  10.495  1.00 0.00 ? 144 MET A CB   1  
ATOM 2230  C CG   . MET A 1 144 ? -17.645 18.987  11.594  1.00 0.00 ? 144 MET A CG   1  
ATOM 2231  S SD   . MET A 1 144 ? -16.847 19.389  13.140  1.00 0.00 ? 144 MET A SD   1  
ATOM 2232  C CE   . MET A 1 144 ? -16.029 17.839  13.479  1.00 0.00 ? 144 MET A CE   1  
ATOM 2233  H H    . MET A 1 144 ? -15.486 18.863  8.316   1.00 0.00 ? 144 MET A H    1  
ATOM 2234  H HA   . MET A 1 144 ? -17.349 20.553  9.427   1.00 0.00 ? 144 MET A HA   1  
ATOM 2235  H HB2  . MET A 1 144 ? -16.908 18.018  9.814   1.00 0.00 ? 144 MET A HB2  1  
ATOM 2236  H HB3  . MET A 1 144 ? -15.650 18.497  10.936  1.00 0.00 ? 144 MET A HB3  1  
ATOM 2237  H HG2  . MET A 1 144 ? -18.342 19.778  11.319  1.00 0.00 ? 144 MET A HG2  1  
ATOM 2238  H HG3  . MET A 1 144 ? -18.227 18.073  11.704  1.00 0.00 ? 144 MET A HG3  1  
ATOM 2239  H HE1  . MET A 1 144 ? -16.539 17.036  12.946  1.00 0.00 ? 144 MET A HE1  1  
ATOM 2240  H HE2  . MET A 1 144 ? -14.993 17.895  13.147  1.00 0.00 ? 144 MET A HE2  1  
ATOM 2241  H HE3  . MET A 1 144 ? -16.058 17.640  14.550  1.00 0.00 ? 144 MET A HE3  1  
ATOM 2242  N N    . TYR A 1 145 ? -14.304 20.838  10.668  1.00 0.00 ? 145 TYR A N    1  
ATOM 2243  C CA   . TYR A 1 145 ? -13.426 21.694  11.447  1.00 0.00 ? 145 TYR A CA   1  
ATOM 2244  C C    . TYR A 1 145 ? -13.570 23.157  11.025  1.00 0.00 ? 145 TYR A C    1  
ATOM 2245  O O    . TYR A 1 145 ? -13.748 24.035  11.868  1.00 0.00 ? 145 TYR A O    1  
ATOM 2246  C CB   . TYR A 1 145 ? -12.002 21.225  11.142  1.00 0.00 ? 145 TYR A CB   1  
ATOM 2247  C CG   . TYR A 1 145 ? -11.413 20.292  12.202  1.00 0.00 ? 145 TYR A CG   1  
ATOM 2248  C CD1  . TYR A 1 145 ? -12.049 19.107  12.509  1.00 0.00 ? 145 TYR A CD1  1  
ATOM 2249  C CD2  . TYR A 1 145 ? -10.245 20.637  12.852  1.00 0.00 ? 145 TYR A CD2  1  
ATOM 2250  C CE1  . TYR A 1 145 ? -11.495 18.229  13.506  1.00 0.00 ? 145 TYR A CE1  1  
ATOM 2251  C CE2  . TYR A 1 145 ? -9.691  19.759  13.850  1.00 0.00 ? 145 TYR A CE2  1  
ATOM 2252  C CZ   . TYR A 1 145 ? -10.343 18.598  14.128  1.00 0.00 ? 145 TYR A CZ   1  
ATOM 2253  O OH   . TYR A 1 145 ? -9.819  17.769  15.070  1.00 0.00 ? 145 TYR A OH   1  
ATOM 2254  H H    . TYR A 1 145 ? -13.856 20.058  10.231  1.00 0.00 ? 145 TYR A H    1  
ATOM 2255  H HA   . TYR A 1 145 ? -13.705 21.597  12.496  1.00 0.00 ? 145 TYR A HA   1  
ATOM 2256  H HB2  . TYR A 1 145 ? -11.997 20.713  10.180  1.00 0.00 ? 145 TYR A HB2  1  
ATOM 2257  H HB3  . TYR A 1 145 ? -11.356 22.098  11.042  1.00 0.00 ? 145 TYR A HB3  1  
ATOM 2258  H HD1  . TYR A 1 145 ? -12.972 18.835  11.995  1.00 0.00 ? 145 TYR A HD1  1  
ATOM 2259  H HD2  . TYR A 1 145 ? -9.742  21.573  12.610  1.00 0.00 ? 145 TYR A HD2  1  
ATOM 2260  H HE1  . TYR A 1 145 ? -11.988 17.290  13.758  1.00 0.00 ? 145 TYR A HE1  1  
ATOM 2261  H HE2  . TYR A 1 145 ? -8.769  20.018  14.371  1.00 0.00 ? 145 TYR A HE2  1  
ATOM 2262  H HH   . TYR A 1 145 ? -9.726  16.845  14.699  1.00 0.00 ? 145 TYR A HH   1  
ATOM 2263  N N    . SER A 1 146 ? -13.488 23.374  9.721   1.00 0.00 ? 146 SER A N    1  
ATOM 2264  C CA   . SER A 1 146 ? -13.607 24.716  9.176   1.00 0.00 ? 146 SER A CA   1  
ATOM 2265  C C    . SER A 1 146 ? -15.082 25.114  9.082   1.00 0.00 ? 146 SER A C    1  
ATOM 2266  O O    . SER A 1 146 ? -15.928 24.294  8.728   1.00 0.00 ? 146 SER A O    1  
ATOM 2267  C CB   . SER A 1 146 ? -12.942 24.814  7.802   1.00 0.00 ? 146 SER A CB   1  
ATOM 2268  O OG   . SER A 1 146 ? -12.986 26.140  7.281   1.00 0.00 ? 146 SER A OG   1  
ATOM 2269  H H    . SER A 1 146 ? -13.343 22.654  9.042   1.00 0.00 ? 146 SER A H    1  
ATOM 2270  H HA   . SER A 1 146 ? -13.081 25.361  9.880   1.00 0.00 ? 146 SER A HA   1  
ATOM 2271  H HB2  . SER A 1 146 ? -11.905 24.488  7.877   1.00 0.00 ? 146 SER A HB2  1  
ATOM 2272  H HB3  . SER A 1 146 ? -13.440 24.136  7.109   1.00 0.00 ? 146 SER A HB3  1  
ATOM 2273  H HG   . SER A 1 146 ? -13.901 26.524  7.401   1.00 0.00 ? 146 SER A HG   1  
ATOM 2274  N N    . PRO A 1 147 ? -15.351 26.405  9.414   1.00 0.00 ? 147 PRO A N    1  
ATOM 2275  C CA   . PRO A 1 147 ? -16.709 26.921  9.370   1.00 0.00 ? 147 PRO A CA   1  
ATOM 2276  C C    . PRO A 1 147 ? -17.158 27.162  7.928   1.00 0.00 ? 147 PRO A C    1  
ATOM 2277  O O    . PRO A 1 147 ? -17.289 28.306  7.498   1.00 0.00 ? 147 PRO A O    1  
ATOM 2278  C CB   . PRO A 1 147 ? -16.673 28.193  10.201  1.00 0.00 ? 147 PRO A CB   1  
ATOM 2279  C CG   . PRO A 1 147 ? -15.209 28.590  10.293  1.00 0.00 ? 147 PRO A CG   1  
ATOM 2280  C CD   . PRO A 1 147 ? -14.375 27.403  9.838   1.00 0.00 ? 147 PRO A CD   1  
ATOM 2281  H HA   . PRO A 1 147 ? -17.348 26.250  9.747   1.00 0.00 ? 147 PRO A HA   1  
ATOM 2282  H HB2  . PRO A 1 147 ? -17.263 28.981  9.735   1.00 0.00 ? 147 PRO A HB2  1  
ATOM 2283  H HB3  . PRO A 1 147 ? -17.094 28.024  11.193  1.00 0.00 ? 147 PRO A HB3  1  
ATOM 2284  H HG2  . PRO A 1 147 ? -15.009 29.459  9.666   1.00 0.00 ? 147 PRO A HG2  1  
ATOM 2285  H HG3  . PRO A 1 147 ? -14.951 28.868  11.315  1.00 0.00 ? 147 PRO A HG3  1  
ATOM 2286  H HD2  . PRO A 1 147 ? -13.708 27.678  9.020   1.00 0.00 ? 147 PRO A HD2  1  
ATOM 2287  H HD3  . PRO A 1 147 ? -13.748 27.027  10.647  1.00 0.00 ? 147 PRO A HD3  1  
ATOM 2288  N N    . THR A 1 148 ? -17.381 26.064  7.220   1.00 0.00 ? 148 THR A N    1  
ATOM 2289  C CA   . THR A 1 148 ? -17.812 26.141  5.835   1.00 0.00 ? 148 THR A CA   1  
ATOM 2290  C C    . THR A 1 148 ? -17.203 27.369  5.154   1.00 0.00 ? 148 THR A C    1  
ATOM 2291  O O    . THR A 1 148 ? -17.796 28.446  5.164   1.00 0.00 ? 148 THR A O    1  
ATOM 2292  C CB   . THR A 1 148 ? -19.342 26.132  5.815   1.00 0.00 ? 148 THR A CB   1  
ATOM 2293  O OG1  . THR A 1 148 ? -19.672 26.197  4.430   1.00 0.00 ? 148 THR A OG1  1  
ATOM 2294  C CG2  . THR A 1 148 ? -19.943 27.411  6.401   1.00 0.00 ? 148 THR A CG2  1  
ATOM 2295  H H    . THR A 1 148 ? -17.272 25.136  7.577   1.00 0.00 ? 148 THR A H    1  
ATOM 2296  H HA   . THR A 1 148 ? -17.436 25.264  5.308   1.00 0.00 ? 148 THR A HA   1  
ATOM 2297  H HB   . THR A 1 148 ? -19.733 25.250  6.322   1.00 0.00 ? 148 THR A HB   1  
ATOM 2298  H HG1  . THR A 1 148 ? -19.170 25.494  3.925   1.00 0.00 ? 148 THR A HG1  1  
ATOM 2299  H HG21 . THR A 1 148 ? -19.377 27.706  7.285   1.00 0.00 ? 148 THR A HG21 1  
ATOM 2300  H HG22 . THR A 1 148 ? -19.899 28.207  5.658   1.00 0.00 ? 148 THR A HG22 1  
ATOM 2301  H HG23 . THR A 1 148 ? -20.981 27.230  6.679   1.00 0.00 ? 148 THR A HG23 1  
ATOM 2302  N N    . SER A 1 149 ? -16.027 27.164  4.580   1.00 0.00 ? 149 SER A N    1  
ATOM 2303  C CA   . SER A 1 149 ? -15.331 28.241  3.896   1.00 0.00 ? 149 SER A CA   1  
ATOM 2304  C C    . SER A 1 149 ? -15.337 27.992  2.386   1.00 0.00 ? 149 SER A C    1  
ATOM 2305  O O    . SER A 1 149 ? -14.332 27.565  1.820   1.00 0.00 ? 149 SER A O    1  
ATOM 2306  C CB   . SER A 1 149 ? -13.895 28.380  4.405   1.00 0.00 ? 149 SER A CB   1  
ATOM 2307  O OG   . SER A 1 149 ? -13.815 29.219  5.554   1.00 0.00 ? 149 SER A OG   1  
ATOM 2308  H H    . SER A 1 149 ? -15.551 26.285  4.576   1.00 0.00 ? 149 SER A H    1  
ATOM 2309  H HA   . SER A 1 149 ? -15.890 29.145  4.137   1.00 0.00 ? 149 SER A HA   1  
ATOM 2310  H HB2  . SER A 1 149 ? -13.500 27.393  4.649   1.00 0.00 ? 149 SER A HB2  1  
ATOM 2311  H HB3  . SER A 1 149 ? -13.267 28.788  3.613   1.00 0.00 ? 149 SER A HB3  1  
ATOM 2312  H HG   . SER A 1 149 ? -13.028 28.959  6.113   1.00 0.00 ? 149 SER A HG   1  
ATOM 2313  N N    . ILE A 1 150 ? -16.480 28.270  1.777   1.00 0.00 ? 150 ILE A N    1  
ATOM 2314  C CA   . ILE A 1 150 ? -16.630 28.082  0.344   1.00 0.00 ? 150 ILE A CA   1  
ATOM 2315  C C    . ILE A 1 150 ? -16.580 29.443  -0.353  1.00 0.00 ? 150 ILE A C    1  
ATOM 2316  O O    . ILE A 1 150 ? -16.480 30.478  0.305   1.00 0.00 ? 150 ILE A O    1  
ATOM 2317  C CB   . ILE A 1 150 ? -17.897 27.281  0.039   1.00 0.00 ? 150 ILE A CB   1  
ATOM 2318  C CG1  . ILE A 1 150 ? -19.150 28.063  0.437   1.00 0.00 ? 150 ILE A CG1  1  
ATOM 2319  C CG2  . ILE A 1 150 ? -17.847 25.903  0.702   1.00 0.00 ? 150 ILE A CG2  1  
ATOM 2320  C CD1  . ILE A 1 150 ? -19.827 28.675  -0.791  1.00 0.00 ? 150 ILE A CD1  1  
ATOM 2321  H H    . ILE A 1 150 ? -17.293 28.618  2.245   1.00 0.00 ? 150 ILE A H    1  
ATOM 2322  H HA   . ILE A 1 150 ? -15.782 27.488  0.003   1.00 0.00 ? 150 ILE A HA   1  
ATOM 2323  H HB   . ILE A 1 150 ? -17.947 27.118  -1.038  1.00 0.00 ? 150 ILE A HB   1  
ATOM 2324  H HG12 . ILE A 1 150 ? -19.848 27.402  0.950   1.00 0.00 ? 150 ILE A HG12 1  
ATOM 2325  H HG13 . ILE A 1 150 ? -18.882 28.852  1.140   1.00 0.00 ? 150 ILE A HG13 1  
ATOM 2326  H HG21 . ILE A 1 150 ? -16.847 25.484  0.594   1.00 0.00 ? 150 ILE A HG21 1  
ATOM 2327  H HG22 . ILE A 1 150 ? -18.089 26.000  1.760   1.00 0.00 ? 150 ILE A HG22 1  
ATOM 2328  H HG23 . ILE A 1 150 ? -18.571 25.243  0.223   1.00 0.00 ? 150 ILE A HG23 1  
ATOM 2329  H HD11 . ILE A 1 150 ? -19.066 29.002  -1.501  1.00 0.00 ? 150 ILE A HD11 1  
ATOM 2330  H HD12 . ILE A 1 150 ? -20.467 27.930  -1.263  1.00 0.00 ? 150 ILE A HD12 1  
ATOM 2331  H HD13 . ILE A 1 150 ? -20.429 29.531  -0.485  1.00 0.00 ? 150 ILE A HD13 1  
ATOM 2332  N N    . LEU A 1 151 ? -16.653 29.398  -1.675  1.00 0.00 ? 151 LEU A N    1  
ATOM 2333  C CA   . LEU A 1 151 ? -16.617 30.615  -2.468  1.00 0.00 ? 151 LEU A CA   1  
ATOM 2334  C C    . LEU A 1 151 ? -17.817 31.492  -2.103  1.00 0.00 ? 151 LEU A C    1  
ATOM 2335  O O    . LEU A 1 151 ? -17.985 31.869  -0.944  1.00 0.00 ? 151 LEU A O    1  
ATOM 2336  C CB   . LEU A 1 151 ? -16.531 30.281  -3.958  1.00 0.00 ? 151 LEU A CB   1  
ATOM 2337  C CG   . LEU A 1 151 ? -15.125 30.267  -4.562  1.00 0.00 ? 151 LEU A CG   1  
ATOM 2338  C CD1  . LEU A 1 151 ? -14.518 31.672  -4.569  1.00 0.00 ? 151 LEU A CD1  1  
ATOM 2339  C CD2  . LEU A 1 151 ? -14.228 29.259  -3.842  1.00 0.00 ? 151 LEU A CD2  1  
ATOM 2340  H H    . LEU A 1 151 ? -16.734 28.552  -2.202  1.00 0.00 ? 151 LEU A H    1  
ATOM 2341  H HA   . LEU A 1 151 ? -15.705 31.150  -2.204  1.00 0.00 ? 151 LEU A HA   1  
ATOM 2342  H HB2  . LEU A 1 151 ? -16.982 29.302  -4.118  1.00 0.00 ? 151 LEU A HB2  1  
ATOM 2343  H HB3  . LEU A 1 151 ? -17.134 31.003  -4.508  1.00 0.00 ? 151 LEU A HB3  1  
ATOM 2344  H HG   . LEU A 1 151 ? -15.202 29.945  -5.601  1.00 0.00 ? 151 LEU A HG   1  
ATOM 2345  H HD11 . LEU A 1 151 ? -14.624 32.118  -3.581  1.00 0.00 ? 151 LEU A HD11 1  
ATOM 2346  H HD12 . LEU A 1 151 ? -13.461 31.609  -4.829  1.00 0.00 ? 151 LEU A HD12 1  
ATOM 2347  H HD13 . LEU A 1 151 ? -15.036 32.288  -5.304  1.00 0.00 ? 151 LEU A HD13 1  
ATOM 2348  H HD21 . LEU A 1 151 ? -14.740 28.886  -2.954  1.00 0.00 ? 151 LEU A HD21 1  
ATOM 2349  H HD22 . LEU A 1 151 ? -14.007 28.427  -4.510  1.00 0.00 ? 151 LEU A HD22 1  
ATOM 2350  H HD23 . LEU A 1 151 ? -13.298 29.745  -3.547  1.00 0.00 ? 151 LEU A HD23 1  
ATOM 2351  N N    . PRO A 1 1   ? 1.798   -0.221  0.283   1.00 0.00 ? 1   PRO A N    2  
ATOM 2352  C CA   . PRO A 1 1   ? 1.592   -0.046  -1.144  1.00 0.00 ? 1   PRO A CA   2  
ATOM 2353  C C    . PRO A 1 1   ? 1.648   -1.390  -1.875  1.00 0.00 ? 1   PRO A C    2  
ATOM 2354  O O    . PRO A 1 1   ? 1.864   -2.429  -1.254  1.00 0.00 ? 1   PRO A O    2  
ATOM 2355  C CB   . PRO A 1 1   ? 2.683   0.916   -1.585  1.00 0.00 ? 1   PRO A CB   2  
ATOM 2356  C CG   . PRO A 1 1   ? 3.737   0.881   -0.491  1.00 0.00 ? 1   PRO A CG   2  
ATOM 2357  C CD   . PRO A 1 1   ? 3.126   0.199   0.723   1.00 0.00 ? 1   PRO A CD   2  
ATOM 2358  H HA   . PRO A 1 1   ? 0.679   0.323   -1.321  1.00 0.00 ? 1   PRO A HA   2  
ATOM 2359  H HB2  . PRO A 1 1   ? 3.106   0.614   -2.544  1.00 0.00 ? 1   PRO A HB2  2  
ATOM 2360  H HB3  . PRO A 1 1   ? 2.288   1.923   -1.714  1.00 0.00 ? 1   PRO A HB3  2  
ATOM 2361  H HG2  . PRO A 1 1   ? 4.620   0.339   -0.828  1.00 0.00 ? 1   PRO A HG2  2  
ATOM 2362  H HG3  . PRO A 1 1   ? 4.059   1.891   -0.238  1.00 0.00 ? 1   PRO A HG3  2  
ATOM 2363  H HD2  . PRO A 1 1   ? 3.725   -0.654  1.041   1.00 0.00 ? 1   PRO A HD2  2  
ATOM 2364  H HD3  . PRO A 1 1   ? 3.065   0.880   1.571   1.00 0.00 ? 1   PRO A HD3  2  
ATOM 2365  N N    . ILE A 1 2   ? 1.450   -1.324  -3.184  1.00 0.00 ? 2   ILE A N    2  
ATOM 2366  C CA   . ILE A 1 2   ? 1.476   -2.523  -4.005  1.00 0.00 ? 2   ILE A CA   2  
ATOM 2367  C C    . ILE A 1 2   ? 2.778   -2.558  -4.806  1.00 0.00 ? 2   ILE A C    2  
ATOM 2368  O O    . ILE A 1 2   ? 3.222   -1.533  -5.322  1.00 0.00 ? 2   ILE A O    2  
ATOM 2369  C CB   . ILE A 1 2   ? 0.217   -2.605  -4.871  1.00 0.00 ? 2   ILE A CB   2  
ATOM 2370  C CG1  . ILE A 1 2   ? -1.044  -2.419  -4.025  1.00 0.00 ? 2   ILE A CG1  2  
ATOM 2371  C CG2  . ILE A 1 2   ? 0.186   -3.910  -5.668  1.00 0.00 ? 2   ILE A CG2  2  
ATOM 2372  C CD1  . ILE A 1 2   ? -1.478  -3.741  -3.390  1.00 0.00 ? 2   ILE A CD1  2  
ATOM 2373  H H    . ILE A 1 2   ? 1.275   -0.474  -3.681  1.00 0.00 ? 2   ILE A H    2  
ATOM 2374  H HA   . ILE A 1 2   ? 1.460   -3.380  -3.332  1.00 0.00 ? 2   ILE A HA   2  
ATOM 2375  H HB   . ILE A 1 2   ? 0.245   -1.788  -5.592  1.00 0.00 ? 2   ILE A HB   2  
ATOM 2376  H HG12 . ILE A 1 2   ? -0.858  -1.680  -3.246  1.00 0.00 ? 2   ILE A HG12 2  
ATOM 2377  H HG13 . ILE A 1 2   ? -1.850  -2.029  -4.648  1.00 0.00 ? 2   ILE A HG13 2  
ATOM 2378  H HG21 . ILE A 1 2   ? 0.389   -4.749  -5.001  1.00 0.00 ? 2   ILE A HG21 2  
ATOM 2379  H HG22 . ILE A 1 2   ? -0.799  -4.036  -6.120  1.00 0.00 ? 2   ILE A HG22 2  
ATOM 2380  H HG23 . ILE A 1 2   ? 0.943   -3.877  -6.452  1.00 0.00 ? 2   ILE A HG23 2  
ATOM 2381  H HD11 . ILE A 1 2   ? -0.643  -4.171  -2.838  1.00 0.00 ? 2   ILE A HD11 2  
ATOM 2382  H HD12 . ILE A 1 2   ? -2.309  -3.561  -2.708  1.00 0.00 ? 2   ILE A HD12 2  
ATOM 2383  H HD13 . ILE A 1 2   ? -1.793  -4.433  -4.171  1.00 0.00 ? 2   ILE A HD13 2  
ATOM 2384  N N    . VAL A 1 3   ? 3.354   -3.749  -4.888  1.00 0.00 ? 3   VAL A N    2  
ATOM 2385  C CA   . VAL A 1 3   ? 4.596   -3.932  -5.618  1.00 0.00 ? 3   VAL A CA   2  
ATOM 2386  C C    . VAL A 1 3   ? 4.509   -5.210  -6.453  1.00 0.00 ? 3   VAL A C    2  
ATOM 2387  O O    . VAL A 1 3   ? 3.629   -6.042  -6.232  1.00 0.00 ? 3   VAL A O    2  
ATOM 2388  C CB   . VAL A 1 3   ? 5.779   -3.931  -4.647  1.00 0.00 ? 3   VAL A CB   2  
ATOM 2389  C CG1  . VAL A 1 3   ? 5.750   -2.693  -3.749  1.00 0.00 ? 3   VAL A CG1  2  
ATOM 2390  C CG2  . VAL A 1 3   ? 5.804   -5.213  -3.813  1.00 0.00 ? 3   VAL A CG2  2  
ATOM 2391  H H    . VAL A 1 3   ? 2.986   -4.578  -4.465  1.00 0.00 ? 3   VAL A H    2  
ATOM 2392  H HA   . VAL A 1 3   ? 4.711   -3.081  -6.290  1.00 0.00 ? 3   VAL A HA   2  
ATOM 2393  H HB   . VAL A 1 3   ? 6.696   -3.896  -5.236  1.00 0.00 ? 3   VAL A HB   2  
ATOM 2394  H HG11 . VAL A 1 3   ? 5.497   -1.817  -4.345  1.00 0.00 ? 3   VAL A HG11 2  
ATOM 2395  H HG12 . VAL A 1 3   ? 5.003   -2.829  -2.967  1.00 0.00 ? 3   VAL A HG12 2  
ATOM 2396  H HG13 . VAL A 1 3   ? 6.730   -2.551  -3.293  1.00 0.00 ? 3   VAL A HG13 2  
ATOM 2397  H HG21 . VAL A 1 3   ? 5.736   -6.078  -4.473  1.00 0.00 ? 3   VAL A HG21 2  
ATOM 2398  H HG22 . VAL A 1 3   ? 6.735   -5.261  -3.248  1.00 0.00 ? 3   VAL A HG22 2  
ATOM 2399  H HG23 . VAL A 1 3   ? 4.960   -5.216  -3.124  1.00 0.00 ? 3   VAL A HG23 2  
ATOM 2400  N N    . GLN A 1 4   ? 5.433   -5.329  -7.395  1.00 0.00 ? 4   GLN A N    2  
ATOM 2401  C CA   . GLN A 1 4   ? 5.472   -6.493  -8.264  1.00 0.00 ? 4   GLN A CA   2  
ATOM 2402  C C    . GLN A 1 4   ? 6.464   -7.525  -7.725  1.00 0.00 ? 4   GLN A C    2  
ATOM 2403  O O    . GLN A 1 4   ? 7.631   -7.210  -7.497  1.00 0.00 ? 4   GLN A O    2  
ATOM 2404  C CB   . GLN A 1 4   ? 5.820   -6.094  -9.699  1.00 0.00 ? 4   GLN A CB   2  
ATOM 2405  C CG   . GLN A 1 4   ? 5.509   -7.231  -10.675 1.00 0.00 ? 4   GLN A CG   2  
ATOM 2406  C CD   . GLN A 1 4   ? 6.535   -7.275  -11.810 1.00 0.00 ? 4   GLN A CD   2  
ATOM 2407  O OE1  . GLN A 1 4   ? 7.582   -7.893  -11.711 1.00 0.00 ? 4   GLN A OE1  2  
ATOM 2408  N NE2  . GLN A 1 4   ? 6.176   -6.587  -12.890 1.00 0.00 ? 4   GLN A NE2  2  
ATOM 2409  H H    . GLN A 1 4   ? 6.146   -4.649  -7.568  1.00 0.00 ? 4   GLN A H    2  
ATOM 2410  H HA   . GLN A 1 4   ? 4.462   -6.904  -8.242  1.00 0.00 ? 4   GLN A HA   2  
ATOM 2411  H HB2  . GLN A 1 4   ? 5.257   -5.205  -9.980  1.00 0.00 ? 4   GLN A HB2  2  
ATOM 2412  H HB3  . GLN A 1 4   ? 6.877   -5.835  -9.762  1.00 0.00 ? 4   GLN A HB3  2  
ATOM 2413  H HG2  . GLN A 1 4   ? 5.510   -8.182  -10.143 1.00 0.00 ? 4   GLN A HG2  2  
ATOM 2414  H HG3  . GLN A 1 4   ? 4.510   -7.097  -11.088 1.00 0.00 ? 4   GLN A HG3  2  
ATOM 2415  H HE21 . GLN A 1 4   ? 5.301   -6.102  -12.906 1.00 0.00 ? 4   GLN A HE21 2  
ATOM 2416  H HE22 . GLN A 1 4   ? 6.780   -6.555  -13.686 1.00 0.00 ? 4   GLN A HE22 2  
ATOM 2417  N N    . ASN A 1 5   ? 5.964   -8.737  -7.536  1.00 0.00 ? 5   ASN A N    2  
ATOM 2418  C CA   . ASN A 1 5   ? 6.792   -9.818  -7.028  1.00 0.00 ? 5   ASN A CA   2  
ATOM 2419  C C    . ASN A 1 5   ? 8.090   -9.883  -7.837  1.00 0.00 ? 5   ASN A C    2  
ATOM 2420  O O    . ASN A 1 5   ? 8.240   -9.180  -8.833  1.00 0.00 ? 5   ASN A O    2  
ATOM 2421  C CB   . ASN A 1 5   ? 6.082   -11.167 -7.164  1.00 0.00 ? 5   ASN A CB   2  
ATOM 2422  C CG   . ASN A 1 5   ? 5.605   -11.675 -5.801  1.00 0.00 ? 5   ASN A CG   2  
ATOM 2423  O OD1  . ASN A 1 5   ? 6.387   -11.955 -4.907  1.00 0.00 ? 5   ASN A OD1  2  
ATOM 2424  N ND2  . ASN A 1 5   ? 4.284   -11.776 -5.695  1.00 0.00 ? 5   ASN A ND2  2  
ATOM 2425  H H    . ASN A 1 5   ? 5.013   -8.986  -7.723  1.00 0.00 ? 5   ASN A H    2  
ATOM 2426  H HA   . ASN A 1 5   ? 6.966   -9.577  -5.980  1.00 0.00 ? 5   ASN A HA   2  
ATOM 2427  H HB2  . ASN A 1 5   ? 5.230   -11.067 -7.837  1.00 0.00 ? 5   ASN A HB2  2  
ATOM 2428  H HB3  . ASN A 1 5   ? 6.759   -11.894 -7.611  1.00 0.00 ? 5   ASN A HB3  2  
ATOM 2429  H HD21 . ASN A 1 5   ? 3.700   -11.530 -6.467  1.00 0.00 ? 5   ASN A HD21 2  
ATOM 2430  H HD22 . ASN A 1 5   ? 3.875   -12.100 -4.841  1.00 0.00 ? 5   ASN A HD22 2  
ATOM 2431  N N    . LEU A 1 6   ? 8.994   -10.735 -7.375  1.00 0.00 ? 6   LEU A N    2  
ATOM 2432  C CA   . LEU A 1 6   ? 10.274  -10.901 -8.042  1.00 0.00 ? 6   LEU A CA   2  
ATOM 2433  C C    . LEU A 1 6   ? 10.069  -11.686 -9.340  1.00 0.00 ? 6   LEU A C    2  
ATOM 2434  O O    . LEU A 1 6   ? 10.557  -11.286 -10.396 1.00 0.00 ? 6   LEU A O    2  
ATOM 2435  C CB   . LEU A 1 6   ? 11.294  -11.534 -7.095  1.00 0.00 ? 6   LEU A CB   2  
ATOM 2436  C CG   . LEU A 1 6   ? 12.323  -10.582 -6.482  1.00 0.00 ? 6   LEU A CG   2  
ATOM 2437  C CD1  . LEU A 1 6   ? 11.861  -10.085 -5.110  1.00 0.00 ? 6   LEU A CD1  2  
ATOM 2438  C CD2  . LEU A 1 6   ? 13.706  -11.233 -6.421  1.00 0.00 ? 6   LEU A CD2  2  
ATOM 2439  H H    . LEU A 1 6   ? 8.864   -11.304 -6.564  1.00 0.00 ? 6   LEU A H    2  
ATOM 2440  H HA   . LEU A 1 6   ? 10.642  -9.907  -8.295  1.00 0.00 ? 6   LEU A HA   2  
ATOM 2441  H HB2  . LEU A 1 6   ? 10.753  -12.023 -6.285  1.00 0.00 ? 6   LEU A HB2  2  
ATOM 2442  H HB3  . LEU A 1 6   ? 11.829  -12.314 -7.637  1.00 0.00 ? 6   LEU A HB3  2  
ATOM 2443  H HG   . LEU A 1 6   ? 12.407  -9.708  -7.129  1.00 0.00 ? 6   LEU A HG   2  
ATOM 2444  H HD11 . LEU A 1 6   ? 11.433  -10.916 -4.549  1.00 0.00 ? 6   LEU A HD11 2  
ATOM 2445  H HD12 . LEU A 1 6   ? 12.713  -9.679  -4.565  1.00 0.00 ? 6   LEU A HD12 2  
ATOM 2446  H HD13 . LEU A 1 6   ? 11.109  -9.307  -5.240  1.00 0.00 ? 6   LEU A HD13 2  
ATOM 2447  H HD21 . LEU A 1 6   ? 13.596  -12.296 -6.204  1.00 0.00 ? 6   LEU A HD21 2  
ATOM 2448  H HD22 . LEU A 1 6   ? 14.209  -11.107 -7.379  1.00 0.00 ? 6   LEU A HD22 2  
ATOM 2449  H HD23 . LEU A 1 6   ? 14.295  -10.760 -5.636  1.00 0.00 ? 6   LEU A HD23 2  
ATOM 2450  N N    . GLN A 1 7   ? 9.347   -12.790 -9.219  1.00 0.00 ? 7   GLN A N    2  
ATOM 2451  C CA   . GLN A 1 7   ? 9.071   -13.635 -10.368 1.00 0.00 ? 7   GLN A CA   2  
ATOM 2452  C C    . GLN A 1 7   ? 8.156   -12.907 -11.355 1.00 0.00 ? 7   GLN A C    2  
ATOM 2453  O O    . GLN A 1 7   ? 8.490   -12.770 -12.531 1.00 0.00 ? 7   GLN A O    2  
ATOM 2454  C CB   . GLN A 1 7   ? 8.460   -14.969 -9.935  1.00 0.00 ? 7   GLN A CB   2  
ATOM 2455  C CG   . GLN A 1 7   ? 9.544   -16.030 -9.740  1.00 0.00 ? 7   GLN A CG   2  
ATOM 2456  C CD   . GLN A 1 7   ? 10.447  -15.680 -8.555  1.00 0.00 ? 7   GLN A CD   2  
ATOM 2457  O OE1  . GLN A 1 7   ? 11.625  -15.397 -8.703  1.00 0.00 ? 7   GLN A OE1  2  
ATOM 2458  N NE2  . GLN A 1 7   ? 9.833   -15.714 -7.376  1.00 0.00 ? 7   GLN A NE2  2  
ATOM 2459  H H    . GLN A 1 7   ? 8.954   -13.109 -8.356  1.00 0.00 ? 7   GLN A H    2  
ATOM 2460  H HA   . GLN A 1 7   ? 10.041  -13.820 -10.830 1.00 0.00 ? 7   GLN A HA   2  
ATOM 2461  H HB2  . GLN A 1 7   ? 7.906   -14.834 -9.006  1.00 0.00 ? 7   GLN A HB2  2  
ATOM 2462  H HB3  . GLN A 1 7   ? 7.746   -15.306 -10.686 1.00 0.00 ? 7   GLN A HB3  2  
ATOM 2463  H HG2  . GLN A 1 7   ? 9.079   -17.002 -9.572  1.00 0.00 ? 7   GLN A HG2  2  
ATOM 2464  H HG3  . GLN A 1 7   ? 10.143  -16.116 -10.646 1.00 0.00 ? 7   GLN A HG3  2  
ATOM 2465  H HE21 . GLN A 1 7   ? 8.863   -15.954 -7.325  1.00 0.00 ? 7   GLN A HE21 2  
ATOM 2466  H HE22 . GLN A 1 7   ? 10.340  -15.500 -6.542  1.00 0.00 ? 7   GLN A HE22 2  
ATOM 2467  N N    . GLY A 1 8   ? 7.021   -12.460 -10.840 1.00 0.00 ? 8   GLY A N    2  
ATOM 2468  C CA   . GLY A 1 8   ? 6.056   -11.749 -11.661 1.00 0.00 ? 8   GLY A CA   2  
ATOM 2469  C C    . GLY A 1 8   ? 4.630   -11.980 -11.154 1.00 0.00 ? 8   GLY A C    2  
ATOM 2470  O O    . GLY A 1 8   ? 3.904   -12.814 -11.694 1.00 0.00 ? 8   GLY A O    2  
ATOM 2471  H H    . GLY A 1 8   ? 6.757   -12.576 -9.882  1.00 0.00 ? 8   GLY A H    2  
ATOM 2472  H HA2  . GLY A 1 8   ? 6.279   -10.682 -11.652 1.00 0.00 ? 8   GLY A HA2  2  
ATOM 2473  H HA3  . GLY A 1 8   ? 6.137   -12.083 -12.695 1.00 0.00 ? 8   GLY A HA3  2  
ATOM 2474  N N    . GLN A 1 9   ? 4.272   -11.227 -10.125 1.00 0.00 ? 9   GLN A N    2  
ATOM 2475  C CA   . GLN A 1 9   ? 2.948   -11.339 -9.540  1.00 0.00 ? 9   GLN A CA   2  
ATOM 2476  C C    . GLN A 1 9   ? 2.656   -10.130 -8.649  1.00 0.00 ? 9   GLN A C    2  
ATOM 2477  O O    . GLN A 1 9   ? 3.410   -9.840  -7.723  1.00 0.00 ? 9   GLN A O    2  
ATOM 2478  C CB   . GLN A 1 9   ? 2.803   -12.645 -8.755  1.00 0.00 ? 9   GLN A CB   2  
ATOM 2479  C CG   . GLN A 1 9   ? 2.009   -13.680 -9.555  1.00 0.00 ? 9   GLN A CG   2  
ATOM 2480  C CD   . GLN A 1 9   ? 1.120   -14.519 -8.635  1.00 0.00 ? 9   GLN A CD   2  
ATOM 2481  O OE1  . GLN A 1 9   ? 1.459   -15.621 -8.237  1.00 0.00 ? 9   GLN A OE1  2  
ATOM 2482  N NE2  . GLN A 1 9   ? -0.034  -13.937 -8.321  1.00 0.00 ? 9   GLN A NE2  2  
ATOM 2483  H H    . GLN A 1 9   ? 4.870   -10.551 -9.692  1.00 0.00 ? 9   GLN A H    2  
ATOM 2484  H HA   . GLN A 1 9   ? 2.259   -11.352 -10.384 1.00 0.00 ? 9   GLN A HA   2  
ATOM 2485  H HB2  . GLN A 1 9   ? 3.790   -13.042 -8.518  1.00 0.00 ? 9   GLN A HB2  2  
ATOM 2486  H HB3  . GLN A 1 9   ? 2.302   -12.450 -7.807  1.00 0.00 ? 9   GLN A HB3  2  
ATOM 2487  H HG2  . GLN A 1 9   ? 1.394   -13.175 -10.300 1.00 0.00 ? 9   GLN A HG2  2  
ATOM 2488  H HG3  . GLN A 1 9   ? 2.695   -14.331 -10.096 1.00 0.00 ? 9   GLN A HG3  2  
ATOM 2489  H HE21 . GLN A 1 9   ? -0.252  -13.031 -8.681  1.00 0.00 ? 9   GLN A HE21 2  
ATOM 2490  H HE22 . GLN A 1 9   ? -0.684  -14.408 -7.724  1.00 0.00 ? 9   GLN A HE22 2  
ATOM 2491  N N    . MET A 1 10  ? 1.560   -9.455  -8.963  1.00 0.00 ? 10  MET A N    2  
ATOM 2492  C CA   . MET A 1 10  ? 1.158   -8.284  -8.203  1.00 0.00 ? 10  MET A CA   2  
ATOM 2493  C C    . MET A 1 10  ? 0.760   -8.666  -6.775  1.00 0.00 ? 10  MET A C    2  
ATOM 2494  O O    . MET A 1 10  ? -0.148  -9.470  -6.576  1.00 0.00 ? 10  MET A O    2  
ATOM 2495  C CB   . MET A 1 10  ? -0.022  -7.603  -8.898  1.00 0.00 ? 10  MET A CB   2  
ATOM 2496  C CG   . MET A 1 10  ? 0.407   -6.988  -10.231 1.00 0.00 ? 10  MET A CG   2  
ATOM 2497  S SD   . MET A 1 10  ? 0.687   -5.236  -10.033 1.00 0.00 ? 10  MET A SD   2  
ATOM 2498  C CE   . MET A 1 10  ? 2.362   -5.120  -10.640 1.00 0.00 ? 10  MET A CE   2  
ATOM 2499  H H    . MET A 1 10  ? 0.951   -9.697  -9.719  1.00 0.00 ? 10  MET A H    2  
ATOM 2500  H HA   . MET A 1 10  ? 2.034   -7.635  -8.182  1.00 0.00 ? 10  MET A HA   2  
ATOM 2501  H HB2  . MET A 1 10  ? -0.817  -8.330  -9.067  1.00 0.00 ? 10  MET A HB2  2  
ATOM 2502  H HB3  . MET A 1 10  ? -0.432  -6.827  -8.250  1.00 0.00 ? 10  MET A HB3  2  
ATOM 2503  H HG2  . MET A 1 10  ? 1.316   -7.472  -10.589 1.00 0.00 ? 10  MET A HG2  2  
ATOM 2504  H HG3  . MET A 1 10  ? -0.362  -7.159  -10.984 1.00 0.00 ? 10  MET A HG3  2  
ATOM 2505  H HE1  . MET A 1 10  ? 2.606   -6.017  -11.209 1.00 0.00 ? 10  MET A HE1  2  
ATOM 2506  H HE2  . MET A 1 10  ? 2.456   -4.245  -11.284 1.00 0.00 ? 10  MET A HE2  2  
ATOM 2507  H HE3  . MET A 1 10  ? 3.048   -5.026  -9.798  1.00 0.00 ? 10  MET A HE3  2  
ATOM 2508  N N    . VAL A 1 11  ? 1.459   -8.069  -5.821  1.00 0.00 ? 11  VAL A N    2  
ATOM 2509  C CA   . VAL A 1 11  ? 1.189   -8.337  -4.418  1.00 0.00 ? 11  VAL A CA   2  
ATOM 2510  C C    . VAL A 1 11  ? 1.522   -7.092  -3.593  1.00 0.00 ? 11  VAL A C    2  
ATOM 2511  O O    . VAL A 1 11  ? 2.342   -6.272  -4.003  1.00 0.00 ? 11  VAL A O    2  
ATOM 2512  C CB   . VAL A 1 11  ? 1.959   -9.579  -3.965  1.00 0.00 ? 11  VAL A CB   2  
ATOM 2513  C CG1  . VAL A 1 11  ? 1.496   -10.820 -4.728  1.00 0.00 ? 11  VAL A CG1  2  
ATOM 2514  C CG2  . VAL A 1 11  ? 3.467   -9.373  -4.116  1.00 0.00 ? 11  VAL A CG2  2  
ATOM 2515  H H    . VAL A 1 11  ? 2.195   -7.415  -5.992  1.00 0.00 ? 11  VAL A H    2  
ATOM 2516  H HA   . VAL A 1 11  ? 0.124   -8.547  -4.323  1.00 0.00 ? 11  VAL A HA   2  
ATOM 2517  H HB   . VAL A 1 11  ? 1.747   -9.737  -2.908  1.00 0.00 ? 11  VAL A HB   2  
ATOM 2518  H HG11 . VAL A 1 11  ? 0.414   -10.919 -4.639  1.00 0.00 ? 11  VAL A HG11 2  
ATOM 2519  H HG12 . VAL A 1 11  ? 1.765   -10.722 -5.780  1.00 0.00 ? 11  VAL A HG12 2  
ATOM 2520  H HG13 . VAL A 1 11  ? 1.977   -11.705 -4.311  1.00 0.00 ? 11  VAL A HG13 2  
ATOM 2521  H HG21 . VAL A 1 11  ? 3.746   -8.405  -3.701  1.00 0.00 ? 11  VAL A HG21 2  
ATOM 2522  H HG22 . VAL A 1 11  ? 3.997   -10.163 -3.582  1.00 0.00 ? 11  VAL A HG22 2  
ATOM 2523  H HG23 . VAL A 1 11  ? 3.735   -9.407  -5.172  1.00 0.00 ? 11  VAL A HG23 2  
ATOM 2524  N N    . HIS A 1 12  ? 0.870   -6.991  -2.444  1.00 0.00 ? 12  HIS A N    2  
ATOM 2525  C CA   . HIS A 1 12  ? 1.086   -5.861  -1.558  1.00 0.00 ? 12  HIS A CA   2  
ATOM 2526  C C    . HIS A 1 12  ? 2.362   -6.083  -0.745  1.00 0.00 ? 12  HIS A C    2  
ATOM 2527  O O    . HIS A 1 12  ? 2.855   -7.207  -0.650  1.00 0.00 ? 12  HIS A O    2  
ATOM 2528  C CB   . HIS A 1 12  ? -0.142  -5.617  -0.678  1.00 0.00 ? 12  HIS A CB   2  
ATOM 2529  C CG   . HIS A 1 12  ? -0.493  -6.777  0.222   1.00 0.00 ? 12  HIS A CG   2  
ATOM 2530  N ND1  . HIS A 1 12  ? 0.301   -7.167  1.287   1.00 0.00 ? 12  HIS A ND1  2  
ATOM 2531  C CD2  . HIS A 1 12  ? -1.560  -7.627  0.206   1.00 0.00 ? 12  HIS A CD2  2  
ATOM 2532  C CE1  . HIS A 1 12  ? -0.271  -8.206  1.877   1.00 0.00 ? 12  HIS A CE1  2  
ATOM 2533  N NE2  . HIS A 1 12  ? -1.424  -8.489  1.206   1.00 0.00 ? 12  HIS A NE2  2  
ATOM 2534  H H    . HIS A 1 12  ? 0.204   -7.662  -2.118  1.00 0.00 ? 12  HIS A H    2  
ATOM 2535  H HA   . HIS A 1 12  ? 1.218   -4.985  -2.194  1.00 0.00 ? 12  HIS A HA   2  
ATOM 2536  H HB2  . HIS A 1 12  ? 0.033   -4.733  -0.064  1.00 0.00 ? 12  HIS A HB2  2  
ATOM 2537  H HB3  . HIS A 1 12  ? -0.996  -5.395  -1.318  1.00 0.00 ? 12  HIS A HB3  2  
ATOM 2538  H HD1  . HIS A 1 12  ? 1.160   -6.738  1.563   1.00 0.00 ? 12  HIS A HD1  2  
ATOM 2539  H HD2  . HIS A 1 12  ? -2.385  -7.601  -0.507  1.00 0.00 ? 12  HIS A HD2  2  
ATOM 2540  H HE1  . HIS A 1 12  ? 0.112   -8.740  2.746   1.00 0.00 ? 12  HIS A HE1  2  
ATOM 2541  H HE2  . HIS A 1 12  ? -2.090  -9.190  1.463   1.00 0.00 ? 12  HIS A HE2  2  
ATOM 2542  N N    . GLN A 1 13  ? 2.862   -4.994  -0.178  1.00 0.00 ? 13  GLN A N    2  
ATOM 2543  C CA   . GLN A 1 13  ? 4.072   -5.057  0.625   1.00 0.00 ? 13  GLN A CA   2  
ATOM 2544  C C    . GLN A 1 13  ? 3.860   -4.343  1.961   1.00 0.00 ? 13  GLN A C    2  
ATOM 2545  O O    . GLN A 1 13  ? 4.746   -3.633  2.437   1.00 0.00 ? 13  GLN A O    2  
ATOM 2546  C CB   . GLN A 1 13  ? 5.262   -4.464  -0.132  1.00 0.00 ? 13  GLN A CB   2  
ATOM 2547  C CG   . GLN A 1 13  ? 6.586   -4.951  0.461   1.00 0.00 ? 13  GLN A CG   2  
ATOM 2548  C CD   . GLN A 1 13  ? 7.687   -4.973  -0.602  1.00 0.00 ? 13  GLN A CD   2  
ATOM 2549  O OE1  . GLN A 1 13  ? 8.577   -5.808  -0.593  1.00 0.00 ? 13  GLN A OE1  2  
ATOM 2550  N NE2  . GLN A 1 13  ? 7.578   -4.012  -1.515  1.00 0.00 ? 13  GLN A NE2  2  
ATOM 2551  H H    . GLN A 1 13  ? 2.455   -4.085  -0.259  1.00 0.00 ? 13  GLN A H    2  
ATOM 2552  H HA   . GLN A 1 13  ? 4.251   -6.118  0.796   1.00 0.00 ? 13  GLN A HA   2  
ATOM 2553  H HB2  . GLN A 1 13  ? 5.206   -4.744  -1.184  1.00 0.00 ? 13  GLN A HB2  2  
ATOM 2554  H HB3  . GLN A 1 13  ? 5.219   -3.375  -0.089  1.00 0.00 ? 13  GLN A HB3  2  
ATOM 2555  H HG2  . GLN A 1 13  ? 6.882   -4.300  1.283   1.00 0.00 ? 13  GLN A HG2  2  
ATOM 2556  H HG3  . GLN A 1 13  ? 6.457   -5.950  0.876   1.00 0.00 ? 13  GLN A HG3  2  
ATOM 2557  H HE21 . GLN A 1 13  ? 6.822   -3.358  -1.464  1.00 0.00 ? 13  GLN A HE21 2  
ATOM 2558  H HE22 . GLN A 1 13  ? 8.250   -3.943  -2.252  1.00 0.00 ? 13  GLN A HE22 2  
ATOM 2559  N N    . ALA A 1 14  ? 2.682   -4.555  2.529   1.00 0.00 ? 14  ALA A N    2  
ATOM 2560  C CA   . ALA A 1 14  ? 2.343   -3.939  3.801   1.00 0.00 ? 14  ALA A CA   2  
ATOM 2561  C C    . ALA A 1 14  ? 2.704   -2.453  3.756   1.00 0.00 ? 14  ALA A C    2  
ATOM 2562  O O    . ALA A 1 14  ? 3.091   -1.936  2.709   1.00 0.00 ? 14  ALA A O    2  
ATOM 2563  C CB   . ALA A 1 14  ? 3.059   -4.679  4.933   1.00 0.00 ? 14  ALA A CB   2  
ATOM 2564  H H    . ALA A 1 14  ? 1.968   -5.133  2.136   1.00 0.00 ? 14  ALA A H    2  
ATOM 2565  H HA   . ALA A 1 14  ? 1.267   -4.039  3.942   1.00 0.00 ? 14  ALA A HA   2  
ATOM 2566  H HB1  . ALA A 1 14  ? 4.115   -4.410  4.932   1.00 0.00 ? 14  ALA A HB1  2  
ATOM 2567  H HB2  . ALA A 1 14  ? 2.614   -4.401  5.887   1.00 0.00 ? 14  ALA A HB2  2  
ATOM 2568  H HB3  . ALA A 1 14  ? 2.958   -5.755  4.785   1.00 0.00 ? 14  ALA A HB3  2  
ATOM 2569  N N    . ILE A 1 15  ? 2.564   -1.808  4.905   1.00 0.00 ? 15  ILE A N    2  
ATOM 2570  C CA   . ILE A 1 15  ? 2.870   -0.391  5.009   1.00 0.00 ? 15  ILE A CA   2  
ATOM 2571  C C    . ILE A 1 15  ? 4.376   -0.213  5.206   1.00 0.00 ? 15  ILE A C    2  
ATOM 2572  O O    . ILE A 1 15  ? 5.130   -1.185  5.173   1.00 0.00 ? 15  ILE A O    2  
ATOM 2573  C CB   . ILE A 1 15  ? 2.025   0.259   6.106   1.00 0.00 ? 15  ILE A CB   2  
ATOM 2574  C CG1  . ILE A 1 15  ? 1.739   1.727   5.780   1.00 0.00 ? 15  ILE A CG1  2  
ATOM 2575  C CG2  . ILE A 1 15  ? 2.684   0.094   7.477   1.00 0.00 ? 15  ILE A CG2  2  
ATOM 2576  C CD1  . ILE A 1 15  ? 0.335   2.127   6.238   1.00 0.00 ? 15  ILE A CD1  2  
ATOM 2577  H H    . ILE A 1 15  ? 2.248   -2.237  5.752   1.00 0.00 ? 15  ILE A H    2  
ATOM 2578  H HA   . ILE A 1 15  ? 2.587   0.075   4.066   1.00 0.00 ? 15  ILE A HA   2  
ATOM 2579  H HB   . ILE A 1 15  ? 1.064   -0.254  6.148   1.00 0.00 ? 15  ILE A HB   2  
ATOM 2580  H HG12 . ILE A 1 15  ? 2.479   2.362   6.268   1.00 0.00 ? 15  ILE A HG12 2  
ATOM 2581  H HG13 . ILE A 1 15  ? 1.836   1.891   4.707   1.00 0.00 ? 15  ILE A HG13 2  
ATOM 2582  H HG21 . ILE A 1 15  ? 3.319   -0.791  7.471   1.00 0.00 ? 15  ILE A HG21 2  
ATOM 2583  H HG22 . ILE A 1 15  ? 3.290   0.974   7.697   1.00 0.00 ? 15  ILE A HG22 2  
ATOM 2584  H HG23 . ILE A 1 15  ? 1.914   -0.016  8.240   1.00 0.00 ? 15  ILE A HG23 2  
ATOM 2585  H HD11 . ILE A 1 15  ? -0.208  1.239   6.562   1.00 0.00 ? 15  ILE A HD11 2  
ATOM 2586  H HD12 . ILE A 1 15  ? 0.410   2.830   7.068   1.00 0.00 ? 15  ILE A HD12 2  
ATOM 2587  H HD13 . ILE A 1 15  ? -0.197  2.597   5.410   1.00 0.00 ? 15  ILE A HD13 2  
ATOM 2588  N N    . SER A 1 16  ? 4.771   1.035   5.409   1.00 0.00 ? 16  SER A N    2  
ATOM 2589  C CA   . SER A 1 16  ? 6.174   1.354   5.612   1.00 0.00 ? 16  SER A CA   2  
ATOM 2590  C C    . SER A 1 16  ? 6.344   2.183   6.886   1.00 0.00 ? 16  SER A C    2  
ATOM 2591  O O    . SER A 1 16  ? 5.463   2.963   7.246   1.00 0.00 ? 16  SER A O    2  
ATOM 2592  C CB   . SER A 1 16  ? 6.747   2.107   4.409   1.00 0.00 ? 16  SER A CB   2  
ATOM 2593  O OG   . SER A 1 16  ? 7.733   3.059   4.797   1.00 0.00 ? 16  SER A OG   2  
ATOM 2594  H H    . SER A 1 16  ? 4.151   1.820   5.435   1.00 0.00 ? 16  SER A H    2  
ATOM 2595  H HA   . SER A 1 16  ? 6.677   0.391   5.710   1.00 0.00 ? 16  SER A HA   2  
ATOM 2596  H HB2  . SER A 1 16  ? 7.186   1.393   3.711   1.00 0.00 ? 16  SER A HB2  2  
ATOM 2597  H HB3  . SER A 1 16  ? 5.941   2.615   3.881   1.00 0.00 ? 16  SER A HB3  2  
ATOM 2598  H HG   . SER A 1 16  ? 8.519   3.010   4.178   1.00 0.00 ? 16  SER A HG   2  
ATOM 2599  N N    . PRO A 1 17  ? 7.512   1.979   7.553   1.00 0.00 ? 17  PRO A N    2  
ATOM 2600  C CA   . PRO A 1 17  ? 7.808   2.698   8.780   1.00 0.00 ? 17  PRO A CA   2  
ATOM 2601  C C    . PRO A 1 17  ? 8.189   4.151   8.486   1.00 0.00 ? 17  PRO A C    2  
ATOM 2602  O O    . PRO A 1 17  ? 7.835   5.054   9.243   1.00 0.00 ? 17  PRO A O    2  
ATOM 2603  C CB   . PRO A 1 17  ? 8.932   1.911   9.436   1.00 0.00 ? 17  PRO A CB   2  
ATOM 2604  C CG   . PRO A 1 17  ? 9.537   1.053   8.336   1.00 0.00 ? 17  PRO A CG   2  
ATOM 2605  C CD   . PRO A 1 17  ? 8.577   1.063   7.157   1.00 0.00 ? 17  PRO A CD   2  
ATOM 2606  H HA   . PRO A 1 17  ? 6.996   2.741   9.363   1.00 0.00 ? 17  PRO A HA   2  
ATOM 2607  H HB2  . PRO A 1 17  ? 9.678   2.579   9.865   1.00 0.00 ? 17  PRO A HB2  2  
ATOM 2608  H HB3  . PRO A 1 17  ? 8.552   1.293   10.250  1.00 0.00 ? 17  PRO A HB3  2  
ATOM 2609  H HG2  . PRO A 1 17  ? 10.510  1.444   8.039   1.00 0.00 ? 17  PRO A HG2  2  
ATOM 2610  H HG3  . PRO A 1 17  ? 9.696   0.035   8.690   1.00 0.00 ? 17  PRO A HG3  2  
ATOM 2611  H HD2  . PRO A 1 17  ? 9.072   1.401   6.247   1.00 0.00 ? 17  PRO A HD2  2  
ATOM 2612  H HD3  . PRO A 1 17  ? 8.187   0.065   6.956   1.00 0.00 ? 17  PRO A HD3  2  
ATOM 2613  N N    . ARG A 1 18  ? 8.905   4.330   7.386   1.00 0.00 ? 18  ARG A N    2  
ATOM 2614  C CA   . ARG A 1 18  ? 9.336   5.658   6.982   1.00 0.00 ? 18  ARG A CA   2  
ATOM 2615  C C    . ARG A 1 18  ? 8.133   6.501   6.557   1.00 0.00 ? 18  ARG A C    2  
ATOM 2616  O O    . ARG A 1 18  ? 8.121   7.716   6.752   1.00 0.00 ? 18  ARG A O    2  
ATOM 2617  C CB   . ARG A 1 18  ? 10.335  5.584   5.826   1.00 0.00 ? 18  ARG A CB   2  
ATOM 2618  C CG   . ARG A 1 18  ? 11.526  4.694   6.184   1.00 0.00 ? 18  ARG A CG   2  
ATOM 2619  C CD   . ARG A 1 18  ? 11.465  3.366   5.426   1.00 0.00 ? 18  ARG A CD   2  
ATOM 2620  N NE   . ARG A 1 18  ? 12.705  3.174   4.643   1.00 0.00 ? 18  ARG A NE   2  
ATOM 2621  C CZ   . ARG A 1 18  ? 13.058  2.016   4.067   1.00 0.00 ? 18  ARG A CZ   2  
ATOM 2622  N NH1  . ARG A 1 18  ? 12.266  0.941   4.183   1.00 0.00 ? 18  ARG A NH1  2  
ATOM 2623  N NH2  . ARG A 1 18  ? 14.202  1.934   3.374   1.00 0.00 ? 18  ARG A NH2  2  
ATOM 2624  H H    . ARG A 1 18  ? 9.188   3.590   6.776   1.00 0.00 ? 18  ARG A H    2  
ATOM 2625  H HA   . ARG A 1 18  ? 9.814   6.076   7.869   1.00 0.00 ? 18  ARG A HA   2  
ATOM 2626  H HB2  . ARG A 1 18  ? 9.839   5.194   4.937   1.00 0.00 ? 18  ARG A HB2  2  
ATOM 2627  H HB3  . ARG A 1 18  ? 10.686  6.587   5.580   1.00 0.00 ? 18  ARG A HB3  2  
ATOM 2628  H HG2  . ARG A 1 18  ? 12.455  5.211   5.947   1.00 0.00 ? 18  ARG A HG2  2  
ATOM 2629  H HG3  . ARG A 1 18  ? 11.533  4.504   7.258   1.00 0.00 ? 18  ARG A HG3  2  
ATOM 2630  H HD2  . ARG A 1 18  ? 11.337  2.543   6.129   1.00 0.00 ? 18  ARG A HD2  2  
ATOM 2631  H HD3  . ARG A 1 18  ? 10.601  3.356   4.763   1.00 0.00 ? 18  ARG A HD3  2  
ATOM 2632  H HE   . ARG A 1 18  ? 13.320  3.956   4.538   1.00 0.00 ? 18  ARG A HE   2  
ATOM 2633  H HH11 . ARG A 1 18  ? 11.412  1.003   4.699   1.00 0.00 ? 18  ARG A HH11 2  
ATOM 2634  H HH12 . ARG A 1 18  ? 12.530  0.078   3.753   1.00 0.00 ? 18  ARG A HH12 2  
ATOM 2635  H HH21 . ARG A 1 18  ? 14.794  2.735   3.288   1.00 0.00 ? 18  ARG A HH21 2  
ATOM 2636  H HH22 . ARG A 1 18  ? 14.466  1.070   2.944   1.00 0.00 ? 18  ARG A HH22 2  
ATOM 2637  N N    . THR A 1 19  ? 7.150   5.824   5.982   1.00 0.00 ? 19  THR A N    2  
ATOM 2638  C CA   . THR A 1 19  ? 5.945   6.495   5.526   1.00 0.00 ? 19  THR A CA   2  
ATOM 2639  C C    . THR A 1 19  ? 5.059   6.866   6.717   1.00 0.00 ? 19  THR A C    2  
ATOM 2640  O O    . THR A 1 19  ? 4.612   8.006   6.832   1.00 0.00 ? 19  THR A O    2  
ATOM 2641  C CB   . THR A 1 19  ? 5.251   5.585   4.512   1.00 0.00 ? 19  THR A CB   2  
ATOM 2642  O OG1  . THR A 1 19  ? 5.388   6.276   3.273   1.00 0.00 ? 19  THR A OG1  2  
ATOM 2643  C CG2  . THR A 1 19  ? 3.737   5.510   4.731   1.00 0.00 ? 19  THR A CG2  2  
ATOM 2644  H H    . THR A 1 19  ? 7.168   4.836   5.827   1.00 0.00 ? 19  THR A H    2  
ATOM 2645  H HA   . THR A 1 19  ? 6.233   7.428   5.041   1.00 0.00 ? 19  THR A HA   2  
ATOM 2646  H HB   . THR A 1 19  ? 5.694   4.589   4.516   1.00 0.00 ? 19  THR A HB   2  
ATOM 2647  H HG1  . THR A 1 19  ? 5.116   5.679   2.518   1.00 0.00 ? 19  THR A HG1  2  
ATOM 2648  H HG21 . THR A 1 19  ? 3.336   6.518   4.836   1.00 0.00 ? 19  THR A HG21 2  
ATOM 2649  H HG22 . THR A 1 19  ? 3.271   5.021   3.877   1.00 0.00 ? 19  THR A HG22 2  
ATOM 2650  H HG23 . THR A 1 19  ? 3.529   4.938   5.636   1.00 0.00 ? 19  THR A HG23 2  
ATOM 2651  N N    . LEU A 1 20  ? 4.830   5.880   7.573   1.00 0.00 ? 20  LEU A N    2  
ATOM 2652  C CA   . LEU A 1 20  ? 4.004   6.089   8.751   1.00 0.00 ? 20  LEU A CA   2  
ATOM 2653  C C    . LEU A 1 20  ? 4.685   7.102   9.672   1.00 0.00 ? 20  LEU A C    2  
ATOM 2654  O O    . LEU A 1 20  ? 4.024   7.965   10.249  1.00 0.00 ? 20  LEU A O    2  
ATOM 2655  C CB   . LEU A 1 20  ? 3.693   4.753   9.429   1.00 0.00 ? 20  LEU A CB   2  
ATOM 2656  C CG   . LEU A 1 20  ? 2.539   3.948   8.826   1.00 0.00 ? 20  LEU A CG   2  
ATOM 2657  C CD1  . LEU A 1 20  ? 2.521   2.521   9.377   1.00 0.00 ? 20  LEU A CD1  2  
ATOM 2658  C CD2  . LEU A 1 20  ? 1.203   4.661   9.039   1.00 0.00 ? 20  LEU A CD2  2  
ATOM 2659  H H    . LEU A 1 20  ? 5.196   4.956   7.472   1.00 0.00 ? 20  LEU A H    2  
ATOM 2660  H HA   . LEU A 1 20  ? 3.056   6.510   8.415   1.00 0.00 ? 20  LEU A HA   2  
ATOM 2661  H HB2  . LEU A 1 20  ? 4.592   4.137   9.404   1.00 0.00 ? 20  LEU A HB2  2  
ATOM 2662  H HB3  . LEU A 1 20  ? 3.466   4.946   10.478  1.00 0.00 ? 20  LEU A HB3  2  
ATOM 2663  H HG   . LEU A 1 20  ? 2.698   3.877   7.751   1.00 0.00 ? 20  LEU A HG   2  
ATOM 2664  H HD11 . LEU A 1 20  ? 3.525   2.101   9.331   1.00 0.00 ? 20  LEU A HD11 2  
ATOM 2665  H HD12 . LEU A 1 20  ? 2.180   2.534   10.412  1.00 0.00 ? 20  LEU A HD12 2  
ATOM 2666  H HD13 . LEU A 1 20  ? 1.843   1.910   8.780   1.00 0.00 ? 20  LEU A HD13 2  
ATOM 2667  H HD21 . LEU A 1 20  ? 1.180   5.102   10.036  1.00 0.00 ? 20  LEU A HD21 2  
ATOM 2668  H HD22 . LEU A 1 20  ? 1.086   5.448   8.292   1.00 0.00 ? 20  LEU A HD22 2  
ATOM 2669  H HD23 . LEU A 1 20  ? 0.388   3.944   8.941   1.00 0.00 ? 20  LEU A HD23 2  
ATOM 2670  N N    . ASN A 1 21  ? 5.998   6.966   9.782   1.00 0.00 ? 21  ASN A N    2  
ATOM 2671  C CA   . ASN A 1 21  ? 6.776   7.859   10.624  1.00 0.00 ? 21  ASN A CA   2  
ATOM 2672  C C    . ASN A 1 21  ? 6.616   9.295   10.120  1.00 0.00 ? 21  ASN A C    2  
ATOM 2673  O O    . ASN A 1 21  ? 6.208   10.178  10.873  1.00 0.00 ? 21  ASN A O    2  
ATOM 2674  C CB   . ASN A 1 21  ? 8.264   7.504   10.578  1.00 0.00 ? 21  ASN A CB   2  
ATOM 2675  C CG   . ASN A 1 21  ? 9.065   8.374   11.547  1.00 0.00 ? 21  ASN A CG   2  
ATOM 2676  O OD1  . ASN A 1 21  ? 8.527   9.028   12.426  1.00 0.00 ? 21  ASN A OD1  2  
ATOM 2677  N ND2  . ASN A 1 21  ? 10.379  8.346   11.340  1.00 0.00 ? 21  ASN A ND2  2  
ATOM 2678  H H    . ASN A 1 21  ? 6.528   6.262   9.310   1.00 0.00 ? 21  ASN A H    2  
ATOM 2679  H HA   . ASN A 1 21  ? 6.378   7.723   11.630  1.00 0.00 ? 21  ASN A HA   2  
ATOM 2680  H HB2  . ASN A 1 21  ? 8.398   6.452   10.830  1.00 0.00 ? 21  ASN A HB2  2  
ATOM 2681  H HB3  . ASN A 1 21  ? 8.642   7.639   9.564   1.00 0.00 ? 21  ASN A HB3  2  
ATOM 2682  H HD21 . ASN A 1 21  ? 10.756  7.789   10.600  1.00 0.00 ? 21  ASN A HD21 2  
ATOM 2683  H HD22 . ASN A 1 21  ? 10.989  8.883   11.922  1.00 0.00 ? 21  ASN A HD22 2  
ATOM 2684  N N    . ALA A 1 22  ? 6.947   9.483   8.851   1.00 0.00 ? 22  ALA A N    2  
ATOM 2685  C CA   . ALA A 1 22  ? 6.846   10.797  8.239   1.00 0.00 ? 22  ALA A CA   2  
ATOM 2686  C C    . ALA A 1 22  ? 5.416   11.319  8.396   1.00 0.00 ? 22  ALA A C    2  
ATOM 2687  O O    . ALA A 1 22  ? 5.211   12.478  8.756   1.00 0.00 ? 22  ALA A O    2  
ATOM 2688  C CB   . ALA A 1 22  ? 7.277   10.711  6.773   1.00 0.00 ? 22  ALA A CB   2  
ATOM 2689  H H    . ALA A 1 22  ? 7.278   8.759   8.246   1.00 0.00 ? 22  ALA A H    2  
ATOM 2690  H HA   . ALA A 1 22  ? 7.527   11.463  8.767   1.00 0.00 ? 22  ALA A HA   2  
ATOM 2691  H HB1  . ALA A 1 22  ? 6.496   10.222  6.192   1.00 0.00 ? 22  ALA A HB1  2  
ATOM 2692  H HB2  . ALA A 1 22  ? 8.200   10.135  6.699   1.00 0.00 ? 22  ALA A HB2  2  
ATOM 2693  H HB3  . ALA A 1 22  ? 7.444   11.716  6.384   1.00 0.00 ? 22  ALA A HB3  2  
ATOM 2694  N N    . TRP A 1 23  ? 4.465   10.439  8.119   1.00 0.00 ? 23  TRP A N    2  
ATOM 2695  C CA   . TRP A 1 23  ? 3.060   10.798  8.225   1.00 0.00 ? 23  TRP A CA   2  
ATOM 2696  C C    . TRP A 1 23  ? 2.819   11.349  9.632   1.00 0.00 ? 23  TRP A C    2  
ATOM 2697  O O    . TRP A 1 23  ? 2.411   12.498  9.790   1.00 0.00 ? 23  TRP A O    2  
ATOM 2698  C CB   . TRP A 1 23  ? 2.164   9.605   7.888   1.00 0.00 ? 23  TRP A CB   2  
ATOM 2699  C CG   . TRP A 1 23  ? 0.680   9.840   8.179   1.00 0.00 ? 23  TRP A CG   2  
ATOM 2700  C CD1  . TRP A 1 23  ? -0.066  9.297   9.150   1.00 0.00 ? 23  TRP A CD1  2  
ATOM 2701  C CD2  . TRP A 1 23  ? -0.213  10.707  7.449   1.00 0.00 ? 23  TRP A CD2  2  
ATOM 2702  N NE1  . TRP A 1 23  ? -1.369  9.748   9.100   1.00 0.00 ? 23  TRP A NE1  2  
ATOM 2703  C CE2  . TRP A 1 23  ? -1.460  10.634  8.033   1.00 0.00 ? 23  TRP A CE2  2  
ATOM 2704  C CE3  . TRP A 1 23  ? 0.027   11.527  6.332   1.00 0.00 ? 23  TRP A CE3  2  
ATOM 2705  C CZ2  . TRP A 1 23  ? -2.567  11.354  7.569   1.00 0.00 ? 23  TRP A CZ2  2  
ATOM 2706  C CZ3  . TRP A 1 23  ? -1.089  12.242  5.881   1.00 0.00 ? 23  TRP A CZ3  2  
ATOM 2707  C CH2  . TRP A 1 23  ? -2.353  12.178  6.457   1.00 0.00 ? 23  TRP A CH2  2  
ATOM 2708  H H    . TRP A 1 23  ? 4.640   9.499   7.827   1.00 0.00 ? 23  TRP A H    2  
ATOM 2709  H HA   . TRP A 1 23  ? 2.856   11.568  7.482   1.00 0.00 ? 23  TRP A HA   2  
ATOM 2710  H HB2  . TRP A 1 23  ? 2.282   9.361   6.832   1.00 0.00 ? 23  TRP A HB2  2  
ATOM 2711  H HB3  . TRP A 1 23  ? 2.502   8.738   8.454   1.00 0.00 ? 23  TRP A HB3  2  
ATOM 2712  H HD1  . TRP A 1 23  ? 0.309   8.586   9.888   1.00 0.00 ? 23  TRP A HD1  2  
ATOM 2713  H HE1  . TRP A 1 23  ? -2.177  9.464   9.774   1.00 0.00 ? 23  TRP A HE1  2  
ATOM 2714  H HE3  . TRP A 1 23  ? 1.003   11.602  5.853   1.00 0.00 ? 23  TRP A HE3  2  
ATOM 2715  H HZ2  . TRP A 1 23  ? -3.544  11.279  8.048   1.00 0.00 ? 23  TRP A HZ2  2  
ATOM 2716  H HZ3  . TRP A 1 23  ? -0.960  12.893  5.017   1.00 0.00 ? 23  TRP A HZ3  2  
ATOM 2717  H HH2  . TRP A 1 23  ? -3.173  12.767  6.045   1.00 0.00 ? 23  TRP A HH2  2  
ATOM 2718  N N    . VAL A 1 24  ? 3.080   10.503  10.618  1.00 0.00 ? 24  VAL A N    2  
ATOM 2719  C CA   . VAL A 1 24  ? 2.896   10.891  12.005  1.00 0.00 ? 24  VAL A CA   2  
ATOM 2720  C C    . VAL A 1 24  ? 3.484   12.286  12.223  1.00 0.00 ? 24  VAL A C    2  
ATOM 2721  O O    . VAL A 1 24  ? 2.894   13.112  12.919  1.00 0.00 ? 24  VAL A O    2  
ATOM 2722  C CB   . VAL A 1 24  ? 3.504   9.835   12.929  1.00 0.00 ? 24  VAL A CB   2  
ATOM 2723  C CG1  . VAL A 1 24  ? 3.473   10.298  14.387  1.00 0.00 ? 24  VAL A CG1  2  
ATOM 2724  C CG2  . VAL A 1 24  ? 2.793   8.490   12.766  1.00 0.00 ? 24  VAL A CG2  2  
ATOM 2725  H H    . VAL A 1 24  ? 3.411   9.569   10.480  1.00 0.00 ? 24  VAL A H    2  
ATOM 2726  H HA   . VAL A 1 24  ? 1.822   10.930  12.197  1.00 0.00 ? 24  VAL A HA   2  
ATOM 2727  H HB   . VAL A 1 24  ? 4.546   9.700   12.643  1.00 0.00 ? 24  VAL A HB   2  
ATOM 2728  H HG11 . VAL A 1 24  ? 3.866   11.312  14.455  1.00 0.00 ? 24  VAL A HG11 2  
ATOM 2729  H HG12 . VAL A 1 24  ? 2.444   10.283  14.751  1.00 0.00 ? 24  VAL A HG12 2  
ATOM 2730  H HG13 . VAL A 1 24  ? 4.082   9.629   14.994  1.00 0.00 ? 24  VAL A HG13 2  
ATOM 2731  H HG21 . VAL A 1 24  ? 1.956   8.602   12.077  1.00 0.00 ? 24  VAL A HG21 2  
ATOM 2732  H HG22 . VAL A 1 24  ? 3.494   7.755   12.370  1.00 0.00 ? 24  VAL A HG22 2  
ATOM 2733  H HG23 . VAL A 1 24  ? 2.424   8.154   13.735  1.00 0.00 ? 24  VAL A HG23 2  
ATOM 2734  N N    . LYS A 1 25  ? 4.640   12.507  11.614  1.00 0.00 ? 25  LYS A N    2  
ATOM 2735  C CA   . LYS A 1 25  ? 5.315   13.789  11.732  1.00 0.00 ? 25  LYS A CA   2  
ATOM 2736  C C    . LYS A 1 25  ? 4.488   14.864  11.025  1.00 0.00 ? 25  LYS A C    2  
ATOM 2737  O O    . LYS A 1 25  ? 4.384   15.990  11.509  1.00 0.00 ? 25  LYS A O    2  
ATOM 2738  C CB   . LYS A 1 25  ? 6.754   13.685  11.221  1.00 0.00 ? 25  LYS A CB   2  
ATOM 2739  C CG   . LYS A 1 25  ? 7.741   13.557  12.384  1.00 0.00 ? 25  LYS A CG   2  
ATOM 2740  C CD   . LYS A 1 25  ? 9.137   13.187  11.879  1.00 0.00 ? 25  LYS A CD   2  
ATOM 2741  C CE   . LYS A 1 25  ? 9.734   12.045  12.705  1.00 0.00 ? 25  LYS A CE   2  
ATOM 2742  N NZ   . LYS A 1 25  ? 11.112  11.746  12.256  1.00 0.00 ? 25  LYS A NZ   2  
ATOM 2743  H H    . LYS A 1 25  ? 5.113   11.831  11.050  1.00 0.00 ? 25  LYS A H    2  
ATOM 2744  H HA   . LYS A 1 25  ? 5.367   14.033  12.793  1.00 0.00 ? 25  LYS A HA   2  
ATOM 2745  H HB2  . LYS A 1 25  ? 6.849   12.822  10.562  1.00 0.00 ? 25  LYS A HB2  2  
ATOM 2746  H HB3  . LYS A 1 25  ? 6.998   14.566  10.628  1.00 0.00 ? 25  LYS A HB3  2  
ATOM 2747  H HG2  . LYS A 1 25  ? 7.786   14.498  12.932  1.00 0.00 ? 25  LYS A HG2  2  
ATOM 2748  H HG3  . LYS A 1 25  ? 7.389   12.797  13.082  1.00 0.00 ? 25  LYS A HG3  2  
ATOM 2749  H HD2  . LYS A 1 25  ? 9.083   12.892  10.831  1.00 0.00 ? 25  LYS A HD2  2  
ATOM 2750  H HD3  . LYS A 1 25  ? 9.790   14.058  11.932  1.00 0.00 ? 25  LYS A HD3  2  
ATOM 2751  H HE2  . LYS A 1 25  ? 9.740   12.317  13.761  1.00 0.00 ? 25  LYS A HE2  2  
ATOM 2752  H HE3  . LYS A 1 25  ? 9.112   11.155  12.609  1.00 0.00 ? 25  LYS A HE3  2  
ATOM 2753  H HZ1  . LYS A 1 25  ? 11.380  12.397  11.546  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 2754  H HZ2  . LYS A 1 25  ? 11.739  11.822  13.031  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 2755  H HZ3  . LYS A 1 25  ? 11.148  10.817  11.887  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 2756  N N    . VAL A 1 26  ? 3.920   14.478  9.893   1.00 0.00 ? 26  VAL A N    2  
ATOM 2757  C CA   . VAL A 1 26  ? 3.104   15.395  9.115   1.00 0.00 ? 26  VAL A CA   2  
ATOM 2758  C C    . VAL A 1 26  ? 1.901   15.835  9.951   1.00 0.00 ? 26  VAL A C    2  
ATOM 2759  O O    . VAL A 1 26  ? 1.698   17.028  10.174  1.00 0.00 ? 26  VAL A O    2  
ATOM 2760  C CB   . VAL A 1 26  ? 2.704   14.744  7.789   1.00 0.00 ? 26  VAL A CB   2  
ATOM 2761  C CG1  . VAL A 1 26  ? 1.639   15.574  7.069   1.00 0.00 ? 26  VAL A CG1  2  
ATOM 2762  C CG2  . VAL A 1 26  ? 3.927   14.528  6.894   1.00 0.00 ? 26  VAL A CG2  2  
ATOM 2763  H H    . VAL A 1 26  ? 4.008   13.560  9.506   1.00 0.00 ? 26  VAL A H    2  
ATOM 2764  H HA   . VAL A 1 26  ? 3.714   16.270  8.892   1.00 0.00 ? 26  VAL A HA   2  
ATOM 2765  H HB   . VAL A 1 26  ? 2.275   13.768  8.010   1.00 0.00 ? 26  VAL A HB   2  
ATOM 2766  H HG11 . VAL A 1 26  ? 0.873   15.878  7.783   1.00 0.00 ? 26  VAL A HG11 2  
ATOM 2767  H HG12 . VAL A 1 26  ? 2.101   16.459  6.633   1.00 0.00 ? 26  VAL A HG12 2  
ATOM 2768  H HG13 . VAL A 1 26  ? 1.184   14.975  6.281   1.00 0.00 ? 26  VAL A HG13 2  
ATOM 2769  H HG21 . VAL A 1 26  ? 4.832   14.770  7.451   1.00 0.00 ? 26  VAL A HG21 2  
ATOM 2770  H HG22 . VAL A 1 26  ? 3.964   13.486  6.576   1.00 0.00 ? 26  VAL A HG22 2  
ATOM 2771  H HG23 . VAL A 1 26  ? 3.856   15.173  6.019   1.00 0.00 ? 26  VAL A HG23 2  
ATOM 2772  N N    . VAL A 1 27  ? 1.132   14.849  10.390  1.00 0.00 ? 27  VAL A N    2  
ATOM 2773  C CA   . VAL A 1 27  ? -0.045  15.120  11.195  1.00 0.00 ? 27  VAL A CA   2  
ATOM 2774  C C    . VAL A 1 27  ? 0.374   15.841  12.478  1.00 0.00 ? 27  VAL A C    2  
ATOM 2775  O O    . VAL A 1 27  ? -0.313  16.753  12.935  1.00 0.00 ? 27  VAL A O    2  
ATOM 2776  C CB   . VAL A 1 27  ? -0.807  13.820  11.463  1.00 0.00 ? 27  VAL A CB   2  
ATOM 2777  C CG1  . VAL A 1 27  ? -2.187  14.106  12.058  1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2778  C CG2  . VAL A 1 27  ? -0.922  12.980  10.189  1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2779  H H    . VAL A 1 27  ? 1.304   13.881  10.203  1.00 0.00 ? 27  VAL A H    2  
ATOM 2780  H HA   . VAL A 1 27  ? -0.695  15.779  10.620  1.00 0.00 ? 27  VAL A HA   2  
ATOM 2781  H HB   . VAL A 1 27  ? -0.240  13.244  12.194  1.00 0.00 ? 27  VAL A HB   2  
ATOM 2782  H HG11 . VAL A 1 27  ? -2.075  14.671  12.982  1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2783  H HG12 . VAL A 1 27  ? -2.777  14.685  11.346  1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2784  H HG13 . VAL A 1 27  ? -2.695  13.164  12.267  1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2785  H HG21 . VAL A 1 27  ? -0.475  13.522  9.355   1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2786  H HG22 . VAL A 1 27  ? -0.400  12.034  10.329  1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2787  H HG23 . VAL A 1 27  ? -1.973  12.787  9.974   1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2788  N N    . GLU A 1 28  ? 1.500   15.405  13.023  1.00 0.00 ? 28  GLU A N    2  
ATOM 2789  C CA   . GLU A 1 28  ? 2.020   15.996  14.244  1.00 0.00 ? 28  GLU A CA   2  
ATOM 2790  C C    . GLU A 1 28  ? 2.270   17.492  14.044  1.00 0.00 ? 28  GLU A C    2  
ATOM 2791  O O    . GLU A 1 28  ? 2.067   18.288  14.960  1.00 0.00 ? 28  GLU A O    2  
ATOM 2792  C CB   . GLU A 1 28  ? 3.295   15.284  14.699  1.00 0.00 ? 28  GLU A CB   2  
ATOM 2793  C CG   . GLU A 1 28  ? 2.969   14.144  15.667  1.00 0.00 ? 28  GLU A CG   2  
ATOM 2794  C CD   . GLU A 1 28  ? 3.960   14.114  16.833  1.00 0.00 ? 28  GLU A CD   2  
ATOM 2795  O OE1  . GLU A 1 28  ? 5.159   13.898  16.553  1.00 0.00 ? 28  GLU A OE1  2  
ATOM 2796  O OE2  . GLU A 1 28  ? 3.497   14.308  17.977  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 2797  H H    . GLU A 1 28  ? 2.054   14.662  12.645  1.00 0.00 ? 28  GLU A H    2  
ATOM 2798  H HA   . GLU A 1 28  ? 1.241   15.848  14.991  1.00 0.00 ? 28  GLU A HA   2  
ATOM 2799  H HB2  . GLU A 1 28  ? 3.825   14.890  13.833  1.00 0.00 ? 28  GLU A HB2  2  
ATOM 2800  H HB3  . GLU A 1 28  ? 3.961   15.997  15.185  1.00 0.00 ? 28  GLU A HB3  2  
ATOM 2801  H HG2  . GLU A 1 28  ? 1.955   14.265  16.049  1.00 0.00 ? 28  GLU A HG2  2  
ATOM 2802  H HG3  . GLU A 1 28  ? 2.999   13.193  15.136  1.00 0.00 ? 28  GLU A HG3  2  
ATOM 2803  N N    . GLU A 1 29  ? 2.707   17.830  12.840  1.00 0.00 ? 29  GLU A N    2  
ATOM 2804  C CA   . GLU A 1 29  ? 2.987   19.218  12.507  1.00 0.00 ? 29  GLU A CA   2  
ATOM 2805  C C    . GLU A 1 29  ? 1.686   19.963  12.199  1.00 0.00 ? 29  GLU A C    2  
ATOM 2806  O O    . GLU A 1 29  ? 1.429   21.026  12.760  1.00 0.00 ? 29  GLU A O    2  
ATOM 2807  C CB   . GLU A 1 29  ? 3.966   19.313  11.334  1.00 0.00 ? 29  GLU A CB   2  
ATOM 2808  C CG   . GLU A 1 29  ? 5.275   19.977  11.766  1.00 0.00 ? 29  GLU A CG   2  
ATOM 2809  C CD   . GLU A 1 29  ? 5.997   19.134  12.818  1.00 0.00 ? 29  GLU A CD   2  
ATOM 2810  O OE1  . GLU A 1 29  ? 6.632   18.138  12.409  1.00 0.00 ? 29  GLU A OE1  2  
ATOM 2811  O OE2  . GLU A 1 29  ? 5.897   19.503  14.008  1.00 0.00 ? 29  GLU A OE2  2  
ATOM 2812  H H    . GLU A 1 29  ? 2.870   17.177  12.100  1.00 0.00 ? 29  GLU A H    2  
ATOM 2813  H HA   . GLU A 1 29  ? 3.454   19.640  13.397  1.00 0.00 ? 29  GLU A HA   2  
ATOM 2814  H HB2  . GLU A 1 29  ? 4.170   18.317  10.945  1.00 0.00 ? 29  GLU A HB2  2  
ATOM 2815  H HB3  . GLU A 1 29  ? 3.513   19.885  10.524  1.00 0.00 ? 29  GLU A HB3  2  
ATOM 2816  H HG2  . GLU A 1 29  ? 5.921   20.113  10.898  1.00 0.00 ? 29  GLU A HG2  2  
ATOM 2817  H HG3  . GLU A 1 29  ? 5.068   20.969  12.168  1.00 0.00 ? 29  GLU A HG3  2  
ATOM 2818  N N    . LYS A 1 30  ? 0.902   19.374  11.307  1.00 0.00 ? 30  LYS A N    2  
ATOM 2819  C CA   . LYS A 1 30  ? -0.365  19.969  10.919  1.00 0.00 ? 30  LYS A CA   2  
ATOM 2820  C C    . LYS A 1 30  ? -1.478  19.421  11.815  1.00 0.00 ? 30  LYS A C    2  
ATOM 2821  O O    . LYS A 1 30  ? -1.985  20.130  12.682  1.00 0.00 ? 30  LYS A O    2  
ATOM 2822  C CB   . LYS A 1 30  ? -0.619  19.757  9.424   1.00 0.00 ? 30  LYS A CB   2  
ATOM 2823  C CG   . LYS A 1 30  ? 0.268   20.676  8.582   1.00 0.00 ? 30  LYS A CG   2  
ATOM 2824  C CD   . LYS A 1 30  ? 1.118   19.868  7.600   1.00 0.00 ? 30  LYS A CD   2  
ATOM 2825  C CE   . LYS A 1 30  ? 2.589   19.864  8.023   1.00 0.00 ? 30  LYS A CE   2  
ATOM 2826  N NZ   . LYS A 1 30  ? 3.462   20.161  6.865   1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2827  H H    . LYS A 1 30  ? 1.120   18.509  10.855  1.00 0.00 ? 30  LYS A H    2  
ATOM 2828  H HA   . LYS A 1 30  ? -0.286  21.043  11.082  1.00 0.00 ? 30  LYS A HA   2  
ATOM 2829  H HB2  . LYS A 1 30  ? -0.424  18.717  9.162   1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2830  H HB3  . LYS A 1 30  ? -1.668  19.951  9.200   1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2831  H HG2  . LYS A 1 30  ? -0.354  21.384  8.033   1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2832  H HG3  . LYS A 1 30  ? 0.916   21.260  9.234   1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2833  H HD2  . LYS A 1 30  ? 0.748   18.844  7.550   1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2834  H HD3  . LYS A 1 30  ? 1.024   20.290  6.599   1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2835  H HE2  . LYS A 1 30  ? 2.750   20.604  8.806   1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2836  H HE3  . LYS A 1 30  ? 2.849   18.893  8.443   1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2837  H HZ1  . LYS A 1 30  ? 2.928   20.618  6.154   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2838  H HZ2  . LYS A 1 30  ? 4.210   20.757  7.156   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2839  H HZ3  . LYS A 1 30  ? 3.837   19.307  6.503   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2840  N N    . ALA A 1 31  ? -1.823  18.165  11.575  1.00 0.00 ? 31  ALA A N    2  
ATOM 2841  C CA   . ALA A 1 31  ? -2.866  17.514  12.350  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2842  C C    . ALA A 1 31  ? -4.229  17.835  11.732  1.00 0.00 ? 31  ALA A C    2  
ATOM 2843  O O    . ALA A 1 31  ? -4.831  18.861  12.046  1.00 0.00 ? 31  ALA A O    2  
ATOM 2844  C CB   . ALA A 1 31  ? -2.769  17.959  13.810  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2845  H H    . ALA A 1 31  ? -1.405  17.596  10.866  1.00 0.00 ? 31  ALA A H    2  
ATOM 2846  H HA   . ALA A 1 31  ? -2.696  16.439  12.298  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2847  H HB1  . ALA A 1 31  ? -1.779  18.376  13.998  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2848  H HB2  . ALA A 1 31  ? -3.527  18.715  14.011  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2849  H HB3  . ALA A 1 31  ? -2.930  17.100  14.462  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2850  N N    . PHE A 1 32  ? -4.676  16.937  10.865  1.00 0.00 ? 32  PHE A N    2  
ATOM 2851  C CA   . PHE A 1 32  ? -5.956  17.112  10.202  1.00 0.00 ? 32  PHE A CA   2  
ATOM 2852  C C    . PHE A 1 32  ? -6.085  18.521  9.619   1.00 0.00 ? 32  PHE A C    2  
ATOM 2853  O O    . PHE A 1 32  ? -6.800  19.360  10.165  1.00 0.00 ? 32  PHE A O    2  
ATOM 2854  C CB   . PHE A 1 32  ? -7.041  16.910  11.261  1.00 0.00 ? 32  PHE A CB   2  
ATOM 2855  C CG   . PHE A 1 32  ? -7.426  15.447  11.487  1.00 0.00 ? 32  PHE A CG   2  
ATOM 2856  C CD1  . PHE A 1 32  ? -6.568  14.609  12.129  1.00 0.00 ? 32  PHE A CD1  2  
ATOM 2857  C CD2  . PHE A 1 32  ? -8.627  14.984  11.047  1.00 0.00 ? 32  PHE A CD2  2  
ATOM 2858  C CE1  . PHE A 1 32  ? -6.926  13.250  12.339  1.00 0.00 ? 32  PHE A CE1  2  
ATOM 2859  C CE2  . PHE A 1 32  ? -8.984  13.625  11.256  1.00 0.00 ? 32  PHE A CE2  2  
ATOM 2860  C CZ   . PHE A 1 32  ? -8.127  12.788  11.898  1.00 0.00 ? 32  PHE A CZ   2  
ATOM 2861  H H    . PHE A 1 32  ? -4.180  16.106  10.616  1.00 0.00 ? 32  PHE A H    2  
ATOM 2862  H HA   . PHE A 1 32  ? -6.005  16.381  9.394   1.00 0.00 ? 32  PHE A HA   2  
ATOM 2863  H HB2  . PHE A 1 32  ? -6.696  17.334  12.204  1.00 0.00 ? 32  PHE A HB2  2  
ATOM 2864  H HB3  . PHE A 1 32  ? -7.930  17.467  10.967  1.00 0.00 ? 32  PHE A HB3  2  
ATOM 2865  H HD1  . PHE A 1 32  ? -5.606  14.980  12.482  1.00 0.00 ? 32  PHE A HD1  2  
ATOM 2866  H HD2  . PHE A 1 32  ? -9.314  15.655  10.533  1.00 0.00 ? 32  PHE A HD2  2  
ATOM 2867  H HE1  . PHE A 1 32  ? -6.238  12.579  12.853  1.00 0.00 ? 32  PHE A HE1  2  
ATOM 2868  H HE2  . PHE A 1 32  ? -9.946  13.255  10.903  1.00 0.00 ? 32  PHE A HE2  2  
ATOM 2869  H HZ   . PHE A 1 32  ? -8.401  11.746  12.058  1.00 0.00 ? 32  PHE A HZ   2  
ATOM 2870  N N    . SER A 1 33  ? -5.381  18.737  8.518   1.00 0.00 ? 33  SER A N    2  
ATOM 2871  C CA   . SER A 1 33  ? -5.407  20.031  7.855   1.00 0.00 ? 33  SER A CA   2  
ATOM 2872  C C    . SER A 1 33  ? -5.654  19.846  6.357   1.00 0.00 ? 33  SER A C    2  
ATOM 2873  O O    . SER A 1 33  ? -5.698  18.719  5.866   1.00 0.00 ? 33  SER A O    2  
ATOM 2874  C CB   . SER A 1 33  ? -4.103  20.795  8.087   1.00 0.00 ? 33  SER A CB   2  
ATOM 2875  O OG   . SER A 1 33  ? -3.238  20.731  6.956   1.00 0.00 ? 33  SER A OG   2  
ATOM 2876  H H    . SER A 1 33  ? -4.801  18.050  8.080   1.00 0.00 ? 33  SER A H    2  
ATOM 2877  H HA   . SER A 1 33  ? -6.232  20.574  8.316   1.00 0.00 ? 33  SER A HA   2  
ATOM 2878  H HB2  . SER A 1 33  ? -4.328  21.838  8.312   1.00 0.00 ? 33  SER A HB2  2  
ATOM 2879  H HB3  . SER A 1 33  ? -3.591  20.384  8.957   1.00 0.00 ? 33  SER A HB3  2  
ATOM 2880  H HG   . SER A 1 33  ? -2.292  20.895  7.238   1.00 0.00 ? 33  SER A HG   2  
ATOM 2881  N N    . PRO A 1 34  ? -5.816  20.999  5.655   1.00 0.00 ? 34  PRO A N    2  
ATOM 2882  C CA   . PRO A 1 34  ? -6.058  20.976  4.222   1.00 0.00 ? 34  PRO A CA   2  
ATOM 2883  C C    . PRO A 1 34  ? -4.776  20.646  3.454   1.00 0.00 ? 34  PRO A C    2  
ATOM 2884  O O    . PRO A 1 34  ? -4.784  20.576  2.226   1.00 0.00 ? 34  PRO A O    2  
ATOM 2885  C CB   . PRO A 1 34  ? -6.609  22.353  3.894   1.00 0.00 ? 34  PRO A CB   2  
ATOM 2886  C CG   . PRO A 1 34  ? -6.221  23.246  5.060   1.00 0.00 ? 34  PRO A CG   2  
ATOM 2887  C CD   . PRO A 1 34  ? -5.771  22.352  6.203   1.00 0.00 ? 34  PRO A CD   2  
ATOM 2888  H HA   . PRO A 1 34  ? -6.708  20.251  3.992   1.00 0.00 ? 34  PRO A HA   2  
ATOM 2889  H HB2  . PRO A 1 34  ? -6.192  22.728  2.959   1.00 0.00 ? 34  PRO A HB2  2  
ATOM 2890  H HB3  . PRO A 1 34  ? -7.691  22.322  3.769   1.00 0.00 ? 34  PRO A HB3  2  
ATOM 2891  H HG2  . PRO A 1 34  ? -5.421  23.928  4.770   1.00 0.00 ? 34  PRO A HG2  2  
ATOM 2892  H HG3  . PRO A 1 34  ? -7.066  23.862  5.368   1.00 0.00 ? 34  PRO A HG3  2  
ATOM 2893  H HD2  . PRO A 1 34  ? -4.765  22.610  6.536   1.00 0.00 ? 34  PRO A HD2  2  
ATOM 2894  H HD3  . PRO A 1 34  ? -6.428  22.451  7.067   1.00 0.00 ? 34  PRO A HD3  2  
ATOM 2895  N N    . GLU A 1 35  ? -3.705  20.452  4.210   1.00 0.00 ? 35  GLU A N    2  
ATOM 2896  C CA   . GLU A 1 35  ? -2.419  20.131  3.616   1.00 0.00 ? 35  GLU A CA   2  
ATOM 2897  C C    . GLU A 1 35  ? -2.032  18.685  3.934   1.00 0.00 ? 35  GLU A C    2  
ATOM 2898  O O    . GLU A 1 35  ? -0.950  18.233  3.567   1.00 0.00 ? 35  GLU A O    2  
ATOM 2899  C CB   . GLU A 1 35  ? -1.338  21.104  4.091   1.00 0.00 ? 35  GLU A CB   2  
ATOM 2900  C CG   . GLU A 1 35  ? -0.411  21.499  2.939   1.00 0.00 ? 35  GLU A CG   2  
ATOM 2901  C CD   . GLU A 1 35  ? 0.465   20.321  2.511   1.00 0.00 ? 35  GLU A CD   2  
ATOM 2902  O OE1  . GLU A 1 35  ? -0.001  19.555  1.640   1.00 0.00 ? 35  GLU A OE1  2  
ATOM 2903  O OE2  . GLU A 1 35  ? 1.580   20.212  3.063   1.00 0.00 ? 35  GLU A OE2  2  
ATOM 2904  H H    . GLU A 1 35  ? -3.707  20.511  5.208   1.00 0.00 ? 35  GLU A H    2  
ATOM 2905  H HA   . GLU A 1 35  ? -2.558  20.249  2.541   1.00 0.00 ? 35  GLU A HA   2  
ATOM 2906  H HB2  . GLU A 1 35  ? -1.804  21.996  4.509   1.00 0.00 ? 35  GLU A HB2  2  
ATOM 2907  H HB3  . GLU A 1 35  ? -0.755  20.645  4.889   1.00 0.00 ? 35  GLU A HB3  2  
ATOM 2908  H HG2  . GLU A 1 35  ? -1.005  21.843  2.093   1.00 0.00 ? 35  GLU A HG2  2  
ATOM 2909  H HG3  . GLU A 1 35  ? 0.220   22.334  3.245   1.00 0.00 ? 35  GLU A HG3  2  
ATOM 2910  N N    . VAL A 1 36  ? -2.940  18.000  4.614   1.00 0.00 ? 36  VAL A N    2  
ATOM 2911  C CA   . VAL A 1 36  ? -2.708  16.615  4.986   1.00 0.00 ? 36  VAL A CA   2  
ATOM 2912  C C    . VAL A 1 36  ? -3.660  15.714  4.196   1.00 0.00 ? 36  VAL A C    2  
ATOM 2913  O O    . VAL A 1 36  ? -3.412  14.517  4.054   1.00 0.00 ? 36  VAL A O    2  
ATOM 2914  C CB   . VAL A 1 36  ? -2.847  16.450  6.501   1.00 0.00 ? 36  VAL A CB   2  
ATOM 2915  C CG1  . VAL A 1 36  ? -4.254  15.978  6.874   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2916  C CG2  . VAL A 1 36  ? -1.785  15.492  7.047   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2917  H H    . VAL A 1 36  ? -3.819  18.376  4.909   1.00 0.00 ? 36  VAL A H    2  
ATOM 2918  H HA   . VAL A 1 36  ? -1.683  16.368  4.712   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2919  H HB   . VAL A 1 36  ? -2.686  17.424  6.961   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2920  H HG11 . VAL A 1 36  ? -4.991  16.647  6.428   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2921  H HG12 . VAL A 1 36  ? -4.409  14.965  6.503   1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2922  H HG13 . VAL A 1 36  ? -4.364  15.988  7.959   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2923  H HG21 . VAL A 1 36  ? -0.805  15.782  6.667   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2924  H HG22 . VAL A 1 36  ? -1.780  15.539  8.136   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2925  H HG23 . VAL A 1 36  ? -2.013  14.476  6.727   1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2926  N N    . ILE A 1 37  ? -4.729  16.322  3.705   1.00 0.00 ? 37  ILE A N    2  
ATOM 2927  C CA   . ILE A 1 37  ? -5.719  15.590  2.934   1.00 0.00 ? 37  ILE A CA   2  
ATOM 2928  C C    . ILE A 1 37  ? -5.086  15.106  1.628   1.00 0.00 ? 37  ILE A C    2  
ATOM 2929  O O    . ILE A 1 37  ? -5.315  13.973  1.204   1.00 0.00 ? 37  ILE A O    2  
ATOM 2930  C CB   . ILE A 1 37  ? -6.976  16.439  2.731   1.00 0.00 ? 37  ILE A CB   2  
ATOM 2931  C CG1  . ILE A 1 37  ? -7.456  17.034  4.056   1.00 0.00 ? 37  ILE A CG1  2  
ATOM 2932  C CG2  . ILE A 1 37  ? -8.074  15.634  2.034   1.00 0.00 ? 37  ILE A CG2  2  
ATOM 2933  C CD1  . ILE A 1 37  ? -8.584  16.195  4.658   1.00 0.00 ? 37  ILE A CD1  2  
ATOM 2934  H H    . ILE A 1 37  ? -4.923  17.295  3.826   1.00 0.00 ? 37  ILE A H    2  
ATOM 2935  H HA   . ILE A 1 37  ? -6.010  14.718  3.520   1.00 0.00 ? 37  ILE A HA   2  
ATOM 2936  H HB   . ILE A 1 37  ? -6.722  17.272  2.077   1.00 0.00 ? 37  ILE A HB   2  
ATOM 2937  H HG12 . ILE A 1 37  ? -6.623  17.087  4.757   1.00 0.00 ? 37  ILE A HG12 2  
ATOM 2938  H HG13 . ILE A 1 37  ? -7.802  18.055  3.896   1.00 0.00 ? 37  ILE A HG13 2  
ATOM 2939  H HG21 . ILE A 1 37  ? -8.122  14.634  2.464   1.00 0.00 ? 37  ILE A HG21 2  
ATOM 2940  H HG22 . ILE A 1 37  ? -9.033  16.134  2.169   1.00 0.00 ? 37  ILE A HG22 2  
ATOM 2941  H HG23 . ILE A 1 37  ? -7.851  15.560  0.969   1.00 0.00 ? 37  ILE A HG23 2  
ATOM 2942  H HD11 . ILE A 1 37  ? -8.464  15.155  4.356   1.00 0.00 ? 37  ILE A HD11 2  
ATOM 2943  H HD12 . ILE A 1 37  ? -8.547  16.264  5.745   1.00 0.00 ? 37  ILE A HD12 2  
ATOM 2944  H HD13 . ILE A 1 37  ? -9.544  16.570  4.302   1.00 0.00 ? 37  ILE A HD13 2  
ATOM 2945  N N    . PRO A 1 38  ? -4.281  16.010  1.009   1.00 0.00 ? 38  PRO A N    2  
ATOM 2946  C CA   . PRO A 1 38  ? -3.613  15.688  -0.240  1.00 0.00 ? 38  PRO A CA   2  
ATOM 2947  C C    . PRO A 1 38  ? -2.431  14.747  -0.002  1.00 0.00 ? 38  PRO A C    2  
ATOM 2948  O O    . PRO A 1 38  ? -2.157  13.869  -0.819  1.00 0.00 ? 38  PRO A O    2  
ATOM 2949  C CB   . PRO A 1 38  ? -3.198  17.028  -0.821  1.00 0.00 ? 38  PRO A CB   2  
ATOM 2950  C CG   . PRO A 1 38  ? -3.232  18.014  0.335   1.00 0.00 ? 38  PRO A CG   2  
ATOM 2951  C CD   . PRO A 1 38  ? -3.986  17.361  1.481   1.00 0.00 ? 38  PRO A CD   2  
ATOM 2952  H HA   . PRO A 1 38  ? -4.235  15.196  -0.849  1.00 0.00 ? 38  PRO A HA   2  
ATOM 2953  H HB2  . PRO A 1 38  ? -2.200  16.973  -1.258  1.00 0.00 ? 38  PRO A HB2  2  
ATOM 2954  H HB3  . PRO A 1 38  ? -3.876  17.337  -1.617  1.00 0.00 ? 38  PRO A HB3  2  
ATOM 2955  H HG2  . PRO A 1 38  ? -2.221  18.276  0.644   1.00 0.00 ? 38  PRO A HG2  2  
ATOM 2956  H HG3  . PRO A 1 38  ? -3.723  18.940  0.034   1.00 0.00 ? 38  PRO A HG3  2  
ATOM 2957  H HD2  . PRO A 1 38  ? -3.386  17.340  2.390   1.00 0.00 ? 38  PRO A HD2  2  
ATOM 2958  H HD3  . PRO A 1 38  ? -4.900  17.906  1.716   1.00 0.00 ? 38  PRO A HD3  2  
ATOM 2959  N N    . MET A 1 39  ? -1.760  14.963  1.121   1.00 0.00 ? 39  MET A N    2  
ATOM 2960  C CA   . MET A 1 39  ? -0.613  14.145  1.476   1.00 0.00 ? 39  MET A CA   2  
ATOM 2961  C C    . MET A 1 39  ? -1.035  12.700  1.755   1.00 0.00 ? 39  MET A C    2  
ATOM 2962  O O    . MET A 1 39  ? -0.293  11.766  1.457   1.00 0.00 ? 39  MET A O    2  
ATOM 2963  C CB   . MET A 1 39  ? 0.064   14.728  2.718   1.00 0.00 ? 39  MET A CB   2  
ATOM 2964  C CG   . MET A 1 39  ? 1.468   15.239  2.388   1.00 0.00 ? 39  MET A CG   2  
ATOM 2965  S SD   . MET A 1 39  ? 2.628   13.881  2.386   1.00 0.00 ? 39  MET A SD   2  
ATOM 2966  C CE   . MET A 1 39  ? 2.552   13.406  4.105   1.00 0.00 ? 39  MET A CE   2  
ATOM 2967  H H    . MET A 1 39  ? -1.989  15.680  1.779   1.00 0.00 ? 39  MET A H    2  
ATOM 2968  H HA   . MET A 1 39  ? 0.049   14.178  0.611   1.00 0.00 ? 39  MET A HA   2  
ATOM 2969  H HB2  . MET A 1 39  ? -0.539  15.543  3.116   1.00 0.00 ? 39  MET A HB2  2  
ATOM 2970  H HB3  . MET A 1 39  ? 0.124   13.966  3.496   1.00 0.00 ? 39  MET A HB3  2  
ATOM 2971  H HG2  . MET A 1 39  ? 1.466   15.728  1.414   1.00 0.00 ? 39  MET A HG2  2  
ATOM 2972  H HG3  . MET A 1 39  ? 1.773   15.987  3.121   1.00 0.00 ? 39  MET A HG3  2  
ATOM 2973  H HE1  . MET A 1 39  ? 2.524   14.300  4.727   1.00 0.00 ? 39  MET A HE1  2  
ATOM 2974  H HE2  . MET A 1 39  ? 1.654   12.813  4.279   1.00 0.00 ? 39  MET A HE2  2  
ATOM 2975  H HE3  . MET A 1 39  ? 3.431   12.814  4.357   1.00 0.00 ? 39  MET A HE3  2  
ATOM 2976  N N    . PHE A 1 40  ? -2.224  12.564  2.323   1.00 0.00 ? 40  PHE A N    2  
ATOM 2977  C CA   . PHE A 1 40  ? -2.753  11.249  2.644   1.00 0.00 ? 40  PHE A CA   2  
ATOM 2978  C C    . PHE A 1 40  ? -3.253  10.537  1.386   1.00 0.00 ? 40  PHE A C    2  
ATOM 2979  O O    . PHE A 1 40  ? -2.978  9.355   1.187   1.00 0.00 ? 40  PHE A O    2  
ATOM 2980  C CB   . PHE A 1 40  ? -3.930  11.463  3.598   1.00 0.00 ? 40  PHE A CB   2  
ATOM 2981  C CG   . PHE A 1 40  ? -4.179  10.292  4.551   1.00 0.00 ? 40  PHE A CG   2  
ATOM 2982  C CD1  . PHE A 1 40  ? -3.153  9.784   5.287   1.00 0.00 ? 40  PHE A CD1  2  
ATOM 2983  C CD2  . PHE A 1 40  ? -5.425  9.758   4.662   1.00 0.00 ? 40  PHE A CD2  2  
ATOM 2984  C CE1  . PHE A 1 40  ? -3.384  8.698   6.171   1.00 0.00 ? 40  PHE A CE1  2  
ATOM 2985  C CE2  . PHE A 1 40  ? -5.656  8.672   5.548   1.00 0.00 ? 40  PHE A CE2  2  
ATOM 2986  C CZ   . PHE A 1 40  ? -4.631  8.165   6.283   1.00 0.00 ? 40  PHE A CZ   2  
ATOM 2987  H H    . PHE A 1 40  ? -2.821  13.330  2.561   1.00 0.00 ? 40  PHE A H    2  
ATOM 2988  H HA   . PHE A 1 40  ? -1.940  10.673  3.087   1.00 0.00 ? 40  PHE A HA   2  
ATOM 2989  H HB2  . PHE A 1 40  ? -3.751  12.364  4.184   1.00 0.00 ? 40  PHE A HB2  2  
ATOM 2990  H HB3  . PHE A 1 40  ? -4.833  11.638  3.011   1.00 0.00 ? 40  PHE A HB3  2  
ATOM 2991  H HD1  . PHE A 1 40  ? -2.155  10.212  5.197   1.00 0.00 ? 40  PHE A HD1  2  
ATOM 2992  H HD2  . PHE A 1 40  ? -6.246  10.165  4.073   1.00 0.00 ? 40  PHE A HD2  2  
ATOM 2993  H HE1  . PHE A 1 40  ? -2.562  8.291   6.761   1.00 0.00 ? 40  PHE A HE1  2  
ATOM 2994  H HE2  . PHE A 1 40  ? -6.654  8.244   5.637   1.00 0.00 ? 40  PHE A HE2  2  
ATOM 2995  H HZ   . PHE A 1 40  ? -4.807  7.331   6.962   1.00 0.00 ? 40  PHE A HZ   2  
ATOM 2996  N N    . SER A 1 41  ? -3.980  11.285  0.569   1.00 0.00 ? 41  SER A N    2  
ATOM 2997  C CA   . SER A 1 41  ? -4.520  10.740  -0.663  1.00 0.00 ? 41  SER A CA   2  
ATOM 2998  C C    . SER A 1 41  ? -3.387  10.211  -1.544  1.00 0.00 ? 41  SER A C    2  
ATOM 2999  O O    . SER A 1 41  ? -3.506  9.141   -2.140  1.00 0.00 ? 41  SER A O    2  
ATOM 3000  C CB   . SER A 1 41  ? -5.334  11.792  -1.421  1.00 0.00 ? 41  SER A CB   2  
ATOM 3001  O OG   . SER A 1 41  ? -5.017  13.116  -1.002  1.00 0.00 ? 41  SER A OG   2  
ATOM 3002  H H    . SER A 1 41  ? -4.199  12.246  0.739   1.00 0.00 ? 41  SER A H    2  
ATOM 3003  H HA   . SER A 1 41  ? -5.177  9.927   -0.355  1.00 0.00 ? 41  SER A HA   2  
ATOM 3004  H HB2  . SER A 1 41  ? -5.145  11.694  -2.490  1.00 0.00 ? 41  SER A HB2  2  
ATOM 3005  H HB3  . SER A 1 41  ? -6.397  11.608  -1.267  1.00 0.00 ? 41  SER A HB3  2  
ATOM 3006  H HG   . SER A 1 41  ? -4.024  13.226  -0.938  1.00 0.00 ? 41  SER A HG   2  
ATOM 3007  N N    . ALA A 1 42  ? -2.312  10.984  -1.597  1.00 0.00 ? 42  ALA A N    2  
ATOM 3008  C CA   . ALA A 1 42  ? -1.157  10.606  -2.394  1.00 0.00 ? 42  ALA A CA   2  
ATOM 3009  C C    . ALA A 1 42  ? -0.482  9.388   -1.761  1.00 0.00 ? 42  ALA A C    2  
ATOM 3010  O O    . ALA A 1 42  ? -0.176  8.417   -2.450  1.00 0.00 ? 42  ALA A O    2  
ATOM 3011  C CB   . ALA A 1 42  ? -0.210  11.801  -2.517  1.00 0.00 ? 42  ALA A CB   2  
ATOM 3012  H H    . ALA A 1 42  ? -2.223  11.852  -1.109  1.00 0.00 ? 42  ALA A H    2  
ATOM 3013  H HA   . ALA A 1 42  ? -1.514  10.338  -3.389  1.00 0.00 ? 42  ALA A HA   2  
ATOM 3014  H HB1  . ALA A 1 42  ? -0.590  12.630  -1.921  1.00 0.00 ? 42  ALA A HB1  2  
ATOM 3015  H HB2  . ALA A 1 42  ? -0.141  12.105  -3.562  1.00 0.00 ? 42  ALA A HB2  2  
ATOM 3016  H HB3  . ALA A 1 42  ? 0.780   11.519  -2.155  1.00 0.00 ? 42  ALA A HB3  2  
ATOM 3017  N N    . LEU A 1 43  ? -0.269  9.481   -0.457  1.00 0.00 ? 43  LEU A N    2  
ATOM 3018  C CA   . LEU A 1 43  ? 0.365   8.399   0.277   1.00 0.00 ? 43  LEU A CA   2  
ATOM 3019  C C    . LEU A 1 43  ? -0.493  7.137   0.159   1.00 0.00 ? 43  LEU A C    2  
ATOM 3020  O O    . LEU A 1 43  ? 0.003   6.026   0.337   1.00 0.00 ? 43  LEU A O    2  
ATOM 3021  C CB   . LEU A 1 43  ? 0.642   8.821   1.721   1.00 0.00 ? 43  LEU A CB   2  
ATOM 3022  C CG   . LEU A 1 43  ? 2.038   9.379   2.001   1.00 0.00 ? 43  LEU A CG   2  
ATOM 3023  C CD1  . LEU A 1 43  ? 1.965   10.838  2.454   1.00 0.00 ? 43  LEU A CD1  2  
ATOM 3024  C CD2  . LEU A 1 43  ? 2.787   8.503   3.007   1.00 0.00 ? 43  LEU A CD2  2  
ATOM 3025  H H    . LEU A 1 43  ? -0.521  10.276  0.096   1.00 0.00 ? 43  LEU A H    2  
ATOM 3026  H HA   . LEU A 1 43  ? 1.329   8.207   -0.193  1.00 0.00 ? 43  LEU A HA   2  
ATOM 3027  H HB2  . LEU A 1 43  ? -0.093  9.574   2.007   1.00 0.00 ? 43  LEU A HB2  2  
ATOM 3028  H HB3  . LEU A 1 43  ? 0.480   7.958   2.368   1.00 0.00 ? 43  LEU A HB3  2  
ATOM 3029  H HG   . LEU A 1 43  ? 2.607   9.358   1.071   1.00 0.00 ? 43  LEU A HG   2  
ATOM 3030  H HD11 . LEU A 1 43  ? 1.050   10.996  3.027   1.00 0.00 ? 43  LEU A HD11 2  
ATOM 3031  H HD12 . LEU A 1 43  ? 2.828   11.069  3.078   1.00 0.00 ? 43  LEU A HD12 2  
ATOM 3032  H HD13 . LEU A 1 43  ? 1.963   11.490  1.581   1.00 0.00 ? 43  LEU A HD13 2  
ATOM 3033  H HD21 . LEU A 1 43  ? 2.133   8.276   3.850   1.00 0.00 ? 43  LEU A HD21 2  
ATOM 3034  H HD22 . LEU A 1 43  ? 3.094   7.576   2.525   1.00 0.00 ? 43  LEU A HD22 2  
ATOM 3035  H HD23 . LEU A 1 43  ? 3.668   9.034   3.366   1.00 0.00 ? 43  LEU A HD23 2  
ATOM 3036  N N    . SER A 1 44  ? -1.765  7.352   -0.141  1.00 0.00 ? 44  SER A N    2  
ATOM 3037  C CA   . SER A 1 44  ? -2.698  6.246   -0.286  1.00 0.00 ? 44  SER A CA   2  
ATOM 3038  C C    . SER A 1 44  ? -3.064  6.059   -1.759  1.00 0.00 ? 44  SER A C    2  
ATOM 3039  O O    . SER A 1 44  ? -4.212  5.763   -2.084  1.00 0.00 ? 44  SER A O    2  
ATOM 3040  C CB   . SER A 1 44  ? -3.958  6.476   0.550   1.00 0.00 ? 44  SER A CB   2  
ATOM 3041  O OG   . SER A 1 44  ? -4.956  7.191   -0.174  1.00 0.00 ? 44  SER A OG   2  
ATOM 3042  H H    . SER A 1 44  ? -2.161  8.259   -0.284  1.00 0.00 ? 44  SER A H    2  
ATOM 3043  H HA   . SER A 1 44  ? -2.167  5.371   0.091   1.00 0.00 ? 44  SER A HA   2  
ATOM 3044  H HB2  . SER A 1 44  ? -4.362  5.514   0.868   1.00 0.00 ? 44  SER A HB2  2  
ATOM 3045  H HB3  . SER A 1 44  ? -3.699  7.027   1.454   1.00 0.00 ? 44  SER A HB3  2  
ATOM 3046  H HG   . SER A 1 44  ? -5.861  6.986   0.197   1.00 0.00 ? 44  SER A HG   2  
ATOM 3047  N N    . GLU A 1 45  ? -2.066  6.240   -2.612  1.00 0.00 ? 45  GLU A N    2  
ATOM 3048  C CA   . GLU A 1 45  ? -2.269  6.096   -4.043  1.00 0.00 ? 45  GLU A CA   2  
ATOM 3049  C C    . GLU A 1 45  ? -3.004  4.789   -4.346  1.00 0.00 ? 45  GLU A C    2  
ATOM 3050  O O    . GLU A 1 45  ? -3.993  4.783   -5.077  1.00 0.00 ? 45  GLU A O    2  
ATOM 3051  C CB   . GLU A 1 45  ? -0.938  6.164   -4.796  1.00 0.00 ? 45  GLU A CB   2  
ATOM 3052  C CG   . GLU A 1 45  ? -0.855  7.430   -5.650  1.00 0.00 ? 45  GLU A CG   2  
ATOM 3053  C CD   . GLU A 1 45  ? 0.301   7.343   -6.648  1.00 0.00 ? 45  GLU A CD   2  
ATOM 3054  O OE1  . GLU A 1 45  ? 0.190   6.511   -7.575  1.00 0.00 ? 45  GLU A OE1  2  
ATOM 3055  O OE2  . GLU A 1 45  ? 1.271   8.110   -6.463  1.00 0.00 ? 45  GLU A OE2  2  
ATOM 3056  H H    . GLU A 1 45  ? -1.135  6.481   -2.340  1.00 0.00 ? 45  GLU A H    2  
ATOM 3057  H HA   . GLU A 1 45  ? -2.888  6.945   -4.335  1.00 0.00 ? 45  GLU A HA   2  
ATOM 3058  H HB2  . GLU A 1 45  ? -0.113  6.146   -4.084  1.00 0.00 ? 45  GLU A HB2  2  
ATOM 3059  H HB3  . GLU A 1 45  ? -0.830  5.285   -5.430  1.00 0.00 ? 45  GLU A HB3  2  
ATOM 3060  H HG2  . GLU A 1 45  ? -1.793  7.574   -6.186  1.00 0.00 ? 45  GLU A HG2  2  
ATOM 3061  H HG3  . GLU A 1 45  ? -0.719  8.299   -5.006  1.00 0.00 ? 45  GLU A HG3  2  
ATOM 3062  N N    . GLY A 1 46  ? -2.492  3.712   -3.769  1.00 0.00 ? 46  GLY A N    2  
ATOM 3063  C CA   . GLY A 1 46  ? -3.088  2.402   -3.967  1.00 0.00 ? 46  GLY A CA   2  
ATOM 3064  C C    . GLY A 1 46  ? -2.710  1.449   -2.830  1.00 0.00 ? 46  GLY A C    2  
ATOM 3065  O O    . GLY A 1 46  ? -2.306  0.313   -3.076  1.00 0.00 ? 46  GLY A O    2  
ATOM 3066  H H    . GLY A 1 46  ? -1.687  3.725   -3.175  1.00 0.00 ? 46  GLY A H    2  
ATOM 3067  H HA2  . GLY A 1 46  ? -4.172  2.496   -4.022  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 3068  H HA3  . GLY A 1 46  ? -2.755  1.987   -4.919  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 3069  N N    . ALA A 1 47  ? -2.854  1.948   -1.611  1.00 0.00 ? 47  ALA A N    2  
ATOM 3070  C CA   . ALA A 1 47  ? -2.533  1.156   -0.436  1.00 0.00 ? 47  ALA A CA   2  
ATOM 3071  C C    . ALA A 1 47  ? -3.658  0.149   -0.182  1.00 0.00 ? 47  ALA A C    2  
ATOM 3072  O O    . ALA A 1 47  ? -4.773  0.323   -0.670  1.00 0.00 ? 47  ALA A O    2  
ATOM 3073  C CB   . ALA A 1 47  ? -2.301  2.084   0.757   1.00 0.00 ? 47  ALA A CB   2  
ATOM 3074  H H    . ALA A 1 47  ? -3.183  2.873   -1.420  1.00 0.00 ? 47  ALA A H    2  
ATOM 3075  H HA   . ALA A 1 47  ? -1.611  0.613   -0.643  1.00 0.00 ? 47  ALA A HA   2  
ATOM 3076  H HB1  . ALA A 1 47  ? -1.296  2.503   0.703   1.00 0.00 ? 47  ALA A HB1  2  
ATOM 3077  H HB2  . ALA A 1 47  ? -3.033  2.892   0.737   1.00 0.00 ? 47  ALA A HB2  2  
ATOM 3078  H HB3  . ALA A 1 47  ? -2.410  1.519   1.683   1.00 0.00 ? 47  ALA A HB3  2  
ATOM 3079  N N    . THR A 1 48  ? -3.324  -0.882  0.580   1.00 0.00 ? 48  THR A N    2  
ATOM 3080  C CA   . THR A 1 48  ? -4.291  -1.917  0.905   1.00 0.00 ? 48  THR A CA   2  
ATOM 3081  C C    . THR A 1 48  ? -5.165  -1.479  2.081   1.00 0.00 ? 48  THR A C    2  
ATOM 3082  O O    . THR A 1 48  ? -5.103  -0.328  2.512   1.00 0.00 ? 48  THR A O    2  
ATOM 3083  C CB   . THR A 1 48  ? -3.525  -3.215  1.166   1.00 0.00 ? 48  THR A CB   2  
ATOM 3084  O OG1  . THR A 1 48  ? -3.259  -3.185  2.566   1.00 0.00 ? 48  THR A OG1  2  
ATOM 3085  C CG2  . THR A 1 48  ? -2.137  -3.215  0.523   1.00 0.00 ? 48  THR A CG2  2  
ATOM 3086  H H    . THR A 1 48  ? -2.414  -1.016  0.973   1.00 0.00 ? 48  THR A H    2  
ATOM 3087  H HA   . THR A 1 48  ? -4.951  -2.051  0.048   1.00 0.00 ? 48  THR A HA   2  
ATOM 3088  H HB   . THR A 1 48  ? -4.103  -4.080  0.844   1.00 0.00 ? 48  THR A HB   2  
ATOM 3089  H HG1  . THR A 1 48  ? -2.553  -2.504  2.765   1.00 0.00 ? 48  THR A HG1  2  
ATOM 3090  H HG21 . THR A 1 48  ? -2.150  -2.594  -0.372  1.00 0.00 ? 48  THR A HG21 2  
ATOM 3091  H HG22 . THR A 1 48  ? -1.409  -2.818  1.231   1.00 0.00 ? 48  THR A HG22 2  
ATOM 3092  H HG23 . THR A 1 48  ? -1.862  -4.235  0.253   1.00 0.00 ? 48  THR A HG23 2  
ATOM 3093  N N    . PRO A 1 49  ? -5.982  -2.445  2.580   1.00 0.00 ? 49  PRO A N    2  
ATOM 3094  C CA   . PRO A 1 49  ? -6.868  -2.171  3.700   1.00 0.00 ? 49  PRO A CA   2  
ATOM 3095  C C    . PRO A 1 49  ? -6.088  -2.103  5.013   1.00 0.00 ? 49  PRO A C    2  
ATOM 3096  O O    . PRO A 1 49  ? -6.397  -1.289  5.882   1.00 0.00 ? 49  PRO A O    2  
ATOM 3097  C CB   . PRO A 1 49  ? -7.892  -3.294  3.674   1.00 0.00 ? 49  PRO A CB   2  
ATOM 3098  C CG   . PRO A 1 49  ? -7.274  -4.402  2.837   1.00 0.00 ? 49  PRO A CG   2  
ATOM 3099  C CD   . PRO A 1 49  ? -6.083  -3.818  2.095   1.00 0.00 ? 49  PRO A CD   2  
ATOM 3100  H HA   . PRO A 1 49  ? -7.298  -1.275  3.590   1.00 0.00 ? 49  PRO A HA   2  
ATOM 3101  H HB2  . PRO A 1 49  ? -8.114  -3.643  4.683   1.00 0.00 ? 49  PRO A HB2  2  
ATOM 3102  H HB3  . PRO A 1 49  ? -8.834  -2.955  3.240   1.00 0.00 ? 49  PRO A HB3  2  
ATOM 3103  H HG2  . PRO A 1 49  ? -6.961  -5.231  3.472   1.00 0.00 ? 49  PRO A HG2  2  
ATOM 3104  H HG3  . PRO A 1 49  ? -8.005  -4.801  2.132   1.00 0.00 ? 49  PRO A HG3  2  
ATOM 3105  H HD2  . PRO A 1 49  ? -5.173  -4.379  2.304   1.00 0.00 ? 49  PRO A HD2  2  
ATOM 3106  H HD3  . PRO A 1 49  ? -6.235  -3.847  1.017   1.00 0.00 ? 49  PRO A HD3  2  
ATOM 3107  N N    . GLN A 1 50  ? -5.090  -2.970  5.117   1.00 0.00 ? 50  GLN A N    2  
ATOM 3108  C CA   . GLN A 1 50  ? -4.263  -3.018  6.311   1.00 0.00 ? 50  GLN A CA   2  
ATOM 3109  C C    . GLN A 1 50  ? -3.357  -1.788  6.379   1.00 0.00 ? 50  GLN A C    2  
ATOM 3110  O O    . GLN A 1 50  ? -3.025  -1.316  7.466   1.00 0.00 ? 50  GLN A O    2  
ATOM 3111  C CB   . GLN A 1 50  ? -3.441  -4.308  6.356   1.00 0.00 ? 50  GLN A CB   2  
ATOM 3112  C CG   . GLN A 1 50  ? -4.140  -5.375  7.203   1.00 0.00 ? 50  GLN A CG   2  
ATOM 3113  C CD   . GLN A 1 50  ? -3.200  -6.546  7.494   1.00 0.00 ? 50  GLN A CD   2  
ATOM 3114  O OE1  . GLN A 1 50  ? -2.009  -6.500  7.232   1.00 0.00 ? 50  GLN A OE1  2  
ATOM 3115  N NE2  . GLN A 1 50  ? -3.799  -7.594  8.051   1.00 0.00 ? 50  GLN A NE2  2  
ATOM 3116  H H    . GLN A 1 50  ? -4.846  -3.629  4.406   1.00 0.00 ? 50  GLN A H    2  
ATOM 3117  H HA   . GLN A 1 50  ? -4.961  -3.010  7.148   1.00 0.00 ? 50  GLN A HA   2  
ATOM 3118  H HB2  . GLN A 1 50  ? -3.291  -4.683  5.344   1.00 0.00 ? 50  GLN A HB2  2  
ATOM 3119  H HB3  . GLN A 1 50  ? -2.454  -4.100  6.769   1.00 0.00 ? 50  GLN A HB3  2  
ATOM 3120  H HG2  . GLN A 1 50  ? -4.481  -4.935  8.139   1.00 0.00 ? 50  GLN A HG2  2  
ATOM 3121  H HG3  . GLN A 1 50  ? -5.025  -5.736  6.679   1.00 0.00 ? 50  GLN A HG3  2  
ATOM 3122  H HE21 . GLN A 1 50  ? -4.781  -7.567  8.241   1.00 0.00 ? 50  GLN A HE21 2  
ATOM 3123  H HE22 . GLN A 1 50  ? -3.268  -8.410  8.280   1.00 0.00 ? 50  GLN A HE22 2  
ATOM 3124  N N    . ASP A 1 51  ? -2.983  -1.303  5.205   1.00 0.00 ? 51  ASP A N    2  
ATOM 3125  C CA   . ASP A 1 51  ? -2.121  -0.136  5.117   1.00 0.00 ? 51  ASP A CA   2  
ATOM 3126  C C    . ASP A 1 51  ? -2.922  1.114   5.489   1.00 0.00 ? 51  ASP A C    2  
ATOM 3127  O O    . ASP A 1 51  ? -2.582  1.812   6.442   1.00 0.00 ? 51  ASP A O    2  
ATOM 3128  C CB   . ASP A 1 51  ? -1.588  0.050   3.696   1.00 0.00 ? 51  ASP A CB   2  
ATOM 3129  C CG   . ASP A 1 51  ? -0.807  1.345   3.462   1.00 0.00 ? 51  ASP A CG   2  
ATOM 3130  O OD1  . ASP A 1 51  ? -1.437  2.417   3.578   1.00 0.00 ? 51  ASP A OD1  2  
ATOM 3131  O OD2  . ASP A 1 51  ? 0.404   1.232   3.172   1.00 0.00 ? 51  ASP A OD2  2  
ATOM 3132  H H    . ASP A 1 51  ? -3.257  -1.692  4.326   1.00 0.00 ? 51  ASP A H    2  
ATOM 3133  H HA   . ASP A 1 51  ? -1.304  -0.329  5.812   1.00 0.00 ? 51  ASP A HA   2  
ATOM 3134  H HB2  . ASP A 1 51  ? -0.943  -0.794  3.451   1.00 0.00 ? 51  ASP A HB2  2  
ATOM 3135  H HB3  . ASP A 1 51  ? -2.428  0.020   3.001   1.00 0.00 ? 51  ASP A HB3  2  
ATOM 3136  N N    . LEU A 1 52  ? -3.970  1.357   4.716   1.00 0.00 ? 52  LEU A N    2  
ATOM 3137  C CA   . LEU A 1 52  ? -4.822  2.510   4.952   1.00 0.00 ? 52  LEU A CA   2  
ATOM 3138  C C    . LEU A 1 52  ? -5.401  2.429   6.365   1.00 0.00 ? 52  LEU A C    2  
ATOM 3139  O O    . LEU A 1 52  ? -5.610  3.453   7.015   1.00 0.00 ? 52  LEU A O    2  
ATOM 3140  C CB   . LEU A 1 52  ? -5.886  2.624   3.858   1.00 0.00 ? 52  LEU A CB   2  
ATOM 3141  C CG   . LEU A 1 52  ? -5.560  3.572   2.702   1.00 0.00 ? 52  LEU A CG   2  
ATOM 3142  C CD1  . LEU A 1 52  ? -6.724  3.652   1.713   1.00 0.00 ? 52  LEU A CD1  2  
ATOM 3143  C CD2  . LEU A 1 52  ? -5.154  4.952   3.222   1.00 0.00 ? 52  LEU A CD2  2  
ATOM 3144  H H    . LEU A 1 52  ? -4.240  0.784   3.942   1.00 0.00 ? 52  LEU A H    2  
ATOM 3145  H HA   . LEU A 1 52  ? -4.195  3.399   4.886   1.00 0.00 ? 52  LEU A HA   2  
ATOM 3146  H HB2  . LEU A 1 52  ? -6.063  1.630   3.447   1.00 0.00 ? 52  LEU A HB2  2  
ATOM 3147  H HB3  . LEU A 1 52  ? -6.818  2.950   4.317   1.00 0.00 ? 52  LEU A HB3  2  
ATOM 3148  H HG   . LEU A 1 52  ? -4.705  3.168   2.159   1.00 0.00 ? 52  LEU A HG   2  
ATOM 3149  H HD11 . LEU A 1 52  ? -7.667  3.586   2.256   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 3150  H HD12 . LEU A 1 52  ? -6.681  4.600   1.176   1.00 0.00 ? 52  LEU A HD12 2  
ATOM 3151  H HD13 . LEU A 1 52  ? -6.656  2.828   1.003   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 3152  H HD21 . LEU A 1 52  ? -5.486  5.062   4.255   1.00 0.00 ? 52  LEU A HD21 2  
ATOM 3153  H HD22 . LEU A 1 52  ? -4.070  5.053   3.178   1.00 0.00 ? 52  LEU A HD22 2  
ATOM 3154  H HD23 . LEU A 1 52  ? -5.617  5.723   2.607   1.00 0.00 ? 52  LEU A HD23 2  
ATOM 3155  N N    . ASN A 1 53  ? -5.647  1.202   6.802   1.00 0.00 ? 53  ASN A N    2  
ATOM 3156  C CA   . ASN A 1 53  ? -6.198  0.976   8.127   1.00 0.00 ? 53  ASN A CA   2  
ATOM 3157  C C    . ASN A 1 53  ? -5.175  1.404   9.180   1.00 0.00 ? 53  ASN A C    2  
ATOM 3158  O O    . ASN A 1 53  ? -5.528  2.050   10.167  1.00 0.00 ? 53  ASN A O    2  
ATOM 3159  C CB   . ASN A 1 53  ? -6.509  -0.507  8.347   1.00 0.00 ? 53  ASN A CB   2  
ATOM 3160  C CG   . ASN A 1 53  ? -6.759  -0.799  9.828   1.00 0.00 ? 53  ASN A CG   2  
ATOM 3161  O OD1  . ASN A 1 53  ? -5.909  -1.310  10.539  1.00 0.00 ? 53  ASN A OD1  2  
ATOM 3162  N ND2  . ASN A 1 53  ? -7.972  -0.451  10.251  1.00 0.00 ? 53  ASN A ND2  2  
ATOM 3163  H H    . ASN A 1 53  ? -5.474  0.375   6.268   1.00 0.00 ? 53  ASN A H    2  
ATOM 3164  H HA   . ASN A 1 53  ? -7.110  1.570   8.164   1.00 0.00 ? 53  ASN A HA   2  
ATOM 3165  H HB2  . ASN A 1 53  ? -7.386  -0.788  7.763   1.00 0.00 ? 53  ASN A HB2  2  
ATOM 3166  H HB3  . ASN A 1 53  ? -5.678  -1.114  7.988   1.00 0.00 ? 53  ASN A HB3  2  
ATOM 3167  H HD21 . ASN A 1 53  ? -8.623  -0.037  9.615   1.00 0.00 ? 53  ASN A HD21 2  
ATOM 3168  H HD22 . ASN A 1 53  ? -8.231  -0.604  11.204  1.00 0.00 ? 53  ASN A HD22 2  
ATOM 3169  N N    . THR A 1 54  ? -3.928  1.029   8.937   1.00 0.00 ? 54  THR A N    2  
ATOM 3170  C CA   . THR A 1 54  ? -2.852  1.367   9.852   1.00 0.00 ? 54  THR A CA   2  
ATOM 3171  C C    . THR A 1 54  ? -2.626  2.880   9.875   1.00 0.00 ? 54  THR A C    2  
ATOM 3172  O O    . THR A 1 54  ? -2.438  3.468   10.938  1.00 0.00 ? 54  THR A O    2  
ATOM 3173  C CB   . THR A 1 54  ? -1.610  0.574   9.436   1.00 0.00 ? 54  THR A CB   2  
ATOM 3174  O OG1  . THR A 1 54  ? -1.541  -0.484  10.388  1.00 0.00 ? 54  THR A OG1  2  
ATOM 3175  C CG2  . THR A 1 54  ? -0.315  1.358   9.655   1.00 0.00 ? 54  THR A CG2  2  
ATOM 3176  H H    . THR A 1 54  ? -3.649  0.504   8.132   1.00 0.00 ? 54  THR A H    2  
ATOM 3177  H HA   . THR A 1 54  ? -3.151  1.073   10.858  1.00 0.00 ? 54  THR A HA   2  
ATOM 3178  H HB   . THR A 1 54  ? -1.693  0.237   8.403   1.00 0.00 ? 54  THR A HB   2  
ATOM 3179  H HG1  . THR A 1 54  ? -1.462  -1.363  9.918   1.00 0.00 ? 54  THR A HG1  2  
ATOM 3180  H HG21 . THR A 1 54  ? -0.394  1.945   10.570  1.00 0.00 ? 54  THR A HG21 2  
ATOM 3181  H HG22 . THR A 1 54  ? 0.520   0.663   9.740   1.00 0.00 ? 54  THR A HG22 2  
ATOM 3182  H HG23 . THR A 1 54  ? -0.147  2.026   8.809   1.00 0.00 ? 54  THR A HG23 2  
ATOM 3183  N N    . MET A 1 55  ? -2.654  3.468   8.687   1.00 0.00 ? 55  MET A N    2  
ATOM 3184  C CA   . MET A 1 55  ? -2.454  4.902   8.558   1.00 0.00 ? 55  MET A CA   2  
ATOM 3185  C C    . MET A 1 55  ? -3.520  5.676   9.337   1.00 0.00 ? 55  MET A C    2  
ATOM 3186  O O    . MET A 1 55  ? -3.209  6.654   10.016  1.00 0.00 ? 55  MET A O    2  
ATOM 3187  C CB   . MET A 1 55  ? -2.517  5.294   7.080   1.00 0.00 ? 55  MET A CB   2  
ATOM 3188  C CG   . MET A 1 55  ? -1.179  5.870   6.610   1.00 0.00 ? 55  MET A CG   2  
ATOM 3189  S SD   . MET A 1 55  ? -1.174  6.027   4.832   1.00 0.00 ? 55  MET A SD   2  
ATOM 3190  C CE   . MET A 1 55  ? -0.796  7.764   4.675   1.00 0.00 ? 55  MET A CE   2  
ATOM 3191  H H    . MET A 1 55  ? -2.807  2.984   7.827   1.00 0.00 ? 55  MET A H    2  
ATOM 3192  H HA   . MET A 1 55  ? -1.470  5.100   8.980   1.00 0.00 ? 55  MET A HA   2  
ATOM 3193  H HB2  . MET A 1 55  ? -2.773  4.422   6.479   1.00 0.00 ? 55  MET A HB2  2  
ATOM 3194  H HB3  . MET A 1 55  ? -3.307  6.029   6.929   1.00 0.00 ? 55  MET A HB3  2  
ATOM 3195  H HG2  . MET A 1 55  ? -1.012  6.843   7.069   1.00 0.00 ? 55  MET A HG2  2  
ATOM 3196  H HG3  . MET A 1 55  ? -0.363  5.221   6.928   1.00 0.00 ? 55  MET A HG3  2  
ATOM 3197  H HE1  . MET A 1 55  ? -0.921  8.252   5.642   1.00 0.00 ? 55  MET A HE1  2  
ATOM 3198  H HE2  . MET A 1 55  ? 0.233   7.883   4.337   1.00 0.00 ? 55  MET A HE2  2  
ATOM 3199  H HE3  . MET A 1 55  ? -1.472  8.219   3.950   1.00 0.00 ? 55  MET A HE3  2  
ATOM 3200  N N    . LEU A 1 56  ? -4.753  5.209   9.213   1.00 0.00 ? 56  LEU A N    2  
ATOM 3201  C CA   . LEU A 1 56  ? -5.866  5.846   9.897   1.00 0.00 ? 56  LEU A CA   2  
ATOM 3202  C C    . LEU A 1 56  ? -5.725  5.626   11.405  1.00 0.00 ? 56  LEU A C    2  
ATOM 3203  O O    . LEU A 1 56  ? -5.999  6.528   12.195  1.00 0.00 ? 56  LEU A O    2  
ATOM 3204  C CB   . LEU A 1 56  ? -7.199  5.354   9.326   1.00 0.00 ? 56  LEU A CB   2  
ATOM 3205  C CG   . LEU A 1 56  ? -7.591  5.919   7.960   1.00 0.00 ? 56  LEU A CG   2  
ATOM 3206  C CD1  . LEU A 1 56  ? -8.972  5.417   7.536   1.00 0.00 ? 56  LEU A CD1  2  
ATOM 3207  C CD2  . LEU A 1 56  ? -7.512  7.448   7.956   1.00 0.00 ? 56  LEU A CD2  2  
ATOM 3208  H H    . LEU A 1 56  ? -4.997  4.413   8.659   1.00 0.00 ? 56  LEU A H    2  
ATOM 3209  H HA   . LEU A 1 56  ? -5.805  6.915   9.697   1.00 0.00 ? 56  LEU A HA   2  
ATOM 3210  H HB2  . LEU A 1 56  ? -7.159  4.267   9.249   1.00 0.00 ? 56  LEU A HB2  2  
ATOM 3211  H HB3  . LEU A 1 56  ? -7.988  5.595   10.038  1.00 0.00 ? 56  LEU A HB3  2  
ATOM 3212  H HG   . LEU A 1 56  ? -6.876  5.557   7.221   1.00 0.00 ? 56  LEU A HG   2  
ATOM 3213  H HD11 . LEU A 1 56  ? -9.618  5.342   8.411   1.00 0.00 ? 56  LEU A HD11 2  
ATOM 3214  H HD12 . LEU A 1 56  ? -9.410  6.115   6.822   1.00 0.00 ? 56  LEU A HD12 2  
ATOM 3215  H HD13 . LEU A 1 56  ? -8.876  4.435   7.072   1.00 0.00 ? 56  LEU A HD13 2  
ATOM 3216  H HD21 . LEU A 1 56  ? -8.024  7.840   8.833   1.00 0.00 ? 56  LEU A HD21 2  
ATOM 3217  H HD22 . LEU A 1 56  ? -6.467  7.756   7.977   1.00 0.00 ? 56  LEU A HD22 2  
ATOM 3218  H HD23 . LEU A 1 56  ? -7.987  7.833   7.053   1.00 0.00 ? 56  LEU A HD23 2  
ATOM 3219  N N    . ASN A 1 57  ? -5.299  4.422   11.758  1.00 0.00 ? 57  ASN A N    2  
ATOM 3220  C CA   . ASN A 1 57  ? -5.119  4.073   13.157  1.00 0.00 ? 57  ASN A CA   2  
ATOM 3221  C C    . ASN A 1 57  ? -3.938  4.861   13.727  1.00 0.00 ? 57  ASN A C    2  
ATOM 3222  O O    . ASN A 1 57  ? -3.848  5.063   14.936  1.00 0.00 ? 57  ASN A O    2  
ATOM 3223  C CB   . ASN A 1 57  ? -4.814  2.582   13.317  1.00 0.00 ? 57  ASN A CB   2  
ATOM 3224  C CG   . ASN A 1 57  ? -5.962  1.861   14.025  1.00 0.00 ? 57  ASN A CG   2  
ATOM 3225  O OD1  . ASN A 1 57  ? -5.863  1.457   15.172  1.00 0.00 ? 57  ASN A OD1  2  
ATOM 3226  N ND2  . ASN A 1 57  ? -7.055  1.722   13.280  1.00 0.00 ? 57  ASN A ND2  2  
ATOM 3227  H H    . ASN A 1 57  ? -5.079  3.695   11.109  1.00 0.00 ? 57  ASN A H    2  
ATOM 3228  H HA   . ASN A 1 57  ? -6.062  4.328   13.639  1.00 0.00 ? 57  ASN A HA   2  
ATOM 3229  H HB2  . ASN A 1 57  ? -4.647  2.133   12.338  1.00 0.00 ? 57  ASN A HB2  2  
ATOM 3230  H HB3  . ASN A 1 57  ? -3.894  2.455   13.887  1.00 0.00 ? 57  ASN A HB3  2  
ATOM 3231  H HD21 . ASN A 1 57  ? -7.071  2.076   12.345  1.00 0.00 ? 57  ASN A HD21 2  
ATOM 3232  H HD22 . ASN A 1 57  ? -7.861  1.262   13.654  1.00 0.00 ? 57  ASN A HD22 2  
ATOM 3233  N N    . THR A 1 58  ? -3.061  5.284   12.828  1.00 0.00 ? 58  THR A N    2  
ATOM 3234  C CA   . THR A 1 58  ? -1.890  6.046   13.226  1.00 0.00 ? 58  THR A CA   2  
ATOM 3235  C C    . THR A 1 58  ? -2.275  7.493   13.538  1.00 0.00 ? 58  THR A C    2  
ATOM 3236  O O    . THR A 1 58  ? -1.645  8.142   14.372  1.00 0.00 ? 58  THR A O    2  
ATOM 3237  C CB   . THR A 1 58  ? -0.844  5.921   12.115  1.00 0.00 ? 58  THR A CB   2  
ATOM 3238  O OG1  . THR A 1 58  ? 0.175   5.107   12.687  1.00 0.00 ? 58  THR A OG1  2  
ATOM 3239  C CG2  . THR A 1 58  ? -0.142  7.248   11.821  1.00 0.00 ? 58  THR A CG2  2  
ATOM 3240  H H    . THR A 1 58  ? -3.142  5.115   11.845  1.00 0.00 ? 58  THR A H    2  
ATOM 3241  H HA   . THR A 1 58  ? -1.496  5.615   14.146  1.00 0.00 ? 58  THR A HA   2  
ATOM 3242  H HB   . THR A 1 58  ? -1.288  5.506   11.210  1.00 0.00 ? 58  THR A HB   2  
ATOM 3243  H HG1  . THR A 1 58  ? 0.878   4.907   12.004  1.00 0.00 ? 58  THR A HG1  2  
ATOM 3244  H HG21 . THR A 1 58  ? 0.249   7.666   12.749  1.00 0.00 ? 58  THR A HG21 2  
ATOM 3245  H HG22 . THR A 1 58  ? 0.680   7.076   11.126  1.00 0.00 ? 58  THR A HG22 2  
ATOM 3246  H HG23 . THR A 1 58  ? -0.852  7.945   11.378  1.00 0.00 ? 58  THR A HG23 2  
ATOM 3247  N N    . VAL A 1 59  ? -3.308  7.958   12.850  1.00 0.00 ? 59  VAL A N    2  
ATOM 3248  C CA   . VAL A 1 59  ? -3.784  9.317   13.043  1.00 0.00 ? 59  VAL A CA   2  
ATOM 3249  C C    . VAL A 1 59  ? -3.806  9.638   14.538  1.00 0.00 ? 59  VAL A C    2  
ATOM 3250  O O    . VAL A 1 59  ? -3.710  8.738   15.372  1.00 0.00 ? 59  VAL A O    2  
ATOM 3251  C CB   . VAL A 1 59  ? -5.150  9.492   12.374  1.00 0.00 ? 59  VAL A CB   2  
ATOM 3252  C CG1  . VAL A 1 59  ? -6.256  9.653   13.419  1.00 0.00 ? 59  VAL A CG1  2  
ATOM 3253  C CG2  . VAL A 1 59  ? -5.137  10.676  11.404  1.00 0.00 ? 59  VAL A CG2  2  
ATOM 3254  H H    . VAL A 1 59  ? -3.815  7.424   12.174  1.00 0.00 ? 59  VAL A H    2  
ATOM 3255  H HA   . VAL A 1 59  ? -3.079  9.986   12.550  1.00 0.00 ? 59  VAL A HA   2  
ATOM 3256  H HB   . VAL A 1 59  ? -5.360  8.591   11.800  1.00 0.00 ? 59  VAL A HB   2  
ATOM 3257  H HG11 . VAL A 1 59  ? -6.098  8.940   14.227  1.00 0.00 ? 59  VAL A HG11 2  
ATOM 3258  H HG12 . VAL A 1 59  ? -6.233  10.666  13.820  1.00 0.00 ? 59  VAL A HG12 2  
ATOM 3259  H HG13 . VAL A 1 59  ? -7.224  9.468   12.955  1.00 0.00 ? 59  VAL A HG13 2  
ATOM 3260  H HG21 . VAL A 1 59  ? -4.590  11.505  11.851  1.00 0.00 ? 59  VAL A HG21 2  
ATOM 3261  H HG22 . VAL A 1 59  ? -4.650  10.378  10.475  1.00 0.00 ? 59  VAL A HG22 2  
ATOM 3262  H HG23 . VAL A 1 59  ? -6.161  10.985  11.196  1.00 0.00 ? 59  VAL A HG23 2  
ATOM 3263  N N    . GLY A 1 60  ? -3.932  10.924  14.834  1.00 0.00 ? 60  GLY A N    2  
ATOM 3264  C CA   . GLY A 1 60  ? -3.968  11.374  16.215  1.00 0.00 ? 60  GLY A CA   2  
ATOM 3265  C C    . GLY A 1 60  ? -4.702  10.366  17.102  1.00 0.00 ? 60  GLY A C    2  
ATOM 3266  O O    . GLY A 1 60  ? -4.228  10.027  18.186  1.00 0.00 ? 60  GLY A O    2  
ATOM 3267  H H    . GLY A 1 60  ? -4.010  11.649  14.150  1.00 0.00 ? 60  GLY A H    2  
ATOM 3268  H HA2  . GLY A 1 60  ? -2.951  11.514  16.582  1.00 0.00 ? 60  GLY A HA2  2  
ATOM 3269  H HA3  . GLY A 1 60  ? -4.464  12.343  16.273  1.00 0.00 ? 60  GLY A HA3  2  
ATOM 3270  N N    . GLY A 1 61  ? -5.846  9.916   16.609  1.00 0.00 ? 61  GLY A N    2  
ATOM 3271  C CA   . GLY A 1 61  ? -6.651  8.953   17.344  1.00 0.00 ? 61  GLY A CA   2  
ATOM 3272  C C    . GLY A 1 61  ? -7.824  9.641   18.044  1.00 0.00 ? 61  GLY A C    2  
ATOM 3273  O O    . GLY A 1 61  ? -7.990  9.513   19.256  1.00 0.00 ? 61  GLY A O    2  
ATOM 3274  H H    . GLY A 1 61  ? -6.224  10.197  15.728  1.00 0.00 ? 61  GLY A H    2  
ATOM 3275  H HA2  . GLY A 1 61  ? -7.025  8.192   16.661  1.00 0.00 ? 61  GLY A HA2  2  
ATOM 3276  H HA3  . GLY A 1 61  ? -6.030  8.444   18.081  1.00 0.00 ? 61  GLY A HA3  2  
ATOM 3277  N N    . HIS A 1 62  ? -8.608  10.357  17.251  1.00 0.00 ? 62  HIS A N    2  
ATOM 3278  C CA   . HIS A 1 62  ? -9.762  11.064  17.780  1.00 0.00 ? 62  HIS A CA   2  
ATOM 3279  C C    . HIS A 1 62  ? -11.038 10.293  17.436  1.00 0.00 ? 62  HIS A C    2  
ATOM 3280  O O    . HIS A 1 62  ? -11.269 9.950   16.278  1.00 0.00 ? 62  HIS A O    2  
ATOM 3281  C CB   . HIS A 1 62  ? -9.789  12.509  17.278  1.00 0.00 ? 62  HIS A CB   2  
ATOM 3282  C CG   . HIS A 1 62  ? -8.421  13.118  17.083  1.00 0.00 ? 62  HIS A CG   2  
ATOM 3283  N ND1  . HIS A 1 62  ? -8.140  14.025  16.076  1.00 0.00 ? 62  HIS A ND1  2  
ATOM 3284  C CD2  . HIS A 1 62  ? -7.260  12.941  17.777  1.00 0.00 ? 62  HIS A CD2  2  
ATOM 3285  C CE1  . HIS A 1 62  ? -6.864  14.370  16.168  1.00 0.00 ? 62  HIS A CE1  2  
ATOM 3286  N NE2  . HIS A 1 62  ? -6.320  13.697  17.223  1.00 0.00 ? 62  HIS A NE2  2  
ATOM 3287  H H    . HIS A 1 62  ? -8.467  10.456  16.266  1.00 0.00 ? 62  HIS A H    2  
ATOM 3288  H HA   . HIS A 1 62  ? -9.643  11.090  18.863  1.00 0.00 ? 62  HIS A HA   2  
ATOM 3289  H HB2  . HIS A 1 62  ? -10.329 12.544  16.332  1.00 0.00 ? 62  HIS A HB2  2  
ATOM 3290  H HB3  . HIS A 1 62  ? -10.348 13.119  17.987  1.00 0.00 ? 62  HIS A HB3  2  
ATOM 3291  H HD1  . HIS A 1 62  ? -8.790  14.361  15.395  1.00 0.00 ? 62  HIS A HD1  2  
ATOM 3292  H HD2  . HIS A 1 62  ? -7.127  12.289  18.640  1.00 0.00 ? 62  HIS A HD2  2  
ATOM 3293  H HE1  . HIS A 1 62  ? -6.341  15.070  15.517  1.00 0.00 ? 62  HIS A HE1  2  
ATOM 3294  H HE2  . HIS A 1 62  ? -5.386  13.805  17.562  1.00 0.00 ? 62  HIS A HE2  2  
ATOM 3295  N N    . GLN A 1 63  ? -11.835 10.043  18.465  1.00 0.00 ? 63  GLN A N    2  
ATOM 3296  C CA   . GLN A 1 63  ? -13.083 9.320   18.287  1.00 0.00 ? 63  GLN A CA   2  
ATOM 3297  C C    . GLN A 1 63  ? -14.009 10.083  17.339  1.00 0.00 ? 63  GLN A C    2  
ATOM 3298  O O    . GLN A 1 63  ? -14.792 9.478   16.610  1.00 0.00 ? 63  GLN A O    2  
ATOM 3299  C CB   . GLN A 1 63  ? -13.764 9.064   19.633  1.00 0.00 ? 63  GLN A CB   2  
ATOM 3300  C CG   . GLN A 1 63  ? -15.047 8.251   19.450  1.00 0.00 ? 63  GLN A CG   2  
ATOM 3301  C CD   . GLN A 1 63  ? -15.935 8.342   20.694  1.00 0.00 ? 63  GLN A CD   2  
ATOM 3302  O OE1  . GLN A 1 63  ? -16.368 9.408   21.102  1.00 0.00 ? 63  GLN A OE1  2  
ATOM 3303  N NE2  . GLN A 1 63  ? -16.181 7.169   21.271  1.00 0.00 ? 63  GLN A NE2  2  
ATOM 3304  H H    . GLN A 1 63  ? -11.641 10.326  19.404  1.00 0.00 ? 63  GLN A H    2  
ATOM 3305  H HA   . GLN A 1 63  ? -12.802 8.365   17.842  1.00 0.00 ? 63  GLN A HA   2  
ATOM 3306  H HB2  . GLN A 1 63  ? -13.083 8.531   20.295  1.00 0.00 ? 63  GLN A HB2  2  
ATOM 3307  H HB3  . GLN A 1 63  ? -13.997 10.015  20.113  1.00 0.00 ? 63  GLN A HB3  2  
ATOM 3308  H HG2  . GLN A 1 63  ? -15.595 8.617   18.582  1.00 0.00 ? 63  GLN A HG2  2  
ATOM 3309  H HG3  . GLN A 1 63  ? -14.797 7.208   19.255  1.00 0.00 ? 63  GLN A HG3  2  
ATOM 3310  H HE21 . GLN A 1 63  ? -15.795 6.332   20.885  1.00 0.00 ? 63  GLN A HE21 2  
ATOM 3311  H HE22 . GLN A 1 63  ? -16.753 7.124   22.090  1.00 0.00 ? 63  GLN A HE22 2  
ATOM 3312  N N    . ALA A 1 64  ? -13.888 11.402  17.380  1.00 0.00 ? 64  ALA A N    2  
ATOM 3313  C CA   . ALA A 1 64  ? -14.705 12.255  16.533  1.00 0.00 ? 64  ALA A CA   2  
ATOM 3314  C C    . ALA A 1 64  ? -14.238 12.123  15.082  1.00 0.00 ? 64  ALA A C    2  
ATOM 3315  O O    . ALA A 1 64  ? -15.048 11.899  14.183  1.00 0.00 ? 64  ALA A O    2  
ATOM 3316  C CB   . ALA A 1 64  ? -14.633 13.697  17.040  1.00 0.00 ? 64  ALA A CB   2  
ATOM 3317  H H    . ALA A 1 64  ? -13.248 11.887  17.976  1.00 0.00 ? 64  ALA A H    2  
ATOM 3318  H HA   . ALA A 1 64  ? -15.735 11.908  16.608  1.00 0.00 ? 64  ALA A HA   2  
ATOM 3319  H HB1  . ALA A 1 64  ? -13.718 13.834  17.615  1.00 0.00 ? 64  ALA A HB1  2  
ATOM 3320  H HB2  . ALA A 1 64  ? -14.635 14.381  16.191  1.00 0.00 ? 64  ALA A HB2  2  
ATOM 3321  H HB3  . ALA A 1 64  ? -15.495 13.902  17.674  1.00 0.00 ? 64  ALA A HB3  2  
ATOM 3322  N N    . ALA A 1 65  ? -12.934 12.267  14.898  1.00 0.00 ? 65  ALA A N    2  
ATOM 3323  C CA   . ALA A 1 65  ? -12.350 12.166  13.571  1.00 0.00 ? 65  ALA A CA   2  
ATOM 3324  C C    . ALA A 1 65  ? -12.673 10.793  12.980  1.00 0.00 ? 65  ALA A C    2  
ATOM 3325  O O    . ALA A 1 65  ? -13.230 10.699  11.886  1.00 0.00 ? 65  ALA A O    2  
ATOM 3326  C CB   . ALA A 1 65  ? -10.845 12.425  13.655  1.00 0.00 ? 65  ALA A CB   2  
ATOM 3327  H H    . ALA A 1 65  ? -12.283 12.448  15.634  1.00 0.00 ? 65  ALA A H    2  
ATOM 3328  H HA   . ALA A 1 65  ? -12.805 12.937  12.949  1.00 0.00 ? 65  ALA A HA   2  
ATOM 3329  H HB1  . ALA A 1 65  ? -10.377 11.659  14.274  1.00 0.00 ? 65  ALA A HB1  2  
ATOM 3330  H HB2  . ALA A 1 65  ? -10.415 12.395  12.654  1.00 0.00 ? 65  ALA A HB2  2  
ATOM 3331  H HB3  . ALA A 1 65  ? -10.668 13.405  14.097  1.00 0.00 ? 65  ALA A HB3  2  
ATOM 3332  N N    . MET A 1 66  ? -12.310 9.761   13.727  1.00 0.00 ? 66  MET A N    2  
ATOM 3333  C CA   . MET A 1 66  ? -12.554 8.396   13.290  1.00 0.00 ? 66  MET A CA   2  
ATOM 3334  C C    . MET A 1 66  ? -14.053 8.131   13.133  1.00 0.00 ? 66  MET A C    2  
ATOM 3335  O O    . MET A 1 66  ? -14.466 7.390   12.244  1.00 0.00 ? 66  MET A O    2  
ATOM 3336  C CB   . MET A 1 66  ? -11.966 7.420   14.311  1.00 0.00 ? 66  MET A CB   2  
ATOM 3337  C CG   . MET A 1 66  ? -10.688 6.771   13.775  1.00 0.00 ? 66  MET A CG   2  
ATOM 3338  S SD   . MET A 1 66  ? -9.537  8.031   13.249  1.00 0.00 ? 66  MET A SD   2  
ATOM 3339  C CE   . MET A 1 66  ? -9.320  7.559   11.542  1.00 0.00 ? 66  MET A CE   2  
ATOM 3340  H H    . MET A 1 66  ? -11.857 9.846   14.615  1.00 0.00 ? 66  MET A H    2  
ATOM 3341  H HA   . MET A 1 66  ? -12.059 8.306   12.323  1.00 0.00 ? 66  MET A HA   2  
ATOM 3342  H HB2  . MET A 1 66  ? -11.749 7.947   15.239  1.00 0.00 ? 66  MET A HB2  2  
ATOM 3343  H HB3  . MET A 1 66  ? -12.699 6.649   14.545  1.00 0.00 ? 66  MET A HB3  2  
ATOM 3344  H HG2  . MET A 1 66  ? -10.233 6.153   14.548  1.00 0.00 ? 66  MET A HG2  2  
ATOM 3345  H HG3  . MET A 1 66  ? -10.926 6.114   12.940  1.00 0.00 ? 66  MET A HG3  2  
ATOM 3346  H HE1  . MET A 1 66  ? -9.439  6.479   11.446  1.00 0.00 ? 66  MET A HE1  2  
ATOM 3347  H HE2  . MET A 1 66  ? -10.065 8.063   10.927  1.00 0.00 ? 66  MET A HE2  2  
ATOM 3348  H HE3  . MET A 1 66  ? -8.322  7.845   11.210  1.00 0.00 ? 66  MET A HE3  2  
ATOM 3349  N N    . GLN A 1 67  ? -14.826 8.751   14.013  1.00 0.00 ? 67  GLN A N    2  
ATOM 3350  C CA   . GLN A 1 67  ? -16.269 8.591   13.984  1.00 0.00 ? 67  GLN A CA   2  
ATOM 3351  C C    . GLN A 1 67  ? -16.818 8.966   12.606  1.00 0.00 ? 67  GLN A C    2  
ATOM 3352  O O    . GLN A 1 67  ? -17.491 8.164   11.962  1.00 0.00 ? 67  GLN A O    2  
ATOM 3353  C CB   . GLN A 1 67  ? -16.936 9.421   15.083  1.00 0.00 ? 67  GLN A CB   2  
ATOM 3354  C CG   . GLN A 1 67  ? -18.419 9.642   14.781  1.00 0.00 ? 67  GLN A CG   2  
ATOM 3355  C CD   . GLN A 1 67  ? -18.673 11.074  14.306  1.00 0.00 ? 67  GLN A CD   2  
ATOM 3356  O OE1  . GLN A 1 67  ? -17.916 11.991  14.580  1.00 0.00 ? 67  GLN A OE1  2  
ATOM 3357  N NE2  . GLN A 1 67  ? -19.780 11.215  13.580  1.00 0.00 ? 67  GLN A NE2  2  
ATOM 3358  H H    . GLN A 1 67  ? -14.481 9.352   14.734  1.00 0.00 ? 67  GLN A H    2  
ATOM 3359  H HA   . GLN A 1 67  ? -16.448 7.532   14.177  1.00 0.00 ? 67  GLN A HA   2  
ATOM 3360  H HB2  . GLN A 1 67  ? -16.828 8.913   16.042  1.00 0.00 ? 67  GLN A HB2  2  
ATOM 3361  H HB3  . GLN A 1 67  ? -16.432 10.382  15.174  1.00 0.00 ? 67  GLN A HB3  2  
ATOM 3362  H HG2  . GLN A 1 67  ? -18.747 8.937   14.017  1.00 0.00 ? 67  GLN A HG2  2  
ATOM 3363  H HG3  . GLN A 1 67  ? -19.010 9.440   15.675  1.00 0.00 ? 67  GLN A HG3  2  
ATOM 3364  H HE21 . GLN A 1 67  ? -20.358 10.421  13.393  1.00 0.00 ? 67  GLN A HE21 2  
ATOM 3365  H HE22 . GLN A 1 67  ? -20.033 12.113  13.224  1.00 0.00 ? 67  GLN A HE22 2  
ATOM 3366  N N    . MET A 1 68  ? -16.507 10.187  12.193  1.00 0.00 ? 68  MET A N    2  
ATOM 3367  C CA   . MET A 1 68  ? -16.960 10.678  10.903  1.00 0.00 ? 68  MET A CA   2  
ATOM 3368  C C    . MET A 1 68  ? -16.305 9.901   9.759   1.00 0.00 ? 68  MET A C    2  
ATOM 3369  O O    . MET A 1 68  ? -16.907 9.724   8.701   1.00 0.00 ? 68  MET A O    2  
ATOM 3370  C CB   . MET A 1 68  ? -16.616 12.164  10.773  1.00 0.00 ? 68  MET A CB   2  
ATOM 3371  C CG   . MET A 1 68  ? -17.658 13.031  11.483  1.00 0.00 ? 68  MET A CG   2  
ATOM 3372  S SD   . MET A 1 68  ? -17.272 14.759  11.253  1.00 0.00 ? 68  MET A SD   2  
ATOM 3373  C CE   . MET A 1 68  ? -15.901 14.925  12.384  1.00 0.00 ? 68  MET A CE   2  
ATOM 3374  H H    . MET A 1 68  ? -15.959 10.833  12.723  1.00 0.00 ? 68  MET A H    2  
ATOM 3375  H HA   . MET A 1 68  ? -18.038 10.518  10.891  1.00 0.00 ? 68  MET A HA   2  
ATOM 3376  H HB2  . MET A 1 68  ? -15.630 12.351  11.199  1.00 0.00 ? 68  MET A HB2  2  
ATOM 3377  H HB3  . MET A 1 68  ? -16.566 12.439  9.720   1.00 0.00 ? 68  MET A HB3  2  
ATOM 3378  H HG2  . MET A 1 68  ? -18.651 12.816  11.091  1.00 0.00 ? 68  MET A HG2  2  
ATOM 3379  H HG3  . MET A 1 68  ? -17.677 12.794  12.547  1.00 0.00 ? 68  MET A HG3  2  
ATOM 3380  H HE1  . MET A 1 68  ? -15.347 13.987  12.424  1.00 0.00 ? 68  MET A HE1  2  
ATOM 3381  H HE2  . MET A 1 68  ? -15.241 15.722  12.041  1.00 0.00 ? 68  MET A HE2  2  
ATOM 3382  H HE3  . MET A 1 68  ? -16.278 15.166  13.378  1.00 0.00 ? 68  MET A HE3  2  
ATOM 3383  N N    . LEU A 1 69  ? -15.083 9.458   10.011  1.00 0.00 ? 69  LEU A N    2  
ATOM 3384  C CA   . LEU A 1 69  ? -14.340 8.704   9.016   1.00 0.00 ? 69  LEU A CA   2  
ATOM 3385  C C    . LEU A 1 69  ? -15.094 7.411   8.695   1.00 0.00 ? 69  LEU A C    2  
ATOM 3386  O O    . LEU A 1 69  ? -15.218 7.033   7.532   1.00 0.00 ? 69  LEU A O    2  
ATOM 3387  C CB   . LEU A 1 69  ? -12.900 8.477   9.480   1.00 0.00 ? 69  LEU A CB   2  
ATOM 3388  C CG   . LEU A 1 69  ? -11.913 8.018   8.404   1.00 0.00 ? 69  LEU A CG   2  
ATOM 3389  C CD1  . LEU A 1 69  ? -12.445 6.792   7.659   1.00 0.00 ? 69  LEU A CD1  2  
ATOM 3390  C CD2  . LEU A 1 69  ? -11.570 9.164   7.451   1.00 0.00 ? 69  LEU A CD2  2  
ATOM 3391  H H    . LEU A 1 69  ? -14.602 9.606   10.875  1.00 0.00 ? 69  LEU A H    2  
ATOM 3392  H HA   . LEU A 1 69  ? -14.295 9.310   8.112   1.00 0.00 ? 69  LEU A HA   2  
ATOM 3393  H HB2  . LEU A 1 69  ? -12.528 9.406   9.913   1.00 0.00 ? 69  LEU A HB2  2  
ATOM 3394  H HB3  . LEU A 1 69  ? -12.909 7.735   10.278  1.00 0.00 ? 69  LEU A HB3  2  
ATOM 3395  H HG   . LEU A 1 69  ? -10.988 7.719   8.896   1.00 0.00 ? 69  LEU A HG   2  
ATOM 3396  H HD11 . LEU A 1 69  ? -12.985 6.150   8.356   1.00 0.00 ? 69  LEU A HD11 2  
ATOM 3397  H HD12 . LEU A 1 69  ? -13.120 7.114   6.866   1.00 0.00 ? 69  LEU A HD12 2  
ATOM 3398  H HD13 . LEU A 1 69  ? -11.612 6.239   7.227   1.00 0.00 ? 69  LEU A HD13 2  
ATOM 3399  H HD21 . LEU A 1 69  ? -12.389 9.881   7.435   1.00 0.00 ? 69  LEU A HD21 2  
ATOM 3400  H HD22 . LEU A 1 69  ? -10.659 9.658   7.790   1.00 0.00 ? 69  LEU A HD22 2  
ATOM 3401  H HD23 . LEU A 1 69  ? -11.414 8.767   6.448   1.00 0.00 ? 69  LEU A HD23 2  
ATOM 3402  N N    . LYS A 1 70  ? -15.577 6.769   9.749   1.00 0.00 ? 70  LYS A N    2  
ATOM 3403  C CA   . LYS A 1 70  ? -16.315 5.526   9.594   1.00 0.00 ? 70  LYS A CA   2  
ATOM 3404  C C    . LYS A 1 70  ? -17.653 5.815   8.911   1.00 0.00 ? 70  LYS A C    2  
ATOM 3405  O O    . LYS A 1 70  ? -18.029 5.129   7.962   1.00 0.00 ? 70  LYS A O    2  
ATOM 3406  C CB   . LYS A 1 70  ? -16.453 4.814   10.942  1.00 0.00 ? 70  LYS A CB   2  
ATOM 3407  C CG   . LYS A 1 70  ? -15.802 3.430   10.900  1.00 0.00 ? 70  LYS A CG   2  
ATOM 3408  C CD   . LYS A 1 70  ? -16.027 2.678   12.213  1.00 0.00 ? 70  LYS A CD   2  
ATOM 3409  C CE   . LYS A 1 70  ? -15.488 1.248   12.125  1.00 0.00 ? 70  LYS A CE   2  
ATOM 3410  N NZ   . LYS A 1 70  ? -15.608 0.569   13.434  1.00 0.00 ? 70  LYS A NZ   2  
ATOM 3411  H H    . LYS A 1 70  ? -15.471 7.082   10.693  1.00 0.00 ? 70  LYS A H    2  
ATOM 3412  H HA   . LYS A 1 70  ? -15.727 4.877   8.945   1.00 0.00 ? 70  LYS A HA   2  
ATOM 3413  H HB2  . LYS A 1 70  ? -15.989 5.414   11.724  1.00 0.00 ? 70  LYS A HB2  2  
ATOM 3414  H HB3  . LYS A 1 70  ? -17.507 4.716   11.199  1.00 0.00 ? 70  LYS A HB3  2  
ATOM 3415  H HG2  . LYS A 1 70  ? -16.216 2.855   10.071  1.00 0.00 ? 70  LYS A HG2  2  
ATOM 3416  H HG3  . LYS A 1 70  ? -14.733 3.532   10.713  1.00 0.00 ? 70  LYS A HG3  2  
ATOM 3417  H HD2  . LYS A 1 70  ? -15.534 3.207   13.028  1.00 0.00 ? 70  LYS A HD2  2  
ATOM 3418  H HD3  . LYS A 1 70  ? -17.092 2.655   12.446  1.00 0.00 ? 70  LYS A HD3  2  
ATOM 3419  H HE2  . LYS A 1 70  ? -16.040 0.691   11.368  1.00 0.00 ? 70  LYS A HE2  2  
ATOM 3420  H HE3  . LYS A 1 70  ? -14.444 1.265   11.812  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 3421  H HZ1  . LYS A 1 70  ? -16.535 0.688   13.788  1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 3422  H HZ2  . LYS A 1 70  ? -15.415 -0.406  13.323  1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 3423  H HZ3  . LYS A 1 70  ? -14.953 0.966   14.077  1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 3424  N N    . GLU A 1 71  ? -18.334 6.830   9.421   1.00 0.00 ? 71  GLU A N    2  
ATOM 3425  C CA   . GLU A 1 71  ? -19.621 7.218   8.871   1.00 0.00 ? 71  GLU A CA   2  
ATOM 3426  C C    . GLU A 1 71  ? -19.509 7.443   7.361   1.00 0.00 ? 71  GLU A C    2  
ATOM 3427  O O    . GLU A 1 71  ? -20.333 6.948   6.593   1.00 0.00 ? 71  GLU A O    2  
ATOM 3428  C CB   . GLU A 1 71  ? -20.165 8.465   9.572   1.00 0.00 ? 71  GLU A CB   2  
ATOM 3429  C CG   . GLU A 1 71  ? -21.513 8.883   8.981   1.00 0.00 ? 71  GLU A CG   2  
ATOM 3430  C CD   . GLU A 1 71  ? -21.694 10.401  9.050   1.00 0.00 ? 71  GLU A CD   2  
ATOM 3431  O OE1  . GLU A 1 71  ? -21.177 11.076  8.133   1.00 0.00 ? 71  GLU A OE1  2  
ATOM 3432  O OE2  . GLU A 1 71  ? -22.344 10.851  10.017  1.00 0.00 ? 71  GLU A OE2  2  
ATOM 3433  H H    . GLU A 1 71  ? -18.020 7.383   10.192  1.00 0.00 ? 71  GLU A H    2  
ATOM 3434  H HA   . GLU A 1 71  ? -20.286 6.378   9.071   1.00 0.00 ? 71  GLU A HA   2  
ATOM 3435  H HB2  . GLU A 1 71  ? -20.277 8.266   10.638  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 3436  H HB3  . GLU A 1 71  ? -19.450 9.282   9.473   1.00 0.00 ? 71  GLU A HB3  2  
ATOM 3437  H HG2  . GLU A 1 71  ? -21.577 8.552   7.944   1.00 0.00 ? 71  GLU A HG2  2  
ATOM 3438  H HG3  . GLU A 1 71  ? -22.320 8.392   9.524   1.00 0.00 ? 71  GLU A HG3  2  
ATOM 3439  N N    . THR A 1 72  ? -18.483 8.190   6.982   1.00 0.00 ? 72  THR A N    2  
ATOM 3440  C CA   . THR A 1 72  ? -18.252 8.487   5.578   1.00 0.00 ? 72  THR A CA   2  
ATOM 3441  C C    . THR A 1 72  ? -18.045 7.193   4.787   1.00 0.00 ? 72  THR A C    2  
ATOM 3442  O O    . THR A 1 72  ? -18.799 6.900   3.861   1.00 0.00 ? 72  THR A O    2  
ATOM 3443  C CB   . THR A 1 72  ? -17.068 9.451   5.488   1.00 0.00 ? 72  THR A CB   2  
ATOM 3444  O OG1  . THR A 1 72  ? -17.674 10.732  5.335   1.00 0.00 ? 72  THR A OG1  2  
ATOM 3445  C CG2  . THR A 1 72  ? -16.258 9.266   4.203   1.00 0.00 ? 72  THR A CG2  2  
ATOM 3446  H H    . THR A 1 72  ? -17.818 8.589   7.614   1.00 0.00 ? 72  THR A H    2  
ATOM 3447  H HA   . THR A 1 72  ? -19.145 8.967   5.177   1.00 0.00 ? 72  THR A HA   2  
ATOM 3448  H HB   . THR A 1 72  ? -16.428 9.366   6.367   1.00 0.00 ? 72  THR A HB   2  
ATOM 3449  H HG1  . THR A 1 72  ? -16.986 11.407  5.069   1.00 0.00 ? 72  THR A HG1  2  
ATOM 3450  H HG21 . THR A 1 72  ? -16.876 8.771   3.452   1.00 0.00 ? 72  THR A HG21 2  
ATOM 3451  H HG22 . THR A 1 72  ? -15.944 10.241  3.828   1.00 0.00 ? 72  THR A HG22 2  
ATOM 3452  H HG23 . THR A 1 72  ? -15.380 8.656   4.411   1.00 0.00 ? 72  THR A HG23 2  
ATOM 3453  N N    . ILE A 1 73  ? -17.017 6.456   5.181   1.00 0.00 ? 73  ILE A N    2  
ATOM 3454  C CA   . ILE A 1 73  ? -16.701 5.200   4.519   1.00 0.00 ? 73  ILE A CA   2  
ATOM 3455  C C    . ILE A 1 73  ? -17.987 4.399   4.314   1.00 0.00 ? 73  ILE A C    2  
ATOM 3456  O O    . ILE A 1 73  ? -18.270 3.945   3.206   1.00 0.00 ? 73  ILE A O    2  
ATOM 3457  C CB   . ILE A 1 73  ? -15.622 4.443   5.297   1.00 0.00 ? 73  ILE A CB   2  
ATOM 3458  C CG1  . ILE A 1 73  ? -14.255 5.109   5.125   1.00 0.00 ? 73  ILE A CG1  2  
ATOM 3459  C CG2  . ILE A 1 73  ? -15.594 2.966   4.899   1.00 0.00 ? 73  ILE A CG2  2  
ATOM 3460  C CD1  . ILE A 1 73  ? -13.492 4.500   3.947   1.00 0.00 ? 73  ILE A CD1  2  
ATOM 3461  H H    . ILE A 1 73  ? -16.409 6.701   5.935   1.00 0.00 ? 73  ILE A H    2  
ATOM 3462  H HA   . ILE A 1 73  ? -16.284 5.442   3.542   1.00 0.00 ? 73  ILE A HA   2  
ATOM 3463  H HB   . ILE A 1 73  ? -15.871 4.486   6.357   1.00 0.00 ? 73  ILE A HB   2  
ATOM 3464  H HG12 . ILE A 1 73  ? -14.384 6.179   4.967   1.00 0.00 ? 73  ILE A HG12 2  
ATOM 3465  H HG13 . ILE A 1 73  ? -13.672 4.990   6.040   1.00 0.00 ? 73  ILE A HG13 2  
ATOM 3466  H HG21 . ILE A 1 73  ? -15.947 2.859   3.873   1.00 0.00 ? 73  ILE A HG21 2  
ATOM 3467  H HG22 . ILE A 1 73  ? -14.575 2.588   4.973   1.00 0.00 ? 73  ILE A HG22 2  
ATOM 3468  H HG23 . ILE A 1 73  ? -16.242 2.398   5.566   1.00 0.00 ? 73  ILE A HG23 2  
ATOM 3469  H HD11 . ILE A 1 73  ? -14.200 4.054   3.248   1.00 0.00 ? 73  ILE A HD11 2  
ATOM 3470  H HD12 . ILE A 1 73  ? -12.924 5.280   3.440   1.00 0.00 ? 73  ILE A HD12 2  
ATOM 3471  H HD13 . ILE A 1 73  ? -12.810 3.733   4.312   1.00 0.00 ? 73  ILE A HD13 2  
ATOM 3472  N N    . ASN A 1 74  ? -18.733 4.248   5.399   1.00 0.00 ? 74  ASN A N    2  
ATOM 3473  C CA   . ASN A 1 74  ? -19.983 3.509   5.351   1.00 0.00 ? 74  ASN A CA   2  
ATOM 3474  C C    . ASN A 1 74  ? -20.907 4.144   4.310   1.00 0.00 ? 74  ASN A C    2  
ATOM 3475  O O    . ASN A 1 74  ? -21.661 3.446   3.635   1.00 0.00 ? 74  ASN A O    2  
ATOM 3476  C CB   . ASN A 1 74  ? -20.697 3.547   6.704   1.00 0.00 ? 74  ASN A CB   2  
ATOM 3477  C CG   . ASN A 1 74  ? -21.678 2.380   6.839   1.00 0.00 ? 74  ASN A CG   2  
ATOM 3478  O OD1  . ASN A 1 74  ? -21.922 1.630   5.908   1.00 0.00 ? 74  ASN A OD1  2  
ATOM 3479  N ND2  . ASN A 1 74  ? -22.225 2.271   8.046   1.00 0.00 ? 74  ASN A ND2  2  
ATOM 3480  H H    . ASN A 1 74  ? -18.496 4.620   6.296   1.00 0.00 ? 74  ASN A H    2  
ATOM 3481  H HA   . ASN A 1 74  ? -19.702 2.488   5.092   1.00 0.00 ? 74  ASN A HA   2  
ATOM 3482  H HB2  . ASN A 1 74  ? -19.962 3.504   7.509   1.00 0.00 ? 74  ASN A HB2  2  
ATOM 3483  H HB3  . ASN A 1 74  ? -21.232 4.490   6.810   1.00 0.00 ? 74  ASN A HB3  2  
ATOM 3484  H HD21 . ASN A 1 74  ? -21.982 2.920   8.766   1.00 0.00 ? 74  ASN A HD21 2  
ATOM 3485  H HD22 . ASN A 1 74  ? -22.880 1.538   8.234   1.00 0.00 ? 74  ASN A HD22 2  
ATOM 3486  N N    . GLU A 1 75  ? -20.819 5.463   4.215   1.00 0.00 ? 75  GLU A N    2  
ATOM 3487  C CA   . GLU A 1 75  ? -21.637 6.201   3.267   1.00 0.00 ? 75  GLU A CA   2  
ATOM 3488  C C    . GLU A 1 75  ? -21.287 5.795   1.834   1.00 0.00 ? 75  GLU A C    2  
ATOM 3489  O O    . GLU A 1 75  ? -22.167 5.431   1.056   1.00 0.00 ? 75  GLU A O    2  
ATOM 3490  C CB   . GLU A 1 75  ? -21.480 7.710   3.465   1.00 0.00 ? 75  GLU A CB   2  
ATOM 3491  C CG   . GLU A 1 75  ? -22.740 8.455   3.024   1.00 0.00 ? 75  GLU A CG   2  
ATOM 3492  C CD   . GLU A 1 75  ? -22.462 9.950   2.853   1.00 0.00 ? 75  GLU A CD   2  
ATOM 3493  O OE1  . GLU A 1 75  ? -21.946 10.546  3.823   1.00 0.00 ? 75  GLU A OE1  2  
ATOM 3494  O OE2  . GLU A 1 75  ? -22.771 10.463  1.756   1.00 0.00 ? 75  GLU A OE2  2  
ATOM 3495  H H    . GLU A 1 75  ? -20.203 6.024   4.768   1.00 0.00 ? 75  GLU A H    2  
ATOM 3496  H HA   . GLU A 1 75  ? -22.666 5.917   3.491   1.00 0.00 ? 75  GLU A HA   2  
ATOM 3497  H HB2  . GLU A 1 75  ? -21.274 7.923   4.514   1.00 0.00 ? 75  GLU A HB2  2  
ATOM 3498  H HB3  . GLU A 1 75  ? -20.623 8.067   2.894   1.00 0.00 ? 75  GLU A HB3  2  
ATOM 3499  H HG2  . GLU A 1 75  ? -23.103 8.039   2.084   1.00 0.00 ? 75  GLU A HG2  2  
ATOM 3500  H HG3  . GLU A 1 75  ? -23.529 8.311   3.763   1.00 0.00 ? 75  GLU A HG3  2  
ATOM 3501  N N    . GLU A 1 76  ? -20.000 5.873   1.529   1.00 0.00 ? 76  GLU A N    2  
ATOM 3502  C CA   . GLU A 1 76  ? -19.522 5.520   0.203   1.00 0.00 ? 76  GLU A CA   2  
ATOM 3503  C C    . GLU A 1 76  ? -20.007 4.119   -0.179  1.00 0.00 ? 76  GLU A C    2  
ATOM 3504  O O    . GLU A 1 76  ? -20.455 3.899   -1.304  1.00 0.00 ? 76  GLU A O    2  
ATOM 3505  C CB   . GLU A 1 76  ? -17.997 5.610   0.128   1.00 0.00 ? 76  GLU A CB   2  
ATOM 3506  C CG   . GLU A 1 76  ? -17.547 7.046   -0.150  1.00 0.00 ? 76  GLU A CG   2  
ATOM 3507  C CD   . GLU A 1 76  ? -17.246 7.788   1.153   1.00 0.00 ? 76  GLU A CD   2  
ATOM 3508  O OE1  . GLU A 1 76  ? -16.179 7.502   1.736   1.00 0.00 ? 76  GLU A OE1  2  
ATOM 3509  O OE2  . GLU A 1 76  ? -18.091 8.626   1.537   1.00 0.00 ? 76  GLU A OE2  2  
ATOM 3510  H H    . GLU A 1 76  ? -19.290 6.170   2.169   1.00 0.00 ? 76  GLU A H    2  
ATOM 3511  H HA   . GLU A 1 76  ? -19.958 6.258   -0.468  1.00 0.00 ? 76  GLU A HA   2  
ATOM 3512  H HB2  . GLU A 1 76  ? -17.561 5.264   1.065   1.00 0.00 ? 76  GLU A HB2  2  
ATOM 3513  H HB3  . GLU A 1 76  ? -17.628 4.952   -0.658  1.00 0.00 ? 76  GLU A HB3  2  
ATOM 3514  H HG2  . GLU A 1 76  ? -16.659 7.037   -0.782  1.00 0.00 ? 76  GLU A HG2  2  
ATOM 3515  H HG3  . GLU A 1 76  ? -18.324 7.574   -0.702  1.00 0.00 ? 76  GLU A HG3  2  
ATOM 3516  N N    . ALA A 1 77  ? -19.901 3.209   0.778   1.00 0.00 ? 77  ALA A N    2  
ATOM 3517  C CA   . ALA A 1 77  ? -20.323 1.836   0.555   1.00 0.00 ? 77  ALA A CA   2  
ATOM 3518  C C    . ALA A 1 77  ? -21.802 1.820   0.163   1.00 0.00 ? 77  ALA A C    2  
ATOM 3519  O O    . ALA A 1 77  ? -22.180 1.184   -0.819  1.00 0.00 ? 77  ALA A O    2  
ATOM 3520  C CB   . ALA A 1 77  ? -20.042 1.006   1.810   1.00 0.00 ? 77  ALA A CB   2  
ATOM 3521  H H    . ALA A 1 77  ? -19.535 3.396   1.689   1.00 0.00 ? 77  ALA A H    2  
ATOM 3522  H HA   . ALA A 1 77  ? -19.733 1.437   -0.269  1.00 0.00 ? 77  ALA A HA   2  
ATOM 3523  H HB1  . ALA A 1 77  ? -19.265 1.490   2.399   1.00 0.00 ? 77  ALA A HB1  2  
ATOM 3524  H HB2  . ALA A 1 77  ? -20.952 0.927   2.404   1.00 0.00 ? 77  ALA A HB2  2  
ATOM 3525  H HB3  . ALA A 1 77  ? -19.710 0.010   1.518   1.00 0.00 ? 77  ALA A HB3  2  
ATOM 3526  N N    . ALA A 1 78  ? -22.599 2.525   0.952   1.00 0.00 ? 78  ALA A N    2  
ATOM 3527  C CA   . ALA A 1 78  ? -24.028 2.599   0.701   1.00 0.00 ? 78  ALA A CA   2  
ATOM 3528  C C    . ALA A 1 78  ? -24.264 3.042   -0.745  1.00 0.00 ? 78  ALA A C    2  
ATOM 3529  O O    . ALA A 1 78  ? -25.055 2.433   -1.463  1.00 0.00 ? 78  ALA A O    2  
ATOM 3530  C CB   . ALA A 1 78  ? -24.677 3.545   1.714   1.00 0.00 ? 78  ALA A CB   2  
ATOM 3531  H H    . ALA A 1 78  ? -22.282 3.040   1.750   1.00 0.00 ? 78  ALA A H    2  
ATOM 3532  H HA   . ALA A 1 78  ? -24.441 1.600   0.838   1.00 0.00 ? 78  ALA A HA   2  
ATOM 3533  H HB1  . ALA A 1 78  ? -25.727 3.686   1.458   1.00 0.00 ? 78  ALA A HB1  2  
ATOM 3534  H HB2  . ALA A 1 78  ? -24.165 4.506   1.693   1.00 0.00 ? 78  ALA A HB2  2  
ATOM 3535  H HB3  . ALA A 1 78  ? -24.601 3.115   2.712   1.00 0.00 ? 78  ALA A HB3  2  
ATOM 3536  N N    . GLU A 1 79  ? -23.563 4.100   -1.128  1.00 0.00 ? 79  GLU A N    2  
ATOM 3537  C CA   . GLU A 1 79  ? -23.687 4.632   -2.474  1.00 0.00 ? 79  GLU A CA   2  
ATOM 3538  C C    . GLU A 1 79  ? -23.265 3.579   -3.502  1.00 0.00 ? 79  GLU A C    2  
ATOM 3539  O O    . GLU A 1 79  ? -23.789 3.546   -4.614  1.00 0.00 ? 79  GLU A O    2  
ATOM 3540  C CB   . GLU A 1 79  ? -22.869 5.913   -2.635  1.00 0.00 ? 79  GLU A CB   2  
ATOM 3541  C CG   . GLU A 1 79  ? -23.717 7.034   -3.241  1.00 0.00 ? 79  GLU A CG   2  
ATOM 3542  C CD   . GLU A 1 79  ? -22.954 8.360   -3.242  1.00 0.00 ? 79  GLU A CD   2  
ATOM 3543  O OE1  . GLU A 1 79  ? -22.764 8.906   -2.134  1.00 0.00 ? 79  GLU A OE1  2  
ATOM 3544  O OE2  . GLU A 1 79  ? -22.578 8.798   -4.351  1.00 0.00 ? 79  GLU A OE2  2  
ATOM 3545  H H    . GLU A 1 79  ? -22.922 4.590   -0.537  1.00 0.00 ? 79  GLU A H    2  
ATOM 3546  H HA   . GLU A 1 79  ? -24.745 4.865   -2.597  1.00 0.00 ? 79  GLU A HA   2  
ATOM 3547  H HB2  . GLU A 1 79  ? -22.484 6.228   -1.664  1.00 0.00 ? 79  GLU A HB2  2  
ATOM 3548  H HB3  . GLU A 1 79  ? -22.006 5.721   -3.273  1.00 0.00 ? 79  GLU A HB3  2  
ATOM 3549  H HG2  . GLU A 1 79  ? -23.999 6.771   -4.260  1.00 0.00 ? 79  GLU A HG2  2  
ATOM 3550  H HG3  . GLU A 1 79  ? -24.641 7.142   -2.673  1.00 0.00 ? 79  GLU A HG3  2  
ATOM 3551  N N    . TRP A 1 80  ? -22.322 2.743   -3.092  1.00 0.00 ? 80  TRP A N    2  
ATOM 3552  C CA   . TRP A 1 80  ? -21.823 1.692   -3.962  1.00 0.00 ? 80  TRP A CA   2  
ATOM 3553  C C    . TRP A 1 80  ? -22.975 0.727   -4.245  1.00 0.00 ? 80  TRP A C    2  
ATOM 3554  O O    . TRP A 1 80  ? -23.149 0.275   -5.376  1.00 0.00 ? 80  TRP A O    2  
ATOM 3555  C CB   . TRP A 1 80  ? -20.603 1.004   -3.347  1.00 0.00 ? 80  TRP A CB   2  
ATOM 3556  C CG   . TRP A 1 80  ? -19.435 0.821   -4.320  1.00 0.00 ? 80  TRP A CG   2  
ATOM 3557  C CD1  . TRP A 1 80  ? -18.993 -0.316  -4.873  1.00 0.00 ? 80  TRP A CD1  2  
ATOM 3558  C CD2  . TRP A 1 80  ? -18.575 1.859   -4.834  1.00 0.00 ? 80  TRP A CD2  2  
ATOM 3559  N NE1  . TRP A 1 80  ? -17.914 -0.088  -5.702  1.00 0.00 ? 80  TRP A NE1  2  
ATOM 3560  C CE2  . TRP A 1 80  ? -17.652 1.277   -5.678  1.00 0.00 ? 80  TRP A CE2  2  
ATOM 3561  C CE3  . TRP A 1 80  ? -18.576 3.245   -4.593  1.00 0.00 ? 80  TRP A CE3  2  
ATOM 3562  C CZ2  . TRP A 1 80  ? -16.661 2.004   -6.350  1.00 0.00 ? 80  TRP A CZ2  2  
ATOM 3563  C CZ3  . TRP A 1 80  ? -17.581 3.957   -5.272  1.00 0.00 ? 80  TRP A CZ3  2  
ATOM 3564  C CH2  . TRP A 1 80  ? -16.644 3.386   -6.125  1.00 0.00 ? 80  TRP A CH2  2  
ATOM 3565  H H    . TRP A 1 80  ? -21.901 2.776   -2.185  1.00 0.00 ? 80  TRP A H    2  
ATOM 3566  H HA   . TRP A 1 80  ? -21.491 2.158   -4.890  1.00 0.00 ? 80  TRP A HA   2  
ATOM 3567  H HB2  . TRP A 1 80  ? -20.262 1.587   -2.492  1.00 0.00 ? 80  TRP A HB2  2  
ATOM 3568  H HB3  . TRP A 1 80  ? -20.903 0.026   -2.968  1.00 0.00 ? 80  TRP A HB3  2  
ATOM 3569  H HD1  . TRP A 1 80  ? -19.430 -1.297  -4.690  1.00 0.00 ? 80  TRP A HD1  2  
ATOM 3570  H HE1  . TRP A 1 80  ? -17.368 -0.839  -6.272  1.00 0.00 ? 80  TRP A HE1  2  
ATOM 3571  H HE3  . TRP A 1 80  ? -19.294 3.728   -3.931  1.00 0.00 ? 80  TRP A HE3  2  
ATOM 3572  H HZ2  . TRP A 1 80  ? -15.943 1.520   -7.012  1.00 0.00 ? 80  TRP A HZ2  2  
ATOM 3573  H HZ3  . TRP A 1 80  ? -17.537 5.036   -5.121  1.00 0.00 ? 80  TRP A HZ3  2  
ATOM 3574  H HH2  . TRP A 1 80  ? -15.899 4.011   -6.618  1.00 0.00 ? 80  TRP A HH2  2  
ATOM 3575  N N    . ASP A 1 81  ? -23.733 0.437   -3.197  1.00 0.00 ? 81  ASP A N    2  
ATOM 3576  C CA   . ASP A 1 81  ? -24.865 -0.467  -3.319  1.00 0.00 ? 81  ASP A CA   2  
ATOM 3577  C C    . ASP A 1 81  ? -25.983 0.224   -4.100  1.00 0.00 ? 81  ASP A C    2  
ATOM 3578  O O    . ASP A 1 81  ? -26.556 -0.359  -5.019  1.00 0.00 ? 81  ASP A O    2  
ATOM 3579  C CB   . ASP A 1 81  ? -25.414 -0.849  -1.944  1.00 0.00 ? 81  ASP A CB   2  
ATOM 3580  C CG   . ASP A 1 81  ? -26.258 -2.126  -1.916  1.00 0.00 ? 81  ASP A CG   2  
ATOM 3581  O OD1  . ASP A 1 81  ? -27.312 -2.123  -2.585  1.00 0.00 ? 81  ASP A OD1  2  
ATOM 3582  O OD2  . ASP A 1 81  ? -25.827 -3.075  -1.225  1.00 0.00 ? 81  ASP A OD2  2  
ATOM 3583  H H    . ASP A 1 81  ? -23.586 0.809   -2.281  1.00 0.00 ? 81  ASP A H    2  
ATOM 3584  H HA   . ASP A 1 81  ? -24.476 -1.344  -3.836  1.00 0.00 ? 81  ASP A HA   2  
ATOM 3585  H HB2  . ASP A 1 81  ? -24.578 -0.970  -1.255  1.00 0.00 ? 81  ASP A HB2  2  
ATOM 3586  H HB3  . ASP A 1 81  ? -26.020 -0.024  -1.569  1.00 0.00 ? 81  ASP A HB3  2  
ATOM 3587  N N    . ARG A 1 82  ? -26.261 1.459   -3.706  1.00 0.00 ? 82  ARG A N    2  
ATOM 3588  C CA   . ARG A 1 82  ? -27.301 2.236   -4.358  1.00 0.00 ? 82  ARG A CA   2  
ATOM 3589  C C    . ARG A 1 82  ? -27.021 2.346   -5.858  1.00 0.00 ? 82  ARG A C    2  
ATOM 3590  O O    . ARG A 1 82  ? -27.914 2.135   -6.677  1.00 0.00 ? 82  ARG A O    2  
ATOM 3591  C CB   . ARG A 1 82  ? -27.396 3.641   -3.760  1.00 0.00 ? 82  ARG A CB   2  
ATOM 3592  C CG   . ARG A 1 82  ? -28.487 4.459   -4.452  1.00 0.00 ? 82  ARG A CG   2  
ATOM 3593  C CD   . ARG A 1 82  ? -27.927 5.779   -4.987  1.00 0.00 ? 82  ARG A CD   2  
ATOM 3594  N NE   . ARG A 1 82  ? -28.895 6.398   -5.919  1.00 0.00 ? 82  ARG A NE   2  
ATOM 3595  C CZ   . ARG A 1 82  ? -28.636 7.488   -6.656  1.00 0.00 ? 82  ARG A CZ   2  
ATOM 3596  N NH1  . ARG A 1 82  ? -27.439 8.084   -6.573  1.00 0.00 ? 82  ARG A NH1  2  
ATOM 3597  N NH2  . ARG A 1 82  ? -29.575 7.980   -7.476  1.00 0.00 ? 82  ARG A NH2  2  
ATOM 3598  H H    . ARG A 1 82  ? -25.791 1.926   -2.957  1.00 0.00 ? 82  ARG A H    2  
ATOM 3599  H HA   . ARG A 1 82  ? -28.221 1.683   -4.170  1.00 0.00 ? 82  ARG A HA   2  
ATOM 3600  H HB2  . ARG A 1 82  ? -27.609 3.572   -2.692  1.00 0.00 ? 82  ARG A HB2  2  
ATOM 3601  H HB3  . ARG A 1 82  ? -26.437 4.149   -3.860  1.00 0.00 ? 82  ARG A HB3  2  
ATOM 3602  H HG2  . ARG A 1 82  ? -28.914 3.882   -5.273  1.00 0.00 ? 82  ARG A HG2  2  
ATOM 3603  H HG3  . ARG A 1 82  ? -29.296 4.662   -3.750  1.00 0.00 ? 82  ARG A HG3  2  
ATOM 3604  H HD2  . ARG A 1 82  ? -27.723 6.458   -4.158  1.00 0.00 ? 82  ARG A HD2  2  
ATOM 3605  H HD3  . ARG A 1 82  ? -26.980 5.602   -5.495  1.00 0.00 ? 82  ARG A HD3  2  
ATOM 3606  H HE   . ARG A 1 82  ? -29.798 5.978   -6.006  1.00 0.00 ? 82  ARG A HE   2  
ATOM 3607  H HH11 . ARG A 1 82  ? -26.739 7.716   -5.961  1.00 0.00 ? 82  ARG A HH11 2  
ATOM 3608  H HH12 . ARG A 1 82  ? -27.246 8.897   -7.123  1.00 0.00 ? 82  ARG A HH12 2  
ATOM 3609  H HH21 . ARG A 1 82  ? -30.468 7.536   -7.538  1.00 0.00 ? 82  ARG A HH21 2  
ATOM 3610  H HH22 . ARG A 1 82  ? -29.382 8.792   -8.026  1.00 0.00 ? 82  ARG A HH22 2  
ATOM 3611  N N    . LEU A 1 83  ? -25.777 2.674   -6.173  1.00 0.00 ? 83  LEU A N    2  
ATOM 3612  C CA   . LEU A 1 83  ? -25.367 2.814   -7.559  1.00 0.00 ? 83  LEU A CA   2  
ATOM 3613  C C    . LEU A 1 83  ? -25.317 1.432   -8.214  1.00 0.00 ? 83  LEU A C    2  
ATOM 3614  O O    . LEU A 1 83  ? -26.295 0.992   -8.817  1.00 0.00 ? 83  LEU A O    2  
ATOM 3615  C CB   . LEU A 1 83  ? -24.050 3.587   -7.654  1.00 0.00 ? 83  LEU A CB   2  
ATOM 3616  C CG   . LEU A 1 83  ? -24.129 5.086   -7.357  1.00 0.00 ? 83  LEU A CG   2  
ATOM 3617  C CD1  . LEU A 1 83  ? -22.901 5.555   -6.574  1.00 0.00 ? 83  LEU A CD1  2  
ATOM 3618  C CD2  . LEU A 1 83  ? -24.331 5.890   -8.643  1.00 0.00 ? 83  LEU A CD2  2  
ATOM 3619  H H    . LEU A 1 83  ? -25.056 2.844   -5.500  1.00 0.00 ? 83  LEU A H    2  
ATOM 3620  H HA   . LEU A 1 83  ? -26.128 3.410   -8.066  1.00 0.00 ? 83  LEU A HA   2  
ATOM 3621  H HB2  . LEU A 1 83  ? -23.338 3.137   -6.963  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 3622  H HB3  . LEU A 1 83  ? -23.647 3.456   -8.658  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 3623  H HG   . LEU A 1 83  ? -25.000 5.264   -6.726  1.00 0.00 ? 83  LEU A HG   2  
ATOM 3624  H HD11 . LEU A 1 83  ? -22.030 4.980   -6.886  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 3625  H HD12 . LEU A 1 83  ? -22.727 6.613   -6.771  1.00 0.00 ? 83  LEU A HD12 2  
ATOM 3626  H HD13 . LEU A 1 83  ? -23.072 5.407   -5.508  1.00 0.00 ? 83  LEU A HD13 2  
ATOM 3627  H HD21 . LEU A 1 83  ? -24.674 5.226   -9.437  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 3628  H HD22 . LEU A 1 83  ? -25.076 6.668   -8.472  1.00 0.00 ? 83  LEU A HD22 2  
ATOM 3629  H HD23 . LEU A 1 83  ? -23.386 6.349   -8.936  1.00 0.00 ? 83  LEU A HD23 2  
ATOM 3630  N N    . HIS A 1 84  ? -24.169 0.788   -8.073  1.00 0.00 ? 84  HIS A N    2  
ATOM 3631  C CA   . HIS A 1 84  ? -23.980 -0.536  -8.644  1.00 0.00 ? 84  HIS A CA   2  
ATOM 3632  C C    . HIS A 1 84  ? -23.768 -1.553  -7.522  1.00 0.00 ? 84  HIS A C    2  
ATOM 3633  O O    . HIS A 1 84  ? -22.636 -1.799  -7.107  1.00 0.00 ? 84  HIS A O    2  
ATOM 3634  C CB   . HIS A 1 84  ? -22.839 -0.529  -9.663  1.00 0.00 ? 84  HIS A CB   2  
ATOM 3635  C CG   . HIS A 1 84  ? -21.462 -0.565  -9.043  1.00 0.00 ? 84  HIS A CG   2  
ATOM 3636  N ND1  . HIS A 1 84  ? -20.431 -1.337  -9.550  1.00 0.00 ? 84  HIS A ND1  2  
ATOM 3637  C CD2  . HIS A 1 84  ? -20.957 0.085   -7.955  1.00 0.00 ? 84  HIS A CD2  2  
ATOM 3638  C CE1  . HIS A 1 84  ? -19.360 -1.153  -8.792  1.00 0.00 ? 84  HIS A CE1  2  
ATOM 3639  N NE2  . HIS A 1 84  ? -19.688 -0.273  -7.804  1.00 0.00 ? 84  HIS A NE2  2  
ATOM 3640  H H    . HIS A 1 84  ? -23.379 1.153   -7.582  1.00 0.00 ? 84  HIS A H    2  
ATOM 3641  H HA   . HIS A 1 84  ? -24.899 -0.781  -9.176  1.00 0.00 ? 84  HIS A HA   2  
ATOM 3642  H HB2  . HIS A 1 84  ? -22.950 -1.390  -10.323 1.00 0.00 ? 84  HIS A HB2  2  
ATOM 3643  H HB3  . HIS A 1 84  ? -22.924 0.362   -10.283 1.00 0.00 ? 84  HIS A HB3  2  
ATOM 3644  H HD1  . HIS A 1 84  ? -20.485 -1.932  -10.351 1.00 0.00 ? 84  HIS A HD1  2  
ATOM 3645  H HD2  . HIS A 1 84  ? -21.505 0.779   -7.317  1.00 0.00 ? 84  HIS A HD2  2  
ATOM 3646  H HE1  . HIS A 1 84  ? -18.387 -1.624  -8.934  1.00 0.00 ? 84  HIS A HE1  2  
ATOM 3647  H HE2  . HIS A 1 84  ? -19.059 0.094   -7.119  1.00 0.00 ? 84  HIS A HE2  2  
ATOM 3648  N N    . PRO A 1 85  ? -24.903 -2.132  -7.049  1.00 0.00 ? 85  PRO A N    2  
ATOM 3649  C CA   . PRO A 1 85  ? -24.852 -3.118  -5.982  1.00 0.00 ? 85  PRO A CA   2  
ATOM 3650  C C    . PRO A 1 85  ? -24.342 -4.463  -6.502  1.00 0.00 ? 85  PRO A C    2  
ATOM 3651  O O    . PRO A 1 85  ? -23.817 -4.545  -7.611  1.00 0.00 ? 85  PRO A O    2  
ATOM 3652  C CB   . PRO A 1 85  ? -26.272 -3.189  -5.444  1.00 0.00 ? 85  PRO A CB   2  
ATOM 3653  C CG   . PRO A 1 85  ? -27.158 -2.592  -6.526  1.00 0.00 ? 85  PRO A CG   2  
ATOM 3654  C CD   . PRO A 1 85  ? -26.261 -1.865  -7.514  1.00 0.00 ? 85  PRO A CD   2  
ATOM 3655  H HA   . PRO A 1 85  ? -24.203 -2.832  -5.276  1.00 0.00 ? 85  PRO A HA   2  
ATOM 3656  H HB2  . PRO A 1 85  ? -26.558 -4.219  -5.229  1.00 0.00 ? 85  PRO A HB2  2  
ATOM 3657  H HB3  . PRO A 1 85  ? -26.365 -2.632  -4.511  1.00 0.00 ? 85  PRO A HB3  2  
ATOM 3658  H HG2  . PRO A 1 85  ? -27.726 -3.375  -7.029  1.00 0.00 ? 85  PRO A HG2  2  
ATOM 3659  H HG3  . PRO A 1 85  ? -27.882 -1.903  -6.089  1.00 0.00 ? 85  PRO A HG3  2  
ATOM 3660  H HD2  . PRO A 1 85  ? -26.411 -2.234  -8.529  1.00 0.00 ? 85  PRO A HD2  2  
ATOM 3661  H HD3  . PRO A 1 85  ? -26.472 -0.797  -7.529  1.00 0.00 ? 85  PRO A HD3  2  
ATOM 3662  N N    . VAL A 1 86  ? -24.513 -5.484  -5.675  1.00 0.00 ? 86  VAL A N    2  
ATOM 3663  C CA   . VAL A 1 86  ? -24.076 -6.822  -6.038  1.00 0.00 ? 86  VAL A CA   2  
ATOM 3664  C C    . VAL A 1 86  ? -25.152 -7.490  -6.896  1.00 0.00 ? 86  VAL A C    2  
ATOM 3665  O O    . VAL A 1 86  ? -26.025 -8.182  -6.376  1.00 0.00 ? 86  VAL A O    2  
ATOM 3666  C CB   . VAL A 1 86  ? -23.736 -7.621  -4.778  1.00 0.00 ? 86  VAL A CB   2  
ATOM 3667  C CG1  . VAL A 1 86  ? -24.939 -7.696  -3.836  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 3668  C CG2  . VAL A 1 86  ? -23.230 -9.019  -5.135  1.00 0.00 ? 86  VAL A CG2  2  
ATOM 3669  H H    . VAL A 1 86  ? -24.941 -5.409  -4.775  1.00 0.00 ? 86  VAL A H    2  
ATOM 3670  H HA   . VAL A 1 86  ? -23.166 -6.721  -6.629  1.00 0.00 ? 86  VAL A HA   2  
ATOM 3671  H HB   . VAL A 1 86  ? -22.934 -7.098  -4.256  1.00 0.00 ? 86  VAL A HB   2  
ATOM 3672  H HG11 . VAL A 1 86  ? -25.776 -7.149  -4.270  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 3673  H HG12 . VAL A 1 86  ? -25.222 -8.740  -3.691  1.00 0.00 ? 86  VAL A HG12 2  
ATOM 3674  H HG13 . VAL A 1 86  ? -24.676 -7.255  -2.874  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 3675  H HG21 . VAL A 1 86  ? -22.884 -9.028  -6.169  1.00 0.00 ? 86  VAL A HG21 2  
ATOM 3676  H HG22 . VAL A 1 86  ? -22.406 -9.288  -4.474  1.00 0.00 ? 86  VAL A HG22 2  
ATOM 3677  H HG23 . VAL A 1 86  ? -24.040 -9.740  -5.018  1.00 0.00 ? 86  VAL A HG23 2  
ATOM 3678  N N    . HIS A 1 87  ? -25.053 -7.258  -8.197  1.00 0.00 ? 87  HIS A N    2  
ATOM 3679  C CA   . HIS A 1 87  ? -26.007 -7.829  -9.134  1.00 0.00 ? 87  HIS A CA   2  
ATOM 3680  C C    . HIS A 1 87  ? -25.632 -7.421  -10.560 1.00 0.00 ? 87  HIS A C    2  
ATOM 3681  O O    . HIS A 1 87  ? -24.690 -6.657  -10.764 1.00 0.00 ? 87  HIS A O    2  
ATOM 3682  C CB   . HIS A 1 87  ? -27.436 -7.435  -8.760  1.00 0.00 ? 87  HIS A CB   2  
ATOM 3683  C CG   . HIS A 1 87  ? -27.986 -6.280  -9.564  1.00 0.00 ? 87  HIS A CG   2  
ATOM 3684  N ND1  . HIS A 1 87  ? -27.246 -5.145  -9.847  1.00 0.00 ? 87  HIS A ND1  2  
ATOM 3685  C CD2  . HIS A 1 87  ? -29.207 -6.098  -10.143 1.00 0.00 ? 87  HIS A CD2  2  
ATOM 3686  C CE1  . HIS A 1 87  ? -27.999 -4.323  -10.563 1.00 0.00 ? 87  HIS A CE1  2  
ATOM 3687  N NE2  . HIS A 1 87  ? -29.214 -4.915  -10.745 1.00 0.00 ? 87  HIS A NE2  2  
ATOM 3688  H H    . HIS A 1 87  ? -24.339 -6.694  -8.612  1.00 0.00 ? 87  HIS A H    2  
ATOM 3689  H HA   . HIS A 1 87  ? -25.925 -8.912  -9.041  1.00 0.00 ? 87  HIS A HA   2  
ATOM 3690  H HB2  . HIS A 1 87  ? -28.087 -8.299  -8.894  1.00 0.00 ? 87  HIS A HB2  2  
ATOM 3691  H HB3  . HIS A 1 87  ? -27.466 -7.174  -7.702  1.00 0.00 ? 87  HIS A HB3  2  
ATOM 3692  H HD1  . HIS A 1 87  ? -26.303 -4.974  -9.558  1.00 0.00 ? 87  HIS A HD1  2  
ATOM 3693  H HD2  . HIS A 1 87  ? -30.037 -6.805  -10.116 1.00 0.00 ? 87  HIS A HD2  2  
ATOM 3694  H HE1  . HIS A 1 87  ? -27.700 -3.346  -10.940 1.00 0.00 ? 87  HIS A HE1  2  
ATOM 3695  H HE2  . HIS A 1 87  ? -29.963 -4.548  -11.296 1.00 0.00 ? 87  HIS A HE2  2  
ATOM 3696  N N    . ALA A 1 88  ? -26.390 -7.949  -11.510 1.00 0.00 ? 88  ALA A N    2  
ATOM 3697  C CA   . ALA A 1 88  ? -26.150 -7.650  -12.911 1.00 0.00 ? 88  ALA A CA   2  
ATOM 3698  C C    . ALA A 1 88  ? -24.686 -7.942  -13.247 1.00 0.00 ? 88  ALA A C    2  
ATOM 3699  O O    . ALA A 1 88  ? -23.883 -7.021  -13.396 1.00 0.00 ? 88  ALA A O    2  
ATOM 3700  C CB   . ALA A 1 88  ? -26.535 -6.197  -13.196 1.00 0.00 ? 88  ALA A CB   2  
ATOM 3701  H H    . ALA A 1 88  ? -27.154 -8.569  -11.335 1.00 0.00 ? 88  ALA A H    2  
ATOM 3702  H HA   . ALA A 1 88  ? -26.787 -8.305  -13.504 1.00 0.00 ? 88  ALA A HA   2  
ATOM 3703  H HB1  . ALA A 1 88  ? -27.594 -6.053  -12.982 1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3704  H HB2  . ALA A 1 88  ? -25.943 -5.533  -12.566 1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3705  H HB3  . ALA A 1 88  ? -26.342 -5.969  -14.245 1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3706  N N    . GLY A 1 89  ? -24.382 -9.226  -13.357 1.00 0.00 ? 89  GLY A N    2  
ATOM 3707  C CA   . GLY A 1 89  ? -23.028 -9.651  -13.672 1.00 0.00 ? 89  GLY A CA   2  
ATOM 3708  C C    . GLY A 1 89  ? -22.918 -11.177 -13.669 1.00 0.00 ? 89  GLY A C    2  
ATOM 3709  O O    . GLY A 1 89  ? -22.934 -11.803 -12.610 1.00 0.00 ? 89  GLY A O    2  
ATOM 3710  H H    . GLY A 1 89  ? -25.040 -9.969  -13.234 1.00 0.00 ? 89  GLY A H    2  
ATOM 3711  H HA2  . GLY A 1 89  ? -22.740 -9.264  -14.648 1.00 0.00 ? 89  GLY A HA2  2  
ATOM 3712  H HA3  . GLY A 1 89  ? -22.333 -9.231  -12.945 1.00 0.00 ? 89  GLY A HA3  2  
ATOM 3713  N N    . PRO A 1 90  ? -22.805 -11.747 -14.899 1.00 0.00 ? 90  PRO A N    2  
ATOM 3714  C CA   . PRO A 1 90  ? -22.692 -13.188 -15.047 1.00 0.00 ? 90  PRO A CA   2  
ATOM 3715  C C    . PRO A 1 90  ? -21.293 -13.672 -14.658 1.00 0.00 ? 90  PRO A C    2  
ATOM 3716  O O    . PRO A 1 90  ? -20.416 -13.796 -15.510 1.00 0.00 ? 90  PRO A O    2  
ATOM 3717  C CB   . PRO A 1 90  ? -23.030 -13.461 -16.504 1.00 0.00 ? 90  PRO A CB   2  
ATOM 3718  C CG   . PRO A 1 90  ? -22.865 -12.132 -17.226 1.00 0.00 ? 90  PRO A CG   2  
ATOM 3719  C CD   . PRO A 1 90  ? -22.783 -11.038 -16.175 1.00 0.00 ? 90  PRO A CD   2  
ATOM 3720  H HA   . PRO A 1 90  ? -23.325 -13.652 -14.428 1.00 0.00 ? 90  PRO A HA   2  
ATOM 3721  H HB2  . PRO A 1 90  ? -22.367 -14.218 -16.925 1.00 0.00 ? 90  PRO A HB2  2  
ATOM 3722  H HB3  . PRO A 1 90  ? -24.048 -13.836 -16.606 1.00 0.00 ? 90  PRO A HB3  2  
ATOM 3723  H HG2  . PRO A 1 90  ? -21.964 -12.140 -17.840 1.00 0.00 ? 90  PRO A HG2  2  
ATOM 3724  H HG3  . PRO A 1 90  ? -23.706 -11.956 -17.897 1.00 0.00 ? 90  PRO A HG3  2  
ATOM 3725  H HD2  . PRO A 1 90  ? -21.872 -10.450 -16.285 1.00 0.00 ? 90  PRO A HD2  2  
ATOM 3726  H HD3  . PRO A 1 90  ? -23.621 -10.346 -16.258 1.00 0.00 ? 90  PRO A HD3  2  
ATOM 3727  N N    . ILE A 1 91  ? -21.131 -13.932 -13.369 1.00 0.00 ? 91  ILE A N    2  
ATOM 3728  C CA   . ILE A 1 91  ? -19.854 -14.399 -12.856 1.00 0.00 ? 91  ILE A CA   2  
ATOM 3729  C C    . ILE A 1 91  ? -19.682 -15.880 -13.199 1.00 0.00 ? 91  ILE A C    2  
ATOM 3730  O O    . ILE A 1 91  ? -20.663 -16.617 -13.292 1.00 0.00 ? 91  ILE A O    2  
ATOM 3731  C CB   . ILE A 1 91  ? -19.735 -14.096 -11.360 1.00 0.00 ? 91  ILE A CB   2  
ATOM 3732  C CG1  . ILE A 1 91  ? -19.687 -12.588 -11.109 1.00 0.00 ? 91  ILE A CG1  2  
ATOM 3733  C CG2  . ILE A 1 91  ? -18.532 -14.819 -10.749 1.00 0.00 ? 91  ILE A CG2  2  
ATOM 3734  C CD1  . ILE A 1 91  ? -19.581 -12.285 -9.612  1.00 0.00 ? 91  ILE A CD1  2  
ATOM 3735  H H    . ILE A 1 91  ? -21.850 -13.828 -12.683 1.00 0.00 ? 91  ILE A H    2  
ATOM 3736  H HA   . ILE A 1 91  ? -19.072 -13.834 -13.363 1.00 0.00 ? 91  ILE A HA   2  
ATOM 3737  H HB   . ILE A 1 91  ? -20.626 -14.478 -10.862 1.00 0.00 ? 91  ILE A HB   2  
ATOM 3738  H HG12 . ILE A 1 91  ? -18.835 -12.155 -11.632 1.00 0.00 ? 91  ILE A HG12 2  
ATOM 3739  H HG13 . ILE A 1 91  ? -20.583 -12.119 -11.515 1.00 0.00 ? 91  ILE A HG13 2  
ATOM 3740  H HG21 . ILE A 1 91  ? -18.496 -15.842 -11.122 1.00 0.00 ? 91  ILE A HG21 2  
ATOM 3741  H HG22 . ILE A 1 91  ? -17.616 -14.298 -11.028 1.00 0.00 ? 91  ILE A HG22 2  
ATOM 3742  H HG23 . ILE A 1 91  ? -18.629 -14.829 -9.664  1.00 0.00 ? 91  ILE A HG23 2  
ATOM 3743  H HD11 . ILE A 1 91  ? -20.278 -12.918 -9.063  1.00 0.00 ? 91  ILE A HD11 2  
ATOM 3744  H HD12 . ILE A 1 91  ? -18.565 -12.484 -9.273  1.00 0.00 ? 91  ILE A HD12 2  
ATOM 3745  H HD13 . ILE A 1 91  ? -19.825 -11.237 -9.435  1.00 0.00 ? 91  ILE A HD13 2  
ATOM 3746  N N    . ALA A 1 92  ? -18.430 -16.271 -13.377 1.00 0.00 ? 92  ALA A N    2  
ATOM 3747  C CA   . ALA A 1 92  ? -18.117 -17.652 -13.708 1.00 0.00 ? 92  ALA A CA   2  
ATOM 3748  C C    . ALA A 1 92  ? -18.491 -18.552 -12.529 1.00 0.00 ? 92  ALA A C    2  
ATOM 3749  O O    . ALA A 1 92  ? -18.526 -18.100 -11.385 1.00 0.00 ? 92  ALA A O    2  
ATOM 3750  C CB   . ALA A 1 92  ? -16.638 -17.764 -14.082 1.00 0.00 ? 92  ALA A CB   2  
ATOM 3751  H H    . ALA A 1 92  ? -17.638 -15.666 -13.299 1.00 0.00 ? 92  ALA A H    2  
ATOM 3752  H HA   . ALA A 1 92  ? -18.719 -17.930 -14.572 1.00 0.00 ? 92  ALA A HA   2  
ATOM 3753  H HB1  . ALA A 1 92  ? -16.211 -16.767 -14.182 1.00 0.00 ? 92  ALA A HB1  2  
ATOM 3754  H HB2  . ALA A 1 92  ? -16.106 -18.310 -13.302 1.00 0.00 ? 92  ALA A HB2  2  
ATOM 3755  H HB3  . ALA A 1 92  ? -16.541 -18.297 -15.028 1.00 0.00 ? 92  ALA A HB3  2  
ATOM 3756  N N    . PRO A 1 93  ? -18.767 -19.842 -12.856 1.00 0.00 ? 93  PRO A N    2  
ATOM 3757  C CA   . PRO A 1 93  ? -19.136 -20.810 -11.837 1.00 0.00 ? 93  PRO A CA   2  
ATOM 3758  C C    . PRO A 1 93  ? -17.916 -21.242 -11.022 1.00 0.00 ? 93  PRO A C    2  
ATOM 3759  O O    . PRO A 1 93  ? -17.279 -22.246 -11.337 1.00 0.00 ? 93  PRO A O    2  
ATOM 3760  C CB   . PRO A 1 93  ? -19.779 -21.958 -12.599 1.00 0.00 ? 93  PRO A CB   2  
ATOM 3761  C CG   . PRO A 1 93  ? -19.329 -21.803 -14.042 1.00 0.00 ? 93  PRO A CG   2  
ATOM 3762  C CD   . PRO A 1 93  ? -18.736 -20.413 -14.199 1.00 0.00 ? 93  PRO A CD   2  
ATOM 3763  H HA   . PRO A 1 93  ? -19.772 -20.399 -11.182 1.00 0.00 ? 93  PRO A HA   2  
ATOM 3764  H HB2  . PRO A 1 93  ? -19.466 -22.920 -12.192 1.00 0.00 ? 93  PRO A HB2  2  
ATOM 3765  H HB3  . PRO A 1 93  ? -20.866 -21.918 -12.521 1.00 0.00 ? 93  PRO A HB3  2  
ATOM 3766  H HG2  . PRO A 1 93  ? -18.590 -22.564 -14.295 1.00 0.00 ? 93  PRO A HG2  2  
ATOM 3767  H HG3  . PRO A 1 93  ? -20.171 -21.938 -14.721 1.00 0.00 ? 93  PRO A HG3  2  
ATOM 3768  H HD2  . PRO A 1 93  ? -17.718 -20.458 -14.587 1.00 0.00 ? 93  PRO A HD2  2  
ATOM 3769  H HD3  . PRO A 1 93  ? -19.316 -19.811 -14.899 1.00 0.00 ? 93  PRO A HD3  2  
ATOM 3770  N N    . GLY A 1 94  ? -17.627 -20.462 -9.990  1.00 0.00 ? 94  GLY A N    2  
ATOM 3771  C CA   . GLY A 1 94  ? -16.494 -20.752 -9.128  1.00 0.00 ? 94  GLY A CA   2  
ATOM 3772  C C    . GLY A 1 94  ? -15.619 -19.511 -8.938  1.00 0.00 ? 94  GLY A C    2  
ATOM 3773  O O    . GLY A 1 94  ? -14.630 -19.550 -8.208  1.00 0.00 ? 94  GLY A O    2  
ATOM 3774  H H    . GLY A 1 94  ? -18.150 -19.647 -9.741  1.00 0.00 ? 94  GLY A H    2  
ATOM 3775  H HA2  . GLY A 1 94  ? -16.850 -21.102 -8.160  1.00 0.00 ? 94  GLY A HA2  2  
ATOM 3776  H HA3  . GLY A 1 94  ? -15.900 -21.558 -9.560  1.00 0.00 ? 94  GLY A HA3  2  
ATOM 3777  N N    . GLN A 1 95  ? -16.013 -18.439 -9.609  1.00 0.00 ? 95  GLN A N    2  
ATOM 3778  C CA   . GLN A 1 95  ? -15.278 -17.189 -9.524  1.00 0.00 ? 95  GLN A CA   2  
ATOM 3779  C C    . GLN A 1 95  ? -15.896 -16.281 -8.460  1.00 0.00 ? 95  GLN A C    2  
ATOM 3780  O O    . GLN A 1 95  ? -17.111 -16.291 -8.258  1.00 0.00 ? 95  GLN A O    2  
ATOM 3781  C CB   . GLN A 1 95  ? -15.227 -16.487 -10.882 1.00 0.00 ? 95  GLN A CB   2  
ATOM 3782  C CG   . GLN A 1 95  ? -14.414 -17.302 -11.890 1.00 0.00 ? 95  GLN A CG   2  
ATOM 3783  C CD   . GLN A 1 95  ? -12.913 -17.149 -11.633 1.00 0.00 ? 95  GLN A CD   2  
ATOM 3784  O OE1  . GLN A 1 95  ? -12.470 -16.885 -10.528 1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3785  N NE2  . GLN A 1 95  ? -12.159 -17.329 -12.714 1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3786  H H    . GLN A 1 95  ? -16.819 -18.415 -10.202 1.00 0.00 ? 95  GLN A H    2  
ATOM 3787  H HA   . GLN A 1 95  ? -14.266 -17.468 -9.228  1.00 0.00 ? 95  GLN A HA   2  
ATOM 3788  H HB2  . GLN A 1 95  ? -16.240 -16.344 -11.259 1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3789  H HB3  . GLN A 1 95  ? -14.787 -15.497 -10.768 1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3790  H HG2  . GLN A 1 95  ? -14.693 -18.353 -11.824 1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3791  H HG3  . GLN A 1 95  ? -14.648 -16.973 -12.903 1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3792  H HE21 . GLN A 1 95  ? -12.586 -17.544 -13.593 1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3793  H HE22 . GLN A 1 95  ? -11.164 -17.251 -12.648 1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3794  N N    . MET A 1 96  ? -15.035 -15.515 -7.806  1.00 0.00 ? 96  MET A N    2  
ATOM 3795  C CA   . MET A 1 96  ? -15.482 -14.602 -6.767  1.00 0.00 ? 96  MET A CA   2  
ATOM 3796  C C    . MET A 1 96  ? -16.764 -13.880 -7.187  1.00 0.00 ? 96  MET A C    2  
ATOM 3797  O O    . MET A 1 96  ? -17.132 -13.893 -8.361  1.00 0.00 ? 96  MET A O    2  
ATOM 3798  C CB   . MET A 1 96  ? -14.386 -13.573 -6.486  1.00 0.00 ? 96  MET A CB   2  
ATOM 3799  C CG   . MET A 1 96  ? -13.968 -12.851 -7.769  1.00 0.00 ? 96  MET A CG   2  
ATOM 3800  S SD   . MET A 1 96  ? -12.189 -12.733 -7.852  1.00 0.00 ? 96  MET A SD   2  
ATOM 3801  C CE   . MET A 1 96  ? -11.960 -11.070 -7.245  1.00 0.00 ? 96  MET A CE   2  
ATOM 3802  H H    . MET A 1 96  ? -14.049 -15.512 -7.975  1.00 0.00 ? 96  MET A H    2  
ATOM 3803  H HA   . MET A 1 96  ? -15.676 -15.225 -5.895  1.00 0.00 ? 96  MET A HA   2  
ATOM 3804  H HB2  . MET A 1 96  ? -14.743 -12.847 -5.756  1.00 0.00 ? 96  MET A HB2  2  
ATOM 3805  H HB3  . MET A 1 96  ? -13.521 -14.069 -6.046  1.00 0.00 ? 96  MET A HB3  2  
ATOM 3806  H HG2  . MET A 1 96  ? -14.346 -13.389 -8.638  1.00 0.00 ? 96  MET A HG2  2  
ATOM 3807  H HG3  . MET A 1 96  ? -14.408 -11.854 -7.795  1.00 0.00 ? 96  MET A HG3  2  
ATOM 3808  H HE1  . MET A 1 96  ? -12.471 -10.958 -6.289  1.00 0.00 ? 96  MET A HE1  2  
ATOM 3809  H HE2  . MET A 1 96  ? -10.896 -10.875 -7.113  1.00 0.00 ? 96  MET A HE2  2  
ATOM 3810  H HE3  . MET A 1 96  ? -12.373 -10.361 -7.963  1.00 0.00 ? 96  MET A HE3  2  
ATOM 3811  N N    . ARG A 1 97  ? -17.410 -13.270 -6.205  1.00 0.00 ? 97  ARG A N    2  
ATOM 3812  C CA   . ARG A 1 97  ? -18.643 -12.544 -6.457  1.00 0.00 ? 97  ARG A CA   2  
ATOM 3813  C C    . ARG A 1 97  ? -18.357 -11.049 -6.617  1.00 0.00 ? 97  ARG A C    2  
ATOM 3814  O O    . ARG A 1 97  ? -17.205 -10.623 -6.544  1.00 0.00 ? 97  ARG A O    2  
ATOM 3815  C CB   . ARG A 1 97  ? -19.644 -12.746 -5.318  1.00 0.00 ? 97  ARG A CB   2  
ATOM 3816  C CG   . ARG A 1 97  ? -21.013 -13.165 -5.859  1.00 0.00 ? 97  ARG A CG   2  
ATOM 3817  C CD   . ARG A 1 97  ? -22.070 -12.101 -5.557  1.00 0.00 ? 97  ARG A CD   2  
ATOM 3818  N NE   . ARG A 1 97  ? -23.312 -12.744 -5.073  1.00 0.00 ? 97  ARG A NE   2  
ATOM 3819  C CZ   . ARG A 1 97  ? -24.217 -13.328 -5.871  1.00 0.00 ? 97  ARG A CZ   2  
ATOM 3820  N NH1  . ARG A 1 97  ? -24.023 -13.353 -7.196  1.00 0.00 ? 97  ARG A NH1  2  
ATOM 3821  N NH2  . ARG A 1 97  ? -25.314 -13.886 -5.344  1.00 0.00 ? 97  ARG A NH2  2  
ATOM 3822  H H    . ARG A 1 97  ? -17.104 -13.265 -5.253  1.00 0.00 ? 97  ARG A H    2  
ATOM 3823  H HA   . ARG A 1 97  ? -19.032 -12.970 -7.383  1.00 0.00 ? 97  ARG A HA   2  
ATOM 3824  H HB2  . ARG A 1 97  ? -19.272 -13.508 -4.633  1.00 0.00 ? 97  ARG A HB2  2  
ATOM 3825  H HB3  . ARG A 1 97  ? -19.741 -11.823 -4.747  1.00 0.00 ? 97  ARG A HB3  2  
ATOM 3826  H HG2  . ARG A 1 97  ? -20.950 -13.325 -6.935  1.00 0.00 ? 97  ARG A HG2  2  
ATOM 3827  H HG3  . ARG A 1 97  ? -21.310 -14.115 -5.412  1.00 0.00 ? 97  ARG A HG3  2  
ATOM 3828  H HD2  . ARG A 1 97  ? -21.695 -11.406 -4.806  1.00 0.00 ? 97  ARG A HD2  2  
ATOM 3829  H HD3  . ARG A 1 97  ? -22.279 -11.519 -6.454  1.00 0.00 ? 97  ARG A HD3  2  
ATOM 3830  H HE   . ARG A 1 97  ? -23.487 -12.743 -4.088  1.00 0.00 ? 97  ARG A HE   2  
ATOM 3831  H HH11 . ARG A 1 97  ? -23.204 -12.935 -7.590  1.00 0.00 ? 97  ARG A HH11 2  
ATOM 3832  H HH12 . ARG A 1 97  ? -24.698 -13.788 -7.792  1.00 0.00 ? 97  ARG A HH12 2  
ATOM 3833  H HH21 . ARG A 1 97  ? -25.458 -13.868 -4.354  1.00 0.00 ? 97  ARG A HH21 2  
ATOM 3834  H HH22 . ARG A 1 97  ? -25.989 -14.322 -5.938  1.00 0.00 ? 97  ARG A HH22 2  
ATOM 3835  N N    . GLU A 1 98  ? -19.425 -10.295 -6.830  1.00 0.00 ? 98  GLU A N    2  
ATOM 3836  C CA   . GLU A 1 98  ? -19.303 -8.857  -6.999  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3837  C C    . GLU A 1 98  ? -20.040 -8.125  -5.877  1.00 0.00 ? 98  GLU A C    2  
ATOM 3838  O O    . GLU A 1 98  ? -21.165 -7.663  -6.066  1.00 0.00 ? 98  GLU A O    2  
ATOM 3839  C CB   . GLU A 1 98  ? -19.822 -8.421  -8.371  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3840  C CG   . GLU A 1 98  ? -18.816 -7.504  -9.072  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3841  C CD   . GLU A 1 98  ? -18.881 -7.677  -10.590 1.00 0.00 ? 98  GLU A CD   2  
ATOM 3842  O OE1  . GLU A 1 98  ? -19.126 -8.825  -11.021 1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3843  O OE2  . GLU A 1 98  ? -18.684 -6.659  -11.286 1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3844  H H    . GLU A 1 98  ? -20.358 -10.649 -6.887  1.00 0.00 ? 98  GLU A H    2  
ATOM 3845  H HA   . GLU A 1 98  ? -18.235 -8.648  -6.939  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3846  H HB2  . GLU A 1 98  ? -20.009 -9.299  -8.989  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3847  H HB3  . GLU A 1 98  ? -20.773 -7.902  -8.257  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3848  H HG2  . GLU A 1 98  ? -19.023 -6.466  -8.811  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3849  H HG3  . GLU A 1 98  ? -17.809 -7.726  -8.719  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3850  N N    . PRO A 1 99  ? -19.360 -8.041  -4.702  1.00 0.00 ? 99  PRO A N    2  
ATOM 3851  C CA   . PRO A 1 99  ? -19.939 -7.373  -3.549  1.00 0.00 ? 99  PRO A CA   2  
ATOM 3852  C C    . PRO A 1 99  ? -19.902 -5.853  -3.719  1.00 0.00 ? 99  PRO A C    2  
ATOM 3853  O O    . PRO A 1 99  ? -19.100 -5.330  -4.492  1.00 0.00 ? 99  PRO A O    2  
ATOM 3854  C CB   . PRO A 1 99  ? -19.122 -7.857  -2.363  1.00 0.00 ? 99  PRO A CB   2  
ATOM 3855  C CG   . PRO A 1 99  ? -17.830 -8.410  -2.944  1.00 0.00 ? 99  PRO A CG   2  
ATOM 3856  C CD   . PRO A 1 99  ? -18.028 -8.576  -4.442  1.00 0.00 ? 99  PRO A CD   2  
ATOM 3857  H HA   . PRO A 1 99  ? -20.905 -7.614  -3.456  1.00 0.00 ? 99  PRO A HA   2  
ATOM 3858  H HB2  . PRO A 1 99  ? -18.920 -7.042  -1.667  1.00 0.00 ? 99  PRO A HB2  2  
ATOM 3859  H HB3  . PRO A 1 99  ? -19.659 -8.624  -1.805  1.00 0.00 ? 99  PRO A HB3  2  
ATOM 3860  H HG2  . PRO A 1 99  ? -17.000 -7.733  -2.740  1.00 0.00 ? 99  PRO A HG2  2  
ATOM 3861  H HG3  . PRO A 1 99  ? -17.583 -9.366  -2.483  1.00 0.00 ? 99  PRO A HG3  2  
ATOM 3862  H HD2  . PRO A 1 99  ? -17.266 -8.035  -5.004  1.00 0.00 ? 99  PRO A HD2  2  
ATOM 3863  H HD3  . PRO A 1 99  ? -17.957 -9.623  -4.736  1.00 0.00 ? 99  PRO A HD3  2  
ATOM 3864  N N    . ARG A 1 100 ? -20.781 -5.186  -2.986  1.00 0.00 ? 100 ARG A N    2  
ATOM 3865  C CA   . ARG A 1 100 ? -20.860 -3.736  -3.046  1.00 0.00 ? 100 ARG A CA   2  
ATOM 3866  C C    . ARG A 1 100 ? -19.553 -3.112  -2.550  1.00 0.00 ? 100 ARG A C    2  
ATOM 3867  O O    . ARG A 1 100 ? -18.481 -3.689  -2.723  1.00 0.00 ? 100 ARG A O    2  
ATOM 3868  C CB   . ARG A 1 100 ? -22.021 -3.211  -2.200  1.00 0.00 ? 100 ARG A CB   2  
ATOM 3869  C CG   . ARG A 1 100 ? -23.239 -4.131  -2.309  1.00 0.00 ? 100 ARG A CG   2  
ATOM 3870  C CD   . ARG A 1 100 ? -23.455 -4.911  -1.011  1.00 0.00 ? 100 ARG A CD   2  
ATOM 3871  N NE   . ARG A 1 100 ? -23.008 -6.312  -1.182  1.00 0.00 ? 100 ARG A NE   2  
ATOM 3872  C CZ   . ARG A 1 100 ? -22.640 -7.112  -0.172  1.00 0.00 ? 100 ARG A CZ   2  
ATOM 3873  N NH1  . ARG A 1 100 ? -22.663 -6.654  1.088   1.00 0.00 ? 100 ARG A NH1  2  
ATOM 3874  N NH2  . ARG A 1 100 ? -22.249 -8.369  -0.421  1.00 0.00 ? 100 ARG A NH2  2  
ATOM 3875  H H    . ARG A 1 100 ? -21.431 -5.618  -2.361  1.00 0.00 ? 100 ARG A H    2  
ATOM 3876  H HA   . ARG A 1 100 ? -21.026 -3.510  -4.099  1.00 0.00 ? 100 ARG A HA   2  
ATOM 3877  H HB2  . ARG A 1 100 ? -21.711 -3.134  -1.158  1.00 0.00 ? 100 ARG A HB2  2  
ATOM 3878  H HB3  . ARG A 1 100 ? -22.289 -2.207  -2.527  1.00 0.00 ? 100 ARG A HB3  2  
ATOM 3879  H HG2  . ARG A 1 100 ? -24.126 -3.540  -2.535  1.00 0.00 ? 100 ARG A HG2  2  
ATOM 3880  H HG3  . ARG A 1 100 ? -23.100 -4.827  -3.137  1.00 0.00 ? 100 ARG A HG3  2  
ATOM 3881  H HD2  . ARG A 1 100 ? -22.901 -4.441  -0.199  1.00 0.00 ? 100 ARG A HD2  2  
ATOM 3882  H HD3  . ARG A 1 100 ? -24.509 -4.888  -0.734  1.00 0.00 ? 100 ARG A HD3  2  
ATOM 3883  H HE   . ARG A 1 100 ? -22.980 -6.685  -2.110  1.00 0.00 ? 100 ARG A HE   2  
ATOM 3884  H HH11 . ARG A 1 100 ? -22.954 -5.716  1.274   1.00 0.00 ? 100 ARG A HH11 2  
ATOM 3885  H HH12 . ARG A 1 100 ? -22.388 -7.251  1.841   1.00 0.00 ? 100 ARG A HH12 2  
ATOM 3886  H HH21 . ARG A 1 100 ? -22.232 -8.711  -1.361  1.00 0.00 ? 100 ARG A HH21 2  
ATOM 3887  H HH22 . ARG A 1 100 ? -21.974 -8.966  0.333   1.00 0.00 ? 100 ARG A HH22 2  
ATOM 3888  N N    . GLY A 1 101 ? -19.687 -1.943  -1.942  1.00 0.00 ? 101 GLY A N    2  
ATOM 3889  C CA   . GLY A 1 101 ? -18.531 -1.236  -1.418  1.00 0.00 ? 101 GLY A CA   2  
ATOM 3890  C C    . GLY A 1 101 ? -18.093 -1.819  -0.073  1.00 0.00 ? 101 GLY A C    2  
ATOM 3891  O O    . GLY A 1 101 ? -16.932 -1.696  0.313   1.00 0.00 ? 101 GLY A O    2  
ATOM 3892  H H    . GLY A 1 101 ? -20.563 -1.481  -1.805  1.00 0.00 ? 101 GLY A H    2  
ATOM 3893  H HA2  . GLY A 1 101 ? -17.708 -1.299  -2.131  1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3894  H HA3  . GLY A 1 101 ? -18.769 -0.179  -1.300  1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3895  N N    . SER A 1 102 ? -19.048 -2.440  0.605   1.00 0.00 ? 102 SER A N    2  
ATOM 3896  C CA   . SER A 1 102 ? -18.775 -3.041  1.899   1.00 0.00 ? 102 SER A CA   2  
ATOM 3897  C C    . SER A 1 102 ? -17.589 -4.001  1.790   1.00 0.00 ? 102 SER A C    2  
ATOM 3898  O O    . SER A 1 102 ? -16.889 -4.242  2.774   1.00 0.00 ? 102 SER A O    2  
ATOM 3899  C CB   . SER A 1 102 ? -20.006 -3.778  2.432   1.00 0.00 ? 102 SER A CB   2  
ATOM 3900  O OG   . SER A 1 102 ? -20.056 -3.771  3.857   1.00 0.00 ? 102 SER A OG   2  
ATOM 3901  H H    . SER A 1 102 ? -19.990 -2.535  0.284   1.00 0.00 ? 102 SER A H    2  
ATOM 3902  H HA   . SER A 1 102 ? -18.536 -2.209  2.560   1.00 0.00 ? 102 SER A HA   2  
ATOM 3903  H HB2  . SER A 1 102 ? -20.908 -3.312  2.036   1.00 0.00 ? 102 SER A HB2  2  
ATOM 3904  H HB3  . SER A 1 102 ? -19.996 -4.808  2.076   1.00 0.00 ? 102 SER A HB3  2  
ATOM 3905  H HG   . SER A 1 102 ? -19.900 -4.693  4.210   1.00 0.00 ? 102 SER A HG   2  
ATOM 3906  N N    . ASP A 1 103 ? -17.398 -4.523  0.587   1.00 0.00 ? 103 ASP A N    2  
ATOM 3907  C CA   . ASP A 1 103 ? -16.307 -5.450  0.339   1.00 0.00 ? 103 ASP A CA   2  
ATOM 3908  C C    . ASP A 1 103 ? -14.984 -4.682  0.322   1.00 0.00 ? 103 ASP A C    2  
ATOM 3909  O O    . ASP A 1 103 ? -13.991 -5.137  0.888   1.00 0.00 ? 103 ASP A O    2  
ATOM 3910  C CB   . ASP A 1 103 ? -16.470 -6.140  -1.018  1.00 0.00 ? 103 ASP A CB   2  
ATOM 3911  C CG   . ASP A 1 103 ? -15.161 -6.538  -1.703  1.00 0.00 ? 103 ASP A CG   2  
ATOM 3912  O OD1  . ASP A 1 103 ? -14.193 -6.811  -0.961  1.00 0.00 ? 103 ASP A OD1  2  
ATOM 3913  O OD2  . ASP A 1 103 ? -15.158 -6.559  -2.952  1.00 0.00 ? 103 ASP A OD2  2  
ATOM 3914  H H    . ASP A 1 103 ? -17.971 -4.322  -0.206  1.00 0.00 ? 103 ASP A H    2  
ATOM 3915  H HA   . ASP A 1 103 ? -16.358 -6.176  1.149   1.00 0.00 ? 103 ASP A HA   2  
ATOM 3916  H HB2  . ASP A 1 103 ? -17.078 -7.035  -0.882  1.00 0.00 ? 103 ASP A HB2  2  
ATOM 3917  H HB3  . ASP A 1 103 ? -17.024 -5.477  -1.682  1.00 0.00 ? 103 ASP A HB3  2  
ATOM 3918  N N    . ILE A 1 104 ? -15.013 -3.530  -0.332  1.00 0.00 ? 104 ILE A N    2  
ATOM 3919  C CA   . ILE A 1 104 ? -13.828 -2.695  -0.429  1.00 0.00 ? 104 ILE A CA   2  
ATOM 3920  C C    . ILE A 1 104 ? -13.428 -2.219  0.969   1.00 0.00 ? 104 ILE A C    2  
ATOM 3921  O O    . ILE A 1 104 ? -12.281 -1.837  1.195   1.00 0.00 ? 104 ILE A O    2  
ATOM 3922  C CB   . ILE A 1 104 ? -14.056 -1.555  -1.424  1.00 0.00 ? 104 ILE A CB   2  
ATOM 3923  C CG1  . ILE A 1 104 ? -14.542 -2.093  -2.772  1.00 0.00 ? 104 ILE A CG1  2  
ATOM 3924  C CG2  . ILE A 1 104 ? -12.801 -0.694  -1.569  1.00 0.00 ? 104 ILE A CG2  2  
ATOM 3925  C CD1  . ILE A 1 104 ? -15.153 -0.975  -3.620  1.00 0.00 ? 104 ILE A CD1  2  
ATOM 3926  H H    . ILE A 1 104 ? -15.825 -3.167  -0.789  1.00 0.00 ? 104 ILE A H    2  
ATOM 3927  H HA   . ILE A 1 104 ? -13.024 -3.313  -0.826  1.00 0.00 ? 104 ILE A HA   2  
ATOM 3928  H HB   . ILE A 1 104 ? -14.844 -0.912  -1.031  1.00 0.00 ? 104 ILE A HB   2  
ATOM 3929  H HG12 . ILE A 1 104 ? -13.708 -2.547  -3.308  1.00 0.00 ? 104 ILE A HG12 2  
ATOM 3930  H HG13 . ILE A 1 104 ? -15.281 -2.877  -2.610  1.00 0.00 ? 104 ILE A HG13 2  
ATOM 3931  H HG21 . ILE A 1 104 ? -12.086 -0.960  -0.789  1.00 0.00 ? 104 ILE A HG21 2  
ATOM 3932  H HG22 . ILE A 1 104 ? -12.352 -0.868  -2.547  1.00 0.00 ? 104 ILE A HG22 2  
ATOM 3933  H HG23 . ILE A 1 104 ? -13.067 0.358   -1.473  1.00 0.00 ? 104 ILE A HG23 2  
ATOM 3934  H HD11 . ILE A 1 104 ? -15.475 -0.162  -2.970  1.00 0.00 ? 104 ILE A HD11 2  
ATOM 3935  H HD12 . ILE A 1 104 ? -14.408 -0.605  -4.324  1.00 0.00 ? 104 ILE A HD12 2  
ATOM 3936  H HD13 . ILE A 1 104 ? -16.011 -1.364  -4.169  1.00 0.00 ? 104 ILE A HD13 2  
ATOM 3937  N N    . ALA A 1 105 ? -14.398 -2.259  1.872   1.00 0.00 ? 105 ALA A N    2  
ATOM 3938  C CA   . ALA A 1 105 ? -14.161 -1.837  3.243   1.00 0.00 ? 105 ALA A CA   2  
ATOM 3939  C C    . ALA A 1 105 ? -13.510 -2.983  4.019   1.00 0.00 ? 105 ALA A C    2  
ATOM 3940  O O    . ALA A 1 105 ? -12.848 -2.756  5.030   1.00 0.00 ? 105 ALA A O    2  
ATOM 3941  C CB   . ALA A 1 105 ? -15.478 -1.381  3.871   1.00 0.00 ? 105 ALA A CB   2  
ATOM 3942  H H    . ALA A 1 105 ? -15.328 -2.571  1.681   1.00 0.00 ? 105 ALA A H    2  
ATOM 3943  H HA   . ALA A 1 105 ? -13.473 -0.991  3.215   1.00 0.00 ? 105 ALA A HA   2  
ATOM 3944  H HB1  . ALA A 1 105 ? -15.355 -0.382  4.289   1.00 0.00 ? 105 ALA A HB1  2  
ATOM 3945  H HB2  . ALA A 1 105 ? -16.258 -1.363  3.110   1.00 0.00 ? 105 ALA A HB2  2  
ATOM 3946  H HB3  . ALA A 1 105 ? -15.762 -2.073  4.664   1.00 0.00 ? 105 ALA A HB3  2  
ATOM 3947  N N    . GLY A 1 106 ? -13.722 -4.192  3.517   1.00 0.00 ? 106 GLY A N    2  
ATOM 3948  C CA   . GLY A 1 106 ? -13.164 -5.374  4.152   1.00 0.00 ? 106 GLY A CA   2  
ATOM 3949  C C    . GLY A 1 106 ? -14.019 -5.812  5.343   1.00 0.00 ? 106 GLY A C    2  
ATOM 3950  O O    . GLY A 1 106 ? -13.505 -6.384  6.302   1.00 0.00 ? 106 GLY A O    2  
ATOM 3951  H H    . GLY A 1 106 ? -14.262 -4.368  2.695   1.00 0.00 ? 106 GLY A H    2  
ATOM 3952  H HA2  . GLY A 1 106 ? -13.102 -6.185  3.427   1.00 0.00 ? 106 GLY A HA2  2  
ATOM 3953  H HA3  . GLY A 1 106 ? -12.148 -5.166  4.486   1.00 0.00 ? 106 GLY A HA3  2  
ATOM 3954  N N    . THR A 1 107 ? -15.309 -5.525  5.242   1.00 0.00 ? 107 THR A N    2  
ATOM 3955  C CA   . THR A 1 107 ? -16.240 -5.883  6.299   1.00 0.00 ? 107 THR A CA   2  
ATOM 3956  C C    . THR A 1 107 ? -16.645 -7.353  6.178   1.00 0.00 ? 107 THR A C    2  
ATOM 3957  O O    . THR A 1 107 ? -16.795 -8.044  7.184   1.00 0.00 ? 107 THR A O    2  
ATOM 3958  C CB   . THR A 1 107 ? -17.425 -4.918  6.230   1.00 0.00 ? 107 THR A CB   2  
ATOM 3959  O OG1  . THR A 1 107 ? -16.880 -3.669  6.649   1.00 0.00 ? 107 THR A OG1  2  
ATOM 3960  C CG2  . THR A 1 107 ? -18.494 -5.229  7.280   1.00 0.00 ? 107 THR A CG2  2  
ATOM 3961  H H    . THR A 1 107 ? -15.719 -5.060  4.457   1.00 0.00 ? 107 THR A H    2  
ATOM 3962  H HA   . THR A 1 107 ? -15.732 -5.769  7.256   1.00 0.00 ? 107 THR A HA   2  
ATOM 3963  H HB   . THR A 1 107 ? -17.855 -4.901  5.229   1.00 0.00 ? 107 THR A HB   2  
ATOM 3964  H HG1  . THR A 1 107 ? -17.072 -2.966  5.964   1.00 0.00 ? 107 THR A HG1  2  
ATOM 3965  H HG21 . THR A 1 107 ? -18.435 -6.281  7.558   1.00 0.00 ? 107 THR A HG21 2  
ATOM 3966  H HG22 . THR A 1 107 ? -18.328 -4.610  8.162   1.00 0.00 ? 107 THR A HG22 2  
ATOM 3967  H HG23 . THR A 1 107 ? -19.481 -5.018  6.867   1.00 0.00 ? 107 THR A HG23 2  
ATOM 3968  N N    . THR A 1 108 ? -16.812 -7.788  4.937   1.00 0.00 ? 108 THR A N    2  
ATOM 3969  C CA   . THR A 1 108 ? -17.197 -9.164  4.671   1.00 0.00 ? 108 THR A CA   2  
ATOM 3970  C C    . THR A 1 108 ? -16.036 -9.929  4.032   1.00 0.00 ? 108 THR A C    2  
ATOM 3971  O O    . THR A 1 108 ? -15.997 -11.157 4.079   1.00 0.00 ? 108 THR A O    2  
ATOM 3972  C CB   . THR A 1 108 ? -18.459 -9.143  3.807   1.00 0.00 ? 108 THR A CB   2  
ATOM 3973  O OG1  . THR A 1 108 ? -18.884 -10.502 3.781   1.00 0.00 ? 108 THR A OG1  2  
ATOM 3974  C CG2  . THR A 1 108 ? -18.160 -8.817  2.342   1.00 0.00 ? 108 THR A CG2  2  
ATOM 3975  H H    . THR A 1 108 ? -16.687 -7.220  4.124   1.00 0.00 ? 108 THR A H    2  
ATOM 3976  H HA   . THR A 1 108 ? -17.414 -9.649  5.623   1.00 0.00 ? 108 THR A HA   2  
ATOM 3977  H HB   . THR A 1 108 ? -19.199 -8.454  4.216   1.00 0.00 ? 108 THR A HB   2  
ATOM 3978  H HG1  . THR A 1 108 ? -18.208 -11.063 3.304   1.00 0.00 ? 108 THR A HG1  2  
ATOM 3979  H HG21 . THR A 1 108 ? -17.680 -7.841  2.277   1.00 0.00 ? 108 THR A HG21 2  
ATOM 3980  H HG22 . THR A 1 108 ? -17.495 -9.577  1.930   1.00 0.00 ? 108 THR A HG22 2  
ATOM 3981  H HG23 . THR A 1 108 ? -19.091 -8.803  1.776   1.00 0.00 ? 108 THR A HG23 2  
ATOM 3982  N N    . SER A 1 109 ? -15.118 -9.171  3.450   1.00 0.00 ? 109 SER A N    2  
ATOM 3983  C CA   . SER A 1 109 ? -13.959 -9.761  2.804   1.00 0.00 ? 109 SER A CA   2  
ATOM 3984  C C    . SER A 1 109 ? -12.683 -9.359  3.546   1.00 0.00 ? 109 SER A C    2  
ATOM 3985  O O    . SER A 1 109 ? -12.682 -8.392  4.305   1.00 0.00 ? 109 SER A O    2  
ATOM 3986  C CB   . SER A 1 109 ? -13.874 -9.341  1.336   1.00 0.00 ? 109 SER A CB   2  
ATOM 3987  O OG   . SER A 1 109 ? -13.615 -7.947  1.193   1.00 0.00 ? 109 SER A OG   2  
ATOM 3988  H H    . SER A 1 109 ? -15.157 -8.172  3.417   1.00 0.00 ? 109 SER A H    2  
ATOM 3989  H HA   . SER A 1 109 ? -14.113 -10.839 2.864   1.00 0.00 ? 109 SER A HA   2  
ATOM 3990  H HB2  . SER A 1 109 ? -13.086 -9.909  0.841   1.00 0.00 ? 109 SER A HB2  2  
ATOM 3991  H HB3  . SER A 1 109 ? -14.809 -9.589  0.832   1.00 0.00 ? 109 SER A HB3  2  
ATOM 3992  H HG   . SER A 1 109 ? -14.311 -7.419  1.680   1.00 0.00 ? 109 SER A HG   2  
ATOM 3993  N N    . THR A 1 110 ? -11.629 -10.123 3.300   1.00 0.00 ? 110 THR A N    2  
ATOM 3994  C CA   . THR A 1 110 ? -10.349 -9.857  3.935   1.00 0.00 ? 110 THR A CA   2  
ATOM 3995  C C    . THR A 1 110 ? -9.372  -9.244  2.931   1.00 0.00 ? 110 THR A C    2  
ATOM 3996  O O    . THR A 1 110 ? -9.728  -9.006  1.778   1.00 0.00 ? 110 THR A O    2  
ATOM 3997  C CB   . THR A 1 110 ? -9.847  -11.164 4.552   1.00 0.00 ? 110 THR A CB   2  
ATOM 3998  O OG1  . THR A 1 110 ? -9.692  -12.037 3.436   1.00 0.00 ? 110 THR A OG1  2  
ATOM 3999  C CG2  . THR A 1 110 ? -10.907 -11.850 5.416   1.00 0.00 ? 110 THR A CG2  2  
ATOM 4000  H H    . THR A 1 110 ? -11.637 -10.907 2.681   1.00 0.00 ? 110 THR A H    2  
ATOM 4001  H HA   . THR A 1 110 ? -10.503 -9.120  4.723   1.00 0.00 ? 110 THR A HA   2  
ATOM 4002  H HB   . THR A 1 110 ? -8.930  -11.002 5.117   1.00 0.00 ? 110 THR A HB   2  
ATOM 4003  H HG1  . THR A 1 110 ? -8.777  -12.440 3.441   1.00 0.00 ? 110 THR A HG1  2  
ATOM 4004  H HG21 . THR A 1 110 ? -11.867 -11.825 4.900   1.00 0.00 ? 110 THR A HG21 2  
ATOM 4005  H HG22 . THR A 1 110 ? -10.617 -12.885 5.594   1.00 0.00 ? 110 THR A HG22 2  
ATOM 4006  H HG23 . THR A 1 110 ? -10.993 -11.327 6.368   1.00 0.00 ? 110 THR A HG23 2  
ATOM 4007  N N    . LEU A 1 111 ? -8.157  -9.006  3.405   1.00 0.00 ? 111 LEU A N    2  
ATOM 4008  C CA   . LEU A 1 111 ? -7.126  -8.425  2.562   1.00 0.00 ? 111 LEU A CA   2  
ATOM 4009  C C    . LEU A 1 111 ? -6.957  -9.282  1.306   1.00 0.00 ? 111 LEU A C    2  
ATOM 4010  O O    . LEU A 1 111 ? -7.107  -8.789  0.189   1.00 0.00 ? 111 LEU A O    2  
ATOM 4011  C CB   . LEU A 1 111 ? -5.830  -8.235  3.355   1.00 0.00 ? 111 LEU A CB   2  
ATOM 4012  C CG   . LEU A 1 111 ? -4.545  -8.146  2.529   1.00 0.00 ? 111 LEU A CG   2  
ATOM 4013  C CD1  . LEU A 1 111 ? -4.357  -6.739  1.959   1.00 0.00 ? 111 LEU A CD1  2  
ATOM 4014  C CD2  . LEU A 1 111 ? -3.335  -8.600  3.348   1.00 0.00 ? 111 LEU A CD2  2  
ATOM 4015  H H    . LEU A 1 111 ? -7.874  -9.203  4.344   1.00 0.00 ? 111 LEU A H    2  
ATOM 4016  H HA   . LEU A 1 111 ? -7.468  -7.435  2.262   1.00 0.00 ? 111 LEU A HA   2  
ATOM 4017  H HB2  . LEU A 1 111 ? -5.921  -7.326  3.949   1.00 0.00 ? 111 LEU A HB2  2  
ATOM 4018  H HB3  . LEU A 1 111 ? -5.732  -9.065  4.056   1.00 0.00 ? 111 LEU A HB3  2  
ATOM 4019  H HG   . LEU A 1 111 ? -4.635  -8.827  1.682   1.00 0.00 ? 111 LEU A HG   2  
ATOM 4020  H HD11 . LEU A 1 111 ? -5.262  -6.435  1.435   1.00 0.00 ? 111 LEU A HD11 2  
ATOM 4021  H HD12 . LEU A 1 111 ? -4.156  -6.041  2.772   1.00 0.00 ? 111 LEU A HD12 2  
ATOM 4022  H HD13 . LEU A 1 111 ? -3.517  -6.738  1.265   1.00 0.00 ? 111 LEU A HD13 2  
ATOM 4023  H HD21 . LEU A 1 111 ? -3.579  -8.562  4.410   1.00 0.00 ? 111 LEU A HD21 2  
ATOM 4024  H HD22 . LEU A 1 111 ? -3.073  -9.621  3.072   1.00 0.00 ? 111 LEU A HD22 2  
ATOM 4025  H HD23 . LEU A 1 111 ? -2.491  -7.941  3.145   1.00 0.00 ? 111 LEU A HD23 2  
ATOM 4026  N N    . GLN A 1 112 ? -6.647  -10.551 1.530   1.00 0.00 ? 112 GLN A N    2  
ATOM 4027  C CA   . GLN A 1 112 ? -6.457  -11.481 0.430   1.00 0.00 ? 112 GLN A CA   2  
ATOM 4028  C C    . GLN A 1 112 ? -7.551  -11.289 -0.622  1.00 0.00 ? 112 GLN A C    2  
ATOM 4029  O O    . GLN A 1 112 ? -7.266  -11.240 -1.818  1.00 0.00 ? 112 GLN A O    2  
ATOM 4030  C CB   . GLN A 1 112 ? -6.425  -12.925 0.932   1.00 0.00 ? 112 GLN A CB   2  
ATOM 4031  C CG   . GLN A 1 112 ? -5.816  -13.858 -0.117  1.00 0.00 ? 112 GLN A CG   2  
ATOM 4032  C CD   . GLN A 1 112 ? -6.645  -15.135 -0.263  1.00 0.00 ? 112 GLN A CD   2  
ATOM 4033  O OE1  . GLN A 1 112 ? -7.789  -15.118 -0.687  1.00 0.00 ? 112 GLN A OE1  2  
ATOM 4034  N NE2  . GLN A 1 112 ? -6.007  -16.240 0.112   1.00 0.00 ? 112 GLN A NE2  2  
ATOM 4035  H H    . GLN A 1 112 ? -6.526  -10.944 2.442   1.00 0.00 ? 112 GLN A H    2  
ATOM 4036  H HA   . GLN A 1 112 ? -5.485  -11.229 0.003   1.00 0.00 ? 112 GLN A HA   2  
ATOM 4037  H HB2  . GLN A 1 112 ? -5.845  -12.981 1.854   1.00 0.00 ? 112 GLN A HB2  2  
ATOM 4038  H HB3  . GLN A 1 112 ? -7.437  -13.253 1.172   1.00 0.00 ? 112 GLN A HB3  2  
ATOM 4039  H HG2  . GLN A 1 112 ? -5.761  -13.343 -1.077  1.00 0.00 ? 112 GLN A HG2  2  
ATOM 4040  H HG3  . GLN A 1 112 ? -4.795  -14.113 0.167   1.00 0.00 ? 112 GLN A HG3  2  
ATOM 4041  H HE21 . GLN A 1 112 ? -5.069  -16.184 0.452   1.00 0.00 ? 112 GLN A HE21 2  
ATOM 4042  H HE22 . GLN A 1 112 ? -6.467  -17.127 0.053   1.00 0.00 ? 112 GLN A HE22 2  
ATOM 4043  N N    . GLU A 1 113 ? -8.780  -11.186 -0.139  1.00 0.00 ? 113 GLU A N    2  
ATOM 4044  C CA   . GLU A 1 113 ? -9.919  -11.002 -1.022  1.00 0.00 ? 113 GLU A CA   2  
ATOM 4045  C C    . GLU A 1 113 ? -9.749  -9.725  -1.847  1.00 0.00 ? 113 GLU A C    2  
ATOM 4046  O O    . GLU A 1 113 ? -9.980  -9.727  -3.055  1.00 0.00 ? 113 GLU A O    2  
ATOM 4047  C CB   . GLU A 1 113 ? -11.228 -10.974 -0.231  1.00 0.00 ? 113 GLU A CB   2  
ATOM 4048  C CG   . GLU A 1 113 ? -11.617 -12.378 0.236   1.00 0.00 ? 113 GLU A CG   2  
ATOM 4049  C CD   . GLU A 1 113 ? -12.265 -13.173 -0.900  1.00 0.00 ? 113 GLU A CD   2  
ATOM 4050  O OE1  . GLU A 1 113 ? -11.804 -12.999 -2.049  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4051  O OE2  . GLU A 1 113 ? -13.206 -13.937 -0.594  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4052  H H    . GLU A 1 113 ? -9.003  -11.227 0.835   1.00 0.00 ? 113 GLU A H    2  
ATOM 4053  H HA   . GLU A 1 113 ? -9.919  -11.871 -1.680  1.00 0.00 ? 113 GLU A HA   2  
ATOM 4054  H HB2  . GLU A 1 113 ? -11.122 -10.317 0.632   1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4055  H HB3  . GLU A 1 113 ? -12.023 -10.558 -0.851  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4056  H HG2  . GLU A 1 113 ? -10.733 -12.904 0.594   1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4057  H HG3  . GLU A 1 113 ? -12.310 -12.307 1.075   1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4058  N N    . GLN A 1 114 ? -9.345  -8.665  -1.162  1.00 0.00 ? 114 GLN A N    2  
ATOM 4059  C CA   . GLN A 1 114 ? -9.142  -7.385  -1.816  1.00 0.00 ? 114 GLN A CA   2  
ATOM 4060  C C    . GLN A 1 114 ? -8.041  -7.497  -2.874  1.00 0.00 ? 114 GLN A C    2  
ATOM 4061  O O    . GLN A 1 114 ? -8.078  -6.805  -3.890  1.00 0.00 ? 114 GLN A O    2  
ATOM 4062  C CB   . GLN A 1 114 ? -8.811  -6.293  -0.796  1.00 0.00 ? 114 GLN A CB   2  
ATOM 4063  C CG   . GLN A 1 114 ? -10.043 -5.440  -0.486  1.00 0.00 ? 114 GLN A CG   2  
ATOM 4064  C CD   . GLN A 1 114 ? -9.715  -4.353  0.539   1.00 0.00 ? 114 GLN A CD   2  
ATOM 4065  O OE1  . GLN A 1 114 ? -10.383 -4.191  1.545   1.00 0.00 ? 114 GLN A OE1  2  
ATOM 4066  N NE2  . GLN A 1 114 ? -8.649  -3.620  0.227   1.00 0.00 ? 114 GLN A NE2  2  
ATOM 4067  H H    . GLN A 1 114 ? -9.159  -8.672  -0.179  1.00 0.00 ? 114 GLN A H    2  
ATOM 4068  H HA   . GLN A 1 114 ? -10.092 -7.149  -2.295  1.00 0.00 ? 114 GLN A HA   2  
ATOM 4069  H HB2  . GLN A 1 114 ? -8.440  -6.749  0.122   1.00 0.00 ? 114 GLN A HB2  2  
ATOM 4070  H HB3  . GLN A 1 114 ? -8.013  -5.659  -1.181  1.00 0.00 ? 114 GLN A HB3  2  
ATOM 4071  H HG2  . GLN A 1 114 ? -10.412 -4.981  -1.404  1.00 0.00 ? 114 GLN A HG2  2  
ATOM 4072  H HG3  . GLN A 1 114 ? -10.843 -6.075  -0.104  1.00 0.00 ? 114 GLN A HG3  2  
ATOM 4073  H HE21 . GLN A 1 114 ? -8.144  -3.806  -0.616  1.00 0.00 ? 114 GLN A HE21 2  
ATOM 4074  H HE22 . GLN A 1 114 ? -8.353  -2.884  0.834   1.00 0.00 ? 114 GLN A HE22 2  
ATOM 4075  N N    . ILE A 1 115 ? -7.088  -8.375  -2.598  1.00 0.00 ? 115 ILE A N    2  
ATOM 4076  C CA   . ILE A 1 115 ? -5.980  -8.587  -3.513  1.00 0.00 ? 115 ILE A CA   2  
ATOM 4077  C C    . ILE A 1 115 ? -6.502  -9.230  -4.799  1.00 0.00 ? 115 ILE A C    2  
ATOM 4078  O O    . ILE A 1 115 ? -6.108  -8.838  -5.897  1.00 0.00 ? 115 ILE A O    2  
ATOM 4079  C CB   . ILE A 1 115 ? -4.868  -9.389  -2.832  1.00 0.00 ? 115 ILE A CB   2  
ATOM 4080  C CG1  . ILE A 1 115 ? -4.467  -8.749  -1.501  1.00 0.00 ? 115 ILE A CG1  2  
ATOM 4081  C CG2  . ILE A 1 115 ? -3.671  -9.570  -3.766  1.00 0.00 ? 115 ILE A CG2  2  
ATOM 4082  C CD1  . ILE A 1 115 ? -4.474  -7.222  -1.604  1.00 0.00 ? 115 ILE A CD1  2  
ATOM 4083  H H    . ILE A 1 115 ? -7.065  -8.934  -1.769  1.00 0.00 ? 115 ILE A H    2  
ATOM 4084  H HA   . ILE A 1 115 ? -5.567  -7.609  -3.758  1.00 0.00 ? 115 ILE A HA   2  
ATOM 4085  H HB   . ILE A 1 115 ? -5.255  -10.383 -2.606  1.00 0.00 ? 115 ILE A HB   2  
ATOM 4086  H HG12 . ILE A 1 115 ? -5.155  -9.067  -0.718  1.00 0.00 ? 115 ILE A HG12 2  
ATOM 4087  H HG13 . ILE A 1 115 ? -3.473  -9.093  -1.214  1.00 0.00 ? 115 ILE A HG13 2  
ATOM 4088  H HG21 . ILE A 1 115 ? -3.941  -9.245  -4.770  1.00 0.00 ? 115 ILE A HG21 2  
ATOM 4089  H HG22 . ILE A 1 115 ? -2.834  -8.973  -3.403  1.00 0.00 ? 115 ILE A HG22 2  
ATOM 4090  H HG23 . ILE A 1 115 ? -3.384  -10.622 -3.788  1.00 0.00 ? 115 ILE A HG23 2  
ATOM 4091  H HD11 . ILE A 1 115 ? -5.468  -6.882  -1.891  1.00 0.00 ? 115 ILE A HD11 2  
ATOM 4092  H HD12 . ILE A 1 115 ? -4.207  -6.792  -0.638  1.00 0.00 ? 115 ILE A HD12 2  
ATOM 4093  H HD13 . ILE A 1 115 ? -3.749  -6.905  -2.355  1.00 0.00 ? 115 ILE A HD13 2  
ATOM 4094  N N    . GLY A 1 116 ? -7.378  -10.207 -4.621  1.00 0.00 ? 116 GLY A N    2  
ATOM 4095  C CA   . GLY A 1 116 ? -7.958  -10.907 -5.754  1.00 0.00 ? 116 GLY A CA   2  
ATOM 4096  C C    . GLY A 1 116 ? -8.745  -9.948  -6.648  1.00 0.00 ? 116 GLY A C    2  
ATOM 4097  O O    . GLY A 1 116 ? -8.495  -9.867  -7.851  1.00 0.00 ? 116 GLY A O    2  
ATOM 4098  H H    . GLY A 1 116 ? -7.692  -10.520 -3.725  1.00 0.00 ? 116 GLY A H    2  
ATOM 4099  H HA2  . GLY A 1 116 ? -7.168  -11.385 -6.334  1.00 0.00 ? 116 GLY A HA2  2  
ATOM 4100  H HA3  . GLY A 1 116 ? -8.616  -11.700 -5.398  1.00 0.00 ? 116 GLY A HA3  2  
ATOM 4101  N N    . TRP A 1 117 ? -9.681  -9.244  -6.028  1.00 0.00 ? 117 TRP A N    2  
ATOM 4102  C CA   . TRP A 1 117 ? -10.506 -8.294  -6.753  1.00 0.00 ? 117 TRP A CA   2  
ATOM 4103  C C    . TRP A 1 117 ? -9.577  -7.312  -7.471  1.00 0.00 ? 117 TRP A C    2  
ATOM 4104  O O    . TRP A 1 117 ? -9.789  -6.995  -8.640  1.00 0.00 ? 117 TRP A O    2  
ATOM 4105  C CB   . TRP A 1 117 ? -11.497 -7.600  -5.815  1.00 0.00 ? 117 TRP A CB   2  
ATOM 4106  C CG   . TRP A 1 117 ? -12.759 -8.417  -5.531  1.00 0.00 ? 117 TRP A CG   2  
ATOM 4107  C CD1  . TRP A 1 117 ? -13.630 -8.925  -6.414  1.00 0.00 ? 117 TRP A CD1  2  
ATOM 4108  C CD2  . TRP A 1 117 ? -13.261 -8.801  -4.233  1.00 0.00 ? 117 TRP A CD2  2  
ATOM 4109  N NE1  . TRP A 1 117 ? -14.651 -9.606  -5.783  1.00 0.00 ? 117 TRP A NE1  2  
ATOM 4110  C CE2  . TRP A 1 117 ? -14.420 -9.528  -4.415  1.00 0.00 ? 117 TRP A CE2  2  
ATOM 4111  C CE3  . TRP A 1 117 ? -12.752 -8.543  -2.948  1.00 0.00 ? 117 TRP A CE3  2  
ATOM 4112  C CZ2  . TRP A 1 117 ? -15.168 -10.057 -3.356  1.00 0.00 ? 117 TRP A CZ2  2  
ATOM 4113  C CZ3  . TRP A 1 117 ? -13.511 -9.078  -1.900  1.00 0.00 ? 117 TRP A CZ3  2  
ATOM 4114  C CH2  . TRP A 1 117 ? -14.679 -9.811  -2.066  1.00 0.00 ? 117 TRP A CH2  2  
ATOM 4115  H H    . TRP A 1 117 ? -9.878  -9.316  -5.050  1.00 0.00 ? 117 TRP A H    2  
ATOM 4116  H HA   . TRP A 1 117 ? -11.095 -8.850  -7.482  1.00 0.00 ? 117 TRP A HA   2  
ATOM 4117  H HB2  . TRP A 1 117 ? -10.997 -7.384  -4.870  1.00 0.00 ? 117 TRP A HB2  2  
ATOM 4118  H HB3  . TRP A 1 117 ? -11.786 -6.644  -6.250  1.00 0.00 ? 117 TRP A HB3  2  
ATOM 4119  H HD1  . TRP A 1 117 ? -13.541 -8.815  -7.495  1.00 0.00 ? 117 TRP A HD1  2  
ATOM 4120  H HE1  . TRP A 1 117 ? -15.486 -10.112 -6.269  1.00 0.00 ? 117 TRP A HE1  2  
ATOM 4121  H HE3  . TRP A 1 117 ? -11.839 -7.971  -2.778  1.00 0.00 ? 117 TRP A HE3  2  
ATOM 4122  H HZ2  . TRP A 1 117 ? -16.080 -10.627 -3.526  1.00 0.00 ? 117 TRP A HZ2  2  
ATOM 4123  H HZ3  . TRP A 1 117 ? -13.161 -8.906  -0.882  1.00 0.00 ? 117 TRP A HZ3  2  
ATOM 4124  H HH2  . TRP A 1 117 ? -15.214 -10.195 -1.197  1.00 0.00 ? 117 TRP A HH2  2  
ATOM 4125  N N    . MET A 1 118 ? -8.569  -6.860  -6.741  1.00 0.00 ? 118 MET A N    2  
ATOM 4126  C CA   . MET A 1 118 ? -7.606  -5.921  -7.294  1.00 0.00 ? 118 MET A CA   2  
ATOM 4127  C C    . MET A 1 118 ? -6.678  -6.613  -8.294  1.00 0.00 ? 118 MET A C    2  
ATOM 4128  O O    . MET A 1 118 ? -5.987  -5.950  -9.066  1.00 0.00 ? 118 MET A O    2  
ATOM 4129  C CB   . MET A 1 118 ? -6.775  -5.315  -6.161  1.00 0.00 ? 118 MET A CB   2  
ATOM 4130  C CG   . MET A 1 118 ? -5.950  -4.128  -6.661  1.00 0.00 ? 118 MET A CG   2  
ATOM 4131  S SD   . MET A 1 118 ? -4.350  -4.120  -5.869  1.00 0.00 ? 118 MET A SD   2  
ATOM 4132  C CE   . MET A 1 118 ? -4.672  -2.986  -4.530  1.00 0.00 ? 118 MET A CE   2  
ATOM 4133  H H    . MET A 1 118 ? -8.403  -7.123  -5.791  1.00 0.00 ? 118 MET A H    2  
ATOM 4134  H HA   . MET A 1 118 ? -8.199  -5.161  -7.802  1.00 0.00 ? 118 MET A HA   2  
ATOM 4135  H HB2  . MET A 1 118 ? -7.434  -4.991  -5.356  1.00 0.00 ? 118 MET A HB2  2  
ATOM 4136  H HB3  . MET A 1 118 ? -6.113  -6.074  -5.744  1.00 0.00 ? 118 MET A HB3  2  
ATOM 4137  H HG2  . MET A 1 118 ? -5.830  -4.188  -7.743  1.00 0.00 ? 118 MET A HG2  2  
ATOM 4138  H HG3  . MET A 1 118 ? -6.474  -3.196  -6.451  1.00 0.00 ? 118 MET A HG3  2  
ATOM 4139  H HE1  . MET A 1 118 ? -5.747  -2.833  -4.434  1.00 0.00 ? 118 MET A HE1  2  
ATOM 4140  H HE2  . MET A 1 118 ? -4.280  -3.400  -3.601  1.00 0.00 ? 118 MET A HE2  2  
ATOM 4141  H HE3  . MET A 1 118 ? -4.187  -2.033  -4.737  1.00 0.00 ? 118 MET A HE3  2  
ATOM 4142  N N    . THR A 1 119 ? -6.692  -7.938  -8.248  1.00 0.00 ? 119 THR A N    2  
ATOM 4143  C CA   . THR A 1 119 ? -5.860  -8.727  -9.140  1.00 0.00 ? 119 THR A CA   2  
ATOM 4144  C C    . THR A 1 119 ? -6.730  -9.541  -10.099 1.00 0.00 ? 119 THR A C    2  
ATOM 4145  O O    . THR A 1 119 ? -6.277  -10.540 -10.657 1.00 0.00 ? 119 THR A O    2  
ATOM 4146  C CB   . THR A 1 119 ? -4.930  -9.587  -8.282  1.00 0.00 ? 119 THR A CB   2  
ATOM 4147  O OG1  . THR A 1 119 ? -4.270  -8.648  -7.436  1.00 0.00 ? 119 THR A OG1  2  
ATOM 4148  C CG2  . THR A 1 119 ? -3.797  -10.216 -9.097  1.00 0.00 ? 119 THR A CG2  2  
ATOM 4149  H H    . THR A 1 119 ? -7.256  -8.469  -7.616  1.00 0.00 ? 119 THR A H    2  
ATOM 4150  H HA   . THR A 1 119 ? -5.266  -8.044  -9.749  1.00 0.00 ? 119 THR A HA   2  
ATOM 4151  H HB   . THR A 1 119 ? -5.492  -10.349 -7.744  1.00 0.00 ? 119 THR A HB   2  
ATOM 4152  H HG1  . THR A 1 119 ? -3.625  -9.123  -6.838  1.00 0.00 ? 119 THR A HG1  2  
ATOM 4153  H HG21 . THR A 1 119 ? -4.148  -10.423 -10.107 1.00 0.00 ? 119 THR A HG21 2  
ATOM 4154  H HG22 . THR A 1 119 ? -2.954  -9.526  -9.139  1.00 0.00 ? 119 THR A HG22 2  
ATOM 4155  H HG23 . THR A 1 119 ? -3.483  -11.146 -8.623  1.00 0.00 ? 119 THR A HG23 2  
ATOM 4156  N N    . HIS A 1 120 ? -7.963  -9.085  -10.261 1.00 0.00 ? 120 HIS A N    2  
ATOM 4157  C CA   . HIS A 1 120 ? -8.901  -9.760  -11.141 1.00 0.00 ? 120 HIS A CA   2  
ATOM 4158  C C    . HIS A 1 120 ? -9.065  -8.954  -12.431 1.00 0.00 ? 120 HIS A C    2  
ATOM 4159  O O    . HIS A 1 120 ? -8.562  -7.836  -12.536 1.00 0.00 ? 120 HIS A O    2  
ATOM 4160  C CB   . HIS A 1 120 ? -10.231 -10.014 -10.428 1.00 0.00 ? 120 HIS A CB   2  
ATOM 4161  C CG   . HIS A 1 120 ? -10.832 -11.369 -10.715 1.00 0.00 ? 120 HIS A CG   2  
ATOM 4162  N ND1  . HIS A 1 120 ? -10.065 -12.499 -10.933 1.00 0.00 ? 120 HIS A ND1  2  
ATOM 4163  C CD2  . HIS A 1 120 ? -12.134 -11.763 -10.816 1.00 0.00 ? 120 HIS A CD2  2  
ATOM 4164  C CE1  . HIS A 1 120 ? -10.878 -13.522 -11.154 1.00 0.00 ? 120 HIS A CE1  2  
ATOM 4165  N NE2  . HIS A 1 120 ? -12.160 -13.062 -11.083 1.00 0.00 ? 120 HIS A NE2  2  
ATOM 4166  H H    . HIS A 1 120 ? -8.324  -8.273  -9.803  1.00 0.00 ? 120 HIS A H    2  
ATOM 4167  H HA   . HIS A 1 120 ? -8.463  -10.729 -11.382 1.00 0.00 ? 120 HIS A HA   2  
ATOM 4168  H HB2  . HIS A 1 120 ? -10.080 -9.914  -9.354  1.00 0.00 ? 120 HIS A HB2  2  
ATOM 4169  H HB3  . HIS A 1 120 ? -10.942 -9.242  -10.723 1.00 0.00 ? 120 HIS A HB3  2  
ATOM 4170  H HD1  . HIS A 1 120 ? -9.066  -12.539 -10.923 1.00 0.00 ? 120 HIS A HD1  2  
ATOM 4171  H HD2  . HIS A 1 120 ? -13.006 -11.118 -10.699 1.00 0.00 ? 120 HIS A HD2  2  
ATOM 4172  H HE1  . HIS A 1 120 ? -10.576 -14.548 -11.359 1.00 0.00 ? 120 HIS A HE1  2  
ATOM 4173  H HE2  . HIS A 1 120 ? -12.984 -13.625 -11.154 1.00 0.00 ? 120 HIS A HE2  2  
ATOM 4174  N N    . ASN A 1 121 ? -9.768  -9.552  -13.381 1.00 0.00 ? 121 ASN A N    2  
ATOM 4175  C CA   . ASN A 1 121 ? -10.004 -8.903  -14.659 1.00 0.00 ? 121 ASN A CA   2  
ATOM 4176  C C    . ASN A 1 121 ? -11.508 -8.704  -14.855 1.00 0.00 ? 121 ASN A C    2  
ATOM 4177  O O    . ASN A 1 121 ? -12.255 -9.673  -14.975 1.00 0.00 ? 121 ASN A O    2  
ATOM 4178  C CB   . ASN A 1 121 ? -9.485  -9.760  -15.816 1.00 0.00 ? 121 ASN A CB   2  
ATOM 4179  C CG   . ASN A 1 121 ? -8.100  -10.328 -15.500 1.00 0.00 ? 121 ASN A CG   2  
ATOM 4180  O OD1  . ASN A 1 121 ? -7.947  -11.288 -14.763 1.00 0.00 ? 121 ASN A OD1  2  
ATOM 4181  N ND2  . ASN A 1 121 ? -7.103  -9.681  -16.097 1.00 0.00 ? 121 ASN A ND2  2  
ATOM 4182  H H    . ASN A 1 121 ? -10.173 -10.461 -13.288 1.00 0.00 ? 121 ASN A H    2  
ATOM 4183  H HA   . ASN A 1 121 ? -9.462  -7.959  -14.606 1.00 0.00 ? 121 ASN A HA   2  
ATOM 4184  H HB2  . ASN A 1 121 ? -10.181 -10.578 -16.008 1.00 0.00 ? 121 ASN A HB2  2  
ATOM 4185  H HB3  . ASN A 1 121 ? -9.438  -9.162  -16.725 1.00 0.00 ? 121 ASN A HB3  2  
ATOM 4186  H HD21 . ASN A 1 121 ? -7.297  -8.901  -16.691 1.00 0.00 ? 121 ASN A HD21 2  
ATOM 4187  H HD22 . ASN A 1 121 ? -6.158  -9.977  -15.954 1.00 0.00 ? 121 ASN A HD22 2  
ATOM 4188  N N    . PRO A 1 122 ? -11.917 -7.407  -14.884 1.00 0.00 ? 122 PRO A N    2  
ATOM 4189  C CA   . PRO A 1 122 ? -10.966 -6.319  -14.736 1.00 0.00 ? 122 PRO A CA   2  
ATOM 4190  C C    . PRO A 1 122 ? -10.514 -6.181  -13.280 1.00 0.00 ? 122 PRO A C    2  
ATOM 4191  O O    . PRO A 1 122 ? -11.169 -6.689  -12.372 1.00 0.00 ? 122 PRO A O    2  
ATOM 4192  C CB   . PRO A 1 122 ? -11.692 -5.088  -15.251 1.00 0.00 ? 122 PRO A CB   2  
ATOM 4193  C CG   . PRO A 1 122 ? -13.171 -5.439  -15.234 1.00 0.00 ? 122 PRO A CG   2  
ATOM 4194  C CD   . PRO A 1 122 ? -13.291 -6.944  -15.058 1.00 0.00 ? 122 PRO A CD   2  
ATOM 4195  H HA   . PRO A 1 122 ? -10.137 -6.508  -15.262 1.00 0.00 ? 122 PRO A HA   2  
ATOM 4196  H HB2  . PRO A 1 122 ? -11.490 -4.222  -14.620 1.00 0.00 ? 122 PRO A HB2  2  
ATOM 4197  H HB3  . PRO A 1 122 ? -11.363 -4.832  -16.258 1.00 0.00 ? 122 PRO A HB3  2  
ATOM 4198  H HG2  . PRO A 1 122 ? -13.679 -4.918  -14.423 1.00 0.00 ? 122 PRO A HG2  2  
ATOM 4199  H HG3  . PRO A 1 122 ? -13.648 -5.125  -16.163 1.00 0.00 ? 122 PRO A HG3  2  
ATOM 4200  H HD2  . PRO A 1 122 ? -13.905 -7.194  -14.193 1.00 0.00 ? 122 PRO A HD2  2  
ATOM 4201  H HD3  . PRO A 1 122 ? -13.758 -7.408  -15.926 1.00 0.00 ? 122 PRO A HD3  2  
ATOM 4202  N N    . PRO A 1 123 ? -9.367  -5.472  -13.099 1.00 0.00 ? 123 PRO A N    2  
ATOM 4203  C CA   . PRO A 1 123 ? -8.820  -5.260  -11.770 1.00 0.00 ? 123 PRO A CA   2  
ATOM 4204  C C    . PRO A 1 123 ? -9.630  -4.212  -11.004 1.00 0.00 ? 123 PRO A C    2  
ATOM 4205  O O    . PRO A 1 123 ? -9.709  -3.057  -11.421 1.00 0.00 ? 123 PRO A O    2  
ATOM 4206  C CB   . PRO A 1 123 ? -7.377  -4.843  -12.000 1.00 0.00 ? 123 PRO A CB   2  
ATOM 4207  C CG   . PRO A 1 123 ? -7.301  -4.387  -13.449 1.00 0.00 ? 123 PRO A CG   2  
ATOM 4208  C CD   . PRO A 1 123 ? -8.564  -4.855  -14.151 1.00 0.00 ? 123 PRO A CD   2  
ATOM 4209  H HA   . PRO A 1 123 ? -8.882  -6.100  -11.231 1.00 0.00 ? 123 PRO A HA   2  
ATOM 4210  H HB2  . PRO A 1 123 ? -7.089  -4.040  -11.322 1.00 0.00 ? 123 PRO A HB2  2  
ATOM 4211  H HB3  . PRO A 1 123 ? -6.696  -5.674  -11.816 1.00 0.00 ? 123 PRO A HB3  2  
ATOM 4212  H HG2  . PRO A 1 123 ? -7.212  -3.302  -13.503 1.00 0.00 ? 123 PRO A HG2  2  
ATOM 4213  H HG3  . PRO A 1 123 ? -6.418  -4.803  -13.934 1.00 0.00 ? 123 PRO A HG3  2  
ATOM 4214  H HD2  . PRO A 1 123 ? -9.092  -4.021  -14.614 1.00 0.00 ? 123 PRO A HD2  2  
ATOM 4215  H HD3  . PRO A 1 123 ? -8.336  -5.567  -14.945 1.00 0.00 ? 123 PRO A HD3  2  
ATOM 4216  N N    . ILE A 1 124 ? -10.211 -4.652  -9.897  1.00 0.00 ? 124 ILE A N    2  
ATOM 4217  C CA   . ILE A 1 124 ? -11.011 -3.766  -9.070  1.00 0.00 ? 124 ILE A CA   2  
ATOM 4218  C C    . ILE A 1 124 ? -10.088 -2.816  -8.305  1.00 0.00 ? 124 ILE A C    2  
ATOM 4219  O O    . ILE A 1 124 ? -9.250  -3.257  -7.520  1.00 0.00 ? 124 ILE A O    2  
ATOM 4220  C CB   . ILE A 1 124 ? -11.944 -4.576  -8.166  1.00 0.00 ? 124 ILE A CB   2  
ATOM 4221  C CG1  . ILE A 1 124 ? -13.132 -5.127  -8.957  1.00 0.00 ? 124 ILE A CG1  2  
ATOM 4222  C CG2  . ILE A 1 124 ? -12.394 -3.748  -6.960  1.00 0.00 ? 124 ILE A CG2  2  
ATOM 4223  C CD1  . ILE A 1 124 ? -13.110 -6.656  -8.984  1.00 0.00 ? 124 ILE A CD1  2  
ATOM 4224  H H    . ILE A 1 124 ? -10.141 -5.593  -9.565  1.00 0.00 ? 124 ILE A H    2  
ATOM 4225  H HA   . ILE A 1 124 ? -11.640 -3.177  -9.735  1.00 0.00 ? 124 ILE A HA   2  
ATOM 4226  H HB   . ILE A 1 124 ? -11.389 -5.431  -7.780  1.00 0.00 ? 124 ILE A HB   2  
ATOM 4227  H HG12 . ILE A 1 124 ? -14.064 -4.781  -8.510  1.00 0.00 ? 124 ILE A HG12 2  
ATOM 4228  H HG13 . ILE A 1 124 ? -13.105 -4.742  -9.977  1.00 0.00 ? 124 ILE A HG13 2  
ATOM 4229  H HG21 . ILE A 1 124 ? -12.916 -2.856  -7.306  1.00 0.00 ? 124 ILE A HG21 2  
ATOM 4230  H HG22 . ILE A 1 124 ? -13.063 -4.344  -6.340  1.00 0.00 ? 124 ILE A HG22 2  
ATOM 4231  H HG23 . ILE A 1 124 ? -11.522 -3.455  -6.375  1.00 0.00 ? 124 ILE A HG23 2  
ATOM 4232  H HD11 . ILE A 1 124 ? -12.585 -7.029  -8.104  1.00 0.00 ? 124 ILE A HD11 2  
ATOM 4233  H HD12 . ILE A 1 124 ? -14.132 -7.035  -8.985  1.00 0.00 ? 124 ILE A HD12 2  
ATOM 4234  H HD13 . ILE A 1 124 ? -12.596 -6.997  -9.884  1.00 0.00 ? 124 ILE A HD13 2  
ATOM 4235  N N    . PRO A 1 125 ? -10.277 -1.495  -8.569  1.00 0.00 ? 125 PRO A N    2  
ATOM 4236  C CA   . PRO A 1 125 ? -9.471  -0.479  -7.915  1.00 0.00 ? 125 PRO A CA   2  
ATOM 4237  C C    . PRO A 1 125 ? -9.905  -0.285  -6.462  1.00 0.00 ? 125 PRO A C    2  
ATOM 4238  O O    . PRO A 1 125 ? -10.113 0.842   -6.016  1.00 0.00 ? 125 PRO A O    2  
ATOM 4239  C CB   . PRO A 1 125 ? -9.653  0.772   -8.761  1.00 0.00 ? 125 PRO A CB   2  
ATOM 4240  C CG   . PRO A 1 125 ? -10.911 0.540   -9.582  1.00 0.00 ? 125 PRO A CG   2  
ATOM 4241  C CD   . PRO A 1 125 ? -11.260 -0.937  -9.494  1.00 0.00 ? 125 PRO A CD   2  
ATOM 4242  H HA   . PRO A 1 125 ? -8.513  -0.765  -7.879  1.00 0.00 ? 125 PRO A HA   2  
ATOM 4243  H HB2  . PRO A 1 125 ? -9.754  1.657   -8.132  1.00 0.00 ? 125 PRO A HB2  2  
ATOM 4244  H HB3  . PRO A 1 125 ? -8.790  0.936   -9.407  1.00 0.00 ? 125 PRO A HB3  2  
ATOM 4245  H HG2  . PRO A 1 125 ? -11.731 1.149   -9.204  1.00 0.00 ? 125 PRO A HG2  2  
ATOM 4246  H HG3  . PRO A 1 125 ? -10.749 0.832   -10.619 1.00 0.00 ? 125 PRO A HG3  2  
ATOM 4247  H HD2  . PRO A 1 125 ? -12.276 -1.083  -9.126  1.00 0.00 ? 125 PRO A HD2  2  
ATOM 4248  H HD3  . PRO A 1 125 ? -11.202 -1.417  -10.470 1.00 0.00 ? 125 PRO A HD3  2  
ATOM 4249  N N    . VAL A 1 126 ? -10.029 -1.403  -5.761  1.00 0.00 ? 126 VAL A N    2  
ATOM 4250  C CA   . VAL A 1 126 ? -10.435 -1.371  -4.366  1.00 0.00 ? 126 VAL A CA   2  
ATOM 4251  C C    . VAL A 1 126 ? -9.554  -0.377  -3.606  1.00 0.00 ? 126 VAL A C    2  
ATOM 4252  O O    . VAL A 1 126 ? -10.023 0.303   -2.696  1.00 0.00 ? 126 VAL A O    2  
ATOM 4253  C CB   . VAL A 1 126 ? -10.391 -2.782  -3.776  1.00 0.00 ? 126 VAL A CB   2  
ATOM 4254  C CG1  . VAL A 1 126 ? -9.124  -3.521  -4.213  1.00 0.00 ? 126 VAL A CG1  2  
ATOM 4255  C CG2  . VAL A 1 126 ? -10.505 -2.743  -2.251  1.00 0.00 ? 126 VAL A CG2  2  
ATOM 4256  H H    . VAL A 1 126 ? -9.857  -2.317  -6.131  1.00 0.00 ? 126 VAL A H    2  
ATOM 4257  H HA   . VAL A 1 126 ? -11.467 -1.023  -4.332  1.00 0.00 ? 126 VAL A HA   2  
ATOM 4258  H HB   . VAL A 1 126 ? -11.249 -3.333  -4.161  1.00 0.00 ? 126 VAL A HB   2  
ATOM 4259  H HG11 . VAL A 1 126 ? -8.286  -2.824  -4.228  1.00 0.00 ? 126 VAL A HG11 2  
ATOM 4260  H HG12 . VAL A 1 126 ? -8.914  -4.328  -3.512  1.00 0.00 ? 126 VAL A HG12 2  
ATOM 4261  H HG13 . VAL A 1 126 ? -9.271  -3.935  -5.210  1.00 0.00 ? 126 VAL A HG13 2  
ATOM 4262  H HG21 . VAL A 1 126 ? -10.617 -1.710  -1.922  1.00 0.00 ? 126 VAL A HG21 2  
ATOM 4263  H HG22 . VAL A 1 126 ? -11.373 -3.321  -1.936  1.00 0.00 ? 126 VAL A HG22 2  
ATOM 4264  H HG23 . VAL A 1 126 ? -9.604  -3.168  -1.808  1.00 0.00 ? 126 VAL A HG23 2  
ATOM 4265  N N    . GLY A 1 127 ? -8.292  -0.327  -4.008  1.00 0.00 ? 127 GLY A N    2  
ATOM 4266  C CA   . GLY A 1 127 ? -7.341  0.571   -3.376  1.00 0.00 ? 127 GLY A CA   2  
ATOM 4267  C C    . GLY A 1 127 ? -7.737  2.033   -3.598  1.00 0.00 ? 127 GLY A C    2  
ATOM 4268  O O    . GLY A 1 127 ? -8.055  2.745   -2.647  1.00 0.00 ? 127 GLY A O    2  
ATOM 4269  H H    . GLY A 1 127 ? -7.918  -0.884  -4.749  1.00 0.00 ? 127 GLY A H    2  
ATOM 4270  H HA2  . GLY A 1 127 ? -7.293  0.363   -2.307  1.00 0.00 ? 127 GLY A HA2  2  
ATOM 4271  H HA3  . GLY A 1 127 ? -6.345  0.395   -3.780  1.00 0.00 ? 127 GLY A HA3  2  
ATOM 4272  N N    . GLU A 1 128 ? -7.702  2.437   -4.859  1.00 0.00 ? 128 GLU A N    2  
ATOM 4273  C CA   . GLU A 1 128 ? -8.053  3.801   -5.219  1.00 0.00 ? 128 GLU A CA   2  
ATOM 4274  C C    . GLU A 1 128 ? -9.413  4.173   -4.625  1.00 0.00 ? 128 GLU A C    2  
ATOM 4275  O O    . GLU A 1 128 ? -9.606  5.296   -4.161  1.00 0.00 ? 128 GLU A O    2  
ATOM 4276  C CB   . GLU A 1 128 ? -8.049  3.985   -6.738  1.00 0.00 ? 128 GLU A CB   2  
ATOM 4277  C CG   . GLU A 1 128 ? -6.639  4.283   -7.250  1.00 0.00 ? 128 GLU A CG   2  
ATOM 4278  C CD   . GLU A 1 128 ? -6.587  4.230   -8.778  1.00 0.00 ? 128 GLU A CD   2  
ATOM 4279  O OE1  . GLU A 1 128 ? -7.298  3.368   -9.340  1.00 0.00 ? 128 GLU A OE1  2  
ATOM 4280  O OE2  . GLU A 1 128 ? -5.839  5.050   -9.351  1.00 0.00 ? 128 GLU A OE2  2  
ATOM 4281  H H    . GLU A 1 128 ? -7.442  1.851   -5.627  1.00 0.00 ? 128 GLU A H    2  
ATOM 4282  H HA   . GLU A 1 128 ? -7.274  4.424   -4.781  1.00 0.00 ? 128 GLU A HA   2  
ATOM 4283  H HB2  . GLU A 1 128 ? -8.432  3.085   -7.218  1.00 0.00 ? 128 GLU A HB2  2  
ATOM 4284  H HB3  . GLU A 1 128 ? -8.720  4.801   -7.010  1.00 0.00 ? 128 GLU A HB3  2  
ATOM 4285  H HG2  . GLU A 1 128 ? -6.325  5.269   -6.907  1.00 0.00 ? 128 GLU A HG2  2  
ATOM 4286  H HG3  . GLU A 1 128 ? -5.937  3.562   -6.833  1.00 0.00 ? 128 GLU A HG3  2  
ATOM 4287  N N    . ILE A 1 129 ? -10.321 3.209   -4.658  1.00 0.00 ? 129 ILE A N    2  
ATOM 4288  C CA   . ILE A 1 129 ? -11.658 3.422   -4.129  1.00 0.00 ? 129 ILE A CA   2  
ATOM 4289  C C    . ILE A 1 129 ? -11.565 3.733   -2.633  1.00 0.00 ? 129 ILE A C    2  
ATOM 4290  O O    . ILE A 1 129 ? -12.044 4.773   -2.182  1.00 0.00 ? 129 ILE A O    2  
ATOM 4291  C CB   . ILE A 1 129 ? -12.559 2.229   -4.453  1.00 0.00 ? 129 ILE A CB   2  
ATOM 4292  C CG1  . ILE A 1 129 ? -12.857 2.160   -5.953  1.00 0.00 ? 129 ILE A CG1  2  
ATOM 4293  C CG2  . ILE A 1 129 ? -13.838 2.264   -3.615  1.00 0.00 ? 129 ILE A CG2  2  
ATOM 4294  C CD1  . ILE A 1 129 ? -12.664 0.738   -6.485  1.00 0.00 ? 129 ILE A CD1  2  
ATOM 4295  H H    . ILE A 1 129 ? -10.157 2.298   -5.036  1.00 0.00 ? 129 ILE A H    2  
ATOM 4296  H HA   . ILE A 1 129 ? -12.076 4.290   -4.637  1.00 0.00 ? 129 ILE A HA   2  
ATOM 4297  H HB   . ILE A 1 129 ? -12.026 1.316   -4.189  1.00 0.00 ? 129 ILE A HB   2  
ATOM 4298  H HG12 . ILE A 1 129 ? -13.881 2.485   -6.138  1.00 0.00 ? 129 ILE A HG12 2  
ATOM 4299  H HG13 . ILE A 1 129 ? -12.203 2.846   -6.489  1.00 0.00 ? 129 ILE A HG13 2  
ATOM 4300  H HG21 . ILE A 1 129 ? -13.582 2.413   -2.567  1.00 0.00 ? 129 ILE A HG21 2  
ATOM 4301  H HG22 . ILE A 1 129 ? -14.473 3.083   -3.954  1.00 0.00 ? 129 ILE A HG22 2  
ATOM 4302  H HG23 . ILE A 1 129 ? -14.373 1.321   -3.728  1.00 0.00 ? 129 ILE A HG23 2  
ATOM 4303  H HD11 . ILE A 1 129 ? -12.349 0.085   -5.671  1.00 0.00 ? 129 ILE A HD11 2  
ATOM 4304  H HD12 . ILE A 1 129 ? -13.603 0.375   -6.901  1.00 0.00 ? 129 ILE A HD12 2  
ATOM 4305  H HD13 . ILE A 1 129 ? -11.900 0.743   -7.263  1.00 0.00 ? 129 ILE A HD13 2  
ATOM 4306  N N    . TYR A 1 130 ? -10.948 2.813   -1.907  1.00 0.00 ? 130 TYR A N    2  
ATOM 4307  C CA   . TYR A 1 130 ? -10.786 2.977   -0.472  1.00 0.00 ? 130 TYR A CA   2  
ATOM 4308  C C    . TYR A 1 130 ? -10.049 4.278   -0.148  1.00 0.00 ? 130 TYR A C    2  
ATOM 4309  O O    . TYR A 1 130 ? -10.340 4.927   0.856   1.00 0.00 ? 130 TYR A O    2  
ATOM 4310  C CB   . TYR A 1 130 ? -9.937  1.794   -0.005  1.00 0.00 ? 130 TYR A CB   2  
ATOM 4311  C CG   . TYR A 1 130 ? -10.101 1.455   1.478   1.00 0.00 ? 130 TYR A CG   2  
ATOM 4312  C CD1  . TYR A 1 130 ? -11.354 1.181   1.988   1.00 0.00 ? 130 TYR A CD1  2  
ATOM 4313  C CD2  . TYR A 1 130 ? -8.997  1.423   2.305   1.00 0.00 ? 130 TYR A CD2  2  
ATOM 4314  C CE1  . TYR A 1 130 ? -11.509 0.862   3.383   1.00 0.00 ? 130 TYR A CE1  2  
ATOM 4315  C CE2  . TYR A 1 130 ? -9.153  1.105   3.701   1.00 0.00 ? 130 TYR A CE2  2  
ATOM 4316  C CZ   . TYR A 1 130 ? -10.402 0.841   4.171   1.00 0.00 ? 130 TYR A CZ   2  
ATOM 4317  O OH   . TYR A 1 130 ? -10.548 0.539   5.489   1.00 0.00 ? 130 TYR A OH   2  
ATOM 4318  H H    . TYR A 1 130 ? -10.561 1.971   -2.282  1.00 0.00 ? 130 TYR A H    2  
ATOM 4319  H HA   . TYR A 1 130 ? -11.779 3.009   -0.024  1.00 0.00 ? 130 TYR A HA   2  
ATOM 4320  H HB2  . TYR A 1 130 ? -10.196 0.917   -0.598  1.00 0.00 ? 130 TYR A HB2  2  
ATOM 4321  H HB3  . TYR A 1 130 ? -8.888  2.012   -0.203  1.00 0.00 ? 130 TYR A HB3  2  
ATOM 4322  H HD1  . TYR A 1 130 ? -12.226 1.206   1.334   1.00 0.00 ? 130 TYR A HD1  2  
ATOM 4323  H HD2  . TYR A 1 130 ? -8.008  1.639   1.903   1.00 0.00 ? 130 TYR A HD2  2  
ATOM 4324  H HE1  . TYR A 1 130 ? -12.493 0.645   3.799   1.00 0.00 ? 130 TYR A HE1  2  
ATOM 4325  H HE2  . TYR A 1 130 ? -8.289  1.076   4.366   1.00 0.00 ? 130 TYR A HE2  2  
ATOM 4326  H HH   . TYR A 1 130 ? -9.652  0.490   5.930   1.00 0.00 ? 130 TYR A HH   2  
ATOM 4327  N N    . LYS A 1 131 ? -9.109  4.620   -1.017  1.00 0.00 ? 131 LYS A N    2  
ATOM 4328  C CA   . LYS A 1 131 ? -8.329  5.833   -0.834  1.00 0.00 ? 131 LYS A CA   2  
ATOM 4329  C C    . LYS A 1 131 ? -9.250  7.049   -0.948  1.00 0.00 ? 131 LYS A C    2  
ATOM 4330  O O    . LYS A 1 131 ? -9.104  8.014   -0.199  1.00 0.00 ? 131 LYS A O    2  
ATOM 4331  C CB   . LYS A 1 131 ? -7.150  5.861   -1.809  1.00 0.00 ? 131 LYS A CB   2  
ATOM 4332  C CG   . LYS A 1 131 ? -6.910  7.276   -2.339  1.00 0.00 ? 131 LYS A CG   2  
ATOM 4333  C CD   . LYS A 1 131 ? -5.829  7.281   -3.422  1.00 0.00 ? 131 LYS A CD   2  
ATOM 4334  C CE   . LYS A 1 131 ? -6.280  8.084   -4.643  1.00 0.00 ? 131 LYS A CE   2  
ATOM 4335  N NZ   . LYS A 1 131 ? -5.795  7.450   -5.889  1.00 0.00 ? 131 LYS A NZ   2  
ATOM 4336  H H    . LYS A 1 131 ? -8.878  4.087   -1.830  1.00 0.00 ? 131 LYS A H    2  
ATOM 4337  H HA   . LYS A 1 131 ? -7.913  5.806   0.173   1.00 0.00 ? 131 LYS A HA   2  
ATOM 4338  H HB2  . LYS A 1 131 ? -6.251  5.499   -1.310  1.00 0.00 ? 131 LYS A HB2  2  
ATOM 4339  H HB3  . LYS A 1 131 ? -7.344  5.185   -2.642  1.00 0.00 ? 131 LYS A HB3  2  
ATOM 4340  H HG2  . LYS A 1 131 ? -7.839  7.678   -2.745  1.00 0.00 ? 131 LYS A HG2  2  
ATOM 4341  H HG3  . LYS A 1 131 ? -6.612  7.929   -1.520  1.00 0.00 ? 131 LYS A HG3  2  
ATOM 4342  H HD2  . LYS A 1 131 ? -4.910  7.708   -3.021  1.00 0.00 ? 131 LYS A HD2  2  
ATOM 4343  H HD3  . LYS A 1 131 ? -5.603  6.257   -3.719  1.00 0.00 ? 131 LYS A HD3  2  
ATOM 4344  H HE2  . LYS A 1 131 ? -7.368  8.150   -4.661  1.00 0.00 ? 131 LYS A HE2  2  
ATOM 4345  H HE3  . LYS A 1 131 ? -5.900  9.104   -4.575  1.00 0.00 ? 131 LYS A HE3  2  
ATOM 4346  H HZ1  . LYS A 1 131 ? -5.449  6.535   -5.684  1.00 0.00 ? 131 LYS A HZ1  2  
ATOM 4347  H HZ2  . LYS A 1 131 ? -6.547  7.382   -6.545  1.00 0.00 ? 131 LYS A HZ2  2  
ATOM 4348  H HZ3  . LYS A 1 131 ? -5.060  8.004   -6.281  1.00 0.00 ? 131 LYS A HZ3  2  
ATOM 4349  N N    . ARG A 1 132 ? -10.177 6.963   -1.890  1.00 0.00 ? 132 ARG A N    2  
ATOM 4350  C CA   . ARG A 1 132 ? -11.122 8.046   -2.112  1.00 0.00 ? 132 ARG A CA   2  
ATOM 4351  C C    . ARG A 1 132 ? -12.081 8.162   -0.925  1.00 0.00 ? 132 ARG A C    2  
ATOM 4352  O O    . ARG A 1 132 ? -12.439 9.267   -0.519  1.00 0.00 ? 132 ARG A O    2  
ATOM 4353  C CB   . ARG A 1 132 ? -11.928 7.819   -3.391  1.00 0.00 ? 132 ARG A CB   2  
ATOM 4354  C CG   . ARG A 1 132 ? -11.711 8.962   -4.385  1.00 0.00 ? 132 ARG A CG   2  
ATOM 4355  C CD   . ARG A 1 132 ? -12.383 8.657   -5.725  1.00 0.00 ? 132 ARG A CD   2  
ATOM 4356  N NE   . ARG A 1 132 ? -11.356 8.367   -6.752  1.00 0.00 ? 132 ARG A NE   2  
ATOM 4357  C CZ   . ARG A 1 132 ? -10.505 9.277   -7.242  1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4358  N NH1  . ARG A 1 132 ? -10.552 10.542  -6.804  1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4359  N NH2  . ARG A 1 132 ? -9.606  8.923   -8.170  1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4360  H H    . ARG A 1 132 ? -10.288 6.175   -2.495  1.00 0.00 ? 132 ARG A H    2  
ATOM 4361  H HA   . ARG A 1 132 ? -10.504 8.939   -2.206  1.00 0.00 ? 132 ARG A HA   2  
ATOM 4362  H HB2  . ARG A 1 132 ? -11.635 6.874   -3.848  1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4363  H HB3  . ARG A 1 132 ? -12.988 7.740   -3.148  1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4364  H HG2  . ARG A 1 132 ? -12.115 9.887   -3.974  1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4365  H HG3  . ARG A 1 132 ? -10.644 9.119   -4.536  1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4366  H HD2  . ARG A 1 132 ? -13.055 7.805   -5.620  1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4367  H HD3  . ARG A 1 132 ? -12.991 9.505   -6.039  1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4368  H HE   . ARG A 1 132 ? -11.294 7.431   -7.100  1.00 0.00 ? 132 ARG A HE   2  
ATOM 4369  H HH11 . ARG A 1 132 ? -11.223 10.806  -6.110  1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4370  H HH12 . ARG A 1 132 ? -9.916  11.223  -7.170  1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4371  H HH21 . ARG A 1 132 ? -9.571  7.979   -8.498  1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4372  H HH22 . ARG A 1 132 ? -8.971  9.603   -8.536  1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4373  N N    . TRP A 1 133 ? -12.470 7.008   -0.403  1.00 0.00 ? 133 TRP A N    2  
ATOM 4374  C CA   . TRP A 1 133 ? -13.382 6.968   0.727   1.00 0.00 ? 133 TRP A CA   2  
ATOM 4375  C C    . TRP A 1 133 ? -12.663 7.573   1.935   1.00 0.00 ? 133 TRP A C    2  
ATOM 4376  O O    . TRP A 1 133 ? -13.137 8.544   2.523   1.00 0.00 ? 133 TRP A O    2  
ATOM 4377  C CB   . TRP A 1 133 ? -13.879 5.543   0.980   1.00 0.00 ? 133 TRP A CB   2  
ATOM 4378  C CG   . TRP A 1 133 ? -14.562 4.899   -0.229  1.00 0.00 ? 133 TRP A CG   2  
ATOM 4379  C CD1  . TRP A 1 133 ? -14.836 5.457   -1.417  1.00 0.00 ? 133 TRP A CD1  2  
ATOM 4380  C CD2  . TRP A 1 133 ? -15.051 3.544   -0.320  1.00 0.00 ? 133 TRP A CD2  2  
ATOM 4381  N NE1  . TRP A 1 133 ? -15.461 4.564   -2.262  1.00 0.00 ? 133 TRP A NE1  2  
ATOM 4382  C CE2  . TRP A 1 133 ? -15.596 3.364   -1.575  1.00 0.00 ? 133 TRP A CE2  2  
ATOM 4383  C CE3  . TRP A 1 133 ? -15.031 2.505   0.627   1.00 0.00 ? 133 TRP A CE3  2  
ATOM 4384  C CZ2  . TRP A 1 133 ? -16.163 2.156   -1.998  1.00 0.00 ? 133 TRP A CZ2  2  
ATOM 4385  C CZ3  . TRP A 1 133 ? -15.602 1.304   0.188   1.00 0.00 ? 133 TRP A CZ3  2  
ATOM 4386  C CH2  . TRP A 1 133 ? -16.155 1.106   -1.072  1.00 0.00 ? 133 TRP A CH2  2  
ATOM 4387  H H    . TRP A 1 133 ? -12.174 6.115   -0.740  1.00 0.00 ? 133 TRP A H    2  
ATOM 4388  H HA   . TRP A 1 133 ? -14.255 7.569   0.473   1.00 0.00 ? 133 TRP A HA   2  
ATOM 4389  H HB2  . TRP A 1 133 ? -13.036 4.922   1.281   1.00 0.00 ? 133 TRP A HB2  2  
ATOM 4390  H HB3  . TRP A 1 133 ? -14.579 5.557   1.815   1.00 0.00 ? 133 TRP A HB3  2  
ATOM 4391  H HD1  . TRP A 1 133 ? -14.593 6.487   -1.681  1.00 0.00 ? 133 TRP A HD1  2  
ATOM 4392  H HE1  . TRP A 1 133 ? -15.788 4.764   -3.283  1.00 0.00 ? 133 TRP A HE1  2  
ATOM 4393  H HE3  . TRP A 1 133 ? -14.606 2.622   1.624   1.00 0.00 ? 133 TRP A HE3  2  
ATOM 4394  H HZ2  . TRP A 1 133 ? -16.588 2.040   -2.995  1.00 0.00 ? 133 TRP A HZ2  2  
ATOM 4395  H HZ3  . TRP A 1 133 ? -15.613 0.465   0.884   1.00 0.00 ? 133 TRP A HZ3  2  
ATOM 4396  H HH2  . TRP A 1 133 ? -16.582 0.140   -1.337  1.00 0.00 ? 133 TRP A HH2  2  
ATOM 4397  N N    . ILE A 1 134 ? -11.530 6.972   2.271   1.00 0.00 ? 134 ILE A N    2  
ATOM 4398  C CA   . ILE A 1 134 ? -10.741 7.440   3.399   1.00 0.00 ? 134 ILE A CA   2  
ATOM 4399  C C    . ILE A 1 134 ? -10.621 8.964   3.334   1.00 0.00 ? 134 ILE A C    2  
ATOM 4400  O O    . ILE A 1 134 ? -10.909 9.655   4.310   1.00 0.00 ? 134 ILE A O    2  
ATOM 4401  C CB   . ILE A 1 134 ? -9.393  6.718   3.445   1.00 0.00 ? 134 ILE A CB   2  
ATOM 4402  C CG1  . ILE A 1 134 ? -9.505  5.397   4.209   1.00 0.00 ? 134 ILE A CG1  2  
ATOM 4403  C CG2  . ILE A 1 134 ? -8.305  7.625   4.025   1.00 0.00 ? 134 ILE A CG2  2  
ATOM 4404  C CD1  . ILE A 1 134 ? -8.136  4.939   4.715   1.00 0.00 ? 134 ILE A CD1  2  
ATOM 4405  H H    . ILE A 1 134 ? -11.151 6.183   1.789   1.00 0.00 ? 134 ILE A H    2  
ATOM 4406  H HA   . ILE A 1 134 ? -11.282 7.174   4.307   1.00 0.00 ? 134 ILE A HA   2  
ATOM 4407  H HB   . ILE A 1 134 ? -9.100  6.476   2.424   1.00 0.00 ? 134 ILE A HB   2  
ATOM 4408  H HG12 . ILE A 1 134 ? -10.187 5.517   5.052   1.00 0.00 ? 134 ILE A HG12 2  
ATOM 4409  H HG13 . ILE A 1 134 ? -9.932  4.633   3.559   1.00 0.00 ? 134 ILE A HG13 2  
ATOM 4410  H HG21 . ILE A 1 134 ? -8.225  8.528   3.419   1.00 0.00 ? 134 ILE A HG21 2  
ATOM 4411  H HG22 . ILE A 1 134 ? -8.566  7.896   5.047   1.00 0.00 ? 134 ILE A HG22 2  
ATOM 4412  H HG23 . ILE A 1 134 ? -7.352  7.097   4.019   1.00 0.00 ? 134 ILE A HG23 2  
ATOM 4413  H HD11 . ILE A 1 134 ? -7.460  4.813   3.870   1.00 0.00 ? 134 ILE A HD11 2  
ATOM 4414  H HD12 . ILE A 1 134 ? -7.731  5.688   5.396   1.00 0.00 ? 134 ILE A HD12 2  
ATOM 4415  H HD13 . ILE A 1 134 ? -8.241  3.990   5.240   1.00 0.00 ? 134 ILE A HD13 2  
ATOM 4416  N N    . ILE A 1 135 ? -10.195 9.443   2.175   1.00 0.00 ? 135 ILE A N    2  
ATOM 4417  C CA   . ILE A 1 135 ? -10.033 10.873  1.971   1.00 0.00 ? 135 ILE A CA   2  
ATOM 4418  C C    . ILE A 1 135 ? -11.399 11.556  2.067   1.00 0.00 ? 135 ILE A C    2  
ATOM 4419  O O    . ILE A 1 135 ? -11.489 12.721  2.448   1.00 0.00 ? 135 ILE A O    2  
ATOM 4420  C CB   . ILE A 1 135 ? -9.300  11.147  0.656   1.00 0.00 ? 135 ILE A CB   2  
ATOM 4421  C CG1  . ILE A 1 135 ? -8.134  12.114  0.870   1.00 0.00 ? 135 ILE A CG1  2  
ATOM 4422  C CG2  . ILE A 1 135 ? -10.269 11.645  -0.418  1.00 0.00 ? 135 ILE A CG2  2  
ATOM 4423  C CD1  . ILE A 1 135 ? -7.027  11.463  1.703   1.00 0.00 ? 135 ILE A CD1  2  
ATOM 4424  H H    . ILE A 1 135 ? -9.963  8.875   1.386   1.00 0.00 ? 135 ILE A H    2  
ATOM 4425  H HA   . ILE A 1 135 ? -9.402  11.249  2.776   1.00 0.00 ? 135 ILE A HA   2  
ATOM 4426  H HB   . ILE A 1 135 ? -8.878  10.208  0.298   1.00 0.00 ? 135 ILE A HB   2  
ATOM 4427  H HG12 . ILE A 1 135 ? -7.733  12.425  -0.095  1.00 0.00 ? 135 ILE A HG12 2  
ATOM 4428  H HG13 . ILE A 1 135 ? -8.490  13.014  1.372   1.00 0.00 ? 135 ILE A HG13 2  
ATOM 4429  H HG21 . ILE A 1 135 ? -10.814 12.510  -0.042  1.00 0.00 ? 135 ILE A HG21 2  
ATOM 4430  H HG22 . ILE A 1 135 ? -9.708  11.929  -1.309  1.00 0.00 ? 135 ILE A HG22 2  
ATOM 4431  H HG23 . ILE A 1 135 ? -10.972 10.852  -0.669  1.00 0.00 ? 135 ILE A HG23 2  
ATOM 4432  H HD11 . ILE A 1 135 ? -7.427  10.590  2.219   1.00 0.00 ? 135 ILE A HD11 2  
ATOM 4433  H HD12 . ILE A 1 135 ? -6.212  11.157  1.047   1.00 0.00 ? 135 ILE A HD12 2  
ATOM 4434  H HD13 . ILE A 1 135 ? -6.656  12.180  2.435   1.00 0.00 ? 135 ILE A HD13 2  
ATOM 4435  N N    . LEU A 1 136 ? -12.429 10.800  1.714   1.00 0.00 ? 136 LEU A N    2  
ATOM 4436  C CA   . LEU A 1 136 ? -13.786 11.317  1.756   1.00 0.00 ? 136 LEU A CA   2  
ATOM 4437  C C    . LEU A 1 136 ? -14.108 11.778  3.178   1.00 0.00 ? 136 LEU A C    2  
ATOM 4438  O O    . LEU A 1 136 ? -14.627 12.876  3.377   1.00 0.00 ? 136 LEU A O    2  
ATOM 4439  C CB   . LEU A 1 136 ? -14.771 10.283  1.207   1.00 0.00 ? 136 LEU A CB   2  
ATOM 4440  C CG   . LEU A 1 136 ? -15.917 10.834  0.356   1.00 0.00 ? 136 LEU A CG   2  
ATOM 4441  C CD1  . LEU A 1 136 ? -16.301 9.851   -0.751  1.00 0.00 ? 136 LEU A CD1  2  
ATOM 4442  C CD2  . LEU A 1 136 ? -17.115 11.210  1.229   1.00 0.00 ? 136 LEU A CD2  2  
ATOM 4443  H H    . LEU A 1 136 ? -12.347 9.853   1.405   1.00 0.00 ? 136 LEU A H    2  
ATOM 4444  H HA   . LEU A 1 136 ? -13.826 12.184  1.095   1.00 0.00 ? 136 LEU A HA   2  
ATOM 4445  H HB2  . LEU A 1 136 ? -14.214 9.563   0.607   1.00 0.00 ? 136 LEU A HB2  2  
ATOM 4446  H HB3  . LEU A 1 136 ? -15.198 9.736   2.046   1.00 0.00 ? 136 LEU A HB3  2  
ATOM 4447  H HG   . LEU A 1 136 ? -15.574 11.747  -0.129  1.00 0.00 ? 136 LEU A HG   2  
ATOM 4448  H HD11 . LEU A 1 136 ? -15.701 8.945   -0.656  1.00 0.00 ? 136 LEU A HD11 2  
ATOM 4449  H HD12 . LEU A 1 136 ? -17.357 9.597   -0.662  1.00 0.00 ? 136 LEU A HD12 2  
ATOM 4450  H HD13 . LEU A 1 136 ? -16.117 10.309  -1.724  1.00 0.00 ? 136 LEU A HD13 2  
ATOM 4451  H HD21 . LEU A 1 136 ? -17.015 10.740  2.207   1.00 0.00 ? 136 LEU A HD21 2  
ATOM 4452  H HD22 . LEU A 1 136 ? -17.153 12.293  1.349   1.00 0.00 ? 136 LEU A HD22 2  
ATOM 4453  H HD23 . LEU A 1 136 ? -18.034 10.866  0.754   1.00 0.00 ? 136 LEU A HD23 2  
ATOM 4454  N N    . GLY A 1 137 ? -13.787 10.916  4.133   1.00 0.00 ? 137 GLY A N    2  
ATOM 4455  C CA   . GLY A 1 137 ? -14.036 11.222  5.531   1.00 0.00 ? 137 GLY A CA   2  
ATOM 4456  C C    . GLY A 1 137 ? -13.116 12.341  6.021   1.00 0.00 ? 137 GLY A C    2  
ATOM 4457  O O    . GLY A 1 137 ? -13.573 13.300  6.640   1.00 0.00 ? 137 GLY A O    2  
ATOM 4458  H H    . GLY A 1 137 ? -13.365 10.026  3.963   1.00 0.00 ? 137 GLY A H    2  
ATOM 4459  H HA2  . GLY A 1 137 ? -15.076 11.517  5.663   1.00 0.00 ? 137 GLY A HA2  2  
ATOM 4460  H HA3  . GLY A 1 137 ? -13.879 10.327  6.135   1.00 0.00 ? 137 GLY A HA3  2  
ATOM 4461  N N    . LEU A 1 138 ? -11.834 12.184  5.723   1.00 0.00 ? 138 LEU A N    2  
ATOM 4462  C CA   . LEU A 1 138 ? -10.845 13.169  6.124   1.00 0.00 ? 138 LEU A CA   2  
ATOM 4463  C C    . LEU A 1 138 ? -11.240 14.539  5.566   1.00 0.00 ? 138 LEU A C    2  
ATOM 4464  O O    . LEU A 1 138 ? -10.960 15.567  6.178   1.00 0.00 ? 138 LEU A O    2  
ATOM 4465  C CB   . LEU A 1 138 ? -9.442  12.720  5.714   1.00 0.00 ? 138 LEU A CB   2  
ATOM 4466  C CG   . LEU A 1 138 ? -8.724  11.786  6.691   1.00 0.00 ? 138 LEU A CG   2  
ATOM 4467  C CD1  . LEU A 1 138 ? -7.348  11.385  6.155   1.00 0.00 ? 138 LEU A CD1  2  
ATOM 4468  C CD2  . LEU A 1 138 ? -8.638  12.411  8.084   1.00 0.00 ? 138 LEU A CD2  2  
ATOM 4469  H H    . LEU A 1 138 ? -11.469 11.401  5.218   1.00 0.00 ? 138 LEU A H    2  
ATOM 4470  H HA   . LEU A 1 138 ? -10.861 13.224  7.213   1.00 0.00 ? 138 LEU A HA   2  
ATOM 4471  H HB2  . LEU A 1 138 ? -9.511  12.220  4.748   1.00 0.00 ? 138 LEU A HB2  2  
ATOM 4472  H HB3  . LEU A 1 138 ? -8.825  13.606  5.571   1.00 0.00 ? 138 LEU A HB3  2  
ATOM 4473  H HG   . LEU A 1 138 ? -9.312  10.872  6.784   1.00 0.00 ? 138 LEU A HG   2  
ATOM 4474  H HD11 . LEU A 1 138 ? -7.083  12.030  5.317   1.00 0.00 ? 138 LEU A HD11 2  
ATOM 4475  H HD12 . LEU A 1 138 ? -6.605  11.495  6.946   1.00 0.00 ? 138 LEU A HD12 2  
ATOM 4476  H HD13 . LEU A 1 138 ? -7.375  10.349  5.823   1.00 0.00 ? 138 LEU A HD13 2  
ATOM 4477  H HD21 . LEU A 1 138 ? -8.586  13.496  7.993   1.00 0.00 ? 138 LEU A HD21 2  
ATOM 4478  H HD22 . LEU A 1 138 ? -9.522  12.138  8.660   1.00 0.00 ? 138 LEU A HD22 2  
ATOM 4479  H HD23 . LEU A 1 138 ? -7.745  12.045  8.592   1.00 0.00 ? 138 LEU A HD23 2  
ATOM 4480  N N    . ASN A 1 139 ? -11.885 14.506  4.409   1.00 0.00 ? 139 ASN A N    2  
ATOM 4481  C CA   . ASN A 1 139 ? -12.322 15.731  3.761   1.00 0.00 ? 139 ASN A CA   2  
ATOM 4482  C C    . ASN A 1 139 ? -13.494 16.327  4.543   1.00 0.00 ? 139 ASN A C    2  
ATOM 4483  O O    . ASN A 1 139 ? -13.511 17.523  4.829   1.00 0.00 ? 139 ASN A O    2  
ATOM 4484  C CB   . ASN A 1 139 ? -12.795 15.459  2.332   1.00 0.00 ? 139 ASN A CB   2  
ATOM 4485  C CG   . ASN A 1 139 ? -12.831 16.751  1.511   1.00 0.00 ? 139 ASN A CG   2  
ATOM 4486  O OD1  . ASN A 1 139 ? -12.118 17.705  1.776   1.00 0.00 ? 139 ASN A OD1  2  
ATOM 4487  N ND2  . ASN A 1 139 ? -13.699 16.728  0.504   1.00 0.00 ? 139 ASN A ND2  2  
ATOM 4488  H H    . ASN A 1 139 ? -12.110 13.664  3.917   1.00 0.00 ? 139 ASN A H    2  
ATOM 4489  H HA   . ASN A 1 139 ? -11.447 16.382  3.760   1.00 0.00 ? 139 ASN A HA   2  
ATOM 4490  H HB2  . ASN A 1 139 ? -12.131 14.739  1.855   1.00 0.00 ? 139 ASN A HB2  2  
ATOM 4491  H HB3  . ASN A 1 139 ? -13.788 15.010  2.353   1.00 0.00 ? 139 ASN A HB3  2  
ATOM 4492  H HD21 . ASN A 1 139 ? -14.255 15.912  0.342   1.00 0.00 ? 139 ASN A HD21 2  
ATOM 4493  H HD22 . ASN A 1 139 ? -13.796 17.526  -0.092  1.00 0.00 ? 139 ASN A HD22 2  
ATOM 4494  N N    . LYS A 1 140 ? -14.447 15.465  4.866   1.00 0.00 ? 140 LYS A N    2  
ATOM 4495  C CA   . LYS A 1 140 ? -15.621 15.891  5.609   1.00 0.00 ? 140 LYS A CA   2  
ATOM 4496  C C    . LYS A 1 140 ? -15.190 16.410  6.982   1.00 0.00 ? 140 LYS A C    2  
ATOM 4497  O O    . LYS A 1 140 ? -15.787 17.345  7.513   1.00 0.00 ? 140 LYS A O    2  
ATOM 4498  C CB   . LYS A 1 140 ? -16.652 14.762  5.675   1.00 0.00 ? 140 LYS A CB   2  
ATOM 4499  C CG   . LYS A 1 140 ? -17.484 14.705  4.392   1.00 0.00 ? 140 LYS A CG   2  
ATOM 4500  C CD   . LYS A 1 140 ? -18.412 15.916  4.285   1.00 0.00 ? 140 LYS A CD   2  
ATOM 4501  C CE   . LYS A 1 140 ? -17.821 16.980  3.357   1.00 0.00 ? 140 LYS A CE   2  
ATOM 4502  N NZ   . LYS A 1 140 ? -18.774 17.308  2.273   1.00 0.00 ? 140 LYS A NZ   2  
ATOM 4503  H H    . LYS A 1 140 ? -14.426 14.494  4.630   1.00 0.00 ? 140 LYS A H    2  
ATOM 4504  H HA   . LYS A 1 140 ? -16.077 16.712  5.056   1.00 0.00 ? 140 LYS A HA   2  
ATOM 4505  H HB2  . LYS A 1 140 ? -16.145 13.810  5.827   1.00 0.00 ? 140 LYS A HB2  2  
ATOM 4506  H HB3  . LYS A 1 140 ? -17.308 14.914  6.532   1.00 0.00 ? 140 LYS A HB3  2  
ATOM 4507  H HG2  . LYS A 1 140 ? -16.822 14.671  3.527   1.00 0.00 ? 140 LYS A HG2  2  
ATOM 4508  H HG3  . LYS A 1 140 ? -18.073 13.788  4.378   1.00 0.00 ? 140 LYS A HG3  2  
ATOM 4509  H HD2  . LYS A 1 140 ? -19.386 15.602  3.910   1.00 0.00 ? 140 LYS A HD2  2  
ATOM 4510  H HD3  . LYS A 1 140 ? -18.574 16.343  5.275   1.00 0.00 ? 140 LYS A HD3  2  
ATOM 4511  H HE2  . LYS A 1 140 ? -17.586 17.879  3.927   1.00 0.00 ? 140 LYS A HE2  2  
ATOM 4512  H HE3  . LYS A 1 140 ? -16.885 16.618  2.930   1.00 0.00 ? 140 LYS A HE3  2  
ATOM 4513  H HZ1  . LYS A 1 140 ? -19.546 16.673  2.304   1.00 0.00 ? 140 LYS A HZ1  2  
ATOM 4514  H HZ2  . LYS A 1 140 ? -19.105 18.244  2.393   1.00 0.00 ? 140 LYS A HZ2  2  
ATOM 4515  H HZ3  . LYS A 1 140 ? -18.312 17.228  1.389   1.00 0.00 ? 140 LYS A HZ3  2  
ATOM 4516  N N    . ILE A 1 141 ? -14.154 15.780  7.519   1.00 0.00 ? 141 ILE A N    2  
ATOM 4517  C CA   . ILE A 1 141 ? -13.636 16.167  8.820   1.00 0.00 ? 141 ILE A CA   2  
ATOM 4518  C C    . ILE A 1 141 ? -12.918 17.512  8.699   1.00 0.00 ? 141 ILE A C    2  
ATOM 4519  O O    . ILE A 1 141 ? -13.164 18.425  9.485   1.00 0.00 ? 141 ILE A O    2  
ATOM 4520  C CB   . ILE A 1 141 ? -12.761 15.053  9.401   1.00 0.00 ? 141 ILE A CB   2  
ATOM 4521  C CG1  . ILE A 1 141 ? -13.532 13.734  9.474   1.00 0.00 ? 141 ILE A CG1  2  
ATOM 4522  C CG2  . ILE A 1 141 ? -12.189 15.459  10.760  1.00 0.00 ? 141 ILE A CG2  2  
ATOM 4523  C CD1  . ILE A 1 141 ? -12.586 12.539  9.339   1.00 0.00 ? 141 ILE A CD1  2  
ATOM 4524  H H    . ILE A 1 141 ? -13.674 15.021  7.081   1.00 0.00 ? 141 ILE A H    2  
ATOM 4525  H HA   . ILE A 1 141 ? -14.488 16.290  9.488   1.00 0.00 ? 141 ILE A HA   2  
ATOM 4526  H HB   . ILE A 1 141 ? -11.918 14.896  8.730   1.00 0.00 ? 141 ILE A HB   2  
ATOM 4527  H HG12 . ILE A 1 141 ? -14.067 13.674  10.422  1.00 0.00 ? 141 ILE A HG12 2  
ATOM 4528  H HG13 . ILE A 1 141 ? -14.281 13.701  8.683   1.00 0.00 ? 141 ILE A HG13 2  
ATOM 4529  H HG21 . ILE A 1 141 ? -12.129 16.546  10.820  1.00 0.00 ? 141 ILE A HG21 2  
ATOM 4530  H HG22 . ILE A 1 141 ? -12.837 15.087  11.554  1.00 0.00 ? 141 ILE A HG22 2  
ATOM 4531  H HG23 . ILE A 1 141 ? -11.192 15.033  10.876  1.00 0.00 ? 141 ILE A HG23 2  
ATOM 4532  H HD11 . ILE A 1 141 ? -11.677 12.729  9.908   1.00 0.00 ? 141 ILE A HD11 2  
ATOM 4533  H HD12 . ILE A 1 141 ? -13.076 11.643  9.723   1.00 0.00 ? 141 ILE A HD12 2  
ATOM 4534  H HD13 . ILE A 1 141 ? -12.334 12.392  8.289   1.00 0.00 ? 141 ILE A HD13 2  
ATOM 4535  N N    . VAL A 1 142 ? -12.042 17.593  7.707   1.00 0.00 ? 142 VAL A N    2  
ATOM 4536  C CA   . VAL A 1 142 ? -11.286 18.811  7.472   1.00 0.00 ? 142 VAL A CA   2  
ATOM 4537  C C    . VAL A 1 142 ? -12.255 19.959  7.183   1.00 0.00 ? 142 VAL A C    2  
ATOM 4538  O O    . VAL A 1 142 ? -11.974 21.111  7.512   1.00 0.00 ? 142 VAL A O    2  
ATOM 4539  C CB   . VAL A 1 142 ? -10.270 18.589  6.351   1.00 0.00 ? 142 VAL A CB   2  
ATOM 4540  C CG1  . VAL A 1 142 ? -10.249 19.778  5.386   1.00 0.00 ? 142 VAL A CG1  2  
ATOM 4541  C CG2  . VAL A 1 142 ? -8.876  18.319  6.918   1.00 0.00 ? 142 VAL A CG2  2  
ATOM 4542  H H    . VAL A 1 142 ? -11.846 16.845  7.071   1.00 0.00 ? 142 VAL A H    2  
ATOM 4543  H HA   . VAL A 1 142 ? -10.736 19.038  8.385   1.00 0.00 ? 142 VAL A HA   2  
ATOM 4544  H HB   . VAL A 1 142 ? -10.579 17.707  5.789   1.00 0.00 ? 142 VAL A HB   2  
ATOM 4545  H HG11 . VAL A 1 142 ? -11.245 19.924  4.969   1.00 0.00 ? 142 VAL A HG11 2  
ATOM 4546  H HG12 . VAL A 1 142 ? -9.944  20.675  5.923   1.00 0.00 ? 142 VAL A HG12 2  
ATOM 4547  H HG13 . VAL A 1 142 ? -9.543  19.578  4.580   1.00 0.00 ? 142 VAL A HG13 2  
ATOM 4548  H HG21 . VAL A 1 142 ? -8.603  19.119  7.607   1.00 0.00 ? 142 VAL A HG21 2  
ATOM 4549  H HG22 . VAL A 1 142 ? -8.877  17.367  7.450   1.00 0.00 ? 142 VAL A HG22 2  
ATOM 4550  H HG23 . VAL A 1 142 ? -8.153  18.279  6.104   1.00 0.00 ? 142 VAL A HG23 2  
ATOM 4551  N N    . ARG A 1 143 ? -13.375 19.606  6.571   1.00 0.00 ? 143 ARG A N    2  
ATOM 4552  C CA   . ARG A 1 143 ? -14.387 20.592  6.233   1.00 0.00 ? 143 ARG A CA   2  
ATOM 4553  C C    . ARG A 1 143 ? -14.939 21.242  7.504   1.00 0.00 ? 143 ARG A C    2  
ATOM 4554  O O    . ARG A 1 143 ? -15.099 22.460  7.564   1.00 0.00 ? 143 ARG A O    2  
ATOM 4555  C CB   . ARG A 1 143 ? -15.538 19.956  5.453   1.00 0.00 ? 143 ARG A CB   2  
ATOM 4556  C CG   . ARG A 1 143 ? -15.190 19.830  3.968   1.00 0.00 ? 143 ARG A CG   2  
ATOM 4557  C CD   . ARG A 1 143 ? -15.389 21.163  3.244   1.00 0.00 ? 143 ARG A CD   2  
ATOM 4558  N NE   . ARG A 1 143 ? -15.896 20.924  1.873   1.00 0.00 ? 143 ARG A NE   2  
ATOM 4559  C CZ   . ARG A 1 143 ? -15.122 20.570  0.838   1.00 0.00 ? 143 ARG A CZ   2  
ATOM 4560  N NH1  . ARG A 1 143 ? -13.802 20.411  1.010   1.00 0.00 ? 143 ARG A NH1  2  
ATOM 4561  N NH2  . ARG A 1 143 ? -15.668 20.374  -0.370  1.00 0.00 ? 143 ARG A NH2  2  
ATOM 4562  H H    . ARG A 1 143 ? -13.596 18.667  6.307   1.00 0.00 ? 143 ARG A H    2  
ATOM 4563  H HA   . ARG A 1 143 ? -13.868 21.323  5.613   1.00 0.00 ? 143 ARG A HA   2  
ATOM 4564  H HB2  . ARG A 1 143 ? -15.760 18.971  5.862   1.00 0.00 ? 143 ARG A HB2  2  
ATOM 4565  H HB3  . ARG A 1 143 ? -16.439 20.558  5.569   1.00 0.00 ? 143 ARG A HB3  2  
ATOM 4566  H HG2  . ARG A 1 143 ? -14.156 19.503  3.859   1.00 0.00 ? 143 ARG A HG2  2  
ATOM 4567  H HG3  . ARG A 1 143 ? -15.817 19.065  3.508   1.00 0.00 ? 143 ARG A HG3  2  
ATOM 4568  H HD2  . ARG A 1 143 ? -16.092 21.785  3.797   1.00 0.00 ? 143 ARG A HD2  2  
ATOM 4569  H HD3  . ARG A 1 143 ? -14.446 21.707  3.201   1.00 0.00 ? 143 ARG A HD3  2  
ATOM 4570  H HE   . ARG A 1 143 ? -16.876 21.033  1.711   1.00 0.00 ? 143 ARG A HE   2  
ATOM 4571  H HH11 . ARG A 1 143 ? -13.395 20.558  1.912   1.00 0.00 ? 143 ARG A HH11 2  
ATOM 4572  H HH12 . ARG A 1 143 ? -13.226 20.146  0.237   1.00 0.00 ? 143 ARG A HH12 2  
ATOM 4573  H HH21 . ARG A 1 143 ? -16.653 20.492  -0.498  1.00 0.00 ? 143 ARG A HH21 2  
ATOM 4574  H HH22 . ARG A 1 143 ? -15.092 20.109  -1.143  1.00 0.00 ? 143 ARG A HH22 2  
ATOM 4575  N N    . MET A 1 144 ? -15.216 20.400  8.489   1.00 0.00 ? 144 MET A N    2  
ATOM 4576  C CA   . MET A 1 144 ? -15.747 20.876  9.755   1.00 0.00 ? 144 MET A CA   2  
ATOM 4577  C C    . MET A 1 144 ? -14.714 21.726  10.497  1.00 0.00 ? 144 MET A C    2  
ATOM 4578  O O    . MET A 1 144 ? -15.038 22.799  11.005  1.00 0.00 ? 144 MET A O    2  
ATOM 4579  C CB   . MET A 1 144 ? -16.147 19.682  10.624  1.00 0.00 ? 144 MET A CB   2  
ATOM 4580  C CG   . MET A 1 144 ? -16.567 20.138  12.022  1.00 0.00 ? 144 MET A CG   2  
ATOM 4581  S SD   . MET A 1 144 ? -15.175 20.056  13.135  1.00 0.00 ? 144 MET A SD   2  
ATOM 4582  C CE   . MET A 1 144 ? -15.080 18.291  13.383  1.00 0.00 ? 144 MET A CE   2  
ATOM 4583  H H    . MET A 1 144 ? -15.083 19.410  8.432   1.00 0.00 ? 144 MET A H    2  
ATOM 4584  H HA   . MET A 1 144 ? -16.613 21.487  9.498   1.00 0.00 ? 144 MET A HA   2  
ATOM 4585  H HB2  . MET A 1 144 ? -16.966 19.142  10.151  1.00 0.00 ? 144 MET A HB2  2  
ATOM 4586  H HB3  . MET A 1 144 ? -15.310 18.988  10.700  1.00 0.00 ? 144 MET A HB3  2  
ATOM 4587  H HG2  . MET A 1 144 ? -16.951 21.158  11.981  1.00 0.00 ? 144 MET A HG2  2  
ATOM 4588  H HG3  . MET A 1 144 ? -17.377 19.508  12.390  1.00 0.00 ? 144 MET A HG3  2  
ATOM 4589  H HE1  . MET A 1 144 ? -15.080 17.788  12.416  1.00 0.00 ? 144 MET A HE1  2  
ATOM 4590  H HE2  . MET A 1 144 ? -14.162 18.049  13.919  1.00 0.00 ? 144 MET A HE2  2  
ATOM 4591  H HE3  . MET A 1 144 ? -15.939 17.959  13.966  1.00 0.00 ? 144 MET A HE3  2  
ATOM 4592  N N    . TYR A 1 145 ? -13.493 21.215  10.537  1.00 0.00 ? 145 TYR A N    2  
ATOM 4593  C CA   . TYR A 1 145 ? -12.410 21.913  11.208  1.00 0.00 ? 145 TYR A CA   2  
ATOM 4594  C C    . TYR A 1 145 ? -12.312 23.363  10.729  1.00 0.00 ? 145 TYR A C    2  
ATOM 4595  O O    . TYR A 1 145 ? -12.232 24.284  11.539  1.00 0.00 ? 145 TYR A O    2  
ATOM 4596  C CB   . TYR A 1 145 ? -11.127 21.173  10.824  1.00 0.00 ? 145 TYR A CB   2  
ATOM 4597  C CG   . TYR A 1 145 ? -10.578 20.267  11.927  1.00 0.00 ? 145 TYR A CG   2  
ATOM 4598  C CD1  . TYR A 1 145 ? -11.281 19.143  12.311  1.00 0.00 ? 145 TYR A CD1  2  
ATOM 4599  C CD2  . TYR A 1 145 ? -9.379  20.574  12.538  1.00 0.00 ? 145 TYR A CD2  2  
ATOM 4600  C CE1  . TYR A 1 145 ? -10.762 18.290  13.349  1.00 0.00 ? 145 TYR A CE1  2  
ATOM 4601  C CE2  . TYR A 1 145 ? -8.861  19.721  13.576  1.00 0.00 ? 145 TYR A CE2  2  
ATOM 4602  C CZ   . TYR A 1 145 ? -9.578  18.622  13.931  1.00 0.00 ? 145 TYR A CZ   2  
ATOM 4603  O OH   . TYR A 1 145 ? -9.090  17.816  14.912  1.00 0.00 ? 145 TYR A OH   2  
ATOM 4604  H H    . TYR A 1 145 ? -13.238 20.342  10.120  1.00 0.00 ? 145 TYR A H    2  
ATOM 4605  H HA   . TYR A 1 145 ? -12.619 21.906  12.278  1.00 0.00 ? 145 TYR A HA   2  
ATOM 4606  H HB2  . TYR A 1 145 ? -11.320 20.571  9.936   1.00 0.00 ? 145 TYR A HB2  2  
ATOM 4607  H HB3  . TYR A 1 145 ? -10.365 21.905  10.555  1.00 0.00 ? 145 TYR A HB3  2  
ATOM 4608  H HD1  . TYR A 1 145 ? -12.227 18.901  11.829  1.00 0.00 ? 145 TYR A HD1  2  
ATOM 4609  H HD2  . TYR A 1 145 ? -8.824  21.461  12.235  1.00 0.00 ? 145 TYR A HD2  2  
ATOM 4610  H HE1  . TYR A 1 145 ? -11.307 17.400  13.662  1.00 0.00 ? 145 TYR A HE1  2  
ATOM 4611  H HE2  . TYR A 1 145 ? -7.916  19.951  14.068  1.00 0.00 ? 145 TYR A HE2  2  
ATOM 4612  H HH   . TYR A 1 145 ? -9.637  17.918  15.743  1.00 0.00 ? 145 TYR A HH   2  
ATOM 4613  N N    . SER A 1 146 ? -12.321 23.519  9.413   1.00 0.00 ? 146 SER A N    2  
ATOM 4614  C CA   . SER A 1 146 ? -12.233 24.840  8.816   1.00 0.00 ? 146 SER A CA   2  
ATOM 4615  C C    . SER A 1 146 ? -11.246 25.706  9.601   1.00 0.00 ? 146 SER A C    2  
ATOM 4616  O O    . SER A 1 146 ? -11.639 26.684  10.234  1.00 0.00 ? 146 SER A O    2  
ATOM 4617  C CB   . SER A 1 146 ? -13.606 25.515  8.766   1.00 0.00 ? 146 SER A CB   2  
ATOM 4618  O OG   . SER A 1 146 ? -14.030 25.956  10.053  1.00 0.00 ? 146 SER A OG   2  
ATOM 4619  H H    . SER A 1 146 ? -12.386 22.764  8.761   1.00 0.00 ? 146 SER A H    2  
ATOM 4620  H HA   . SER A 1 146 ? -11.874 24.676  7.801   1.00 0.00 ? 146 SER A HA   2  
ATOM 4621  H HB2  . SER A 1 146 ? -13.568 26.365  8.086   1.00 0.00 ? 146 SER A HB2  2  
ATOM 4622  H HB3  . SER A 1 146 ? -14.338 24.815  8.362   1.00 0.00 ? 146 SER A HB3  2  
ATOM 4623  H HG   . SER A 1 146 ? -13.496 25.501  10.765  1.00 0.00 ? 146 SER A HG   2  
ATOM 4624  N N    . PRO A 1 147 ? -9.948  25.303  9.533   1.00 0.00 ? 147 PRO A N    2  
ATOM 4625  C CA   . PRO A 1 147 ? -8.902  26.030  10.230  1.00 0.00 ? 147 PRO A CA   2  
ATOM 4626  C C    . PRO A 1 147 ? -8.569  27.339  9.509   1.00 0.00 ? 147 PRO A C    2  
ATOM 4627  O O    . PRO A 1 147 ? -9.165  27.653  8.480   1.00 0.00 ? 147 PRO A O    2  
ATOM 4628  C CB   . PRO A 1 147 ? -7.725  25.068  10.287  1.00 0.00 ? 147 PRO A CB   2  
ATOM 4629  C CG   . PRO A 1 147 ? -7.993  24.019  9.221   1.00 0.00 ? 147 PRO A CG   2  
ATOM 4630  C CD   . PRO A 1 147 ? -9.446  24.149  8.793   1.00 0.00 ? 147 PRO A CD   2  
ATOM 4631  H HA   . PRO A 1 147 ? -9.210  26.293  11.144  1.00 0.00 ? 147 PRO A HA   2  
ATOM 4632  H HB2  . PRO A 1 147 ? -6.787  25.588  10.097  1.00 0.00 ? 147 PRO A HB2  2  
ATOM 4633  H HB3  . PRO A 1 147 ? -7.643  24.612  11.274  1.00 0.00 ? 147 PRO A HB3  2  
ATOM 4634  H HG2  . PRO A 1 147 ? -7.330  24.164  8.369   1.00 0.00 ? 147 PRO A HG2  2  
ATOM 4635  H HG3  . PRO A 1 147 ? -7.798  23.020  9.611   1.00 0.00 ? 147 PRO A HG3  2  
ATOM 4636  H HD2  . PRO A 1 147 ? -9.530  24.301  7.717   1.00 0.00 ? 147 PRO A HD2  2  
ATOM 4637  H HD3  . PRO A 1 147 ? -10.011 23.249  9.033   1.00 0.00 ? 147 PRO A HD3  2  
ATOM 4638  N N    . THR A 1 148 ? -7.618  28.065  10.078  1.00 0.00 ? 148 THR A N    2  
ATOM 4639  C CA   . THR A 1 148 ? -7.200  29.332  9.502   1.00 0.00 ? 148 THR A CA   2  
ATOM 4640  C C    . THR A 1 148 ? -5.986  29.883  10.253  1.00 0.00 ? 148 THR A C    2  
ATOM 4641  O O    . THR A 1 148 ? -6.052  30.963  10.840  1.00 0.00 ? 148 THR A O    2  
ATOM 4642  C CB   . THR A 1 148 ? -8.403  30.277  9.515   1.00 0.00 ? 148 THR A CB   2  
ATOM 4643  O OG1  . THR A 1 148 ? -7.901  31.485  8.949   1.00 0.00 ? 148 THR A OG1  2  
ATOM 4644  C CG2  . THR A 1 148 ? -8.820  30.675  10.933  1.00 0.00 ? 148 THR A CG2  2  
ATOM 4645  H H    . THR A 1 148 ? -7.139  27.802  10.915  1.00 0.00 ? 148 THR A H    2  
ATOM 4646  H HA   . THR A 1 148 ? -6.886  29.155  8.473   1.00 0.00 ? 148 THR A HA   2  
ATOM 4647  H HB   . THR A 1 148 ? -9.242  29.847  8.969   1.00 0.00 ? 148 THR A HB   2  
ATOM 4648  H HG1  . THR A 1 148 ? -7.854  31.403  7.953   1.00 0.00 ? 148 THR A HG1  2  
ATOM 4649  H HG21 . THR A 1 148 ? -8.137  30.225  11.653  1.00 0.00 ? 148 THR A HG21 2  
ATOM 4650  H HG22 . THR A 1 148 ? -8.787  31.760  11.030  1.00 0.00 ? 148 THR A HG22 2  
ATOM 4651  H HG23 . THR A 1 148 ? -9.834  30.324  11.125  1.00 0.00 ? 148 THR A HG23 2  
ATOM 4652  N N    . SER A 1 149 ? -4.905  29.118  10.209  1.00 0.00 ? 149 SER A N    2  
ATOM 4653  C CA   . SER A 1 149 ? -3.679  29.516  10.878  1.00 0.00 ? 149 SER A CA   2  
ATOM 4654  C C    . SER A 1 149 ? -2.499  29.420  9.908   1.00 0.00 ? 149 SER A C    2  
ATOM 4655  O O    . SER A 1 149 ? -2.638  28.890  8.807   1.00 0.00 ? 149 SER A O    2  
ATOM 4656  C CB   . SER A 1 149 ? -3.420  28.653  12.114  1.00 0.00 ? 149 SER A CB   2  
ATOM 4657  O OG   . SER A 1 149 ? -2.293  29.109  12.858  1.00 0.00 ? 149 SER A OG   2  
ATOM 4658  H H    . SER A 1 149 ? -4.860  28.241  9.730   1.00 0.00 ? 149 SER A H    2  
ATOM 4659  H HA   . SER A 1 149 ? -3.839  30.550  11.184  1.00 0.00 ? 149 SER A HA   2  
ATOM 4660  H HB2  . SER A 1 149 ? -4.303  28.661  12.754  1.00 0.00 ? 149 SER A HB2  2  
ATOM 4661  H HB3  . SER A 1 149 ? -3.258  27.619  11.808  1.00 0.00 ? 149 SER A HB3  2  
ATOM 4662  H HG   . SER A 1 149 ? -2.407  28.885  13.825  1.00 0.00 ? 149 SER A HG   2  
ATOM 4663  N N    . ILE A 1 150 ? -1.366  29.942  10.352  1.00 0.00 ? 150 ILE A N    2  
ATOM 4664  C CA   . ILE A 1 150 ? -0.163  29.922  9.536   1.00 0.00 ? 150 ILE A CA   2  
ATOM 4665  C C    . ILE A 1 150 ? 1.065   29.854  10.447  1.00 0.00 ? 150 ILE A C    2  
ATOM 4666  O O    . ILE A 1 150 ? 0.955   30.041  11.658  1.00 0.00 ? 150 ILE A O    2  
ATOM 4667  C CB   . ILE A 1 150 ? -0.148  31.112  8.574   1.00 0.00 ? 150 ILE A CB   2  
ATOM 4668  C CG1  . ILE A 1 150 ? 0.834   30.875  7.425   1.00 0.00 ? 150 ILE A CG1  2  
ATOM 4669  C CG2  . ILE A 1 150 ? 0.144   32.416  9.318   1.00 0.00 ? 150 ILE A CG2  2  
ATOM 4670  C CD1  . ILE A 1 150 ? 0.540   31.810  6.250   1.00 0.00 ? 150 ILE A CD1  2  
ATOM 4671  H H    . ILE A 1 150 ? -1.261  30.371  11.249  1.00 0.00 ? 150 ILE A H    2  
ATOM 4672  H HA   . ILE A 1 150 ? -0.194  29.017  8.930   1.00 0.00 ? 150 ILE A HA   2  
ATOM 4673  H HB   . ILE A 1 150 ? -1.141  31.207  8.134   1.00 0.00 ? 150 ILE A HB   2  
ATOM 4674  H HG12 . ILE A 1 150 ? 1.854   31.034  7.774   1.00 0.00 ? 150 ILE A HG12 2  
ATOM 4675  H HG13 . ILE A 1 150 ? 0.769   29.838  7.093   1.00 0.00 ? 150 ILE A HG13 2  
ATOM 4676  H HG21 . ILE A 1 150 ? 0.291   32.204  10.377  1.00 0.00 ? 150 ILE A HG21 2  
ATOM 4677  H HG22 . ILE A 1 150 ? 1.046   32.873  8.910   1.00 0.00 ? 150 ILE A HG22 2  
ATOM 4678  H HG23 . ILE A 1 150 ? -0.696  33.100  9.197   1.00 0.00 ? 150 ILE A HG23 2  
ATOM 4679  H HD11 . ILE A 1 150 ? -0.533  31.828  6.059   1.00 0.00 ? 150 ILE A HD11 2  
ATOM 4680  H HD12 . ILE A 1 150 ? 0.882   32.817  6.493   1.00 0.00 ? 150 ILE A HD12 2  
ATOM 4681  H HD13 . ILE A 1 150 ? 1.061   31.454  5.362   1.00 0.00 ? 150 ILE A HD13 2  
ATOM 4682  N N    . LEU A 1 151 ? 2.205   29.585  9.829   1.00 0.00 ? 151 LEU A N    2  
ATOM 4683  C CA   . LEU A 1 151 ? 3.453   29.489  10.570  1.00 0.00 ? 151 LEU A CA   2  
ATOM 4684  C C    . LEU A 1 151 ? 3.671   30.780  11.362  1.00 0.00 ? 151 LEU A C    2  
ATOM 4685  O O    . LEU A 1 151 ? 4.007   31.815  10.788  1.00 0.00 ? 151 LEU A O    2  
ATOM 4686  C CB   . LEU A 1 151 ? 4.608   29.140  9.630   1.00 0.00 ? 151 LEU A CB   2  
ATOM 4687  C CG   . LEU A 1 151 ? 5.937   28.790  10.301  1.00 0.00 ? 151 LEU A CG   2  
ATOM 4688  C CD1  . LEU A 1 151 ? 6.497   29.989  11.070  1.00 0.00 ? 151 LEU A CD1  2  
ATOM 4689  C CD2  . LEU A 1 151 ? 5.791   27.555  11.194  1.00 0.00 ? 151 LEU A CD2  2  
ATOM 4690  H H    . LEU A 1 151 ? 2.286   29.433  8.845   1.00 0.00 ? 151 LEU A H    2  
ATOM 4691  H HA   . LEU A 1 151 ? 3.351   28.665  11.275  1.00 0.00 ? 151 LEU A HA   2  
ATOM 4692  H HB2  . LEU A 1 151 ? 4.305   28.298  9.009   1.00 0.00 ? 151 LEU A HB2  2  
ATOM 4693  H HB3  . LEU A 1 151 ? 4.774   29.986  8.961   1.00 0.00 ? 151 LEU A HB3  2  
ATOM 4694  H HG   . LEU A 1 151 ? 6.658   28.541  9.524   1.00 0.00 ? 151 LEU A HG   2  
ATOM 4695  H HD11 . LEU A 1 151 ? 6.059   30.908  10.678  1.00 0.00 ? 151 LEU A HD11 2  
ATOM 4696  H HD12 . LEU A 1 151 ? 6.251   29.891  12.126  1.00 0.00 ? 151 LEU A HD12 2  
ATOM 4697  H HD13 . LEU A 1 151 ? 7.580   30.023  10.950  1.00 0.00 ? 151 LEU A HD13 2  
ATOM 4698  H HD21 . LEU A 1 151 ? 4.998   27.725  11.922  1.00 0.00 ? 151 LEU A HD21 2  
ATOM 4699  H HD22 . LEU A 1 151 ? 5.542   26.690  10.580  1.00 0.00 ? 151 LEU A HD22 2  
ATOM 4700  H HD23 . LEU A 1 151 ? 6.729   27.372  11.717  1.00 0.00 ? 151 LEU A HD23 2  
ATOM 4701  N N    . PRO A 1 1   ? 1.596   -0.466  0.933   1.00 0.00 ? 1   PRO A N    3  
ATOM 4702  C CA   . PRO A 1 1   ? 0.725   -0.239  -0.206  1.00 0.00 ? 1   PRO A CA   3  
ATOM 4703  C C    . PRO A 1 1   ? 0.795   -1.407  -1.193  1.00 0.00 ? 1   PRO A C    3  
ATOM 4704  O O    . PRO A 1 1   ? 1.402   -2.435  -0.900  1.00 0.00 ? 1   PRO A O    3  
ATOM 4705  C CB   . PRO A 1 1   ? 1.197   1.075   -0.808  1.00 0.00 ? 1   PRO A CB   3  
ATOM 4706  C CG   . PRO A 1 1   ? 2.601   1.298   -0.269  1.00 0.00 ? 1   PRO A CG   3  
ATOM 4707  C CD   . PRO A 1 1   ? 2.814   0.338   0.889   1.00 0.00 ? 1   PRO A CD   3  
ATOM 4708  H HA   . PRO A 1 1   ? -0.229  -0.188  0.090   1.00 0.00 ? 1   PRO A HA   3  
ATOM 4709  H HB2  . PRO A 1 1   ? 1.200   1.028   -1.897  1.00 0.00 ? 1   PRO A HB2  3  
ATOM 4710  H HB3  . PRO A 1 1   ? 0.536   1.894   -0.526  1.00 0.00 ? 1   PRO A HB3  3  
ATOM 4711  H HG2  . PRO A 1 1   ? 3.341   1.125   -1.050  1.00 0.00 ? 1   PRO A HG2  3  
ATOM 4712  H HG3  . PRO A 1 1   ? 2.723   2.329   0.063   1.00 0.00 ? 1   PRO A HG3  3  
ATOM 4713  H HD2  . PRO A 1 1   ? 3.694   -0.286  0.729   1.00 0.00 ? 1   PRO A HD2  3  
ATOM 4714  H HD3  . PRO A 1 1   ? 2.969   0.874   1.825   1.00 0.00 ? 1   PRO A HD3  3  
ATOM 4715  N N    . ILE A 1 2   ? 0.165   -1.209  -2.341  1.00 0.00 ? 2   ILE A N    3  
ATOM 4716  C CA   . ILE A 1 2   ? 0.148   -2.233  -3.371  1.00 0.00 ? 2   ILE A CA   3  
ATOM 4717  C C    . ILE A 1 2   ? 1.180   -1.885  -4.446  1.00 0.00 ? 2   ILE A C    3  
ATOM 4718  O O    . ILE A 1 2   ? 1.445   -0.711  -4.702  1.00 0.00 ? 2   ILE A O    3  
ATOM 4719  C CB   . ILE A 1 2   ? -1.269  -2.421  -3.917  1.00 0.00 ? 2   ILE A CB   3  
ATOM 4720  C CG1  . ILE A 1 2   ? -2.028  -3.482  -3.118  1.00 0.00 ? 2   ILE A CG1  3  
ATOM 4721  C CG2  . ILE A 1 2   ? -1.242  -2.740  -5.413  1.00 0.00 ? 2   ILE A CG2  3  
ATOM 4722  C CD1  . ILE A 1 2   ? -3.534  -3.212  -3.141  1.00 0.00 ? 2   ILE A CD1  3  
ATOM 4723  H H    . ILE A 1 2   ? -0.327  -0.369  -2.571  1.00 0.00 ? 2   ILE A H    3  
ATOM 4724  H HA   . ILE A 1 2   ? 0.440   -3.173  -2.903  1.00 0.00 ? 2   ILE A HA   3  
ATOM 4725  H HB   . ILE A 1 2   ? -1.808  -1.481  -3.799  1.00 0.00 ? 2   ILE A HB   3  
ATOM 4726  H HG12 . ILE A 1 2   ? -1.825  -4.469  -3.534  1.00 0.00 ? 2   ILE A HG12 3  
ATOM 4727  H HG13 . ILE A 1 2   ? -1.671  -3.490  -2.088  1.00 0.00 ? 2   ILE A HG13 3  
ATOM 4728  H HG21 . ILE A 1 2   ? -0.608  -3.610  -5.588  1.00 0.00 ? 2   ILE A HG21 3  
ATOM 4729  H HG22 . ILE A 1 2   ? -2.254  -2.954  -5.758  1.00 0.00 ? 2   ILE A HG22 3  
ATOM 4730  H HG23 . ILE A 1 2   ? -0.844  -1.886  -5.961  1.00 0.00 ? 2   ILE A HG23 3  
ATOM 4731  H HD11 . ILE A 1 2   ? -3.716  -2.150  -2.979  1.00 0.00 ? 2   ILE A HD11 3  
ATOM 4732  H HD12 . ILE A 1 2   ? -3.941  -3.508  -4.108  1.00 0.00 ? 2   ILE A HD12 3  
ATOM 4733  H HD13 . ILE A 1 2   ? -4.018  -3.787  -2.352  1.00 0.00 ? 2   ILE A HD13 3  
ATOM 4734  N N    . VAL A 1 3   ? 1.735   -2.927  -5.047  1.00 0.00 ? 3   VAL A N    3  
ATOM 4735  C CA   . VAL A 1 3   ? 2.733   -2.747  -6.089  1.00 0.00 ? 3   VAL A CA   3  
ATOM 4736  C C    . VAL A 1 3   ? 2.593   -3.867  -7.122  1.00 0.00 ? 3   VAL A C    3  
ATOM 4737  O O    . VAL A 1 3   ? 1.966   -4.890  -6.852  1.00 0.00 ? 3   VAL A O    3  
ATOM 4738  C CB   . VAL A 1 3   ? 4.130   -2.676  -5.469  1.00 0.00 ? 3   VAL A CB   3  
ATOM 4739  C CG1  . VAL A 1 3   ? 4.185   -1.623  -4.361  1.00 0.00 ? 3   VAL A CG1  3  
ATOM 4740  C CG2  . VAL A 1 3   ? 4.567   -4.045  -4.947  1.00 0.00 ? 3   VAL A CG2  3  
ATOM 4741  H H    . VAL A 1 3   ? 1.515   -3.879  -4.833  1.00 0.00 ? 3   VAL A H    3  
ATOM 4742  H HA   . VAL A 1 3   ? 2.531   -1.793  -6.576  1.00 0.00 ? 3   VAL A HA   3  
ATOM 4743  H HB   . VAL A 1 3   ? 4.829   -2.377  -6.250  1.00 0.00 ? 3   VAL A HB   3  
ATOM 4744  H HG11 . VAL A 1 3   ? 3.911   -0.651  -4.770  1.00 0.00 ? 3   VAL A HG11 3  
ATOM 4745  H HG12 . VAL A 1 3   ? 3.489   -1.893  -3.567  1.00 0.00 ? 3   VAL A HG12 3  
ATOM 4746  H HG13 . VAL A 1 3   ? 5.196   -1.575  -3.956  1.00 0.00 ? 3   VAL A HG13 3  
ATOM 4747  H HG21 . VAL A 1 3   ? 4.177   -4.826  -5.599  1.00 0.00 ? 3   VAL A HG21 3  
ATOM 4748  H HG22 . VAL A 1 3   ? 5.656   -4.097  -4.930  1.00 0.00 ? 3   VAL A HG22 3  
ATOM 4749  H HG23 . VAL A 1 3   ? 4.182   -4.190  -3.936  1.00 0.00 ? 3   VAL A HG23 3  
ATOM 4750  N N    . GLN A 1 4   ? 3.188   -3.634  -8.283  1.00 0.00 ? 4   GLN A N    3  
ATOM 4751  C CA   . GLN A 1 4   ? 3.138   -4.611  -9.358  1.00 0.00 ? 4   GLN A CA   3  
ATOM 4752  C C    . GLN A 1 4   ? 4.477   -5.342  -9.474  1.00 0.00 ? 4   GLN A C    3  
ATOM 4753  O O    . GLN A 1 4   ? 5.492   -4.735  -9.810  1.00 0.00 ? 4   GLN A O    3  
ATOM 4754  C CB   . GLN A 1 4   ? 2.759   -3.948  -10.684 1.00 0.00 ? 4   GLN A CB   3  
ATOM 4755  C CG   . GLN A 1 4   ? 2.108   -4.955  -11.635 1.00 0.00 ? 4   GLN A CG   3  
ATOM 4756  C CD   . GLN A 1 4   ? 1.481   -4.248  -12.837 1.00 0.00 ? 4   GLN A CD   3  
ATOM 4757  O OE1  . GLN A 1 4   ? 2.158   -3.788  -13.743 1.00 0.00 ? 4   GLN A OE1  3  
ATOM 4758  N NE2  . GLN A 1 4   ? 0.153   -4.186  -12.797 1.00 0.00 ? 4   GLN A NE2  3  
ATOM 4759  H H    . GLN A 1 4   ? 3.696   -2.799  -8.494  1.00 0.00 ? 4   GLN A H    3  
ATOM 4760  H HA   . GLN A 1 4   ? 2.355   -5.315  -9.073  1.00 0.00 ? 4   GLN A HA   3  
ATOM 4761  H HB2  . GLN A 1 4   ? 2.072   -3.122  -10.498 1.00 0.00 ? 4   GLN A HB2  3  
ATOM 4762  H HB3  . GLN A 1 4   ? 3.648   -3.524  -11.150 1.00 0.00 ? 4   GLN A HB3  3  
ATOM 4763  H HG2  . GLN A 1 4   ? 2.855   -5.671  -11.978 1.00 0.00 ? 4   GLN A HG2  3  
ATOM 4764  H HG3  . GLN A 1 4   ? 1.345   -5.522  -11.102 1.00 0.00 ? 4   GLN A HG3  3  
ATOM 4765  H HE21 . GLN A 1 4   ? -0.343  -4.585  -12.025 1.00 0.00 ? 4   GLN A HE21 3  
ATOM 4766  H HE22 . GLN A 1 4   ? -0.350  -3.743  -13.539 1.00 0.00 ? 4   GLN A HE22 3  
ATOM 4767  N N    . ASN A 1 5   ? 4.435   -6.635  -9.189  1.00 0.00 ? 5   ASN A N    3  
ATOM 4768  C CA   . ASN A 1 5   ? 5.632   -7.455  -9.257  1.00 0.00 ? 5   ASN A CA   3  
ATOM 4769  C C    . ASN A 1 5   ? 6.387   -7.142  -10.550 1.00 0.00 ? 5   ASN A C    3  
ATOM 4770  O O    . ASN A 1 5   ? 5.863   -6.460  -11.429 1.00 0.00 ? 5   ASN A O    3  
ATOM 4771  C CB   . ASN A 1 5   ? 5.280   -8.945  -9.263  1.00 0.00 ? 5   ASN A CB   3  
ATOM 4772  C CG   . ASN A 1 5   ? 5.227   -9.501  -7.839  1.00 0.00 ? 5   ASN A CG   3  
ATOM 4773  O OD1  . ASN A 1 5   ? 6.233   -9.662  -7.169  1.00 0.00 ? 5   ASN A OD1  3  
ATOM 4774  N ND2  . ASN A 1 5   ? 3.998   -9.785  -7.415  1.00 0.00 ? 5   ASN A ND2  3  
ATOM 4775  H H    . ASN A 1 5   ? 3.604   -7.121  -8.916  1.00 0.00 ? 5   ASN A H    3  
ATOM 4776  H HA   . ASN A 1 5   ? 6.207   -7.198  -8.366  1.00 0.00 ? 5   ASN A HA   3  
ATOM 4777  H HB2  . ASN A 1 5   ? 4.317   -9.092  -9.752  1.00 0.00 ? 5   ASN A HB2  3  
ATOM 4778  H HB3  . ASN A 1 5   ? 6.021   -9.494  -9.844  1.00 0.00 ? 5   ASN A HB3  3  
ATOM 4779  H HD21 . ASN A 1 5   ? 3.214   -9.629  -8.016  1.00 0.00 ? 5   ASN A HD21 3  
ATOM 4780  H HD22 . ASN A 1 5   ? 3.859   -10.155 -6.497  1.00 0.00 ? 5   ASN A HD22 3  
ATOM 4781  N N    . LEU A 1 6   ? 7.606   -7.656  -10.626 1.00 0.00 ? 6   LEU A N    3  
ATOM 4782  C CA   . LEU A 1 6   ? 8.438   -7.440  -11.797 1.00 0.00 ? 6   LEU A CA   3  
ATOM 4783  C C    . LEU A 1 6   ? 7.819   -8.160  -12.997 1.00 0.00 ? 6   LEU A C    3  
ATOM 4784  O O    . LEU A 1 6   ? 7.568   -7.545  -14.033 1.00 0.00 ? 6   LEU A O    3  
ATOM 4785  C CB   . LEU A 1 6   ? 9.883   -7.853  -11.511 1.00 0.00 ? 6   LEU A CB   3  
ATOM 4786  C CG   . LEU A 1 6   ? 10.556  -7.160  -10.325 1.00 0.00 ? 6   LEU A CG   3  
ATOM 4787  C CD1  . LEU A 1 6   ? 10.500  -8.040  -9.073  1.00 0.00 ? 6   LEU A CD1  3  
ATOM 4788  C CD2  . LEU A 1 6   ? 11.988  -6.747  -10.671 1.00 0.00 ? 6   LEU A CD2  3  
ATOM 4789  H H    . LEU A 1 6   ? 8.025   -8.210  -9.906  1.00 0.00 ? 6   LEU A H    3  
ATOM 4790  H HA   . LEU A 1 6   ? 8.443   -6.369  -12.002 1.00 0.00 ? 6   LEU A HA   3  
ATOM 4791  H HB2  . LEU A 1 6   ? 9.906   -8.929  -11.340 1.00 0.00 ? 6   LEU A HB2  3  
ATOM 4792  H HB3  . LEU A 1 6   ? 10.479  -7.660  -12.404 1.00 0.00 ? 6   LEU A HB3  3  
ATOM 4793  H HG   . LEU A 1 6   ? 10.003  -6.249  -10.103 1.00 0.00 ? 6   LEU A HG   3  
ATOM 4794  H HD11 . LEU A 1 6   ? 10.428  -9.086  -9.368  1.00 0.00 ? 6   LEU A HD11 3  
ATOM 4795  H HD12 . LEU A 1 6   ? 11.404  -7.889  -8.483  1.00 0.00 ? 6   LEU A HD12 3  
ATOM 4796  H HD13 . LEU A 1 6   ? 9.628   -7.768  -8.478  1.00 0.00 ? 6   LEU A HD13 3  
ATOM 4797  H HD21 . LEU A 1 6   ? 12.546  -7.620  -11.012 1.00 0.00 ? 6   LEU A HD21 3  
ATOM 4798  H HD22 . LEU A 1 6   ? 11.969  -5.997  -11.461 1.00 0.00 ? 6   LEU A HD22 3  
ATOM 4799  H HD23 . LEU A 1 6   ? 12.470  -6.332  -9.786  1.00 0.00 ? 6   LEU A HD23 3  
ATOM 4800  N N    . GLN A 1 7   ? 7.589   -9.452  -12.817 1.00 0.00 ? 7   GLN A N    3  
ATOM 4801  C CA   . GLN A 1 7   ? 7.005   -10.262 -13.873 1.00 0.00 ? 7   GLN A CA   3  
ATOM 4802  C C    . GLN A 1 7   ? 5.694   -9.637  -14.357 1.00 0.00 ? 7   GLN A C    3  
ATOM 4803  O O    . GLN A 1 7   ? 5.570   -9.277  -15.526 1.00 0.00 ? 7   GLN A O    3  
ATOM 4804  C CB   . GLN A 1 7   ? 6.784   -11.701 -13.401 1.00 0.00 ? 7   GLN A CB   3  
ATOM 4805  C CG   . GLN A 1 7   ? 8.098   -12.333 -12.937 1.00 0.00 ? 7   GLN A CG   3  
ATOM 4806  C CD   . GLN A 1 7   ? 9.214   -12.084 -13.953 1.00 0.00 ? 7   GLN A CD   3  
ATOM 4807  O OE1  . GLN A 1 7   ? 9.423   -12.846 -14.882 1.00 0.00 ? 7   GLN A OE1  3  
ATOM 4808  N NE2  . GLN A 1 7   ? 9.919   -10.980 -13.723 1.00 0.00 ? 7   GLN A NE2  3  
ATOM 4809  H H    . GLN A 1 7   ? 7.797   -9.945  -11.972 1.00 0.00 ? 7   GLN A H    3  
ATOM 4810  H HA   . GLN A 1 7   ? 7.737   -10.259 -14.680 1.00 0.00 ? 7   GLN A HA   3  
ATOM 4811  H HB2  . GLN A 1 7   ? 6.062   -11.713 -12.585 1.00 0.00 ? 7   GLN A HB2  3  
ATOM 4812  H HB3  . GLN A 1 7   ? 6.358   -12.292 -14.212 1.00 0.00 ? 7   GLN A HB3  3  
ATOM 4813  H HG2  . GLN A 1 7   ? 8.383   -11.919 -11.969 1.00 0.00 ? 7   GLN A HG2  3  
ATOM 4814  H HG3  . GLN A 1 7   ? 7.960   -13.405 -12.797 1.00 0.00 ? 7   GLN A HG3  3  
ATOM 4815  H HE21 . GLN A 1 7   ? 9.696   -10.399 -12.941 1.00 0.00 ? 7   GLN A HE21 3  
ATOM 4816  H HE22 . GLN A 1 7   ? 10.672  -10.732 -14.333 1.00 0.00 ? 7   GLN A HE22 3  
ATOM 4817  N N    . GLY A 1 8   ? 4.751   -9.528  -13.433 1.00 0.00 ? 8   GLY A N    3  
ATOM 4818  C CA   . GLY A 1 8   ? 3.456   -8.953  -13.751 1.00 0.00 ? 8   GLY A CA   3  
ATOM 4819  C C    . GLY A 1 8   ? 2.361   -9.537  -12.855 1.00 0.00 ? 8   GLY A C    3  
ATOM 4820  O O    . GLY A 1 8   ? 1.507   -10.289 -13.321 1.00 0.00 ? 8   GLY A O    3  
ATOM 4821  H H    . GLY A 1 8   ? 4.860   -9.824  -12.484 1.00 0.00 ? 8   GLY A H    3  
ATOM 4822  H HA2  . GLY A 1 8   ? 3.493   -7.870  -13.627 1.00 0.00 ? 8   GLY A HA2  3  
ATOM 4823  H HA3  . GLY A 1 8   ? 3.215   -9.145  -14.796 1.00 0.00 ? 8   GLY A HA3  3  
ATOM 4824  N N    . GLN A 1 9   ? 2.423   -9.167  -11.583 1.00 0.00 ? 9   GLN A N    3  
ATOM 4825  C CA   . GLN A 1 9   ? 1.448   -9.645  -10.617 1.00 0.00 ? 9   GLN A CA   3  
ATOM 4826  C C    . GLN A 1 9   ? 1.231   -8.600  -9.521  1.00 0.00 ? 9   GLN A C    3  
ATOM 4827  O O    . GLN A 1 9   ? 2.178   -8.190  -8.852  1.00 0.00 ? 9   GLN A O    3  
ATOM 4828  C CB   . GLN A 1 9   ? 1.880   -10.985 -10.019 1.00 0.00 ? 9   GLN A CB   3  
ATOM 4829  C CG   . GLN A 1 9   ? 1.359   -12.153 -10.857 1.00 0.00 ? 9   GLN A CG   3  
ATOM 4830  C CD   . GLN A 1 9   ? -0.148  -12.339 -10.661 1.00 0.00 ? 9   GLN A CD   3  
ATOM 4831  O OE1  . GLN A 1 9   ? -0.964  -11.823 -11.407 1.00 0.00 ? 9   GLN A OE1  3  
ATOM 4832  N NE2  . GLN A 1 9   ? -0.469  -13.101 -9.620  1.00 0.00 ? 9   GLN A NE2  3  
ATOM 4833  H H    . GLN A 1 9   ? 3.121   -8.555  -11.212 1.00 0.00 ? 9   GLN A H    3  
ATOM 4834  H HA   . GLN A 1 9   ? 0.527   -9.787  -11.182 1.00 0.00 ? 9   GLN A HA   3  
ATOM 4835  H HB2  . GLN A 1 9   ? 2.968   -11.029 -9.964  1.00 0.00 ? 9   GLN A HB2  3  
ATOM 4836  H HB3  . GLN A 1 9   ? 1.507   -11.069 -8.998  1.00 0.00 ? 9   GLN A HB3  3  
ATOM 4837  H HG2  . GLN A 1 9   ? 1.573   -11.974 -11.911 1.00 0.00 ? 9   GLN A HG2  3  
ATOM 4838  H HG3  . GLN A 1 9   ? 1.881   -13.068 -10.576 1.00 0.00 ? 9   GLN A HG3  3  
ATOM 4839  H HE21 . GLN A 1 9   ? 0.250   -13.494 -9.047  1.00 0.00 ? 9   GLN A HE21 3  
ATOM 4840  H HE22 . GLN A 1 9   ? -1.430  -13.281 -9.409  1.00 0.00 ? 9   GLN A HE22 3  
ATOM 4841  N N    . MET A 1 10  ? -0.022  -8.198  -9.372  1.00 0.00 ? 10  MET A N    3  
ATOM 4842  C CA   . MET A 1 10  ? -0.376  -7.208  -8.368  1.00 0.00 ? 10  MET A CA   3  
ATOM 4843  C C    . MET A 1 10  ? -0.435  -7.836  -6.975  1.00 0.00 ? 10  MET A C    3  
ATOM 4844  O O    . MET A 1 10  ? -1.264  -8.709  -6.717  1.00 0.00 ? 10  MET A O    3  
ATOM 4845  C CB   . MET A 1 10  ? -1.738  -6.598  -8.711  1.00 0.00 ? 10  MET A CB   3  
ATOM 4846  C CG   . MET A 1 10  ? -1.613  -5.587  -9.853  1.00 0.00 ? 10  MET A CG   3  
ATOM 4847  S SD   . MET A 1 10  ? -2.391  -4.048  -9.394  1.00 0.00 ? 10  MET A SD   3  
ATOM 4848  C CE   . MET A 1 10  ? -0.953  -3.104  -8.919  1.00 0.00 ? 10  MET A CE   3  
ATOM 4849  H H    . MET A 1 10  ? -0.788  -8.535  -9.920  1.00 0.00 ? 10  MET A H    3  
ATOM 4850  H HA   . MET A 1 10  ? 0.414   -6.460  -8.404  1.00 0.00 ? 10  MET A HA   3  
ATOM 4851  H HB2  . MET A 1 10  ? -2.433  -7.387  -8.992  1.00 0.00 ? 10  MET A HB2  3  
ATOM 4852  H HB3  . MET A 1 10  ? -2.151  -6.107  -7.830  1.00 0.00 ? 10  MET A HB3  3  
ATOM 4853  H HG2  . MET A 1 10  ? -0.563  -5.418  -10.087 1.00 0.00 ? 10  MET A HG2  3  
ATOM 4854  H HG3  . MET A 1 10  ? -2.080  -5.987  -10.754 1.00 0.00 ? 10  MET A HG3  3  
ATOM 4855  H HE1  . MET A 1 10  ? -0.223  -3.121  -9.730  1.00 0.00 ? 10  MET A HE1  3  
ATOM 4856  H HE2  . MET A 1 10  ? -1.245  -2.074  -8.716  1.00 0.00 ? 10  MET A HE2  3  
ATOM 4857  H HE3  . MET A 1 10  ? -0.510  -3.540  -8.023  1.00 0.00 ? 10  MET A HE3  3  
ATOM 4858  N N    . VAL A 1 11  ? 0.456   -7.369  -6.112  1.00 0.00 ? 11  VAL A N    3  
ATOM 4859  C CA   . VAL A 1 11  ? 0.516   -7.874  -4.751  1.00 0.00 ? 11  VAL A CA   3  
ATOM 4860  C C    . VAL A 1 11  ? 0.817   -6.718  -3.796  1.00 0.00 ? 11  VAL A C    3  
ATOM 4861  O O    . VAL A 1 11  ? 1.406   -5.715  -4.195  1.00 0.00 ? 11  VAL A O    3  
ATOM 4862  C CB   . VAL A 1 11  ? 1.539   -9.008  -4.659  1.00 0.00 ? 11  VAL A CB   3  
ATOM 4863  C CG1  . VAL A 1 11  ? 1.151   -10.173 -5.572  1.00 0.00 ? 11  VAL A CG1  3  
ATOM 4864  C CG2  . VAL A 1 11  ? 2.947   -8.504  -4.982  1.00 0.00 ? 11  VAL A CG2  3  
ATOM 4865  H H    . VAL A 1 11  ? 1.126   -6.660  -6.330  1.00 0.00 ? 11  VAL A H    3  
ATOM 4866  H HA   . VAL A 1 11  ? -0.464  -8.284  -4.508  1.00 0.00 ? 11  VAL A HA   3  
ATOM 4867  H HB   . VAL A 1 11  ? 1.543   -9.374  -3.632  1.00 0.00 ? 11  VAL A HB   3  
ATOM 4868  H HG11 . VAL A 1 11  ? 0.959   -9.798  -6.577  1.00 0.00 ? 11  VAL A HG11 3  
ATOM 4869  H HG12 . VAL A 1 11  ? 1.965   -10.897 -5.603  1.00 0.00 ? 11  VAL A HG12 3  
ATOM 4870  H HG13 . VAL A 1 11  ? 0.252   -10.653 -5.186  1.00 0.00 ? 11  VAL A HG13 3  
ATOM 4871  H HG21 . VAL A 1 11  ? 3.167   -7.626  -4.374  1.00 0.00 ? 11  VAL A HG21 3  
ATOM 4872  H HG22 . VAL A 1 11  ? 3.673   -9.287  -4.765  1.00 0.00 ? 11  VAL A HG22 3  
ATOM 4873  H HG23 . VAL A 1 11  ? 3.004   -8.238  -6.038  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 4874  N N    . HIS A 1 12  ? 0.399   -6.897  -2.551  1.00 0.00 ? 12  HIS A N    3  
ATOM 4875  C CA   . HIS A 1 12  ? 0.617   -5.881  -1.535  1.00 0.00 ? 12  HIS A CA   3  
ATOM 4876  C C    . HIS A 1 12  ? 1.910   -6.183  -0.776  1.00 0.00 ? 12  HIS A C    3  
ATOM 4877  O O    . HIS A 1 12  ? 2.354   -7.329  -0.729  1.00 0.00 ? 12  HIS A O    3  
ATOM 4878  C CB   . HIS A 1 12  ? -0.599  -5.767  -0.613  1.00 0.00 ? 12  HIS A CB   3  
ATOM 4879  C CG   . HIS A 1 12  ? -0.771  -6.938  0.324   1.00 0.00 ? 12  HIS A CG   3  
ATOM 4880  N ND1  . HIS A 1 12  ? 0.167   -7.272  1.287   1.00 0.00 ? 12  HIS A ND1  3  
ATOM 4881  C CD2  . HIS A 1 12  ? -1.780  -7.848  0.438   1.00 0.00 ? 12  HIS A CD2  3  
ATOM 4882  C CE1  . HIS A 1 12  ? -0.270  -8.338  1.943   1.00 0.00 ? 12  HIS A CE1  3  
ATOM 4883  N NE2  . HIS A 1 12  ? -1.476  -8.694  1.415   1.00 0.00 ? 12  HIS A NE2  3  
ATOM 4884  H H    . HIS A 1 12  ? -0.079  -7.716  -2.234  1.00 0.00 ? 12  HIS A H    3  
ATOM 4885  H HA   . HIS A 1 12  ? 0.726   -4.932  -2.060  1.00 0.00 ? 12  HIS A HA   3  
ATOM 4886  H HB2  . HIS A 1 12  ? -0.511  -4.854  -0.024  1.00 0.00 ? 12  HIS A HB2  3  
ATOM 4887  H HB3  . HIS A 1 12  ? -1.497  -5.667  -1.222  1.00 0.00 ? 12  HIS A HB3  3  
ATOM 4888  H HD1  . HIS A 1 12  ? 1.027   -6.792  1.459   1.00 0.00 ? 12  HIS A HD1  3  
ATOM 4889  H HD2  . HIS A 1 12  ? -2.684  -7.877  -0.171  1.00 0.00 ? 12  HIS A HD2  3  
ATOM 4890  H HE1  . HIS A 1 12  ? 0.245   -8.842  2.761   1.00 0.00 ? 12  HIS A HE1  3  
ATOM 4891  H HE2  . HIS A 1 12  ? -2.063  -9.430  1.752   1.00 0.00 ? 12  HIS A HE2  3  
ATOM 4892  N N    . GLN A 1 13  ? 2.479   -5.134  -0.202  1.00 0.00 ? 13  GLN A N    3  
ATOM 4893  C CA   . GLN A 1 13  ? 3.714   -5.272  0.553   1.00 0.00 ? 13  GLN A CA   3  
ATOM 4894  C C    . GLN A 1 13  ? 3.619   -4.501  1.871   1.00 0.00 ? 13  GLN A C    3  
ATOM 4895  O O    . GLN A 1 13  ? 4.550   -3.792  2.247   1.00 0.00 ? 13  GLN A O    3  
ATOM 4896  C CB   . GLN A 1 13  ? 4.915   -4.804  -0.271  1.00 0.00 ? 13  GLN A CB   3  
ATOM 4897  C CG   . GLN A 1 13  ? 4.970   -5.525  -1.619  1.00 0.00 ? 13  GLN A CG   3  
ATOM 4898  C CD   . GLN A 1 13  ? 6.082   -4.953  -2.501  1.00 0.00 ? 13  GLN A CD   3  
ATOM 4899  O OE1  . GLN A 1 13  ? 6.940   -5.662  -3.000  1.00 0.00 ? 13  GLN A OE1  3  
ATOM 4900  N NE2  . GLN A 1 13  ? 6.018   -3.635  -2.667  1.00 0.00 ? 13  GLN A NE2  3  
ATOM 4901  H H    . GLN A 1 13  ? 2.113   -4.205  -0.244  1.00 0.00 ? 13  GLN A H    3  
ATOM 4902  H HA   . GLN A 1 13  ? 3.813   -6.339  0.753   1.00 0.00 ? 13  GLN A HA   3  
ATOM 4903  H HB2  . GLN A 1 13  ? 4.853   -3.728  -0.432  1.00 0.00 ? 13  GLN A HB2  3  
ATOM 4904  H HB3  . GLN A 1 13  ? 5.836   -4.990  0.282   1.00 0.00 ? 13  GLN A HB3  3  
ATOM 4905  H HG2  . GLN A 1 13  ? 5.137   -6.589  -1.460  1.00 0.00 ? 13  GLN A HG2  3  
ATOM 4906  H HG3  . GLN A 1 13  ? 4.010   -5.425  -2.128  1.00 0.00 ? 13  GLN A HG3  3  
ATOM 4907  H HE21 . GLN A 1 13  ? 5.287   -3.111  -2.230  1.00 0.00 ? 13  GLN A HE21 3  
ATOM 4908  H HE22 . GLN A 1 13  ? 6.702   -3.167  -3.228  1.00 0.00 ? 13  GLN A HE22 3  
ATOM 4909  N N    . ALA A 1 14  ? 2.487   -4.668  2.537   1.00 0.00 ? 14  ALA A N    3  
ATOM 4910  C CA   . ALA A 1 14  ? 2.259   -3.998  3.806   1.00 0.00 ? 14  ALA A CA   3  
ATOM 4911  C C    . ALA A 1 14  ? 2.628   -2.519  3.669   1.00 0.00 ? 14  ALA A C    3  
ATOM 4912  O O    . ALA A 1 14  ? 2.953   -2.055  2.578   1.00 0.00 ? 14  ALA A O    3  
ATOM 4913  C CB   . ALA A 1 14  ? 3.058   -4.699  4.905   1.00 0.00 ? 14  ALA A CB   3  
ATOM 4914  H H    . ALA A 1 14  ? 1.734   -5.248  2.224   1.00 0.00 ? 14  ALA A H    3  
ATOM 4915  H HA   . ALA A 1 14  ? 1.196   -4.078  4.037   1.00 0.00 ? 14  ALA A HA   3  
ATOM 4916  H HB1  . ALA A 1 14  ? 3.944   -5.161  4.471   1.00 0.00 ? 14  ALA A HB1  3  
ATOM 4917  H HB2  . ALA A 1 14  ? 2.439   -5.467  5.371   1.00 0.00 ? 14  ALA A HB2  3  
ATOM 4918  H HB3  . ALA A 1 14  ? 3.359   -3.970  5.657   1.00 0.00 ? 14  ALA A HB3  3  
ATOM 4919  N N    . ILE A 1 15  ? 2.566   -1.821  4.794   1.00 0.00 ? 15  ILE A N    3  
ATOM 4920  C CA   . ILE A 1 15  ? 2.890   -0.405  4.814   1.00 0.00 ? 15  ILE A CA   3  
ATOM 4921  C C    . ILE A 1 15  ? 4.396   -0.233  5.020   1.00 0.00 ? 15  ILE A C    3  
ATOM 4922  O O    . ILE A 1 15  ? 5.139   -1.214  5.039   1.00 0.00 ? 15  ILE A O    3  
ATOM 4923  C CB   . ILE A 1 15  ? 2.039   0.325   5.855   1.00 0.00 ? 15  ILE A CB   3  
ATOM 4924  C CG1  . ILE A 1 15  ? 1.801   1.780   5.446   1.00 0.00 ? 15  ILE A CG1  3  
ATOM 4925  C CG2  . ILE A 1 15  ? 2.665   0.216   7.247   1.00 0.00 ? 15  ILE A CG2  3  
ATOM 4926  C CD1  . ILE A 1 15  ? 0.369   2.213   5.769   1.00 0.00 ? 15  ILE A CD1  3  
ATOM 4927  H H    . ILE A 1 15  ? 2.301   -2.206  5.678   1.00 0.00 ? 15  ILE A H    3  
ATOM 4928  H HA   . ILE A 1 15  ? 2.627   0.005   3.838   1.00 0.00 ? 15  ILE A HA   3  
ATOM 4929  H HB   . ILE A 1 15  ? 1.065   -0.160  5.901   1.00 0.00 ? 15  ILE A HB   3  
ATOM 4930  H HG12 . ILE A 1 15  ? 2.506   2.429   5.966   1.00 0.00 ? 15  ILE A HG12 3  
ATOM 4931  H HG13 . ILE A 1 15  ? 1.988   1.897   4.379   1.00 0.00 ? 15  ILE A HG13 3  
ATOM 4932  H HG21 . ILE A 1 15  ? 3.358   -0.624  7.269   1.00 0.00 ? 15  ILE A HG21 3  
ATOM 4933  H HG22 . ILE A 1 15  ? 3.203   1.137   7.477   1.00 0.00 ? 15  ILE A HG22 3  
ATOM 4934  H HG23 . ILE A 1 15  ? 1.879   0.061   7.987   1.00 0.00 ? 15  ILE A HG23 3  
ATOM 4935  H HD11 . ILE A 1 15  ? -0.289  1.344   5.735   1.00 0.00 ? 15  ILE A HD11 3  
ATOM 4936  H HD12 . ILE A 1 15  ? 0.339   2.654   6.765   1.00 0.00 ? 15  ILE A HD12 3  
ATOM 4937  H HD13 . ILE A 1 15  ? 0.038   2.948   5.035   1.00 0.00 ? 15  ILE A HD13 3  
ATOM 4938  N N    . SER A 1 16  ? 4.803   1.019   5.172   1.00 0.00 ? 16  SER A N    3  
ATOM 4939  C CA   . SER A 1 16  ? 6.207   1.331   5.376   1.00 0.00 ? 16  SER A CA   3  
ATOM 4940  C C    . SER A 1 16  ? 6.378   2.159   6.651   1.00 0.00 ? 16  SER A C    3  
ATOM 4941  O O    . SER A 1 16  ? 5.490   2.926   7.022   1.00 0.00 ? 16  SER A O    3  
ATOM 4942  C CB   . SER A 1 16  ? 6.785   2.081   4.174   1.00 0.00 ? 16  SER A CB   3  
ATOM 4943  O OG   . SER A 1 16  ? 8.044   2.677   4.473   1.00 0.00 ? 16  SER A OG   3  
ATOM 4944  H H    . SER A 1 16  ? 4.191   1.810   5.155   1.00 0.00 ? 16  SER A H    3  
ATOM 4945  H HA   . SER A 1 16  ? 6.705   0.367   5.477   1.00 0.00 ? 16  SER A HA   3  
ATOM 4946  H HB2  . SER A 1 16  ? 6.900   1.391   3.337   1.00 0.00 ? 16  SER A HB2  3  
ATOM 4947  H HB3  . SER A 1 16  ? 6.085   2.854   3.857   1.00 0.00 ? 16  SER A HB3  3  
ATOM 4948  H HG   . SER A 1 16  ? 7.986   3.189   5.330   1.00 0.00 ? 16  SER A HG   3  
ATOM 4949  N N    . PRO A 1 17  ? 7.556   1.971   7.304   1.00 0.00 ? 17  PRO A N    3  
ATOM 4950  C CA   . PRO A 1 17  ? 7.855   2.692   8.530   1.00 0.00 ? 17  PRO A CA   3  
ATOM 4951  C C    . PRO A 1 17  ? 8.211   4.151   8.236   1.00 0.00 ? 17  PRO A C    3  
ATOM 4952  O O    . PRO A 1 17  ? 7.788   5.054   8.955   1.00 0.00 ? 17  PRO A O    3  
ATOM 4953  C CB   . PRO A 1 17  ? 8.996   1.920   9.172   1.00 0.00 ? 17  PRO A CB   3  
ATOM 4954  C CG   . PRO A 1 17  ? 9.602   1.074   8.064   1.00 0.00 ? 17  PRO A CG   3  
ATOM 4955  C CD   . PRO A 1 17  ? 8.630   1.071   6.895   1.00 0.00 ? 17  PRO A CD   3  
ATOM 4956  H HA   . PRO A 1 17  ? 7.049   2.721   9.121   1.00 0.00 ? 17  PRO A HA   3  
ATOM 4957  H HB2  . PRO A 1 17  ? 9.738   2.598   9.594   1.00 0.00 ? 17  PRO A HB2  3  
ATOM 4958  H HB3  . PRO A 1 17  ? 8.635   1.295   9.988   1.00 0.00 ? 17  PRO A HB3  3  
ATOM 4959  H HG2  . PRO A 1 17  ? 10.566  1.479   7.757   1.00 0.00 ? 17  PRO A HG2  3  
ATOM 4960  H HG3  . PRO A 1 17  ? 9.780   0.057   8.414   1.00 0.00 ? 17  PRO A HG3  3  
ATOM 4961  H HD2  . PRO A 1 17  ? 9.111   1.419   5.980   1.00 0.00 ? 17  PRO A HD2  3  
ATOM 4962  H HD3  . PRO A 1 17  ? 8.252   0.069   6.695   1.00 0.00 ? 17  PRO A HD3  3  
ATOM 4963  N N    . ARG A 1 18  ? 8.987   4.335   7.177   1.00 0.00 ? 18  ARG A N    3  
ATOM 4964  C CA   . ARG A 1 18  ? 9.404   5.668   6.779   1.00 0.00 ? 18  ARG A CA   3  
ATOM 4965  C C    . ARG A 1 18  ? 8.185   6.525   6.429   1.00 0.00 ? 18  ARG A C    3  
ATOM 4966  O O    . ARG A 1 18  ? 8.171   7.727   6.686   1.00 0.00 ? 18  ARG A O    3  
ATOM 4967  C CB   . ARG A 1 18  ? 10.344  5.614   5.573   1.00 0.00 ? 18  ARG A CB   3  
ATOM 4968  C CG   . ARG A 1 18  ? 11.691  6.262   5.898   1.00 0.00 ? 18  ARG A CG   3  
ATOM 4969  C CD   . ARG A 1 18  ? 12.839  5.506   5.224   1.00 0.00 ? 18  ARG A CD   3  
ATOM 4970  N NE   . ARG A 1 18  ? 14.136  6.094   5.626   1.00 0.00 ? 18  ARG A NE   3  
ATOM 4971  C CZ   . ARG A 1 18  ? 14.664  7.196   5.078   1.00 0.00 ? 18  ARG A CZ   3  
ATOM 4972  N NH1  . ARG A 1 18  ? 14.008  7.838   4.100   1.00 0.00 ? 18  ARG A NH1  3  
ATOM 4973  N NH2  . ARG A 1 18  ? 15.847  7.657   5.506   1.00 0.00 ? 18  ARG A NH2  3  
ATOM 4974  H H    . ARG A 1 18  ? 9.327   3.595   6.597   1.00 0.00 ? 18  ARG A H    3  
ATOM 4975  H HA   . ARG A 1 18  ? 9.928   6.068   7.648   1.00 0.00 ? 18  ARG A HA   3  
ATOM 4976  H HB2  . ARG A 1 18  ? 10.497  4.577   5.273   1.00 0.00 ? 18  ARG A HB2  3  
ATOM 4977  H HB3  . ARG A 1 18  ? 9.885   6.126   4.727   1.00 0.00 ? 18  ARG A HB3  3  
ATOM 4978  H HG2  . ARG A 1 18  ? 11.690  7.300   5.565   1.00 0.00 ? 18  ARG A HG2  3  
ATOM 4979  H HG3  . ARG A 1 18  ? 11.842  6.272   6.977   1.00 0.00 ? 18  ARG A HG3  3  
ATOM 4980  H HD2  . ARG A 1 18  ? 12.806  4.453   5.504   1.00 0.00 ? 18  ARG A HD2  3  
ATOM 4981  H HD3  . ARG A 1 18  ? 12.729  5.552   4.140   1.00 0.00 ? 18  ARG A HD3  3  
ATOM 4982  H HE   . ARG A 1 18  ? 14.652  5.639   6.352   1.00 0.00 ? 18  ARG A HE   3  
ATOM 4983  H HH11 . ARG A 1 18  ? 13.126  7.494   3.781   1.00 0.00 ? 18  ARG A HH11 3  
ATOM 4984  H HH12 . ARG A 1 18  ? 14.402  8.660   3.691   1.00 0.00 ? 18  ARG A HH12 3  
ATOM 4985  H HH21 . ARG A 1 18  ? 16.337  7.179   6.234   1.00 0.00 ? 18  ARG A HH21 3  
ATOM 4986  H HH22 . ARG A 1 18  ? 16.241  8.481   5.096   1.00 0.00 ? 18  ARG A HH22 3  
ATOM 4987  N N    . THR A 1 19  ? 7.191   5.870   5.847   1.00 0.00 ? 19  THR A N    3  
ATOM 4988  C CA   . THR A 1 19  ? 5.970   6.557   5.459   1.00 0.00 ? 19  THR A CA   3  
ATOM 4989  C C    . THR A 1 19  ? 5.137   6.904   6.695   1.00 0.00 ? 19  THR A C    3  
ATOM 4990  O O    . THR A 1 19  ? 4.803   8.067   6.914   1.00 0.00 ? 19  THR A O    3  
ATOM 4991  C CB   . THR A 1 19  ? 5.228   5.670   4.456   1.00 0.00 ? 19  THR A CB   3  
ATOM 4992  O OG1  . THR A 1 19  ? 5.278   6.408   3.237   1.00 0.00 ? 19  THR A OG1  3  
ATOM 4993  C CG2  . THR A 1 19  ? 3.733   5.562   4.764   1.00 0.00 ? 19  THR A CG2  3  
ATOM 4994  H H    . THR A 1 19  ? 7.209   4.892   5.640   1.00 0.00 ? 19  THR A H    3  
ATOM 4995  H HA   . THR A 1 19  ? 6.241   7.498   4.980   1.00 0.00 ? 19  THR A HA   3  
ATOM 4996  H HB   . THR A 1 19  ? 5.686   4.683   4.395   1.00 0.00 ? 19  THR A HB   3  
ATOM 4997  H HG1  . THR A 1 19  ? 6.228   6.534   2.953   1.00 0.00 ? 19  THR A HG1  3  
ATOM 4998  H HG21 . THR A 1 19  ? 3.325   6.557   4.943   1.00 0.00 ? 19  THR A HG21 3  
ATOM 4999  H HG22 . THR A 1 19  ? 3.220   5.105   3.917   1.00 0.00 ? 19  THR A HG22 3  
ATOM 5000  H HG23 . THR A 1 19  ? 3.588   4.946   5.651   1.00 0.00 ? 19  THR A HG23 3  
ATOM 5001  N N    . LEU A 1 20  ? 4.827   5.875   7.468   1.00 0.00 ? 20  LEU A N    3  
ATOM 5002  C CA   . LEU A 1 20  ? 4.041   6.056   8.676   1.00 0.00 ? 20  LEU A CA   3  
ATOM 5003  C C    . LEU A 1 20  ? 4.747   7.055   9.594   1.00 0.00 ? 20  LEU A C    3  
ATOM 5004  O O    . LEU A 1 20  ? 4.097   7.853   10.268  1.00 0.00 ? 20  LEU A O    3  
ATOM 5005  C CB   . LEU A 1 20  ? 3.756   4.707   9.339   1.00 0.00 ? 20  LEU A CB   3  
ATOM 5006  C CG   . LEU A 1 20  ? 2.548   3.937   8.801   1.00 0.00 ? 20  LEU A CG   3  
ATOM 5007  C CD1  . LEU A 1 20  ? 2.536   2.501   9.326   1.00 0.00 ? 20  LEU A CD1  3  
ATOM 5008  C CD2  . LEU A 1 20  ? 1.244   4.673   9.115   1.00 0.00 ? 20  LEU A CD2  3  
ATOM 5009  H H    . LEU A 1 20  ? 5.104   4.932   7.282   1.00 0.00 ? 20  LEU A H    3  
ATOM 5010  H HA   . LEU A 1 20  ? 3.081   6.479   8.380   1.00 0.00 ? 20  LEU A HA   3  
ATOM 5011  H HB2  . LEU A 1 20  ? 4.641   4.078   9.231   1.00 0.00 ? 20  LEU A HB2  3  
ATOM 5012  H HB3  . LEU A 1 20  ? 3.611   4.873   10.406  1.00 0.00 ? 20  LEU A HB3  3  
ATOM 5013  H HG   . LEU A 1 20  ? 2.634   3.883   7.716   1.00 0.00 ? 20  LEU A HG   3  
ATOM 5014  H HD11 . LEU A 1 20  ? 3.533   2.070   9.232   1.00 0.00 ? 20  LEU A HD11 3  
ATOM 5015  H HD12 . LEU A 1 20  ? 2.238   2.499   10.374  1.00 0.00 ? 20  LEU A HD12 3  
ATOM 5016  H HD13 . LEU A 1 20  ? 1.828   1.908   8.746   1.00 0.00 ? 20  LEU A HD13 3  
ATOM 5017  H HD21 . LEU A 1 20  ? 1.280   5.674   8.684   1.00 0.00 ? 20  LEU A HD21 3  
ATOM 5018  H HD22 . LEU A 1 20  ? 0.405   4.124   8.689   1.00 0.00 ? 20  LEU A HD22 3  
ATOM 5019  H HD23 . LEU A 1 20  ? 1.120   4.748   10.195  1.00 0.00 ? 20  LEU A HD23 3  
ATOM 5020  N N    . ASN A 1 21  ? 6.070   6.980   9.592   1.00 0.00 ? 21  ASN A N    3  
ATOM 5021  C CA   . ASN A 1 21  ? 6.873   7.868   10.416  1.00 0.00 ? 21  ASN A CA   3  
ATOM 5022  C C    . ASN A 1 21  ? 6.628   9.315   9.986   1.00 0.00 ? 21  ASN A C    3  
ATOM 5023  O O    . ASN A 1 21  ? 6.170   10.134  10.781  1.00 0.00 ? 21  ASN A O    3  
ATOM 5024  C CB   . ASN A 1 21  ? 8.365   7.571   10.254  1.00 0.00 ? 21  ASN A CB   3  
ATOM 5025  C CG   . ASN A 1 21  ? 9.199   8.410   11.223  1.00 0.00 ? 21  ASN A CG   3  
ATOM 5026  O OD1  . ASN A 1 21  ? 8.818   9.495   11.633  1.00 0.00 ? 21  ASN A OD1  3  
ATOM 5027  N ND2  . ASN A 1 21  ? 10.356  7.851   11.567  1.00 0.00 ? 21  ASN A ND2  3  
ATOM 5028  H H    . ASN A 1 21  ? 6.592   6.329   9.041   1.00 0.00 ? 21  ASN A H    3  
ATOM 5029  H HA   . ASN A 1 21  ? 6.551   7.676   11.439  1.00 0.00 ? 21  ASN A HA   3  
ATOM 5030  H HB2  . ASN A 1 21  ? 8.551   6.512   10.432  1.00 0.00 ? 21  ASN A HB2  3  
ATOM 5031  H HB3  . ASN A 1 21  ? 8.671   7.780   9.229   1.00 0.00 ? 21  ASN A HB3  3  
ATOM 5032  H HD21 . ASN A 1 21  ? 10.609  6.958   11.194  1.00 0.00 ? 21  ASN A HD21 3  
ATOM 5033  H HD22 . ASN A 1 21  ? 10.972  8.323   12.197  1.00 0.00 ? 21  ASN A HD22 3  
ATOM 5034  N N    . ALA A 1 22  ? 6.946   9.586   8.728   1.00 0.00 ? 22  ALA A N    3  
ATOM 5035  C CA   . ALA A 1 22  ? 6.767   10.922  8.183   1.00 0.00 ? 22  ALA A CA   3  
ATOM 5036  C C    . ALA A 1 22  ? 5.331   11.383  8.437   1.00 0.00 ? 22  ALA A C    3  
ATOM 5037  O O    . ALA A 1 22  ? 5.105   12.519  8.852   1.00 0.00 ? 22  ALA A O    3  
ATOM 5038  C CB   . ALA A 1 22  ? 7.124   10.918  6.695   1.00 0.00 ? 22  ALA A CB   3  
ATOM 5039  H H    . ALA A 1 22  ? 7.319   8.915   8.089   1.00 0.00 ? 22  ALA A H    3  
ATOM 5040  H HA   . ALA A 1 22  ? 7.452   11.589  8.706   1.00 0.00 ? 22  ALA A HA   3  
ATOM 5041  H HB1  . ALA A 1 22  ? 6.699   11.800  6.218   1.00 0.00 ? 22  ALA A HB1  3  
ATOM 5042  H HB2  . ALA A 1 22  ? 8.208   10.928  6.581   1.00 0.00 ? 22  ALA A HB2  3  
ATOM 5043  H HB3  . ALA A 1 22  ? 6.719   10.020  6.227   1.00 0.00 ? 22  ALA A HB3  3  
ATOM 5044  N N    . TRP A 1 23  ? 4.398   10.479  8.177   1.00 0.00 ? 23  TRP A N    3  
ATOM 5045  C CA   . TRP A 1 23  ? 2.989   10.779  8.372   1.00 0.00 ? 23  TRP A CA   3  
ATOM 5046  C C    . TRP A 1 23  ? 2.806   11.272  9.809   1.00 0.00 ? 23  TRP A C    3  
ATOM 5047  O O    . TRP A 1 23  ? 2.423   12.418  10.032  1.00 0.00 ? 23  TRP A O    3  
ATOM 5048  C CB   . TRP A 1 23  ? 2.119   9.565   8.040   1.00 0.00 ? 23  TRP A CB   3  
ATOM 5049  C CG   . TRP A 1 23  ? 0.660   9.708   8.479   1.00 0.00 ? 23  TRP A CG   3  
ATOM 5050  C CD1  . TRP A 1 23  ? -0.012  8.962   9.365   1.00 0.00 ? 23  TRP A CD1  3  
ATOM 5051  C CD2  . TRP A 1 23  ? -0.287  10.691  8.010   1.00 0.00 ? 23  TRP A CD2  3  
ATOM 5052  N NE1  . TRP A 1 23  ? -1.316  9.390   9.503   1.00 0.00 ? 23  TRP A NE1  3  
ATOM 5053  C CE2  . TRP A 1 23  ? -1.488  10.476  8.653   1.00 0.00 ? 23  TRP A CE2  3  
ATOM 5054  C CE3  . TRP A 1 23  ? -0.131  11.729  7.074   1.00 0.00 ? 23  TRP A CE3  3  
ATOM 5055  C CZ2  . TRP A 1 23  ? -2.629  11.257  8.429   1.00 0.00 ? 23  TRP A CZ2  3  
ATOM 5056  C CZ3  . TRP A 1 23  ? -1.281  12.501  6.862   1.00 0.00 ? 23  TRP A CZ3  3  
ATOM 5057  C CH2  . TRP A 1 23  ? -2.498  12.296  7.500   1.00 0.00 ? 23  TRP A CH2  3  
ATOM 5058  H H    . TRP A 1 23  ? 4.591   9.558   7.840   1.00 0.00 ? 23  TRP A H    3  
ATOM 5059  H HA   . TRP A 1 23  ? 2.716   11.567  7.671   1.00 0.00 ? 23  TRP A HA   3  
ATOM 5060  H HB2  . TRP A 1 23  ? 2.149   9.393   6.964   1.00 0.00 ? 23  TRP A HB2  3  
ATOM 5061  H HB3  . TRP A 1 23  ? 2.547   8.684   8.517   1.00 0.00 ? 23  TRP A HB3  3  
ATOM 5062  H HD1  . TRP A 1 23  ? 0.419   8.121   9.910   1.00 0.00 ? 23  TRP A HD1  3  
ATOM 5063  H HE1  . TRP A 1 23  ? -2.071  8.957   10.158  1.00 0.00 ? 23  TRP A HE1  3  
ATOM 5064  H HE3  . TRP A 1 23  ? 0.807   11.921  6.554   1.00 0.00 ? 23  TRP A HE3  3  
ATOM 5065  H HZ2  . TRP A 1 23  ? -3.566  11.066  8.949   1.00 0.00 ? 23  TRP A HZ2  3  
ATOM 5066  H HZ3  . TRP A 1 23  ? -1.216  13.320  6.146   1.00 0.00 ? 23  TRP A HZ3  3  
ATOM 5067  H HH2  . TRP A 1 23  ? -3.347  12.943  7.280   1.00 0.00 ? 23  TRP A HH2  3  
ATOM 5068  N N    . VAL A 1 24  ? 3.088   10.379  10.747  1.00 0.00 ? 24  VAL A N    3  
ATOM 5069  C CA   . VAL A 1 24  ? 2.958   10.709  12.157  1.00 0.00 ? 24  VAL A CA   3  
ATOM 5070  C C    . VAL A 1 24  ? 3.543   12.101  12.406  1.00 0.00 ? 24  VAL A C    3  
ATOM 5071  O O    . VAL A 1 24  ? 2.963   12.898  13.141  1.00 0.00 ? 24  VAL A O    3  
ATOM 5072  C CB   . VAL A 1 24  ? 3.616   9.622   13.010  1.00 0.00 ? 24  VAL A CB   3  
ATOM 5073  C CG1  . VAL A 1 24  ? 3.709   10.057  14.474  1.00 0.00 ? 24  VAL A CG1  3  
ATOM 5074  C CG2  . VAL A 1 24  ? 2.867   8.294   12.879  1.00 0.00 ? 24  VAL A CG2  3  
ATOM 5075  H H    . VAL A 1 24  ? 3.399   9.448   10.558  1.00 0.00 ? 24  VAL A H    3  
ATOM 5076  H HA   . VAL A 1 24  ? 1.895   10.726  12.394  1.00 0.00 ? 24  VAL A HA   3  
ATOM 5077  H HB   . VAL A 1 24  ? 4.629   9.473   12.640  1.00 0.00 ? 24  VAL A HB   3  
ATOM 5078  H HG11 . VAL A 1 24  ? 3.133   10.971  14.619  1.00 0.00 ? 24  VAL A HG11 3  
ATOM 5079  H HG12 . VAL A 1 24  ? 3.309   9.270   15.114  1.00 0.00 ? 24  VAL A HG12 3  
ATOM 5080  H HG13 . VAL A 1 24  ? 4.752   10.241  14.732  1.00 0.00 ? 24  VAL A HG13 3  
ATOM 5081  H HG21 . VAL A 1 24  ? 2.296   8.289   11.951  1.00 0.00 ? 24  VAL A HG21 3  
ATOM 5082  H HG22 . VAL A 1 24  ? 3.583   7.472   12.870  1.00 0.00 ? 24  VAL A HG22 3  
ATOM 5083  H HG23 . VAL A 1 24  ? 2.188   8.175   13.724  1.00 0.00 ? 24  VAL A HG23 3  
ATOM 5084  N N    . LYS A 1 25  ? 4.684   12.349  11.781  1.00 0.00 ? 25  LYS A N    3  
ATOM 5085  C CA   . LYS A 1 25  ? 5.353   13.630  11.926  1.00 0.00 ? 25  LYS A CA   3  
ATOM 5086  C C    . LYS A 1 25  ? 4.453   14.737  11.373  1.00 0.00 ? 25  LYS A C    3  
ATOM 5087  O O    . LYS A 1 25  ? 4.323   15.798  11.981  1.00 0.00 ? 25  LYS A O    3  
ATOM 5088  C CB   . LYS A 1 25  ? 6.739   13.587  11.280  1.00 0.00 ? 25  LYS A CB   3  
ATOM 5089  C CG   . LYS A 1 25  ? 7.831   13.400  12.336  1.00 0.00 ? 25  LYS A CG   3  
ATOM 5090  C CD   . LYS A 1 25  ? 9.189   13.143  11.681  1.00 0.00 ? 25  LYS A CD   3  
ATOM 5091  C CE   . LYS A 1 25  ? 10.320  13.249  12.707  1.00 0.00 ? 25  LYS A CE   3  
ATOM 5092  N NZ   . LYS A 1 25  ? 11.613  12.868  12.093  1.00 0.00 ? 25  LYS A NZ   3  
ATOM 5093  H H    . LYS A 1 25  ? 5.149   11.695  11.184  1.00 0.00 ? 25  LYS A H    3  
ATOM 5094  H HA   . LYS A 1 25  ? 5.499   13.804  12.992  1.00 0.00 ? 25  LYS A HA   3  
ATOM 5095  H HB2  . LYS A 1 25  ? 6.784   12.772  10.558  1.00 0.00 ? 25  LYS A HB2  3  
ATOM 5096  H HB3  . LYS A 1 25  ? 6.918   14.511  10.729  1.00 0.00 ? 25  LYS A HB3  3  
ATOM 5097  H HG2  . LYS A 1 25  ? 7.889   14.287  12.966  1.00 0.00 ? 25  LYS A HG2  3  
ATOM 5098  H HG3  . LYS A 1 25  ? 7.572   12.564  12.987  1.00 0.00 ? 25  LYS A HG3  3  
ATOM 5099  H HD2  . LYS A 1 25  ? 9.196   12.151  11.227  1.00 0.00 ? 25  LYS A HD2  3  
ATOM 5100  H HD3  . LYS A 1 25  ? 9.352   13.862  10.879  1.00 0.00 ? 25  LYS A HD3  3  
ATOM 5101  H HE2  . LYS A 1 25  ? 10.378  14.267  13.089  1.00 0.00 ? 25  LYS A HE2  3  
ATOM 5102  H HE3  . LYS A 1 25  ? 10.110  12.600  13.557  1.00 0.00 ? 25  LYS A HE3  3  
ATOM 5103  H HZ1  . LYS A 1 25  ? 11.544  12.941  11.098  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 5104  H HZ2  . LYS A 1 25  ? 12.331  13.480  12.423  1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 5105  H HZ3  . LYS A 1 25  ? 11.836  11.926  12.344  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 5106  N N    . VAL A 1 26  ? 3.852   14.450  10.228  1.00 0.00 ? 26  VAL A N    3  
ATOM 5107  C CA   . VAL A 1 26  ? 2.966   15.408  9.587   1.00 0.00 ? 26  VAL A CA   3  
ATOM 5108  C C    . VAL A 1 26  ? 1.758   15.663  10.490  1.00 0.00 ? 26  VAL A C    3  
ATOM 5109  O O    . VAL A 1 26  ? 1.581   16.770  10.997  1.00 0.00 ? 26  VAL A O    3  
ATOM 5110  C CB   . VAL A 1 26  ? 2.576   14.909  8.194   1.00 0.00 ? 26  VAL A CB   3  
ATOM 5111  C CG1  . VAL A 1 26  ? 1.424   15.736  7.618   1.00 0.00 ? 26  VAL A CG1  3  
ATOM 5112  C CG2  . VAL A 1 26  ? 3.781   14.916  7.251   1.00 0.00 ? 26  VAL A CG2  3  
ATOM 5113  H H    . VAL A 1 26  ? 3.961   13.584  9.740   1.00 0.00 ? 26  VAL A H    3  
ATOM 5114  H HA   . VAL A 1 26  ? 3.520   16.340  9.469   1.00 0.00 ? 26  VAL A HA   3  
ATOM 5115  H HB   . VAL A 1 26  ? 2.233   13.880  8.291   1.00 0.00 ? 26  VAL A HB   3  
ATOM 5116  H HG11 . VAL A 1 26  ? 0.670   15.894  8.389   1.00 0.00 ? 26  VAL A HG11 3  
ATOM 5117  H HG12 . VAL A 1 26  ? 1.803   16.699  7.278   1.00 0.00 ? 26  VAL A HG12 3  
ATOM 5118  H HG13 . VAL A 1 26  ? 0.979   15.203  6.778   1.00 0.00 ? 26  VAL A HG13 3  
ATOM 5119  H HG21 . VAL A 1 26  ? 4.574   14.295  7.670   1.00 0.00 ? 26  VAL A HG21 3  
ATOM 5120  H HG22 . VAL A 1 26  ? 3.485   14.521  6.279   1.00 0.00 ? 26  VAL A HG22 3  
ATOM 5121  H HG23 . VAL A 1 26  ? 4.144   15.938  7.133   1.00 0.00 ? 26  VAL A HG23 3  
ATOM 5122  N N    . VAL A 1 27  ? 0.959   14.621  10.664  1.00 0.00 ? 27  VAL A N    3  
ATOM 5123  C CA   . VAL A 1 27  ? -0.227  14.719  11.498  1.00 0.00 ? 27  VAL A CA   3  
ATOM 5124  C C    . VAL A 1 27  ? 0.104   15.523  12.757  1.00 0.00 ? 27  VAL A C    3  
ATOM 5125  O O    . VAL A 1 27  ? -0.703  16.334  13.210  1.00 0.00 ? 27  VAL A O    3  
ATOM 5126  C CB   . VAL A 1 27  ? -0.767  13.321  11.806  1.00 0.00 ? 27  VAL A CB   3  
ATOM 5127  C CG1  . VAL A 1 27  ? -2.013  13.396  12.690  1.00 0.00 ? 27  VAL A CG1  3  
ATOM 5128  C CG2  . VAL A 1 27  ? -1.053  12.546  10.519  1.00 0.00 ? 27  VAL A CG2  3  
ATOM 5129  H H    . VAL A 1 27  ? 1.110   13.724  10.248  1.00 0.00 ? 27  VAL A H    3  
ATOM 5130  H HA   . VAL A 1 27  ? -0.986  15.255  10.928  1.00 0.00 ? 27  VAL A HA   3  
ATOM 5131  H HB   . VAL A 1 27  ? 0.002   12.780  12.358  1.00 0.00 ? 27  VAL A HB   3  
ATOM 5132  H HG11 . VAL A 1 27  ? -1.943  14.265  13.344  1.00 0.00 ? 27  VAL A HG11 3  
ATOM 5133  H HG12 . VAL A 1 27  ? -2.900  13.486  12.061  1.00 0.00 ? 27  VAL A HG12 3  
ATOM 5134  H HG13 . VAL A 1 27  ? -2.086  12.492  13.295  1.00 0.00 ? 27  VAL A HG13 3  
ATOM 5135  H HG21 . VAL A 1 27  ? -0.726  13.135  9.661   1.00 0.00 ? 27  VAL A HG21 3  
ATOM 5136  H HG22 . VAL A 1 27  ? -0.515  11.599  10.536  1.00 0.00 ? 27  VAL A HG22 3  
ATOM 5137  H HG23 . VAL A 1 27  ? -2.123  12.355  10.441  1.00 0.00 ? 27  VAL A HG23 3  
ATOM 5138  N N    . GLU A 1 28  ? 1.292   15.271  13.286  1.00 0.00 ? 28  GLU A N    3  
ATOM 5139  C CA   . GLU A 1 28  ? 1.739   15.961  14.483  1.00 0.00 ? 28  GLU A CA   3  
ATOM 5140  C C    . GLU A 1 28  ? 1.805   17.469  14.234  1.00 0.00 ? 28  GLU A C    3  
ATOM 5141  O O    . GLU A 1 28  ? 1.236   18.253  14.993  1.00 0.00 ? 28  GLU A O    3  
ATOM 5142  C CB   . GLU A 1 28  ? 3.093   15.424  14.953  1.00 0.00 ? 28  GLU A CB   3  
ATOM 5143  C CG   . GLU A 1 28  ? 3.354   15.794  16.414  1.00 0.00 ? 28  GLU A CG   3  
ATOM 5144  C CD   . GLU A 1 28  ? 2.648   14.819  17.360  1.00 0.00 ? 28  GLU A CD   3  
ATOM 5145  O OE1  . GLU A 1 28  ? 2.739   13.602  17.092  1.00 0.00 ? 28  GLU A OE1  3  
ATOM 5146  O OE2  . GLU A 1 28  ? 2.033   15.315  18.330  1.00 0.00 ? 28  GLU A OE2  3  
ATOM 5147  H H    . GLU A 1 28  ? 1.942   14.610  12.911  1.00 0.00 ? 28  GLU A H    3  
ATOM 5148  H HA   . GLU A 1 28  ? 0.987   15.744  15.242  1.00 0.00 ? 28  GLU A HA   3  
ATOM 5149  H HB2  . GLU A 1 28  ? 3.118   14.340  14.838  1.00 0.00 ? 28  GLU A HB2  3  
ATOM 5150  H HB3  . GLU A 1 28  ? 3.887   15.829  14.325  1.00 0.00 ? 28  GLU A HB3  3  
ATOM 5151  H HG2  . GLU A 1 28  ? 4.425   15.784  16.610  1.00 0.00 ? 28  GLU A HG2  3  
ATOM 5152  H HG3  . GLU A 1 28  ? 3.004   16.809  16.604  1.00 0.00 ? 28  GLU A HG3  3  
ATOM 5153  N N    . GLU A 1 29  ? 2.502   17.830  13.166  1.00 0.00 ? 29  GLU A N    3  
ATOM 5154  C CA   . GLU A 1 29  ? 2.649   19.230  12.807  1.00 0.00 ? 29  GLU A CA   3  
ATOM 5155  C C    . GLU A 1 29  ? 1.486   19.676  11.919  1.00 0.00 ? 29  GLU A C    3  
ATOM 5156  O O    . GLU A 1 29  ? 1.507   20.774  11.366  1.00 0.00 ? 29  GLU A O    3  
ATOM 5157  C CB   . GLU A 1 29  ? 3.992   19.482  12.118  1.00 0.00 ? 29  GLU A CB   3  
ATOM 5158  C CG   . GLU A 1 29  ? 4.847   20.461  12.924  1.00 0.00 ? 29  GLU A CG   3  
ATOM 5159  C CD   . GLU A 1 29  ? 5.140   19.912  14.321  1.00 0.00 ? 29  GLU A CD   3  
ATOM 5160  O OE1  . GLU A 1 29  ? 5.707   18.800  14.388  1.00 0.00 ? 29  GLU A OE1  3  
ATOM 5161  O OE2  . GLU A 1 29  ? 4.790   20.618  15.293  1.00 0.00 ? 29  GLU A OE2  3  
ATOM 5162  H H    . GLU A 1 29  ? 2.962   17.186  12.554  1.00 0.00 ? 29  GLU A H    3  
ATOM 5163  H HA   . GLU A 1 29  ? 2.624   19.776  13.751  1.00 0.00 ? 29  GLU A HA   3  
ATOM 5164  H HB2  . GLU A 1 29  ? 4.526   18.539  12.000  1.00 0.00 ? 29  GLU A HB2  3  
ATOM 5165  H HB3  . GLU A 1 29  ? 3.822   19.879  11.117  1.00 0.00 ? 29  GLU A HB3  3  
ATOM 5166  H HG2  . GLU A 1 29  ? 5.784   20.649  12.399  1.00 0.00 ? 29  GLU A HG2  3  
ATOM 5167  H HG3  . GLU A 1 29  ? 4.331   21.418  13.006  1.00 0.00 ? 29  GLU A HG3  3  
ATOM 5168  N N    . LYS A 1 30  ? 0.498   18.799  11.810  1.00 0.00 ? 30  LYS A N    3  
ATOM 5169  C CA   . LYS A 1 30  ? -0.672  19.088  10.998  1.00 0.00 ? 30  LYS A CA   3  
ATOM 5170  C C    . LYS A 1 30  ? -1.920  19.068  11.885  1.00 0.00 ? 30  LYS A C    3  
ATOM 5171  O O    . LYS A 1 30  ? -2.417  20.119  12.287  1.00 0.00 ? 30  LYS A O    3  
ATOM 5172  C CB   . LYS A 1 30  ? -0.749  18.129  9.808   1.00 0.00 ? 30  LYS A CB   3  
ATOM 5173  C CG   . LYS A 1 30  ? 0.138   18.613  8.658   1.00 0.00 ? 30  LYS A CG   3  
ATOM 5174  C CD   . LYS A 1 30  ? -0.442  19.871  8.010   1.00 0.00 ? 30  LYS A CD   3  
ATOM 5175  C CE   . LYS A 1 30  ? 0.668   20.849  7.620   1.00 0.00 ? 30  LYS A CE   3  
ATOM 5176  N NZ   . LYS A 1 30  ? 1.040   21.699  8.772   1.00 0.00 ? 30  LYS A NZ   3  
ATOM 5177  H H    . LYS A 1 30  ? 0.488   17.908  12.263  1.00 0.00 ? 30  LYS A H    3  
ATOM 5178  H HA   . LYS A 1 30  ? -0.550  20.094  10.596  1.00 0.00 ? 30  LYS A HA   3  
ATOM 5179  H HB2  . LYS A 1 30  ? -0.437  17.132  10.118  1.00 0.00 ? 30  LYS A HB2  3  
ATOM 5180  H HB3  . LYS A 1 30  ? -1.781  18.049  9.467   1.00 0.00 ? 30  LYS A HB3  3  
ATOM 5181  H HG2  . LYS A 1 30  ? 1.141   18.821  9.031   1.00 0.00 ? 30  LYS A HG2  3  
ATOM 5182  H HG3  . LYS A 1 30  ? 0.232   17.826  7.910   1.00 0.00 ? 30  LYS A HG3  3  
ATOM 5183  H HD2  . LYS A 1 30  ? -1.018  19.598  7.127   1.00 0.00 ? 30  LYS A HD2  3  
ATOM 5184  H HD3  . LYS A 1 30  ? -1.131  20.357  8.703   1.00 0.00 ? 30  LYS A HD3  3  
ATOM 5185  H HE2  . LYS A 1 30  ? 1.541   20.296  7.272   1.00 0.00 ? 30  LYS A HE2  3  
ATOM 5186  H HE3  . LYS A 1 30  ? 0.337   21.474  6.791   1.00 0.00 ? 30  LYS A HE3  3  
ATOM 5187  H HZ1  . LYS A 1 30  ? 0.407   21.532  9.528   1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 5188  H HZ2  . LYS A 1 30  ? 1.971   21.480  9.063   1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 5189  H HZ3  . LYS A 1 30  ? 0.993   22.662  8.505   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 5190  N N    . ALA A 1 31  ? -2.389  17.860  12.164  1.00 0.00 ? 31  ALA A N    3  
ATOM 5191  C CA   . ALA A 1 31  ? -3.568  17.689  12.995  1.00 0.00 ? 31  ALA A CA   3  
ATOM 5192  C C    . ALA A 1 31  ? -4.822  17.845  12.132  1.00 0.00 ? 31  ALA A C    3  
ATOM 5193  O O    . ALA A 1 31  ? -5.674  18.688  12.413  1.00 0.00 ? 31  ALA A O    3  
ATOM 5194  C CB   . ALA A 1 31  ? -3.528  18.691  14.150  1.00 0.00 ? 31  ALA A CB   3  
ATOM 5195  H H    . ALA A 1 31  ? -1.978  17.011  11.833  1.00 0.00 ? 31  ALA A H    3  
ATOM 5196  H HA   . ALA A 1 31  ? -3.542  16.679  13.404  1.00 0.00 ? 31  ALA A HA   3  
ATOM 5197  H HB1  . ALA A 1 31  ? -3.999  19.624  13.840  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 5198  H HB2  . ALA A 1 31  ? -2.492  18.882  14.430  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 5199  H HB3  . ALA A 1 31  ? -4.065  18.281  15.006  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 5200  N N    . PHE A 1 32  ? -4.896  17.020  11.098  1.00 0.00 ? 32  PHE A N    3  
ATOM 5201  C CA   . PHE A 1 32  ? -6.032  17.056  10.192  1.00 0.00 ? 32  PHE A CA   3  
ATOM 5202  C C    . PHE A 1 32  ? -6.216  18.455  9.599   1.00 0.00 ? 32  PHE A C    3  
ATOM 5203  O O    . PHE A 1 32  ? -7.248  19.092  9.810   1.00 0.00 ? 32  PHE A O    3  
ATOM 5204  C CB   . PHE A 1 32  ? -7.271  16.696  11.013  1.00 0.00 ? 32  PHE A CB   3  
ATOM 5205  C CG   . PHE A 1 32  ? -7.482  15.192  11.195  1.00 0.00 ? 32  PHE A CG   3  
ATOM 5206  C CD1  . PHE A 1 32  ? -6.555  14.451  11.860  1.00 0.00 ? 32  PHE A CD1  3  
ATOM 5207  C CD2  . PHE A 1 32  ? -8.596  14.595  10.693  1.00 0.00 ? 32  PHE A CD2  3  
ATOM 5208  C CE1  . PHE A 1 32  ? -6.751  13.055  12.029  1.00 0.00 ? 32  PHE A CE1  3  
ATOM 5209  C CE2  . PHE A 1 32  ? -8.791  13.199  10.862  1.00 0.00 ? 32  PHE A CE2  3  
ATOM 5210  C CZ   . PHE A 1 32  ? -7.865  12.458  11.526  1.00 0.00 ? 32  PHE A CZ   3  
ATOM 5211  H H    . PHE A 1 32  ? -4.200  16.338  10.875  1.00 0.00 ? 32  PHE A H    3  
ATOM 5212  H HA   . PHE A 1 32  ? -5.828  16.347  9.389   1.00 0.00 ? 32  PHE A HA   3  
ATOM 5213  H HB2  . PHE A 1 32  ? -7.192  17.163  11.995  1.00 0.00 ? 32  PHE A HB2  3  
ATOM 5214  H HB3  . PHE A 1 32  ? -8.151  17.121  10.529  1.00 0.00 ? 32  PHE A HB3  3  
ATOM 5215  H HD1  . PHE A 1 32  ? -5.662  14.929  12.263  1.00 0.00 ? 32  PHE A HD1  3  
ATOM 5216  H HD2  . PHE A 1 32  ? -9.339  15.189  10.160  1.00 0.00 ? 32  PHE A HD2  3  
ATOM 5217  H HE1  . PHE A 1 32  ? -6.008  12.461  12.561  1.00 0.00 ? 32  PHE A HE1  3  
ATOM 5218  H HE2  . PHE A 1 32  ? -9.685  12.721  10.458  1.00 0.00 ? 32  PHE A HE2  3  
ATOM 5219  H HZ   . PHE A 1 32  ? -8.015  11.386  11.656  1.00 0.00 ? 32  PHE A HZ   3  
ATOM 5220  N N    . SER A 1 33  ? -5.201  18.891  8.868   1.00 0.00 ? 33  SER A N    3  
ATOM 5221  C CA   . SER A 1 33  ? -5.237  20.202  8.243   1.00 0.00 ? 33  SER A CA   3  
ATOM 5222  C C    . SER A 1 33  ? -5.865  20.101  6.851   1.00 0.00 ? 33  SER A C    3  
ATOM 5223  O O    . SER A 1 33  ? -6.113  19.002  6.357   1.00 0.00 ? 33  SER A O    3  
ATOM 5224  C CB   . SER A 1 33  ? -3.836  20.809  8.151   1.00 0.00 ? 33  SER A CB   3  
ATOM 5225  O OG   . SER A 1 33  ? -3.734  22.032  8.875   1.00 0.00 ? 33  SER A OG   3  
ATOM 5226  H H    . SER A 1 33  ? -4.366  18.367  8.701   1.00 0.00 ? 33  SER A H    3  
ATOM 5227  H HA   . SER A 1 33  ? -5.856  20.817  8.897   1.00 0.00 ? 33  SER A HA   3  
ATOM 5228  H HB2  . SER A 1 33  ? -3.106  20.097  8.538   1.00 0.00 ? 33  SER A HB2  3  
ATOM 5229  H HB3  . SER A 1 33  ? -3.585  20.984  7.105   1.00 0.00 ? 33  SER A HB3  3  
ATOM 5230  H HG   . SER A 1 33  ? -4.645  22.414  9.028   1.00 0.00 ? 33  SER A HG   3  
ATOM 5231  N N    . PRO A 1 34  ? -6.110  21.292  6.242   1.00 0.00 ? 34  PRO A N    3  
ATOM 5232  C CA   . PRO A 1 34  ? -6.703  21.348  4.918   1.00 0.00 ? 34  PRO A CA   3  
ATOM 5233  C C    . PRO A 1 34  ? -5.682  20.969  3.843   1.00 0.00 ? 34  PRO A C    3  
ATOM 5234  O O    . PRO A 1 34  ? -6.007  20.933  2.657   1.00 0.00 ? 34  PRO A O    3  
ATOM 5235  C CB   . PRO A 1 34  ? -7.214  22.773  4.775   1.00 0.00 ? 34  PRO A CB   3  
ATOM 5236  C CG   . PRO A 1 34  ? -6.482  23.585  5.830   1.00 0.00 ? 34  PRO A CG   3  
ATOM 5237  C CD   . PRO A 1 34  ? -5.828  22.613  6.798   1.00 0.00 ? 34  PRO A CD   3  
ATOM 5238  H HA   . PRO A 1 34  ? -7.442  20.679  4.839   1.00 0.00 ? 34  PRO A HA   3  
ATOM 5239  H HB2  . PRO A 1 34  ? -7.017  23.160  3.776   1.00 0.00 ? 34  PRO A HB2  3  
ATOM 5240  H HB3  . PRO A 1 34  ? -8.293  22.817  4.927   1.00 0.00 ? 34  PRO A HB3  3  
ATOM 5241  H HG2  . PRO A 1 34  ? -5.730  24.225  5.365   1.00 0.00 ? 34  PRO A HG2  3  
ATOM 5242  H HG3  . PRO A 1 34  ? -7.176  24.241  6.357   1.00 0.00 ? 34  PRO A HG3  3  
ATOM 5243  H HD2  . PRO A 1 34  ? -4.756  22.791  6.874   1.00 0.00 ? 34  PRO A HD2  3  
ATOM 5244  H HD3  . PRO A 1 34  ? -6.240  22.716  7.802   1.00 0.00 ? 34  PRO A HD3  3  
ATOM 5245  N N    . GLU A 1 35  ? -4.466  20.698  4.297   1.00 0.00 ? 35  GLU A N    3  
ATOM 5246  C CA   . GLU A 1 35  ? -3.395  20.324  3.389   1.00 0.00 ? 35  GLU A CA   3  
ATOM 5247  C C    . GLU A 1 35  ? -2.875  18.925  3.729   1.00 0.00 ? 35  GLU A C    3  
ATOM 5248  O O    . GLU A 1 35  ? -1.764  18.563  3.347   1.00 0.00 ? 35  GLU A O    3  
ATOM 5249  C CB   . GLU A 1 35  ? -2.264  21.352  3.422   1.00 0.00 ? 35  GLU A CB   3  
ATOM 5250  C CG   . GLU A 1 35  ? -2.184  22.123  2.102   1.00 0.00 ? 35  GLU A CG   3  
ATOM 5251  C CD   . GLU A 1 35  ? -0.729  22.357  1.692   1.00 0.00 ? 35  GLU A CD   3  
ATOM 5252  O OE1  . GLU A 1 35  ? 0.097   22.550  2.612   1.00 0.00 ? 35  GLU A OE1  3  
ATOM 5253  O OE2  . GLU A 1 35  ? -0.473  22.339  0.468   1.00 0.00 ? 35  GLU A OE2  3  
ATOM 5254  H H    . GLU A 1 35  ? -4.210  20.730  5.262   1.00 0.00 ? 35  GLU A H    3  
ATOM 5255  H HA   . GLU A 1 35  ? -3.846  20.320  2.396   1.00 0.00 ? 35  GLU A HA   3  
ATOM 5256  H HB2  . GLU A 1 35  ? -2.425  22.049  4.244   1.00 0.00 ? 35  GLU A HB2  3  
ATOM 5257  H HB3  . GLU A 1 35  ? -1.316  20.850  3.612   1.00 0.00 ? 35  GLU A HB3  3  
ATOM 5258  H HG2  . GLU A 1 35  ? -2.700  21.565  1.320   1.00 0.00 ? 35  GLU A HG2  3  
ATOM 5259  H HG3  . GLU A 1 35  ? -2.695  23.079  2.203   1.00 0.00 ? 35  GLU A HG3  3  
ATOM 5260  N N    . VAL A 1 36  ? -3.704  18.179  4.444   1.00 0.00 ? 36  VAL A N    3  
ATOM 5261  C CA   . VAL A 1 36  ? -3.342  16.828  4.839   1.00 0.00 ? 36  VAL A CA   3  
ATOM 5262  C C    . VAL A 1 36  ? -4.178  15.826  4.042   1.00 0.00 ? 36  VAL A C    3  
ATOM 5263  O O    . VAL A 1 36  ? -3.849  14.642  3.987   1.00 0.00 ? 36  VAL A O    3  
ATOM 5264  C CB   . VAL A 1 36  ? -3.498  16.668  6.353   1.00 0.00 ? 36  VAL A CB   3  
ATOM 5265  C CG1  . VAL A 1 36  ? -3.836  15.220  6.718   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 5266  C CG2  . VAL A 1 36  ? -2.241  17.139  7.088   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 5267  H H    . VAL A 1 36  ? -4.606  18.481  4.750   1.00 0.00 ? 36  VAL A H    3  
ATOM 5268  H HA   . VAL A 1 36  ? -2.290  16.684  4.591   1.00 0.00 ? 36  VAL A HA   3  
ATOM 5269  H HB   . VAL A 1 36  ? -4.328  17.297  6.673   1.00 0.00 ? 36  VAL A HB   3  
ATOM 5270  H HG11 . VAL A 1 36  ? -3.256  14.543  6.092   1.00 0.00 ? 36  VAL A HG11 3  
ATOM 5271  H HG12 . VAL A 1 36  ? -3.593  15.044  7.767   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 5272  H HG13 . VAL A 1 36  ? -4.900  15.045  6.558   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 5273  H HG21 . VAL A 1 36  ? -1.403  17.164  6.392   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 5274  H HG22 . VAL A 1 36  ? -2.410  18.137  7.492   1.00 0.00 ? 36  VAL A HG22 3  
ATOM 5275  H HG23 . VAL A 1 36  ? -2.017  16.451  7.902   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 5276  N N    . ILE A 1 37  ? -5.246  16.336  3.445   1.00 0.00 ? 37  ILE A N    3  
ATOM 5277  C CA   . ILE A 1 37  ? -6.131  15.501  2.653   1.00 0.00 ? 37  ILE A CA   3  
ATOM 5278  C C    . ILE A 1 37  ? -5.406  15.057  1.381   1.00 0.00 ? 37  ILE A C    3  
ATOM 5279  O O    . ILE A 1 37  ? -5.505  13.899  0.978   1.00 0.00 ? 37  ILE A O    3  
ATOM 5280  C CB   . ILE A 1 37  ? -7.453  16.223  2.387   1.00 0.00 ? 37  ILE A CB   3  
ATOM 5281  C CG1  . ILE A 1 37  ? -8.012  16.837  3.671   1.00 0.00 ? 37  ILE A CG1  3  
ATOM 5282  C CG2  . ILE A 1 37  ? -8.462  15.291  1.712   1.00 0.00 ? 37  ILE A CG2  3  
ATOM 5283  C CD1  . ILE A 1 37  ? -8.641  15.765  4.563   1.00 0.00 ? 37  ILE A CD1  3  
ATOM 5284  H H    . ILE A 1 37  ? -5.506  17.300  3.495   1.00 0.00 ? 37  ILE A H    3  
ATOM 5285  H HA   . ILE A 1 37  ? -6.362  14.615  3.246   1.00 0.00 ? 37  ILE A HA   3  
ATOM 5286  H HB   . ILE A 1 37  ? -7.261  17.043  1.694   1.00 0.00 ? 37  ILE A HB   3  
ATOM 5287  H HG12 . ILE A 1 37  ? -7.213  17.344  4.214   1.00 0.00 ? 37  ILE A HG12 3  
ATOM 5288  H HG13 . ILE A 1 37  ? -8.757  17.593  3.424   1.00 0.00 ? 37  ILE A HG13 3  
ATOM 5289  H HG21 . ILE A 1 37  ? -8.269  14.263  2.019   1.00 0.00 ? 37  ILE A HG21 3  
ATOM 5290  H HG22 . ILE A 1 37  ? -9.472  15.575  2.006   1.00 0.00 ? 37  ILE A HG22 3  
ATOM 5291  H HG23 . ILE A 1 37  ? -8.362  15.371  0.629   1.00 0.00 ? 37  ILE A HG23 3  
ATOM 5292  H HD11 . ILE A 1 37  ? -9.227  15.081  3.950   1.00 0.00 ? 37  ILE A HD11 3  
ATOM 5293  H HD12 . ILE A 1 37  ? -7.855  15.212  5.076   1.00 0.00 ? 37  ILE A HD12 3  
ATOM 5294  H HD13 . ILE A 1 37  ? -9.290  16.241  5.299   1.00 0.00 ? 37  ILE A HD13 3  
ATOM 5295  N N    . PRO A 1 38  ? -4.673  16.026  0.770   1.00 0.00 ? 38  PRO A N    3  
ATOM 5296  C CA   . PRO A 1 38  ? -3.931  15.746  -0.448  1.00 0.00 ? 38  PRO A CA   3  
ATOM 5297  C C    . PRO A 1 38  ? -2.670  14.934  -0.148  1.00 0.00 ? 38  PRO A C    3  
ATOM 5298  O O    . PRO A 1 38  ? -2.270  14.084  -0.942  1.00 0.00 ? 38  PRO A O    3  
ATOM 5299  C CB   . PRO A 1 38  ? -3.631  17.110  -1.047  1.00 0.00 ? 38  PRO A CB   3  
ATOM 5300  C CG   . PRO A 1 38  ? -3.805  18.110  0.084   1.00 0.00 ? 38  PRO A CG   3  
ATOM 5301  C CD   . PRO A 1 38  ? -4.533  17.407  1.219   1.00 0.00 ? 38  PRO A CD   3  
ATOM 5302  H HA   . PRO A 1 38  ? -4.479  15.182  -1.066  1.00 0.00 ? 38  PRO A HA   3  
ATOM 5303  H HB2  . PRO A 1 38  ? -2.617  17.146  -1.447  1.00 0.00 ? 38  PRO A HB2  3  
ATOM 5304  H HB3  . PRO A 1 38  ? -4.306  17.332  -1.873  1.00 0.00 ? 38  PRO A HB3  3  
ATOM 5305  H HG2  . PRO A 1 38  ? -2.837  18.479  0.421   1.00 0.00 ? 38  PRO A HG2  3  
ATOM 5306  H HG3  . PRO A 1 38  ? -4.375  18.975  -0.256  1.00 0.00 ? 38  PRO A HG3  3  
ATOM 5307  H HD2  . PRO A 1 38  ? -3.966  17.465  2.148   1.00 0.00 ? 38  PRO A HD2  3  
ATOM 5308  H HD3  . PRO A 1 38  ? -5.504  17.863  1.409   1.00 0.00 ? 38  PRO A HD3  3  
ATOM 5309  N N    . MET A 1 39  ? -2.078  15.224  1.002   1.00 0.00 ? 39  MET A N    3  
ATOM 5310  C CA   . MET A 1 39  ? -0.871  14.530  1.418   1.00 0.00 ? 39  MET A CA   3  
ATOM 5311  C C    . MET A 1 39  ? -1.158  13.056  1.713   1.00 0.00 ? 39  MET A C    3  
ATOM 5312  O O    . MET A 1 39  ? -0.336  12.190  1.420   1.00 0.00 ? 39  MET A O    3  
ATOM 5313  C CB   . MET A 1 39  ? -0.304  15.200  2.671   1.00 0.00 ? 39  MET A CB   3  
ATOM 5314  C CG   . MET A 1 39  ? 1.226   15.159  2.670   1.00 0.00 ? 39  MET A CG   3  
ATOM 5315  S SD   . MET A 1 39  ? 1.842   15.320  4.338   1.00 0.00 ? 39  MET A SD   3  
ATOM 5316  C CE   . MET A 1 39  ? 1.774   13.614  4.859   1.00 0.00 ? 39  MET A CE   3  
ATOM 5317  H H    . MET A 1 39  ? -2.410  15.916  1.644   1.00 0.00 ? 39  MET A H    3  
ATOM 5318  H HA   . MET A 1 39  ? -0.182  14.613  0.578   1.00 0.00 ? 39  MET A HA   3  
ATOM 5319  H HB2  . MET A 1 39  ? -0.643  16.235  2.720   1.00 0.00 ? 39  MET A HB2  3  
ATOM 5320  H HB3  . MET A 1 39  ? -0.684  14.697  3.561   1.00 0.00 ? 39  MET A HB3  3  
ATOM 5321  H HG2  . MET A 1 39  ? 1.573   14.222  2.235   1.00 0.00 ? 39  MET A HG2  3  
ATOM 5322  H HG3  . MET A 1 39  ? 1.619   15.964  2.049   1.00 0.00 ? 39  MET A HG3  3  
ATOM 5323  H HE1  . MET A 1 39  ? 0.868   13.150  4.469   1.00 0.00 ? 39  MET A HE1  3  
ATOM 5324  H HE2  . MET A 1 39  ? 2.646   13.083  4.479   1.00 0.00 ? 39  MET A HE2  3  
ATOM 5325  H HE3  . MET A 1 39  ? 1.766   13.567  5.949   1.00 0.00 ? 39  MET A HE3  3  
ATOM 5326  N N    . PHE A 1 40  ? -2.328  12.818  2.287   1.00 0.00 ? 40  PHE A N    3  
ATOM 5327  C CA   . PHE A 1 40  ? -2.733  11.464  2.623   1.00 0.00 ? 40  PHE A CA   3  
ATOM 5328  C C    . PHE A 1 40  ? -3.142  10.686  1.371   1.00 0.00 ? 40  PHE A C    3  
ATOM 5329  O O    . PHE A 1 40  ? -2.749  9.533   1.196   1.00 0.00 ? 40  PHE A O    3  
ATOM 5330  C CB   . PHE A 1 40  ? -3.942  11.578  3.555   1.00 0.00 ? 40  PHE A CB   3  
ATOM 5331  C CG   . PHE A 1 40  ? -4.084  10.413  4.536   1.00 0.00 ? 40  PHE A CG   3  
ATOM 5332  C CD1  . PHE A 1 40  ? -3.119  10.187  5.468   1.00 0.00 ? 40  PHE A CD1  3  
ATOM 5333  C CD2  . PHE A 1 40  ? -5.174  9.601   4.476   1.00 0.00 ? 40  PHE A CD2  3  
ATOM 5334  C CE1  . PHE A 1 40  ? -3.251  9.105   6.379   1.00 0.00 ? 40  PHE A CE1  3  
ATOM 5335  C CE2  . PHE A 1 40  ? -5.305  8.520   5.387   1.00 0.00 ? 40  PHE A CE2  3  
ATOM 5336  C CZ   . PHE A 1 40  ? -4.341  8.295   6.319   1.00 0.00 ? 40  PHE A CZ   3  
ATOM 5337  H H    . PHE A 1 40  ? -2.992  13.528  2.521   1.00 0.00 ? 40  PHE A H    3  
ATOM 5338  H HA   . PHE A 1 40  ? -1.877  10.975  3.089   1.00 0.00 ? 40  PHE A HA   3  
ATOM 5339  H HB2  . PHE A 1 40  ? -3.867  12.507  4.119   1.00 0.00 ? 40  PHE A HB2  3  
ATOM 5340  H HB3  . PHE A 1 40  ? -4.848  11.643  2.952   1.00 0.00 ? 40  PHE A HB3  3  
ATOM 5341  H HD1  . PHE A 1 40  ? -2.246  10.837  5.516   1.00 0.00 ? 40  PHE A HD1  3  
ATOM 5342  H HD2  . PHE A 1 40  ? -5.947  9.782   3.729   1.00 0.00 ? 40  PHE A HD2  3  
ATOM 5343  H HE1  . PHE A 1 40  ? -2.478  8.925   7.125   1.00 0.00 ? 40  PHE A HE1  3  
ATOM 5344  H HE2  . PHE A 1 40  ? -6.179  7.871   5.339   1.00 0.00 ? 40  PHE A HE2  3  
ATOM 5345  H HZ   . PHE A 1 40  ? -4.442  7.465   7.018   1.00 0.00 ? 40  PHE A HZ   3  
ATOM 5346  N N    . SER A 1 41  ? -3.923  11.348  0.531   1.00 0.00 ? 41  SER A N    3  
ATOM 5347  C CA   . SER A 1 41  ? -4.389  10.733  -0.701  1.00 0.00 ? 41  SER A CA   3  
ATOM 5348  C C    . SER A 1 41  ? -3.196  10.354  -1.580  1.00 0.00 ? 41  SER A C    3  
ATOM 5349  O O    . SER A 1 41  ? -3.208  9.311   -2.233  1.00 0.00 ? 41  SER A O    3  
ATOM 5350  C CB   . SER A 1 41  ? -5.333  11.668  -1.460  1.00 0.00 ? 41  SER A CB   3  
ATOM 5351  O OG   . SER A 1 41  ? -6.262  10.948  -2.267  1.00 0.00 ? 41  SER A OG   3  
ATOM 5352  H H    . SER A 1 41  ? -4.238  12.285  0.681   1.00 0.00 ? 41  SER A H    3  
ATOM 5353  H HA   . SER A 1 41  ? -4.934  9.841   -0.390  1.00 0.00 ? 41  SER A HA   3  
ATOM 5354  H HB2  . SER A 1 41  ? -5.876  12.291  -0.750  1.00 0.00 ? 41  SER A HB2  3  
ATOM 5355  H HB3  . SER A 1 41  ? -4.749  12.338  -2.091  1.00 0.00 ? 41  SER A HB3  3  
ATOM 5356  H HG   . SER A 1 41  ? -7.005  11.552  -2.554  1.00 0.00 ? 41  SER A HG   3  
ATOM 5357  N N    . ALA A 1 42  ? -2.194  11.221  -1.567  1.00 0.00 ? 42  ALA A N    3  
ATOM 5358  C CA   . ALA A 1 42  ? -0.995  10.990  -2.356  1.00 0.00 ? 42  ALA A CA   3  
ATOM 5359  C C    . ALA A 1 42  ? -0.147  9.910   -1.681  1.00 0.00 ? 42  ALA A C    3  
ATOM 5360  O O    . ALA A 1 42  ? 0.430   9.058   -2.356  1.00 0.00 ? 42  ALA A O    3  
ATOM 5361  C CB   . ALA A 1 42  ? -0.235  12.306  -2.527  1.00 0.00 ? 42  ALA A CB   3  
ATOM 5362  H H    . ALA A 1 42  ? -2.192  12.065  -1.033  1.00 0.00 ? 42  ALA A H    3  
ATOM 5363  H HA   . ALA A 1 42  ? -1.307  10.635  -3.338  1.00 0.00 ? 42  ALA A HA   3  
ATOM 5364  H HB1  . ALA A 1 42  ? -0.028  12.736  -1.547  1.00 0.00 ? 42  ALA A HB1  3  
ATOM 5365  H HB2  . ALA A 1 42  ? 0.704   12.118  -3.048  1.00 0.00 ? 42  ALA A HB2  3  
ATOM 5366  H HB3  . ALA A 1 42  ? -0.839  13.002  -3.108  1.00 0.00 ? 42  ALA A HB3  3  
ATOM 5367  N N    . LEU A 1 43  ? -0.098  9.981   -0.360  1.00 0.00 ? 43  LEU A N    3  
ATOM 5368  C CA   . LEU A 1 43  ? 0.670   9.019   0.413   1.00 0.00 ? 43  LEU A CA   3  
ATOM 5369  C C    . LEU A 1 43  ? 0.134   7.612   0.147   1.00 0.00 ? 43  LEU A C    3  
ATOM 5370  O O    . LEU A 1 43  ? 0.893   6.643   0.145   1.00 0.00 ? 43  LEU A O    3  
ATOM 5371  C CB   . LEU A 1 43  ? 0.677   9.405   1.894   1.00 0.00 ? 43  LEU A CB   3  
ATOM 5372  C CG   . LEU A 1 43  ? 1.973   10.024  2.420   1.00 0.00 ? 43  LEU A CG   3  
ATOM 5373  C CD1  . LEU A 1 43  ? 1.680   11.187  3.368   1.00 0.00 ? 43  LEU A CD1  3  
ATOM 5374  C CD2  . LEU A 1 43  ? 2.863   8.963   3.073   1.00 0.00 ? 43  LEU A CD2  3  
ATOM 5375  H H    . LEU A 1 43  ? -0.570  10.677  0.181   1.00 0.00 ? 43  LEU A H    3  
ATOM 5376  H HA   . LEU A 1 43  ? 1.702   9.067   0.063   1.00 0.00 ? 43  LEU A HA   3  
ATOM 5377  H HB2  . LEU A 1 43  ? -0.136  10.110  2.069   1.00 0.00 ? 43  LEU A HB2  3  
ATOM 5378  H HB3  . LEU A 1 43  ? 0.458   8.514   2.482   1.00 0.00 ? 43  LEU A HB3  3  
ATOM 5379  H HG   . LEU A 1 43  ? 2.527   10.430  1.573   1.00 0.00 ? 43  LEU A HG   3  
ATOM 5380  H HD11 . LEU A 1 43  ? 0.637   11.148  3.681   1.00 0.00 ? 43  LEU A HD11 3  
ATOM 5381  H HD12 . LEU A 1 43  ? 2.325   11.114  4.245   1.00 0.00 ? 43  LEU A HD12 3  
ATOM 5382  H HD13 . LEU A 1 43  ? 1.870   12.131  2.857   1.00 0.00 ? 43  LEU A HD13 3  
ATOM 5383  H HD21 . LEU A 1 43  ? 2.814   8.042   2.492   1.00 0.00 ? 43  LEU A HD21 3  
ATOM 5384  H HD22 . LEU A 1 43  ? 3.892   9.320   3.103   1.00 0.00 ? 43  LEU A HD22 3  
ATOM 5385  H HD23 . LEU A 1 43  ? 2.514   8.771   4.087   1.00 0.00 ? 43  LEU A HD23 3  
ATOM 5386  N N    . SER A 1 44  ? -1.171  7.542   -0.072  1.00 0.00 ? 44  SER A N    3  
ATOM 5387  C CA   . SER A 1 44  ? -1.818  6.269   -0.338  1.00 0.00 ? 44  SER A CA   3  
ATOM 5388  C C    . SER A 1 44  ? -1.564  5.845   -1.786  1.00 0.00 ? 44  SER A C    3  
ATOM 5389  O O    . SER A 1 44  ? -0.709  5.001   -2.049  1.00 0.00 ? 44  SER A O    3  
ATOM 5390  C CB   . SER A 1 44  ? -3.321  6.347   -0.065  1.00 0.00 ? 44  SER A CB   3  
ATOM 5391  O OG   . SER A 1 44  ? -3.961  7.331   -0.874  1.00 0.00 ? 44  SER A OG   3  
ATOM 5392  H H    . SER A 1 44  ? -1.782  8.334   -0.068  1.00 0.00 ? 44  SER A H    3  
ATOM 5393  H HA   . SER A 1 44  ? -1.360  5.562   0.354   1.00 0.00 ? 44  SER A HA   3  
ATOM 5394  H HB2  . SER A 1 44  ? -3.775  5.373   -0.251  1.00 0.00 ? 44  SER A HB2  3  
ATOM 5395  H HB3  . SER A 1 44  ? -3.487  6.580   0.988   1.00 0.00 ? 44  SER A HB3  3  
ATOM 5396  H HG   . SER A 1 44  ? -3.718  8.246   -0.554  1.00 0.00 ? 44  SER A HG   3  
ATOM 5397  N N    . GLU A 1 45  ? -2.322  6.451   -2.688  1.00 0.00 ? 45  GLU A N    3  
ATOM 5398  C CA   . GLU A 1 45  ? -2.189  6.148   -4.104  1.00 0.00 ? 45  GLU A CA   3  
ATOM 5399  C C    . GLU A 1 45  ? -2.879  4.822   -4.429  1.00 0.00 ? 45  GLU A C    3  
ATOM 5400  O O    . GLU A 1 45  ? -3.095  4.501   -5.596  1.00 0.00 ? 45  GLU A O    3  
ATOM 5401  C CB   . GLU A 1 45  ? -0.717  6.117   -4.522  1.00 0.00 ? 45  GLU A CB   3  
ATOM 5402  C CG   . GLU A 1 45  ? -0.438  7.144   -5.620  1.00 0.00 ? 45  GLU A CG   3  
ATOM 5403  C CD   . GLU A 1 45  ? -0.670  6.541   -7.007  1.00 0.00 ? 45  GLU A CD   3  
ATOM 5404  O OE1  . GLU A 1 45  ? 0.297   5.958   -7.542  1.00 0.00 ? 45  GLU A OE1  3  
ATOM 5405  O OE2  . GLU A 1 45  ? -1.810  6.677   -7.501  1.00 0.00 ? 45  GLU A OE2  3  
ATOM 5406  H H    . GLU A 1 45  ? -3.015  7.137   -2.466  1.00 0.00 ? 45  GLU A H    3  
ATOM 5407  H HA   . GLU A 1 45  ? -2.690  6.964   -4.623  1.00 0.00 ? 45  GLU A HA   3  
ATOM 5408  H HB2  . GLU A 1 45  ? -0.085  6.322   -3.657  1.00 0.00 ? 45  GLU A HB2  3  
ATOM 5409  H HB3  . GLU A 1 45  ? -0.457  5.120   -4.876  1.00 0.00 ? 45  GLU A HB3  3  
ATOM 5410  H HG2  . GLU A 1 45  ? -1.083  8.012   -5.484  1.00 0.00 ? 45  GLU A HG2  3  
ATOM 5411  H HG3  . GLU A 1 45  ? 0.591   7.497   -5.541  1.00 0.00 ? 45  GLU A HG3  3  
ATOM 5412  N N    . GLY A 1 46  ? -3.206  4.088   -3.376  1.00 0.00 ? 46  GLY A N    3  
ATOM 5413  C CA   . GLY A 1 46  ? -3.867  2.803   -3.534  1.00 0.00 ? 46  GLY A CA   3  
ATOM 5414  C C    . GLY A 1 46  ? -3.358  1.792   -2.505  1.00 0.00 ? 46  GLY A C    3  
ATOM 5415  O O    . GLY A 1 46  ? -3.202  0.612   -2.814  1.00 0.00 ? 46  GLY A O    3  
ATOM 5416  H H    . GLY A 1 46  ? -3.026  4.355   -2.429  1.00 0.00 ? 46  GLY A H    3  
ATOM 5417  H HA2  . GLY A 1 46  ? -4.944  2.929   -3.424  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 5418  H HA3  . GLY A 1 46  ? -3.693  2.423   -4.540  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 5419  N N    . ALA A 1 47  ? -3.112  2.294   -1.303  1.00 0.00 ? 47  ALA A N    3  
ATOM 5420  C CA   . ALA A 1 47  ? -2.623  1.449   -0.226  1.00 0.00 ? 47  ALA A CA   3  
ATOM 5421  C C    . ALA A 1 47  ? -3.700  0.427   0.144   1.00 0.00 ? 47  ALA A C    3  
ATOM 5422  O O    . ALA A 1 47  ? -4.885  0.757   0.189   1.00 0.00 ? 47  ALA A O    3  
ATOM 5423  C CB   . ALA A 1 47  ? -2.216  2.321   0.962   1.00 0.00 ? 47  ALA A CB   3  
ATOM 5424  H H    . ALA A 1 47  ? -3.242  3.255   -1.060  1.00 0.00 ? 47  ALA A H    3  
ATOM 5425  H HA   . ALA A 1 47  ? -1.744  0.920   -0.592  1.00 0.00 ? 47  ALA A HA   3  
ATOM 5426  H HB1  . ALA A 1 47  ? -2.326  3.373   0.696   1.00 0.00 ? 47  ALA A HB1  3  
ATOM 5427  H HB2  . ALA A 1 47  ? -1.176  2.120   1.221   1.00 0.00 ? 47  ALA A HB2  3  
ATOM 5428  H HB3  . ALA A 1 47  ? -2.854  2.094   1.816   1.00 0.00 ? 47  ALA A HB3  3  
ATOM 5429  N N    . THR A 1 48  ? -3.251  -0.793  0.399   1.00 0.00 ? 48  THR A N    3  
ATOM 5430  C CA   . THR A 1 48  ? -4.162  -1.865  0.762   1.00 0.00 ? 48  THR A CA   3  
ATOM 5431  C C    . THR A 1 48  ? -5.100  -1.410  1.883   1.00 0.00 ? 48  THR A C    3  
ATOM 5432  O O    . THR A 1 48  ? -5.026  -0.269  2.334   1.00 0.00 ? 48  THR A O    3  
ATOM 5433  C CB   . THR A 1 48  ? -3.325  -3.092  1.131   1.00 0.00 ? 48  THR A CB   3  
ATOM 5434  O OG1  . THR A 1 48  ? -1.983  -2.685  0.877   1.00 0.00 ? 48  THR A OG1  3  
ATOM 5435  C CG2  . THR A 1 48  ? -3.548  -4.262  0.172   1.00 0.00 ? 48  THR A CG2  3  
ATOM 5436  H H    . THR A 1 48  ? -2.286  -1.054  0.359   1.00 0.00 ? 48  THR A H    3  
ATOM 5437  H HA   . THR A 1 48  ? -4.784  -2.095  -0.102  1.00 0.00 ? 48  THR A HA   3  
ATOM 5438  H HB   . THR A 1 48  ? -3.509  -3.393  2.162   1.00 0.00 ? 48  THR A HB   3  
ATOM 5439  H HG1  . THR A 1 48  ? -1.352  -3.426  1.108   1.00 0.00 ? 48  THR A HG1  3  
ATOM 5440  H HG21 . THR A 1 48  ? -4.535  -4.177  -0.282  1.00 0.00 ? 48  THR A HG21 3  
ATOM 5441  H HG22 . THR A 1 48  ? -2.786  -4.243  -0.607  1.00 0.00 ? 48  THR A HG22 3  
ATOM 5442  H HG23 . THR A 1 48  ? -3.481  -5.201  0.723   1.00 0.00 ? 48  THR A HG23 3  
ATOM 5443  N N    . PRO A 1 49  ? -5.984  -2.352  2.310   1.00 0.00 ? 49  PRO A N    3  
ATOM 5444  C CA   . PRO A 1 49  ? -6.936  -2.060  3.368   1.00 0.00 ? 49  PRO A CA   3  
ATOM 5445  C C    . PRO A 1 49  ? -6.246  -2.037  4.734   1.00 0.00 ? 49  PRO A C    3  
ATOM 5446  O O    . PRO A 1 49  ? -6.613  -1.249  5.605   1.00 0.00 ? 49  PRO A O    3  
ATOM 5447  C CB   . PRO A 1 49  ? -7.994  -3.144  3.255   1.00 0.00 ? 49  PRO A CB   3  
ATOM 5448  C CG   . PRO A 1 49  ? -7.361  -4.264  2.447   1.00 0.00 ? 49  PRO A CG   3  
ATOM 5449  C CD   . PRO A 1 49  ? -6.100  -3.714  1.799   1.00 0.00 ? 49  PRO A CD   3  
ATOM 5450  H HA   . PRO A 1 49  ? -7.324  -1.147  3.243   1.00 0.00 ? 49  PRO A HA   3  
ATOM 5451  H HB2  . PRO A 1 49  ? -8.298  -3.498  4.240   1.00 0.00 ? 49  PRO A HB2  3  
ATOM 5452  H HB3  . PRO A 1 49  ? -8.890  -2.765  2.763   1.00 0.00 ? 49  PRO A HB3  3  
ATOM 5453  H HG2  . PRO A 1 49  ? -7.121  -5.111  3.090   1.00 0.00 ? 49  PRO A HG2  3  
ATOM 5454  H HG3  . PRO A 1 49  ? -8.054  -4.626  1.687   1.00 0.00 ? 49  PRO A HG3  3  
ATOM 5455  H HD2  . PRO A 1 49  ? -5.227  -4.311  2.061   1.00 0.00 ? 49  PRO A HD2  3  
ATOM 5456  H HD3  . PRO A 1 49  ? -6.177  -3.724  0.711   1.00 0.00 ? 49  PRO A HD3  3  
ATOM 5457  N N    . GLN A 1 50  ? -5.260  -2.910  4.879   1.00 0.00 ? 50  GLN A N    3  
ATOM 5458  C CA   . GLN A 1 50  ? -4.516  -3.000  6.123   1.00 0.00 ? 50  GLN A CA   3  
ATOM 5459  C C    . GLN A 1 50  ? -3.528  -1.838  6.236   1.00 0.00 ? 50  GLN A C    3  
ATOM 5460  O O    . GLN A 1 50  ? -3.253  -1.357  7.334   1.00 0.00 ? 50  GLN A O    3  
ATOM 5461  C CB   . GLN A 1 50  ? -3.797  -4.346  6.236   1.00 0.00 ? 50  GLN A CB   3  
ATOM 5462  C CG   . GLN A 1 50  ? -4.092  -5.015  7.580   1.00 0.00 ? 50  GLN A CG   3  
ATOM 5463  C CD   . GLN A 1 50  ? -5.598  -5.184  7.789   1.00 0.00 ? 50  GLN A CD   3  
ATOM 5464  O OE1  . GLN A 1 50  ? -6.247  -4.412  8.475   1.00 0.00 ? 50  GLN A OE1  3  
ATOM 5465  N NE2  . GLN A 1 50  ? -6.116  -6.237  7.161   1.00 0.00 ? 50  GLN A NE2  3  
ATOM 5466  H H    . GLN A 1 50  ? -4.969  -3.547  4.165   1.00 0.00 ? 50  GLN A H    3  
ATOM 5467  H HA   . GLN A 1 50  ? -5.264  -2.929  6.913   1.00 0.00 ? 50  GLN A HA   3  
ATOM 5468  H HB2  . GLN A 1 50  ? -4.112  -5.001  5.423   1.00 0.00 ? 50  GLN A HB2  3  
ATOM 5469  H HB3  . GLN A 1 50  ? -2.722  -4.198  6.127   1.00 0.00 ? 50  GLN A HB3  3  
ATOM 5470  H HG2  . GLN A 1 50  ? -3.603  -5.989  7.620   1.00 0.00 ? 50  GLN A HG2  3  
ATOM 5471  H HG3  . GLN A 1 50  ? -3.674  -4.415  8.388   1.00 0.00 ? 50  GLN A HG3  3  
ATOM 5472  H HE21 . GLN A 1 50  ? -5.528  -6.832  6.614   1.00 0.00 ? 50  GLN A HE21 3  
ATOM 5473  H HE22 . GLN A 1 50  ? -7.093  -6.432  7.237   1.00 0.00 ? 50  GLN A HE22 3  
ATOM 5474  N N    . ASP A 1 51  ? -3.020  -1.421  5.085   1.00 0.00 ? 51  ASP A N    3  
ATOM 5475  C CA   . ASP A 1 51  ? -2.068  -0.325  5.041   1.00 0.00 ? 51  ASP A CA   3  
ATOM 5476  C C    . ASP A 1 51  ? -2.784  0.982   5.390   1.00 0.00 ? 51  ASP A C    3  
ATOM 5477  O O    . ASP A 1 51  ? -2.380  1.688   6.311   1.00 0.00 ? 51  ASP A O    3  
ATOM 5478  C CB   . ASP A 1 51  ? -1.464  -0.175  3.644   1.00 0.00 ? 51  ASP A CB   3  
ATOM 5479  C CG   . ASP A 1 51  ? -0.746  1.151   3.388   1.00 0.00 ? 51  ASP A CG   3  
ATOM 5480  O OD1  . ASP A 1 51  ? -1.410  2.197   3.556   1.00 0.00 ? 51  ASP A OD1  3  
ATOM 5481  O OD2  . ASP A 1 51  ? 0.450   1.089   3.030   1.00 0.00 ? 51  ASP A OD2  3  
ATOM 5482  H H    . ASP A 1 51  ? -3.249  -1.819  4.197   1.00 0.00 ? 51  ASP A H    3  
ATOM 5483  H HA   . ASP A 1 51  ? -1.298  -0.585  5.768   1.00 0.00 ? 51  ASP A HA   3  
ATOM 5484  H HB2  . ASP A 1 51  ? -0.759  -0.990  3.480   1.00 0.00 ? 51  ASP A HB2  3  
ATOM 5485  H HB3  . ASP A 1 51  ? -2.259  -0.289  2.908   1.00 0.00 ? 51  ASP A HB3  3  
ATOM 5486  N N    . LEU A 1 52  ? -3.836  1.262   4.633   1.00 0.00 ? 52  LEU A N    3  
ATOM 5487  C CA   . LEU A 1 52  ? -4.612  2.471   4.850   1.00 0.00 ? 52  LEU A CA   3  
ATOM 5488  C C    . LEU A 1 52  ? -5.155  2.473   6.280   1.00 0.00 ? 52  LEU A C    3  
ATOM 5489  O O    . LEU A 1 52  ? -5.052  3.476   6.986   1.00 0.00 ? 52  LEU A O    3  
ATOM 5490  C CB   . LEU A 1 52  ? -5.696  2.610   3.780   1.00 0.00 ? 52  LEU A CB   3  
ATOM 5491  C CG   . LEU A 1 52  ? -5.427  3.641   2.682   1.00 0.00 ? 52  LEU A CG   3  
ATOM 5492  C CD1  . LEU A 1 52  ? -6.460  3.528   1.559   1.00 0.00 ? 52  LEU A CD1  3  
ATOM 5493  C CD2  . LEU A 1 52  ? -5.364  5.056   3.261   1.00 0.00 ? 52  LEU A CD2  3  
ATOM 5494  H H    . LEU A 1 52  ? -4.158  0.682   3.886   1.00 0.00 ? 52  LEU A H    3  
ATOM 5495  H HA   . LEU A 1 52  ? -3.936  3.318   4.735   1.00 0.00 ? 52  LEU A HA   3  
ATOM 5496  H HB2  . LEU A 1 52  ? -5.842  1.637   3.310   1.00 0.00 ? 52  LEU A HB2  3  
ATOM 5497  H HB3  . LEU A 1 52  ? -6.633  2.869   4.272   1.00 0.00 ? 52  LEU A HB3  3  
ATOM 5498  H HG   . LEU A 1 52  ? -4.452  3.428   2.245   1.00 0.00 ? 52  LEU A HG   3  
ATOM 5499  H HD11 . LEU A 1 52  ? -7.373  3.078   1.948   1.00 0.00 ? 52  LEU A HD11 3  
ATOM 5500  H HD12 . LEU A 1 52  ? -6.683  4.521   1.168   1.00 0.00 ? 52  LEU A HD12 3  
ATOM 5501  H HD13 . LEU A 1 52  ? -6.060  2.904   0.759   1.00 0.00 ? 52  LEU A HD13 3  
ATOM 5502  H HD21 . LEU A 1 52  ? -5.890  5.081   4.216   1.00 0.00 ? 52  LEU A HD21 3  
ATOM 5503  H HD22 . LEU A 1 52  ? -4.323  5.340   3.413   1.00 0.00 ? 52  LEU A HD22 3  
ATOM 5504  H HD23 . LEU A 1 52  ? -5.835  5.754   2.569   1.00 0.00 ? 52  LEU A HD23 3  
ATOM 5505  N N    . ASN A 1 53  ? -5.721  1.340   6.667   1.00 0.00 ? 53  ASN A N    3  
ATOM 5506  C CA   . ASN A 1 53  ? -6.281  1.199   8.000   1.00 0.00 ? 53  ASN A CA   3  
ATOM 5507  C C    . ASN A 1 53  ? -5.204  1.522   9.037   1.00 0.00 ? 53  ASN A C    3  
ATOM 5508  O O    . ASN A 1 53  ? -5.474  2.201   10.026  1.00 0.00 ? 53  ASN A O    3  
ATOM 5509  C CB   . ASN A 1 53  ? -6.760  -0.233  8.247   1.00 0.00 ? 53  ASN A CB   3  
ATOM 5510  C CG   . ASN A 1 53  ? -7.403  -0.365  9.629   1.00 0.00 ? 53  ASN A CG   3  
ATOM 5511  O OD1  . ASN A 1 53  ? -6.756  -0.676  10.616  1.00 0.00 ? 53  ASN A OD1  3  
ATOM 5512  N ND2  . ASN A 1 53  ? -8.709  -0.113  9.645   1.00 0.00 ? 53  ASN A ND2  3  
ATOM 5513  H H    . ASN A 1 53  ? -5.802  0.529   6.086   1.00 0.00 ? 53  ASN A H    3  
ATOM 5514  H HA   . ASN A 1 53  ? -7.117  1.897   8.035   1.00 0.00 ? 53  ASN A HA   3  
ATOM 5515  H HB2  . ASN A 1 53  ? -7.480  -0.517  7.479   1.00 0.00 ? 53  ASN A HB2  3  
ATOM 5516  H HB3  . ASN A 1 53  ? -5.920  -0.922  8.166   1.00 0.00 ? 53  ASN A HB3  3  
ATOM 5517  H HD21 . ASN A 1 53  ? -9.181  0.137   8.799   1.00 0.00 ? 53  ASN A HD21 3  
ATOM 5518  H HD22 . ASN A 1 53  ? -9.220  -0.172  10.503  1.00 0.00 ? 53  ASN A HD22 3  
ATOM 5519  N N    . THR A 1 54  ? -4.005  1.021   8.774   1.00 0.00 ? 54  THR A N    3  
ATOM 5520  C CA   . THR A 1 54  ? -2.886  1.249   9.673   1.00 0.00 ? 54  THR A CA   3  
ATOM 5521  C C    . THR A 1 54  ? -2.603  2.746   9.804   1.00 0.00 ? 54  THR A C    3  
ATOM 5522  O O    . THR A 1 54  ? -2.392  3.248   10.906  1.00 0.00 ? 54  THR A O    3  
ATOM 5523  C CB   . THR A 1 54  ? -1.691  0.447   9.152   1.00 0.00 ? 54  THR A CB   3  
ATOM 5524  O OG1  . THR A 1 54  ? -1.665  -0.713  9.979   1.00 0.00 ? 54  THR A OG1  3  
ATOM 5525  C CG2  . THR A 1 54  ? -0.355  1.137   9.435   1.00 0.00 ? 54  THR A CG2  3  
ATOM 5526  H H    . THR A 1 54  ? -3.794  0.470   7.967   1.00 0.00 ? 54  THR A H    3  
ATOM 5527  H HA   . THR A 1 54  ? -3.162  0.889   10.664  1.00 0.00 ? 54  THR A HA   3  
ATOM 5528  H HB   . THR A 1 54  ? -1.801  0.231   8.089   1.00 0.00 ? 54  THR A HB   3  
ATOM 5529  H HG1  . THR A 1 54  ? -1.670  -0.446  10.943  1.00 0.00 ? 54  THR A HG1  3  
ATOM 5530  H HG21 . THR A 1 54  ? -0.397  1.624   10.409  1.00 0.00 ? 54  THR A HG21 3  
ATOM 5531  H HG22 . THR A 1 54  ? 0.444   0.397   9.434   1.00 0.00 ? 54  THR A HG22 3  
ATOM 5532  H HG23 . THR A 1 54  ? -0.162  1.882   8.664   1.00 0.00 ? 54  THR A HG23 3  
ATOM 5533  N N    . MET A 1 55  ? -2.607  3.419   8.661   1.00 0.00 ? 55  MET A N    3  
ATOM 5534  C CA   . MET A 1 55  ? -2.352  4.849   8.633   1.00 0.00 ? 55  MET A CA   3  
ATOM 5535  C C    . MET A 1 55  ? -3.421  5.611   9.419   1.00 0.00 ? 55  MET A C    3  
ATOM 5536  O O    . MET A 1 55  ? -3.124  6.617   10.063  1.00 0.00 ? 55  MET A O    3  
ATOM 5537  C CB   . MET A 1 55  ? -2.339  5.337   7.184   1.00 0.00 ? 55  MET A CB   3  
ATOM 5538  C CG   . MET A 1 55  ? -1.159  6.279   6.933   1.00 0.00 ? 55  MET A CG   3  
ATOM 5539  S SD   . MET A 1 55  ? -0.832  6.395   5.183   1.00 0.00 ? 55  MET A SD   3  
ATOM 5540  C CE   . MET A 1 55  ? -0.883  8.167   4.974   1.00 0.00 ? 55  MET A CE   3  
ATOM 5541  H H    . MET A 1 55  ? -2.779  3.002   7.768   1.00 0.00 ? 55  MET A H    3  
ATOM 5542  H HA   . MET A 1 55  ? -1.380  4.982   9.106   1.00 0.00 ? 55  MET A HA   3  
ATOM 5543  H HB2  . MET A 1 55  ? -2.276  4.484   6.509   1.00 0.00 ? 55  MET A HB2  3  
ATOM 5544  H HB3  . MET A 1 55  ? -3.274  5.852   6.962   1.00 0.00 ? 55  MET A HB3  3  
ATOM 5545  H HG2  . MET A 1 55  ? -1.381  7.268   7.336   1.00 0.00 ? 55  MET A HG2  3  
ATOM 5546  H HG3  . MET A 1 55  ? -0.275  5.914   7.454   1.00 0.00 ? 55  MET A HG3  3  
ATOM 5547  H HE1  . MET A 1 55  ? -0.894  8.647   5.952   1.00 0.00 ? 55  MET A HE1  3  
ATOM 5548  H HE2  . MET A 1 55  ? -0.005  8.494   4.418   1.00 0.00 ? 55  MET A HE2  3  
ATOM 5549  H HE3  . MET A 1 55  ? -1.784  8.441   4.423   1.00 0.00 ? 55  MET A HE3  3  
ATOM 5550  N N    . LEU A 1 56  ? -4.642  5.102   9.342   1.00 0.00 ? 56  LEU A N    3  
ATOM 5551  C CA   . LEU A 1 56  ? -5.757  5.722   10.038  1.00 0.00 ? 56  LEU A CA   3  
ATOM 5552  C C    . LEU A 1 56  ? -5.572  5.545   11.547  1.00 0.00 ? 56  LEU A C    3  
ATOM 5553  O O    . LEU A 1 56  ? -5.752  6.490   12.314  1.00 0.00 ? 56  LEU A O    3  
ATOM 5554  C CB   . LEU A 1 56  ? -7.086  5.178   9.512   1.00 0.00 ? 56  LEU A CB   3  
ATOM 5555  C CG   . LEU A 1 56  ? -7.380  5.441   8.034   1.00 0.00 ? 56  LEU A CG   3  
ATOM 5556  C CD1  . LEU A 1 56  ? -8.724  4.832   7.626   1.00 0.00 ? 56  LEU A CD1  3  
ATOM 5557  C CD2  . LEU A 1 56  ? -7.310  6.936   7.717   1.00 0.00 ? 56  LEU A CD2  3  
ATOM 5558  H H    . LEU A 1 56  ? -4.875  4.284   8.817   1.00 0.00 ? 56  LEU A H    3  
ATOM 5559  H HA   . LEU A 1 56  ? -5.731  6.788   9.810   1.00 0.00 ? 56  LEU A HA   3  
ATOM 5560  H HB2  . LEU A 1 56  ? -7.108  4.102   9.682   1.00 0.00 ? 56  LEU A HB2  3  
ATOM 5561  H HB3  . LEU A 1 56  ? -7.892  5.611   10.105  1.00 0.00 ? 56  LEU A HB3  3  
ATOM 5562  H HG   . LEU A 1 56  ? -6.610  4.948   7.440   1.00 0.00 ? 56  LEU A HG   3  
ATOM 5563  H HD11 . LEU A 1 56  ? -9.295  4.580   8.520   1.00 0.00 ? 56  LEU A HD11 3  
ATOM 5564  H HD12 . LEU A 1 56  ? -9.281  5.551   7.027   1.00 0.00 ? 56  LEU A HD12 3  
ATOM 5565  H HD13 . LEU A 1 56  ? -8.550  3.928   7.040   1.00 0.00 ? 56  LEU A HD13 3  
ATOM 5566  H HD21 . LEU A 1 56  ? -6.322  7.315   7.978   1.00 0.00 ? 56  LEU A HD21 3  
ATOM 5567  H HD22 . LEU A 1 56  ? -7.488  7.090   6.653   1.00 0.00 ? 56  LEU A HD22 3  
ATOM 5568  H HD23 . LEU A 1 56  ? -8.067  7.465   8.293   1.00 0.00 ? 56  LEU A HD23 3  
ATOM 5569  N N    . ASN A 1 57  ? -5.217  4.326   11.928  1.00 0.00 ? 57  ASN A N    3  
ATOM 5570  C CA   . ASN A 1 57  ? -5.007  4.013   13.330  1.00 0.00 ? 57  ASN A CA   3  
ATOM 5571  C C    . ASN A 1 57  ? -3.806  4.803   13.852  1.00 0.00 ? 57  ASN A C    3  
ATOM 5572  O O    . ASN A 1 57  ? -3.766  5.181   15.021  1.00 0.00 ? 57  ASN A O    3  
ATOM 5573  C CB   . ASN A 1 57  ? -4.713  2.523   13.524  1.00 0.00 ? 57  ASN A CB   3  
ATOM 5574  C CG   . ASN A 1 57  ? -5.234  2.033   14.876  1.00 0.00 ? 57  ASN A CG   3  
ATOM 5575  O OD1  . ASN A 1 57  ? -6.423  2.028   15.148  1.00 0.00 ? 57  ASN A OD1  3  
ATOM 5576  N ND2  . ASN A 1 57  ? -4.280  1.620   15.707  1.00 0.00 ? 57  ASN A ND2  3  
ATOM 5577  H H    . ASN A 1 57  ? -5.074  3.563   11.298  1.00 0.00 ? 57  ASN A H    3  
ATOM 5578  H HA   . ASN A 1 57  ? -5.936  4.290   13.828  1.00 0.00 ? 57  ASN A HA   3  
ATOM 5579  H HB2  . ASN A 1 57  ? -5.178  1.950   12.721  1.00 0.00 ? 57  ASN A HB2  3  
ATOM 5580  H HB3  . ASN A 1 57  ? -3.639  2.349   13.459  1.00 0.00 ? 57  ASN A HB3  3  
ATOM 5581  H HD21 . ASN A 1 57  ? -3.322  1.650   15.421  1.00 0.00 ? 57  ASN A HD21 3  
ATOM 5582  H HD22 . ASN A 1 57  ? -4.520  1.281   16.616  1.00 0.00 ? 57  ASN A HD22 3  
ATOM 5583  N N    . THR A 1 58  ? -2.854  5.031   12.957  1.00 0.00 ? 58  THR A N    3  
ATOM 5584  C CA   . THR A 1 58  ? -1.654  5.769   13.312  1.00 0.00 ? 58  THR A CA   3  
ATOM 5585  C C    . THR A 1 58  ? -2.008  7.206   13.700  1.00 0.00 ? 58  THR A C    3  
ATOM 5586  O O    . THR A 1 58  ? -1.420  7.766   14.622  1.00 0.00 ? 58  THR A O    3  
ATOM 5587  C CB   . THR A 1 58  ? -0.679  5.679   12.136  1.00 0.00 ? 58  THR A CB   3  
ATOM 5588  O OG1  . THR A 1 58  ? 0.245   4.669   12.529  1.00 0.00 ? 58  THR A OG1  3  
ATOM 5589  C CG2  . THR A 1 58  ? 0.181   6.936   11.992  1.00 0.00 ? 58  THR A CG2  3  
ATOM 5590  H H    . THR A 1 58  ? -2.894  4.719   12.008  1.00 0.00 ? 58  THR A H    3  
ATOM 5591  H HA   . THR A 1 58  ? -1.210  5.302   14.190  1.00 0.00 ? 58  THR A HA   3  
ATOM 5592  H HB   . THR A 1 58  ? -1.207  5.460   11.209  1.00 0.00 ? 58  THR A HB   3  
ATOM 5593  H HG1  . THR A 1 58  ? -0.187  3.768   12.474  1.00 0.00 ? 58  THR A HG1  3  
ATOM 5594  H HG21 . THR A 1 58  ? 0.638   7.176   12.953  1.00 0.00 ? 58  THR A HG21 3  
ATOM 5595  H HG22 . THR A 1 58  ? 0.962   6.758   11.253  1.00 0.00 ? 58  THR A HG22 3  
ATOM 5596  H HG23 . THR A 1 58  ? -0.443  7.768   11.668  1.00 0.00 ? 58  THR A HG23 3  
ATOM 5597  N N    . VAL A 1 59  ? -2.969  7.761   12.974  1.00 0.00 ? 59  VAL A N    3  
ATOM 5598  C CA   . VAL A 1 59  ? -3.407  9.122   13.229  1.00 0.00 ? 59  VAL A CA   3  
ATOM 5599  C C    . VAL A 1 59  ? -3.562  9.329   14.738  1.00 0.00 ? 59  VAL A C    3  
ATOM 5600  O O    . VAL A 1 59  ? -3.543  8.367   15.505  1.00 0.00 ? 59  VAL A O    3  
ATOM 5601  C CB   . VAL A 1 59  ? -4.692  9.413   12.451  1.00 0.00 ? 59  VAL A CB   3  
ATOM 5602  C CG1  . VAL A 1 59  ? -5.882  9.577   13.400  1.00 0.00 ? 59  VAL A CG1  3  
ATOM 5603  C CG2  . VAL A 1 59  ? -4.526  10.646  11.560  1.00 0.00 ? 59  VAL A CG2  3  
ATOM 5604  H H    . VAL A 1 59  ? -3.442  7.299   12.224  1.00 0.00 ? 59  VAL A H    3  
ATOM 5605  H HA   . VAL A 1 59  ? -2.631  9.794   12.862  1.00 0.00 ? 59  VAL A HA   3  
ATOM 5606  H HB   . VAL A 1 59  ? -4.893  8.559   11.806  1.00 0.00 ? 59  VAL A HB   3  
ATOM 5607  H HG11 . VAL A 1 59  ? -5.832  8.816   14.179  1.00 0.00 ? 59  VAL A HG11 3  
ATOM 5608  H HG12 . VAL A 1 59  ? -5.850  10.567  13.854  1.00 0.00 ? 59  VAL A HG12 3  
ATOM 5609  H HG13 . VAL A 1 59  ? -6.811  9.464   12.840  1.00 0.00 ? 59  VAL A HG13 3  
ATOM 5610  H HG21 . VAL A 1 59  ? -3.717  10.476  10.851  1.00 0.00 ? 59  VAL A HG21 3  
ATOM 5611  H HG22 . VAL A 1 59  ? -5.454  10.829  11.017  1.00 0.00 ? 59  VAL A HG22 3  
ATOM 5612  H HG23 . VAL A 1 59  ? -4.292  11.512  12.179  1.00 0.00 ? 59  VAL A HG23 3  
ATOM 5613  N N    . GLY A 1 60  ? -3.713  10.589  15.118  1.00 0.00 ? 60  GLY A N    3  
ATOM 5614  C CA   . GLY A 1 60  ? -3.870  10.933  16.521  1.00 0.00 ? 60  GLY A CA   3  
ATOM 5615  C C    . GLY A 1 60  ? -4.804  9.948   17.226  1.00 0.00 ? 60  GLY A C    3  
ATOM 5616  O O    . GLY A 1 60  ? -4.486  9.446   18.303  1.00 0.00 ? 60  GLY A O    3  
ATOM 5617  H H    . GLY A 1 60  ? -3.728  11.365  14.488  1.00 0.00 ? 60  GLY A H    3  
ATOM 5618  H HA2  . GLY A 1 60  ? -2.897  10.932  17.011  1.00 0.00 ? 60  GLY A HA2  3  
ATOM 5619  H HA3  . GLY A 1 60  ? -4.270  11.944  16.609  1.00 0.00 ? 60  GLY A HA3  3  
ATOM 5620  N N    . GLY A 1 61  ? -5.940  9.698   16.589  1.00 0.00 ? 61  GLY A N    3  
ATOM 5621  C CA   . GLY A 1 61  ? -6.922  8.782   17.142  1.00 0.00 ? 61  GLY A CA   3  
ATOM 5622  C C    . GLY A 1 61  ? -8.094  9.543   17.765  1.00 0.00 ? 61  GLY A C    3  
ATOM 5623  O O    . GLY A 1 61  ? -8.418  9.342   18.935  1.00 0.00 ? 61  GLY A O    3  
ATOM 5624  H H    . GLY A 1 61  ? -6.192  10.111  15.714  1.00 0.00 ? 61  GLY A H    3  
ATOM 5625  H HA2  . GLY A 1 61  ? -7.290  8.120   16.357  1.00 0.00 ? 61  GLY A HA2  3  
ATOM 5626  H HA3  . GLY A 1 61  ? -6.452  8.150   17.896  1.00 0.00 ? 61  GLY A HA3  3  
ATOM 5627  N N    . HIS A 1 62  ? -8.697  10.403  16.956  1.00 0.00 ? 62  HIS A N    3  
ATOM 5628  C CA   . HIS A 1 62  ? -9.825  11.195  17.414  1.00 0.00 ? 62  HIS A CA   3  
ATOM 5629  C C    . HIS A 1 62  ? -11.129 10.454  17.112  1.00 0.00 ? 62  HIS A C    3  
ATOM 5630  O O    . HIS A 1 62  ? -11.346 10.005  15.988  1.00 0.00 ? 62  HIS A O    3  
ATOM 5631  C CB   . HIS A 1 62  ? -9.786  12.598  16.805  1.00 0.00 ? 62  HIS A CB   3  
ATOM 5632  C CG   . HIS A 1 62  ? -8.403  13.201  16.740  1.00 0.00 ? 62  HIS A CG   3  
ATOM 5633  N ND1  . HIS A 1 62  ? -8.009  14.066  15.733  1.00 0.00 ? 62  HIS A ND1  3  
ATOM 5634  C CD2  . HIS A 1 62  ? -7.328  13.056  17.566  1.00 0.00 ? 62  HIS A CD2  3  
ATOM 5635  C CE1  . HIS A 1 62  ? -6.751  14.418  15.953  1.00 0.00 ? 62  HIS A CE1  3  
ATOM 5636  N NE2  . HIS A 1 62  ? -6.330  13.791  17.089  1.00 0.00 ? 62  HIS A NE2  3  
ATOM 5637  H H    . HIS A 1 62  ? -8.426  10.560  16.007  1.00 0.00 ? 62  HIS A H    3  
ATOM 5638  H HA   . HIS A 1 62  ? -9.718  11.298  18.494  1.00 0.00 ? 62  HIS A HA   3  
ATOM 5639  H HB2  . HIS A 1 62  ? -10.201 12.557  15.797  1.00 0.00 ? 62  HIS A HB2  3  
ATOM 5640  H HB3  . HIS A 1 62  ? -10.431 13.255  17.389  1.00 0.00 ? 62  HIS A HB3  3  
ATOM 5641  H HD1  . HIS A 1 62  ? -8.577  14.372  14.970  1.00 0.00 ? 62  HIS A HD1  3  
ATOM 5642  H HD2  . HIS A 1 62  ? -7.293  12.441  18.464  1.00 0.00 ? 62  HIS A HD2  3  
ATOM 5643  H HE1  . HIS A 1 62  ? -6.157  15.091  15.336  1.00 0.00 ? 62  HIS A HE1  3  
ATOM 5644  H HE2  . HIS A 1 62  ? -5.440  13.916  17.527  1.00 0.00 ? 62  HIS A HE2  3  
ATOM 5645  N N    . GLN A 1 63  ? -11.963 10.348  18.136  1.00 0.00 ? 63  GLN A N    3  
ATOM 5646  C CA   . GLN A 1 63  ? -13.239 9.669   17.996  1.00 0.00 ? 63  GLN A CA   3  
ATOM 5647  C C    . GLN A 1 63  ? -14.168 10.469  17.081  1.00 0.00 ? 63  GLN A C    3  
ATOM 5648  O O    . GLN A 1 63  ? -14.951 9.893   16.327  1.00 0.00 ? 63  GLN A O    3  
ATOM 5649  C CB   . GLN A 1 63  ? -13.887 9.429   19.361  1.00 0.00 ? 63  GLN A CB   3  
ATOM 5650  C CG   . GLN A 1 63  ? -14.432 8.004   19.467  1.00 0.00 ? 63  GLN A CG   3  
ATOM 5651  C CD   . GLN A 1 63  ? -14.805 7.665   20.911  1.00 0.00 ? 63  GLN A CD   3  
ATOM 5652  O OE1  . GLN A 1 63  ? -14.398 8.322   21.855  1.00 0.00 ? 63  GLN A OE1  3  
ATOM 5653  N NE2  . GLN A 1 63  ? -15.600 6.606   21.031  1.00 0.00 ? 63  GLN A NE2  3  
ATOM 5654  H H    . GLN A 1 63  ? -11.778 10.716  19.048  1.00 0.00 ? 63  GLN A H    3  
ATOM 5655  H HA   . GLN A 1 63  ? -13.007 8.707   17.537  1.00 0.00 ? 63  GLN A HA   3  
ATOM 5656  H HB2  . GLN A 1 63  ? -13.155 9.602   20.150  1.00 0.00 ? 63  GLN A HB2  3  
ATOM 5657  H HB3  . GLN A 1 63  ? -14.695 10.144  19.514  1.00 0.00 ? 63  GLN A HB3  3  
ATOM 5658  H HG2  . GLN A 1 63  ? -15.308 7.896   18.826  1.00 0.00 ? 63  GLN A HG2  3  
ATOM 5659  H HG3  . GLN A 1 63  ? -13.685 7.297   19.106  1.00 0.00 ? 63  GLN A HG3  3  
ATOM 5660  H HE21 . GLN A 1 63  ? -15.899 6.110   20.215  1.00 0.00 ? 63  GLN A HE21 3  
ATOM 5661  H HE22 . GLN A 1 63  ? -15.900 6.305   21.936  1.00 0.00 ? 63  GLN A HE22 3  
ATOM 5662  N N    . ALA A 1 64  ? -14.050 11.786  17.176  1.00 0.00 ? 64  ALA A N    3  
ATOM 5663  C CA   . ALA A 1 64  ? -14.870 12.671  16.367  1.00 0.00 ? 64  ALA A CA   3  
ATOM 5664  C C    . ALA A 1 64  ? -14.456 12.542  14.900  1.00 0.00 ? 64  ALA A C    3  
ATOM 5665  O O    . ALA A 1 64  ? -15.301 12.351  14.027  1.00 0.00 ? 64  ALA A O    3  
ATOM 5666  C CB   . ALA A 1 64  ? -14.739 14.105  16.886  1.00 0.00 ? 64  ALA A CB   3  
ATOM 5667  H H    . ALA A 1 64  ? -13.411 12.246  17.792  1.00 0.00 ? 64  ALA A H    3  
ATOM 5668  H HA   . ALA A 1 64  ? -15.907 12.353  16.473  1.00 0.00 ? 64  ALA A HA   3  
ATOM 5669  H HB1  . ALA A 1 64  ? -15.073 14.147  17.923  1.00 0.00 ? 64  ALA A HB1  3  
ATOM 5670  H HB2  . ALA A 1 64  ? -15.354 14.768  16.278  1.00 0.00 ? 64  ALA A HB2  3  
ATOM 5671  H HB3  . ALA A 1 64  ? -13.697 14.419  16.826  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 5672  N N    . ALA A 1 65  ? -13.156 12.653  14.672  1.00 0.00 ? 65  ALA A N    3  
ATOM 5673  C CA   . ALA A 1 65  ? -12.619 12.552  13.326  1.00 0.00 ? 65  ALA A CA   3  
ATOM 5674  C C    . ALA A 1 65  ? -12.955 11.174  12.751  1.00 0.00 ? 65  ALA A C    3  
ATOM 5675  O O    . ALA A 1 65  ? -13.528 11.072  11.667  1.00 0.00 ? 65  ALA A O    3  
ATOM 5676  C CB   . ALA A 1 65  ? -11.114 12.821  13.354  1.00 0.00 ? 65  ALA A CB   3  
ATOM 5677  H H    . ALA A 1 65  ? -12.474 12.809  15.388  1.00 0.00 ? 65  ALA A H    3  
ATOM 5678  H HA   . ALA A 1 65  ? -13.102 13.317  12.719  1.00 0.00 ? 65  ALA A HA   3  
ATOM 5679  H HB1  . ALA A 1 65  ? -10.584 11.900  13.596  1.00 0.00 ? 65  ALA A HB1  3  
ATOM 5680  H HB2  . ALA A 1 65  ? -10.790 13.180  12.378  1.00 0.00 ? 65  ALA A HB2  3  
ATOM 5681  H HB3  . ALA A 1 65  ? -10.894 13.576  14.110  1.00 0.00 ? 65  ALA A HB3  3  
ATOM 5682  N N    . MET A 1 66  ? -12.583 10.148  13.502  1.00 0.00 ? 66  MET A N    3  
ATOM 5683  C CA   . MET A 1 66  ? -12.837 8.781   13.081  1.00 0.00 ? 66  MET A CA   3  
ATOM 5684  C C    . MET A 1 66  ? -14.332 8.541   12.868  1.00 0.00 ? 66  MET A C    3  
ATOM 5685  O O    . MET A 1 66  ? -14.726 7.828   11.947  1.00 0.00 ? 66  MET A O    3  
ATOM 5686  C CB   . MET A 1 66  ? -12.310 7.813   14.143  1.00 0.00 ? 66  MET A CB   3  
ATOM 5687  C CG   . MET A 1 66  ? -10.854 7.437   13.869  1.00 0.00 ? 66  MET A CG   3  
ATOM 5688  S SD   . MET A 1 66  ? -10.724 6.606   12.294  1.00 0.00 ? 66  MET A SD   3  
ATOM 5689  C CE   . MET A 1 66  ? -9.232  7.359   11.669  1.00 0.00 ? 66  MET A CE   3  
ATOM 5690  H H    . MET A 1 66  ? -12.117 10.239  14.382  1.00 0.00 ? 66  MET A H    3  
ATOM 5691  H HA   . MET A 1 66  ? -12.304 8.661   12.138  1.00 0.00 ? 66  MET A HA   3  
ATOM 5692  H HB2  . MET A 1 66  ? -12.392 8.270   15.129  1.00 0.00 ? 66  MET A HB2  3  
ATOM 5693  H HB3  . MET A 1 66  ? -12.927 6.914   14.157  1.00 0.00 ? 66  MET A HB3  3  
ATOM 5694  H HG2  . MET A 1 66  ? -10.232 8.331   13.869  1.00 0.00 ? 66  MET A HG2  3  
ATOM 5695  H HG3  . MET A 1 66  ? -10.480 6.789   14.663  1.00 0.00 ? 66  MET A HG3  3  
ATOM 5696  H HE1  . MET A 1 66  ? -9.033  8.281   12.216  1.00 0.00 ? 66  MET A HE1  3  
ATOM 5697  H HE2  . MET A 1 66  ? -8.396  6.672   11.798  1.00 0.00 ? 66  MET A HE2  3  
ATOM 5698  H HE3  . MET A 1 66  ? -9.356  7.585   10.609  1.00 0.00 ? 66  MET A HE3  3  
ATOM 5699  N N    . GLN A 1 67  ? -15.126 9.152   13.735  1.00 0.00 ? 67  GLN A N    3  
ATOM 5700  C CA   . GLN A 1 67  ? -16.571 9.014   13.654  1.00 0.00 ? 67  GLN A CA   3  
ATOM 5701  C C    . GLN A 1 67  ? -17.074 9.503   12.295  1.00 0.00 ? 67  GLN A C    3  
ATOM 5702  O O    . GLN A 1 67  ? -17.800 8.790   11.604  1.00 0.00 ? 67  GLN A O    3  
ATOM 5703  C CB   . GLN A 1 67  ? -17.258 9.764   14.796  1.00 0.00 ? 67  GLN A CB   3  
ATOM 5704  C CG   . GLN A 1 67  ? -18.780 9.734   14.634  1.00 0.00 ? 67  GLN A CG   3  
ATOM 5705  C CD   . GLN A 1 67  ? -19.428 8.856   15.706  1.00 0.00 ? 67  GLN A CD   3  
ATOM 5706  O OE1  . GLN A 1 67  ? -19.691 9.283   16.819  1.00 0.00 ? 67  GLN A OE1  3  
ATOM 5707  N NE2  . GLN A 1 67  ? -19.670 7.610   15.312  1.00 0.00 ? 67  GLN A NE2  3  
ATOM 5708  H H    . GLN A 1 67  ? -14.799 9.730   14.482  1.00 0.00 ? 67  GLN A H    3  
ATOM 5709  H HA   . GLN A 1 67  ? -16.766 7.947   13.758  1.00 0.00 ? 67  GLN A HA   3  
ATOM 5710  H HB2  . GLN A 1 67  ? -16.982 9.315   15.749  1.00 0.00 ? 67  GLN A HB2  3  
ATOM 5711  H HB3  . GLN A 1 67  ? -16.912 10.798  14.818  1.00 0.00 ? 67  GLN A HB3  3  
ATOM 5712  H HG2  . GLN A 1 67  ? -19.176 10.748  14.700  1.00 0.00 ? 67  GLN A HG2  3  
ATOM 5713  H HG3  . GLN A 1 67  ? -19.037 9.355   13.645  1.00 0.00 ? 67  GLN A HG3  3  
ATOM 5714  H HE21 . GLN A 1 67  ? -19.429 7.323   14.385  1.00 0.00 ? 67  GLN A HE21 3  
ATOM 5715  H HE22 . GLN A 1 67  ? -20.092 6.959   15.943  1.00 0.00 ? 67  GLN A HE22 3  
ATOM 5716  N N    . MET A 1 68  ? -16.668 10.717  11.950  1.00 0.00 ? 68  MET A N    3  
ATOM 5717  C CA   . MET A 1 68  ? -17.070 11.309  10.686  1.00 0.00 ? 68  MET A CA   3  
ATOM 5718  C C    . MET A 1 68  ? -16.602 10.455  9.507   1.00 0.00 ? 68  MET A C    3  
ATOM 5719  O O    . MET A 1 68  ? -17.339 10.267  8.540   1.00 0.00 ? 68  MET A O    3  
ATOM 5720  C CB   . MET A 1 68  ? -16.473 12.714  10.568  1.00 0.00 ? 68  MET A CB   3  
ATOM 5721  C CG   . MET A 1 68  ? -17.509 13.781  10.922  1.00 0.00 ? 68  MET A CG   3  
ATOM 5722  S SD   . MET A 1 68  ? -16.917 14.783  12.275  1.00 0.00 ? 68  MET A SD   3  
ATOM 5723  C CE   . MET A 1 68  ? -15.501 15.546  11.500  1.00 0.00 ? 68  MET A CE   3  
ATOM 5724  H H    . MET A 1 68  ? -16.078 11.291  12.518  1.00 0.00 ? 68  MET A H    3  
ATOM 5725  H HA   . MET A 1 68  ? -18.159 11.343  10.711  1.00 0.00 ? 68  MET A HA   3  
ATOM 5726  H HB2  . MET A 1 68  ? -15.612 12.802  11.230  1.00 0.00 ? 68  MET A HB2  3  
ATOM 5727  H HB3  . MET A 1 68  ? -16.111 12.875  9.552   1.00 0.00 ? 68  MET A HB3  3  
ATOM 5728  H HG2  . MET A 1 68  ? -17.707 14.410  10.053  1.00 0.00 ? 68  MET A HG2  3  
ATOM 5729  H HG3  . MET A 1 68  ? -18.453 13.308  11.195  1.00 0.00 ? 68  MET A HG3  3  
ATOM 5730  H HE1  . MET A 1 68  ? -15.097 14.874  10.741  1.00 0.00 ? 68  MET A HE1  3  
ATOM 5731  H HE2  . MET A 1 68  ? -15.804 16.483  11.032  1.00 0.00 ? 68  MET A HE2  3  
ATOM 5732  H HE3  . MET A 1 68  ? -14.738 15.745  12.252  1.00 0.00 ? 68  MET A HE3  3  
ATOM 5733  N N    . LEU A 1 69  ? -15.378 9.959   9.625   1.00 0.00 ? 69  LEU A N    3  
ATOM 5734  C CA   . LEU A 1 69  ? -14.803 9.128   8.580   1.00 0.00 ? 69  LEU A CA   3  
ATOM 5735  C C    . LEU A 1 69  ? -15.586 7.817   8.489   1.00 0.00 ? 69  LEU A C    3  
ATOM 5736  O O    . LEU A 1 69  ? -15.749 7.262   7.403   1.00 0.00 ? 69  LEU A O    3  
ATOM 5737  C CB   . LEU A 1 69  ? -13.304 8.934   8.816   1.00 0.00 ? 69  LEU A CB   3  
ATOM 5738  C CG   . LEU A 1 69  ? -12.513 8.341   7.648   1.00 0.00 ? 69  LEU A CG   3  
ATOM 5739  C CD1  . LEU A 1 69  ? -11.144 9.011   7.515   1.00 0.00 ? 69  LEU A CD1  3  
ATOM 5740  C CD2  . LEU A 1 69  ? -12.398 6.821   7.780   1.00 0.00 ? 69  LEU A CD2  3  
ATOM 5741  H H    . LEU A 1 69  ? -14.785 10.117  10.414  1.00 0.00 ? 69  LEU A H    3  
ATOM 5742  H HA   . LEU A 1 69  ? -14.915 9.665   7.638   1.00 0.00 ? 69  LEU A HA   3  
ATOM 5743  H HB2  . LEU A 1 69  ? -12.868 9.900   9.069   1.00 0.00 ? 69  LEU A HB2  3  
ATOM 5744  H HB3  . LEU A 1 69  ? -13.172 8.288   9.683   1.00 0.00 ? 69  LEU A HB3  3  
ATOM 5745  H HG   . LEU A 1 69  ? -13.061 8.543   6.727   1.00 0.00 ? 69  LEU A HG   3  
ATOM 5746  H HD11 . LEU A 1 69  ? -10.985 9.682   8.359   1.00 0.00 ? 69  LEU A HD11 3  
ATOM 5747  H HD12 . LEU A 1 69  ? -10.366 8.247   7.506   1.00 0.00 ? 69  LEU A HD12 3  
ATOM 5748  H HD13 . LEU A 1 69  ? -11.106 9.580   6.586   1.00 0.00 ? 69  LEU A HD13 3  
ATOM 5749  H HD21 . LEU A 1 69  ? -13.302 6.426   8.243   1.00 0.00 ? 69  LEU A HD21 3  
ATOM 5750  H HD22 . LEU A 1 69  ? -12.273 6.379   6.792   1.00 0.00 ? 69  LEU A HD22 3  
ATOM 5751  H HD23 . LEU A 1 69  ? -11.536 6.576   8.400   1.00 0.00 ? 69  LEU A HD23 3  
ATOM 5752  N N    . LYS A 1 70  ? -16.050 7.360   9.642   1.00 0.00 ? 70  LYS A N    3  
ATOM 5753  C CA   . LYS A 1 70  ? -16.812 6.125   9.706   1.00 0.00 ? 70  LYS A CA   3  
ATOM 5754  C C    . LYS A 1 70  ? -18.111 6.290   8.915   1.00 0.00 ? 70  LYS A C    3  
ATOM 5755  O O    . LYS A 1 70  ? -18.452 5.444   8.091   1.00 0.00 ? 70  LYS A O    3  
ATOM 5756  C CB   . LYS A 1 70  ? -17.027 5.702   11.161  1.00 0.00 ? 70  LYS A CB   3  
ATOM 5757  C CG   . LYS A 1 70  ? -15.982 4.670   11.592  1.00 0.00 ? 70  LYS A CG   3  
ATOM 5758  C CD   . LYS A 1 70  ? -16.204 4.239   13.042  1.00 0.00 ? 70  LYS A CD   3  
ATOM 5759  C CE   . LYS A 1 70  ? -15.258 3.099   13.426  1.00 0.00 ? 70  LYS A CE   3  
ATOM 5760  N NZ   . LYS A 1 70  ? -14.741 3.294   14.800  1.00 0.00 ? 70  LYS A NZ   3  
ATOM 5761  H H    . LYS A 1 70  ? -15.914 7.818   10.521  1.00 0.00 ? 70  LYS A H    3  
ATOM 5762  H HA   . LYS A 1 70  ? -16.215 5.348   9.229   1.00 0.00 ? 70  LYS A HA   3  
ATOM 5763  H HB2  . LYS A 1 70  ? -16.970 6.576   11.810  1.00 0.00 ? 70  LYS A HB2  3  
ATOM 5764  H HB3  . LYS A 1 70  ? -18.027 5.283   11.277  1.00 0.00 ? 70  LYS A HB3  3  
ATOM 5765  H HG2  . LYS A 1 70  ? -16.034 3.800   10.937  1.00 0.00 ? 70  LYS A HG2  3  
ATOM 5766  H HG3  . LYS A 1 70  ? -14.983 5.092   11.482  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 5767  H HD2  . LYS A 1 70  ? -16.045 5.088   13.707  1.00 0.00 ? 70  LYS A HD2  3  
ATOM 5768  H HD3  . LYS A 1 70  ? -17.238 3.917   13.177  1.00 0.00 ? 70  LYS A HD3  3  
ATOM 5769  H HE2  . LYS A 1 70  ? -15.781 2.145   13.361  1.00 0.00 ? 70  LYS A HE2  3  
ATOM 5770  H HE3  . LYS A 1 70  ? -14.427 3.055   12.722  1.00 0.00 ? 70  LYS A HE3  3  
ATOM 5771  H HZ1  . LYS A 1 70  ? -14.600 4.270   14.967  1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 5772  H HZ2  . LYS A 1 70  ? -15.403 2.936   15.459  1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 5773  H HZ3  . LYS A 1 70  ? -13.873 2.809   14.902  1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 5774  N N    . GLU A 1 71  ? -18.801 7.387   9.196   1.00 0.00 ? 71  GLU A N    3  
ATOM 5775  C CA   . GLU A 1 71  ? -20.055 7.674   8.521   1.00 0.00 ? 71  GLU A CA   3  
ATOM 5776  C C    . GLU A 1 71  ? -19.822 7.857   7.021   1.00 0.00 ? 71  GLU A C    3  
ATOM 5777  O O    . GLU A 1 71  ? -20.587 7.347   6.202   1.00 0.00 ? 71  GLU A O    3  
ATOM 5778  C CB   . GLU A 1 71  ? -20.732 8.907   9.124   1.00 0.00 ? 71  GLU A CB   3  
ATOM 5779  C CG   . GLU A 1 71  ? -21.925 8.507   9.995   1.00 0.00 ? 71  GLU A CG   3  
ATOM 5780  C CD   . GLU A 1 71  ? -23.085 9.488   9.822   1.00 0.00 ? 71  GLU A CD   3  
ATOM 5781  O OE1  . GLU A 1 71  ? -23.058 10.528  10.515  1.00 0.00 ? 71  GLU A OE1  3  
ATOM 5782  O OE2  . GLU A 1 71  ? -23.973 9.177   8.998   1.00 0.00 ? 71  GLU A OE2  3  
ATOM 5783  H H    . GLU A 1 71  ? -18.517 8.070   9.868   1.00 0.00 ? 71  GLU A H    3  
ATOM 5784  H HA   . GLU A 1 71  ? -20.685 6.800   8.694   1.00 0.00 ? 71  GLU A HA   3  
ATOM 5785  H HB2  . GLU A 1 71  ? -20.012 9.466   9.722   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 5786  H HB3  . GLU A 1 71  ? -21.066 9.570   8.326   1.00 0.00 ? 71  GLU A HB3  3  
ATOM 5787  H HG2  . GLU A 1 71  ? -22.252 7.501   9.731   1.00 0.00 ? 71  GLU A HG2  3  
ATOM 5788  H HG3  . GLU A 1 71  ? -21.622 8.478   11.041  1.00 0.00 ? 71  GLU A HG3  3  
ATOM 5789  N N    . THR A 1 72  ? -18.760 8.585   6.703   1.00 0.00 ? 72  THR A N    3  
ATOM 5790  C CA   . THR A 1 72  ? -18.416 8.841   5.316   1.00 0.00 ? 72  THR A CA   3  
ATOM 5791  C C    . THR A 1 72  ? -18.168 7.524   4.576   1.00 0.00 ? 72  THR A C    3  
ATOM 5792  O O    . THR A 1 72  ? -18.854 7.216   3.602   1.00 0.00 ? 72  THR A O    3  
ATOM 5793  C CB   . THR A 1 72  ? -17.214 9.786   5.293   1.00 0.00 ? 72  THR A CB   3  
ATOM 5794  O OG1  . THR A 1 72  ? -17.783 11.066  5.030   1.00 0.00 ? 72  THR A OG1  3  
ATOM 5795  C CG2  . THR A 1 72  ? -16.293 9.535   4.097   1.00 0.00 ? 72  THR A CG2  3  
ATOM 5796  H H    . THR A 1 72  ? -18.143 8.995   7.375   1.00 0.00 ? 72  THR A H    3  
ATOM 5797  H HA   . THR A 1 72  ? -19.267 9.322   4.833   1.00 0.00 ? 72  THR A HA   3  
ATOM 5798  H HB   . THR A 1 72  ? -16.659 9.732   6.230   1.00 0.00 ? 72  THR A HB   3  
ATOM 5799  H HG1  . THR A 1 72  ? -18.369 11.019  4.221   1.00 0.00 ? 72  THR A HG1  3  
ATOM 5800  H HG21 . THR A 1 72  ? -16.862 9.070   3.292   1.00 0.00 ? 72  THR A HG21 3  
ATOM 5801  H HG22 . THR A 1 72  ? -15.880 10.482  3.751   1.00 0.00 ? 72  THR A HG22 3  
ATOM 5802  H HG23 . THR A 1 72  ? -15.480 8.873   4.397   1.00 0.00 ? 72  THR A HG23 3  
ATOM 5803  N N    . ILE A 1 73  ? -17.184 6.783   5.066   1.00 0.00 ? 73  ILE A N    3  
ATOM 5804  C CA   . ILE A 1 73  ? -16.837 5.507   4.464   1.00 0.00 ? 73  ILE A CA   3  
ATOM 5805  C C    . ILE A 1 73  ? -18.111 4.690   4.241   1.00 0.00 ? 73  ILE A C    3  
ATOM 5806  O O    . ILE A 1 73  ? -18.354 4.202   3.138   1.00 0.00 ? 73  ILE A O    3  
ATOM 5807  C CB   . ILE A 1 73  ? -15.784 4.787   5.308   1.00 0.00 ? 73  ILE A CB   3  
ATOM 5808  C CG1  . ILE A 1 73  ? -14.413 5.450   5.159   1.00 0.00 ? 73  ILE A CG1  3  
ATOM 5809  C CG2  . ILE A 1 73  ? -15.739 3.295   4.971   1.00 0.00 ? 73  ILE A CG2  3  
ATOM 5810  C CD1  . ILE A 1 73  ? -13.601 4.786   4.045   1.00 0.00 ? 73  ILE A CD1  3  
ATOM 5811  H H    . ILE A 1 73  ? -16.631 7.042   5.858   1.00 0.00 ? 73  ILE A H    3  
ATOM 5812  H HA   . ILE A 1 73  ? -16.386 5.716   3.495   1.00 0.00 ? 73  ILE A HA   3  
ATOM 5813  H HB   . ILE A 1 73  ? -16.070 4.871   6.356   1.00 0.00 ? 73  ILE A HB   3  
ATOM 5814  H HG12 . ILE A 1 73  ? -14.541 6.510   4.938   1.00 0.00 ? 73  ILE A HG12 3  
ATOM 5815  H HG13 . ILE A 1 73  ? -13.868 5.383   6.100   1.00 0.00 ? 73  ILE A HG13 3  
ATOM 5816  H HG21 . ILE A 1 73  ? -16.000 3.152   3.922   1.00 0.00 ? 73  ILE A HG21 3  
ATOM 5817  H HG22 . ILE A 1 73  ? -14.734 2.912   5.150   1.00 0.00 ? 73  ILE A HG22 3  
ATOM 5818  H HG23 . ILE A 1 73  ? -16.449 2.759   5.600   1.00 0.00 ? 73  ILE A HG23 3  
ATOM 5819  H HD11 . ILE A 1 73  ? -14.276 4.277   3.357   1.00 0.00 ? 73  ILE A HD11 3  
ATOM 5820  H HD12 . ILE A 1 73  ? -13.035 5.545   3.505   1.00 0.00 ? 73  ILE A HD12 3  
ATOM 5821  H HD13 . ILE A 1 73  ? -12.912 4.061   4.480   1.00 0.00 ? 73  ILE A HD13 3  
ATOM 5822  N N    . ASN A 1 74  ? -18.891 4.567   5.305   1.00 0.00 ? 74  ASN A N    3  
ATOM 5823  C CA   . ASN A 1 74  ? -20.133 3.817   5.238   1.00 0.00 ? 74  ASN A CA   3  
ATOM 5824  C C    . ASN A 1 74  ? -21.030 4.418   4.154   1.00 0.00 ? 74  ASN A C    3  
ATOM 5825  O O    . ASN A 1 74  ? -21.806 3.706   3.519   1.00 0.00 ? 74  ASN A O    3  
ATOM 5826  C CB   . ASN A 1 74  ? -20.889 3.885   6.566   1.00 0.00 ? 74  ASN A CB   3  
ATOM 5827  C CG   . ASN A 1 74  ? -21.686 2.601   6.811   1.00 0.00 ? 74  ASN A CG   3  
ATOM 5828  O OD1  . ASN A 1 74  ? -21.248 1.689   7.494   1.00 0.00 ? 74  ASN A OD1  3  
ATOM 5829  N ND2  . ASN A 1 74  ? -22.875 2.580   6.216   1.00 0.00 ? 74  ASN A ND2  3  
ATOM 5830  H H    . ASN A 1 74  ? -18.686 4.967   6.198   1.00 0.00 ? 74  ASN A H    3  
ATOM 5831  H HA   . ASN A 1 74  ? -19.838 2.792   5.014   1.00 0.00 ? 74  ASN A HA   3  
ATOM 5832  H HB2  . ASN A 1 74  ? -20.184 4.040   7.383   1.00 0.00 ? 74  ASN A HB2  3  
ATOM 5833  H HB3  . ASN A 1 74  ? -21.565 4.741   6.562   1.00 0.00 ? 74  ASN A HB3  3  
ATOM 5834  H HD21 . ASN A 1 74  ? -23.173 3.363   5.668   1.00 0.00 ? 74  ASN A HD21 3  
ATOM 5835  H HD22 . ASN A 1 74  ? -23.470 1.783   6.316   1.00 0.00 ? 74  ASN A HD22 3  
ATOM 5836  N N    . GLU A 1 75  ? -20.893 5.724   3.974   1.00 0.00 ? 75  GLU A N    3  
ATOM 5837  C CA   . GLU A 1 75  ? -21.681 6.429   2.978   1.00 0.00 ? 75  GLU A CA   3  
ATOM 5838  C C    . GLU A 1 75  ? -21.323 5.937   1.574   1.00 0.00 ? 75  GLU A C    3  
ATOM 5839  O O    . GLU A 1 75  ? -22.157 5.350   0.887   1.00 0.00 ? 75  GLU A O    3  
ATOM 5840  C CB   . GLU A 1 75  ? -21.486 7.943   3.094   1.00 0.00 ? 75  GLU A CB   3  
ATOM 5841  C CG   . GLU A 1 75  ? -22.821 8.678   2.974   1.00 0.00 ? 75  GLU A CG   3  
ATOM 5842  C CD   . GLU A 1 75  ? -22.604 10.181  2.791   1.00 0.00 ? 75  GLU A CD   3  
ATOM 5843  O OE1  . GLU A 1 75  ? -22.093 10.555  1.713   1.00 0.00 ? 75  GLU A OE1  3  
ATOM 5844  O OE2  . GLU A 1 75  ? -22.955 10.924  3.734   1.00 0.00 ? 75  GLU A OE2  3  
ATOM 5845  H H    . GLU A 1 75  ? -20.259 6.296   4.495   1.00 0.00 ? 75  GLU A H    3  
ATOM 5846  H HA   . GLU A 1 75  ? -22.718 6.184   3.202   1.00 0.00 ? 75  GLU A HA   3  
ATOM 5847  H HB2  . GLU A 1 75  ? -21.020 8.179   4.051   1.00 0.00 ? 75  GLU A HB2  3  
ATOM 5848  H HB3  . GLU A 1 75  ? -20.805 8.286   2.315   1.00 0.00 ? 75  GLU A HB3  3  
ATOM 5849  H HG2  . GLU A 1 75  ? -23.383 8.282   2.128   1.00 0.00 ? 75  GLU A HG2  3  
ATOM 5850  H HG3  . GLU A 1 75  ? -23.421 8.499   3.866   1.00 0.00 ? 75  GLU A HG3  3  
ATOM 5851  N N    . GLU A 1 76  ? -20.082 6.196   1.189   1.00 0.00 ? 76  GLU A N    3  
ATOM 5852  C CA   . GLU A 1 76  ? -19.603 5.786   -0.121  1.00 0.00 ? 76  GLU A CA   3  
ATOM 5853  C C    . GLU A 1 76  ? -20.001 4.335   -0.401  1.00 0.00 ? 76  GLU A C    3  
ATOM 5854  O O    . GLU A 1 76  ? -20.438 4.010   -1.504  1.00 0.00 ? 76  GLU A O    3  
ATOM 5855  C CB   . GLU A 1 76  ? -18.089 5.971   -0.234  1.00 0.00 ? 76  GLU A CB   3  
ATOM 5856  C CG   . GLU A 1 76  ? -17.738 7.422   -0.572  1.00 0.00 ? 76  GLU A CG   3  
ATOM 5857  C CD   . GLU A 1 76  ? -18.001 7.720   -2.051  1.00 0.00 ? 76  GLU A CD   3  
ATOM 5858  O OE1  . GLU A 1 76  ? -17.190 7.247   -2.877  1.00 0.00 ? 76  GLU A OE1  3  
ATOM 5859  O OE2  . GLU A 1 76  ? -19.005 8.412   -2.320  1.00 0.00 ? 76  GLU A OE2  3  
ATOM 5860  H H    . GLU A 1 76  ? -19.409 6.673   1.754   1.00 0.00 ? 76  GLU A H    3  
ATOM 5861  H HA   . GLU A 1 76  ? -20.099 6.449   -0.831  1.00 0.00 ? 76  GLU A HA   3  
ATOM 5862  H HB2  . GLU A 1 76  ? -17.613 5.687   0.704   1.00 0.00 ? 76  GLU A HB2  3  
ATOM 5863  H HB3  . GLU A 1 76  ? -17.694 5.309   -1.005  1.00 0.00 ? 76  GLU A HB3  3  
ATOM 5864  H HG2  . GLU A 1 76  ? -18.328 8.096   0.048   1.00 0.00 ? 76  GLU A HG2  3  
ATOM 5865  H HG3  . GLU A 1 76  ? -16.690 7.610   -0.340  1.00 0.00 ? 76  GLU A HG3  3  
ATOM 5866  N N    . ALA A 1 77  ? -19.834 3.502   0.616   1.00 0.00 ? 77  ALA A N    3  
ATOM 5867  C CA   . ALA A 1 77  ? -20.169 2.094   0.491   1.00 0.00 ? 77  ALA A CA   3  
ATOM 5868  C C    . ALA A 1 77  ? -21.655 1.956   0.154   1.00 0.00 ? 77  ALA A C    3  
ATOM 5869  O O    . ALA A 1 77  ? -22.022 1.227   -0.766  1.00 0.00 ? 77  ALA A O    3  
ATOM 5870  C CB   . ALA A 1 77  ? -19.795 1.364   1.783   1.00 0.00 ? 77  ALA A CB   3  
ATOM 5871  H H    . ALA A 1 77  ? -19.477 3.776   1.509   1.00 0.00 ? 77  ALA A H    3  
ATOM 5872  H HA   . ALA A 1 77  ? -19.580 1.682   -0.327  1.00 0.00 ? 77  ALA A HA   3  
ATOM 5873  H HB1  . ALA A 1 77  ? -18.796 1.669   2.096   1.00 0.00 ? 77  ALA A HB1  3  
ATOM 5874  H HB2  . ALA A 1 77  ? -20.513 1.616   2.564   1.00 0.00 ? 77  ALA A HB2  3  
ATOM 5875  H HB3  . ALA A 1 77  ? -19.809 0.288   1.610   1.00 0.00 ? 77  ALA A HB3  3  
ATOM 5876  N N    . ALA A 1 78  ? -22.472 2.667   0.918   1.00 0.00 ? 78  ALA A N    3  
ATOM 5877  C CA   . ALA A 1 78  ? -23.910 2.634   0.712   1.00 0.00 ? 78  ALA A CA   3  
ATOM 5878  C C    . ALA A 1 78  ? -24.218 2.956   -0.752  1.00 0.00 ? 78  ALA A C    3  
ATOM 5879  O O    . ALA A 1 78  ? -24.985 2.245   -1.399  1.00 0.00 ? 78  ALA A O    3  
ATOM 5880  C CB   . ALA A 1 78  ? -24.587 3.607   1.678   1.00 0.00 ? 78  ALA A CB   3  
ATOM 5881  H H    . ALA A 1 78  ? -22.165 3.259   1.665   1.00 0.00 ? 78  ALA A H    3  
ATOM 5882  H HA   . ALA A 1 78  ? -24.253 1.623   0.933   1.00 0.00 ? 78  ALA A HA   3  
ATOM 5883  H HB1  . ALA A 1 78  ? -23.829 4.107   2.281   1.00 0.00 ? 78  ALA A HB1  3  
ATOM 5884  H HB2  . ALA A 1 78  ? -25.149 4.350   1.111   1.00 0.00 ? 78  ALA A HB2  3  
ATOM 5885  H HB3  . ALA A 1 78  ? -25.266 3.058   2.331   1.00 0.00 ? 78  ALA A HB3  3  
ATOM 5886  N N    . GLU A 1 79  ? -23.604 4.028   -1.231  1.00 0.00 ? 79  GLU A N    3  
ATOM 5887  C CA   . GLU A 1 79  ? -23.804 4.453   -2.606  1.00 0.00 ? 79  GLU A CA   3  
ATOM 5888  C C    . GLU A 1 79  ? -23.376 3.345   -3.571  1.00 0.00 ? 79  GLU A C    3  
ATOM 5889  O O    . GLU A 1 79  ? -23.998 3.153   -4.615  1.00 0.00 ? 79  GLU A O    3  
ATOM 5890  C CB   . GLU A 1 79  ? -23.048 5.752   -2.894  1.00 0.00 ? 79  GLU A CB   3  
ATOM 5891  C CG   . GLU A 1 79  ? -23.859 6.665   -3.816  1.00 0.00 ? 79  GLU A CG   3  
ATOM 5892  C CD   . GLU A 1 79  ? -22.943 7.618   -4.586  1.00 0.00 ? 79  GLU A CD   3  
ATOM 5893  O OE1  . GLU A 1 79  ? -22.327 8.477   -3.919  1.00 0.00 ? 79  GLU A OE1  3  
ATOM 5894  O OE2  . GLU A 1 79  ? -22.880 7.467   -5.825  1.00 0.00 ? 79  GLU A OE2  3  
ATOM 5895  H H    . GLU A 1 79  ? -22.981 4.600   -0.698  1.00 0.00 ? 79  GLU A H    3  
ATOM 5896  H HA   . GLU A 1 79  ? -24.874 4.634   -2.701  1.00 0.00 ? 79  GLU A HA   3  
ATOM 5897  H HB2  . GLU A 1 79  ? -22.837 6.269   -1.957  1.00 0.00 ? 79  GLU A HB2  3  
ATOM 5898  H HB3  . GLU A 1 79  ? -22.087 5.523   -3.355  1.00 0.00 ? 79  GLU A HB3  3  
ATOM 5899  H HG2  . GLU A 1 79  ? -24.434 6.061   -4.517  1.00 0.00 ? 79  GLU A HG2  3  
ATOM 5900  H HG3  . GLU A 1 79  ? -24.575 7.239   -3.227  1.00 0.00 ? 79  GLU A HG3  3  
ATOM 5901  N N    . TRP A 1 80  ? -22.319 2.646   -3.187  1.00 0.00 ? 80  TRP A N    3  
ATOM 5902  C CA   . TRP A 1 80  ? -21.802 1.561   -4.005  1.00 0.00 ? 80  TRP A CA   3  
ATOM 5903  C C    . TRP A 1 80  ? -22.891 0.493   -4.120  1.00 0.00 ? 80  TRP A C    3  
ATOM 5904  O O    . TRP A 1 80  ? -23.093 -0.082  -5.188  1.00 0.00 ? 80  TRP A O    3  
ATOM 5905  C CB   . TRP A 1 80  ? -20.491 1.019   -3.433  1.00 0.00 ? 80  TRP A CB   3  
ATOM 5906  C CG   . TRP A 1 80  ? -19.399 0.795   -4.481  1.00 0.00 ? 80  TRP A CG   3  
ATOM 5907  C CD1  . TRP A 1 80  ? -18.871 -0.368  -4.887  1.00 0.00 ? 80  TRP A CD1  3  
ATOM 5908  C CD2  . TRP A 1 80  ? -18.719 1.813   -5.245  1.00 0.00 ? 80  TRP A CD2  3  
ATOM 5909  N NE1  . TRP A 1 80  ? -17.904 -0.175  -5.853  1.00 0.00 ? 80  TRP A NE1  3  
ATOM 5910  C CE2  . TRP A 1 80  ? -17.809 1.194   -6.078  1.00 0.00 ? 80  TRP A CE2  3  
ATOM 5911  C CE3  . TRP A 1 80  ? -18.868 3.211   -5.234  1.00 0.00 ? 80  TRP A CE3  3  
ATOM 5912  C CZ2  . TRP A 1 80  ? -16.977 1.894   -6.960  1.00 0.00 ? 80  TRP A CZ2  3  
ATOM 5913  C CZ3  . TRP A 1 80  ? -18.030 3.896   -6.122  1.00 0.00 ? 80  TRP A CZ3  3  
ATOM 5914  C CH2  . TRP A 1 80  ? -17.108 3.287   -6.966  1.00 0.00 ? 80  TRP A CH2  3  
ATOM 5915  H H    . TRP A 1 80  ? -21.819 2.808   -2.337  1.00 0.00 ? 80  TRP A H    3  
ATOM 5916  H HA   . TRP A 1 80  ? -21.574 1.968   -4.991  1.00 0.00 ? 80  TRP A HA   3  
ATOM 5917  H HB2  . TRP A 1 80  ? -20.120 1.716   -2.680  1.00 0.00 ? 80  TRP A HB2  3  
ATOM 5918  H HB3  . TRP A 1 80  ? -20.691 0.076   -2.924  1.00 0.00 ? 80  TRP A HB3  3  
ATOM 5919  H HD1  . TRP A 1 80  ? -19.167 -1.344  -4.502  1.00 0.00 ? 80  TRP A HD1  3  
ATOM 5920  H HE1  . TRP A 1 80  ? -17.323 -0.952  -6.348  1.00 0.00 ? 80  TRP A HE1  3  
ATOM 5921  H HE3  . TRP A 1 80  ? -19.579 3.724   -4.586  1.00 0.00 ? 80  TRP A HE3  3  
ATOM 5922  H HZ2  . TRP A 1 80  ? -16.266 1.381   -7.607  1.00 0.00 ? 80  TRP A HZ2  3  
ATOM 5923  H HZ3  . TRP A 1 80  ? -18.104 4.983   -6.153  1.00 0.00 ? 80  TRP A HZ3  3  
ATOM 5924  H HH2  . TRP A 1 80  ? -16.491 3.892   -7.630  1.00 0.00 ? 80  TRP A HH2  3  
ATOM 5925  N N    . ASP A 1 81  ? -23.566 0.259   -3.003  1.00 0.00 ? 81  ASP A N    3  
ATOM 5926  C CA   . ASP A 1 81  ? -24.630 -0.729  -2.964  1.00 0.00 ? 81  ASP A CA   3  
ATOM 5927  C C    . ASP A 1 81  ? -25.750 -0.304  -3.915  1.00 0.00 ? 81  ASP A C    3  
ATOM 5928  O O    . ASP A 1 81  ? -26.226 -1.107  -4.717  1.00 0.00 ? 81  ASP A O    3  
ATOM 5929  C CB   . ASP A 1 81  ? -25.222 -0.846  -1.558  1.00 0.00 ? 81  ASP A CB   3  
ATOM 5930  C CG   . ASP A 1 81  ? -26.382 -1.835  -1.424  1.00 0.00 ? 81  ASP A CG   3  
ATOM 5931  O OD1  . ASP A 1 81  ? -26.983 -2.148  -2.475  1.00 0.00 ? 81  ASP A OD1  3  
ATOM 5932  O OD2  . ASP A 1 81  ? -26.640 -2.254  -0.277  1.00 0.00 ? 81  ASP A OD2  3  
ATOM 5933  H H    . ASP A 1 81  ? -23.395 0.732   -2.138  1.00 0.00 ? 81  ASP A H    3  
ATOM 5934  H HA   . ASP A 1 81  ? -24.160 -1.666  -3.263  1.00 0.00 ? 81  ASP A HA   3  
ATOM 5935  H HB2  . ASP A 1 81  ? -24.430 -1.142  -0.870  1.00 0.00 ? 81  ASP A HB2  3  
ATOM 5936  H HB3  . ASP A 1 81  ? -25.565 0.139   -1.242  1.00 0.00 ? 81  ASP A HB3  3  
ATOM 5937  N N    . ARG A 1 82  ? -26.138 0.957   -3.795  1.00 0.00 ? 82  ARG A N    3  
ATOM 5938  C CA   . ARG A 1 82  ? -27.194 1.497   -4.634  1.00 0.00 ? 82  ARG A CA   3  
ATOM 5939  C C    . ARG A 1 82  ? -26.808 1.386   -6.110  1.00 0.00 ? 82  ARG A C    3  
ATOM 5940  O O    . ARG A 1 82  ? -27.670 1.201   -6.969  1.00 0.00 ? 82  ARG A O    3  
ATOM 5941  C CB   . ARG A 1 82  ? -27.469 2.965   -4.296  1.00 0.00 ? 82  ARG A CB   3  
ATOM 5942  C CG   . ARG A 1 82  ? -28.973 3.234   -4.209  1.00 0.00 ? 82  ARG A CG   3  
ATOM 5943  C CD   . ARG A 1 82  ? -29.266 4.734   -4.278  1.00 0.00 ? 82  ARG A CD   3  
ATOM 5944  N NE   . ARG A 1 82  ? -29.961 5.171   -3.047  1.00 0.00 ? 82  ARG A NE   3  
ATOM 5945  C CZ   . ARG A 1 82  ? -29.344 5.424   -1.884  1.00 0.00 ? 82  ARG A CZ   3  
ATOM 5946  N NH1  . ARG A 1 82  ? -28.015 5.285   -1.788  1.00 0.00 ? 82  ARG A NH1  3  
ATOM 5947  N NH2  . ARG A 1 82  ? -30.056 5.816   -0.819  1.00 0.00 ? 82  ARG A NH2  3  
ATOM 5948  H H    . ARG A 1 82  ? -25.746 1.603   -3.140  1.00 0.00 ? 82  ARG A H    3  
ATOM 5949  H HA   . ARG A 1 82  ? -28.069 0.887   -4.410  1.00 0.00 ? 82  ARG A HA   3  
ATOM 5950  H HB2  . ARG A 1 82  ? -26.995 3.218   -3.348  1.00 0.00 ? 82  ARG A HB2  3  
ATOM 5951  H HB3  . ARG A 1 82  ? -27.024 3.607   -5.057  1.00 0.00 ? 82  ARG A HB3  3  
ATOM 5952  H HG2  . ARG A 1 82  ? -29.485 2.722   -5.024  1.00 0.00 ? 82  ARG A HG2  3  
ATOM 5953  H HG3  . ARG A 1 82  ? -29.366 2.825   -3.278  1.00 0.00 ? 82  ARG A HG3  3  
ATOM 5954  H HD2  . ARG A 1 82  ? -28.336 5.290   -4.396  1.00 0.00 ? 82  ARG A HD2  3  
ATOM 5955  H HD3  . ARG A 1 82  ? -29.881 4.954   -5.150  1.00 0.00 ? 82  ARG A HD3  3  
ATOM 5956  H HE   . ARG A 1 82  ? -30.954 5.285   -3.085  1.00 0.00 ? 82  ARG A HE   3  
ATOM 5957  H HH11 . ARG A 1 82  ? -27.484 4.993   -2.583  1.00 0.00 ? 82  ARG A HH11 3  
ATOM 5958  H HH12 . ARG A 1 82  ? -27.554 5.473   -0.920  1.00 0.00 ? 82  ARG A HH12 3  
ATOM 5959  H HH21 . ARG A 1 82  ? -31.049 5.919   -0.891  1.00 0.00 ? 82  ARG A HH21 3  
ATOM 5960  H HH22 . ARG A 1 82  ? -29.596 6.004   0.048   1.00 0.00 ? 82  ARG A HH22 3  
ATOM 5961  N N    . LEU A 1 83  ? -25.513 1.502   -6.361  1.00 0.00 ? 83  LEU A N    3  
ATOM 5962  C CA   . LEU A 1 83  ? -25.002 1.416   -7.719  1.00 0.00 ? 83  LEU A CA   3  
ATOM 5963  C C    . LEU A 1 83  ? -24.915 -0.054  -8.134  1.00 0.00 ? 83  LEU A C    3  
ATOM 5964  O O    . LEU A 1 83  ? -25.802 -0.563  -8.819  1.00 0.00 ? 83  LEU A O    3  
ATOM 5965  C CB   . LEU A 1 83  ? -23.676 2.168   -7.841  1.00 0.00 ? 83  LEU A CB   3  
ATOM 5966  C CG   . LEU A 1 83  ? -23.747 3.686   -7.657  1.00 0.00 ? 83  LEU A CG   3  
ATOM 5967  C CD1  . LEU A 1 83  ? -22.563 4.194   -6.833  1.00 0.00 ? 83  LEU A CD1  3  
ATOM 5968  C CD2  . LEU A 1 83  ? -23.852 4.398   -9.008  1.00 0.00 ? 83  LEU A CD2  3  
ATOM 5969  H H    . LEU A 1 83  ? -24.818 1.652   -5.658  1.00 0.00 ? 83  LEU A H    3  
ATOM 5970  H HA   . LEU A 1 83  ? -25.719 1.917   -8.370  1.00 0.00 ? 83  LEU A HA   3  
ATOM 5971  H HB2  . LEU A 1 83  ? -22.982 1.766   -7.104  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 5972  H HB3  . LEU A 1 83  ? -23.253 1.961   -8.824  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 5973  H HG   . LEU A 1 83  ? -24.653 3.921   -7.098  1.00 0.00 ? 83  LEU A HG   3  
ATOM 5974  H HD11 . LEU A 1 83  ? -22.350 3.488   -6.030  1.00 0.00 ? 83  LEU A HD11 3  
ATOM 5975  H HD12 . LEU A 1 83  ? -21.687 4.290   -7.474  1.00 0.00 ? 83  LEU A HD12 3  
ATOM 5976  H HD13 . LEU A 1 83  ? -22.808 5.166   -6.405  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 5977  H HD21 . LEU A 1 83  ? -24.522 3.840   -9.661  1.00 0.00 ? 83  LEU A HD21 3  
ATOM 5978  H HD22 . LEU A 1 83  ? -24.244 5.404   -8.859  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 5979  H HD23 . LEU A 1 83  ? -22.864 4.457   -9.465  1.00 0.00 ? 83  LEU A HD23 3  
ATOM 5980  N N    . HIS A 1 84  ? -23.839 -0.695  -7.703  1.00 0.00 ? 84  HIS A N    3  
ATOM 5981  C CA   . HIS A 1 84  ? -23.625 -2.097  -8.022  1.00 0.00 ? 84  HIS A CA   3  
ATOM 5982  C C    . HIS A 1 84  ? -24.540 -2.965  -7.156  1.00 0.00 ? 84  HIS A C    3  
ATOM 5983  O O    . HIS A 1 84  ? -24.384 -3.014  -5.937  1.00 0.00 ? 84  HIS A O    3  
ATOM 5984  C CB   . HIS A 1 84  ? -22.147 -2.466  -7.879  1.00 0.00 ? 84  HIS A CB   3  
ATOM 5985  C CG   . HIS A 1 84  ? -21.197 -1.407  -8.385  1.00 0.00 ? 84  HIS A CG   3  
ATOM 5986  N ND1  . HIS A 1 84  ? -20.658 -1.431  -9.658  1.00 0.00 ? 84  HIS A ND1  3  
ATOM 5987  C CD2  . HIS A 1 84  ? -20.698 -0.294  -7.775  1.00 0.00 ? 84  HIS A CD2  3  
ATOM 5988  C CE1  . HIS A 1 84  ? -19.870 -0.375  -9.799  1.00 0.00 ? 84  HIS A CE1  3  
ATOM 5989  N NE2  . HIS A 1 84  ? -19.895 0.328   -8.630  1.00 0.00 ? 84  HIS A NE2  3  
ATOM 5990  H H    . HIS A 1 84  ? -23.122 -0.274  -7.146  1.00 0.00 ? 84  HIS A H    3  
ATOM 5991  H HA   . HIS A 1 84  ? -23.900 -2.225  -9.068  1.00 0.00 ? 84  HIS A HA   3  
ATOM 5992  H HB2  . HIS A 1 84  ? -21.932 -2.662  -6.828  1.00 0.00 ? 84  HIS A HB2  3  
ATOM 5993  H HB3  . HIS A 1 84  ? -21.962 -3.394  -8.419  1.00 0.00 ? 84  HIS A HB3  3  
ATOM 5994  H HD1  . HIS A 1 84  ? -20.833 -2.126  -10.355 1.00 0.00 ? 84  HIS A HD1  3  
ATOM 5995  H HD2  . HIS A 1 84  ? -20.920 0.029   -6.758  1.00 0.00 ? 84  HIS A HD2  3  
ATOM 5996  H HE1  . HIS A 1 84  ? -19.301 -0.114  -10.691 1.00 0.00 ? 84  HIS A HE1  3  
ATOM 5997  H HE2  . HIS A 1 84  ? -19.437 1.203   -8.467  1.00 0.00 ? 84  HIS A HE2  3  
ATOM 5998  N N    . PRO A 1 85  ? -25.499 -3.647  -7.837  1.00 0.00 ? 85  PRO A N    3  
ATOM 5999  C CA   . PRO A 1 85  ? -26.438 -4.512  -7.144  1.00 0.00 ? 85  PRO A CA   3  
ATOM 6000  C C    . PRO A 1 85  ? -25.768 -5.817  -6.713  1.00 0.00 ? 85  PRO A C    3  
ATOM 6001  O O    . PRO A 1 85  ? -24.825 -6.277  -7.356  1.00 0.00 ? 85  PRO A O    3  
ATOM 6002  C CB   . PRO A 1 85  ? -27.577 -4.726  -8.130  1.00 0.00 ? 85  PRO A CB   3  
ATOM 6003  C CG   . PRO A 1 85  ? -27.019 -4.360  -9.495  1.00 0.00 ? 85  PRO A CG   3  
ATOM 6004  C CD   . PRO A 1 85  ? -25.712 -3.614  -9.282  1.00 0.00 ? 85  PRO A CD   3  
ATOM 6005  H HA   . PRO A 1 85  ? -26.754 -4.076  -6.302  1.00 0.00 ? 85  PRO A HA   3  
ATOM 6006  H HB2  . PRO A 1 85  ? -27.919 -5.760  -8.111  1.00 0.00 ? 85  PRO A HB2  3  
ATOM 6007  H HB3  . PRO A 1 85  ? -28.433 -4.101  -7.877  1.00 0.00 ? 85  PRO A HB3  3  
ATOM 6008  H HG2  . PRO A 1 85  ? -26.854 -5.256  -10.093 1.00 0.00 ? 85  PRO A HG2  3  
ATOM 6009  H HG3  . PRO A 1 85  ? -27.729 -3.738  -10.043 1.00 0.00 ? 85  PRO A HG3  3  
ATOM 6010  H HD2  . PRO A 1 85  ? -24.891 -4.093  -9.815  1.00 0.00 ? 85  PRO A HD2  3  
ATOM 6011  H HD3  . PRO A 1 85  ? -25.777 -2.590  -9.649  1.00 0.00 ? 85  PRO A HD3  3  
ATOM 6012  N N    . VAL A 1 86  ? -26.280 -6.378  -5.628  1.00 0.00 ? 86  VAL A N    3  
ATOM 6013  C CA   . VAL A 1 86  ? -25.742 -7.622  -5.103  1.00 0.00 ? 86  VAL A CA   3  
ATOM 6014  C C    . VAL A 1 86  ? -26.840 -8.367  -4.342  1.00 0.00 ? 86  VAL A C    3  
ATOM 6015  O O    . VAL A 1 86  ? -27.327 -7.885  -3.319  1.00 0.00 ? 86  VAL A O    3  
ATOM 6016  C CB   . VAL A 1 86  ? -24.507 -7.338  -4.246  1.00 0.00 ? 86  VAL A CB   3  
ATOM 6017  C CG1  . VAL A 1 86  ? -24.127 -8.561  -3.409  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 6018  C CG2  . VAL A 1 86  ? -23.332 -6.879  -5.113  1.00 0.00 ? 86  VAL A CG2  3  
ATOM 6019  H H    . VAL A 1 86  ? -27.046 -5.998  -5.111  1.00 0.00 ? 86  VAL A H    3  
ATOM 6020  H HA   . VAL A 1 86  ? -25.430 -8.230  -5.953  1.00 0.00 ? 86  VAL A HA   3  
ATOM 6021  H HB   . VAL A 1 86  ? -24.754 -6.527  -3.561  1.00 0.00 ? 86  VAL A HB   3  
ATOM 6022  H HG11 . VAL A 1 86  ? -24.967 -8.843  -2.775  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 6023  H HG12 . VAL A 1 86  ? -23.876 -9.390  -4.071  1.00 0.00 ? 86  VAL A HG12 3  
ATOM 6024  H HG13 . VAL A 1 86  ? -23.266 -8.321  -2.785  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 6025  H HG21 . VAL A 1 86  ? -23.137 -7.625  -5.885  1.00 0.00 ? 86  VAL A HG21 3  
ATOM 6026  H HG22 . VAL A 1 86  ? -23.576 -5.926  -5.581  1.00 0.00 ? 86  VAL A HG22 3  
ATOM 6027  H HG23 . VAL A 1 86  ? -22.445 -6.761  -4.489  1.00 0.00 ? 86  VAL A HG23 3  
ATOM 6028  N N    . HIS A 1 87  ? -27.199 -9.528  -4.868  1.00 0.00 ? 87  HIS A N    3  
ATOM 6029  C CA   . HIS A 1 87  ? -28.230 -10.344 -4.250  1.00 0.00 ? 87  HIS A CA   3  
ATOM 6030  C C    . HIS A 1 87  ? -27.989 -11.817 -4.585  1.00 0.00 ? 87  HIS A C    3  
ATOM 6031  O O    . HIS A 1 87  ? -28.886 -12.501 -5.075  1.00 0.00 ? 87  HIS A O    3  
ATOM 6032  C CB   . HIS A 1 87  ? -29.623 -9.862  -4.662  1.00 0.00 ? 87  HIS A CB   3  
ATOM 6033  C CG   . HIS A 1 87  ? -30.618 -9.819  -3.528  1.00 0.00 ? 87  HIS A CG   3  
ATOM 6034  N ND1  . HIS A 1 87  ? -31.408 -10.901 -3.182  1.00 0.00 ? 87  HIS A ND1  3  
ATOM 6035  C CD2  . HIS A 1 87  ? -30.942 -8.815  -2.664  1.00 0.00 ? 87  HIS A CD2  3  
ATOM 6036  C CE1  . HIS A 1 87  ? -32.170 -10.553 -2.156  1.00 0.00 ? 87  HIS A CE1  3  
ATOM 6037  N NE2  . HIS A 1 87  ? -31.881 -9.259  -1.837  1.00 0.00 ? 87  HIS A NE2  3  
ATOM 6038  H H    . HIS A 1 87  ? -26.797 -9.912  -5.699  1.00 0.00 ? 87  HIS A H    3  
ATOM 6039  H HA   . HIS A 1 87  ? -28.135 -10.205 -3.173  1.00 0.00 ? 87  HIS A HA   3  
ATOM 6040  H HB2  . HIS A 1 87  ? -29.538 -8.866  -5.095  1.00 0.00 ? 87  HIS A HB2  3  
ATOM 6041  H HB3  . HIS A 1 87  ? -30.006 -10.518 -5.444  1.00 0.00 ? 87  HIS A HB3  3  
ATOM 6042  H HD1  . HIS A 1 87  ? -31.405 -11.795 -3.631  1.00 0.00 ? 87  HIS A HD1  3  
ATOM 6043  H HD2  . HIS A 1 87  ? -30.504 -7.816  -2.655  1.00 0.00 ? 87  HIS A HD2  3  
ATOM 6044  H HE1  . HIS A 1 87  ? -32.901 -11.188 -1.655  1.00 0.00 ? 87  HIS A HE1  3  
ATOM 6045  H HE2  . HIS A 1 87  ? -32.264 -8.750  -1.065  1.00 0.00 ? 87  HIS A HE2  3  
ATOM 6046  N N    . ALA A 1 88  ? -26.772 -12.263 -4.307  1.00 0.00 ? 88  ALA A N    3  
ATOM 6047  C CA   . ALA A 1 88  ? -26.402 -13.642 -4.573  1.00 0.00 ? 88  ALA A CA   3  
ATOM 6048  C C    . ALA A 1 88  ? -26.996 -14.076 -5.914  1.00 0.00 ? 88  ALA A C    3  
ATOM 6049  O O    . ALA A 1 88  ? -28.060 -14.691 -5.957  1.00 0.00 ? 88  ALA A O    3  
ATOM 6050  C CB   . ALA A 1 88  ? -26.868 -14.528 -3.416  1.00 0.00 ? 88  ALA A CB   3  
ATOM 6051  H H    . ALA A 1 88  ? -26.049 -11.700 -3.909  1.00 0.00 ? 88  ALA A H    3  
ATOM 6052  H HA   . ALA A 1 88  ? -25.315 -13.688 -4.634  1.00 0.00 ? 88  ALA A HA   3  
ATOM 6053  H HB1  . ALA A 1 88  ? -27.363 -13.913 -2.665  1.00 0.00 ? 88  ALA A HB1  3  
ATOM 6054  H HB2  . ALA A 1 88  ? -26.006 -15.024 -2.968  1.00 0.00 ? 88  ALA A HB2  3  
ATOM 6055  H HB3  . ALA A 1 88  ? -27.565 -15.278 -3.790  1.00 0.00 ? 88  ALA A HB3  3  
ATOM 6056  N N    . GLY A 1 89  ? -26.282 -13.737 -6.978  1.00 0.00 ? 89  GLY A N    3  
ATOM 6057  C CA   . GLY A 1 89  ? -26.726 -14.084 -8.318  1.00 0.00 ? 89  GLY A CA   3  
ATOM 6058  C C    . GLY A 1 89  ? -25.847 -15.183 -8.919  1.00 0.00 ? 89  GLY A C    3  
ATOM 6059  O O    . GLY A 1 89  ? -25.436 -16.107 -8.219  1.00 0.00 ? 89  GLY A O    3  
ATOM 6060  H H    . GLY A 1 89  ? -25.418 -13.236 -6.936  1.00 0.00 ? 89  GLY A H    3  
ATOM 6061  H HA2  . GLY A 1 89  ? -27.761 -14.418 -8.287  1.00 0.00 ? 89  GLY A HA2  3  
ATOM 6062  H HA3  . GLY A 1 89  ? -26.694 -13.200 -8.955  1.00 0.00 ? 89  GLY A HA3  3  
ATOM 6063  N N    . PRO A 1 90  ? -25.577 -15.043 -10.245 1.00 0.00 ? 90  PRO A N    3  
ATOM 6064  C CA   . PRO A 1 90  ? -24.756 -16.013 -10.948 1.00 0.00 ? 90  PRO A CA   3  
ATOM 6065  C C    . PRO A 1 90  ? -23.277 -15.838 -10.593 1.00 0.00 ? 90  PRO A C    3  
ATOM 6066  O O    . PRO A 1 90  ? -22.830 -14.728 -10.309 1.00 0.00 ? 90  PRO A O    3  
ATOM 6067  C CB   . PRO A 1 90  ? -25.044 -15.779 -12.421 1.00 0.00 ? 90  PRO A CB   3  
ATOM 6068  C CG   . PRO A 1 90  ? -25.656 -14.391 -12.512 1.00 0.00 ? 90  PRO A CG   3  
ATOM 6069  C CD   . PRO A 1 90  ? -26.046 -13.962 -11.106 1.00 0.00 ? 90  PRO A CD   3  
ATOM 6070  H HA   . PRO A 1 90  ? -24.996 -16.942 -10.665 1.00 0.00 ? 90  PRO A HA   3  
ATOM 6071  H HB2  . PRO A 1 90  ? -24.131 -15.843 -13.014 1.00 0.00 ? 90  PRO A HB2  3  
ATOM 6072  H HB3  . PRO A 1 90  ? -25.729 -16.534 -12.809 1.00 0.00 ? 90  PRO A HB3  3  
ATOM 6073  H HG2  . PRO A 1 90  ? -24.944 -13.687 -12.941 1.00 0.00 ? 90  PRO A HG2  3  
ATOM 6074  H HG3  . PRO A 1 90  ? -26.528 -14.399 -13.164 1.00 0.00 ? 90  PRO A HG3  3  
ATOM 6075  H HD2  . PRO A 1 90  ? -25.583 -13.012 -10.839 1.00 0.00 ? 90  PRO A HD2  3  
ATOM 6076  H HD3  . PRO A 1 90  ? -27.125 -13.825 -11.019 1.00 0.00 ? 90  PRO A HD3  3  
ATOM 6077  N N    . ILE A 1 91  ? -22.559 -16.951 -10.621 1.00 0.00 ? 91  ILE A N    3  
ATOM 6078  C CA   . ILE A 1 91  ? -21.140 -16.935 -10.307 1.00 0.00 ? 91  ILE A CA   3  
ATOM 6079  C C    . ILE A 1 91  ? -20.540 -18.311 -10.603 1.00 0.00 ? 91  ILE A C    3  
ATOM 6080  O O    . ILE A 1 91  ? -21.262 -19.305 -10.673 1.00 0.00 ? 91  ILE A O    3  
ATOM 6081  C CB   . ILE A 1 91  ? -20.916 -16.463 -8.869  1.00 0.00 ? 91  ILE A CB   3  
ATOM 6082  C CG1  . ILE A 1 91  ? -19.584 -15.720 -8.737  1.00 0.00 ? 91  ILE A CG1  3  
ATOM 6083  C CG2  . ILE A 1 91  ? -21.020 -17.631 -7.886  1.00 0.00 ? 91  ILE A CG2  3  
ATOM 6084  C CD1  . ILE A 1 91  ? -19.551 -14.878 -7.460  1.00 0.00 ? 91  ILE A CD1  3  
ATOM 6085  H H    . ILE A 1 91  ? -22.930 -17.851 -10.853 1.00 0.00 ? 91  ILE A H    3  
ATOM 6086  H HA   . ILE A 1 91  ? -20.669 -16.204 -10.963 1.00 0.00 ? 91  ILE A HA   3  
ATOM 6087  H HB   . ILE A 1 91  ? -21.706 -15.757 -8.614  1.00 0.00 ? 91  ILE A HB   3  
ATOM 6088  H HG12 . ILE A 1 91  ? -18.763 -16.436 -8.727  1.00 0.00 ? 91  ILE A HG12 3  
ATOM 6089  H HG13 . ILE A 1 91  ? -19.436 -15.076 -9.605  1.00 0.00 ? 91  ILE A HG13 3  
ATOM 6090  H HG21 . ILE A 1 91  ? -21.831 -18.291 -8.191  1.00 0.00 ? 91  ILE A HG21 3  
ATOM 6091  H HG22 . ILE A 1 91  ? -20.081 -18.186 -7.881  1.00 0.00 ? 91  ILE A HG22 3  
ATOM 6092  H HG23 . ILE A 1 91  ? -21.220 -17.247 -6.885  1.00 0.00 ? 91  ILE A HG23 3  
ATOM 6093  H HD11 . ILE A 1 91  ? -20.568 -14.610 -7.175  1.00 0.00 ? 91  ILE A HD11 3  
ATOM 6094  H HD12 . ILE A 1 91  ? -19.089 -15.453 -6.658  1.00 0.00 ? 91  ILE A HD12 3  
ATOM 6095  H HD13 . ILE A 1 91  ? -18.973 -13.972 -7.638  1.00 0.00 ? 91  ILE A HD13 3  
ATOM 6096  N N    . ALA A 1 92  ? -19.226 -18.325 -10.771 1.00 0.00 ? 92  ALA A N    3  
ATOM 6097  C CA   . ALA A 1 92  ? -18.522 -19.562 -11.058 1.00 0.00 ? 92  ALA A CA   3  
ATOM 6098  C C    . ALA A 1 92  ? -18.328 -20.347 -9.759  1.00 0.00 ? 92  ALA A C    3  
ATOM 6099  O O    . ALA A 1 92  ? -18.296 -19.765 -8.677  1.00 0.00 ? 92  ALA A O    3  
ATOM 6100  C CB   . ALA A 1 92  ? -17.195 -19.245 -11.751 1.00 0.00 ? 92  ALA A CB   3  
ATOM 6101  H H    . ALA A 1 92  ? -18.647 -17.512 -10.714 1.00 0.00 ? 92  ALA A H    3  
ATOM 6102  H HA   . ALA A 1 92  ? -19.142 -20.147 -11.738 1.00 0.00 ? 92  ALA A HA   3  
ATOM 6103  H HB1  . ALA A 1 92  ? -17.248 -18.255 -12.202 1.00 0.00 ? 92  ALA A HB1  3  
ATOM 6104  H HB2  . ALA A 1 92  ? -16.388 -19.270 -11.019 1.00 0.00 ? 92  ALA A HB2  3  
ATOM 6105  H HB3  . ALA A 1 92  ? -17.005 -19.987 -12.527 1.00 0.00 ? 92  ALA A HB3  3  
ATOM 6106  N N    . PRO A 1 93  ? -18.201 -21.693 -9.914  1.00 0.00 ? 93  PRO A N    3  
ATOM 6107  C CA   . PRO A 1 93  ? -18.012 -22.564 -8.767  1.00 0.00 ? 93  PRO A CA   3  
ATOM 6108  C C    . PRO A 1 93  ? -16.585 -22.456 -8.226  1.00 0.00 ? 93  PRO A C    3  
ATOM 6109  O O    . PRO A 1 93  ? -15.719 -23.252 -8.587  1.00 0.00 ? 93  PRO A O    3  
ATOM 6110  C CB   . PRO A 1 93  ? -18.353 -23.957 -9.269  1.00 0.00 ? 93  PRO A CB   3  
ATOM 6111  C CG   . PRO A 1 93  ? -18.271 -23.884 -10.785 1.00 0.00 ? 93  PRO A CG   3  
ATOM 6112  C CD   . PRO A 1 93  ? -18.235 -22.417 -11.181 1.00 0.00 ? 93  PRO A CD   3  
ATOM 6113  H HA   . PRO A 1 93  ? -18.610 -22.283 -8.016  1.00 0.00 ? 93  PRO A HA   3  
ATOM 6114  H HB2  . PRO A 1 93  ? -17.657 -24.696 -8.875  1.00 0.00 ? 93  PRO A HB2  3  
ATOM 6115  H HB3  . PRO A 1 93  ? -19.350 -24.255 -8.946  1.00 0.00 ? 93  PRO A HB3  3  
ATOM 6116  H HG2  . PRO A 1 93  ? -17.379 -24.400 -11.144 1.00 0.00 ? 93  PRO A HG2  3  
ATOM 6117  H HG3  . PRO A 1 93  ? -19.129 -24.381 -11.238 1.00 0.00 ? 93  PRO A HG3  3  
ATOM 6118  H HD2  . PRO A 1 93  ? -17.358 -22.193 -11.789 1.00 0.00 ? 93  PRO A HD2  3  
ATOM 6119  H HD3  . PRO A 1 93  ? -19.110 -22.145 -11.771 1.00 0.00 ? 93  PRO A HD3  3  
ATOM 6120  N N    . GLY A 1 94  ? -16.382 -21.464 -7.371  1.00 0.00 ? 94  GLY A N    3  
ATOM 6121  C CA   . GLY A 1 94  ? -15.075 -21.243 -6.779  1.00 0.00 ? 94  GLY A CA   3  
ATOM 6122  C C    . GLY A 1 94  ? -14.650 -19.779 -6.919  1.00 0.00 ? 94  GLY A C    3  
ATOM 6123  O O    . GLY A 1 94  ? -13.579 -19.392 -6.453  1.00 0.00 ? 94  GLY A O    3  
ATOM 6124  H H    . GLY A 1 94  ? -17.091 -20.820 -7.085  1.00 0.00 ? 94  GLY A H    3  
ATOM 6125  H HA2  . GLY A 1 94  ? -15.098 -21.519 -5.725  1.00 0.00 ? 94  GLY A HA2  3  
ATOM 6126  H HA3  . GLY A 1 94  ? -14.339 -21.886 -7.260  1.00 0.00 ? 94  GLY A HA3  3  
ATOM 6127  N N    . GLN A 1 95  ? -15.511 -19.005 -7.562  1.00 0.00 ? 95  GLN A N    3  
ATOM 6128  C CA   . GLN A 1 95  ? -15.239 -17.594 -7.770  1.00 0.00 ? 95  GLN A CA   3  
ATOM 6129  C C    . GLN A 1 95  ? -15.656 -16.786 -6.540  1.00 0.00 ? 95  GLN A C    3  
ATOM 6130  O O    . GLN A 1 95  ? -16.602 -17.152 -5.844  1.00 0.00 ? 95  GLN A O    3  
ATOM 6131  C CB   . GLN A 1 95  ? -15.942 -17.079 -9.028  1.00 0.00 ? 95  GLN A CB   3  
ATOM 6132  C CG   . GLN A 1 95  ? -14.995 -17.092 -10.230 1.00 0.00 ? 95  GLN A CG   3  
ATOM 6133  C CD   . GLN A 1 95  ? -14.456 -15.690 -10.519 1.00 0.00 ? 95  GLN A CD   3  
ATOM 6134  O OE1  . GLN A 1 95  ? -13.543 -15.202 -9.874  1.00 0.00 ? 95  GLN A OE1  3  
ATOM 6135  N NE2  . GLN A 1 95  ? -15.072 -15.070 -11.523 1.00 0.00 ? 95  GLN A NE2  3  
ATOM 6136  H H    . GLN A 1 95  ? -16.380 -19.328 -7.939  1.00 0.00 ? 95  GLN A H    3  
ATOM 6137  H HA   . GLN A 1 95  ? -14.160 -17.524 -7.910  1.00 0.00 ? 95  GLN A HA   3  
ATOM 6138  H HB2  . GLN A 1 95  ? -16.814 -17.696 -9.240  1.00 0.00 ? 95  GLN A HB2  3  
ATOM 6139  H HB3  . GLN A 1 95  ? -16.305 -16.065 -8.857  1.00 0.00 ? 95  GLN A HB3  3  
ATOM 6140  H HG2  . GLN A 1 95  ? -14.165 -17.771 -10.036 1.00 0.00 ? 95  GLN A HG2  3  
ATOM 6141  H HG3  . GLN A 1 95  ? -15.520 -17.472 -11.106 1.00 0.00 ? 95  GLN A HG3  3  
ATOM 6142  H HE21 . GLN A 1 95  ? -15.815 -15.527 -12.012 1.00 0.00 ? 95  GLN A HE21 3  
ATOM 6143  H HE22 . GLN A 1 95  ? -14.791 -14.148 -11.789 1.00 0.00 ? 95  GLN A HE22 3  
ATOM 6144  N N    . MET A 1 96  ? -14.928 -15.703 -6.307  1.00 0.00 ? 96  MET A N    3  
ATOM 6145  C CA   . MET A 1 96  ? -15.210 -14.841 -5.173  1.00 0.00 ? 96  MET A CA   3  
ATOM 6146  C C    . MET A 1 96  ? -16.644 -14.309 -5.231  1.00 0.00 ? 96  MET A C    3  
ATOM 6147  O O    . MET A 1 96  ? -17.260 -14.291 -6.296  1.00 0.00 ? 96  MET A O    3  
ATOM 6148  C CB   . MET A 1 96  ? -14.230 -13.667 -5.167  1.00 0.00 ? 96  MET A CB   3  
ATOM 6149  C CG   . MET A 1 96  ? -14.347 -12.847 -6.454  1.00 0.00 ? 96  MET A CG   3  
ATOM 6150  S SD   . MET A 1 96  ? -12.750 -12.712 -7.239  1.00 0.00 ? 96  MET A SD   3  
ATOM 6151  C CE   . MET A 1 96  ? -12.331 -11.033 -6.800  1.00 0.00 ? 96  MET A CE   3  
ATOM 6152  H H    . MET A 1 96  ? -14.160 -15.413 -6.878  1.00 0.00 ? 96  MET A H    3  
ATOM 6153  H HA   . MET A 1 96  ? -15.084 -15.468 -4.290  1.00 0.00 ? 96  MET A HA   3  
ATOM 6154  H HB2  . MET A 1 96  ? -14.427 -13.028 -4.306  1.00 0.00 ? 96  MET A HB2  3  
ATOM 6155  H HB3  . MET A 1 96  ? -13.211 -14.039 -5.061  1.00 0.00 ? 96  MET A HB3  3  
ATOM 6156  H HG2  . MET A 1 96  ? -15.056 -13.322 -7.133  1.00 0.00 ? 96  MET A HG2  3  
ATOM 6157  H HG3  . MET A 1 96  ? -14.738 -11.855 -6.229  1.00 0.00 ? 96  MET A HG3  3  
ATOM 6158  H HE1  . MET A 1 96  ? -12.680 -10.824 -5.788  1.00 0.00 ? 96  MET A HE1  3  
ATOM 6159  H HE2  . MET A 1 96  ? -11.250 -10.905 -6.846  1.00 0.00 ? 96  MET A HE2  3  
ATOM 6160  H HE3  . MET A 1 96  ? -12.809 -10.344 -7.497  1.00 0.00 ? 96  MET A HE3  3  
ATOM 6161  N N    . ARG A 1 97  ? -17.133 -13.889 -4.074  1.00 0.00 ? 97  ARG A N    3  
ATOM 6162  C CA   . ARG A 1 97  ? -18.482 -13.358 -3.980  1.00 0.00 ? 97  ARG A CA   3  
ATOM 6163  C C    . ARG A 1 97  ? -18.591 -12.043 -4.754  1.00 0.00 ? 97  ARG A C    3  
ATOM 6164  O O    . ARG A 1 97  ? -17.614 -11.583 -5.344  1.00 0.00 ? 97  ARG A O    3  
ATOM 6165  C CB   . ARG A 1 97  ? -18.881 -13.118 -2.522  1.00 0.00 ? 97  ARG A CB   3  
ATOM 6166  C CG   . ARG A 1 97  ? -20.114 -13.942 -2.147  1.00 0.00 ? 97  ARG A CG   3  
ATOM 6167  C CD   . ARG A 1 97  ? -20.111 -14.287 -0.657  1.00 0.00 ? 97  ARG A CD   3  
ATOM 6168  N NE   . ARG A 1 97  ? -21.464 -14.091 -0.090  1.00 0.00 ? 97  ARG A NE   3  
ATOM 6169  C CZ   . ARG A 1 97  ? -21.739 -14.114 1.222   1.00 0.00 ? 97  ARG A CZ   3  
ATOM 6170  N NH1  . ARG A 1 97  ? -20.757 -14.326 2.109   1.00 0.00 ? 97  ARG A NH1  3  
ATOM 6171  N NH2  . ARG A 1 97  ? -22.997 -13.927 1.645   1.00 0.00 ? 97  ARG A NH2  3  
ATOM 6172  H H    . ARG A 1 97  ? -16.626 -13.908 -3.213  1.00 0.00 ? 97  ARG A H    3  
ATOM 6173  H HA   . ARG A 1 97  ? -19.116 -14.127 -4.423  1.00 0.00 ? 97  ARG A HA   3  
ATOM 6174  H HB2  . ARG A 1 97  ? -18.049 -13.381 -1.867  1.00 0.00 ? 97  ARG A HB2  3  
ATOM 6175  H HB3  . ARG A 1 97  ? -19.085 -12.059 -2.367  1.00 0.00 ? 97  ARG A HB3  3  
ATOM 6176  H HG2  . ARG A 1 97  ? -21.017 -13.384 -2.394  1.00 0.00 ? 97  ARG A HG2  3  
ATOM 6177  H HG3  . ARG A 1 97  ? -20.135 -14.859 -2.736  1.00 0.00 ? 97  ARG A HG3  3  
ATOM 6178  H HD2  . ARG A 1 97  ? -19.794 -15.320 -0.515  1.00 0.00 ? 97  ARG A HD2  3  
ATOM 6179  H HD3  . ARG A 1 97  ? -19.393 -13.657 -0.131  1.00 0.00 ? 97  ARG A HD3  3  
ATOM 6180  H HE   . ARG A 1 97  ? -22.220 -13.931 -0.725  1.00 0.00 ? 97  ARG A HE   3  
ATOM 6181  H HH11 . ARG A 1 97  ? -19.819 -14.466 1.793   1.00 0.00 ? 97  ARG A HH11 3  
ATOM 6182  H HH12 . ARG A 1 97  ? -20.963 -14.343 3.088   1.00 0.00 ? 97  ARG A HH12 3  
ATOM 6183  H HH21 . ARG A 1 97  ? -23.729 -13.769 0.983   1.00 0.00 ? 97  ARG A HH21 3  
ATOM 6184  H HH22 . ARG A 1 97  ? -23.202 -13.944 2.624   1.00 0.00 ? 97  ARG A HH22 3  
ATOM 6185  N N    . GLU A 1 98  ? -19.786 -11.474 -4.727  1.00 0.00 ? 98  GLU A N    3  
ATOM 6186  C CA   . GLU A 1 98  ? -20.035 -10.220 -5.420  1.00 0.00 ? 98  GLU A CA   3  
ATOM 6187  C C    . GLU A 1 98  ? -20.583 -9.176  -4.445  1.00 0.00 ? 98  GLU A C    3  
ATOM 6188  O O    . GLU A 1 98  ? -21.770 -8.859  -4.471  1.00 0.00 ? 98  GLU A O    3  
ATOM 6189  C CB   . GLU A 1 98  ? -20.989 -10.424 -6.598  1.00 0.00 ? 98  GLU A CB   3  
ATOM 6190  C CG   . GLU A 1 98  ? -20.963 -9.219  -7.539  1.00 0.00 ? 98  GLU A CG   3  
ATOM 6191  C CD   . GLU A 1 98  ? -19.626 -9.132  -8.281  1.00 0.00 ? 98  GLU A CD   3  
ATOM 6192  O OE1  . GLU A 1 98  ? -18.661 -8.646  -7.654  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 6193  O OE2  . GLU A 1 98  ? -19.602 -9.553  -9.458  1.00 0.00 ? 98  GLU A OE2  3  
ATOM 6194  H H    . GLU A 1 98  ? -20.576 -11.854 -4.245  1.00 0.00 ? 98  GLU A H    3  
ATOM 6195  H HA   . GLU A 1 98  ? -19.064 -9.901  -5.798  1.00 0.00 ? 98  GLU A HA   3  
ATOM 6196  H HB2  . GLU A 1 98  ? -20.710 -11.325 -7.145  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 6197  H HB3  . GLU A 1 98  ? -22.003 -10.578 -6.228  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 6198  H HG2  . GLU A 1 98  ? -21.777 -9.297  -8.259  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 6199  H HG3  . GLU A 1 98  ? -21.127 -8.305  -6.971  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 6200  N N    . PRO A 1 99  ? -19.665 -8.655  -3.586  1.00 0.00 ? 99  PRO A N    3  
ATOM 6201  C CA   . PRO A 1 99  ? -20.044 -7.652  -2.604  1.00 0.00 ? 99  PRO A CA   3  
ATOM 6202  C C    . PRO A 1 99  ? -20.250 -6.289  -3.266  1.00 0.00 ? 99  PRO A C    3  
ATOM 6203  O O    . PRO A 1 99  ? -20.326 -6.193  -4.490  1.00 0.00 ? 99  PRO A O    3  
ATOM 6204  C CB   . PRO A 1 99  ? -18.917 -7.654  -1.585  1.00 0.00 ? 99  PRO A CB   3  
ATOM 6205  C CG   . PRO A 1 99  ? -17.734 -8.317  -2.273  1.00 0.00 ? 99  PRO A CG   3  
ATOM 6206  C CD   . PRO A 1 99  ? -18.250 -9.006  -3.526  1.00 0.00 ? 99  PRO A CD   3  
ATOM 6207  H HA   . PRO A 1 99  ? -20.921 -7.889  -2.187  1.00 0.00 ? 99  PRO A HA   3  
ATOM 6208  H HB2  . PRO A 1 99  ? -18.669 -6.639  -1.275  1.00 0.00 ? 99  PRO A HB2  3  
ATOM 6209  H HB3  . PRO A 1 99  ? -19.203 -8.201  -0.686  1.00 0.00 ? 99  PRO A HB3  3  
ATOM 6210  H HG2  . PRO A 1 99  ? -16.977 -7.576  -2.529  1.00 0.00 ? 99  PRO A HG2  3  
ATOM 6211  H HG3  . PRO A 1 99  ? -17.261 -9.039  -1.608  1.00 0.00 ? 99  PRO A HG3  3  
ATOM 6212  H HD2  . PRO A 1 99  ? -17.719 -8.662  -4.414  1.00 0.00 ? 99  PRO A HD2  3  
ATOM 6213  H HD3  . PRO A 1 99  ? -18.111 -10.085 -3.470  1.00 0.00 ? 99  PRO A HD3  3  
ATOM 6214  N N    . ARG A 1 100 ? -20.336 -5.266  -2.427  1.00 0.00 ? 100 ARG A N    3  
ATOM 6215  C CA   . ARG A 1 100 ? -20.531 -3.911  -2.915  1.00 0.00 ? 100 ARG A CA   3  
ATOM 6216  C C    . ARG A 1 100 ? -19.400 -3.004  -2.430  1.00 0.00 ? 100 ARG A C    3  
ATOM 6217  O O    . ARG A 1 100 ? -18.365 -2.890  -3.087  1.00 0.00 ? 100 ARG A O    3  
ATOM 6218  C CB   . ARG A 1 100 ? -21.870 -3.344  -2.440  1.00 0.00 ? 100 ARG A CB   3  
ATOM 6219  C CG   . ARG A 1 100 ? -23.036 -3.981  -3.198  1.00 0.00 ? 100 ARG A CG   3  
ATOM 6220  C CD   . ARG A 1 100 ? -24.220 -4.244  -2.264  1.00 0.00 ? 100 ARG A CD   3  
ATOM 6221  N NE   . ARG A 1 100 ? -23.837 -5.228  -1.227  1.00 0.00 ? 100 ARG A NE   3  
ATOM 6222  C CZ   . ARG A 1 100 ? -23.461 -4.901  0.017   1.00 0.00 ? 100 ARG A CZ   3  
ATOM 6223  N NH1  . ARG A 1 100 ? -23.413 -3.615  0.386   1.00 0.00 ? 100 ARG A NH1  3  
ATOM 6224  N NH2  . ARG A 1 100 ? -23.132 -5.862  0.891   1.00 0.00 ? 100 ARG A NH2  3  
ATOM 6225  H H    . ARG A 1 100 ? -20.273 -5.352  -1.433  1.00 0.00 ? 100 ARG A H    3  
ATOM 6226  H HA   . ARG A 1 100 ? -20.523 -4.002  -4.001  1.00 0.00 ? 100 ARG A HA   3  
ATOM 6227  H HB2  . ARG A 1 100 ? -21.986 -3.520  -1.371  1.00 0.00 ? 100 ARG A HB2  3  
ATOM 6228  H HB3  . ARG A 1 100 ? -21.883 -2.263  -2.588  1.00 0.00 ? 100 ARG A HB3  3  
ATOM 6229  H HG2  . ARG A 1 100 ? -23.349 -3.326  -4.012  1.00 0.00 ? 100 ARG A HG2  3  
ATOM 6230  H HG3  . ARG A 1 100 ? -22.712 -4.919  -3.650  1.00 0.00 ? 100 ARG A HG3  3  
ATOM 6231  H HD2  . ARG A 1 100 ? -24.536 -3.312  -1.793  1.00 0.00 ? 100 ARG A HD2  3  
ATOM 6232  H HD3  . ARG A 1 100 ? -25.069 -4.616  -2.835  1.00 0.00 ? 100 ARG A HD3  3  
ATOM 6233  H HE   . ARG A 1 100 ? -23.861 -6.198  -1.470  1.00 0.00 ? 100 ARG A HE   3  
ATOM 6234  H HH11 . ARG A 1 100 ? -23.659 -2.897  -0.266  1.00 0.00 ? 100 ARG A HH11 3  
ATOM 6235  H HH12 . ARG A 1 100 ? -23.133 -3.371  1.315   1.00 0.00 ? 100 ARG A HH12 3  
ATOM 6236  H HH21 . ARG A 1 100 ? -23.168 -6.824  0.615   1.00 0.00 ? 100 ARG A HH21 3  
ATOM 6237  H HH22 . ARG A 1 100 ? -22.851 -5.619  1.819   1.00 0.00 ? 100 ARG A HH22 3  
ATOM 6238  N N    . GLY A 1 101 ? -19.633 -2.381  -1.285  1.00 0.00 ? 101 GLY A N    3  
ATOM 6239  C CA   . GLY A 1 101 ? -18.645 -1.487  -0.704  1.00 0.00 ? 101 GLY A CA   3  
ATOM 6240  C C    . GLY A 1 101 ? -18.013 -2.104  0.545   1.00 0.00 ? 101 GLY A C    3  
ATOM 6241  O O    . GLY A 1 101 ? -16.791 -2.133  0.678   1.00 0.00 ? 101 GLY A O    3  
ATOM 6242  H H    . GLY A 1 101 ? -20.476 -2.479  -0.756  1.00 0.00 ? 101 GLY A H    3  
ATOM 6243  H HA2  . GLY A 1 101 ? -17.870 -1.270  -1.439  1.00 0.00 ? 101 GLY A HA2  3  
ATOM 6244  H HA3  . GLY A 1 101 ? -19.115 -0.538  -0.447  1.00 0.00 ? 101 GLY A HA3  3  
ATOM 6245  N N    . SER A 1 102 ? -18.876 -2.583  1.430   1.00 0.00 ? 102 SER A N    3  
ATOM 6246  C CA   . SER A 1 102 ? -18.418 -3.199  2.664   1.00 0.00 ? 102 SER A CA   3  
ATOM 6247  C C    . SER A 1 102 ? -17.209 -4.095  2.385   1.00 0.00 ? 102 SER A C    3  
ATOM 6248  O O    . SER A 1 102 ? -16.365 -4.294  3.257   1.00 0.00 ? 102 SER A O    3  
ATOM 6249  C CB   . SER A 1 102 ? -19.536 -4.007  3.325   1.00 0.00 ? 102 SER A CB   3  
ATOM 6250  O OG   . SER A 1 102 ? -20.533 -3.166  3.901   1.00 0.00 ? 102 SER A OG   3  
ATOM 6251  H H    . SER A 1 102 ? -19.868 -2.556  1.315   1.00 0.00 ? 102 SER A H    3  
ATOM 6252  H HA   . SER A 1 102 ? -18.137 -2.370  3.314   1.00 0.00 ? 102 SER A HA   3  
ATOM 6253  H HB2  . SER A 1 102 ? -19.996 -4.661  2.585   1.00 0.00 ? 102 SER A HB2  3  
ATOM 6254  H HB3  . SER A 1 102 ? -19.112 -4.648  4.098   1.00 0.00 ? 102 SER A HB3  3  
ATOM 6255  H HG   . SER A 1 102 ? -20.841 -3.550  4.772   1.00 0.00 ? 102 SER A HG   3  
ATOM 6256  N N    . ASP A 1 103 ? -17.166 -4.611  1.166   1.00 0.00 ? 103 ASP A N    3  
ATOM 6257  C CA   . ASP A 1 103 ? -16.075 -5.482  0.761   1.00 0.00 ? 103 ASP A CA   3  
ATOM 6258  C C    . ASP A 1 103 ? -14.800 -4.652  0.595   1.00 0.00 ? 103 ASP A C    3  
ATOM 6259  O O    . ASP A 1 103 ? -13.743 -5.021  1.104   1.00 0.00 ? 103 ASP A O    3  
ATOM 6260  C CB   . ASP A 1 103 ? -16.376 -6.157  -0.578  1.00 0.00 ? 103 ASP A CB   3  
ATOM 6261  C CG   . ASP A 1 103 ? -15.147 -6.495  -1.424  1.00 0.00 ? 103 ASP A CG   3  
ATOM 6262  O OD1  . ASP A 1 103 ? -14.162 -6.977  -0.826  1.00 0.00 ? 103 ASP A OD1  3  
ATOM 6263  O OD2  . ASP A 1 103 ? -15.220 -6.262  -2.650  1.00 0.00 ? 103 ASP A OD2  3  
ATOM 6264  H H    . ASP A 1 103 ? -17.857 -4.445  0.463   1.00 0.00 ? 103 ASP A H    3  
ATOM 6265  H HA   . ASP A 1 103 ? -15.989 -6.223  1.556   1.00 0.00 ? 103 ASP A HA   3  
ATOM 6266  H HB2  . ASP A 1 103 ? -16.931 -7.076  -0.388  1.00 0.00 ? 103 ASP A HB2  3  
ATOM 6267  H HB3  . ASP A 1 103 ? -17.030 -5.504  -1.158  1.00 0.00 ? 103 ASP A HB3  3  
ATOM 6268  N N    . ILE A 1 104 ? -14.942 -3.545  -0.119  1.00 0.00 ? 104 ILE A N    3  
ATOM 6269  C CA   . ILE A 1 104 ? -13.815 -2.659  -0.359  1.00 0.00 ? 104 ILE A CA   3  
ATOM 6270  C C    . ILE A 1 104 ? -13.271 -2.161  0.981   1.00 0.00 ? 104 ILE A C    3  
ATOM 6271  O O    . ILE A 1 104 ? -12.153 -1.650  1.050   1.00 0.00 ? 104 ILE A O    3  
ATOM 6272  C CB   . ILE A 1 104 ? -14.212 -1.535  -1.318  1.00 0.00 ? 104 ILE A CB   3  
ATOM 6273  C CG1  . ILE A 1 104 ? -14.822 -2.100  -2.603  1.00 0.00 ? 104 ILE A CG1  3  
ATOM 6274  C CG2  . ILE A 1 104 ? -13.023 -0.615  -1.605  1.00 0.00 ? 104 ILE A CG2  3  
ATOM 6275  C CD1  . ILE A 1 104 ? -15.588 -1.019  -3.367  1.00 0.00 ? 104 ILE A CD1  3  
ATOM 6276  H H    . ILE A 1 104 ? -15.805 -3.252  -0.531  1.00 0.00 ? 104 ILE A H    3  
ATOM 6277  H HA   . ILE A 1 104 ? -13.038 -3.244  -0.851  1.00 0.00 ? 104 ILE A HA   3  
ATOM 6278  H HB   . ILE A 1 104 ? -14.979 -0.929  -0.835  1.00 0.00 ? 104 ILE A HB   3  
ATOM 6279  H HG12 . ILE A 1 104 ? -14.034 -2.509  -3.235  1.00 0.00 ? 104 ILE A HG12 3  
ATOM 6280  H HG13 . ILE A 1 104 ? -15.494 -2.924  -2.359  1.00 0.00 ? 104 ILE A HG13 3  
ATOM 6281  H HG21 . ILE A 1 104 ? -12.190 -0.885  -0.957  1.00 0.00 ? 104 ILE A HG21 3  
ATOM 6282  H HG22 . ILE A 1 104 ? -12.724 -0.722  -2.648  1.00 0.00 ? 104 ILE A HG22 3  
ATOM 6283  H HG23 . ILE A 1 104 ? -13.311 0.420   -1.414  1.00 0.00 ? 104 ILE A HG23 3  
ATOM 6284  H HD11 . ILE A 1 104 ? -15.741 -0.155  -2.720  1.00 0.00 ? 104 ILE A HD11 3  
ATOM 6285  H HD12 . ILE A 1 104 ? -15.016 -0.719  -4.245  1.00 0.00 ? 104 ILE A HD12 3  
ATOM 6286  H HD13 . ILE A 1 104 ? -16.555 -1.412  -3.681  1.00 0.00 ? 104 ILE A HD13 3  
ATOM 6287  N N    . ALA A 1 105 ? -14.084 -2.326  2.013   1.00 0.00 ? 105 ALA A N    3  
ATOM 6288  C CA   . ALA A 1 105 ? -13.698 -1.899  3.348   1.00 0.00 ? 105 ALA A CA   3  
ATOM 6289  C C    . ALA A 1 105 ? -12.879 -3.006  4.015   1.00 0.00 ? 105 ALA A C    3  
ATOM 6290  O O    . ALA A 1 105 ? -12.134 -2.748  4.960   1.00 0.00 ? 105 ALA A O    3  
ATOM 6291  C CB   . ALA A 1 105 ? -14.949 -1.535  4.150   1.00 0.00 ? 105 ALA A CB   3  
ATOM 6292  H H    . ALA A 1 105 ? -14.992 -2.742  1.949   1.00 0.00 ? 105 ALA A H    3  
ATOM 6293  H HA   . ALA A 1 105 ? -13.076 -1.010  3.244   1.00 0.00 ? 105 ALA A HA   3  
ATOM 6294  H HB1  . ALA A 1 105 ? -15.823 -1.996  3.689   1.00 0.00 ? 105 ALA A HB1  3  
ATOM 6295  H HB2  . ALA A 1 105 ? -15.072 -0.452  4.159   1.00 0.00 ? 105 ALA A HB2  3  
ATOM 6296  H HB3  . ALA A 1 105 ? -14.843 -1.898  5.172   1.00 0.00 ? 105 ALA A HB3  3  
ATOM 6297  N N    . GLY A 1 106 ? -13.044 -4.214  3.498   1.00 0.00 ? 106 GLY A N    3  
ATOM 6298  C CA   . GLY A 1 106 ? -12.330 -5.361  4.032   1.00 0.00 ? 106 GLY A CA   3  
ATOM 6299  C C    . GLY A 1 106 ? -12.930 -5.809  5.366   1.00 0.00 ? 106 GLY A C    3  
ATOM 6300  O O    . GLY A 1 106 ? -12.239 -6.397  6.196   1.00 0.00 ? 106 GLY A O    3  
ATOM 6301  H H    . GLY A 1 106 ? -13.652 -4.416  2.729   1.00 0.00 ? 106 GLY A H    3  
ATOM 6302  H HA2  . GLY A 1 106 ? -12.368 -6.184  3.318   1.00 0.00 ? 106 GLY A HA2  3  
ATOM 6303  H HA3  . GLY A 1 106 ? -11.278 -5.107  4.169   1.00 0.00 ? 106 GLY A HA3  3  
ATOM 6304  N N    . THR A 1 107 ? -14.212 -5.513  5.530   1.00 0.00 ? 107 THR A N    3  
ATOM 6305  C CA   . THR A 1 107 ? -14.913 -5.878  6.749   1.00 0.00 ? 107 THR A CA   3  
ATOM 6306  C C    . THR A 1 107 ? -15.538 -7.268  6.609   1.00 0.00 ? 107 THR A C    3  
ATOM 6307  O O    . THR A 1 107 ? -15.642 -8.007  7.587   1.00 0.00 ? 107 THR A O    3  
ATOM 6308  C CB   . THR A 1 107 ? -15.935 -4.781  7.053   1.00 0.00 ? 107 THR A CB   3  
ATOM 6309  O OG1  . THR A 1 107 ? -15.159 -3.735  7.631   1.00 0.00 ? 107 THR A OG1  3  
ATOM 6310  C CG2  . THR A 1 107 ? -16.909 -5.180  8.164   1.00 0.00 ? 107 THR A CG2  3  
ATOM 6311  H H    . THR A 1 107 ? -14.766 -5.036  4.850   1.00 0.00 ? 107 THR A H    3  
ATOM 6312  H HA   . THR A 1 107 ? -14.187 -5.934  7.560   1.00 0.00 ? 107 THR A HA   3  
ATOM 6313  H HB   . THR A 1 107 ? -16.472 -4.488  6.151   1.00 0.00 ? 107 THR A HB   3  
ATOM 6314  H HG1  . THR A 1 107 ? -15.676 -2.880  7.623   1.00 0.00 ? 107 THR A HG1  3  
ATOM 6315  H HG21 . THR A 1 107 ? -17.192 -6.224  8.041   1.00 0.00 ? 107 THR A HG21 3  
ATOM 6316  H HG22 . THR A 1 107 ? -16.429 -5.044  9.133   1.00 0.00 ? 107 THR A HG22 3  
ATOM 6317  H HG23 . THR A 1 107 ? -17.799 -4.553  8.108   1.00 0.00 ? 107 THR A HG23 3  
ATOM 6318  N N    . THR A 1 108 ? -15.937 -7.582  5.386   1.00 0.00 ? 108 THR A N    3  
ATOM 6319  C CA   . THR A 1 108 ? -16.549 -8.870  5.104   1.00 0.00 ? 108 THR A CA   3  
ATOM 6320  C C    . THR A 1 108 ? -15.568 -9.774  4.356   1.00 0.00 ? 108 THR A C    3  
ATOM 6321  O O    . THR A 1 108 ? -15.731 -10.992 4.339   1.00 0.00 ? 108 THR A O    3  
ATOM 6322  C CB   . THR A 1 108 ? -17.851 -8.618  4.340   1.00 0.00 ? 108 THR A CB   3  
ATOM 6323  O OG1  . THR A 1 108 ? -18.364 -9.924  4.090   1.00 0.00 ? 108 THR A OG1  3  
ATOM 6324  C CG2  . THR A 1 108 ? -17.607 -8.040  2.945   1.00 0.00 ? 108 THR A CG2  3  
ATOM 6325  H H    . THR A 1 108 ? -15.849 -6.975  4.596   1.00 0.00 ? 108 THR A H    3  
ATOM 6326  H HA   . THR A 1 108 ? -16.772 -9.358  6.053   1.00 0.00 ? 108 THR A HA   3  
ATOM 6327  H HB   . THR A 1 108 ? -18.522 -7.981  4.914   1.00 0.00 ? 108 THR A HB   3  
ATOM 6328  H HG1  . THR A 1 108 ? -18.721 -10.319 4.937   1.00 0.00 ? 108 THR A HG1  3  
ATOM 6329  H HG21 . THR A 1 108 ? -17.012 -7.130  3.027   1.00 0.00 ? 108 THR A HG21 3  
ATOM 6330  H HG22 . THR A 1 108 ? -17.072 -8.770  2.337   1.00 0.00 ? 108 THR A HG22 3  
ATOM 6331  H HG23 . THR A 1 108 ? -18.563 -7.807  2.476   1.00 0.00 ? 108 THR A HG23 3  
ATOM 6332  N N    . SER A 1 109 ? -14.572 -9.141  3.752   1.00 0.00 ? 109 SER A N    3  
ATOM 6333  C CA   . SER A 1 109 ? -13.566 -9.873  3.003   1.00 0.00 ? 109 SER A CA   3  
ATOM 6334  C C    . SER A 1 109 ? -12.201 -9.727  3.679   1.00 0.00 ? 109 SER A C    3  
ATOM 6335  O O    . SER A 1 109 ? -11.994 -8.814  4.476   1.00 0.00 ? 109 SER A O    3  
ATOM 6336  C CB   . SER A 1 109 ? -13.495 -9.386  1.554   1.00 0.00 ? 109 SER A CB   3  
ATOM 6337  O OG   . SER A 1 109 ? -12.608 -8.281  1.405   1.00 0.00 ? 109 SER A OG   3  
ATOM 6338  H H    . SER A 1 109 ? -14.448 -8.150  3.770   1.00 0.00 ? 109 SER A H    3  
ATOM 6339  H HA   . SER A 1 109 ? -13.892 -10.913 3.021   1.00 0.00 ? 109 SER A HA   3  
ATOM 6340  H HB2  . SER A 1 109 ? -13.167 -10.203 0.913   1.00 0.00 ? 109 SER A HB2  3  
ATOM 6341  H HB3  . SER A 1 109 ? -14.492 -9.100  1.219   1.00 0.00 ? 109 SER A HB3  3  
ATOM 6342  H HG   . SER A 1 109 ? -12.985 -7.477  1.865   1.00 0.00 ? 109 SER A HG   3  
ATOM 6343  N N    . THR A 1 110 ? -11.305 -10.642 3.336   1.00 0.00 ? 110 THR A N    3  
ATOM 6344  C CA   . THR A 1 110 ? -9.966  -10.625 3.900   1.00 0.00 ? 110 THR A CA   3  
ATOM 6345  C C    . THR A 1 110 ? -8.999  -9.906  2.957   1.00 0.00 ? 110 THR A C    3  
ATOM 6346  O O    . THR A 1 110 ? -9.391  -9.466  1.877   1.00 0.00 ? 110 THR A O    3  
ATOM 6347  C CB   . THR A 1 110 ? -9.561  -12.070 4.197   1.00 0.00 ? 110 THR A CB   3  
ATOM 6348  O OG1  . THR A 1 110 ? -9.192  -12.598 2.926   1.00 0.00 ? 110 THR A OG1  3  
ATOM 6349  C CG2  . THR A 1 110 ? -10.749 -12.934 4.628   1.00 0.00 ? 110 THR A CG2  3  
ATOM 6350  H H    . THR A 1 110 ? -11.482 -11.381 2.687   1.00 0.00 ? 110 THR A H    3  
ATOM 6351  H HA   . THR A 1 110 ? -9.991  -10.055 4.828   1.00 0.00 ? 110 THR A HA   3  
ATOM 6352  H HB   . THR A 1 110 ? -8.765  -12.107 4.940   1.00 0.00 ? 110 THR A HB   3  
ATOM 6353  H HG1  . THR A 1 110 ? -9.963  -12.534 2.292   1.00 0.00 ? 110 THR A HG1  3  
ATOM 6354  H HG21 . THR A 1 110 ? -11.471 -12.318 5.163   1.00 0.00 ? 110 THR A HG21 3  
ATOM 6355  H HG22 . THR A 1 110 ? -11.224 -13.366 3.746   1.00 0.00 ? 110 THR A HG22 3  
ATOM 6356  H HG23 . THR A 1 110 ? -10.399 -13.734 5.280   1.00 0.00 ? 110 THR A HG23 3  
ATOM 6357  N N    . LEU A 1 111 ? -7.754  -9.809  3.399   1.00 0.00 ? 111 LEU A N    3  
ATOM 6358  C CA   . LEU A 1 111 ? -6.728  -9.150  2.608   1.00 0.00 ? 111 LEU A CA   3  
ATOM 6359  C C    . LEU A 1 111 ? -6.583  -9.871  1.267   1.00 0.00 ? 111 LEU A C    3  
ATOM 6360  O O    . LEU A 1 111 ? -6.572  -9.235  0.214   1.00 0.00 ? 111 LEU A O    3  
ATOM 6361  C CB   . LEU A 1 111 ? -5.422  -9.054  3.399   1.00 0.00 ? 111 LEU A CB   3  
ATOM 6362  C CG   . LEU A 1 111 ? -4.250  -8.382  2.681   1.00 0.00 ? 111 LEU A CG   3  
ATOM 6363  C CD1  . LEU A 1 111 ? -4.658  -7.015  2.128   1.00 0.00 ? 111 LEU A CD1  3  
ATOM 6364  C CD2  . LEU A 1 111 ? -3.027  -8.289  3.594   1.00 0.00 ? 111 LEU A CD2  3  
ATOM 6365  H H    . LEU A 1 111 ? -7.443  -10.170 4.279   1.00 0.00 ? 111 LEU A H    3  
ATOM 6366  H HA   . LEU A 1 111 ? -7.066  -8.132  2.419   1.00 0.00 ? 111 LEU A HA   3  
ATOM 6367  H HB2  . LEU A 1 111 ? -5.618  -8.508  4.322   1.00 0.00 ? 111 LEU A HB2  3  
ATOM 6368  H HB3  . LEU A 1 111 ? -5.118  -10.061 3.684   1.00 0.00 ? 111 LEU A HB3  3  
ATOM 6369  H HG   . LEU A 1 111 ? -3.970  -9.002  1.829   1.00 0.00 ? 111 LEU A HG   3  
ATOM 6370  H HD11 . LEU A 1 111 ? -5.600  -6.706  2.581   1.00 0.00 ? 111 LEU A HD11 3  
ATOM 6371  H HD12 . LEU A 1 111 ? -3.885  -6.283  2.363   1.00 0.00 ? 111 LEU A HD12 3  
ATOM 6372  H HD13 . LEU A 1 111 ? -4.780  -7.081  1.047   1.00 0.00 ? 111 LEU A HD13 3  
ATOM 6373  H HD21 . LEU A 1 111 ? -3.344  -8.005  4.598   1.00 0.00 ? 111 LEU A HD21 3  
ATOM 6374  H HD22 . LEU A 1 111 ? -2.526  -9.257  3.631   1.00 0.00 ? 111 LEU A HD22 3  
ATOM 6375  H HD23 . LEU A 1 111 ? -2.338  -7.538  3.204   1.00 0.00 ? 111 LEU A HD23 3  
ATOM 6376  N N    . GLN A 1 112 ? -6.475  -11.190 1.349   1.00 0.00 ? 112 GLN A N    3  
ATOM 6377  C CA   . GLN A 1 112 ? -6.331  -12.004 0.154   1.00 0.00 ? 112 GLN A CA   3  
ATOM 6378  C C    . GLN A 1 112 ? -7.458  -11.699 -0.835  1.00 0.00 ? 112 GLN A C    3  
ATOM 6379  O O    . GLN A 1 112 ? -7.210  -11.511 -2.026  1.00 0.00 ? 112 GLN A O    3  
ATOM 6380  C CB   . GLN A 1 112 ? -6.298  -13.493 0.505   1.00 0.00 ? 112 GLN A CB   3  
ATOM 6381  C CG   . GLN A 1 112 ? -5.248  -14.230 -0.328  1.00 0.00 ? 112 GLN A CG   3  
ATOM 6382  C CD   . GLN A 1 112 ? -5.234  -15.723 0.005   1.00 0.00 ? 112 GLN A CD   3  
ATOM 6383  O OE1  . GLN A 1 112 ? -6.059  -16.496 -0.457  1.00 0.00 ? 112 GLN A OE1  3  
ATOM 6384  N NE2  . GLN A 1 112 ? -4.254  -16.085 0.828   1.00 0.00 ? 112 GLN A NE2  3  
ATOM 6385  H H    . GLN A 1 112 ? -6.485  -11.699 2.209   1.00 0.00 ? 112 GLN A H    3  
ATOM 6386  H HA   . GLN A 1 112 ? -5.372  -11.718 -0.279  1.00 0.00 ? 112 GLN A HA   3  
ATOM 6387  H HB2  . GLN A 1 112 ? -6.078  -13.614 1.566   1.00 0.00 ? 112 GLN A HB2  3  
ATOM 6388  H HB3  . GLN A 1 112 ? -7.281  -13.933 0.331   1.00 0.00 ? 112 GLN A HB3  3  
ATOM 6389  H HG2  . GLN A 1 112 ? -5.456  -14.091 -1.388  1.00 0.00 ? 112 GLN A HG2  3  
ATOM 6390  H HG3  . GLN A 1 112 ? -4.263  -13.802 -0.139  1.00 0.00 ? 112 GLN A HG3  3  
ATOM 6391  H HE21 . GLN A 1 112 ? -3.611  -15.401 1.171   1.00 0.00 ? 112 GLN A HE21 3  
ATOM 6392  H HE22 . GLN A 1 112 ? -4.162  -17.042 1.104   1.00 0.00 ? 112 GLN A HE22 3  
ATOM 6393  N N    . GLU A 1 113 ? -8.672  -11.658 -0.306  1.00 0.00 ? 113 GLU A N    3  
ATOM 6394  C CA   . GLU A 1 113 ? -9.838  -11.379 -1.128  1.00 0.00 ? 113 GLU A CA   3  
ATOM 6395  C C    . GLU A 1 113 ? -9.704  -10.007 -1.791  1.00 0.00 ? 113 GLU A C    3  
ATOM 6396  O O    . GLU A 1 113 ? -10.056 -9.840  -2.957  1.00 0.00 ? 113 GLU A O    3  
ATOM 6397  C CB   . GLU A 1 113 ? -11.124 -11.467 -0.303  1.00 0.00 ? 113 GLU A CB   3  
ATOM 6398  C CG   . GLU A 1 113 ? -11.445 -12.917 0.060   1.00 0.00 ? 113 GLU A CG   3  
ATOM 6399  C CD   . GLU A 1 113 ? -11.796 -13.730 -1.188  1.00 0.00 ? 113 GLU A CD   3  
ATOM 6400  O OE1  . GLU A 1 113 ? -12.906 -13.507 -1.716  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 6401  O OE2  . GLU A 1 113 ? -10.945 -14.556 -1.585  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 6402  H H    . GLU A 1 113 ? -8.866  -11.812 0.663   1.00 0.00 ? 113 GLU A H    3  
ATOM 6403  H HA   . GLU A 1 113 ? -9.848  -12.158 -1.889  1.00 0.00 ? 113 GLU A HA   3  
ATOM 6404  H HB2  . GLU A 1 113 ? -11.017 -10.876 0.607   1.00 0.00 ? 113 GLU A HB2  3  
ATOM 6405  H HB3  . GLU A 1 113 ? -11.951 -11.037 -0.866  1.00 0.00 ? 113 GLU A HB3  3  
ATOM 6406  H HG2  . GLU A 1 113 ? -10.589 -13.368 0.563   1.00 0.00 ? 113 GLU A HG2  3  
ATOM 6407  H HG3  . GLU A 1 113 ? -12.278 -12.945 0.762   1.00 0.00 ? 113 GLU A HG3  3  
ATOM 6408  N N    . GLN A 1 114 ? -9.192  -9.060  -1.018  1.00 0.00 ? 114 GLN A N    3  
ATOM 6409  C CA   . GLN A 1 114 ? -9.007  -7.706  -1.515  1.00 0.00 ? 114 GLN A CA   3  
ATOM 6410  C C    . GLN A 1 114 ? -8.104  -7.715  -2.751  1.00 0.00 ? 114 GLN A C    3  
ATOM 6411  O O    . GLN A 1 114 ? -8.462  -7.163  -3.790  1.00 0.00 ? 114 GLN A O    3  
ATOM 6412  C CB   . GLN A 1 114 ? -8.440  -6.795  -0.427  1.00 0.00 ? 114 GLN A CB   3  
ATOM 6413  C CG   . GLN A 1 114 ? -8.864  -5.342  -0.651  1.00 0.00 ? 114 GLN A CG   3  
ATOM 6414  C CD   . GLN A 1 114 ? -10.169 -5.032  0.084   1.00 0.00 ? 114 GLN A CD   3  
ATOM 6415  O OE1  . GLN A 1 114 ? -10.183 -4.492  1.178   1.00 0.00 ? 114 GLN A OE1  3  
ATOM 6416  N NE2  . GLN A 1 114 ? -11.263 -5.404  -0.576  1.00 0.00 ? 114 GLN A NE2  3  
ATOM 6417  H H    . GLN A 1 114 ? -8.907  -9.203  -0.071  1.00 0.00 ? 114 GLN A H    3  
ATOM 6418  H HA   . GLN A 1 114 ? -10.004 -7.360  -1.789  1.00 0.00 ? 114 GLN A HA   3  
ATOM 6419  H HB2  . GLN A 1 114 ? -8.785  -7.131  0.551   1.00 0.00 ? 114 GLN A HB2  3  
ATOM 6420  H HB3  . GLN A 1 114 ? -7.352  -6.862  -0.420  1.00 0.00 ? 114 GLN A HB3  3  
ATOM 6421  H HG2  . GLN A 1 114 ? -8.078  -4.672  -0.303  1.00 0.00 ? 114 GLN A HG2  3  
ATOM 6422  H HG3  . GLN A 1 114 ? -8.991  -5.158  -1.718  1.00 0.00 ? 114 GLN A HG3  3  
ATOM 6423  H HE21 . GLN A 1 114 ? -11.182 -5.842  -1.470  1.00 0.00 ? 114 GLN A HE21 3  
ATOM 6424  H HE22 . GLN A 1 114 ? -12.166 -5.243  -0.177  1.00 0.00 ? 114 GLN A HE22 3  
ATOM 6425  N N    . ILE A 1 115 ? -6.949  -8.346  -2.595  1.00 0.00 ? 115 ILE A N    3  
ATOM 6426  C CA   . ILE A 1 115 ? -5.992  -8.433  -3.684  1.00 0.00 ? 115 ILE A CA   3  
ATOM 6427  C C    . ILE A 1 115 ? -6.626  -9.181  -4.858  1.00 0.00 ? 115 ILE A C    3  
ATOM 6428  O O    . ILE A 1 115 ? -6.297  -8.924  -6.015  1.00 0.00 ? 115 ILE A O    3  
ATOM 6429  C CB   . ILE A 1 115 ? -4.680  -9.052  -3.197  1.00 0.00 ? 115 ILE A CB   3  
ATOM 6430  C CG1  . ILE A 1 115 ? -3.766  -7.989  -2.586  1.00 0.00 ? 115 ILE A CG1  3  
ATOM 6431  C CG2  . ILE A 1 115 ? -3.988  -9.826  -4.321  1.00 0.00 ? 115 ILE A CG2  3  
ATOM 6432  C CD1  . ILE A 1 115 ? -4.515  -7.153  -1.547  1.00 0.00 ? 115 ILE A CD1  3  
ATOM 6433  H H    . ILE A 1 115 ? -6.665  -8.792  -1.747  1.00 0.00 ? 115 ILE A H    3  
ATOM 6434  H HA   . ILE A 1 115 ? -5.767  -7.415  -4.005  1.00 0.00 ? 115 ILE A HA   3  
ATOM 6435  H HB   . ILE A 1 115 ? -4.913  -9.768  -2.409  1.00 0.00 ? 115 ILE A HB   3  
ATOM 6436  H HG12 . ILE A 1 115 ? -2.906  -8.469  -2.119  1.00 0.00 ? 115 ILE A HG12 3  
ATOM 6437  H HG13 . ILE A 1 115 ? -3.380  -7.340  -3.372  1.00 0.00 ? 115 ILE A HG13 3  
ATOM 6438  H HG21 . ILE A 1 115 ? -3.928  -9.199  -5.210  1.00 0.00 ? 115 ILE A HG21 3  
ATOM 6439  H HG22 . ILE A 1 115 ? -2.983  -10.106 -4.004  1.00 0.00 ? 115 ILE A HG22 3  
ATOM 6440  H HG23 . ILE A 1 115 ? -4.561  -10.725 -4.548  1.00 0.00 ? 115 ILE A HG23 3  
ATOM 6441  H HD11 . ILE A 1 115 ? -4.977  -7.812  -0.813  1.00 0.00 ? 115 ILE A HD11 3  
ATOM 6442  H HD12 . ILE A 1 115 ? -3.815  -6.484  -1.045  1.00 0.00 ? 115 ILE A HD12 3  
ATOM 6443  H HD13 . ILE A 1 115 ? -5.287  -6.563  -2.043  1.00 0.00 ? 115 ILE A HD13 3  
ATOM 6444  N N    . GLY A 1 116 ? -7.525  -10.094 -4.519  1.00 0.00 ? 116 GLY A N    3  
ATOM 6445  C CA   . GLY A 1 116 ? -8.210  -10.881 -5.530  1.00 0.00 ? 116 GLY A CA   3  
ATOM 6446  C C    . GLY A 1 116 ? -9.023  -9.985  -6.467  1.00 0.00 ? 116 GLY A C    3  
ATOM 6447  O O    . GLY A 1 116 ? -8.829  -10.013 -7.681  1.00 0.00 ? 116 GLY A O    3  
ATOM 6448  H H    . GLY A 1 116 ? -7.788  -10.297 -3.576  1.00 0.00 ? 116 GLY A H    3  
ATOM 6449  H HA2  . GLY A 1 116 ? -7.481  -11.450 -6.107  1.00 0.00 ? 116 GLY A HA2  3  
ATOM 6450  H HA3  . GLY A 1 116 ? -8.869  -11.604 -5.048  1.00 0.00 ? 116 GLY A HA3  3  
ATOM 6451  N N    . TRP A 1 117 ? -9.915  -9.211  -5.867  1.00 0.00 ? 117 TRP A N    3  
ATOM 6452  C CA   . TRP A 1 117 ? -10.757 -8.309  -6.633  1.00 0.00 ? 117 TRP A CA   3  
ATOM 6453  C C    . TRP A 1 117 ? -9.847  -7.373  -7.429  1.00 0.00 ? 117 TRP A C    3  
ATOM 6454  O O    . TRP A 1 117 ? -10.097 -7.110  -8.605  1.00 0.00 ? 117 TRP A O    3  
ATOM 6455  C CB   . TRP A 1 117 ? -11.731 -7.560  -5.719  1.00 0.00 ? 117 TRP A CB   3  
ATOM 6456  C CG   . TRP A 1 117 ? -12.946 -8.387  -5.293  1.00 0.00 ? 117 TRP A CG   3  
ATOM 6457  C CD1  . TRP A 1 117 ? -13.934 -8.859  -6.065  1.00 0.00 ? 117 TRP A CD1  3  
ATOM 6458  C CD2  . TRP A 1 117 ? -13.263 -8.823  -3.954  1.00 0.00 ? 117 TRP A CD2  3  
ATOM 6459  N NE1  . TRP A 1 117 ? -14.861 -9.565  -5.325  1.00 0.00 ? 117 TRP A NE1  3  
ATOM 6460  C CE2  . TRP A 1 117 ? -14.440 -9.542  -4.001  1.00 0.00 ? 117 TRP A CE2  3  
ATOM 6461  C CE3  . TRP A 1 117 ? -12.578 -8.617  -2.745  1.00 0.00 ? 117 TRP A CE3  3  
ATOM 6462  C CZ2  . TRP A 1 117 ? -15.035 -10.113 -2.869  1.00 0.00 ? 117 TRP A CZ2  3  
ATOM 6463  C CZ3  . TRP A 1 117 ? -13.185 -9.193  -1.623  1.00 0.00 ? 117 TRP A CZ3  3  
ATOM 6464  C CH2  . TRP A 1 117 ? -14.370 -9.919  -1.652  1.00 0.00 ? 117 TRP A CH2  3  
ATOM 6465  H H    . TRP A 1 117 ? -10.067 -9.195  -4.878  1.00 0.00 ? 117 TRP A H    3  
ATOM 6466  H HA   . TRP A 1 117 ? -11.361 -8.912  -7.312  1.00 0.00 ? 117 TRP A HA   3  
ATOM 6467  H HB2  . TRP A 1 117 ? -11.197 -7.233  -4.827  1.00 0.00 ? 117 TRP A HB2  3  
ATOM 6468  H HB3  . TRP A 1 117 ? -12.077 -6.663  -6.232  1.00 0.00 ? 117 TRP A HB3  3  
ATOM 6469  H HD1  . TRP A 1 117 ? -13.997 -8.706  -7.142  1.00 0.00 ? 117 TRP A HD1  3  
ATOM 6470  H HE1  . TRP A 1 117 ? -15.758 -10.051 -5.708  1.00 0.00 ? 117 TRP A HE1  3  
ATOM 6471  H HE3  . TRP A 1 117 ? -11.647 -8.053  -2.682  1.00 0.00 ? 117 TRP A HE3  3  
ATOM 6472  H HZ2  . TRP A 1 117 ? -15.966 -10.677 -2.932  1.00 0.00 ? 117 TRP A HZ2  3  
ATOM 6473  H HZ3  . TRP A 1 117 ? -12.695 -9.063  -0.658  1.00 0.00 ? 117 TRP A HZ3  3  
ATOM 6474  H HH2  . TRP A 1 117 ? -14.779 -10.337 -0.732  1.00 0.00 ? 117 TRP A HH2  3  
ATOM 6475  N N    . MET A 1 118 ? -8.809  -6.896  -6.758  1.00 0.00 ? 118 MET A N    3  
ATOM 6476  C CA   . MET A 1 118 ? -7.859  -5.996  -7.389  1.00 0.00 ? 118 MET A CA   3  
ATOM 6477  C C    . MET A 1 118 ? -6.958  -6.748  -8.371  1.00 0.00 ? 118 MET A C    3  
ATOM 6478  O O    . MET A 1 118 ? -6.264  -6.134  -9.177  1.00 0.00 ? 118 MET A O    3  
ATOM 6479  C CB   . MET A 1 118 ? -6.998  -5.328  -6.316  1.00 0.00 ? 118 MET A CB   3  
ATOM 6480  C CG   . MET A 1 118 ? -6.151  -4.203  -6.914  1.00 0.00 ? 118 MET A CG   3  
ATOM 6481  S SD   . MET A 1 118 ? -6.774  -2.618  -6.377  1.00 0.00 ? 118 MET A SD   3  
ATOM 6482  C CE   . MET A 1 118 ? -6.071  -2.547  -4.738  1.00 0.00 ? 118 MET A CE   3  
ATOM 6483  H H    . MET A 1 118 ? -8.613  -7.116  -5.802  1.00 0.00 ? 118 MET A H    3  
ATOM 6484  H HA   . MET A 1 118 ? -8.462  -5.264  -7.926  1.00 0.00 ? 118 MET A HA   3  
ATOM 6485  H HB2  . MET A 1 118 ? -7.637  -4.928  -5.529  1.00 0.00 ? 118 MET A HB2  3  
ATOM 6486  H HB3  . MET A 1 118 ? -6.348  -6.069  -5.852  1.00 0.00 ? 118 MET A HB3  3  
ATOM 6487  H HG2  . MET A 1 118 ? -5.111  -4.316  -6.607  1.00 0.00 ? 118 MET A HG2  3  
ATOM 6488  H HG3  . MET A 1 118 ? -6.170  -4.260  -8.002  1.00 0.00 ? 118 MET A HG3  3  
ATOM 6489  H HE1  . MET A 1 118 ? -5.927  -3.560  -4.361  1.00 0.00 ? 118 MET A HE1  3  
ATOM 6490  H HE2  . MET A 1 118 ? -5.111  -2.033  -4.777  1.00 0.00 ? 118 MET A HE2  3  
ATOM 6491  H HE3  . MET A 1 118 ? -6.747  -2.005  -4.076  1.00 0.00 ? 118 MET A HE3  3  
ATOM 6492  N N    . THR A 1 119 ? -7.000  -8.069  -8.269  1.00 0.00 ? 119 THR A N    3  
ATOM 6493  C CA   . THR A 1 119 ? -6.196  -8.912  -9.138  1.00 0.00 ? 119 THR A CA   3  
ATOM 6494  C C    . THR A 1 119 ? -7.087  -9.641  -10.147 1.00 0.00 ? 119 THR A C    3  
ATOM 6495  O O    . THR A 1 119 ? -6.690  -10.659 -10.709 1.00 0.00 ? 119 THR A O    3  
ATOM 6496  C CB   . THR A 1 119 ? -5.380  -9.858  -8.255  1.00 0.00 ? 119 THR A CB   3  
ATOM 6497  O OG1  . THR A 1 119 ? -4.472  -8.997  -7.573  1.00 0.00 ? 119 THR A OG1  3  
ATOM 6498  C CG2  . THR A 1 119 ? -4.475  -10.784 -9.071  1.00 0.00 ? 119 THR A CG2  3  
ATOM 6499  H H    . THR A 1 119 ? -7.568  -8.561  -7.610  1.00 0.00 ? 119 THR A H    3  
ATOM 6500  H HA   . THR A 1 119 ? -5.523  -8.274  -9.709  1.00 0.00 ? 119 THR A HA   3  
ATOM 6501  H HB   . THR A 1 119 ? -6.029  -10.431 -7.594  1.00 0.00 ? 119 THR A HB   3  
ATOM 6502  H HG1  . THR A 1 119 ? -3.922  -8.487  -8.234  1.00 0.00 ? 119 THR A HG1  3  
ATOM 6503  H HG21 . THR A 1 119 ? -4.080  -10.243 -9.930  1.00 0.00 ? 119 THR A HG21 3  
ATOM 6504  H HG22 . THR A 1 119 ? -3.650  -11.127 -8.446  1.00 0.00 ? 119 THR A HG22 3  
ATOM 6505  H HG23 . THR A 1 119 ? -5.051  -11.643 -9.415  1.00 0.00 ? 119 THR A HG23 3  
ATOM 6506  N N    . HIS A 1 120 ? -8.275  -9.088  -10.346 1.00 0.00 ? 120 HIS A N    3  
ATOM 6507  C CA   . HIS A 1 120 ? -9.225  -9.672  -11.278 1.00 0.00 ? 120 HIS A CA   3  
ATOM 6508  C C    . HIS A 1 120 ? -9.226  -8.869  -12.580 1.00 0.00 ? 120 HIS A C    3  
ATOM 6509  O O    . HIS A 1 120 ? -8.602  -7.813  -12.663 1.00 0.00 ? 120 HIS A O    3  
ATOM 6510  C CB   . HIS A 1 120 ? -10.614 -9.775  -10.644 1.00 0.00 ? 120 HIS A CB   3  
ATOM 6511  C CG   . HIS A 1 120 ? -11.187 -11.172 -10.644 1.00 0.00 ? 120 HIS A CG   3  
ATOM 6512  N ND1  . HIS A 1 120 ? -11.874 -11.700 -11.724 1.00 0.00 ? 120 HIS A ND1  3  
ATOM 6513  C CD2  . HIS A 1 120 ? -11.168 -12.144 -9.687  1.00 0.00 ? 120 HIS A CD2  3  
ATOM 6514  C CE1  . HIS A 1 120 ? -12.247 -12.934 -11.418 1.00 0.00 ? 120 HIS A CE1  3  
ATOM 6515  N NE2  . HIS A 1 120 ? -11.809 -13.207 -10.155 1.00 0.00 ? 120 HIS A NE2  3  
ATOM 6516  H H    . HIS A 1 120 ? -8.590  -8.258  -9.885  1.00 0.00 ? 120 HIS A H    3  
ATOM 6517  H HA   . HIS A 1 120 ? -8.878  -10.684 -11.484 1.00 0.00 ? 120 HIS A HA   3  
ATOM 6518  H HB2  . HIS A 1 120 ? -10.560 -9.415  -9.616  1.00 0.00 ? 120 HIS A HB2  3  
ATOM 6519  H HB3  . HIS A 1 120 ? -11.295 -9.113  -11.178 1.00 0.00 ? 120 HIS A HB3  3  
ATOM 6520  H HD1  . HIS A 1 120 ? -12.057 -11.231 -12.587 1.00 0.00 ? 120 HIS A HD1  3  
ATOM 6521  H HD2  . HIS A 1 120 ? -10.704 -12.060 -8.704  1.00 0.00 ? 120 HIS A HD2  3  
ATOM 6522  H HE1  . HIS A 1 120 ? -12.806 -13.613 -12.063 1.00 0.00 ? 120 HIS A HE1  3  
ATOM 6523  H HE2  . HIS A 1 120 ? -11.899 -14.085 -9.686  1.00 0.00 ? 120 HIS A HE2  3  
ATOM 6524  N N    . ASN A 1 121 ? -9.932  -9.403  -13.566 1.00 0.00 ? 121 ASN A N    3  
ATOM 6525  C CA   . ASN A 1 121 ? -10.023 -8.750  -14.861 1.00 0.00 ? 121 ASN A CA   3  
ATOM 6526  C C    . ASN A 1 121 ? -11.490 -8.454  -15.177 1.00 0.00 ? 121 ASN A C    3  
ATOM 6527  O O    . ASN A 1 121 ? -12.274 -9.371  -15.418 1.00 0.00 ? 121 ASN A O    3  
ATOM 6528  C CB   . ASN A 1 121 ? -9.472  -9.648  -15.970 1.00 0.00 ? 121 ASN A CB   3  
ATOM 6529  C CG   . ASN A 1 121 ? -8.293  -8.980  -16.682 1.00 0.00 ? 121 ASN A CG   3  
ATOM 6530  O OD1  . ASN A 1 121 ? -7.569  -8.177  -16.117 1.00 0.00 ? 121 ASN A OD1  3  
ATOM 6531  N ND2  . ASN A 1 121 ? -8.143  -9.355  -17.949 1.00 0.00 ? 121 ASN A ND2  3  
ATOM 6532  H H    . ASN A 1 121 ? -10.437 -10.263 -13.490 1.00 0.00 ? 121 ASN A H    3  
ATOM 6533  H HA   . ASN A 1 121 ? -9.426  -7.843  -14.766 1.00 0.00 ? 121 ASN A HA   3  
ATOM 6534  H HB2  . ASN A 1 121 ? -9.152  -10.600 -15.547 1.00 0.00 ? 121 ASN A HB2  3  
ATOM 6535  H HB3  . ASN A 1 121 ? -10.260 -9.867  -16.690 1.00 0.00 ? 121 ASN A HB3  3  
ATOM 6536  H HD21 . ASN A 1 121 ? -8.773  -10.019 -18.352 1.00 0.00 ? 121 ASN A HD21 3  
ATOM 6537  H HD22 . ASN A 1 121 ? -7.400  -8.974  -18.499 1.00 0.00 ? 121 ASN A HD22 3  
ATOM 6538  N N    . PRO A 1 122 ? -11.827 -7.137  -15.166 1.00 0.00 ? 122 PRO A N    3  
ATOM 6539  C CA   . PRO A 1 122 ? -10.838 -6.114  -14.871 1.00 0.00 ? 122 PRO A CA   3  
ATOM 6540  C C    . PRO A 1 122 ? -10.513 -6.080  -13.377 1.00 0.00 ? 122 PRO A C    3  
ATOM 6541  O O    . PRO A 1 122 ? -11.280 -6.587  -12.559 1.00 0.00 ? 122 PRO A O    3  
ATOM 6542  C CB   . PRO A 1 122 ? -11.448 -4.817  -15.377 1.00 0.00 ? 122 PRO A CB   3  
ATOM 6543  C CG   . PRO A 1 122 ? -12.939 -5.084  -15.512 1.00 0.00 ? 122 PRO A CG   3  
ATOM 6544  C CD   . PRO A 1 122 ? -13.153 -6.588  -15.433 1.00 0.00 ? 122 PRO A CD   3  
ATOM 6545  H HA   . PRO A 1 122 ? -9.974  -6.322  -15.333 1.00 0.00 ? 122 PRO A HA   3  
ATOM 6546  H HB2  . PRO A 1 122 ? -11.260 -3.999  -14.682 1.00 0.00 ? 122 PRO A HB2  3  
ATOM 6547  H HB3  . PRO A 1 122 ? -11.015 -4.529  -16.335 1.00 0.00 ? 122 PRO A HB3  3  
ATOM 6548  H HG2  . PRO A 1 122 ? -13.490 -4.579  -14.719 1.00 0.00 ? 122 PRO A HG2  3  
ATOM 6549  H HG3  . PRO A 1 122 ? -13.312 -4.695  -16.458 1.00 0.00 ? 122 PRO A HG3  3  
ATOM 6550  H HD2  . PRO A 1 122 ? -13.855 -6.847  -14.642 1.00 0.00 ? 122 PRO A HD2  3  
ATOM 6551  H HD3  . PRO A 1 122 ? -13.563 -6.978  -16.365 1.00 0.00 ? 122 PRO A HD3  3  
ATOM 6552  N N    . PRO A 1 123 ? -9.346  -5.459  -13.055 1.00 0.00 ? 123 PRO A N    3  
ATOM 6553  C CA   . PRO A 1 123 ? -8.912  -5.351  -11.673 1.00 0.00 ? 123 PRO A CA   3  
ATOM 6554  C C    . PRO A 1 123 ? -9.721  -4.290  -10.926 1.00 0.00 ? 123 PRO A C    3  
ATOM 6555  O O    . PRO A 1 123 ? -9.703  -3.117  -11.293 1.00 0.00 ? 123 PRO A O    3  
ATOM 6556  C CB   . PRO A 1 123 ? -7.430  -5.021  -11.752 1.00 0.00 ? 123 PRO A CB   3  
ATOM 6557  C CG   . PRO A 1 123 ? -7.192  -4.501  -13.160 1.00 0.00 ? 123 PRO A CG   3  
ATOM 6558  C CD   . PRO A 1 123 ? -8.413  -4.847  -13.997 1.00 0.00 ? 123 PRO A CD   3  
ATOM 6559  H HA   . PRO A 1 123 ? -9.075  -6.212  -11.190 1.00 0.00 ? 123 PRO A HA   3  
ATOM 6560  H HB2  . PRO A 1 123 ? -7.156  -4.274  -11.007 1.00 0.00 ? 123 PRO A HB2  3  
ATOM 6561  H HB3  . PRO A 1 123 ? -6.822  -5.905  -11.555 1.00 0.00 ? 123 PRO A HB3  3  
ATOM 6562  H HG2  . PRO A 1 123 ? -7.032  -3.422  -13.146 1.00 0.00 ? 123 PRO A HG2  3  
ATOM 6563  H HG3  . PRO A 1 123 ? -6.297  -4.950  -13.588 1.00 0.00 ? 123 PRO A HG3  3  
ATOM 6564  H HD2  . PRO A 1 123 ? -8.842  -3.957  -14.458 1.00 0.00 ? 123 PRO A HD2  3  
ATOM 6565  H HD3  . PRO A 1 123 ? -8.158  -5.532  -14.805 1.00 0.00 ? 123 PRO A HD3  3  
ATOM 6566  N N    . ILE A 1 124 ? -10.412 -4.742  -9.889  1.00 0.00 ? 124 ILE A N    3  
ATOM 6567  C CA   . ILE A 1 124 ? -11.226 -3.846  -9.085  1.00 0.00 ? 124 ILE A CA   3  
ATOM 6568  C C    . ILE A 1 124 ? -10.318 -2.850  -8.361  1.00 0.00 ? 124 ILE A C    3  
ATOM 6569  O O    . ILE A 1 124 ? -9.434  -3.247  -7.603  1.00 0.00 ? 124 ILE A O    3  
ATOM 6570  C CB   . ILE A 1 124 ? -12.135 -4.644  -8.148  1.00 0.00 ? 124 ILE A CB   3  
ATOM 6571  C CG1  . ILE A 1 124 ? -13.309 -5.256  -8.914  1.00 0.00 ? 124 ILE A CG1  3  
ATOM 6572  C CG2  . ILE A 1 124 ? -12.602 -3.783  -6.973  1.00 0.00 ? 124 ILE A CG2  3  
ATOM 6573  C CD1  . ILE A 1 124 ? -13.187 -6.780  -8.980  1.00 0.00 ? 124 ILE A CD1  3  
ATOM 6574  H H    . ILE A 1 124 ? -10.420 -5.698  -9.595  1.00 0.00 ? 124 ILE A H    3  
ATOM 6575  H HA   . ILE A 1 124 ? -11.872 -3.292  -9.766  1.00 0.00 ? 124 ILE A HA   3  
ATOM 6576  H HB   . ILE A 1 124 ? -11.557 -5.469  -7.732  1.00 0.00 ? 124 ILE A HB   3  
ATOM 6577  H HG12 . ILE A 1 124 ? -14.246 -4.983  -8.427  1.00 0.00 ? 124 ILE A HG12 3  
ATOM 6578  H HG13 . ILE A 1 124 ? -13.343 -4.846  -9.923  1.00 0.00 ? 124 ILE A HG13 3  
ATOM 6579  H HG21 . ILE A 1 124 ? -12.437 -2.731  -7.205  1.00 0.00 ? 124 ILE A HG21 3  
ATOM 6580  H HG22 . ILE A 1 124 ? -13.664 -3.954  -6.797  1.00 0.00 ? 124 ILE A HG22 3  
ATOM 6581  H HG23 . ILE A 1 124 ? -12.039 -4.050  -6.078  1.00 0.00 ? 124 ILE A HG23 3  
ATOM 6582  H HD11 . ILE A 1 124 ? -12.654 -7.140  -8.099  1.00 0.00 ? 124 ILE A HD11 3  
ATOM 6583  H HD12 . ILE A 1 124 ? -14.182 -7.223  -9.009  1.00 0.00 ? 124 ILE A HD12 3  
ATOM 6584  H HD13 . ILE A 1 124 ? -12.638 -7.061  -9.877  1.00 0.00 ? 124 ILE A HD13 3  
ATOM 6585  N N    . PRO A 1 125 ? -10.574 -1.541  -8.625  1.00 0.00 ? 125 PRO A N    3  
ATOM 6586  C CA   . PRO A 1 125 ? -9.790  -0.485  -8.008  1.00 0.00 ? 125 PRO A CA   3  
ATOM 6587  C C    . PRO A 1 125 ? -10.181 -0.299  -6.540  1.00 0.00 ? 125 PRO A C    3  
ATOM 6588  O O    . PRO A 1 125 ? -10.397 0.824   -6.088  1.00 0.00 ? 125 PRO A O    3  
ATOM 6589  C CB   . PRO A 1 125 ? -10.057 0.749   -8.854  1.00 0.00 ? 125 PRO A CB   3  
ATOM 6590  C CG   . PRO A 1 125 ? -11.331 0.457   -9.628  1.00 0.00 ? 125 PRO A CG   3  
ATOM 6591  C CD   . PRO A 1 125 ? -11.613 -1.033  -9.518  1.00 0.00 ? 125 PRO A CD   3  
ATOM 6592  H HA   . PRO A 1 125 ? -8.821  -0.729  -8.003  1.00 0.00 ? 125 PRO A HA   3  
ATOM 6593  H HB2  . PRO A 1 125 ? -10.175 1.634   -8.227  1.00 0.00 ? 125 PRO A HB2  3  
ATOM 6594  H HB3  . PRO A 1 125 ? -9.226  0.947   -9.530  1.00 0.00 ? 125 PRO A HB3  3  
ATOM 6595  H HG2  . PRO A 1 125 ? -12.165 1.033   -9.225  1.00 0.00 ? 125 PRO A HG2  3  
ATOM 6596  H HG3  . PRO A 1 125 ? -11.219 0.748   -10.672 1.00 0.00 ? 125 PRO A HG3  3  
ATOM 6597  H HD2  . PRO A 1 125 ? -12.608 -1.220  -9.114  1.00 0.00 ? 125 PRO A HD2  3  
ATOM 6598  H HD3  . PRO A 1 125 ? -11.568 -1.518  -10.493 1.00 0.00 ? 125 PRO A HD3  3  
ATOM 6599  N N    . VAL A 1 126 ? -10.260 -1.419  -5.836  1.00 0.00 ? 126 VAL A N    3  
ATOM 6600  C CA   . VAL A 1 126 ? -10.621 -1.394  -4.428  1.00 0.00 ? 126 VAL A CA   3  
ATOM 6601  C C    . VAL A 1 126 ? -9.699  -0.423  -3.687  1.00 0.00 ? 126 VAL A C    3  
ATOM 6602  O O    . VAL A 1 126 ? -10.122 0.239   -2.740  1.00 0.00 ? 126 VAL A O    3  
ATOM 6603  C CB   . VAL A 1 126 ? -10.583 -2.812  -3.854  1.00 0.00 ? 126 VAL A CB   3  
ATOM 6604  C CG1  . VAL A 1 126 ? -9.359  -3.577  -4.361  1.00 0.00 ? 126 VAL A CG1  3  
ATOM 6605  C CG2  . VAL A 1 126 ? -10.617 -2.784  -2.324  1.00 0.00 ? 126 VAL A CG2  3  
ATOM 6606  H H    . VAL A 1 126 ? -10.083 -2.329  -6.210  1.00 0.00 ? 126 VAL A H    3  
ATOM 6607  H HA   . VAL A 1 126 ? -11.646 -1.029  -4.358  1.00 0.00 ? 126 VAL A HA   3  
ATOM 6608  H HB   . VAL A 1 126 ? -11.474 -3.337  -4.199  1.00 0.00 ? 126 VAL A HB   3  
ATOM 6609  H HG11 . VAL A 1 126 ? -8.510  -2.896  -4.437  1.00 0.00 ? 126 VAL A HG11 3  
ATOM 6610  H HG12 . VAL A 1 126 ? -9.119  -4.381  -3.666  1.00 0.00 ? 126 VAL A HG12 3  
ATOM 6611  H HG13 . VAL A 1 126 ? -9.575  -3.998  -5.343  1.00 0.00 ? 126 VAL A HG13 3  
ATOM 6612  H HG21 . VAL A 1 126 ? -9.882  -2.068  -1.957  1.00 0.00 ? 126 VAL A HG21 3  
ATOM 6613  H HG22 . VAL A 1 126 ? -11.611 -2.489  -1.988  1.00 0.00 ? 126 VAL A HG22 3  
ATOM 6614  H HG23 . VAL A 1 126 ? -10.382 -3.775  -1.938  1.00 0.00 ? 126 VAL A HG23 3  
ATOM 6615  N N    . GLY A 1 127 ? -8.458  -0.370  -4.146  1.00 0.00 ? 127 GLY A N    3  
ATOM 6616  C CA   . GLY A 1 127 ? -7.473  0.509   -3.538  1.00 0.00 ? 127 GLY A CA   3  
ATOM 6617  C C    . GLY A 1 127 ? -7.850  1.978   -3.740  1.00 0.00 ? 127 GLY A C    3  
ATOM 6618  O O    . GLY A 1 127 ? -8.155  2.682   -2.779  1.00 0.00 ? 127 GLY A O    3  
ATOM 6619  H H    . GLY A 1 127 ? -8.122  -0.912  -4.916  1.00 0.00 ? 127 GLY A H    3  
ATOM 6620  H HA2  . GLY A 1 127 ? -7.396  0.293   -2.472  1.00 0.00 ? 127 GLY A HA2  3  
ATOM 6621  H HA3  . GLY A 1 127 ? -6.492  0.318   -3.973  1.00 0.00 ? 127 GLY A HA3  3  
ATOM 6622  N N    . GLU A 1 128 ? -7.816  2.396   -4.997  1.00 0.00 ? 128 GLU A N    3  
ATOM 6623  C CA   . GLU A 1 128 ? -8.150  3.769   -5.338  1.00 0.00 ? 128 GLU A CA   3  
ATOM 6624  C C    . GLU A 1 128 ? -9.515  4.143   -4.754  1.00 0.00 ? 128 GLU A C    3  
ATOM 6625  O O    . GLU A 1 128 ? -9.730  5.287   -4.354  1.00 0.00 ? 128 GLU A O    3  
ATOM 6626  C CB   . GLU A 1 128 ? -8.126  3.979   -6.853  1.00 0.00 ? 128 GLU A CB   3  
ATOM 6627  C CG   . GLU A 1 128 ? -6.976  4.903   -7.259  1.00 0.00 ? 128 GLU A CG   3  
ATOM 6628  C CD   . GLU A 1 128 ? -6.625  4.726   -8.738  1.00 0.00 ? 128 GLU A CD   3  
ATOM 6629  O OE1  . GLU A 1 128 ? -6.692  3.566   -9.201  1.00 0.00 ? 128 GLU A OE1  3  
ATOM 6630  O OE2  . GLU A 1 128 ? -6.300  5.753   -9.371  1.00 0.00 ? 128 GLU A OE2  3  
ATOM 6631  H H    . GLU A 1 128 ? -7.566  1.817   -5.773  1.00 0.00 ? 128 GLU A H    3  
ATOM 6632  H HA   . GLU A 1 128 ? -7.372  4.380   -4.879  1.00 0.00 ? 128 GLU A HA   3  
ATOM 6633  H HB2  . GLU A 1 128 ? -8.020  3.018   -7.355  1.00 0.00 ? 128 GLU A HB2  3  
ATOM 6634  H HB3  . GLU A 1 128 ? -9.074  4.408   -7.180  1.00 0.00 ? 128 GLU A HB3  3  
ATOM 6635  H HG2  . GLU A 1 128 ? -7.253  5.940   -7.069  1.00 0.00 ? 128 GLU A HG2  3  
ATOM 6636  H HG3  . GLU A 1 128 ? -6.100  4.691   -6.646  1.00 0.00 ? 128 GLU A HG3  3  
ATOM 6637  N N    . ILE A 1 129 ? -10.400 3.158   -4.724  1.00 0.00 ? 129 ILE A N    3  
ATOM 6638  C CA   . ILE A 1 129 ? -11.737 3.370   -4.198  1.00 0.00 ? 129 ILE A CA   3  
ATOM 6639  C C    . ILE A 1 129 ? -11.647 3.689   -2.704  1.00 0.00 ? 129 ILE A C    3  
ATOM 6640  O O    . ILE A 1 129 ? -12.126 4.731   -2.258  1.00 0.00 ? 129 ILE A O    3  
ATOM 6641  C CB   . ILE A 1 129 ? -12.635 2.173   -4.517  1.00 0.00 ? 129 ILE A CB   3  
ATOM 6642  C CG1  . ILE A 1 129 ? -12.911 2.082   -6.020  1.00 0.00 ? 129 ILE A CG1  3  
ATOM 6643  C CG2  . ILE A 1 129 ? -13.927 2.222   -3.700  1.00 0.00 ? 129 ILE A CG2  3  
ATOM 6644  C CD1  . ILE A 1 129 ? -12.955 0.623   -6.481  1.00 0.00 ? 129 ILE A CD1  3  
ATOM 6645  H H    . ILE A 1 129 ? -10.217 2.231   -5.051  1.00 0.00 ? 129 ILE A H    3  
ATOM 6646  H HA   . ILE A 1 129 ? -12.158 4.235   -4.710  1.00 0.00 ? 129 ILE A HA   3  
ATOM 6647  H HB   . ILE A 1 129 ? -12.107 1.264   -4.231  1.00 0.00 ? 129 ILE A HB   3  
ATOM 6648  H HG12 . ILE A 1 129 ? -13.860 2.568   -6.249  1.00 0.00 ? 129 ILE A HG12 3  
ATOM 6649  H HG13 . ILE A 1 129 ? -12.138 2.617   -6.568  1.00 0.00 ? 129 ILE A HG13 3  
ATOM 6650  H HG21 . ILE A 1 129 ? -13.689 2.440   -2.658  1.00 0.00 ? 129 ILE A HG21 3  
ATOM 6651  H HG22 . ILE A 1 129 ? -14.578 3.003   -4.094  1.00 0.00 ? 129 ILE A HG22 3  
ATOM 6652  H HG23 . ILE A 1 129 ? -14.435 1.260   -3.763  1.00 0.00 ? 129 ILE A HG23 3  
ATOM 6653  H HD11 . ILE A 1 129 ? -12.646 -0.026  -5.662  1.00 0.00 ? 129 ILE A HD11 3  
ATOM 6654  H HD12 . ILE A 1 129 ? -13.971 0.368   -6.784  1.00 0.00 ? 129 ILE A HD12 3  
ATOM 6655  H HD13 . ILE A 1 129 ? -12.280 0.488   -7.326  1.00 0.00 ? 129 ILE A HD13 3  
ATOM 6656  N N    . TYR A 1 130 ? -11.032 2.772   -1.972  1.00 0.00 ? 130 TYR A N    3  
ATOM 6657  C CA   . TYR A 1 130 ? -10.872 2.943   -0.538  1.00 0.00 ? 130 TYR A CA   3  
ATOM 6658  C C    . TYR A 1 130 ? -10.133 4.244   -0.218  1.00 0.00 ? 130 TYR A C    3  
ATOM 6659  O O    . TYR A 1 130 ? -10.469 4.934   0.743   1.00 0.00 ? 130 TYR A O    3  
ATOM 6660  C CB   . TYR A 1 130 ? -10.026 1.759   -0.063  1.00 0.00 ? 130 TYR A CB   3  
ATOM 6661  C CG   . TYR A 1 130 ? -10.249 1.384   1.403   1.00 0.00 ? 130 TYR A CG   3  
ATOM 6662  C CD1  . TYR A 1 130 ? -11.531 1.312   1.910   1.00 0.00 ? 130 TYR A CD1  3  
ATOM 6663  C CD2  . TYR A 1 130 ? -9.168  1.118   2.218   1.00 0.00 ? 130 TYR A CD2  3  
ATOM 6664  C CE1  . TYR A 1 130 ? -11.740 0.957   3.291   1.00 0.00 ? 130 TYR A CE1  3  
ATOM 6665  C CE2  . TYR A 1 130 ? -9.377  0.764   3.599   1.00 0.00 ? 130 TYR A CE2  3  
ATOM 6666  C CZ   . TYR A 1 130 ? -10.652 0.701   4.067   1.00 0.00 ? 130 TYR A CZ   3  
ATOM 6667  O OH   . TYR A 1 130 ? -10.850 0.367   5.370   1.00 0.00 ? 130 TYR A OH   3  
ATOM 6668  H H    . TYR A 1 130 ? -10.645 1.927   -2.342  1.00 0.00 ? 130 TYR A H    3  
ATOM 6669  H HA   . TYR A 1 130 ? -11.866 2.980   -0.090  1.00 0.00 ? 130 TYR A HA   3  
ATOM 6670  H HB2  . TYR A 1 130 ? -10.249 0.894   -0.687  1.00 0.00 ? 130 TYR A HB2  3  
ATOM 6671  H HB3  . TYR A 1 130 ? -8.973  1.997   -0.210  1.00 0.00 ? 130 TYR A HB3  3  
ATOM 6672  H HD1  . TYR A 1 130 ? -12.384 1.522   1.266   1.00 0.00 ? 130 TYR A HD1  3  
ATOM 6673  H HD2  . TYR A 1 130 ? -8.155  1.175   1.818   1.00 0.00 ? 130 TYR A HD2  3  
ATOM 6674  H HE1  . TYR A 1 130 ? -12.746 0.897   3.704   1.00 0.00 ? 130 TYR A HE1  3  
ATOM 6675  H HE2  . TYR A 1 130 ? -8.532  0.551   4.254   1.00 0.00 ? 130 TYR A HE2  3  
ATOM 6676  H HH   . TYR A 1 130 ? -10.097 -0.205  5.695   1.00 0.00 ? 130 TYR A HH   3  
ATOM 6677  N N    . LYS A 1 131 ? -9.139  4.539   -1.043  1.00 0.00 ? 131 LYS A N    3  
ATOM 6678  C CA   . LYS A 1 131 ? -8.348  5.745   -0.861  1.00 0.00 ? 131 LYS A CA   3  
ATOM 6679  C C    . LYS A 1 131 ? -9.263  6.968   -0.951  1.00 0.00 ? 131 LYS A C    3  
ATOM 6680  O O    . LYS A 1 131 ? -9.170  7.880   -0.131  1.00 0.00 ? 131 LYS A O    3  
ATOM 6681  C CB   . LYS A 1 131 ? -7.182  5.776   -1.851  1.00 0.00 ? 131 LYS A CB   3  
ATOM 6682  C CG   . LYS A 1 131 ? -6.772  7.215   -2.171  1.00 0.00 ? 131 LYS A CG   3  
ATOM 6683  C CD   . LYS A 1 131 ? -5.722  7.250   -3.283  1.00 0.00 ? 131 LYS A CD   3  
ATOM 6684  C CE   . LYS A 1 131 ? -6.231  8.035   -4.494  1.00 0.00 ? 131 LYS A CE   3  
ATOM 6685  N NZ   . LYS A 1 131 ? -5.889  7.329   -5.749  1.00 0.00 ? 131 LYS A NZ   3  
ATOM 6686  H H    . LYS A 1 131 ? -8.871  3.973   -1.822  1.00 0.00 ? 131 LYS A H    3  
ATOM 6687  H HA   . LYS A 1 131 ? -7.920  5.707   0.140   1.00 0.00 ? 131 LYS A HA   3  
ATOM 6688  H HB2  . LYS A 1 131 ? -6.331  5.236   -1.433  1.00 0.00 ? 131 LYS A HB2  3  
ATOM 6689  H HB3  . LYS A 1 131 ? -7.465  5.262   -2.769  1.00 0.00 ? 131 LYS A HB3  3  
ATOM 6690  H HG2  . LYS A 1 131 ? -7.649  7.786   -2.476  1.00 0.00 ? 131 LYS A HG2  3  
ATOM 6691  H HG3  . LYS A 1 131 ? -6.375  7.692   -1.275  1.00 0.00 ? 131 LYS A HG3  3  
ATOM 6692  H HD2  . LYS A 1 131 ? -4.806  7.709   -2.907  1.00 0.00 ? 131 LYS A HD2  3  
ATOM 6693  H HD3  . LYS A 1 131 ? -5.469  6.233   -3.583  1.00 0.00 ? 131 LYS A HD3  3  
ATOM 6694  H HE2  . LYS A 1 131 ? -7.311  8.161   -4.424  1.00 0.00 ? 131 LYS A HE2  3  
ATOM 6695  H HE3  . LYS A 1 131 ? -5.792  9.032   -4.500  1.00 0.00 ? 131 LYS A HE3  3  
ATOM 6696  H HZ1  . LYS A 1 131 ? -5.995  6.342   -5.616  1.00 0.00 ? 131 LYS A HZ1  3  
ATOM 6697  H HZ2  . LYS A 1 131 ? -6.499  7.634   -6.481  1.00 0.00 ? 131 LYS A HZ2  3  
ATOM 6698  H HZ3  . LYS A 1 131 ? -4.942  7.531   -5.999  1.00 0.00 ? 131 LYS A HZ3  3  
ATOM 6699  N N    . ARG A 1 132 ? -10.127 6.948   -1.955  1.00 0.00 ? 132 ARG A N    3  
ATOM 6700  C CA   . ARG A 1 132 ? -11.059 8.044   -2.163  1.00 0.00 ? 132 ARG A CA   3  
ATOM 6701  C C    . ARG A 1 132 ? -12.024 8.152   -0.980  1.00 0.00 ? 132 ARG A C    3  
ATOM 6702  O O    . ARG A 1 132 ? -12.394 9.254   -0.577  1.00 0.00 ? 132 ARG A O    3  
ATOM 6703  C CB   . ARG A 1 132 ? -11.862 7.847   -3.451  1.00 0.00 ? 132 ARG A CB   3  
ATOM 6704  C CG   . ARG A 1 132 ? -12.409 9.180   -3.965  1.00 0.00 ? 132 ARG A CG   3  
ATOM 6705  C CD   . ARG A 1 132 ? -11.807 9.532   -5.327  1.00 0.00 ? 132 ARG A CD   3  
ATOM 6706  N NE   . ARG A 1 132 ? -11.924 10.987  -5.571  1.00 0.00 ? 132 ARG A NE   3  
ATOM 6707  C CZ   . ARG A 1 132 ? -11.708 11.569  -6.759  1.00 0.00 ? 132 ARG A CZ   3  
ATOM 6708  N NH1  . ARG A 1 132 ? -11.362 10.823  -7.817  1.00 0.00 ? 132 ARG A NH1  3  
ATOM 6709  N NH2  . ARG A 1 132 ? -11.837 12.895  -6.888  1.00 0.00 ? 132 ARG A NH2  3  
ATOM 6710  H H    . ARG A 1 132 ? -10.198 6.202   -2.618  1.00 0.00 ? 132 ARG A H    3  
ATOM 6711  H HA   . ARG A 1 132 ? -10.431 8.931   -2.242  1.00 0.00 ? 132 ARG A HA   3  
ATOM 6712  H HB2  . ARG A 1 132 ? -11.229 7.392   -4.213  1.00 0.00 ? 132 ARG A HB2  3  
ATOM 6713  H HB3  . ARG A 1 132 ? -12.687 7.158   -3.268  1.00 0.00 ? 132 ARG A HB3  3  
ATOM 6714  H HG2  . ARG A 1 132 ? -13.495 9.125   -4.046  1.00 0.00 ? 132 ARG A HG2  3  
ATOM 6715  H HG3  . ARG A 1 132 ? -12.184 9.970   -3.249  1.00 0.00 ? 132 ARG A HG3  3  
ATOM 6716  H HD2  . ARG A 1 132 ? -10.760 9.232   -5.358  1.00 0.00 ? 132 ARG A HD2  3  
ATOM 6717  H HD3  . ARG A 1 132 ? -12.321 8.980   -6.114  1.00 0.00 ? 132 ARG A HD3  3  
ATOM 6718  H HE   . ARG A 1 132 ? -12.179 11.572  -4.802  1.00 0.00 ? 132 ARG A HE   3  
ATOM 6719  H HH11 . ARG A 1 132 ? -11.266 9.831   -7.721  1.00 0.00 ? 132 ARG A HH11 3  
ATOM 6720  H HH12 . ARG A 1 132 ? -11.200 11.256  -8.703  1.00 0.00 ? 132 ARG A HH12 3  
ATOM 6721  H HH21 . ARG A 1 132 ? -12.095 13.452  -6.098  1.00 0.00 ? 132 ARG A HH21 3  
ATOM 6722  H HH22 . ARG A 1 132 ? -11.675 13.330  -7.774  1.00 0.00 ? 132 ARG A HH22 3  
ATOM 6723  N N    . TRP A 1 133 ? -12.402 6.995   -0.459  1.00 0.00 ? 133 TRP A N    3  
ATOM 6724  C CA   . TRP A 1 133 ? -13.317 6.946   0.670   1.00 0.00 ? 133 TRP A CA   3  
ATOM 6725  C C    . TRP A 1 133 ? -12.601 7.543   1.883   1.00 0.00 ? 133 TRP A C    3  
ATOM 6726  O O    . TRP A 1 133 ? -13.020 8.573   2.410   1.00 0.00 ? 133 TRP A O    3  
ATOM 6727  C CB   . TRP A 1 133 ? -13.814 5.520   0.912   1.00 0.00 ? 133 TRP A CB   3  
ATOM 6728  C CG   . TRP A 1 133 ? -14.595 4.926   -0.263  1.00 0.00 ? 133 TRP A CG   3  
ATOM 6729  C CD1  . TRP A 1 133 ? -14.701 5.405   -1.510  1.00 0.00 ? 133 TRP A CD1  3  
ATOM 6730  C CD2  . TRP A 1 133 ? -15.379 3.714   -0.248  1.00 0.00 ? 133 TRP A CD2  3  
ATOM 6731  N NE1  . TRP A 1 133 ? -15.493 4.594   -2.297  1.00 0.00 ? 133 TRP A NE1  3  
ATOM 6732  C CE2  . TRP A 1 133 ? -15.919 3.534   -1.506  1.00 0.00 ? 133 TRP A CE2  3  
ATOM 6733  C CE3  . TRP A 1 133 ? -15.625 2.802   0.792   1.00 0.00 ? 133 TRP A CE3  3  
ATOM 6734  C CZ2  . TRP A 1 133 ? -16.737 2.450   -1.840  1.00 0.00 ? 133 TRP A CZ2  3  
ATOM 6735  C CZ3  . TRP A 1 133 ? -16.445 1.723   0.442   1.00 0.00 ? 133 TRP A CZ3  3  
ATOM 6736  C CH2  . TRP A 1 133 ? -16.996 1.527   -0.820  1.00 0.00 ? 133 TRP A CH2  3  
ATOM 6737  H H    . TRP A 1 133 ? -12.096 6.104   -0.793  1.00 0.00 ? 133 TRP A H    3  
ATOM 6738  H HA   . TRP A 1 133 ? -14.189 7.549   0.418   1.00 0.00 ? 133 TRP A HA   3  
ATOM 6739  H HB2  . TRP A 1 133 ? -12.959 4.880   1.127   1.00 0.00 ? 133 TRP A HB2  3  
ATOM 6740  H HB3  . TRP A 1 133 ? -14.449 5.513   1.798   1.00 0.00 ? 133 TRP A HB3  3  
ATOM 6741  H HD1  . TRP A 1 133 ? -14.221 6.319   -1.858  1.00 0.00 ? 133 TRP A HD1  3  
ATOM 6742  H HE1  . TRP A 1 133 ? -15.739 4.756   -3.347  1.00 0.00 ? 133 TRP A HE1  3  
ATOM 6743  H HE3  . TRP A 1 133 ? -15.212 2.923   1.793   1.00 0.00 ? 133 TRP A HE3  3  
ATOM 6744  H HZ2  . TRP A 1 133 ? -17.152 2.328   -2.841  1.00 0.00 ? 133 TRP A HZ2  3  
ATOM 6745  H HZ3  . TRP A 1 133 ? -16.668 0.985   1.213   1.00 0.00 ? 133 TRP A HZ3  3  
ATOM 6746  H HH2  . TRP A 1 133 ? -17.627 0.659   -1.012  1.00 0.00 ? 133 TRP A HH2  3  
ATOM 6747  N N    . ILE A 1 134 ? -11.535 6.872   2.291   1.00 0.00 ? 134 ILE A N    3  
ATOM 6748  C CA   . ILE A 1 134 ? -10.758 7.324   3.433   1.00 0.00 ? 134 ILE A CA   3  
ATOM 6749  C C    . ILE A 1 134 ? -10.542 8.834   3.332   1.00 0.00 ? 134 ILE A C    3  
ATOM 6750  O O    . ILE A 1 134 ? -10.714 9.557   4.313   1.00 0.00 ? 134 ILE A O    3  
ATOM 6751  C CB   . ILE A 1 134 ? -9.459  6.522   3.548   1.00 0.00 ? 134 ILE A CB   3  
ATOM 6752  C CG1  . ILE A 1 134 ? -9.707  5.170   4.218   1.00 0.00 ? 134 ILE A CG1  3  
ATOM 6753  C CG2  . ILE A 1 134 ? -8.378  7.331   4.270   1.00 0.00 ? 134 ILE A CG2  3  
ATOM 6754  C CD1  . ILE A 1 134 ? -8.386  4.474   4.552   1.00 0.00 ? 134 ILE A CD1  3  
ATOM 6755  H H    . ILE A 1 134 ? -11.201 6.035   1.858   1.00 0.00 ? 134 ILE A H    3  
ATOM 6756  H HA   . ILE A 1 134 ? -11.344 7.118   4.329   1.00 0.00 ? 134 ILE A HA   3  
ATOM 6757  H HB   . ILE A 1 134 ? -9.092  6.321   2.542   1.00 0.00 ? 134 ILE A HB   3  
ATOM 6758  H HG12 . ILE A 1 134 ? -10.288 5.312   5.129   1.00 0.00 ? 134 ILE A HG12 3  
ATOM 6759  H HG13 . ILE A 1 134 ? -10.298 4.536   3.558   1.00 0.00 ? 134 ILE A HG13 3  
ATOM 6760  H HG21 . ILE A 1 134 ? -8.762  7.673   5.231   1.00 0.00 ? 134 ILE A HG21 3  
ATOM 6761  H HG22 . ILE A 1 134 ? -7.502  6.703   4.431   1.00 0.00 ? 134 ILE A HG22 3  
ATOM 6762  H HG23 . ILE A 1 134 ? -8.101  8.192   3.661   1.00 0.00 ? 134 ILE A HG23 3  
ATOM 6763  H HD11 . ILE A 1 134 ? -7.734  4.493   3.679   1.00 0.00 ? 134 ILE A HD11 3  
ATOM 6764  H HD12 . ILE A 1 134 ? -7.900  4.993   5.379   1.00 0.00 ? 134 ILE A HD12 3  
ATOM 6765  H HD13 . ILE A 1 134 ? -8.581  3.440   4.838   1.00 0.00 ? 134 ILE A HD13 3  
ATOM 6766  N N    . ILE A 1 135 ? -10.167 9.268   2.137   1.00 0.00 ? 135 ILE A N    3  
ATOM 6767  C CA   . ILE A 1 135 ? -9.925  10.680  1.895   1.00 0.00 ? 135 ILE A CA   3  
ATOM 6768  C C    . ILE A 1 135 ? -11.242 11.448  2.027   1.00 0.00 ? 135 ILE A C    3  
ATOM 6769  O O    . ILE A 1 135 ? -11.256 12.586  2.493   1.00 0.00 ? 135 ILE A O    3  
ATOM 6770  C CB   . ILE A 1 135 ? -9.227  10.881  0.549   1.00 0.00 ? 135 ILE A CB   3  
ATOM 6771  C CG1  . ILE A 1 135 ? -7.707  10.908  0.717   1.00 0.00 ? 135 ILE A CG1  3  
ATOM 6772  C CG2  . ILE A 1 135 ? -9.749  12.135  -0.157  1.00 0.00 ? 135 ILE A CG2  3  
ATOM 6773  C CD1  . ILE A 1 135 ? -7.228  9.730   1.568   1.00 0.00 ? 135 ILE A CD1  3  
ATOM 6774  H H    . ILE A 1 135 ? -10.029 8.674   1.345   1.00 0.00 ? 135 ILE A H    3  
ATOM 6775  H HA   . ILE A 1 135 ? -9.242  11.031  2.668   1.00 0.00 ? 135 ILE A HA   3  
ATOM 6776  H HB   . ILE A 1 135 ? -9.465  10.030  -0.089  1.00 0.00 ? 135 ILE A HB   3  
ATOM 6777  H HG12 . ILE A 1 135 ? -7.228  10.873  -0.261  1.00 0.00 ? 135 ILE A HG12 3  
ATOM 6778  H HG13 . ILE A 1 135 ? -7.406  11.846  1.186   1.00 0.00 ? 135 ILE A HG13 3  
ATOM 6779  H HG21 . ILE A 1 135 ? -9.850  12.943  0.567   1.00 0.00 ? 135 ILE A HG21 3  
ATOM 6780  H HG22 . ILE A 1 135 ? -9.046  12.431  -0.937  1.00 0.00 ? 135 ILE A HG22 3  
ATOM 6781  H HG23 . ILE A 1 135 ? -10.720 11.923  -0.604  1.00 0.00 ? 135 ILE A HG23 3  
ATOM 6782  H HD11 . ILE A 1 135 ? -7.512  8.795   1.086   1.00 0.00 ? 135 ILE A HD11 3  
ATOM 6783  H HD12 . ILE A 1 135 ? -6.144  9.773   1.670   1.00 0.00 ? 135 ILE A HD12 3  
ATOM 6784  H HD13 . ILE A 1 135 ? -7.688  9.784   2.555   1.00 0.00 ? 135 ILE A HD13 3  
ATOM 6785  N N    . LEU A 1 136 ? -12.315 10.794  1.608   1.00 0.00 ? 136 LEU A N    3  
ATOM 6786  C CA   . LEU A 1 136 ? -13.633 11.402  1.672   1.00 0.00 ? 136 LEU A CA   3  
ATOM 6787  C C    . LEU A 1 136 ? -13.920 11.839  3.110   1.00 0.00 ? 136 LEU A C    3  
ATOM 6788  O O    . LEU A 1 136 ? -14.369 12.959  3.345   1.00 0.00 ? 136 LEU A O    3  
ATOM 6789  C CB   . LEU A 1 136 ? -14.689 10.455  1.095   1.00 0.00 ? 136 LEU A CB   3  
ATOM 6790  C CG   . LEU A 1 136 ? -15.677 11.076  0.106   1.00 0.00 ? 136 LEU A CG   3  
ATOM 6791  C CD1  . LEU A 1 136 ? -16.012 10.096  -1.021  1.00 0.00 ? 136 LEU A CD1  3  
ATOM 6792  C CD2  . LEU A 1 136 ? -16.933 11.573  0.824   1.00 0.00 ? 136 LEU A CD2  3  
ATOM 6793  H H    . LEU A 1 136 ? -12.294 9.869   1.229   1.00 0.00 ? 136 LEU A H    3  
ATOM 6794  H HA   . LEU A 1 136 ? -13.616 12.289  1.039   1.00 0.00 ? 136 LEU A HA   3  
ATOM 6795  H HB2  . LEU A 1 136 ? -14.176 9.631   0.599   1.00 0.00 ? 136 LEU A HB2  3  
ATOM 6796  H HB3  . LEU A 1 136 ? -15.254 10.026  1.923   1.00 0.00 ? 136 LEU A HB3  3  
ATOM 6797  H HG   . LEU A 1 136 ? -15.203 11.944  -0.352  1.00 0.00 ? 136 LEU A HG   3  
ATOM 6798  H HD11 . LEU A 1 136 ? -15.508 9.147   -0.839  1.00 0.00 ? 136 LEU A HD11 3  
ATOM 6799  H HD12 . LEU A 1 136 ? -17.089 9.935   -1.054  1.00 0.00 ? 136 LEU A HD12 3  
ATOM 6800  H HD13 . LEU A 1 136 ? -15.676 10.509  -1.972  1.00 0.00 ? 136 LEU A HD13 3  
ATOM 6801  H HD21 . LEU A 1 136 ? -16.673 11.888  1.835   1.00 0.00 ? 136 LEU A HD21 3  
ATOM 6802  H HD22 . LEU A 1 136 ? -17.354 12.417  0.277   1.00 0.00 ? 136 LEU A HD22 3  
ATOM 6803  H HD23 . LEU A 1 136 ? -17.667 10.768  0.872   1.00 0.00 ? 136 LEU A HD23 3  
ATOM 6804  N N    . GLY A 1 137 ? -13.648 10.930  4.036   1.00 0.00 ? 137 GLY A N    3  
ATOM 6805  C CA   . GLY A 1 137 ? -13.870 11.207  5.444   1.00 0.00 ? 137 GLY A CA   3  
ATOM 6806  C C    . GLY A 1 137 ? -12.892 12.266  5.955   1.00 0.00 ? 137 GLY A C    3  
ATOM 6807  O O    . GLY A 1 137 ? -13.302 13.251  6.569   1.00 0.00 ? 137 GLY A O    3  
ATOM 6808  H H    . GLY A 1 137 ? -13.282 10.020  3.836   1.00 0.00 ? 137 GLY A H    3  
ATOM 6809  H HA2  . GLY A 1 137 ? -14.893 11.549  5.595   1.00 0.00 ? 137 GLY A HA2  3  
ATOM 6810  H HA3  . GLY A 1 137 ? -13.752 10.290  6.022   1.00 0.00 ? 137 GLY A HA3  3  
ATOM 6811  N N    . LEU A 1 138 ? -11.617 12.030  5.684   1.00 0.00 ? 138 LEU A N    3  
ATOM 6812  C CA   . LEU A 1 138 ? -10.577 12.952  6.109   1.00 0.00 ? 138 LEU A CA   3  
ATOM 6813  C C    . LEU A 1 138 ? -10.971 14.376  5.711   1.00 0.00 ? 138 LEU A C    3  
ATOM 6814  O O    . LEU A 1 138 ? -10.863 15.300  6.515   1.00 0.00 ? 138 LEU A O    3  
ATOM 6815  C CB   . LEU A 1 138 ? -9.217  12.514  5.563   1.00 0.00 ? 138 LEU A CB   3  
ATOM 6816  C CG   . LEU A 1 138 ? -8.423  11.543  6.439   1.00 0.00 ? 138 LEU A CG   3  
ATOM 6817  C CD1  . LEU A 1 138 ? -7.124  11.119  5.750   1.00 0.00 ? 138 LEU A CD1  3  
ATOM 6818  C CD2  . LEU A 1 138 ? -8.167  12.140  7.825   1.00 0.00 ? 138 LEU A CD2  3  
ATOM 6819  H H    . LEU A 1 138 ? -11.291 11.227  5.185   1.00 0.00 ? 138 LEU A H    3  
ATOM 6820  H HA   . LEU A 1 138 ? -10.520 12.900  7.197   1.00 0.00 ? 138 LEU A HA   3  
ATOM 6821  H HB2  . LEU A 1 138 ? -9.371  12.050  4.590   1.00 0.00 ? 138 LEU A HB2  3  
ATOM 6822  H HB3  . LEU A 1 138 ? -8.609  13.405  5.399   1.00 0.00 ? 138 LEU A HB3  3  
ATOM 6823  H HG   . LEU A 1 138 ? -9.021  10.644  6.581   1.00 0.00 ? 138 LEU A HG   3  
ATOM 6824  H HD11 . LEU A 1 138 ? -6.724  11.958  5.181   1.00 0.00 ? 138 LEU A HD11 3  
ATOM 6825  H HD12 . LEU A 1 138 ? -6.398  10.810  6.502   1.00 0.00 ? 138 LEU A HD12 3  
ATOM 6826  H HD13 . LEU A 1 138 ? -7.326  10.286  5.077   1.00 0.00 ? 138 LEU A HD13 3  
ATOM 6827  H HD21 . LEU A 1 138 ? -7.830  13.171  7.721   1.00 0.00 ? 138 LEU A HD21 3  
ATOM 6828  H HD22 . LEU A 1 138 ? -9.089  12.117  8.406   1.00 0.00 ? 138 LEU A HD22 3  
ATOM 6829  H HD23 . LEU A 1 138 ? -7.401  11.556  8.336   1.00 0.00 ? 138 LEU A HD23 3  
ATOM 6830  N N    . ASN A 1 139 ? -11.418 14.507  4.471   1.00 0.00 ? 139 ASN A N    3  
ATOM 6831  C CA   . ASN A 1 139 ? -11.827 15.802  3.957   1.00 0.00 ? 139 ASN A CA   3  
ATOM 6832  C C    . ASN A 1 139 ? -13.034 16.304  4.752   1.00 0.00 ? 139 ASN A C    3  
ATOM 6833  O O    . ASN A 1 139 ? -13.078 17.465  5.155   1.00 0.00 ? 139 ASN A O    3  
ATOM 6834  C CB   . ASN A 1 139 ? -12.237 15.707  2.486   1.00 0.00 ? 139 ASN A CB   3  
ATOM 6835  C CG   . ASN A 1 139 ? -11.967 17.023  1.754   1.00 0.00 ? 139 ASN A CG   3  
ATOM 6836  O OD1  . ASN A 1 139 ? -10.858 17.314  1.335   1.00 0.00 ? 139 ASN A OD1  3  
ATOM 6837  N ND2  . ASN A 1 139 ? -13.038 17.800  1.624   1.00 0.00 ? 139 ASN A ND2  3  
ATOM 6838  H H    . ASN A 1 139 ? -11.501 13.749  3.823   1.00 0.00 ? 139 ASN A H    3  
ATOM 6839  H HA   . ASN A 1 139 ? -10.955 16.446  4.073   1.00 0.00 ? 139 ASN A HA   3  
ATOM 6840  H HB2  . ASN A 1 139 ? -11.687 14.899  2.003   1.00 0.00 ? 139 ASN A HB2  3  
ATOM 6841  H HB3  . ASN A 1 139 ? -13.297 15.459  2.415   1.00 0.00 ? 139 ASN A HB3  3  
ATOM 6842  H HD21 . ASN A 1 139 ? -13.919 17.502  1.992   1.00 0.00 ? 139 ASN A HD21 3  
ATOM 6843  H HD22 . ASN A 1 139 ? -12.963 18.682  1.160   1.00 0.00 ? 139 ASN A HD22 3  
ATOM 6844  N N    . LYS A 1 140 ? -13.985 15.403  4.954   1.00 0.00 ? 140 LYS A N    3  
ATOM 6845  C CA   . LYS A 1 140 ? -15.189 15.739  5.694   1.00 0.00 ? 140 LYS A CA   3  
ATOM 6846  C C    . LYS A 1 140 ? -14.803 16.266  7.077   1.00 0.00 ? 140 LYS A C    3  
ATOM 6847  O O    . LYS A 1 140 ? -15.446 17.172  7.603   1.00 0.00 ? 140 LYS A O    3  
ATOM 6848  C CB   . LYS A 1 140 ? -16.144 14.544  5.735   1.00 0.00 ? 140 LYS A CB   3  
ATOM 6849  C CG   . LYS A 1 140 ? -17.600 15.008  5.804   1.00 0.00 ? 140 LYS A CG   3  
ATOM 6850  C CD   . LYS A 1 140 ? -18.208 15.116  4.403   1.00 0.00 ? 140 LYS A CD   3  
ATOM 6851  C CE   . LYS A 1 140 ? -18.619 16.557  4.094   1.00 0.00 ? 140 LYS A CE   3  
ATOM 6852  N NZ   . LYS A 1 140 ? -18.126 16.961  2.757   1.00 0.00 ? 140 LYS A NZ   3  
ATOM 6853  H H    . LYS A 1 140 ? -13.942 14.460  4.622   1.00 0.00 ? 140 LYS A H    3  
ATOM 6854  H HA   . LYS A 1 140 ? -15.696 16.537  5.149   1.00 0.00 ? 140 LYS A HA   3  
ATOM 6855  H HB2  . LYS A 1 140 ? -15.997 13.925  4.851   1.00 0.00 ? 140 LYS A HB2  3  
ATOM 6856  H HB3  . LYS A 1 140 ? -15.915 13.922  6.600   1.00 0.00 ? 140 LYS A HB3  3  
ATOM 6857  H HG2  . LYS A 1 140 ? -18.181 14.306  6.403   1.00 0.00 ? 140 LYS A HG2  3  
ATOM 6858  H HG3  . LYS A 1 140 ? -17.655 15.975  6.302   1.00 0.00 ? 140 LYS A HG3  3  
ATOM 6859  H HD2  . LYS A 1 140 ? -17.485 14.773  3.662   1.00 0.00 ? 140 LYS A HD2  3  
ATOM 6860  H HD3  . LYS A 1 140 ? -19.076 14.463  4.328   1.00 0.00 ? 140 LYS A HD3  3  
ATOM 6861  H HE2  . LYS A 1 140 ? -19.704 16.648  4.130   1.00 0.00 ? 140 LYS A HE2  3  
ATOM 6862  H HE3  . LYS A 1 140 ? -18.216 17.227  4.853   1.00 0.00 ? 140 LYS A HE3  3  
ATOM 6863  H HZ1  . LYS A 1 140 ? -18.446 16.307  2.072   1.00 0.00 ? 140 LYS A HZ1  3  
ATOM 6864  H HZ2  . LYS A 1 140 ? -18.472 17.872  2.536   1.00 0.00 ? 140 LYS A HZ2  3  
ATOM 6865  H HZ3  . LYS A 1 140 ? -17.126 16.976  2.762   1.00 0.00 ? 140 LYS A HZ3  3  
ATOM 6866  N N    . ILE A 1 141 ? -13.752 15.674  7.628   1.00 0.00 ? 141 ILE A N    3  
ATOM 6867  C CA   . ILE A 1 141 ? -13.272 16.073  8.940   1.00 0.00 ? 141 ILE A CA   3  
ATOM 6868  C C    . ILE A 1 141 ? -12.563 17.424  8.831   1.00 0.00 ? 141 ILE A C    3  
ATOM 6869  O O    . ILE A 1 141 ? -12.794 18.317  9.644   1.00 0.00 ? 141 ILE A O    3  
ATOM 6870  C CB   . ILE A 1 141 ? -12.404 14.970  9.550   1.00 0.00 ? 141 ILE A CB   3  
ATOM 6871  C CG1  . ILE A 1 141 ? -13.119 13.619  9.501   1.00 0.00 ? 141 ILE A CG1  3  
ATOM 6872  C CG2  . ILE A 1 141 ? -11.968 15.338  10.969  1.00 0.00 ? 141 ILE A CG2  3  
ATOM 6873  C CD1  . ILE A 1 141 ? -12.118 12.474  9.331   1.00 0.00 ? 141 ILE A CD1  3  
ATOM 6874  H H    . ILE A 1 141 ? -13.234 14.938  7.193   1.00 0.00 ? 141 ILE A H    3  
ATOM 6875  H HA   . ILE A 1 141 ? -14.143 16.190  9.585   1.00 0.00 ? 141 ILE A HA   3  
ATOM 6876  H HB   . ILE A 1 141 ? -11.498 14.878  8.950   1.00 0.00 ? 141 ILE A HB   3  
ATOM 6877  H HG12 . ILE A 1 141 ? -13.691 13.473  10.417  1.00 0.00 ? 141 ILE A HG12 3  
ATOM 6878  H HG13 . ILE A 1 141 ? -13.831 13.609  8.676   1.00 0.00 ? 141 ILE A HG13 3  
ATOM 6879  H HG21 . ILE A 1 141 ? -11.856 16.419  11.047  1.00 0.00 ? 141 ILE A HG21 3  
ATOM 6880  H HG22 . ILE A 1 141 ? -12.722 15.000  11.680  1.00 0.00 ? 141 ILE A HG22 3  
ATOM 6881  H HG23 . ILE A 1 141 ? -11.016 14.857  11.194  1.00 0.00 ? 141 ILE A HG23 3  
ATOM 6882  H HD11 . ILE A 1 141 ? -11.135 12.884  9.098   1.00 0.00 ? 141 ILE A HD11 3  
ATOM 6883  H HD12 . ILE A 1 141 ? -12.062 11.899  10.255  1.00 0.00 ? 141 ILE A HD12 3  
ATOM 6884  H HD13 . ILE A 1 141 ? -12.443 11.825  8.518   1.00 0.00 ? 141 ILE A HD13 3  
ATOM 6885  N N    . VAL A 1 142 ? -11.717 17.532  7.818   1.00 0.00 ? 142 VAL A N    3  
ATOM 6886  C CA   . VAL A 1 142 ? -10.973 18.759  7.592   1.00 0.00 ? 142 VAL A CA   3  
ATOM 6887  C C    . VAL A 1 142 ? -11.954 19.921  7.424   1.00 0.00 ? 142 VAL A C    3  
ATOM 6888  O O    . VAL A 1 142 ? -11.662 21.046  7.826   1.00 0.00 ? 142 VAL A O    3  
ATOM 6889  C CB   . VAL A 1 142 ? -10.036 18.591  6.394   1.00 0.00 ? 142 VAL A CB   3  
ATOM 6890  C CG1  . VAL A 1 142 ? -9.836  19.919  5.663   1.00 0.00 ? 142 VAL A CG1  3  
ATOM 6891  C CG2  . VAL A 1 142 ? -8.695  17.995  6.827   1.00 0.00 ? 142 VAL A CG2  3  
ATOM 6892  H H    . VAL A 1 142 ? -11.535 16.800  7.161   1.00 0.00 ? 142 VAL A H    3  
ATOM 6893  H HA   . VAL A 1 142 ? -10.361 18.941  8.476   1.00 0.00 ? 142 VAL A HA   3  
ATOM 6894  H HB   . VAL A 1 142 ? -10.503 17.893  5.700   1.00 0.00 ? 142 VAL A HB   3  
ATOM 6895  H HG11 . VAL A 1 142 ? -10.804 20.317  5.360   1.00 0.00 ? 142 VAL A HG11 3  
ATOM 6896  H HG12 . VAL A 1 142 ? -9.343  20.630  6.328   1.00 0.00 ? 142 VAL A HG12 3  
ATOM 6897  H HG13 . VAL A 1 142 ? -9.217  19.759  4.780   1.00 0.00 ? 142 VAL A HG13 3  
ATOM 6898  H HG21 . VAL A 1 142 ? -8.869  17.105  7.431   1.00 0.00 ? 142 VAL A HG21 3  
ATOM 6899  H HG22 . VAL A 1 142 ? -8.114  17.727  5.944   1.00 0.00 ? 142 VAL A HG22 3  
ATOM 6900  H HG23 . VAL A 1 142 ? -8.143  18.730  7.414   1.00 0.00 ? 142 VAL A HG23 3  
ATOM 6901  N N    . ARG A 1 143 ? -13.096 19.608  6.831   1.00 0.00 ? 143 ARG A N    3  
ATOM 6902  C CA   . ARG A 1 143 ? -14.121 20.613  6.605   1.00 0.00 ? 143 ARG A CA   3  
ATOM 6903  C C    . ARG A 1 143 ? -14.635 21.156  7.941   1.00 0.00 ? 143 ARG A C    3  
ATOM 6904  O O    . ARG A 1 143 ? -14.715 22.369  8.131   1.00 0.00 ? 143 ARG A O    3  
ATOM 6905  C CB   . ARG A 1 143 ? -15.296 20.032  5.815   1.00 0.00 ? 143 ARG A CB   3  
ATOM 6906  C CG   . ARG A 1 143 ? -15.173 20.366  4.326   1.00 0.00 ? 143 ARG A CG   3  
ATOM 6907  C CD   . ARG A 1 143 ? -16.000 21.603  3.972   1.00 0.00 ? 143 ARG A CD   3  
ATOM 6908  N NE   . ARG A 1 143 ? -15.138 22.624  3.335   1.00 0.00 ? 143 ARG A NE   3  
ATOM 6909  C CZ   . ARG A 1 143 ? -14.626 22.510  2.102   1.00 0.00 ? 143 ARG A CZ   3  
ATOM 6910  N NH1  . ARG A 1 143 ? -14.885 21.422  1.365   1.00 0.00 ? 143 ARG A NH1  3  
ATOM 6911  N NH2  . ARG A 1 143 ? -13.854 23.487  1.605   1.00 0.00 ? 143 ARG A NH2  3  
ATOM 6912  H H    . ARG A 1 143 ? -13.326 18.690  6.508   1.00 0.00 ? 143 ARG A H    3  
ATOM 6913  H HA   . ARG A 1 143 ? -13.626 21.393  6.029   1.00 0.00 ? 143 ARG A HA   3  
ATOM 6914  H HB2  . ARG A 1 143 ? -15.329 18.951  5.946   1.00 0.00 ? 143 ARG A HB2  3  
ATOM 6915  H HB3  . ARG A 1 143 ? -16.233 20.430  6.203   1.00 0.00 ? 143 ARG A HB3  3  
ATOM 6916  H HG2  . ARG A 1 143 ? -14.126 20.540  4.075   1.00 0.00 ? 143 ARG A HG2  3  
ATOM 6917  H HG3  . ARG A 1 143 ? -15.506 19.518  3.730   1.00 0.00 ? 143 ARG A HG3  3  
ATOM 6918  H HD2  . ARG A 1 143 ? -16.811 21.328  3.297   1.00 0.00 ? 143 ARG A HD2  3  
ATOM 6919  H HD3  . ARG A 1 143 ? -16.460 22.013  4.870   1.00 0.00 ? 143 ARG A HD3  3  
ATOM 6920  H HE   . ARG A 1 143 ? -14.926 23.449  3.857   1.00 0.00 ? 143 ARG A HE   3  
ATOM 6921  H HH11 . ARG A 1 143 ? -15.460 20.693  1.737   1.00 0.00 ? 143 ARG A HH11 3  
ATOM 6922  H HH12 . ARG A 1 143 ? -14.501 21.337  0.446   1.00 0.00 ? 143 ARG A HH12 3  
ATOM 6923  H HH21 . ARG A 1 143 ? -13.660 24.301  2.155   1.00 0.00 ? 143 ARG A HH21 3  
ATOM 6924  H HH22 . ARG A 1 143 ? -13.470 23.403  0.685   1.00 0.00 ? 143 ARG A HH22 3  
ATOM 6925  N N    . MET A 1 144 ? -14.969 20.233  8.831   1.00 0.00 ? 144 MET A N    3  
ATOM 6926  C CA   . MET A 1 144 ? -15.472 20.604  10.141  1.00 0.00 ? 144 MET A CA   3  
ATOM 6927  C C    . MET A 1 144 ? -14.329 21.024  11.068  1.00 0.00 ? 144 MET A C    3  
ATOM 6928  O O    . MET A 1 144 ? -14.557 21.677  12.085  1.00 0.00 ? 144 MET A O    3  
ATOM 6929  C CB   . MET A 1 144 ? -16.220 19.420  10.756  1.00 0.00 ? 144 MET A CB   3  
ATOM 6930  C CG   . MET A 1 144 ? -16.971 19.843  12.021  1.00 0.00 ? 144 MET A CG   3  
ATOM 6931  S SD   . MET A 1 144 ? -17.001 18.495  13.191  1.00 0.00 ? 144 MET A SD   3  
ATOM 6932  C CE   . MET A 1 144 ? -15.272 18.425  13.629  1.00 0.00 ? 144 MET A CE   3  
ATOM 6933  H H    . MET A 1 144 ? -14.901 19.248  8.667   1.00 0.00 ? 144 MET A H    3  
ATOM 6934  H HA   . MET A 1 144 ? -16.139 21.450  9.970   1.00 0.00 ? 144 MET A HA   3  
ATOM 6935  H HB2  . MET A 1 144 ? -16.923 19.012  10.030  1.00 0.00 ? 144 MET A HB2  3  
ATOM 6936  H HB3  . MET A 1 144 ? -15.514 18.625  10.997  1.00 0.00 ? 144 MET A HB3  3  
ATOM 6937  H HG2  . MET A 1 144 ? -16.489 20.712  12.467  1.00 0.00 ? 144 MET A HG2  3  
ATOM 6938  H HG3  . MET A 1 144 ? -17.989 20.138  11.767  1.00 0.00 ? 144 MET A HG3  3  
ATOM 6939  H HE1  . MET A 1 144 ? -14.949 19.402  13.991  1.00 0.00 ? 144 MET A HE1  3  
ATOM 6940  H HE2  . MET A 1 144 ? -15.125 17.681  14.411  1.00 0.00 ? 144 MET A HE2  3  
ATOM 6941  H HE3  . MET A 1 144 ? -14.687 18.151  12.752  1.00 0.00 ? 144 MET A HE3  3  
ATOM 6942  N N    . TYR A 1 145 ? -13.124 20.630  10.684  1.00 0.00 ? 145 TYR A N    3  
ATOM 6943  C CA   . TYR A 1 145 ? -11.945 20.957  11.469  1.00 0.00 ? 145 TYR A CA   3  
ATOM 6944  C C    . TYR A 1 145 ? -10.974 21.823  10.664  1.00 0.00 ? 145 TYR A C    3  
ATOM 6945  O O    . TYR A 1 145 ? -9.765  21.600  10.694  1.00 0.00 ? 145 TYR A O    3  
ATOM 6946  C CB   . TYR A 1 145 ? -11.270 19.623  11.792  1.00 0.00 ? 145 TYR A CB   3  
ATOM 6947  C CG   . TYR A 1 145 ? -10.609 19.577  13.171  1.00 0.00 ? 145 TYR A CG   3  
ATOM 6948  C CD1  . TYR A 1 145 ? -9.735  20.577  13.550  1.00 0.00 ? 145 TYR A CD1  3  
ATOM 6949  C CD2  . TYR A 1 145 ? -10.886 18.538  14.035  1.00 0.00 ? 145 TYR A CD2  3  
ATOM 6950  C CE1  . TYR A 1 145 ? -9.112  20.533  14.848  1.00 0.00 ? 145 TYR A CE1  3  
ATOM 6951  C CE2  . TYR A 1 145 ? -10.263 18.495  15.333  1.00 0.00 ? 145 TYR A CE2  3  
ATOM 6952  C CZ   . TYR A 1 145 ? -9.407  19.496  15.675  1.00 0.00 ? 145 TYR A CZ   3  
ATOM 6953  O OH   . TYR A 1 145 ? -8.819  19.455  16.901  1.00 0.00 ? 145 TYR A OH   3  
ATOM 6954  H H    . TYR A 1 145 ? -12.947 20.099  9.856   1.00 0.00 ? 145 TYR A H    3  
ATOM 6955  H HA   . TYR A 1 145 ? -12.269 21.510  12.349  1.00 0.00 ? 145 TYR A HA   3  
ATOM 6956  H HB2  . TYR A 1 145 ? -12.013 18.827  11.731  1.00 0.00 ? 145 TYR A HB2  3  
ATOM 6957  H HB3  . TYR A 1 145 ? -10.517 19.414  11.032  1.00 0.00 ? 145 TYR A HB3  3  
ATOM 6958  H HD1  . TYR A 1 145 ? -9.517  21.397  12.867  1.00 0.00 ? 145 TYR A HD1  3  
ATOM 6959  H HD2  . TYR A 1 145 ? -11.575 17.749  13.735  1.00 0.00 ? 145 TYR A HD2  3  
ATOM 6960  H HE1  . TYR A 1 145 ? -8.420  21.316  15.160  1.00 0.00 ? 145 TYR A HE1  3  
ATOM 6961  H HE2  . TYR A 1 145 ? -10.473 17.680  16.025  1.00 0.00 ? 145 TYR A HE2  3  
ATOM 6962  H HH   . TYR A 1 145 ? -8.907  20.344  17.352  1.00 0.00 ? 145 TYR A HH   3  
ATOM 6963  N N    . SER A 1 146 ? -11.540 22.795  9.963   1.00 0.00 ? 146 SER A N    3  
ATOM 6964  C CA   . SER A 1 146 ? -10.740 23.696  9.151   1.00 0.00 ? 146 SER A CA   3  
ATOM 6965  C C    . SER A 1 146 ? -10.360 24.935  9.965   1.00 0.00 ? 146 SER A C    3  
ATOM 6966  O O    . SER A 1 146 ? -11.220 25.743  10.311  1.00 0.00 ? 146 SER A O    3  
ATOM 6967  C CB   . SER A 1 146 ? -11.489 24.105  7.881   1.00 0.00 ? 146 SER A CB   3  
ATOM 6968  O OG   . SER A 1 146 ? -12.591 24.963  8.164   1.00 0.00 ? 146 SER A OG   3  
ATOM 6969  H H    . SER A 1 146 ? -12.524 22.970  9.944   1.00 0.00 ? 146 SER A H    3  
ATOM 6970  H HA   . SER A 1 146 ? -9.850  23.129  8.881   1.00 0.00 ? 146 SER A HA   3  
ATOM 6971  H HB2  . SER A 1 146 ? -10.802 24.610  7.202   1.00 0.00 ? 146 SER A HB2  3  
ATOM 6972  H HB3  . SER A 1 146 ? -11.846 23.213  7.368   1.00 0.00 ? 146 SER A HB3  3  
ATOM 6973  H HG   . SER A 1 146 ? -12.971 24.746  9.063   1.00 0.00 ? 146 SER A HG   3  
ATOM 6974  N N    . PRO A 1 147 ? -9.036  25.049  10.255  1.00 0.00 ? 147 PRO A N    3  
ATOM 6975  C CA   . PRO A 1 147 ? -8.531  26.175  11.020  1.00 0.00 ? 147 PRO A CA   3  
ATOM 6976  C C    . PRO A 1 147 ? -8.489  27.445  10.167  1.00 0.00 ? 147 PRO A C    3  
ATOM 6977  O O    . PRO A 1 147 ? -7.904  27.450  9.085   1.00 0.00 ? 147 PRO A O    3  
ATOM 6978  C CB   . PRO A 1 147 ? -7.157  25.739  11.503  1.00 0.00 ? 147 PRO A CB   3  
ATOM 6979  C CG   . PRO A 1 147 ? -6.750  24.578  10.609  1.00 0.00 ? 147 PRO A CG   3  
ATOM 6980  C CD   . PRO A 1 147 ? -7.988  24.112  9.860   1.00 0.00 ? 147 PRO A CD   3  
ATOM 6981  H HA   . PRO A 1 147 ? -9.145  26.379  11.784  1.00 0.00 ? 147 PRO A HA   3  
ATOM 6982  H HB2  . PRO A 1 147 ? -6.440  26.557  11.432  1.00 0.00 ? 147 PRO A HB2  3  
ATOM 6983  H HB3  . PRO A 1 147 ? -7.190  25.434  12.549  1.00 0.00 ? 147 PRO A HB3  3  
ATOM 6984  H HG2  . PRO A 1 147 ? -5.975  24.889  9.909   1.00 0.00 ? 147 PRO A HG2  3  
ATOM 6985  H HG3  . PRO A 1 147 ? -6.336  23.766  11.205  1.00 0.00 ? 147 PRO A HG3  3  
ATOM 6986  H HD2  . PRO A 1 147 ? -7.828  24.128  8.782   1.00 0.00 ? 147 PRO A HD2  3  
ATOM 6987  H HD3  . PRO A 1 147 ? -8.251  23.088  10.128  1.00 0.00 ? 147 PRO A HD3  3  
ATOM 6988  N N    . THR A 1 148 ? -9.117  28.489  10.687  1.00 0.00 ? 148 THR A N    3  
ATOM 6989  C CA   . THR A 1 148 ? -9.159  29.761  9.985   1.00 0.00 ? 148 THR A CA   3  
ATOM 6990  C C    . THR A 1 148 ? -7.745  30.217  9.622   1.00 0.00 ? 148 THR A C    3  
ATOM 6991  O O    . THR A 1 148 ? -6.787  29.903  10.327  1.00 0.00 ? 148 THR A O    3  
ATOM 6992  C CB   . THR A 1 148 ? -9.912  30.761  10.867  1.00 0.00 ? 148 THR A CB   3  
ATOM 6993  O OG1  . THR A 1 148 ? -11.264 30.313  10.823  1.00 0.00 ? 148 THR A OG1  3  
ATOM 6994  C CG2  . THR A 1 148 ? -9.964  32.161  10.249  1.00 0.00 ? 148 THR A CG2  3  
ATOM 6995  H H    . THR A 1 148 ? -9.591  28.476  11.567  1.00 0.00 ? 148 THR A H    3  
ATOM 6996  H HA   . THR A 1 148 ? -9.701  29.621  9.050   1.00 0.00 ? 148 THR A HA   3  
ATOM 6997  H HB   . THR A 1 148 ? -9.488  30.794  11.870  1.00 0.00 ? 148 THR A HB   3  
ATOM 6998  H HG1  . THR A 1 148 ? -11.601 30.333  9.883   1.00 0.00 ? 148 THR A HG1  3  
ATOM 6999  H HG21 . THR A 1 148 ? -10.268 32.087  9.205   1.00 0.00 ? 148 THR A HG21 3  
ATOM 7000  H HG22 . THR A 1 148 ? -10.684 32.771  10.794  1.00 0.00 ? 148 THR A HG22 3  
ATOM 7001  H HG23 . THR A 1 148 ? -8.978  32.621  10.310  1.00 0.00 ? 148 THR A HG23 3  
ATOM 7002  N N    . SER A 1 149 ? -7.659  30.950  8.521   1.00 0.00 ? 149 SER A N    3  
ATOM 7003  C CA   . SER A 1 149 ? -6.377  31.452  8.055   1.00 0.00 ? 149 SER A CA   3  
ATOM 7004  C C    . SER A 1 149 ? -5.436  30.283  7.756   1.00 0.00 ? 149 SER A C    3  
ATOM 7005  O O    . SER A 1 149 ? -5.621  29.184  8.274   1.00 0.00 ? 149 SER A O    3  
ATOM 7006  C CB   . SER A 1 149 ? -5.746  32.392  9.084   1.00 0.00 ? 149 SER A CB   3  
ATOM 7007  O OG   . SER A 1 149 ? -4.544  32.983  8.600   1.00 0.00 ? 149 SER A OG   3  
ATOM 7008  H H    . SER A 1 149 ? -8.443  31.201  7.953   1.00 0.00 ? 149 SER A H    3  
ATOM 7009  H HA   . SER A 1 149 ? -6.599  32.007  7.145   1.00 0.00 ? 149 SER A HA   3  
ATOM 7010  H HB2  . SER A 1 149 ? -6.458  33.176  9.342   1.00 0.00 ? 149 SER A HB2  3  
ATOM 7011  H HB3  . SER A 1 149 ? -5.535  31.838  9.999   1.00 0.00 ? 149 SER A HB3  3  
ATOM 7012  H HG   . SER A 1 149 ? -4.317  33.791  9.143   1.00 0.00 ? 149 SER A HG   3  
ATOM 7013  N N    . ILE A 1 150 ? -4.446  30.562  6.920   1.00 0.00 ? 150 ILE A N    3  
ATOM 7014  C CA   . ILE A 1 150 ? -3.475  29.548  6.545   1.00 0.00 ? 150 ILE A CA   3  
ATOM 7015  C C    . ILE A 1 150 ? -2.084  30.182  6.474   1.00 0.00 ? 150 ILE A C    3  
ATOM 7016  O O    . ILE A 1 150 ? -1.894  31.195  5.802   1.00 0.00 ? 150 ILE A O    3  
ATOM 7017  C CB   . ILE A 1 150 ? -3.900  28.850  5.252   1.00 0.00 ? 150 ILE A CB   3  
ATOM 7018  C CG1  . ILE A 1 150 ? -5.194  28.059  5.457   1.00 0.00 ? 150 ILE A CG1  3  
ATOM 7019  C CG2  . ILE A 1 150 ? -2.773  27.973  4.705   1.00 0.00 ? 150 ILE A CG2  3  
ATOM 7020  C CD1  . ILE A 1 150 ? -6.408  28.860  4.983   1.00 0.00 ? 150 ILE A CD1  3  
ATOM 7021  H H    . ILE A 1 150 ? -4.302  31.460  6.503   1.00 0.00 ? 150 ILE A H    3  
ATOM 7022  H HA   . ILE A 1 150 ? -3.470  28.794  7.333   1.00 0.00 ? 150 ILE A HA   3  
ATOM 7023  H HB   . ILE A 1 150 ? -4.106  29.615  4.504   1.00 0.00 ? 150 ILE A HB   3  
ATOM 7024  H HG12 . ILE A 1 150 ? -5.139  27.117  4.910   1.00 0.00 ? 150 ILE A HG12 3  
ATOM 7025  H HG13 . ILE A 1 150 ? -5.308  27.809  6.511   1.00 0.00 ? 150 ILE A HG13 3  
ATOM 7026  H HG21 . ILE A 1 150 ? -2.478  27.246  5.463   1.00 0.00 ? 150 ILE A HG21 3  
ATOM 7027  H HG22 . ILE A 1 150 ? -3.119  27.450  3.815   1.00 0.00 ? 150 ILE A HG22 3  
ATOM 7028  H HG23 . ILE A 1 150 ? -1.917  28.598  4.450   1.00 0.00 ? 150 ILE A HG23 3  
ATOM 7029  H HD11 . ILE A 1 150 ? -6.206  29.926  5.093   1.00 0.00 ? 150 ILE A HD11 3  
ATOM 7030  H HD12 . ILE A 1 150 ? -6.604  28.635  3.934   1.00 0.00 ? 150 ILE A HD12 3  
ATOM 7031  H HD13 . ILE A 1 150 ? -7.278  28.591  5.582   1.00 0.00 ? 150 ILE A HD13 3  
ATOM 7032  N N    . LEU A 1 151 ? -1.147  29.559  7.173   1.00 0.00 ? 151 LEU A N    3  
ATOM 7033  C CA   . LEU A 1 151 ? 0.221   30.051  7.196   1.00 0.00 ? 151 LEU A CA   3  
ATOM 7034  C C    . LEU A 1 151 ? 0.725   30.209  5.761   1.00 0.00 ? 151 LEU A C    3  
ATOM 7035  O O    . LEU A 1 151 ? 0.492   29.344  4.917   1.00 0.00 ? 151 LEU A O    3  
ATOM 7036  C CB   . LEU A 1 151 ? 1.100   29.144  8.060   1.00 0.00 ? 151 LEU A CB   3  
ATOM 7037  C CG   . LEU A 1 151 ? 2.608   29.384  7.965   1.00 0.00 ? 151 LEU A CG   3  
ATOM 7038  C CD1  . LEU A 1 151 ? 3.074   30.379  9.030   1.00 0.00 ? 151 LEU A CD1  3  
ATOM 7039  C CD2  . LEU A 1 151 ? 3.379   28.065  8.036   1.00 0.00 ? 151 LEU A CD2  3  
ATOM 7040  H H    . LEU A 1 151 ? -1.310  28.736  7.716   1.00 0.00 ? 151 LEU A H    3  
ATOM 7041  H HA   . LEU A 1 151 ? 0.208   31.032  7.669   1.00 0.00 ? 151 LEU A HA   3  
ATOM 7042  H HB2  . LEU A 1 151 ? 0.798   29.263  9.100   1.00 0.00 ? 151 LEU A HB2  3  
ATOM 7043  H HB3  . LEU A 1 151 ? 0.900   28.108  7.786   1.00 0.00 ? 151 LEU A HB3  3  
ATOM 7044  H HG   . LEU A 1 151 ? 2.822   29.830  6.993   1.00 0.00 ? 151 LEU A HG   3  
ATOM 7045  H HD11 . LEU A 1 151 ? 2.205   30.814  9.525   1.00 0.00 ? 151 LEU A HD11 3  
ATOM 7046  H HD12 . LEU A 1 151 ? 3.688   29.861  9.766   1.00 0.00 ? 151 LEU A HD12 3  
ATOM 7047  H HD13 . LEU A 1 151 ? 3.658   31.169  8.559   1.00 0.00 ? 151 LEU A HD13 3  
ATOM 7048  H HD21 . LEU A 1 151 ? 2.864   27.379  8.710   1.00 0.00 ? 151 LEU A HD21 3  
ATOM 7049  H HD22 . LEU A 1 151 ? 3.436   27.623  7.042   1.00 0.00 ? 151 LEU A HD22 3  
ATOM 7050  H HD23 . LEU A 1 151 ? 4.386   28.253  8.408   1.00 0.00 ? 151 LEU A HD23 3  
ATOM 7051  N N    . PRO A 1 1   ? 1.121   0.263   -0.332  1.00 0.00 ? 1   PRO A N    4  
ATOM 7052  C CA   . PRO A 1 1   ? 1.794   0.184   -1.617  1.00 0.00 ? 1   PRO A CA   4  
ATOM 7053  C C    . PRO A 1 1   ? 1.824   -1.257  -2.132  1.00 0.00 ? 1   PRO A C    4  
ATOM 7054  O O    . PRO A 1 1   ? 2.161   -2.178  -1.390  1.00 0.00 ? 1   PRO A O    4  
ATOM 7055  C CB   . PRO A 1 1   ? 3.181   0.755   -1.371  1.00 0.00 ? 1   PRO A CB   4  
ATOM 7056  C CG   . PRO A 1 1   ? 3.393   0.703   0.133   1.00 0.00 ? 1   PRO A CG   4  
ATOM 7057  C CD   . PRO A 1 1   ? 2.044   0.445   0.785   1.00 0.00 ? 1   PRO A CD   4  
ATOM 7058  H HA   . PRO A 1 1   ? 1.293   0.710   -2.305  1.00 0.00 ? 1   PRO A HA   4  
ATOM 7059  H HB2  . PRO A 1 1   ? 3.941   0.174   -1.893  1.00 0.00 ? 1   PRO A HB2  4  
ATOM 7060  H HB3  . PRO A 1 1   ? 3.253   1.778   -1.740  1.00 0.00 ? 1   PRO A HB3  4  
ATOM 7061  H HG2  . PRO A 1 1   ? 4.098   -0.086  0.391   1.00 0.00 ? 1   PRO A HG2  4  
ATOM 7062  H HG3  . PRO A 1 1   ? 3.817   1.640   0.491   1.00 0.00 ? 1   PRO A HG3  4  
ATOM 7063  H HD2  . PRO A 1 1   ? 2.075   -0.439  1.421   1.00 0.00 ? 1   PRO A HD2  4  
ATOM 7064  H HD3  . PRO A 1 1   ? 1.743   1.282   1.415   1.00 0.00 ? 1   PRO A HD3  4  
ATOM 7065  N N    . ILE A 1 2   ? 1.466   -1.406  -3.399  1.00 0.00 ? 2   ILE A N    4  
ATOM 7066  C CA   . ILE A 1 2   ? 1.447   -2.718  -4.022  1.00 0.00 ? 2   ILE A CA   4  
ATOM 7067  C C    . ILE A 1 2   ? 2.476   -2.756  -5.154  1.00 0.00 ? 2   ILE A C    4  
ATOM 7068  O O    . ILE A 1 2   ? 2.787   -1.726  -5.749  1.00 0.00 ? 2   ILE A O    4  
ATOM 7069  C CB   . ILE A 1 2   ? 0.029   -3.080  -4.468  1.00 0.00 ? 2   ILE A CB   4  
ATOM 7070  C CG1  . ILE A 1 2   ? -0.730  -3.799  -3.351  1.00 0.00 ? 2   ILE A CG1  4  
ATOM 7071  C CG2  . ILE A 1 2   ? 0.053   -3.894  -5.763  1.00 0.00 ? 2   ILE A CG2  4  
ATOM 7072  C CD1  . ILE A 1 2   ? -2.215  -3.432  -3.374  1.00 0.00 ? 2   ILE A CD1  4  
ATOM 7073  H H    . ILE A 1 2   ? 1.194   -0.651  -3.996  1.00 0.00 ? 2   ILE A H    4  
ATOM 7074  H HA   . ILE A 1 2   ? 1.741   -3.444  -3.263  1.00 0.00 ? 2   ILE A HA   4  
ATOM 7075  H HB   . ILE A 1 2   ? -0.508  -2.155  -4.679  1.00 0.00 ? 2   ILE A HB   4  
ATOM 7076  H HG12 . ILE A 1 2   ? -0.616  -4.877  -3.466  1.00 0.00 ? 2   ILE A HG12 4  
ATOM 7077  H HG13 . ILE A 1 2   ? -0.301  -3.534  -2.386  1.00 0.00 ? 2   ILE A HG13 4  
ATOM 7078  H HG21 . ILE A 1 2   ? 0.604   -3.347  -6.527  1.00 0.00 ? 2   ILE A HG21 4  
ATOM 7079  H HG22 . ILE A 1 2   ? 0.539   -4.853  -5.581  1.00 0.00 ? 2   ILE A HG22 4  
ATOM 7080  H HG23 . ILE A 1 2   ? -0.968  -4.064  -6.103  1.00 0.00 ? 2   ILE A HG23 4  
ATOM 7081  H HD11 . ILE A 1 2   ? -2.465  -2.984  -4.336  1.00 0.00 ? 2   ILE A HD11 4  
ATOM 7082  H HD12 . ILE A 1 2   ? -2.814  -4.330  -3.226  1.00 0.00 ? 2   ILE A HD12 4  
ATOM 7083  H HD13 . ILE A 1 2   ? -2.425  -2.720  -2.576  1.00 0.00 ? 2   ILE A HD13 4  
ATOM 7084  N N    . VAL A 1 3   ? 2.977   -3.955  -5.416  1.00 0.00 ? 3   VAL A N    4  
ATOM 7085  C CA   . VAL A 1 3   ? 3.965   -4.140  -6.466  1.00 0.00 ? 3   VAL A CA   4  
ATOM 7086  C C    . VAL A 1 3   ? 3.511   -5.269  -7.393  1.00 0.00 ? 3   VAL A C    4  
ATOM 7087  O O    . VAL A 1 3   ? 2.629   -6.050  -7.040  1.00 0.00 ? 3   VAL A O    4  
ATOM 7088  C CB   . VAL A 1 3   ? 5.342   -4.389  -5.849  1.00 0.00 ? 3   VAL A CB   4  
ATOM 7089  C CG1  . VAL A 1 3   ? 5.860   -3.138  -5.138  1.00 0.00 ? 3   VAL A CG1  4  
ATOM 7090  C CG2  . VAL A 1 3   ? 5.308   -5.587  -4.897  1.00 0.00 ? 3   VAL A CG2  4  
ATOM 7091  H H    . VAL A 1 3   ? 2.719   -4.788  -4.926  1.00 0.00 ? 3   VAL A H    4  
ATOM 7092  H HA   . VAL A 1 3   ? 4.014   -3.214  -7.038  1.00 0.00 ? 3   VAL A HA   4  
ATOM 7093  H HB   . VAL A 1 3   ? 6.034   -4.625  -6.658  1.00 0.00 ? 3   VAL A HB   4  
ATOM 7094  H HG11 . VAL A 1 3   ? 5.570   -2.252  -5.704  1.00 0.00 ? 3   VAL A HG11 4  
ATOM 7095  H HG12 . VAL A 1 3   ? 5.432   -3.086  -4.136  1.00 0.00 ? 3   VAL A HG12 4  
ATOM 7096  H HG13 . VAL A 1 3   ? 6.947   -3.183  -5.067  1.00 0.00 ? 3   VAL A HG13 4  
ATOM 7097  H HG21 . VAL A 1 3   ? 4.898   -6.453  -5.416  1.00 0.00 ? 3   VAL A HG21 4  
ATOM 7098  H HG22 . VAL A 1 3   ? 6.320   -5.811  -4.560  1.00 0.00 ? 3   VAL A HG22 4  
ATOM 7099  H HG23 . VAL A 1 3   ? 4.683   -5.349  -4.036  1.00 0.00 ? 3   VAL A HG23 4  
ATOM 7100  N N    . GLN A 1 4   ? 4.135   -5.319  -8.560  1.00 0.00 ? 4   GLN A N    4  
ATOM 7101  C CA   . GLN A 1 4   ? 3.807   -6.340  -9.541  1.00 0.00 ? 4   GLN A CA   4  
ATOM 7102  C C    . GLN A 1 4   ? 4.937   -7.366  -9.639  1.00 0.00 ? 4   GLN A C    4  
ATOM 7103  O O    . GLN A 1 4   ? 6.075   -7.013  -9.946  1.00 0.00 ? 4   GLN A O    4  
ATOM 7104  C CB   . GLN A 1 4   ? 3.514   -5.715  -10.906 1.00 0.00 ? 4   GLN A CB   4  
ATOM 7105  C CG   . GLN A 1 4   ? 3.360   -6.791  -11.981 1.00 0.00 ? 4   GLN A CG   4  
ATOM 7106  C CD   . GLN A 1 4   ? 3.187   -6.164  -13.366 1.00 0.00 ? 4   GLN A CD   4  
ATOM 7107  O OE1  . GLN A 1 4   ? 4.127   -6.010  -14.128 1.00 0.00 ? 4   GLN A OE1  4  
ATOM 7108  N NE2  . GLN A 1 4   ? 1.936   -5.812  -13.647 1.00 0.00 ? 4   GLN A NE2  4  
ATOM 7109  H H    . GLN A 1 4   ? 4.851   -4.680  -8.840  1.00 0.00 ? 4   GLN A H    4  
ATOM 7110  H HA   . GLN A 1 4   ? 2.902   -6.820  -9.167  1.00 0.00 ? 4   GLN A HA   4  
ATOM 7111  H HB2  . GLN A 1 4   ? 2.603   -5.119  -10.850 1.00 0.00 ? 4   GLN A HB2  4  
ATOM 7112  H HB3  . GLN A 1 4   ? 4.322   -5.035  -11.180 1.00 0.00 ? 4   GLN A HB3  4  
ATOM 7113  H HG2  . GLN A 1 4   ? 4.237   -7.440  -11.979 1.00 0.00 ? 4   GLN A HG2  4  
ATOM 7114  H HG3  . GLN A 1 4   ? 2.500   -7.419  -11.752 1.00 0.00 ? 4   GLN A HG3  4  
ATOM 7115  H HE21 . GLN A 1 4   ? 1.210   -5.967  -12.977 1.00 0.00 ? 4   GLN A HE21 4  
ATOM 7116  H HE22 . GLN A 1 4   ? 1.721   -5.393  -14.530 1.00 0.00 ? 4   GLN A HE22 4  
ATOM 7117  N N    . ASN A 1 5   ? 4.586   -8.615  -9.372  1.00 0.00 ? 5   ASN A N    4  
ATOM 7118  C CA   . ASN A 1 5   ? 5.556   -9.694  -9.425  1.00 0.00 ? 5   ASN A CA   4  
ATOM 7119  C C    . ASN A 1 5   ? 6.337   -9.606  -10.738 1.00 0.00 ? 5   ASN A C    4  
ATOM 7120  O O    . ASN A 1 5   ? 6.048   -8.759  -11.581 1.00 0.00 ? 5   ASN A O    4  
ATOM 7121  C CB   . ASN A 1 5   ? 4.867   -11.059 -9.376  1.00 0.00 ? 5   ASN A CB   4  
ATOM 7122  C CG   . ASN A 1 5   ? 4.744   -11.559 -7.935  1.00 0.00 ? 5   ASN A CG   4  
ATOM 7123  O OD1  . ASN A 1 5   ? 5.616   -12.231 -7.407  1.00 0.00 ? 5   ASN A OD1  4  
ATOM 7124  N ND2  . ASN A 1 5   ? 3.617   -11.196 -7.330  1.00 0.00 ? 5   ASN A ND2  4  
ATOM 7125  H H    . ASN A 1 5   ? 3.658   -8.893  -9.123  1.00 0.00 ? 5   ASN A H    4  
ATOM 7126  H HA   . ASN A 1 5   ? 6.193   -9.551  -8.552  1.00 0.00 ? 5   ASN A HA   4  
ATOM 7127  H HB2  . ASN A 1 5   ? 3.876   -10.986 -9.824  1.00 0.00 ? 5   ASN A HB2  4  
ATOM 7128  H HB3  . ASN A 1 5   ? 5.432   -11.778 -9.968  1.00 0.00 ? 5   ASN A HB3  4  
ATOM 7129  H HD21 . ASN A 1 5   ? 2.942   -10.644 -7.819  1.00 0.00 ? 5   ASN A HD21 4  
ATOM 7130  H HD22 . ASN A 1 5   ? 3.444   -11.474 -6.385  1.00 0.00 ? 5   ASN A HD22 4  
ATOM 7131  N N    . LEU A 1 6   ? 7.312   -10.494 -10.871 1.00 0.00 ? 6   LEU A N    4  
ATOM 7132  C CA   . LEU A 1 6   ? 8.136   -10.529 -12.067 1.00 0.00 ? 6   LEU A CA   4  
ATOM 7133  C C    . LEU A 1 6   ? 7.413   -11.321 -13.157 1.00 0.00 ? 6   LEU A C    4  
ATOM 7134  O O    . LEU A 1 6   ? 7.368   -10.898 -14.312 1.00 0.00 ? 6   LEU A O    4  
ATOM 7135  C CB   . LEU A 1 6   ? 9.531   -11.065 -11.741 1.00 0.00 ? 6   LEU A CB   4  
ATOM 7136  C CG   . LEU A 1 6   ? 10.661  -10.032 -11.734 1.00 0.00 ? 6   LEU A CG   4  
ATOM 7137  C CD1  . LEU A 1 6   ? 11.530  -10.180 -10.483 1.00 0.00 ? 6   LEU A CD1  4  
ATOM 7138  C CD2  . LEU A 1 6   ? 11.487  -10.117 -13.018 1.00 0.00 ? 6   LEU A CD2  4  
ATOM 7139  H H    . LEU A 1 6   ? 7.540   -11.180 -10.180 1.00 0.00 ? 6   LEU A H    4  
ATOM 7140  H HA   . LEU A 1 6   ? 8.257   -9.501  -12.409 1.00 0.00 ? 6   LEU A HA   4  
ATOM 7141  H HB2  . LEU A 1 6   ? 9.496   -11.542 -10.761 1.00 0.00 ? 6   LEU A HB2  4  
ATOM 7142  H HB3  . LEU A 1 6   ? 9.780   -11.840 -12.464 1.00 0.00 ? 6   LEU A HB3  4  
ATOM 7143  H HG   . LEU A 1 6   ? 10.216  -9.038  -11.702 1.00 0.00 ? 6   LEU A HG   4  
ATOM 7144  H HD11 . LEU A 1 6   ? 11.868  -11.212 -10.395 1.00 0.00 ? 6   LEU A HD11 4  
ATOM 7145  H HD12 . LEU A 1 6   ? 12.395  -9.520  -10.562 1.00 0.00 ? 6   LEU A HD12 4  
ATOM 7146  H HD13 . LEU A 1 6   ? 10.946  -9.911  -9.602  1.00 0.00 ? 6   LEU A HD13 4  
ATOM 7147  H HD21 . LEU A 1 6   ? 10.922  -10.653 -13.781 1.00 0.00 ? 6   LEU A HD21 4  
ATOM 7148  H HD22 . LEU A 1 6   ? 11.711  -9.110  -13.373 1.00 0.00 ? 6   LEU A HD22 4  
ATOM 7149  H HD23 . LEU A 1 6   ? 12.419  -10.645 -12.818 1.00 0.00 ? 6   LEU A HD23 4  
ATOM 7150  N N    . GLN A 1 7   ? 6.864   -12.457 -12.754 1.00 0.00 ? 7   GLN A N    4  
ATOM 7151  C CA   . GLN A 1 7   ? 6.145   -13.312 -13.682 1.00 0.00 ? 7   GLN A CA   4  
ATOM 7152  C C    . GLN A 1 7   ? 4.936   -12.572 -14.259 1.00 0.00 ? 7   GLN A C    4  
ATOM 7153  O O    . GLN A 1 7   ? 4.839   -12.383 -15.470 1.00 0.00 ? 7   GLN A O    4  
ATOM 7154  C CB   . GLN A 1 7   ? 5.716   -14.617 -13.007 1.00 0.00 ? 7   GLN A CB   4  
ATOM 7155  C CG   . GLN A 1 7   ? 6.933   -15.471 -12.646 1.00 0.00 ? 7   GLN A CG   4  
ATOM 7156  C CD   . GLN A 1 7   ? 7.478   -15.096 -11.267 1.00 0.00 ? 7   GLN A CD   4  
ATOM 7157  O OE1  . GLN A 1 7   ? 6.751   -14.978 -10.294 1.00 0.00 ? 7   GLN A OE1  4  
ATOM 7158  N NE2  . GLN A 1 7   ? 8.795   -14.913 -11.238 1.00 0.00 ? 7   GLN A NE2  4  
ATOM 7159  H H    . GLN A 1 7   ? 6.904   -12.794 -11.813 1.00 0.00 ? 7   GLN A H    4  
ATOM 7160  H HA   . GLN A 1 7   ? 6.854   -13.538 -14.478 1.00 0.00 ? 7   GLN A HA   4  
ATOM 7161  H HB2  . GLN A 1 7   ? 5.144   -14.394 -12.107 1.00 0.00 ? 7   GLN A HB2  4  
ATOM 7162  H HB3  . GLN A 1 7   ? 5.059   -15.177 -13.672 1.00 0.00 ? 7   GLN A HB3  4  
ATOM 7163  H HG2  . GLN A 1 7   ? 6.656   -16.526 -12.656 1.00 0.00 ? 7   GLN A HG2  4  
ATOM 7164  H HG3  . GLN A 1 7   ? 7.711   -15.339 -13.397 1.00 0.00 ? 7   GLN A HG3  4  
ATOM 7165  H HE21 . GLN A 1 7   ? 9.335   -15.025 -12.072 1.00 0.00 ? 7   GLN A HE21 4  
ATOM 7166  H HE22 . GLN A 1 7   ? 9.247   -14.664 -10.381 1.00 0.00 ? 7   GLN A HE22 4  
ATOM 7167  N N    . GLY A 1 8   ? 4.045   -12.172 -13.364 1.00 0.00 ? 8   GLY A N    4  
ATOM 7168  C CA   . GLY A 1 8   ? 2.847   -11.456 -13.769 1.00 0.00 ? 8   GLY A CA   4  
ATOM 7169  C C    . GLY A 1 8   ? 1.728   -11.633 -12.740 1.00 0.00 ? 8   GLY A C    4  
ATOM 7170  O O    . GLY A 1 8   ? 0.776   -12.375 -12.973 1.00 0.00 ? 8   GLY A O    4  
ATOM 7171  H H    . GLY A 1 8   ? 4.130   -12.330 -12.381 1.00 0.00 ? 8   GLY A H    4  
ATOM 7172  H HA2  . GLY A 1 8   ? 3.074   -10.397 -13.886 1.00 0.00 ? 8   GLY A HA2  4  
ATOM 7173  H HA3  . GLY A 1 8   ? 2.512   -11.820 -14.740 1.00 0.00 ? 8   GLY A HA3  4  
ATOM 7174  N N    . GLN A 1 9   ? 1.881   -10.937 -11.622 1.00 0.00 ? 9   GLN A N    4  
ATOM 7175  C CA   . GLN A 1 9   ? 0.896   -11.008 -10.556 1.00 0.00 ? 9   GLN A CA   4  
ATOM 7176  C C    . GLN A 1 9   ? 0.956   -9.746  -9.694  1.00 0.00 ? 9   GLN A C    4  
ATOM 7177  O O    . GLN A 1 9   ? 1.975   -9.057  -9.665  1.00 0.00 ? 9   GLN A O    4  
ATOM 7178  C CB   . GLN A 1 9   ? 1.097   -12.264 -9.705  1.00 0.00 ? 9   GLN A CB   4  
ATOM 7179  C CG   . GLN A 1 9   ? 0.139   -13.377 -10.135 1.00 0.00 ? 9   GLN A CG   4  
ATOM 7180  C CD   . GLN A 1 9   ? -1.104  -13.404 -9.244  1.00 0.00 ? 9   GLN A CD   4  
ATOM 7181  O OE1  . GLN A 1 9   ? -2.120  -12.793 -9.534  1.00 0.00 ? 9   GLN A OE1  4  
ATOM 7182  N NE2  . GLN A 1 9   ? -0.967  -14.142 -8.146  1.00 0.00 ? 9   GLN A NE2  4  
ATOM 7183  H H    . GLN A 1 9   ? 2.658   -10.336 -11.439 1.00 0.00 ? 9   GLN A H    4  
ATOM 7184  H HA   . GLN A 1 9   ? -0.070  -11.068 -11.058 1.00 0.00 ? 9   GLN A HA   4  
ATOM 7185  H HB2  . GLN A 1 9   ? 2.127   -12.609 -9.799  1.00 0.00 ? 9   GLN A HB2  4  
ATOM 7186  H HB3  . GLN A 1 9   ? 0.936   -12.025 -8.654  1.00 0.00 ? 9   GLN A HB3  4  
ATOM 7187  H HG2  . GLN A 1 9   ? -0.156  -13.226 -11.173 1.00 0.00 ? 9   GLN A HG2  4  
ATOM 7188  H HG3  . GLN A 1 9   ? 0.648   -14.339 -10.084 1.00 0.00 ? 9   GLN A HG3  4  
ATOM 7189  H HE21 . GLN A 1 9   ? -0.105  -14.617 -7.968  1.00 0.00 ? 9   GLN A HE21 4  
ATOM 7190  H HE22 . GLN A 1 9   ? -1.726  -14.222 -7.500  1.00 0.00 ? 9   GLN A HE22 4  
ATOM 7191  N N    . MET A 1 10  ? -0.148  -9.480  -9.013  1.00 0.00 ? 10  MET A N    4  
ATOM 7192  C CA   . MET A 1 10  ? -0.235  -8.313  -8.152  1.00 0.00 ? 10  MET A CA   4  
ATOM 7193  C C    . MET A 1 10  ? -0.197  -8.716  -6.676  1.00 0.00 ? 10  MET A C    4  
ATOM 7194  O O    . MET A 1 10  ? -1.023  -9.507  -6.223  1.00 0.00 ? 10  MET A O    4  
ATOM 7195  C CB   . MET A 1 10  ? -1.534  -7.559  -8.441  1.00 0.00 ? 10  MET A CB   4  
ATOM 7196  C CG   . MET A 1 10  ? -1.402  -6.706  -9.704  1.00 0.00 ? 10  MET A CG   4  
ATOM 7197  S SD   . MET A 1 10  ? -1.322  -4.977  -9.266  1.00 0.00 ? 10  MET A SD   4  
ATOM 7198  C CE   . MET A 1 10  ? 0.424   -4.681  -9.494  1.00 0.00 ? 10  MET A CE   4  
ATOM 7199  H H    . MET A 1 10  ? -0.974  -10.046 -9.042  1.00 0.00 ? 10  MET A H    4  
ATOM 7200  H HA   . MET A 1 10  ? 0.639   -7.707  -8.393  1.00 0.00 ? 10  MET A HA   4  
ATOM 7201  H HB2  . MET A 1 10  ? -2.352  -8.270  -8.562  1.00 0.00 ? 10  MET A HB2  4  
ATOM 7202  H HB3  . MET A 1 10  ? -1.787  -6.923  -7.593  1.00 0.00 ? 10  MET A HB3  4  
ATOM 7203  H HG2  . MET A 1 10  ? -0.507  -6.992  -10.254 1.00 0.00 ? 10  MET A HG2  4  
ATOM 7204  H HG3  . MET A 1 10  ? -2.252  -6.883  -10.363 1.00 0.00 ? 10  MET A HG3  4  
ATOM 7205  H HE1  . MET A 1 10  ? 0.944   -5.633  -9.588  1.00 0.00 ? 10  MET A HE1  4  
ATOM 7206  H HE2  . MET A 1 10  ? 0.578   -4.090  -10.397 1.00 0.00 ? 10  MET A HE2  4  
ATOM 7207  H HE3  . MET A 1 10  ? 0.815   -4.137  -8.634  1.00 0.00 ? 10  MET A HE3  4  
ATOM 7208  N N    . VAL A 1 11  ? 0.771   -8.155  -5.967  1.00 0.00 ? 11  VAL A N    4  
ATOM 7209  C CA   . VAL A 1 11  ? 0.928   -8.445  -4.551  1.00 0.00 ? 11  VAL A CA   4  
ATOM 7210  C C    . VAL A 1 11  ? 1.241   -7.150  -3.801  1.00 0.00 ? 11  VAL A C    4  
ATOM 7211  O O    . VAL A 1 11  ? 1.777   -6.207  -4.380  1.00 0.00 ? 11  VAL A O    4  
ATOM 7212  C CB   . VAL A 1 11  ? 1.996   -9.524  -4.354  1.00 0.00 ? 11  VAL A CB   4  
ATOM 7213  C CG1  . VAL A 1 11  ? 1.524   -10.870 -4.908  1.00 0.00 ? 11  VAL A CG1  4  
ATOM 7214  C CG2  . VAL A 1 11  ? 3.323   -9.104  -4.988  1.00 0.00 ? 11  VAL A CG2  4  
ATOM 7215  H H    . VAL A 1 11  ? 1.440   -7.512  -6.343  1.00 0.00 ? 11  VAL A H    4  
ATOM 7216  H HA   . VAL A 1 11  ? -0.021  -8.841  -4.190  1.00 0.00 ? 11  VAL A HA   4  
ATOM 7217  H HB   . VAL A 1 11  ? 2.159   -9.641  -3.283  1.00 0.00 ? 11  VAL A HB   4  
ATOM 7218  H HG11 . VAL A 1 11  ? 1.271   -10.760 -5.963  1.00 0.00 ? 11  VAL A HG11 4  
ATOM 7219  H HG12 . VAL A 1 11  ? 2.321   -11.606 -4.800  1.00 0.00 ? 11  VAL A HG12 4  
ATOM 7220  H HG13 . VAL A 1 11  ? 0.645   -11.202 -4.356  1.00 0.00 ? 11  VAL A HG13 4  
ATOM 7221  H HG21 . VAL A 1 11  ? 3.560   -8.082  -4.692  1.00 0.00 ? 11  VAL A HG21 4  
ATOM 7222  H HG22 . VAL A 1 11  ? 4.114   -9.773  -4.652  1.00 0.00 ? 11  VAL A HG22 4  
ATOM 7223  H HG23 . VAL A 1 11  ? 3.240   -9.157  -6.075  1.00 0.00 ? 11  VAL A HG23 4  
ATOM 7224  N N    . HIS A 1 12  ? 0.892   -7.145  -2.523  1.00 0.00 ? 12  HIS A N    4  
ATOM 7225  C CA   . HIS A 1 12  ? 1.129   -5.981  -1.687  1.00 0.00 ? 12  HIS A CA   4  
ATOM 7226  C C    . HIS A 1 12  ? 2.491   -6.110  -1.000  1.00 0.00 ? 12  HIS A C    4  
ATOM 7227  O O    . HIS A 1 12  ? 2.986   -7.218  -0.799  1.00 0.00 ? 12  HIS A O    4  
ATOM 7228  C CB   . HIS A 1 12  ? -0.018  -5.782  -0.694  1.00 0.00 ? 12  HIS A CB   4  
ATOM 7229  C CG   . HIS A 1 12  ? -0.247  -6.958  0.224   1.00 0.00 ? 12  HIS A CG   4  
ATOM 7230  N ND1  . HIS A 1 12  ? 0.617   -7.283  1.256   1.00 0.00 ? 12  HIS A ND1  4  
ATOM 7231  C CD2  . HIS A 1 12  ? -1.250  -7.882  0.258   1.00 0.00 ? 12  HIS A CD2  4  
ATOM 7232  C CE1  . HIS A 1 12  ? 0.146   -8.357  1.873   1.00 0.00 ? 12  HIS A CE1  4  
ATOM 7233  N NE2  . HIS A 1 12  ? -1.010  -8.726  1.252   1.00 0.00 ? 12  HIS A NE2  4  
ATOM 7234  H H    . HIS A 1 12  ? 0.456   -7.917  -2.059  1.00 0.00 ? 12  HIS A H    4  
ATOM 7235  H HA   . HIS A 1 12  ? 1.148   -5.117  -2.351  1.00 0.00 ? 12  HIS A HA   4  
ATOM 7236  H HB2  . HIS A 1 12  ? 0.186   -4.898  -0.091  1.00 0.00 ? 12  HIS A HB2  4  
ATOM 7237  H HB3  . HIS A 1 12  ? -0.935  -5.585  -1.249  1.00 0.00 ? 12  HIS A HB3  4  
ATOM 7238  H HD1  . HIS A 1 12  ? 1.455   -6.792  1.493   1.00 0.00 ? 12  HIS A HD1  4  
ATOM 7239  H HD2  . HIS A 1 12  ? -2.103  -7.920  -0.420  1.00 0.00 ? 12  HIS A HD2  4  
ATOM 7240  H HE1  . HIS A 1 12  ? 0.603   -8.857  2.728   1.00 0.00 ? 12  HIS A HE1  4  
ATOM 7241  H HE2  . HIS A 1 12  ? -1.613  -9.471  1.542   1.00 0.00 ? 12  HIS A HE2  4  
ATOM 7242  N N    . GLN A 1 13  ? 3.057   -4.962  -0.659  1.00 0.00 ? 13  GLN A N    4  
ATOM 7243  C CA   . GLN A 1 13  ? 4.351   -4.933  0.001   1.00 0.00 ? 13  GLN A CA   4  
ATOM 7244  C C    . GLN A 1 13  ? 4.233   -4.267  1.373   1.00 0.00 ? 13  GLN A C    4  
ATOM 7245  O O    . GLN A 1 13  ? 5.112   -3.508  1.776   1.00 0.00 ? 13  GLN A O    4  
ATOM 7246  C CB   . GLN A 1 13  ? 5.392   -4.221  -0.866  1.00 0.00 ? 13  GLN A CB   4  
ATOM 7247  C CG   . GLN A 1 13  ? 6.812   -4.578  -0.421  1.00 0.00 ? 13  GLN A CG   4  
ATOM 7248  C CD   . GLN A 1 13  ? 7.617   -5.170  -1.581  1.00 0.00 ? 13  GLN A CD   4  
ATOM 7249  O OE1  . GLN A 1 13  ? 8.352   -6.132  -1.433  1.00 0.00 ? 13  GLN A OE1  4  
ATOM 7250  N NE2  . GLN A 1 13  ? 7.438   -4.542  -2.740  1.00 0.00 ? 13  GLN A NE2  4  
ATOM 7251  H H    . GLN A 1 13  ? 2.648   -4.065  -0.825  1.00 0.00 ? 13  GLN A H    4  
ATOM 7252  H HA   . GLN A 1 13  ? 4.640   -5.978  0.119   1.00 0.00 ? 13  GLN A HA   4  
ATOM 7253  H HB2  . GLN A 1 13  ? 5.254   -4.499  -1.911  1.00 0.00 ? 13  GLN A HB2  4  
ATOM 7254  H HB3  . GLN A 1 13  ? 5.247   -3.143  -0.802  1.00 0.00 ? 13  GLN A HB3  4  
ATOM 7255  H HG2  . GLN A 1 13  ? 7.314   -3.687  -0.044  1.00 0.00 ? 13  GLN A HG2  4  
ATOM 7256  H HG3  . GLN A 1 13  ? 6.771   -5.293  0.400   1.00 0.00 ? 13  GLN A HG3  4  
ATOM 7257  H HE21 . GLN A 1 13  ? 6.820   -3.757  -2.793  1.00 0.00 ? 13  GLN A HE21 4  
ATOM 7258  H HE22 . GLN A 1 13  ? 7.921   -4.854  -3.557  1.00 0.00 ? 13  GLN A HE22 4  
ATOM 7259  N N    . ALA A 1 14  ? 3.139   -4.578  2.054   1.00 0.00 ? 14  ALA A N    4  
ATOM 7260  C CA   . ALA A 1 14  ? 2.894   -4.019  3.372   1.00 0.00 ? 14  ALA A CA   4  
ATOM 7261  C C    . ALA A 1 14  ? 3.162   -2.513  3.341   1.00 0.00 ? 14  ALA A C    4  
ATOM 7262  O O    . ALA A 1 14  ? 3.406   -1.945  2.279   1.00 0.00 ? 14  ALA A O    4  
ATOM 7263  C CB   . ALA A 1 14  ? 3.761   -4.745  4.403   1.00 0.00 ? 14  ALA A CB   4  
ATOM 7264  H H    . ALA A 1 14  ? 2.429   -5.197  1.718   1.00 0.00 ? 14  ALA A H    4  
ATOM 7265  H HA   . ALA A 1 14  ? 1.845   -4.189  3.614   1.00 0.00 ? 14  ALA A HA   4  
ATOM 7266  H HB1  . ALA A 1 14  ? 4.809   -4.675  4.110   1.00 0.00 ? 14  ALA A HB1  4  
ATOM 7267  H HB2  . ALA A 1 14  ? 3.625   -4.284  5.381   1.00 0.00 ? 14  ALA A HB2  4  
ATOM 7268  H HB3  . ALA A 1 14  ? 3.467   -5.794  4.451   1.00 0.00 ? 14  ALA A HB3  4  
ATOM 7269  N N    . ILE A 1 15  ? 3.108   -1.911  4.520   1.00 0.00 ? 15  ILE A N    4  
ATOM 7270  C CA   . ILE A 1 15  ? 3.343   -0.482  4.641   1.00 0.00 ? 15  ILE A CA   4  
ATOM 7271  C C    . ILE A 1 15  ? 4.836   -0.231  4.862   1.00 0.00 ? 15  ILE A C    4  
ATOM 7272  O O    . ILE A 1 15  ? 5.635   -1.166  4.843   1.00 0.00 ? 15  ILE A O    4  
ATOM 7273  C CB   . ILE A 1 15  ? 2.451   0.117   5.732   1.00 0.00 ? 15  ILE A CB   4  
ATOM 7274  C CG1  . ILE A 1 15  ? 2.064   1.557   5.394   1.00 0.00 ? 15  ILE A CG1  4  
ATOM 7275  C CG2  . ILE A 1 15  ? 3.117   0.009   7.105   1.00 0.00 ? 15  ILE A CG2  4  
ATOM 7276  C CD1  . ILE A 1 15  ? 0.654   1.878   5.895   1.00 0.00 ? 15  ILE A CD1  4  
ATOM 7277  H H    . ILE A 1 15  ? 2.909   -2.381  5.380   1.00 0.00 ? 15  ILE A H    4  
ATOM 7278  H HA   . ILE A 1 15  ? 3.051   -0.021  3.698   1.00 0.00 ? 15  ILE A HA   4  
ATOM 7279  H HB   . ILE A 1 15  ? 1.529   -0.463  5.775   1.00 0.00 ? 15  ILE A HB   4  
ATOM 7280  H HG12 . ILE A 1 15  ? 2.779   2.245   5.845   1.00 0.00 ? 15  ILE A HG12 4  
ATOM 7281  H HG13 . ILE A 1 15  ? 2.113   1.708   4.316   1.00 0.00 ? 15  ILE A HG13 4  
ATOM 7282  H HG21 . ILE A 1 15  ? 3.823   -0.823  7.103   1.00 0.00 ? 15  ILE A HG21 4  
ATOM 7283  H HG22 . ILE A 1 15  ? 3.648   0.934   7.325   1.00 0.00 ? 15  ILE A HG22 4  
ATOM 7284  H HG23 . ILE A 1 15  ? 2.355   -0.164  7.865   1.00 0.00 ? 15  ILE A HG23 4  
ATOM 7285  H HD11 . ILE A 1 15  ? 0.124   0.949   6.108   1.00 0.00 ? 15  ILE A HD11 4  
ATOM 7286  H HD12 . ILE A 1 15  ? 0.719   2.475   6.805   1.00 0.00 ? 15  ILE A HD12 4  
ATOM 7287  H HD13 . ILE A 1 15  ? 0.116   2.438   5.131   1.00 0.00 ? 15  ILE A HD13 4  
ATOM 7288  N N    . SER A 1 16  ? 5.167   1.036   5.065   1.00 0.00 ? 16  SER A N    4  
ATOM 7289  C CA   . SER A 1 16  ? 6.549   1.421   5.288   1.00 0.00 ? 16  SER A CA   4  
ATOM 7290  C C    . SER A 1 16  ? 6.671   2.199   6.600   1.00 0.00 ? 16  SER A C    4  
ATOM 7291  O O    . SER A 1 16  ? 5.760   2.936   6.976   1.00 0.00 ? 16  SER A O    4  
ATOM 7292  C CB   . SER A 1 16  ? 7.083   2.258   4.123   1.00 0.00 ? 16  SER A CB   4  
ATOM 7293  O OG   . SER A 1 16  ? 8.072   3.193   4.547   1.00 0.00 ? 16  SER A OG   4  
ATOM 7294  H H    . SER A 1 16  ? 4.511   1.789   5.079   1.00 0.00 ? 16  SER A H    4  
ATOM 7295  H HA   . SER A 1 16  ? 7.104   0.485   5.347   1.00 0.00 ? 16  SER A HA   4  
ATOM 7296  H HB2  . SER A 1 16  ? 7.509   1.597   3.368   1.00 0.00 ? 16  SER A HB2  4  
ATOM 7297  H HB3  . SER A 1 16  ? 6.258   2.790   3.652   1.00 0.00 ? 16  SER A HB3  4  
ATOM 7298  H HG   . SER A 1 16  ? 8.101   3.968   3.916   1.00 0.00 ? 16  SER A HG   4  
ATOM 7299  N N    . PRO A 1 17  ? 7.833   2.005   7.279   1.00 0.00 ? 17  PRO A N    4  
ATOM 7300  C CA   . PRO A 1 17  ? 8.085   2.681   8.541   1.00 0.00 ? 17  PRO A CA   4  
ATOM 7301  C C    . PRO A 1 17  ? 8.422   4.155   8.315   1.00 0.00 ? 17  PRO A C    4  
ATOM 7302  O O    . PRO A 1 17  ? 8.040   5.013   9.110   1.00 0.00 ? 17  PRO A O    4  
ATOM 7303  C CB   . PRO A 1 17  ? 9.220   1.902   9.184   1.00 0.00 ? 17  PRO A CB   4  
ATOM 7304  C CG   . PRO A 1 17  ? 9.872   1.110   8.061   1.00 0.00 ? 17  PRO A CG   4  
ATOM 7305  C CD   . PRO A 1 17  ? 8.934   1.140   6.865   1.00 0.00 ? 17  PRO A CD   4  
ATOM 7306  H HA   . PRO A 1 17  ? 7.262   2.673   9.108   1.00 0.00 ? 17  PRO A HA   4  
ATOM 7307  H HB2  . PRO A 1 17  ? 9.938   2.575   9.654   1.00 0.00 ? 17  PRO A HB2  4  
ATOM 7308  H HB3  . PRO A 1 17  ? 8.848   1.238   9.964   1.00 0.00 ? 17  PRO A HB3  4  
ATOM 7309  H HG2  . PRO A 1 17  ? 10.837  1.544   7.799   1.00 0.00 ? 17  PRO A HG2  4  
ATOM 7310  H HG3  . PRO A 1 17  ? 10.058  0.084   8.375   1.00 0.00 ? 17  PRO A HG3  4  
ATOM 7311  H HD2  . PRO A 1 17  ? 9.434   1.532   5.979   1.00 0.00 ? 17  PRO A HD2  4  
ATOM 7312  H HD3  . PRO A 1 17  ? 8.580   0.140   6.615   1.00 0.00 ? 17  PRO A HD3  4  
ATOM 7313  N N    . ARG A 1 18  ? 9.138   4.406   7.227   1.00 0.00 ? 18  ARG A N    4  
ATOM 7314  C CA   . ARG A 1 18  ? 9.531   5.763   6.888   1.00 0.00 ? 18  ARG A CA   4  
ATOM 7315  C C    . ARG A 1 18  ? 8.307   6.586   6.483   1.00 0.00 ? 18  ARG A C    4  
ATOM 7316  O O    . ARG A 1 18  ? 8.258   7.791   6.723   1.00 0.00 ? 18  ARG A O    4  
ATOM 7317  C CB   . ARG A 1 18  ? 10.544  5.771   5.741   1.00 0.00 ? 18  ARG A CB   4  
ATOM 7318  C CG   . ARG A 1 18  ? 11.968  5.573   6.266   1.00 0.00 ? 18  ARG A CG   4  
ATOM 7319  C CD   . ARG A 1 18  ? 12.876  4.990   5.181   1.00 0.00 ? 18  ARG A CD   4  
ATOM 7320  N NE   . ARG A 1 18  ? 13.747  3.941   5.760   1.00 0.00 ? 18  ARG A NE   4  
ATOM 7321  C CZ   . ARG A 1 18  ? 13.365  2.672   5.954   1.00 0.00 ? 18  ARG A CZ   4  
ATOM 7322  N NH1  . ARG A 1 18  ? 12.126  2.285   5.617   1.00 0.00 ? 18  ARG A NH1  4  
ATOM 7323  N NH2  . ARG A 1 18  ? 14.221  1.788   6.485   1.00 0.00 ? 18  ARG A NH2  4  
ATOM 7324  H H    . ARG A 1 18  ? 9.445   3.703   6.586   1.00 0.00 ? 18  ARG A H    4  
ATOM 7325  H HA   . ARG A 1 18  ? 9.986   6.157   7.797   1.00 0.00 ? 18  ARG A HA   4  
ATOM 7326  H HB2  . ARG A 1 18  ? 10.302  4.979   5.031   1.00 0.00 ? 18  ARG A HB2  4  
ATOM 7327  H HB3  . ARG A 1 18  ? 10.480  6.715   5.201   1.00 0.00 ? 18  ARG A HB3  4  
ATOM 7328  H HG2  . ARG A 1 18  ? 12.370  6.528   6.607   1.00 0.00 ? 18  ARG A HG2  4  
ATOM 7329  H HG3  . ARG A 1 18  ? 11.953  4.907   7.129   1.00 0.00 ? 18  ARG A HG3  4  
ATOM 7330  H HD2  . ARG A 1 18  ? 12.272  4.570   4.377   1.00 0.00 ? 18  ARG A HD2  4  
ATOM 7331  H HD3  . ARG A 1 18  ? 13.487  5.779   4.743   1.00 0.00 ? 18  ARG A HD3  4  
ATOM 7332  H HE   . ARG A 1 18  ? 14.677  4.196   6.022   1.00 0.00 ? 18  ARG A HE   4  
ATOM 7333  H HH11 . ARG A 1 18  ? 11.487  2.944   5.222   1.00 0.00 ? 18  ARG A HH11 4  
ATOM 7334  H HH12 . ARG A 1 18  ? 11.842  1.337   5.762   1.00 0.00 ? 18  ARG A HH12 4  
ATOM 7335  H HH21 . ARG A 1 18  ? 15.145  2.076   6.736   1.00 0.00 ? 18  ARG A HH21 4  
ATOM 7336  H HH22 . ARG A 1 18  ? 13.936  0.840   6.630   1.00 0.00 ? 18  ARG A HH22 4  
ATOM 7337  N N    . THR A 1 19  ? 7.348   5.902   5.876   1.00 0.00 ? 19  THR A N    4  
ATOM 7338  C CA   . THR A 1 19  ? 6.127   6.554   5.435   1.00 0.00 ? 19  THR A CA   4  
ATOM 7339  C C    . THR A 1 19  ? 5.223   6.855   6.631   1.00 0.00 ? 19  THR A C    4  
ATOM 7340  O O    . THR A 1 19  ? 4.741   7.977   6.783   1.00 0.00 ? 19  THR A O    4  
ATOM 7341  C CB   . THR A 1 19  ? 5.467   5.661   4.382   1.00 0.00 ? 19  THR A CB   4  
ATOM 7342  O OG1  . THR A 1 19  ? 5.566   6.413   3.176   1.00 0.00 ? 19  THR A OG1  4  
ATOM 7343  C CG2  . THR A 1 19  ? 3.961   5.510   4.605   1.00 0.00 ? 19  THR A CG2  4  
ATOM 7344  H H    . THR A 1 19  ? 7.396   4.921   5.683   1.00 0.00 ? 19  THR A H    4  
ATOM 7345  H HA   . THR A 1 19  ? 6.392   7.511   4.985   1.00 0.00 ? 19  THR A HA   4  
ATOM 7346  H HB   . THR A 1 19  ? 5.953   4.687   4.339   1.00 0.00 ? 19  THR A HB   4  
ATOM 7347  H HG1  . THR A 1 19  ? 5.919   5.834   2.441   1.00 0.00 ? 19  THR A HG1  4  
ATOM 7348  H HG21 . THR A 1 19  ? 3.495   6.496   4.617   1.00 0.00 ? 19  THR A HG21 4  
ATOM 7349  H HG22 . THR A 1 19  ? 3.532   4.917   3.797   1.00 0.00 ? 19  THR A HG22 4  
ATOM 7350  H HG23 . THR A 1 19  ? 3.781   5.013   5.558   1.00 0.00 ? 19  THR A HG23 4  
ATOM 7351  N N    . LEU A 1 20  ? 5.017   5.834   7.449   1.00 0.00 ? 20  LEU A N    4  
ATOM 7352  C CA   . LEU A 1 20  ? 4.178   5.975   8.627   1.00 0.00 ? 20  LEU A CA   4  
ATOM 7353  C C    . LEU A 1 20  ? 4.831   6.962   9.597   1.00 0.00 ? 20  LEU A C    4  
ATOM 7354  O O    . LEU A 1 20  ? 4.149   7.793   10.195  1.00 0.00 ? 20  LEU A O    4  
ATOM 7355  C CB   . LEU A 1 20  ? 3.888   4.607   9.246   1.00 0.00 ? 20  LEU A CB   4  
ATOM 7356  C CG   . LEU A 1 20  ? 2.762   3.802   8.594   1.00 0.00 ? 20  LEU A CG   4  
ATOM 7357  C CD1  . LEU A 1 20  ? 2.778   2.348   9.071   1.00 0.00 ? 20  LEU A CD1  4  
ATOM 7358  C CD2  . LEU A 1 20  ? 1.404   4.467   8.829   1.00 0.00 ? 20  LEU A CD2  4  
ATOM 7359  H H    . LEU A 1 20  ? 5.412   4.924   7.318   1.00 0.00 ? 20  LEU A H    4  
ATOM 7360  H HA   . LEU A 1 20  ? 3.225   6.391   8.301   1.00 0.00 ? 20  LEU A HA   4  
ATOM 7361  H HB2  . LEU A 1 20  ? 4.801   4.012   9.209   1.00 0.00 ? 20  LEU A HB2  4  
ATOM 7362  H HB3  . LEU A 1 20  ? 3.643   4.749   10.297  1.00 0.00 ? 20  LEU A HB3  4  
ATOM 7363  H HG   . LEU A 1 20  ? 2.930   3.788   7.516   1.00 0.00 ? 20  LEU A HG   4  
ATOM 7364  H HD11 . LEU A 1 20  ? 3.797   1.964   9.029   1.00 0.00 ? 20  LEU A HD11 4  
ATOM 7365  H HD12 . LEU A 1 20  ? 2.413   2.299   10.097  1.00 0.00 ? 20  LEU A HD12 4  
ATOM 7366  H HD13 . LEU A 1 20  ? 2.136   1.747   8.428   1.00 0.00 ? 20  LEU A HD13 4  
ATOM 7367  H HD21 . LEU A 1 20  ? 1.555   5.483   9.192   1.00 0.00 ? 20  LEU A HD21 4  
ATOM 7368  H HD22 . LEU A 1 20  ? 0.845   4.494   7.894   1.00 0.00 ? 20  LEU A HD22 4  
ATOM 7369  H HD23 . LEU A 1 20  ? 0.845   3.897   9.571   1.00 0.00 ? 20  LEU A HD23 4  
ATOM 7370  N N    . ASN A 1 21  ? 6.144   6.836   9.724   1.00 0.00 ? 21  ASN A N    4  
ATOM 7371  C CA   . ASN A 1 21  ? 6.897   7.707   10.612  1.00 0.00 ? 21  ASN A CA   4  
ATOM 7372  C C    . ASN A 1 21  ? 6.711   9.160   10.172  1.00 0.00 ? 21  ASN A C    4  
ATOM 7373  O O    . ASN A 1 21  ? 6.229   9.989   10.943  1.00 0.00 ? 21  ASN A O    4  
ATOM 7374  C CB   . ASN A 1 21  ? 8.392   7.386   10.561  1.00 0.00 ? 21  ASN A CB   4  
ATOM 7375  C CG   . ASN A 1 21  ? 9.171   8.243   11.559  1.00 0.00 ? 21  ASN A CG   4  
ATOM 7376  O OD1  . ASN A 1 21  ? 9.528   9.380   11.295  1.00 0.00 ? 21  ASN A OD1  4  
ATOM 7377  N ND2  . ASN A 1 21  ? 9.414   7.639   12.719  1.00 0.00 ? 21  ASN A ND2  4  
ATOM 7378  H H    . ASN A 1 21  ? 6.691   6.157   9.234   1.00 0.00 ? 21  ASN A H    4  
ATOM 7379  H HA   . ASN A 1 21  ? 6.495   7.517   11.607  1.00 0.00 ? 21  ASN A HA   4  
ATOM 7380  H HB2  . ASN A 1 21  ? 8.548   6.329   10.784  1.00 0.00 ? 21  ASN A HB2  4  
ATOM 7381  H HB3  . ASN A 1 21  ? 8.771   7.558   9.554   1.00 0.00 ? 21  ASN A HB3  4  
ATOM 7382  H HD21 . ASN A 1 21  ? 9.093   6.704   12.872  1.00 0.00 ? 21  ASN A HD21 4  
ATOM 7383  H HD22 . ASN A 1 21  ? 9.919   8.118   13.437  1.00 0.00 ? 21  ASN A HD22 4  
ATOM 7384  N N    . ALA A 1 22  ? 7.102   9.426   8.935   1.00 0.00 ? 22  ALA A N    4  
ATOM 7385  C CA   . ALA A 1 22  ? 6.984   10.764  8.383   1.00 0.00 ? 22  ALA A CA   4  
ATOM 7386  C C    . ALA A 1 22  ? 5.547   11.259  8.558   1.00 0.00 ? 22  ALA A C    4  
ATOM 7387  O O    . ALA A 1 22  ? 5.324   12.401  8.959   1.00 0.00 ? 22  ALA A O    4  
ATOM 7388  C CB   . ALA A 1 22  ? 7.422   10.754  6.917   1.00 0.00 ? 22  ALA A CB   4  
ATOM 7389  H H    . ALA A 1 22  ? 7.493   8.746   8.314   1.00 0.00 ? 22  ALA A H    4  
ATOM 7390  H HA   . ALA A 1 22  ? 7.655   11.415  8.944   1.00 0.00 ? 22  ALA A HA   4  
ATOM 7391  H HB1  . ALA A 1 22  ? 6.934   11.570  6.385   1.00 0.00 ? 22  ALA A HB1  4  
ATOM 7392  H HB2  . ALA A 1 22  ? 8.504   10.878  6.860   1.00 0.00 ? 22  ALA A HB2  4  
ATOM 7393  H HB3  . ALA A 1 22  ? 7.141   9.805   6.461   1.00 0.00 ? 22  ALA A HB3  4  
ATOM 7394  N N    . TRP A 1 23  ? 4.609   10.376  8.249   1.00 0.00 ? 23  TRP A N    4  
ATOM 7395  C CA   . TRP A 1 23  ? 3.199   10.708  8.368   1.00 0.00 ? 23  TRP A CA   4  
ATOM 7396  C C    . TRP A 1 23  ? 2.951   11.212  9.791   1.00 0.00 ? 23  TRP A C    4  
ATOM 7397  O O    . TRP A 1 23  ? 2.540   12.355  9.986   1.00 0.00 ? 23  TRP A O    4  
ATOM 7398  C CB   . TRP A 1 23  ? 2.321   9.513   7.994   1.00 0.00 ? 23  TRP A CB   4  
ATOM 7399  C CG   . TRP A 1 23  ? 0.853   9.671   8.394   1.00 0.00 ? 23  TRP A CG   4  
ATOM 7400  C CD1  . TRP A 1 23  ? 0.153   8.936   9.270   1.00 0.00 ? 23  TRP A CD1  4  
ATOM 7401  C CD2  . TRP A 1 23  ? -0.073  10.659  7.895   1.00 0.00 ? 23  TRP A CD2  4  
ATOM 7402  N NE1  . TRP A 1 23  ? -1.151  9.378   9.371   1.00 0.00 ? 23  TRP A NE1  4  
ATOM 7403  C CE2  . TRP A 1 23  ? -1.292  10.458  8.508   1.00 0.00 ? 23  TRP A CE2  4  
ATOM 7404  C CE3  . TRP A 1 23  ? 0.114   11.689  6.956   1.00 0.00 ? 23  TRP A CE3  4  
ATOM 7405  C CZ2  . TRP A 1 23  ? -2.420  11.248  8.250   1.00 0.00 ? 23  TRP A CZ2  4  
ATOM 7406  C CZ3  . TRP A 1 23  ? -1.022  12.469  6.708   1.00 0.00 ? 23  TRP A CZ3  4  
ATOM 7407  C CH2  . TRP A 1 23  ? -2.257  12.279  7.318   1.00 0.00 ? 23  TRP A CH2  4  
ATOM 7408  H H    . TRP A 1 23  ? 4.799   9.450   7.924   1.00 0.00 ? 23  TRP A H    4  
ATOM 7409  H HA   . TRP A 1 23  ? 2.982   11.499  7.649   1.00 0.00 ? 23  TRP A HA   4  
ATOM 7410  H HB2  . TRP A 1 23  ? 2.379   9.355   6.918   1.00 0.00 ? 23  TRP A HB2  4  
ATOM 7411  H HB3  . TRP A 1 23  ? 2.722   8.618   8.469   1.00 0.00 ? 23  TRP A HB3  4  
ATOM 7412  H HD1  . TRP A 1 23  ? 0.562   8.098   9.832   1.00 0.00 ? 23  TRP A HD1  4  
ATOM 7413  H HE1  . TRP A 1 23  ? -1.927  8.956   10.010  1.00 0.00 ? 23  TRP A HE1  4  
ATOM 7414  H HE3  . TRP A 1 23  ? 1.067   11.868  6.458   1.00 0.00 ? 23  TRP A HE3  4  
ATOM 7415  H HZ2  . TRP A 1 23  ? -3.373  11.068  8.748   1.00 0.00 ? 23  TRP A HZ2  4  
ATOM 7416  H HZ3  . TRP A 1 23  ? -0.932  13.282  5.989   1.00 0.00 ? 23  TRP A HZ3  4  
ATOM 7417  H HH2  . TRP A 1 23  ? -3.095  12.931  7.071   1.00 0.00 ? 23  TRP A HH2  4  
ATOM 7418  N N    . VAL A 1 24  ? 3.209   10.334  10.749  1.00 0.00 ? 24  VAL A N    4  
ATOM 7419  C CA   . VAL A 1 24  ? 3.019   10.675  12.148  1.00 0.00 ? 24  VAL A CA   4  
ATOM 7420  C C    . VAL A 1 24  ? 3.597   12.067  12.412  1.00 0.00 ? 24  VAL A C    4  
ATOM 7421  O O    . VAL A 1 24  ? 3.000   12.863  13.137  1.00 0.00 ? 24  VAL A O    4  
ATOM 7422  C CB   . VAL A 1 24  ? 3.634   9.594   13.039  1.00 0.00 ? 24  VAL A CB   4  
ATOM 7423  C CG1  . VAL A 1 24  ? 3.577   10.001  14.513  1.00 0.00 ? 24  VAL A CG1  4  
ATOM 7424  C CG2  . VAL A 1 24  ? 2.949   8.244   12.816  1.00 0.00 ? 24  VAL A CG2  4  
ATOM 7425  H H    . VAL A 1 24  ? 3.544   9.407   10.582  1.00 0.00 ? 24  VAL A H    4  
ATOM 7426  H HA   . VAL A 1 24  ? 1.946   10.699  12.338  1.00 0.00 ? 24  VAL A HA   4  
ATOM 7427  H HB   . VAL A 1 24  ? 4.683   9.488   12.761  1.00 0.00 ? 24  VAL A HB   4  
ATOM 7428  H HG11 . VAL A 1 24  ? 3.802   11.063  14.606  1.00 0.00 ? 24  VAL A HG11 4  
ATOM 7429  H HG12 . VAL A 1 24  ? 2.579   9.805   14.906  1.00 0.00 ? 24  VAL A HG12 4  
ATOM 7430  H HG13 . VAL A 1 24  ? 4.309   9.423   15.077  1.00 0.00 ? 24  VAL A HG13 4  
ATOM 7431  H HG21 . VAL A 1 24  ? 2.331   8.295   11.919  1.00 0.00 ? 24  VAL A HG21 4  
ATOM 7432  H HG22 . VAL A 1 24  ? 3.705   7.470   12.692  1.00 0.00 ? 24  VAL A HG22 4  
ATOM 7433  H HG23 . VAL A 1 24  ? 2.322   8.008   13.675  1.00 0.00 ? 24  VAL A HG23 4  
ATOM 7434  N N    . LYS A 1 25  ? 4.750   12.318  11.812  1.00 0.00 ? 25  LYS A N    4  
ATOM 7435  C CA   . LYS A 1 25  ? 5.414   13.601  11.973  1.00 0.00 ? 25  LYS A CA   4  
ATOM 7436  C C    . LYS A 1 25  ? 4.573   14.693  11.310  1.00 0.00 ? 25  LYS A C    4  
ATOM 7437  O O    . LYS A 1 25  ? 4.456   15.798  11.837  1.00 0.00 ? 25  LYS A O    4  
ATOM 7438  C CB   . LYS A 1 25  ? 6.851   13.529  11.452  1.00 0.00 ? 25  LYS A CB   4  
ATOM 7439  C CG   . LYS A 1 25  ? 7.710   12.624  12.337  1.00 0.00 ? 25  LYS A CG   4  
ATOM 7440  C CD   . LYS A 1 25  ? 8.574   13.450  13.293  1.00 0.00 ? 25  LYS A CD   4  
ATOM 7441  C CE   . LYS A 1 25  ? 8.676   12.775  14.662  1.00 0.00 ? 25  LYS A CE   4  
ATOM 7442  N NZ   . LYS A 1 25  ? 9.822   13.319  15.424  1.00 0.00 ? 25  LYS A NZ   4  
ATOM 7443  H H    . LYS A 1 25  ? 5.228   11.666  11.224  1.00 0.00 ? 25  LYS A H    4  
ATOM 7444  H HA   . LYS A 1 25  ? 5.469   13.808  13.042  1.00 0.00 ? 25  LYS A HA   4  
ATOM 7445  H HB2  . LYS A 1 25  ? 6.853   13.152  10.429  1.00 0.00 ? 25  LYS A HB2  4  
ATOM 7446  H HB3  . LYS A 1 25  ? 7.282   14.530  11.423  1.00 0.00 ? 25  LYS A HB3  4  
ATOM 7447  H HG2  . LYS A 1 25  ? 7.069   11.952  12.908  1.00 0.00 ? 25  LYS A HG2  4  
ATOM 7448  H HG3  . LYS A 1 25  ? 8.350   11.999  11.713  1.00 0.00 ? 25  LYS A HG3  4  
ATOM 7449  H HD2  . LYS A 1 25  ? 9.570   13.578  12.870  1.00 0.00 ? 25  LYS A HD2  4  
ATOM 7450  H HD3  . LYS A 1 25  ? 8.146   14.446  13.406  1.00 0.00 ? 25  LYS A HD3  4  
ATOM 7451  H HE2  . LYS A 1 25  ? 7.754   12.930  15.221  1.00 0.00 ? 25  LYS A HE2  4  
ATOM 7452  H HE3  . LYS A 1 25  ? 8.795   11.698  14.535  1.00 0.00 ? 25  LYS A HE3  4  
ATOM 7453  H HZ1  . LYS A 1 25  ? 10.644  13.294  14.853  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 7454  H HZ2  . LYS A 1 25  ? 9.629   14.265  15.687  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 7455  H HZ3  . LYS A 1 25  ? 9.969   12.768  16.245  1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 7456  N N    . VAL A 1 26  ? 4.009   14.346  10.162  1.00 0.00 ? 26  VAL A N    4  
ATOM 7457  C CA   . VAL A 1 26  ? 3.183   15.283  9.421   1.00 0.00 ? 26  VAL A CA   4  
ATOM 7458  C C    . VAL A 1 26  ? 1.983   15.688  10.279  1.00 0.00 ? 26  VAL A C    4  
ATOM 7459  O O    . VAL A 1 26  ? 1.783   16.869  10.555  1.00 0.00 ? 26  VAL A O    4  
ATOM 7460  C CB   . VAL A 1 26  ? 2.778   14.675  8.077   1.00 0.00 ? 26  VAL A CB   4  
ATOM 7461  C CG1  . VAL A 1 26  ? 1.725   15.537  7.378   1.00 0.00 ? 26  VAL A CG1  4  
ATOM 7462  C CG2  . VAL A 1 26  ? 4.000   14.467  7.179   1.00 0.00 ? 26  VAL A CG2  4  
ATOM 7463  H H    . VAL A 1 26  ? 4.110   13.445  9.739   1.00 0.00 ? 26  VAL A H    4  
ATOM 7464  H HA   . VAL A 1 26  ? 3.786   16.169  9.223   1.00 0.00 ? 26  VAL A HA   4  
ATOM 7465  H HB   . VAL A 1 26  ? 2.336   13.698  8.270   1.00 0.00 ? 26  VAL A HB   4  
ATOM 7466  H HG11 . VAL A 1 26  ? 1.420   16.346  8.043   1.00 0.00 ? 26  VAL A HG11 4  
ATOM 7467  H HG12 . VAL A 1 26  ? 2.147   15.958  6.465   1.00 0.00 ? 26  VAL A HG12 4  
ATOM 7468  H HG13 . VAL A 1 26  ? 0.859   14.925  7.130   1.00 0.00 ? 26  VAL A HG13 4  
ATOM 7469  H HG21 . VAL A 1 26  ? 4.896   14.395  7.796   1.00 0.00 ? 26  VAL A HG21 4  
ATOM 7470  H HG22 . VAL A 1 26  ? 3.878   13.548  6.606   1.00 0.00 ? 26  VAL A HG22 4  
ATOM 7471  H HG23 . VAL A 1 26  ? 4.096   15.311  6.495   1.00 0.00 ? 26  VAL A HG23 4  
ATOM 7472  N N    . VAL A 1 27  ? 1.215   14.684  10.677  1.00 0.00 ? 27  VAL A N    4  
ATOM 7473  C CA   . VAL A 1 27  ? 0.040   14.921  11.498  1.00 0.00 ? 27  VAL A CA   4  
ATOM 7474  C C    . VAL A 1 27  ? 0.463   15.600  12.802  1.00 0.00 ? 27  VAL A C    4  
ATOM 7475  O O    . VAL A 1 27  ? -0.225  16.495  13.291  1.00 0.00 ? 27  VAL A O    4  
ATOM 7476  C CB   . VAL A 1 27  ? -0.713  13.607  11.725  1.00 0.00 ? 27  VAL A CB   4  
ATOM 7477  C CG1  . VAL A 1 27  ? -2.125  13.869  12.252  1.00 0.00 ? 27  VAL A CG1  4  
ATOM 7478  C CG2  . VAL A 1 27  ? -0.752  12.769  10.445  1.00 0.00 ? 27  VAL A CG2  4  
ATOM 7479  H H    . VAL A 1 27  ? 1.384   13.725  10.447  1.00 0.00 ? 27  VAL A H    4  
ATOM 7480  H HA   . VAL A 1 27  ? -0.615  15.594  10.948  1.00 0.00 ? 27  VAL A HA   4  
ATOM 7481  H HB   . VAL A 1 27  ? -0.172  13.038  12.481  1.00 0.00 ? 27  VAL A HB   4  
ATOM 7482  H HG11 . VAL A 1 27  ? -2.588  14.665  11.669  1.00 0.00 ? 27  VAL A HG11 4  
ATOM 7483  H HG12 . VAL A 1 27  ? -2.720  12.960  12.164  1.00 0.00 ? 27  VAL A HG12 4  
ATOM 7484  H HG13 . VAL A 1 27  ? -2.072  14.168  13.299  1.00 0.00 ? 27  VAL A HG13 4  
ATOM 7485  H HG21 . VAL A 1 27  ? -0.339  13.348  9.619   1.00 0.00 ? 27  VAL A HG21 4  
ATOM 7486  H HG22 . VAL A 1 27  ? -0.160  11.865  10.586  1.00 0.00 ? 27  VAL A HG22 4  
ATOM 7487  H HG23 . VAL A 1 27  ? -1.783  12.497  10.220  1.00 0.00 ? 27  VAL A HG23 4  
ATOM 7488  N N    . GLU A 1 28  ? 1.592   15.148  13.329  1.00 0.00 ? 28  GLU A N    4  
ATOM 7489  C CA   . GLU A 1 28  ? 2.114   15.702  14.566  1.00 0.00 ? 28  GLU A CA   4  
ATOM 7490  C C    . GLU A 1 28  ? 2.392   17.197  14.403  1.00 0.00 ? 28  GLU A C    4  
ATOM 7491  O O    . GLU A 1 28  ? 2.255   17.965  15.354  1.00 0.00 ? 28  GLU A O    4  
ATOM 7492  C CB   . GLU A 1 28  ? 3.373   14.955  15.013  1.00 0.00 ? 28  GLU A CB   4  
ATOM 7493  C CG   . GLU A 1 28  ? 3.018   13.776  15.920  1.00 0.00 ? 28  GLU A CG   4  
ATOM 7494  C CD   . GLU A 1 28  ? 4.016   13.654  17.074  1.00 0.00 ? 28  GLU A CD   4  
ATOM 7495  O OE1  . GLU A 1 28  ? 4.395   14.716  17.612  1.00 0.00 ? 28  GLU A OE1  4  
ATOM 7496  O OE2  . GLU A 1 28  ? 4.376   12.499  17.393  1.00 0.00 ? 28  GLU A OE2  4  
ATOM 7497  H H    . GLU A 1 28  ? 2.144   14.420  12.925  1.00 0.00 ? 28  GLU A H    4  
ATOM 7498  H HA   . GLU A 1 28  ? 1.328   15.550  15.306  1.00 0.00 ? 28  GLU A HA   4  
ATOM 7499  H HB2  . GLU A 1 28  ? 3.916   14.595  14.139  1.00 0.00 ? 28  GLU A HB2  4  
ATOM 7500  H HB3  . GLU A 1 28  ? 4.037   15.639  15.540  1.00 0.00 ? 28  GLU A HB3  4  
ATOM 7501  H HG2  . GLU A 1 28  ? 2.012   13.908  16.318  1.00 0.00 ? 28  GLU A HG2  4  
ATOM 7502  H HG3  . GLU A 1 28  ? 3.013   12.854  15.340  1.00 0.00 ? 28  GLU A HG3  4  
ATOM 7503  N N    . GLU A 1 29  ? 2.780   17.566  13.190  1.00 0.00 ? 29  GLU A N    4  
ATOM 7504  C CA   . GLU A 1 29  ? 3.078   18.956  12.891  1.00 0.00 ? 29  GLU A CA   4  
ATOM 7505  C C    . GLU A 1 29  ? 1.786   19.734  12.635  1.00 0.00 ? 29  GLU A C    4  
ATOM 7506  O O    . GLU A 1 29  ? 1.558   20.780  13.239  1.00 0.00 ? 29  GLU A O    4  
ATOM 7507  C CB   . GLU A 1 29  ? 4.031   19.066  11.699  1.00 0.00 ? 29  GLU A CB   4  
ATOM 7508  C CG   . GLU A 1 29  ? 5.021   20.217  11.892  1.00 0.00 ? 29  GLU A CG   4  
ATOM 7509  C CD   . GLU A 1 29  ? 6.159   20.138  10.873  1.00 0.00 ? 29  GLU A CD   4  
ATOM 7510  O OE1  . GLU A 1 29  ? 6.638   19.007  10.643  1.00 0.00 ? 29  GLU A OE1  4  
ATOM 7511  O OE2  . GLU A 1 29  ? 6.525   21.212  10.346  1.00 0.00 ? 29  GLU A OE2  4  
ATOM 7512  H H    . GLU A 1 29  ? 2.890   16.935  12.423  1.00 0.00 ? 29  GLU A H    4  
ATOM 7513  H HA   . GLU A 1 29  ? 3.575   19.344  13.781  1.00 0.00 ? 29  GLU A HA   4  
ATOM 7514  H HB2  . GLU A 1 29  ? 4.576   18.131  11.574  1.00 0.00 ? 29  GLU A HB2  4  
ATOM 7515  H HB3  . GLU A 1 29  ? 3.458   19.226  10.785  1.00 0.00 ? 29  GLU A HB3  4  
ATOM 7516  H HG2  . GLU A 1 29  ? 4.501   21.170  11.791  1.00 0.00 ? 29  GLU A HG2  4  
ATOM 7517  H HG3  . GLU A 1 29  ? 5.430   20.184  12.902  1.00 0.00 ? 29  GLU A HG3  4  
ATOM 7518  N N    . LYS A 1 30  ? 0.975   19.191  11.738  1.00 0.00 ? 30  LYS A N    4  
ATOM 7519  C CA   . LYS A 1 30  ? -0.289  19.821  11.395  1.00 0.00 ? 30  LYS A CA   4  
ATOM 7520  C C    . LYS A 1 30  ? -1.392  19.266  12.297  1.00 0.00 ? 30  LYS A C    4  
ATOM 7521  O O    . LYS A 1 30  ? -1.902  19.971  13.167  1.00 0.00 ? 30  LYS A O    4  
ATOM 7522  C CB   . LYS A 1 30  ? -0.578  19.662  9.901   1.00 0.00 ? 30  LYS A CB   4  
ATOM 7523  C CG   . LYS A 1 30  ? -0.214  20.935  9.134   1.00 0.00 ? 30  LYS A CG   4  
ATOM 7524  C CD   . LYS A 1 30  ? 1.303   21.062  8.969   1.00 0.00 ? 30  LYS A CD   4  
ATOM 7525  C CE   . LYS A 1 30  ? 1.653   22.094  7.896   1.00 0.00 ? 30  LYS A CE   4  
ATOM 7526  N NZ   . LYS A 1 30  ? 3.121   22.238  7.776   1.00 0.00 ? 30  LYS A NZ   4  
ATOM 7527  H H    . LYS A 1 30  ? 1.169   18.340  11.252  1.00 0.00 ? 30  LYS A H    4  
ATOM 7528  H HA   . LYS A 1 30  ? -0.186  20.889  11.592  1.00 0.00 ? 30  LYS A HA   4  
ATOM 7529  H HB2  . LYS A 1 30  ? -0.011  18.820  9.504   1.00 0.00 ? 30  LYS A HB2  4  
ATOM 7530  H HB3  . LYS A 1 30  ? -1.633  19.435  9.753   1.00 0.00 ? 30  LYS A HB3  4  
ATOM 7531  H HG2  . LYS A 1 30  ? -0.690  20.923  8.154   1.00 0.00 ? 30  LYS A HG2  4  
ATOM 7532  H HG3  . LYS A 1 30  ? -0.599  21.807  9.664   1.00 0.00 ? 30  LYS A HG3  4  
ATOM 7533  H HD2  . LYS A 1 30  ? 1.752   21.352  9.919   1.00 0.00 ? 30  LYS A HD2  4  
ATOM 7534  H HD3  . LYS A 1 30  ? 1.725   20.094  8.699   1.00 0.00 ? 30  LYS A HD3  4  
ATOM 7535  H HE2  . LYS A 1 30  ? 1.232   21.790  6.939   1.00 0.00 ? 30  LYS A HE2  4  
ATOM 7536  H HE3  . LYS A 1 30  ? 1.207   23.056  8.149   1.00 0.00 ? 30  LYS A HE3  4  
ATOM 7537  H HZ1  . LYS A 1 30  ? 3.543   22.115  8.674   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 7538  H HZ2  . LYS A 1 30  ? 3.473   21.546  7.144   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 7539  H HZ3  . LYS A 1 30  ? 3.340   23.149  7.426   1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 7540  N N    . ALA A 1 31  ? -1.729  18.007  12.060  1.00 0.00 ? 31  ALA A N    4  
ATOM 7541  C CA   . ALA A 1 31  ? -2.763  17.349  12.839  1.00 0.00 ? 31  ALA A CA   4  
ATOM 7542  C C    . ALA A 1 31  ? -4.122  17.580  12.176  1.00 0.00 ? 31  ALA A C    4  
ATOM 7543  O O    . ALA A 1 31  ? -4.913  18.400  12.642  1.00 0.00 ? 31  ALA A O    4  
ATOM 7544  C CB   . ALA A 1 31  ? -2.722  17.864  14.279  1.00 0.00 ? 31  ALA A CB   4  
ATOM 7545  H H    . ALA A 1 31  ? -1.310  17.440  11.351  1.00 0.00 ? 31  ALA A H    4  
ATOM 7546  H HA   . ALA A 1 31  ? -2.547  16.281  12.843  1.00 0.00 ? 31  ALA A HA   4  
ATOM 7547  H HB1  . ALA A 1 31  ? -3.426  18.689  14.391  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 7548  H HB2  . ALA A 1 31  ? -1.715  18.211  14.513  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 7549  H HB3  . ALA A 1 31  ? -2.996  17.059  14.961  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 7550  N N    . PHE A 1 32  ? -4.352  16.844  11.099  1.00 0.00 ? 32  PHE A N    4  
ATOM 7551  C CA   . PHE A 1 32  ? -5.602  16.959  10.366  1.00 0.00 ? 32  PHE A CA   4  
ATOM 7552  C C    . PHE A 1 32  ? -5.818  18.391  9.873   1.00 0.00 ? 32  PHE A C    4  
ATOM 7553  O O    . PHE A 1 32  ? -6.578  19.150  10.473  1.00 0.00 ? 32  PHE A O    4  
ATOM 7554  C CB   . PHE A 1 32  ? -6.725  16.592  11.338  1.00 0.00 ? 32  PHE A CB   4  
ATOM 7555  C CG   . PHE A 1 32  ? -7.165  15.129  11.256  1.00 0.00 ? 32  PHE A CG   4  
ATOM 7556  C CD1  . PHE A 1 32  ? -6.356  14.147  11.740  1.00 0.00 ? 32  PHE A CD1  4  
ATOM 7557  C CD2  . PHE A 1 32  ? -8.363  14.808  10.698  1.00 0.00 ? 32  PHE A CD2  4  
ATOM 7558  C CE1  . PHE A 1 32  ? -6.764  12.789  11.665  1.00 0.00 ? 32  PHE A CE1  4  
ATOM 7559  C CE2  . PHE A 1 32  ? -8.771  13.450  10.623  1.00 0.00 ? 32  PHE A CE2  4  
ATOM 7560  C CZ   . PHE A 1 32  ? -7.963  12.470  11.107  1.00 0.00 ? 32  PHE A CZ   4  
ATOM 7561  H H    . PHE A 1 32  ? -3.703  16.180  10.726  1.00 0.00 ? 32  PHE A H    4  
ATOM 7562  H HA   . PHE A 1 32  ? -5.537  16.288  9.510   1.00 0.00 ? 32  PHE A HA   4  
ATOM 7563  H HB2  . PHE A 1 32  ? -6.396  16.805  12.355  1.00 0.00 ? 32  PHE A HB2  4  
ATOM 7564  H HB3  . PHE A 1 32  ? -7.585  17.230  11.140  1.00 0.00 ? 32  PHE A HB3  4  
ATOM 7565  H HD1  . PHE A 1 32  ? -5.396  14.403  12.187  1.00 0.00 ? 32  PHE A HD1  4  
ATOM 7566  H HD2  . PHE A 1 32  ? -9.010  15.595  10.310  1.00 0.00 ? 32  PHE A HD2  4  
ATOM 7567  H HE1  . PHE A 1 32  ? -6.118  12.003  12.053  1.00 0.00 ? 32  PHE A HE1  4  
ATOM 7568  H HE2  . PHE A 1 32  ? -9.731  13.194  10.175  1.00 0.00 ? 32  PHE A HE2  4  
ATOM 7569  H HZ   . PHE A 1 32  ? -8.276  11.427  11.049  1.00 0.00 ? 32  PHE A HZ   4  
ATOM 7570  N N    . SER A 1 33  ? -5.136  18.718  8.785   1.00 0.00 ? 33  SER A N    4  
ATOM 7571  C CA   . SER A 1 33  ? -5.245  20.046  8.204   1.00 0.00 ? 33  SER A CA   4  
ATOM 7572  C C    . SER A 1 33  ? -5.788  19.950  6.778   1.00 0.00 ? 33  SER A C    4  
ATOM 7573  O O    . SER A 1 33  ? -5.953  18.853  6.244   1.00 0.00 ? 33  SER A O    4  
ATOM 7574  C CB   . SER A 1 33  ? -3.894  20.762  8.211   1.00 0.00 ? 33  SER A CB   4  
ATOM 7575  O OG   . SER A 1 33  ? -3.275  20.746  6.928   1.00 0.00 ? 33  SER A OG   4  
ATOM 7576  H H    . SER A 1 33  ? -4.521  18.095  8.304   1.00 0.00 ? 33  SER A H    4  
ATOM 7577  H HA   . SER A 1 33  ? -5.944  20.584  8.844   1.00 0.00 ? 33  SER A HA   4  
ATOM 7578  H HB2  . SER A 1 33  ? -4.031  21.793  8.535   1.00 0.00 ? 33  SER A HB2  4  
ATOM 7579  H HB3  . SER A 1 33  ? -3.234  20.286  8.938   1.00 0.00 ? 33  SER A HB3  4  
ATOM 7580  H HG   . SER A 1 33  ? -2.295  20.567  7.023   1.00 0.00 ? 33  SER A HG   4  
ATOM 7581  N N    . PRO A 1 34  ? -6.056  21.143  6.183   1.00 0.00 ? 34  PRO A N    4  
ATOM 7582  C CA   . PRO A 1 34  ? -6.577  21.204  4.828   1.00 0.00 ? 34  PRO A CA   4  
ATOM 7583  C C    . PRO A 1 34  ? -5.480  20.903  3.806   1.00 0.00 ? 34  PRO A C    4  
ATOM 7584  O O    . PRO A 1 34  ? -5.734  20.894  2.602   1.00 0.00 ? 34  PRO A O    4  
ATOM 7585  C CB   . PRO A 1 34  ? -7.150  22.605  4.690   1.00 0.00 ? 34  PRO A CB   4  
ATOM 7586  C CG   . PRO A 1 34  ? -6.519  23.426  5.803   1.00 0.00 ? 34  PRO A CG   4  
ATOM 7587  C CD   . PRO A 1 34  ? -5.873  22.461  6.784   1.00 0.00 ? 34  PRO A CD   4  
ATOM 7588  H HA   . PRO A 1 34  ? -7.277  20.502  4.693   1.00 0.00 ? 34  PRO A HA   4  
ATOM 7589  H HB2  . PRO A 1 34  ? -6.917  23.027  3.713   1.00 0.00 ? 34  PRO A HB2  4  
ATOM 7590  H HB3  . PRO A 1 34  ? -8.236  22.593  4.780   1.00 0.00 ? 34  PRO A HB3  4  
ATOM 7591  H HG2  . PRO A 1 34  ? -5.775  24.112  5.397   1.00 0.00 ? 34  PRO A HG2  4  
ATOM 7592  H HG3  . PRO A 1 34  ? -7.272  24.033  6.305   1.00 0.00 ? 34  PRO A HG3  4  
ATOM 7593  H HD2  . PRO A 1 34  ? -4.816  22.689  6.924   1.00 0.00 ? 34  PRO A HD2  4  
ATOM 7594  H HD3  . PRO A 1 34  ? -6.345  22.518  7.765   1.00 0.00 ? 34  PRO A HD3  4  
ATOM 7595  N N    . GLU A 1 35  ? -4.284  20.664  4.322   1.00 0.00 ? 35  GLU A N    4  
ATOM 7596  C CA   . GLU A 1 35  ? -3.146  20.364  3.468   1.00 0.00 ? 35  GLU A CA   4  
ATOM 7597  C C    . GLU A 1 35  ? -2.627  18.953  3.754   1.00 0.00 ? 35  GLU A C    4  
ATOM 7598  O O    . GLU A 1 35  ? -1.511  18.609  3.367   1.00 0.00 ? 35  GLU A O    4  
ATOM 7599  C CB   . GLU A 1 35  ? -2.038  21.403  3.645   1.00 0.00 ? 35  GLU A CB   4  
ATOM 7600  C CG   . GLU A 1 35  ? -2.410  22.723  2.968   1.00 0.00 ? 35  GLU A CG   4  
ATOM 7601  C CD   . GLU A 1 35  ? -1.636  22.906  1.661   1.00 0.00 ? 35  GLU A CD   4  
ATOM 7602  O OE1  . GLU A 1 35  ? -0.404  22.697  1.698   1.00 0.00 ? 35  GLU A OE1  4  
ATOM 7603  O OE2  . GLU A 1 35  ? -2.293  23.253  0.656   1.00 0.00 ? 35  GLU A OE2  4  
ATOM 7604  H H    . GLU A 1 35  ? -4.086  20.674  5.301   1.00 0.00 ? 35  GLU A H    4  
ATOM 7605  H HA   . GLU A 1 35  ? -3.527  20.418  2.448   1.00 0.00 ? 35  GLU A HA   4  
ATOM 7606  H HB2  . GLU A 1 35  ? -1.860  21.572  4.708   1.00 0.00 ? 35  GLU A HB2  4  
ATOM 7607  H HB3  . GLU A 1 35  ? -1.108  21.023  3.223   1.00 0.00 ? 35  GLU A HB3  4  
ATOM 7608  H HG2  . GLU A 1 35  ? -3.482  22.742  2.765   1.00 0.00 ? 35  GLU A HG2  4  
ATOM 7609  H HG3  . GLU A 1 35  ? -2.198  23.554  3.641   1.00 0.00 ? 35  GLU A HG3  4  
ATOM 7610  N N    . VAL A 1 36  ? -3.461  18.175  4.428   1.00 0.00 ? 36  VAL A N    4  
ATOM 7611  C CA   . VAL A 1 36  ? -3.100  16.809  4.769   1.00 0.00 ? 36  VAL A CA   4  
ATOM 7612  C C    . VAL A 1 36  ? -3.986  15.840  3.985   1.00 0.00 ? 36  VAL A C    4  
ATOM 7613  O O    . VAL A 1 36  ? -3.660  14.661  3.856   1.00 0.00 ? 36  VAL A O    4  
ATOM 7614  C CB   . VAL A 1 36  ? -3.188  16.608  6.283   1.00 0.00 ? 36  VAL A CB   4  
ATOM 7615  C CG1  . VAL A 1 36  ? -4.037  15.382  6.625   1.00 0.00 ? 36  VAL A CG1  4  
ATOM 7616  C CG2  . VAL A 1 36  ? -1.794  16.500  6.904   1.00 0.00 ? 36  VAL A CG2  4  
ATOM 7617  H H    . VAL A 1 36  ? -4.367  18.462  4.737   1.00 0.00 ? 36  VAL A H    4  
ATOM 7618  H HA   . VAL A 1 36  ? -2.062  16.659  4.469   1.00 0.00 ? 36  VAL A HA   4  
ATOM 7619  H HB   . VAL A 1 36  ? -3.677  17.484  6.710   1.00 0.00 ? 36  VAL A HB   4  
ATOM 7620  H HG11 . VAL A 1 36  ? -3.697  14.530  6.037   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 7621  H HG12 . VAL A 1 36  ? -3.937  15.154  7.686   1.00 0.00 ? 36  VAL A HG12 4  
ATOM 7622  H HG13 . VAL A 1 36  ? -5.082  15.588  6.394   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 7623  H HG21 . VAL A 1 36  ? -1.230  17.408  6.692   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 7624  H HG22 . VAL A 1 36  ? -1.886  16.372  7.983   1.00 0.00 ? 36  VAL A HG22 4  
ATOM 7625  H HG23 . VAL A 1 36  ? -1.273  15.641  6.480   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 7626  N N    . ILE A 1 37  ? -5.089  16.373  3.480   1.00 0.00 ? 37  ILE A N    4  
ATOM 7627  C CA   . ILE A 1 37  ? -6.024  15.571  2.711   1.00 0.00 ? 37  ILE A CA   4  
ATOM 7628  C C    . ILE A 1 37  ? -5.338  15.075  1.437   1.00 0.00 ? 37  ILE A C    4  
ATOM 7629  O O    . ILE A 1 37  ? -5.498  13.918  1.051   1.00 0.00 ? 37  ILE A O    4  
ATOM 7630  C CB   . ILE A 1 37  ? -7.314  16.352  2.451   1.00 0.00 ? 37  ILE A CB   4  
ATOM 7631  C CG1  . ILE A 1 37  ? -7.884  16.918  3.753   1.00 0.00 ? 37  ILE A CG1  4  
ATOM 7632  C CG2  . ILE A 1 37  ? -8.335  15.493  1.703   1.00 0.00 ? 37  ILE A CG2  4  
ATOM 7633  C CD1  . ILE A 1 37  ? -8.628  15.838  4.540   1.00 0.00 ? 37  ILE A CD1  4  
ATOM 7634  H H    . ILE A 1 37  ? -5.346  17.334  3.589   1.00 0.00 ? 37  ILE A H    4  
ATOM 7635  H HA   . ILE A 1 37  ? -6.289  14.705  3.319   1.00 0.00 ? 37  ILE A HA   4  
ATOM 7636  H HB   . ILE A 1 37  ? -7.075  17.200  1.809   1.00 0.00 ? 37  ILE A HB   4  
ATOM 7637  H HG12 . ILE A 1 37  ? -7.077  17.325  4.361   1.00 0.00 ? 37  ILE A HG12 4  
ATOM 7638  H HG13 . ILE A 1 37  ? -8.562  17.742  3.530   1.00 0.00 ? 37  ILE A HG13 4  
ATOM 7639  H HG21 . ILE A 1 37  ? -8.099  14.439  1.850   1.00 0.00 ? 37  ILE A HG21 4  
ATOM 7640  H HG22 . ILE A 1 37  ? -9.334  15.698  2.087   1.00 0.00 ? 37  ILE A HG22 4  
ATOM 7641  H HG23 . ILE A 1 37  ? -8.299  15.728  0.640   1.00 0.00 ? 37  ILE A HG23 4  
ATOM 7642  H HD11 . ILE A 1 37  ? -8.655  14.917  3.958   1.00 0.00 ? 37  ILE A HD11 4  
ATOM 7643  H HD12 . ILE A 1 37  ? -8.113  15.656  5.483   1.00 0.00 ? 37  ILE A HD12 4  
ATOM 7644  H HD13 . ILE A 1 37  ? -9.647  16.170  4.741   1.00 0.00 ? 37  ILE A HD13 4  
ATOM 7645  N N    . PRO A 1 38  ? -4.567  15.999  0.803   1.00 0.00 ? 38  PRO A N    4  
ATOM 7646  C CA   . PRO A 1 38  ? -3.856  15.669  -0.420  1.00 0.00 ? 38  PRO A CA   4  
ATOM 7647  C C    . PRO A 1 38  ? -2.631  14.800  -0.124  1.00 0.00 ? 38  PRO A C    4  
ATOM 7648  O O    . PRO A 1 38  ? -2.305  13.897  -0.892  1.00 0.00 ? 38  PRO A O    4  
ATOM 7649  C CB   . PRO A 1 38  ? -3.498  17.008  -1.042  1.00 0.00 ? 38  PRO A CB   4  
ATOM 7650  C CG   . PRO A 1 38  ? -3.610  18.030  0.077   1.00 0.00 ? 38  PRO A CG   4  
ATOM 7651  C CD   . PRO A 1 38  ? -4.355  17.379  1.231   1.00 0.00 ? 38  PRO A CD   4  
ATOM 7652  H HA   . PRO A 1 38  ? -4.438  15.123  -1.024  1.00 0.00 ? 38  PRO A HA   4  
ATOM 7653  H HB2  . PRO A 1 38  ? -2.489  16.990  -1.455  1.00 0.00 ? 38  PRO A HB2  4  
ATOM 7654  H HB3  . PRO A 1 38  ? -4.174  17.251  -1.861  1.00 0.00 ? 38  PRO A HB3  4  
ATOM 7655  H HG2  . PRO A 1 38  ? -2.620  18.356  0.398   1.00 0.00 ? 38  PRO A HG2  4  
ATOM 7656  H HG3  . PRO A 1 38  ? -4.141  18.917  -0.267  1.00 0.00 ? 38  PRO A HG3  4  
ATOM 7657  H HD2  . PRO A 1 38  ? -3.774  17.421  2.152   1.00 0.00 ? 38  PRO A HD2  4  
ATOM 7658  H HD3  . PRO A 1 38  ? -5.300  17.883  1.426   1.00 0.00 ? 38  PRO A HD3  4  
ATOM 7659  N N    . MET A 1 39  ? -1.986  15.104  0.993   1.00 0.00 ? 39  MET A N    4  
ATOM 7660  C CA   . MET A 1 39  ? -0.805  14.363  1.400   1.00 0.00 ? 39  MET A CA   4  
ATOM 7661  C C    . MET A 1 39  ? -1.154  12.909  1.724   1.00 0.00 ? 39  MET A C    4  
ATOM 7662  O O    . MET A 1 39  ? -0.373  12.002  1.443   1.00 0.00 ? 39  MET A O    4  
ATOM 7663  C CB   . MET A 1 39  ? -0.187  15.026  2.633   1.00 0.00 ? 39  MET A CB   4  
ATOM 7664  C CG   . MET A 1 39  ? 1.218   15.549  2.327   1.00 0.00 ? 39  MET A CG   4  
ATOM 7665  S SD   . MET A 1 39  ? 2.399   14.212  2.407   1.00 0.00 ? 39  MET A SD   4  
ATOM 7666  C CE   . MET A 1 39  ? 2.502   13.996  4.177   1.00 0.00 ? 39  MET A CE   4  
ATOM 7667  H H    . MET A 1 39  ? -2.258  15.840  1.613   1.00 0.00 ? 39  MET A H    4  
ATOM 7668  H HA   . MET A 1 39  ? -0.127  14.400  0.548   1.00 0.00 ? 39  MET A HA   4  
ATOM 7669  H HB2  . MET A 1 39  ? -0.820  15.847  2.965   1.00 0.00 ? 39  MET A HB2  4  
ATOM 7670  H HB3  . MET A 1 39  ? -0.140  14.308  3.452   1.00 0.00 ? 39  MET A HB3  4  
ATOM 7671  H HG2  . MET A 1 39  ? 1.239   16.004  1.336   1.00 0.00 ? 39  MET A HG2  4  
ATOM 7672  H HG3  . MET A 1 39  ? 1.489   16.328  3.040   1.00 0.00 ? 39  MET A HG3  4  
ATOM 7673  H HE1  . MET A 1 39  ? 1.829   14.697  4.668   1.00 0.00 ? 39  MET A HE1  4  
ATOM 7674  H HE2  . MET A 1 39  ? 2.216   12.976  4.435   1.00 0.00 ? 39  MET A HE2  4  
ATOM 7675  H HE3  . MET A 1 39  ? 3.524   14.181  4.506   1.00 0.00 ? 39  MET A HE3  4  
ATOM 7676  N N    . PHE A 1 40  ? -2.329  12.733  2.310   1.00 0.00 ? 40  PHE A N    4  
ATOM 7677  C CA   . PHE A 1 40  ? -2.791  11.404  2.675   1.00 0.00 ? 40  PHE A CA   4  
ATOM 7678  C C    . PHE A 1 40  ? -3.253  10.626  1.440   1.00 0.00 ? 40  PHE A C    4  
ATOM 7679  O O    . PHE A 1 40  ? -2.921  9.452   1.282   1.00 0.00 ? 40  PHE A O    4  
ATOM 7680  C CB   . PHE A 1 40  ? -3.980  11.588  3.620   1.00 0.00 ? 40  PHE A CB   4  
ATOM 7681  C CG   . PHE A 1 40  ? -4.156  10.449  4.627   1.00 0.00 ? 40  PHE A CG   4  
ATOM 7682  C CD1  . PHE A 1 40  ? -3.172  10.178  5.525   1.00 0.00 ? 40  PHE A CD1  4  
ATOM 7683  C CD2  . PHE A 1 40  ? -5.297  9.710   4.624   1.00 0.00 ? 40  PHE A CD2  4  
ATOM 7684  C CE1  . PHE A 1 40  ? -3.336  9.122   6.460   1.00 0.00 ? 40  PHE A CE1  4  
ATOM 7685  C CE2  . PHE A 1 40  ? -5.461  8.653   5.559   1.00 0.00 ? 40  PHE A CE2  4  
ATOM 7686  C CZ   . PHE A 1 40  ? -4.476  8.381   6.457   1.00 0.00 ? 40  PHE A CZ   4  
ATOM 7687  H H    . PHE A 1 40  ? -2.959  13.475  2.535   1.00 0.00 ? 40  PHE A H    4  
ATOM 7688  H HA   . PHE A 1 40  ? -1.952  10.884  3.136   1.00 0.00 ? 40  PHE A HA   4  
ATOM 7689  H HB2  . PHE A 1 40  ? -3.858  12.525  4.164   1.00 0.00 ? 40  PHE A HB2  4  
ATOM 7690  H HB3  . PHE A 1 40  ? -4.891  11.680  3.028   1.00 0.00 ? 40  PHE A HB3  4  
ATOM 7691  H HD1  . PHE A 1 40  ? -2.258  10.771  5.528   1.00 0.00 ? 40  PHE A HD1  4  
ATOM 7692  H HD2  . PHE A 1 40  ? -6.087  9.928   3.905   1.00 0.00 ? 40  PHE A HD2  4  
ATOM 7693  H HE1  . PHE A 1 40  ? -2.547  8.904   7.180   1.00 0.00 ? 40  PHE A HE1  4  
ATOM 7694  H HE2  . PHE A 1 40  ? -6.376  8.060   5.556   1.00 0.00 ? 40  PHE A HE2  4  
ATOM 7695  H HZ   . PHE A 1 40  ? -4.602  7.570   7.174   1.00 0.00 ? 40  PHE A HZ   4  
ATOM 7696  N N    . SER A 1 41  ? -4.011  11.312  0.597   1.00 0.00 ? 41  SER A N    4  
ATOM 7697  C CA   . SER A 1 41  ? -4.522  10.700  -0.618  1.00 0.00 ? 41  SER A CA   4  
ATOM 7698  C C    . SER A 1 41  ? -3.359  10.249  -1.504  1.00 0.00 ? 41  SER A C    4  
ATOM 7699  O O    . SER A 1 41  ? -3.448  9.223   -2.177  1.00 0.00 ? 41  SER A O    4  
ATOM 7700  C CB   . SER A 1 41  ? -5.428  11.666  -1.382  1.00 0.00 ? 41  SER A CB   4  
ATOM 7701  O OG   . SER A 1 41  ? -4.689  12.509  -2.261  1.00 0.00 ? 41  SER A OG   4  
ATOM 7702  H H    . SER A 1 41  ? -4.276  12.267  0.734   1.00 0.00 ? 41  SER A H    4  
ATOM 7703  H HA   . SER A 1 41  ? -5.104  9.841   -0.286  1.00 0.00 ? 41  SER A HA   4  
ATOM 7704  H HB2  . SER A 1 41  ? -6.161  11.098  -1.955  1.00 0.00 ? 41  SER A HB2  4  
ATOM 7705  H HB3  . SER A 1 41  ? -5.983  12.279  -0.673  1.00 0.00 ? 41  SER A HB3  4  
ATOM 7706  H HG   . SER A 1 41  ? -4.560  12.055  -3.143  1.00 0.00 ? 41  SER A HG   4  
ATOM 7707  N N    . ALA A 1 42  ? -2.296  11.040  -1.479  1.00 0.00 ? 42  ALA A N    4  
ATOM 7708  C CA   . ALA A 1 42  ? -1.117  10.735  -2.272  1.00 0.00 ? 42  ALA A CA   4  
ATOM 7709  C C    . ALA A 1 42  ? -0.347  9.587   -1.614  1.00 0.00 ? 42  ALA A C    4  
ATOM 7710  O O    . ALA A 1 42  ? 0.050   8.636   -2.285  1.00 0.00 ? 42  ALA A O    4  
ATOM 7711  C CB   . ALA A 1 42  ? -0.264  11.995  -2.426  1.00 0.00 ? 42  ALA A CB   4  
ATOM 7712  H H    . ALA A 1 42  ? -2.231  11.872  -0.929  1.00 0.00 ? 42  ALA A H    4  
ATOM 7713  H HA   . ALA A 1 42  ? -1.454  10.416  -3.258  1.00 0.00 ? 42  ALA A HA   4  
ATOM 7714  H HB1  . ALA A 1 42  ? -0.245  12.539  -1.481  1.00 0.00 ? 42  ALA A HB1  4  
ATOM 7715  H HB2  . ALA A 1 42  ? 0.752   11.716  -2.704  1.00 0.00 ? 42  ALA A HB2  4  
ATOM 7716  H HB3  . ALA A 1 42  ? -0.692  12.631  -3.201  1.00 0.00 ? 42  ALA A HB3  4  
ATOM 7717  N N    . LEU A 1 43  ? -0.160  9.715   -0.309  1.00 0.00 ? 43  LEU A N    4  
ATOM 7718  C CA   . LEU A 1 43  ? 0.555   8.701   0.448   1.00 0.00 ? 43  LEU A CA   4  
ATOM 7719  C C    . LEU A 1 43  ? -0.170  7.360   0.307   1.00 0.00 ? 43  LEU A C    4  
ATOM 7720  O O    . LEU A 1 43  ? 0.456   6.303   0.369   1.00 0.00 ? 43  LEU A O    4  
ATOM 7721  C CB   . LEU A 1 43  ? 0.744   9.148   1.899   1.00 0.00 ? 43  LEU A CB   4  
ATOM 7722  C CG   . LEU A 1 43  ? 2.142   9.648   2.269   1.00 0.00 ? 43  LEU A CG   4  
ATOM 7723  C CD1  . LEU A 1 43  ? 2.062   10.923  3.111   1.00 0.00 ? 43  LEU A CD1  4  
ATOM 7724  C CD2  . LEU A 1 43  ? 2.949   8.551   2.966   1.00 0.00 ? 43  LEU A CD2  4  
ATOM 7725  H H    . LEU A 1 43  ? -0.487  10.492  0.230   1.00 0.00 ? 43  LEU A H    4  
ATOM 7726  H HA   . LEU A 1 43  ? 1.547   8.604   0.008   1.00 0.00 ? 43  LEU A HA   4  
ATOM 7727  H HB2  . LEU A 1 43  ? 0.028   9.942   2.110   1.00 0.00 ? 43  LEU A HB2  4  
ATOM 7728  H HB3  . LEU A 1 43  ? 0.493   8.312   2.552   1.00 0.00 ? 43  LEU A HB3  4  
ATOM 7729  H HG   . LEU A 1 43  ? 2.669   9.902   1.350   1.00 0.00 ? 43  LEU A HG   4  
ATOM 7730  H HD11 . LEU A 1 43  ? 1.093   11.398  2.962   1.00 0.00 ? 43  LEU A HD11 4  
ATOM 7731  H HD12 . LEU A 1 43  ? 2.186   10.672  4.164   1.00 0.00 ? 43  LEU A HD12 4  
ATOM 7732  H HD13 . LEU A 1 43  ? 2.853   11.609  2.806   1.00 0.00 ? 43  LEU A HD13 4  
ATOM 7733  H HD21 . LEU A 1 43  ? 2.709   7.585   2.523   1.00 0.00 ? 43  LEU A HD21 4  
ATOM 7734  H HD22 . LEU A 1 43  ? 4.014   8.751   2.844   1.00 0.00 ? 43  LEU A HD22 4  
ATOM 7735  H HD23 . LEU A 1 43  ? 2.702   8.536   4.027   1.00 0.00 ? 43  LEU A HD23 4  
ATOM 7736  N N    . SER A 1 44  ? -1.479  7.449   0.122   1.00 0.00 ? 44  SER A N    4  
ATOM 7737  C CA   . SER A 1 44  ? -2.295  6.256   -0.028  1.00 0.00 ? 44  SER A CA   4  
ATOM 7738  C C    . SER A 1 44  ? -2.858  6.181   -1.449  1.00 0.00 ? 44  SER A C    4  
ATOM 7739  O O    . SER A 1 44  ? -4.020  5.829   -1.643  1.00 0.00 ? 44  SER A O    4  
ATOM 7740  C CB   . SER A 1 44  ? -3.433  6.235   0.994   1.00 0.00 ? 44  SER A CB   4  
ATOM 7741  O OG   . SER A 1 44  ? -3.935  4.919   1.209   1.00 0.00 ? 44  SER A OG   4  
ATOM 7742  H H    . SER A 1 44  ? -1.981  8.312   0.074   1.00 0.00 ? 44  SER A H    4  
ATOM 7743  H HA   . SER A 1 44  ? -1.622  5.419   0.162   1.00 0.00 ? 44  SER A HA   4  
ATOM 7744  H HB2  . SER A 1 44  ? -3.079  6.647   1.941   1.00 0.00 ? 44  SER A HB2  4  
ATOM 7745  H HB3  . SER A 1 44  ? -4.242  6.880   0.650   1.00 0.00 ? 44  SER A HB3  4  
ATOM 7746  H HG   . SER A 1 44  ? -3.392  4.455   1.908   1.00 0.00 ? 44  SER A HG   4  
ATOM 7747  N N    . GLU A 1 45  ? -2.006  6.520   -2.406  1.00 0.00 ? 45  GLU A N    4  
ATOM 7748  C CA   . GLU A 1 45  ? -2.404  6.495   -3.803  1.00 0.00 ? 45  GLU A CA   4  
ATOM 7749  C C    . GLU A 1 45  ? -3.057  5.154   -4.146  1.00 0.00 ? 45  GLU A C    4  
ATOM 7750  O O    . GLU A 1 45  ? -4.136  5.119   -4.736  1.00 0.00 ? 45  GLU A O    4  
ATOM 7751  C CB   . GLU A 1 45  ? -1.209  6.772   -4.718  1.00 0.00 ? 45  GLU A CB   4  
ATOM 7752  C CG   . GLU A 1 45  ? -1.187  8.236   -5.163  1.00 0.00 ? 45  GLU A CG   4  
ATOM 7753  C CD   . GLU A 1 45  ? -1.703  8.382   -6.596  1.00 0.00 ? 45  GLU A CD   4  
ATOM 7754  O OE1  . GLU A 1 45  ? -1.403  7.475   -7.402  1.00 0.00 ? 45  GLU A OE1  4  
ATOM 7755  O OE2  . GLU A 1 45  ? -2.386  9.396   -6.853  1.00 0.00 ? 45  GLU A OE2  4  
ATOM 7756  H H    . GLU A 1 45  ? -1.063  6.804   -2.240  1.00 0.00 ? 45  GLU A H    4  
ATOM 7757  H HA   . GLU A 1 45  ? -3.131  7.299   -3.912  1.00 0.00 ? 45  GLU A HA   4  
ATOM 7758  H HB2  . GLU A 1 45  ? -0.283  6.534   -4.195  1.00 0.00 ? 45  GLU A HB2  4  
ATOM 7759  H HB3  . GLU A 1 45  ? -1.258  6.124   -5.593  1.00 0.00 ? 45  GLU A HB3  4  
ATOM 7760  H HG2  . GLU A 1 45  ? -1.801  8.834   -4.489  1.00 0.00 ? 45  GLU A HG2  4  
ATOM 7761  H HG3  . GLU A 1 45  ? -0.171  8.625   -5.097  1.00 0.00 ? 45  GLU A HG3  4  
ATOM 7762  N N    . GLY A 1 46  ? -2.376  4.085   -3.763  1.00 0.00 ? 46  GLY A N    4  
ATOM 7763  C CA   . GLY A 1 46  ? -2.877  2.746   -4.022  1.00 0.00 ? 46  GLY A CA   4  
ATOM 7764  C C    . GLY A 1 46  ? -2.460  1.780   -2.911  1.00 0.00 ? 46  GLY A C    4  
ATOM 7765  O O    . GLY A 1 46  ? -1.780  0.789   -3.169  1.00 0.00 ? 46  GLY A O    4  
ATOM 7766  H H    . GLY A 1 46  ? -1.498  4.123   -3.283  1.00 0.00 ? 46  GLY A H    4  
ATOM 7767  H HA2  . GLY A 1 46  ? -3.963  2.769   -4.100  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 7768  H HA3  . GLY A 1 46  ? -2.495  2.391   -4.979  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 7769  N N    . ALA A 1 47  ? -2.887  2.104   -1.700  1.00 0.00 ? 47  ALA A N    4  
ATOM 7770  C CA   . ALA A 1 47  ? -2.567  1.277   -0.548  1.00 0.00 ? 47  ALA A CA   4  
ATOM 7771  C C    . ALA A 1 47  ? -3.671  0.236   -0.351  1.00 0.00 ? 47  ALA A C    4  
ATOM 7772  O O    . ALA A 1 47  ? -4.759  0.366   -0.909  1.00 0.00 ? 47  ALA A O    4  
ATOM 7773  C CB   . ALA A 1 47  ? -2.378  2.166   0.682   1.00 0.00 ? 47  ALA A CB   4  
ATOM 7774  H H    . ALA A 1 47  ? -3.440  2.911   -1.499  1.00 0.00 ? 47  ALA A H    4  
ATOM 7775  H HA   . ALA A 1 47  ? -1.629  0.764   -0.759  1.00 0.00 ? 47  ALA A HA   4  
ATOM 7776  H HB1  . ALA A 1 47  ? -2.857  3.130   0.512   1.00 0.00 ? 47  ALA A HB1  4  
ATOM 7777  H HB2  . ALA A 1 47  ? -1.313  2.317   0.861   1.00 0.00 ? 47  ALA A HB2  4  
ATOM 7778  H HB3  . ALA A 1 47  ? -2.827  1.685   1.551   1.00 0.00 ? 47  ALA A HB3  4  
ATOM 7779  N N    . THR A 1 48  ? -3.352  -0.774  0.446   1.00 0.00 ? 48  THR A N    4  
ATOM 7780  C CA   . THR A 1 48  ? -4.304  -1.837  0.724   1.00 0.00 ? 48  THR A CA   4  
ATOM 7781  C C    . THR A 1 48  ? -5.193  -1.459  1.910   1.00 0.00 ? 48  THR A C    4  
ATOM 7782  O O    . THR A 1 48  ? -5.159  -0.324  2.381   1.00 0.00 ? 48  THR A O    4  
ATOM 7783  C CB   . THR A 1 48  ? -3.516  -3.131  0.941   1.00 0.00 ? 48  THR A CB   4  
ATOM 7784  O OG1  . THR A 1 48  ? -3.321  -3.185  2.352   1.00 0.00 ? 48  THR A OG1  4  
ATOM 7785  C CG2  . THR A 1 48  ? -2.098  -3.056  0.371   1.00 0.00 ? 48  THR A CG2  4  
ATOM 7786  H H    . THR A 1 48  ? -2.465  -0.873  0.896   1.00 0.00 ? 48  THR A H    4  
ATOM 7787  H HA   . THR A 1 48  ? -4.957  -1.949  -0.142  1.00 0.00 ? 48  THR A HA   4  
ATOM 7788  H HB   . THR A 1 48  ? -4.055  -3.987  0.536   1.00 0.00 ? 48  THR A HB   4  
ATOM 7789  H HG1  . THR A 1 48  ? -2.790  -3.997  2.593   1.00 0.00 ? 48  THR A HG1  4  
ATOM 7790  H HG21 . THR A 1 48  ? -2.104  -2.453  -0.536  1.00 0.00 ? 48  THR A HG21 4  
ATOM 7791  H HG22 . THR A 1 48  ? -1.434  -2.602  1.106   1.00 0.00 ? 48  THR A HG22 4  
ATOM 7792  H HG23 . THR A 1 48  ? -1.748  -4.062  0.137   1.00 0.00 ? 48  THR A HG23 4  
ATOM 7793  N N    . PRO A 1 49  ? -5.989  -2.461  2.373   1.00 0.00 ? 49  PRO A N    4  
ATOM 7794  C CA   . PRO A 1 49  ? -6.885  -2.245  3.497   1.00 0.00 ? 49  PRO A CA   4  
ATOM 7795  C C    . PRO A 1 49  ? -6.112  -2.203  4.816   1.00 0.00 ? 49  PRO A C    4  
ATOM 7796  O O    . PRO A 1 49  ? -6.460  -1.446  5.720   1.00 0.00 ? 49  PRO A O    4  
ATOM 7797  C CB   . PRO A 1 49  ? -7.883  -3.390  3.428   1.00 0.00 ? 49  PRO A CB   4  
ATOM 7798  C CG   . PRO A 1 49  ? -7.237  -4.455  2.558   1.00 0.00 ? 49  PRO A CG   4  
ATOM 7799  C CD   . PRO A 1 49  ? -6.056  -3.819  1.841   1.00 0.00 ? 49  PRO A CD   4  
ATOM 7800  H HA   . PRO A 1 49  ? -7.336  -1.356  3.415   1.00 0.00 ? 49  PRO A HA   4  
ATOM 7801  H HB2  . PRO A 1 49  ? -8.100  -3.778  4.423   1.00 0.00 ? 49  PRO A HB2  4  
ATOM 7802  H HB3  . PRO A 1 49  ? -8.829  -3.058  3.001   1.00 0.00 ? 49  PRO A HB3  4  
ATOM 7803  H HG2  . PRO A 1 49  ? -6.905  -5.297  3.166   1.00 0.00 ? 49  PRO A HG2  4  
ATOM 7804  H HG3  . PRO A 1 49  ? -7.953  -4.847  1.836   1.00 0.00 ? 49  PRO A HG3  4  
ATOM 7805  H HD2  . PRO A 1 49  ? -5.133  -4.366  2.036   1.00 0.00 ? 49  PRO A HD2  4  
ATOM 7806  H HD3  . PRO A 1 49  ? -6.203  -3.815  0.762   1.00 0.00 ? 49  PRO A HD3  4  
ATOM 7807  N N    . GLN A 1 50  ? -5.077  -3.028  4.884   1.00 0.00 ? 50  GLN A N    4  
ATOM 7808  C CA   . GLN A 1 50  ? -4.251  -3.095  6.077   1.00 0.00 ? 50  GLN A CA   4  
ATOM 7809  C C    . GLN A 1 50  ? -3.354  -1.859  6.172   1.00 0.00 ? 50  GLN A C    4  
ATOM 7810  O O    . GLN A 1 50  ? -3.060  -1.384  7.268   1.00 0.00 ? 50  GLN A O    4  
ATOM 7811  C CB   . GLN A 1 50  ? -3.419  -4.379  6.098   1.00 0.00 ? 50  GLN A CB   4  
ATOM 7812  C CG   . GLN A 1 50  ? -3.202  -4.869  7.531   1.00 0.00 ? 50  GLN A CG   4  
ATOM 7813  C CD   . GLN A 1 50  ? -4.294  -5.857  7.946   1.00 0.00 ? 50  GLN A CD   4  
ATOM 7814  O OE1  . GLN A 1 50  ? -5.355  -5.936  7.347   1.00 0.00 ? 50  GLN A OE1  4  
ATOM 7815  N NE2  . GLN A 1 50  ? -3.976  -6.605  8.999   1.00 0.00 ? 50  GLN A NE2  4  
ATOM 7816  H H    . GLN A 1 50  ? -4.800  -3.641  4.144   1.00 0.00 ? 50  GLN A H    4  
ATOM 7817  H HA   . GLN A 1 50  ? -4.951  -3.110  6.913   1.00 0.00 ? 50  GLN A HA   4  
ATOM 7818  H HB2  . GLN A 1 50  ? -3.924  -5.153  5.519   1.00 0.00 ? 50  GLN A HB2  4  
ATOM 7819  H HB3  . GLN A 1 50  ? -2.456  -4.201  5.621   1.00 0.00 ? 50  GLN A HB3  4  
ATOM 7820  H HG2  . GLN A 1 50  ? -2.225  -5.346  7.611   1.00 0.00 ? 50  GLN A HG2  4  
ATOM 7821  H HG3  . GLN A 1 50  ? -3.199  -4.019  8.213   1.00 0.00 ? 50  GLN A HG3  4  
ATOM 7822  H HE21 . GLN A 1 50  ? -3.088  -6.489  9.444   1.00 0.00 ? 50  GLN A HE21 4  
ATOM 7823  H HE22 . GLN A 1 50  ? -4.625  -7.281  9.346   1.00 0.00 ? 50  GLN A HE22 4  
ATOM 7824  N N    . ASP A 1 51  ? -2.944  -1.375  5.009   1.00 0.00 ? 51  ASP A N    4  
ATOM 7825  C CA   . ASP A 1 51  ? -2.086  -0.204  4.947   1.00 0.00 ? 51  ASP A CA   4  
ATOM 7826  C C    . ASP A 1 51  ? -2.887  1.032   5.360   1.00 0.00 ? 51  ASP A C    4  
ATOM 7827  O O    . ASP A 1 51  ? -2.517  1.731   6.304   1.00 0.00 ? 51  ASP A O    4  
ATOM 7828  C CB   . ASP A 1 51  ? -1.565  0.023   3.527   1.00 0.00 ? 51  ASP A CB   4  
ATOM 7829  C CG   . ASP A 1 51  ? -0.985  1.415   3.266   1.00 0.00 ? 51  ASP A CG   4  
ATOM 7830  O OD1  . ASP A 1 51  ? -1.771  2.382   3.349   1.00 0.00 ? 51  ASP A OD1  4  
ATOM 7831  O OD2  . ASP A 1 51  ? 0.232   1.479   2.989   1.00 0.00 ? 51  ASP A OD2  4  
ATOM 7832  H H    . ASP A 1 51  ? -3.187  -1.767  4.123   1.00 0.00 ? 51  ASP A H    4  
ATOM 7833  H HA   . ASP A 1 51  ? -1.264  -0.415  5.631   1.00 0.00 ? 51  ASP A HA   4  
ATOM 7834  H HB2  . ASP A 1 51  ? -0.797  -0.720  3.315   1.00 0.00 ? 51  ASP A HB2  4  
ATOM 7835  H HB3  . ASP A 1 51  ? -2.381  -0.151  2.825   1.00 0.00 ? 51  ASP A HB3  4  
ATOM 7836  N N    . LEU A 1 52  ? -3.971  1.266   4.635   1.00 0.00 ? 52  LEU A N    4  
ATOM 7837  C CA   . LEU A 1 52  ? -4.828  2.405   4.914   1.00 0.00 ? 52  LEU A CA   4  
ATOM 7838  C C    . LEU A 1 52  ? -5.264  2.363   6.379   1.00 0.00 ? 52  LEU A C    4  
ATOM 7839  O O    . LEU A 1 52  ? -5.249  3.384   7.065   1.00 0.00 ? 52  LEU A O    4  
ATOM 7840  C CB   . LEU A 1 52  ? -5.995  2.453   3.926   1.00 0.00 ? 52  LEU A CB   4  
ATOM 7841  C CG   . LEU A 1 52  ? -5.828  3.399   2.735   1.00 0.00 ? 52  LEU A CG   4  
ATOM 7842  C CD1  . LEU A 1 52  ? -6.926  3.171   1.694   1.00 0.00 ? 52  LEU A CD1  4  
ATOM 7843  C CD2  . LEU A 1 52  ? -5.770  4.856   3.197   1.00 0.00 ? 52  LEU A CD2  4  
ATOM 7844  H H    . LEU A 1 52  ? -4.265  0.693   3.869   1.00 0.00 ? 52  LEU A H    4  
ATOM 7845  H HA   . LEU A 1 52  ? -4.235  3.307   4.756   1.00 0.00 ? 52  LEU A HA   4  
ATOM 7846  H HB2  . LEU A 1 52  ? -6.163  1.447   3.543   1.00 0.00 ? 52  LEU A HB2  4  
ATOM 7847  H HB3  . LEU A 1 52  ? -6.894  2.742   4.470   1.00 0.00 ? 52  LEU A HB3  4  
ATOM 7848  H HG   . LEU A 1 52  ? -4.876  3.177   2.253   1.00 0.00 ? 52  LEU A HG   4  
ATOM 7849  H HD11 . LEU A 1 52  ? -7.856  2.909   2.200   1.00 0.00 ? 52  LEU A HD11 4  
ATOM 7850  H HD12 . LEU A 1 52  ? -7.073  4.082   1.114   1.00 0.00 ? 52  LEU A HD12 4  
ATOM 7851  H HD13 . LEU A 1 52  ? -6.633  2.359   1.029   1.00 0.00 ? 52  LEU A HD13 4  
ATOM 7852  H HD21 . LEU A 1 52  ? -6.212  4.941   4.189   1.00 0.00 ? 52  LEU A HD21 4  
ATOM 7853  H HD22 . LEU A 1 52  ? -4.732  5.185   3.232   1.00 0.00 ? 52  LEU A HD22 4  
ATOM 7854  H HD23 . LEU A 1 52  ? -6.326  5.482   2.497   1.00 0.00 ? 52  LEU A HD23 4  
ATOM 7855  N N    . ASN A 1 53  ? -5.644  1.171   6.816   1.00 0.00 ? 53  ASN A N    4  
ATOM 7856  C CA   . ASN A 1 53  ? -6.084  0.983   8.189   1.00 0.00 ? 53  ASN A CA   4  
ATOM 7857  C C    . ASN A 1 53  ? -4.931  1.311   9.139   1.00 0.00 ? 53  ASN A C    4  
ATOM 7858  O O    . ASN A 1 53  ? -5.147  1.882   10.207  1.00 0.00 ? 53  ASN A O    4  
ATOM 7859  C CB   . ASN A 1 53  ? -6.503  -0.467  8.438   1.00 0.00 ? 53  ASN A CB   4  
ATOM 7860  C CG   . ASN A 1 53  ? -7.148  -0.623  9.816   1.00 0.00 ? 53  ASN A CG   4  
ATOM 7861  O OD1  . ASN A 1 53  ? -8.111  0.043   10.158  1.00 0.00 ? 53  ASN A OD1  4  
ATOM 7862  N ND2  . ASN A 1 53  ? -6.565  -1.536  10.587  1.00 0.00 ? 53  ASN A ND2  4  
ATOM 7863  H H    . ASN A 1 53  ? -5.654  0.346   6.252   1.00 0.00 ? 53  ASN A H    4  
ATOM 7864  H HA   . ASN A 1 53  ? -6.932  1.656   8.312   1.00 0.00 ? 53  ASN A HA   4  
ATOM 7865  H HB2  . ASN A 1 53  ? -7.205  -0.785  7.666   1.00 0.00 ? 53  ASN A HB2  4  
ATOM 7866  H HB3  . ASN A 1 53  ? -5.633  -1.119  8.364   1.00 0.00 ? 53  ASN A HB3  4  
ATOM 7867  H HD21 . ASN A 1 53  ? -5.777  -2.049  10.245  1.00 0.00 ? 53  ASN A HD21 4  
ATOM 7868  H HD22 . ASN A 1 53  ? -6.915  -1.711  11.507  1.00 0.00 ? 53  ASN A HD22 4  
ATOM 7869  N N    . THR A 1 54  ? -3.733  0.939   8.716   1.00 0.00 ? 54  THR A N    4  
ATOM 7870  C CA   . THR A 1 54  ? -2.546  1.187   9.516   1.00 0.00 ? 54  THR A CA   4  
ATOM 7871  C C    . THR A 1 54  ? -2.287  2.691   9.634   1.00 0.00 ? 54  THR A C    4  
ATOM 7872  O O    . THR A 1 54  ? -2.021  3.196   10.724  1.00 0.00 ? 54  THR A O    4  
ATOM 7873  C CB   . THR A 1 54  ? -1.383  0.417   8.889   1.00 0.00 ? 54  THR A CB   4  
ATOM 7874  O OG1  . THR A 1 54  ? -1.392  -0.838  9.563   1.00 0.00 ? 54  THR A OG1  4  
ATOM 7875  C CG2  . THR A 1 54  ? -0.021  1.020   9.243   1.00 0.00 ? 54  THR A CG2  4  
ATOM 7876  H H    . THR A 1 54  ? -3.566  0.475   7.846   1.00 0.00 ? 54  THR A H    4  
ATOM 7877  H HA   . THR A 1 54  ? -2.726  0.814   10.524  1.00 0.00 ? 54  THR A HA   4  
ATOM 7878  H HB   . THR A 1 54  ? -1.505  0.341   7.808   1.00 0.00 ? 54  THR A HB   4  
ATOM 7879  H HG1  . THR A 1 54  ? -2.303  -1.245  9.513   1.00 0.00 ? 54  THR A HG1  4  
ATOM 7880  H HG21 . THR A 1 54  ? -0.007  1.288   10.300  1.00 0.00 ? 54  THR A HG21 4  
ATOM 7881  H HG22 . THR A 1 54  ? 0.763   0.290   9.043   1.00 0.00 ? 54  THR A HG22 4  
ATOM 7882  H HG23 . THR A 1 54  ? 0.149   1.912   8.640   1.00 0.00 ? 54  THR A HG23 4  
ATOM 7883  N N    . MET A 1 55  ? -2.372  3.364   8.496   1.00 0.00 ? 55  MET A N    4  
ATOM 7884  C CA   . MET A 1 55  ? -2.151  4.799   8.457   1.00 0.00 ? 55  MET A CA   4  
ATOM 7885  C C    . MET A 1 55  ? -3.203  5.539   9.285   1.00 0.00 ? 55  MET A C    4  
ATOM 7886  O O    . MET A 1 55  ? -2.917  6.582   9.870   1.00 0.00 ? 55  MET A O    4  
ATOM 7887  C CB   . MET A 1 55  ? -2.205  5.285   7.008   1.00 0.00 ? 55  MET A CB   4  
ATOM 7888  C CG   . MET A 1 55  ? -1.071  6.271   6.717   1.00 0.00 ? 55  MET A CG   4  
ATOM 7889  S SD   . MET A 1 55  ? -0.527  6.093   5.026   1.00 0.00 ? 55  MET A SD   4  
ATOM 7890  C CE   . MET A 1 55  ? -1.061  7.662   4.362   1.00 0.00 ? 55  MET A CE   4  
ATOM 7891  H H    . MET A 1 55  ? -2.588  2.945   7.614   1.00 0.00 ? 55  MET A H    4  
ATOM 7892  H HA   . MET A 1 55  ? -1.162  4.955   8.891   1.00 0.00 ? 55  MET A HA   4  
ATOM 7893  H HB2  . MET A 1 55  ? -2.135  4.434   6.331   1.00 0.00 ? 55  MET A HB2  4  
ATOM 7894  H HB3  . MET A 1 55  ? -3.166  5.765   6.817   1.00 0.00 ? 55  MET A HB3  4  
ATOM 7895  H HG2  . MET A 1 55  ? -1.411  7.291   6.893   1.00 0.00 ? 55  MET A HG2  4  
ATOM 7896  H HG3  . MET A 1 55  ? -0.239  6.090   7.396   1.00 0.00 ? 55  MET A HG3  4  
ATOM 7897  H HE1  . MET A 1 55  ? -1.944  8.003   4.902   1.00 0.00 ? 55  MET A HE1  4  
ATOM 7898  H HE2  . MET A 1 55  ? -0.262  8.394   4.472   1.00 0.00 ? 55  MET A HE2  4  
ATOM 7899  H HE3  . MET A 1 55  ? -1.304  7.545   3.305   1.00 0.00 ? 55  MET A HE3  4  
ATOM 7900  N N    . LEU A 1 56  ? -4.400  4.970   9.306   1.00 0.00 ? 56  LEU A N    4  
ATOM 7901  C CA   . LEU A 1 56  ? -5.497  5.562   10.052  1.00 0.00 ? 56  LEU A CA   4  
ATOM 7902  C C    . LEU A 1 56  ? -5.287  5.311   11.547  1.00 0.00 ? 56  LEU A C    4  
ATOM 7903  O O    . LEU A 1 56  ? -5.451  6.218   12.361  1.00 0.00 ? 56  LEU A O    4  
ATOM 7904  C CB   . LEU A 1 56  ? -6.840  5.052   9.526   1.00 0.00 ? 56  LEU A CB   4  
ATOM 7905  C CG   . LEU A 1 56  ? -7.156  5.379   8.065   1.00 0.00 ? 56  LEU A CG   4  
ATOM 7906  C CD1  . LEU A 1 56  ? -8.105  4.340   7.464   1.00 0.00 ? 56  LEU A CD1  4  
ATOM 7907  C CD2  . LEU A 1 56  ? -7.701  6.802   7.927   1.00 0.00 ? 56  LEU A CD2  4  
ATOM 7908  H H    . LEU A 1 56  ? -4.625  4.122   8.828   1.00 0.00 ? 56  LEU A H    4  
ATOM 7909  H HA   . LEU A 1 56  ? -5.469  6.638   9.875   1.00 0.00 ? 56  LEU A HA   4  
ATOM 7910  H HB2  . LEU A 1 56  ? -6.869  3.970   9.650   1.00 0.00 ? 56  LEU A HB2  4  
ATOM 7911  H HB3  . LEU A 1 56  ? -7.633  5.465   10.150  1.00 0.00 ? 56  LEU A HB3  4  
ATOM 7912  H HG   . LEU A 1 56  ? -6.228  5.334   7.496   1.00 0.00 ? 56  LEU A HG   4  
ATOM 7913  H HD11 . LEU A 1 56  ? -8.476  3.687   8.254   1.00 0.00 ? 56  LEU A HD11 4  
ATOM 7914  H HD12 . LEU A 1 56  ? -8.944  4.847   6.988   1.00 0.00 ? 56  LEU A HD12 4  
ATOM 7915  H HD13 . LEU A 1 56  ? -7.571  3.747   6.722   1.00 0.00 ? 56  LEU A HD13 4  
ATOM 7916  H HD21 . LEU A 1 56  ? -7.197  7.455   8.638   1.00 0.00 ? 56  LEU A HD21 4  
ATOM 7917  H HD22 . LEU A 1 56  ? -7.524  7.162   6.914   1.00 0.00 ? 56  LEU A HD22 4  
ATOM 7918  H HD23 . LEU A 1 56  ? -8.773  6.802   8.131   1.00 0.00 ? 56  LEU A HD23 4  
ATOM 7919  N N    . ASN A 1 57  ? -4.926  4.076   11.862  1.00 0.00 ? 57  ASN A N    4  
ATOM 7920  C CA   . ASN A 1 57  ? -4.691  3.694   13.243  1.00 0.00 ? 57  ASN A CA   4  
ATOM 7921  C C    . ASN A 1 57  ? -3.433  4.396   13.755  1.00 0.00 ? 57  ASN A C    4  
ATOM 7922  O O    . ASN A 1 57  ? -3.247  4.545   14.962  1.00 0.00 ? 57  ASN A O    4  
ATOM 7923  C CB   . ASN A 1 57  ? -4.475  2.185   13.369  1.00 0.00 ? 57  ASN A CB   4  
ATOM 7924  C CG   . ASN A 1 57  ? -5.533  1.552   14.276  1.00 0.00 ? 57  ASN A CG   4  
ATOM 7925  O OD1  . ASN A 1 57  ? -6.652  2.024   14.391  1.00 0.00 ? 57  ASN A OD1  4  
ATOM 7926  N ND2  . ASN A 1 57  ? -5.116  0.461   14.913  1.00 0.00 ? 57  ASN A ND2  4  
ATOM 7927  H H    . ASN A 1 57  ? -4.795  3.345   11.193  1.00 0.00 ? 57  ASN A H    4  
ATOM 7928  H HA   . ASN A 1 57  ? -5.589  4.001   13.782  1.00 0.00 ? 57  ASN A HA   4  
ATOM 7929  H HB2  . ASN A 1 57  ? -4.517  1.725   12.381  1.00 0.00 ? 57  ASN A HB2  4  
ATOM 7930  H HB3  . ASN A 1 57  ? -3.481  1.988   13.770  1.00 0.00 ? 57  ASN A HB3  4  
ATOM 7931  H HD21 . ASN A 1 57  ? -4.185  0.126   14.773  1.00 0.00 ? 57  ASN A HD21 4  
ATOM 7932  H HD22 . ASN A 1 57  ? -5.736  -0.025  15.530  1.00 0.00 ? 57  ASN A HD22 4  
ATOM 7933  N N    . THR A 1 58  ? -2.600  4.810   12.812  1.00 0.00 ? 58  THR A N    4  
ATOM 7934  C CA   . THR A 1 58  ? -1.363  5.493   13.153  1.00 0.00 ? 58  THR A CA   4  
ATOM 7935  C C    . THR A 1 58  ? -1.662  6.849   13.795  1.00 0.00 ? 58  THR A C    4  
ATOM 7936  O O    . THR A 1 58  ? -1.003  7.244   14.756  1.00 0.00 ? 58  THR A O    4  
ATOM 7937  C CB   . THR A 1 58  ? -0.514  5.595   11.883  1.00 0.00 ? 58  THR A CB   4  
ATOM 7938  O OG1  . THR A 1 58  ? 0.405   4.513   11.992  1.00 0.00 ? 58  THR A OG1  4  
ATOM 7939  C CG2  . THR A 1 58  ? 0.375   6.841   11.872  1.00 0.00 ? 58  THR A CG2  4  
ATOM 7940  H H    . THR A 1 58  ? -2.757  4.685   11.833  1.00 0.00 ? 58  THR A H    4  
ATOM 7941  H HA   . THR A 1 58  ? -0.835  4.896   13.896  1.00 0.00 ? 58  THR A HA   4  
ATOM 7942  H HB   . THR A 1 58  ? -1.141  5.557   10.992  1.00 0.00 ? 58  THR A HB   4  
ATOM 7943  H HG1  . THR A 1 58  ? -0.086  3.643   11.967  1.00 0.00 ? 58  THR A HG1  4  
ATOM 7944  H HG21 . THR A 1 58  ? 0.820   6.979   12.858  1.00 0.00 ? 58  THR A HG21 4  
ATOM 7945  H HG22 . THR A 1 58  ? 1.164   6.717   11.132  1.00 0.00 ? 58  THR A HG22 4  
ATOM 7946  H HG23 . THR A 1 58  ? -0.227  7.715   11.621  1.00 0.00 ? 58  THR A HG23 4  
ATOM 7947  N N    . VAL A 1 59  ? -2.657  7.525   13.238  1.00 0.00 ? 59  VAL A N    4  
ATOM 7948  C CA   . VAL A 1 59  ? -3.052  8.828   13.744  1.00 0.00 ? 59  VAL A CA   4  
ATOM 7949  C C    . VAL A 1 59  ? -3.157  8.767   15.270  1.00 0.00 ? 59  VAL A C    4  
ATOM 7950  O O    . VAL A 1 59  ? -3.076  7.690   15.859  1.00 0.00 ? 59  VAL A O    4  
ATOM 7951  C CB   . VAL A 1 59  ? -4.351  9.279   13.074  1.00 0.00 ? 59  VAL A CB   4  
ATOM 7952  C CG1  . VAL A 1 59  ? -5.500  9.333   14.083  1.00 0.00 ? 59  VAL A CG1  4  
ATOM 7953  C CG2  . VAL A 1 59  ? -4.168  10.629  12.378  1.00 0.00 ? 59  VAL A CG2  4  
ATOM 7954  H H    . VAL A 1 59  ? -3.188  7.197   12.457  1.00 0.00 ? 59  VAL A H    4  
ATOM 7955  H HA   . VAL A 1 59  ? -2.269  9.537   13.475  1.00 0.00 ? 59  VAL A HA   4  
ATOM 7956  H HB   . VAL A 1 59  ? -4.608  8.542   12.312  1.00 0.00 ? 59  VAL A HB   4  
ATOM 7957  H HG11 . VAL A 1 59  ? -5.471  8.444   14.713  1.00 0.00 ? 59  VAL A HG11 4  
ATOM 7958  H HG12 . VAL A 1 59  ? -5.395  10.222  14.704  1.00 0.00 ? 59  VAL A HG12 4  
ATOM 7959  H HG13 . VAL A 1 59  ? -6.449  9.372   13.550  1.00 0.00 ? 59  VAL A HG13 4  
ATOM 7960  H HG21 . VAL A 1 59  ? -3.118  10.763  12.115  1.00 0.00 ? 59  VAL A HG21 4  
ATOM 7961  H HG22 . VAL A 1 59  ? -4.774  10.656  11.473  1.00 0.00 ? 59  VAL A HG22 4  
ATOM 7962  H HG23 . VAL A 1 59  ? -4.480  11.429  13.049  1.00 0.00 ? 59  VAL A HG23 4  
ATOM 7963  N N    . GLY A 1 60  ? -3.336  9.937   15.866  1.00 0.00 ? 60  GLY A N    4  
ATOM 7964  C CA   . GLY A 1 60  ? -3.454  10.030  17.311  1.00 0.00 ? 60  GLY A CA   4  
ATOM 7965  C C    . GLY A 1 60  ? -4.536  9.086   17.836  1.00 0.00 ? 60  GLY A C    4  
ATOM 7966  O O    . GLY A 1 60  ? -4.274  8.256   18.704  1.00 0.00 ? 60  GLY A O    4  
ATOM 7967  H H    . GLY A 1 60  ? -3.401  10.808  15.380  1.00 0.00 ? 60  GLY A H    4  
ATOM 7968  H HA2  . GLY A 1 60  ? -2.498  9.786   17.774  1.00 0.00 ? 60  GLY A HA2  4  
ATOM 7969  H HA3  . GLY A 1 60  ? -3.692  11.055  17.595  1.00 0.00 ? 60  GLY A HA3  4  
ATOM 7970  N N    . GLY A 1 61  ? -5.732  9.244   17.286  1.00 0.00 ? 61  GLY A N    4  
ATOM 7971  C CA   . GLY A 1 61  ? -6.856  8.416   17.688  1.00 0.00 ? 61  GLY A CA   4  
ATOM 7972  C C    . GLY A 1 61  ? -8.072  9.275   18.039  1.00 0.00 ? 61  GLY A C    4  
ATOM 7973  O O    . GLY A 1 61  ? -8.616  9.168   19.137  1.00 0.00 ? 61  GLY A O    4  
ATOM 7974  H H    . GLY A 1 61  ? -5.937  9.922   16.580  1.00 0.00 ? 61  GLY A H    4  
ATOM 7975  H HA2  . GLY A 1 61  ? -7.112  7.728   16.881  1.00 0.00 ? 61  GLY A HA2  4  
ATOM 7976  H HA3  . GLY A 1 61  ? -6.575  7.807   18.548  1.00 0.00 ? 61  GLY A HA3  4  
ATOM 7977  N N    . HIS A 1 62  ? -8.464  10.107  17.086  1.00 0.00 ? 62  HIS A N    4  
ATOM 7978  C CA   . HIS A 1 62  ? -9.606  10.984  17.280  1.00 0.00 ? 62  HIS A CA   4  
ATOM 7979  C C    . HIS A 1 62  ? -10.900 10.202  17.042  1.00 0.00 ? 62  HIS A C    4  
ATOM 7980  O O    . HIS A 1 62  ? -11.147 9.729   15.934  1.00 0.00 ? 62  HIS A O    4  
ATOM 7981  C CB   . HIS A 1 62  ? -9.493  12.228  16.396  1.00 0.00 ? 62  HIS A CB   4  
ATOM 7982  C CG   . HIS A 1 62  ? -8.078  12.571  15.996  1.00 0.00 ? 62  HIS A CG   4  
ATOM 7983  N ND1  . HIS A 1 62  ? -7.150  13.080  16.887  1.00 0.00 ? 62  HIS A ND1  4  
ATOM 7984  C CD2  . HIS A 1 62  ? -7.442  12.471  14.794  1.00 0.00 ? 62  HIS A CD2  4  
ATOM 7985  C CE1  . HIS A 1 62  ? -6.011  13.276  16.239  1.00 0.00 ? 62  HIS A CE1  4  
ATOM 7986  N NE2  . HIS A 1 62  ? -6.195  12.898  14.942  1.00 0.00 ? 62  HIS A NE2  4  
ATOM 7987  H H    . HIS A 1 62  ? -8.017  10.188  16.195  1.00 0.00 ? 62  HIS A H    4  
ATOM 7988  H HA   . HIS A 1 62  ? -9.576  11.311  18.319  1.00 0.00 ? 62  HIS A HA   4  
ATOM 7989  H HB2  . HIS A 1 62  ? -10.087 12.076  15.495  1.00 0.00 ? 62  HIS A HB2  4  
ATOM 7990  H HB3  . HIS A 1 62  ? -9.927  13.077  16.924  1.00 0.00 ? 62  HIS A HB3  4  
ATOM 7991  H HD1  . HIS A 1 62  ? -7.311  13.269  17.856  1.00 0.00 ? 62  HIS A HD1  4  
ATOM 7992  H HD2  . HIS A 1 62  ? -7.885  12.104  13.868  1.00 0.00 ? 62  HIS A HD2  4  
ATOM 7993  H HE1  . HIS A 1 62  ? -5.089  13.669  16.669  1.00 0.00 ? 62  HIS A HE1  4  
ATOM 7994  H HE2  . HIS A 1 62  ? -5.487  12.883  14.235  1.00 0.00 ? 62  HIS A HE2  4  
ATOM 7995  N N    . GLN A 1 63  ? -11.690 10.092  18.099  1.00 0.00 ? 63  GLN A N    4  
ATOM 7996  C CA   . GLN A 1 63  ? -12.952 9.376   18.019  1.00 0.00 ? 63  GLN A CA   4  
ATOM 7997  C C    . GLN A 1 63  ? -13.944 10.146  17.145  1.00 0.00 ? 63  GLN A C    4  
ATOM 7998  O O    . GLN A 1 63  ? -14.697 9.547   16.378  1.00 0.00 ? 63  GLN A O    4  
ATOM 7999  C CB   . GLN A 1 63  ? -13.530 9.124   19.413  1.00 0.00 ? 63  GLN A CB   4  
ATOM 8000  C CG   . GLN A 1 63  ? -14.091 7.705   19.527  1.00 0.00 ? 63  GLN A CG   4  
ATOM 8001  C CD   . GLN A 1 63  ? -12.988 6.663   19.328  1.00 0.00 ? 63  GLN A CD   4  
ATOM 8002  O OE1  . GLN A 1 63  ? -11.838 6.978   19.069  1.00 0.00 ? 63  GLN A OE1  4  
ATOM 8003  N NE2  . GLN A 1 63  ? -13.401 5.406   19.465  1.00 0.00 ? 63  GLN A NE2  4  
ATOM 8004  H H    . GLN A 1 63  ? -11.481 10.480  18.997  1.00 0.00 ? 63  GLN A H    4  
ATOM 8005  H HA   . GLN A 1 63  ? -12.713 8.420   17.554  1.00 0.00 ? 63  GLN A HA   4  
ATOM 8006  H HB2  . GLN A 1 63  ? -12.754 9.274   20.164  1.00 0.00 ? 63  GLN A HB2  4  
ATOM 8007  H HB3  . GLN A 1 63  ? -14.318 9.849   19.620  1.00 0.00 ? 63  GLN A HB3  4  
ATOM 8008  H HG2  . GLN A 1 63  ? -14.552 7.570   20.505  1.00 0.00 ? 63  GLN A HG2  4  
ATOM 8009  H HG3  . GLN A 1 63  ? -14.872 7.559   18.782  1.00 0.00 ? 63  GLN A HG3  4  
ATOM 8010  H HE21 . GLN A 1 63  ? -14.360 5.215   19.678  1.00 0.00 ? 63  GLN A HE21 4  
ATOM 8011  H HE22 . GLN A 1 63  ? -12.755 4.652   19.354  1.00 0.00 ? 63  GLN A HE22 4  
ATOM 8012  N N    . ALA A 1 64  ? -13.913 11.463  17.289  1.00 0.00 ? 64  ALA A N    4  
ATOM 8013  C CA   . ALA A 1 64  ? -14.801 12.320  16.524  1.00 0.00 ? 64  ALA A CA   4  
ATOM 8014  C C    . ALA A 1 64  ? -14.424 12.243  15.042  1.00 0.00 ? 64  ALA A C    4  
ATOM 8015  O O    . ALA A 1 64  ? -15.285 12.027  14.190  1.00 0.00 ? 64  ALA A O    4  
ATOM 8016  C CB   . ALA A 1 64  ? -14.729 13.748  17.069  1.00 0.00 ? 64  ALA A CB   4  
ATOM 8017  H H    . ALA A 1 64  ? -13.298 11.942  17.916  1.00 0.00 ? 64  ALA A H    4  
ATOM 8018  H HA   . ALA A 1 64  ? -15.817 11.947  16.652  1.00 0.00 ? 64  ALA A HA   4  
ATOM 8019  H HB1  . ALA A 1 64  ? -15.145 13.774  18.076  1.00 0.00 ? 64  ALA A HB1  4  
ATOM 8020  H HB2  . ALA A 1 64  ? -15.301 14.413  16.423  1.00 0.00 ? 64  ALA A HB2  4  
ATOM 8021  H HB3  . ALA A 1 64  ? -13.689 14.074  17.097  1.00 0.00 ? 64  ALA A HB3  4  
ATOM 8022  N N    . ALA A 1 65  ? -13.139 12.424  14.781  1.00 0.00 ? 65  ALA A N    4  
ATOM 8023  C CA   . ALA A 1 65  ? -12.638 12.378  13.418  1.00 0.00 ? 65  ALA A CA   4  
ATOM 8024  C C    . ALA A 1 65  ? -12.936 11.003  12.817  1.00 0.00 ? 65  ALA A C    4  
ATOM 8025  O O    . ALA A 1 65  ? -13.534 10.907  11.745  1.00 0.00 ? 65  ALA A O    4  
ATOM 8026  C CB   . ALA A 1 65  ? -11.144 12.704  13.412  1.00 0.00 ? 65  ALA A CB   4  
ATOM 8027  H H    . ALA A 1 65  ? -12.445 12.600  15.480  1.00 0.00 ? 65  ALA A H    4  
ATOM 8028  H HA   . ALA A 1 65  ? -13.166 13.139  12.844  1.00 0.00 ? 65  ALA A HA   4  
ATOM 8029  H HB1  . ALA A 1 65  ? -10.569 11.786  13.529  1.00 0.00 ? 65  ALA A HB1  4  
ATOM 8030  H HB2  . ALA A 1 65  ? -10.879 13.179  12.466  1.00 0.00 ? 65  ALA A HB2  4  
ATOM 8031  H HB3  . ALA A 1 65  ? -10.916 13.383  14.233  1.00 0.00 ? 65  ALA A HB3  4  
ATOM 8032  N N    . MET A 1 66  ? -12.508 9.973   13.532  1.00 0.00 ? 66  MET A N    4  
ATOM 8033  C CA   . MET A 1 66  ? -12.722 8.609   13.082  1.00 0.00 ? 66  MET A CA   4  
ATOM 8034  C C    . MET A 1 66  ? -14.213 8.322   12.890  1.00 0.00 ? 66  MET A C    4  
ATOM 8035  O O    . MET A 1 66  ? -14.598 7.614   11.961  1.00 0.00 ? 66  MET A O    4  
ATOM 8036  C CB   . MET A 1 66  ? -12.142 7.635   14.110  1.00 0.00 ? 66  MET A CB   4  
ATOM 8037  C CG   . MET A 1 66  ? -10.653 7.393   13.857  1.00 0.00 ? 66  MET A CG   4  
ATOM 8038  S SD   . MET A 1 66  ? -10.423 6.612   12.269  1.00 0.00 ? 66  MET A SD   4  
ATOM 8039  C CE   . MET A 1 66  ? -8.942  7.446   11.724  1.00 0.00 ? 66  MET A CE   4  
ATOM 8040  H H    . MET A 1 66  ? -12.024 10.060  14.402  1.00 0.00 ? 66  MET A H    4  
ATOM 8041  H HA   . MET A 1 66  ? -12.205 8.531   12.125  1.00 0.00 ? 66  MET A HA   4  
ATOM 8042  H HB2  . MET A 1 66  ? -12.284 8.035   15.114  1.00 0.00 ? 66  MET A HB2  4  
ATOM 8043  H HB3  . MET A 1 66  ? -12.682 6.689   14.064  1.00 0.00 ? 66  MET A HB3  4  
ATOM 8044  H HG2  . MET A 1 66  ? -10.112 8.339   13.888  1.00 0.00 ? 66  MET A HG2  4  
ATOM 8045  H HG3  . MET A 1 66  ? -10.240 6.763   14.645  1.00 0.00 ? 66  MET A HG3  4  
ATOM 8046  H HE1  . MET A 1 66  ? -9.126  8.520   11.679  1.00 0.00 ? 66  MET A HE1  4  
ATOM 8047  H HE2  . MET A 1 66  ? -8.133  7.245   12.425  1.00 0.00 ? 66  MET A HE2  4  
ATOM 8048  H HE3  . MET A 1 66  ? -8.664  7.084   10.734  1.00 0.00 ? 66  MET A HE3  4  
ATOM 8049  N N    . GLN A 1 67  ? -15.011 8.886   13.786  1.00 0.00 ? 67  GLN A N    4  
ATOM 8050  C CA   . GLN A 1 67  ? -16.451 8.700   13.727  1.00 0.00 ? 67  GLN A CA   4  
ATOM 8051  C C    . GLN A 1 67  ? -16.995 9.188   12.383  1.00 0.00 ? 67  GLN A C    4  
ATOM 8052  O O    . GLN A 1 67  ? -17.672 8.443   11.676  1.00 0.00 ? 67  GLN A O    4  
ATOM 8053  C CB   . GLN A 1 67  ? -17.144 9.412   14.891  1.00 0.00 ? 67  GLN A CB   4  
ATOM 8054  C CG   . GLN A 1 67  ? -18.659 9.210   14.833  1.00 0.00 ? 67  GLN A CG   4  
ATOM 8055  C CD   . GLN A 1 67  ? -19.149 8.402   16.036  1.00 0.00 ? 67  GLN A CD   4  
ATOM 8056  O OE1  . GLN A 1 67  ? -18.673 7.316   16.323  1.00 0.00 ? 67  GLN A OE1  4  
ATOM 8057  N NE2  . GLN A 1 67  ? -20.127 8.990   16.720  1.00 0.00 ? 67  GLN A NE2  4  
ATOM 8058  H H    . GLN A 1 67  ? -14.689 9.460   14.539  1.00 0.00 ? 67  GLN A H    4  
ATOM 8059  H HA   . GLN A 1 67  ? -16.608 7.626   13.822  1.00 0.00 ? 67  GLN A HA   4  
ATOM 8060  H HB2  . GLN A 1 67  ? -16.758 9.032   15.836  1.00 0.00 ? 67  GLN A HB2  4  
ATOM 8061  H HB3  . GLN A 1 67  ? -16.914 10.477  14.858  1.00 0.00 ? 67  GLN A HB3  4  
ATOM 8062  H HG2  . GLN A 1 67  ? -19.159 10.178  14.813  1.00 0.00 ? 67  GLN A HG2  4  
ATOM 8063  H HG3  . GLN A 1 67  ? -18.926 8.694   13.910  1.00 0.00 ? 67  GLN A HG3  4  
ATOM 8064  H HE21 . GLN A 1 67  ? -20.473 9.882   16.431  1.00 0.00 ? 67  GLN A HE21 4  
ATOM 8065  H HE22 . GLN A 1 67  ? -20.514 8.539   17.525  1.00 0.00 ? 67  GLN A HE22 4  
ATOM 8066  N N    . MET A 1 68  ? -16.679 10.436  12.071  1.00 0.00 ? 68  MET A N    4  
ATOM 8067  C CA   . MET A 1 68  ? -17.128 11.033  10.825  1.00 0.00 ? 68  MET A CA   4  
ATOM 8068  C C    . MET A 1 68  ? -16.605 10.245  9.621   1.00 0.00 ? 68  MET A C    4  
ATOM 8069  O O    . MET A 1 68  ? -17.308 10.092  8.623   1.00 0.00 ? 68  MET A O    4  
ATOM 8070  C CB   . MET A 1 68  ? -16.633 12.478  10.743  1.00 0.00 ? 68  MET A CB   4  
ATOM 8071  C CG   . MET A 1 68  ? -17.673 13.446  11.311  1.00 0.00 ? 68  MET A CG   4  
ATOM 8072  S SD   . MET A 1 68  ? -17.377 15.094  10.691  1.00 0.00 ? 68  MET A SD   4  
ATOM 8073  C CE   . MET A 1 68  ? -15.904 15.510  11.609  1.00 0.00 ? 68  MET A CE   4  
ATOM 8074  H H    . MET A 1 68  ? -16.128 11.035  12.651  1.00 0.00 ? 68  MET A H    4  
ATOM 8075  H HA   . MET A 1 68  ? -18.217 10.987  10.853  1.00 0.00 ? 68  MET A HA   4  
ATOM 8076  H HB2  . MET A 1 68  ? -15.699 12.579  11.294  1.00 0.00 ? 68  MET A HB2  4  
ATOM 8077  H HB3  . MET A 1 68  ? -16.420 12.736  9.705   1.00 0.00 ? 68  MET A HB3  4  
ATOM 8078  H HG2  . MET A 1 68  ? -18.675 13.120  11.034  1.00 0.00 ? 68  MET A HG2  4  
ATOM 8079  H HG3  . MET A 1 68  ? -17.627 13.445  12.400  1.00 0.00 ? 68  MET A HG3  4  
ATOM 8080  H HE1  . MET A 1 68  ? -15.883 14.943  12.539  1.00 0.00 ? 68  MET A HE1  4  
ATOM 8081  H HE2  . MET A 1 68  ? -15.024 15.267  11.014  1.00 0.00 ? 68  MET A HE2  4  
ATOM 8082  H HE3  . MET A 1 68  ? -15.906 16.577  11.834  1.00 0.00 ? 68  MET A HE3  4  
ATOM 8083  N N    . LEU A 1 69  ? -15.378 9.767   9.755   1.00 0.00 ? 69  LEU A N    4  
ATOM 8084  C CA   . LEU A 1 69  ? -14.752 8.999   8.690   1.00 0.00 ? 69  LEU A CA   4  
ATOM 8085  C C    . LEU A 1 69  ? -15.543 7.708   8.467   1.00 0.00 ? 69  LEU A C    4  
ATOM 8086  O O    . LEU A 1 69  ? -15.668 7.241   7.337   1.00 0.00 ? 69  LEU A O    4  
ATOM 8087  C CB   . LEU A 1 69  ? -13.271 8.769   8.995   1.00 0.00 ? 69  LEU A CB   4  
ATOM 8088  C CG   . LEU A 1 69  ? -12.429 8.211   7.845   1.00 0.00 ? 69  LEU A CG   4  
ATOM 8089  C CD1  . LEU A 1 69  ? -11.427 9.254   7.345   1.00 0.00 ? 69  LEU A CD1  4  
ATOM 8090  C CD2  . LEU A 1 69  ? -11.744 6.905   8.250   1.00 0.00 ? 69  LEU A CD2  4  
ATOM 8091  H H    . LEU A 1 69  ? -14.813 9.897   10.569  1.00 0.00 ? 69  LEU A H    4  
ATOM 8092  H HA   . LEU A 1 69  ? -14.806 9.599   7.781   1.00 0.00 ? 69  LEU A HA   4  
ATOM 8093  H HB2  . LEU A 1 69  ? -12.835 9.715   9.314   1.00 0.00 ? 69  LEU A HB2  4  
ATOM 8094  H HB3  . LEU A 1 69  ? -13.196 8.083   9.839   1.00 0.00 ? 69  LEU A HB3  4  
ATOM 8095  H HG   . LEU A 1 69  ? -13.096 7.982   7.014   1.00 0.00 ? 69  LEU A HG   4  
ATOM 8096  H HD11 . LEU A 1 69  ? -11.093 9.868   8.182   1.00 0.00 ? 69  LEU A HD11 4  
ATOM 8097  H HD12 . LEU A 1 69  ? -10.569 8.749   6.901   1.00 0.00 ? 69  LEU A HD12 4  
ATOM 8098  H HD13 . LEU A 1 69  ? -11.903 9.886   6.597   1.00 0.00 ? 69  LEU A HD13 4  
ATOM 8099  H HD21 . LEU A 1 69  ? -12.467 6.253   8.741   1.00 0.00 ? 69  LEU A HD21 4  
ATOM 8100  H HD22 . LEU A 1 69  ? -11.352 6.410   7.362   1.00 0.00 ? 69  LEU A HD22 4  
ATOM 8101  H HD23 . LEU A 1 69  ? -10.925 7.122   8.937   1.00 0.00 ? 69  LEU A HD23 4  
ATOM 8102  N N    . LYS A 1 70  ? -16.056 7.169   9.563   1.00 0.00 ? 70  LYS A N    4  
ATOM 8103  C CA   . LYS A 1 70  ? -16.831 5.942   9.501   1.00 0.00 ? 70  LYS A CA   4  
ATOM 8104  C C    . LYS A 1 70  ? -18.154 6.214   8.783   1.00 0.00 ? 70  LYS A C    4  
ATOM 8105  O O    . LYS A 1 70  ? -18.556 5.453   7.904   1.00 0.00 ? 70  LYS A O    4  
ATOM 8106  C CB   . LYS A 1 70  ? -17.002 5.345   10.900  1.00 0.00 ? 70  LYS A CB   4  
ATOM 8107  C CG   . LYS A 1 70  ? -17.518 3.907   10.823  1.00 0.00 ? 70  LYS A CG   4  
ATOM 8108  C CD   . LYS A 1 70  ? -19.030 3.853   11.049  1.00 0.00 ? 70  LYS A CD   4  
ATOM 8109  C CE   . LYS A 1 70  ? -19.478 2.441   11.431  1.00 0.00 ? 70  LYS A CE   4  
ATOM 8110  N NZ   . LYS A 1 70  ? -20.955 2.360   11.478  1.00 0.00 ? 70  LYS A NZ   4  
ATOM 8111  H H    . LYS A 1 70  ? -15.950 7.556   10.480  1.00 0.00 ? 70  LYS A H    4  
ATOM 8112  H HA   . LYS A 1 70  ? -16.259 5.225   8.913   1.00 0.00 ? 70  LYS A HA   4  
ATOM 8113  H HB2  . LYS A 1 70  ? -16.048 5.366   11.428  1.00 0.00 ? 70  LYS A HB2  4  
ATOM 8114  H HB3  . LYS A 1 70  ? -17.698 5.954   11.477  1.00 0.00 ? 70  LYS A HB3  4  
ATOM 8115  H HG2  . LYS A 1 70  ? -17.277 3.482   9.848   1.00 0.00 ? 70  LYS A HG2  4  
ATOM 8116  H HG3  . LYS A 1 70  ? -17.012 3.295   11.571  1.00 0.00 ? 70  LYS A HG3  4  
ATOM 8117  H HD2  . LYS A 1 70  ? -19.308 4.552   11.838  1.00 0.00 ? 70  LYS A HD2  4  
ATOM 8118  H HD3  . LYS A 1 70  ? -19.548 4.171   10.144  1.00 0.00 ? 70  LYS A HD3  4  
ATOM 8119  H HE2  . LYS A 1 70  ? -19.092 1.723   10.708  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 8120  H HE3  . LYS A 1 70  ? -19.062 2.172   12.402  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 8121  H HZ1  . LYS A 1 70  ? -21.345 2.985   10.802  1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 8122  H HZ2  . LYS A 1 70  ? -21.244 1.425   11.275  1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 8123  H HZ3  . LYS A 1 70  ? -21.274 2.616   12.391  1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 8124  N N    . GLU A 1 71  ? -18.794 7.303   9.184   1.00 0.00 ? 71  GLU A N    4  
ATOM 8125  C CA   . GLU A 1 71  ? -20.064 7.686   8.590   1.00 0.00 ? 71  GLU A CA   4  
ATOM 8126  C C    . GLU A 1 71  ? -19.907 7.873   7.079   1.00 0.00 ? 71  GLU A C    4  
ATOM 8127  O O    . GLU A 1 71  ? -20.705 7.354   6.299   1.00 0.00 ? 71  GLU A O    4  
ATOM 8128  C CB   . GLU A 1 71  ? -20.617 8.953   9.246   1.00 0.00 ? 71  GLU A CB   4  
ATOM 8129  C CG   . GLU A 1 71  ? -22.092 8.780   9.613   1.00 0.00 ? 71  GLU A CG   4  
ATOM 8130  C CD   . GLU A 1 71  ? -22.295 7.555   10.507  1.00 0.00 ? 71  GLU A CD   4  
ATOM 8131  O OE1  . GLU A 1 71  ? -21.875 7.634   11.682  1.00 0.00 ? 71  GLU A OE1  4  
ATOM 8132  O OE2  . GLU A 1 71  ? -22.866 6.568   9.996   1.00 0.00 ? 71  GLU A OE2  4  
ATOM 8133  H H    . GLU A 1 71  ? -18.462 7.917   9.900   1.00 0.00 ? 71  GLU A H    4  
ATOM 8134  H HA   . GLU A 1 71  ? -20.740 6.855   8.791   1.00 0.00 ? 71  GLU A HA   4  
ATOM 8135  H HB2  . GLU A 1 71  ? -20.041 9.184   10.141  1.00 0.00 ? 71  GLU A HB2  4  
ATOM 8136  H HB3  . GLU A 1 71  ? -20.504 9.797   8.566   1.00 0.00 ? 71  GLU A HB3  4  
ATOM 8137  H HG2  . GLU A 1 71  ? -22.449 9.672   10.127  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 8138  H HG3  . GLU A 1 71  ? -22.687 8.675   8.706   1.00 0.00 ? 71  GLU A HG3  4  
ATOM 8139  N N    . THR A 1 72  ? -18.875 8.618   6.712   1.00 0.00 ? 72  THR A N    4  
ATOM 8140  C CA   . THR A 1 72  ? -18.604 8.881   5.309   1.00 0.00 ? 72  THR A CA   4  
ATOM 8141  C C    . THR A 1 72  ? -18.354 7.571   4.559   1.00 0.00 ? 72  THR A C    4  
ATOM 8142  O O    . THR A 1 72  ? -19.082 7.237   3.626   1.00 0.00 ? 72  THR A O    4  
ATOM 8143  C CB   . THR A 1 72  ? -17.431 9.860   5.229   1.00 0.00 ? 72  THR A CB   4  
ATOM 8144  O OG1  . THR A 1 72  ? -18.048 11.123  4.992   1.00 0.00 ? 72  THR A OG1  4  
ATOM 8145  C CG2  . THR A 1 72  ? -16.560 9.632   3.991   1.00 0.00 ? 72  THR A CG2  4  
ATOM 8146  H H    . THR A 1 72  ? -18.232 9.037   7.352   1.00 0.00 ? 72  THR A H    4  
ATOM 8147  H HA   . THR A 1 72  ? -19.489 9.338   4.867   1.00 0.00 ? 72  THR A HA   4  
ATOM 8148  H HB   . THR A 1 72  ? -16.831 9.824   6.139   1.00 0.00 ? 72  THR A HB   4  
ATOM 8149  H HG1  . THR A 1 72  ? -18.705 11.325  5.719   1.00 0.00 ? 72  THR A HG1  4  
ATOM 8150  H HG21 . THR A 1 72  ? -17.170 9.215   3.191   1.00 0.00 ? 72  THR A HG21 4  
ATOM 8151  H HG22 . THR A 1 72  ? -16.135 10.581  3.667   1.00 0.00 ? 72  THR A HG22 4  
ATOM 8152  H HG23 . THR A 1 72  ? -15.757 8.938   4.236   1.00 0.00 ? 72  THR A HG23 4  
ATOM 8153  N N    . ILE A 1 73  ? -17.321 6.865   4.996   1.00 0.00 ? 73  ILE A N    4  
ATOM 8154  C CA   . ILE A 1 73  ? -16.966 5.599   4.377   1.00 0.00 ? 73  ILE A CA   4  
ATOM 8155  C C    . ILE A 1 73  ? -18.223 4.740   4.225   1.00 0.00 ? 73  ILE A C    4  
ATOM 8156  O O    . ILE A 1 73  ? -18.466 4.174   3.160   1.00 0.00 ? 73  ILE A O    4  
ATOM 8157  C CB   . ILE A 1 73  ? -15.845 4.915   5.163   1.00 0.00 ? 73  ILE A CB   4  
ATOM 8158  C CG1  . ILE A 1 73  ? -14.476 5.463   4.756   1.00 0.00 ? 73  ILE A CG1  4  
ATOM 8159  C CG2  . ILE A 1 73  ? -15.921 3.394   5.015   1.00 0.00 ? 73  ILE A CG2  4  
ATOM 8160  C CD1  . ILE A 1 73  ? -13.426 4.351   4.731   1.00 0.00 ? 73  ILE A CD1  4  
ATOM 8161  H H    . ILE A 1 73  ? -16.734 7.144   5.755   1.00 0.00 ? 73  ILE A H    4  
ATOM 8162  H HA   . ILE A 1 73  ? -16.574 5.819   3.384   1.00 0.00 ? 73  ILE A HA   4  
ATOM 8163  H HB   . ILE A 1 73  ? -15.981 5.142   6.220   1.00 0.00 ? 73  ILE A HB   4  
ATOM 8164  H HG12 . ILE A 1 73  ? -14.544 5.926   3.772   1.00 0.00 ? 73  ILE A HG12 4  
ATOM 8165  H HG13 . ILE A 1 73  ? -14.170 6.242   5.454   1.00 0.00 ? 73  ILE A HG13 4  
ATOM 8166  H HG21 . ILE A 1 73  ? -16.890 3.042   5.368   1.00 0.00 ? 73  ILE A HG21 4  
ATOM 8167  H HG22 . ILE A 1 73  ? -15.796 3.124   3.966   1.00 0.00 ? 73  ILE A HG22 4  
ATOM 8168  H HG23 . ILE A 1 73  ? -15.130 2.931   5.605   1.00 0.00 ? 73  ILE A HG23 4  
ATOM 8169  H HD11 . ILE A 1 73  ? -13.362 3.889   5.716   1.00 0.00 ? 73  ILE A HD11 4  
ATOM 8170  H HD12 . ILE A 1 73  ? -13.710 3.599   3.995   1.00 0.00 ? 73  ILE A HD12 4  
ATOM 8171  H HD13 . ILE A 1 73  ? -12.457 4.772   4.464   1.00 0.00 ? 73  ILE A HD13 4  
ATOM 8172  N N    . ASN A 1 74  ? -18.988 4.671   5.303   1.00 0.00 ? 74  ASN A N    4  
ATOM 8173  C CA   . ASN A 1 74  ? -20.214 3.890   5.303   1.00 0.00 ? 74  ASN A CA   4  
ATOM 8174  C C    . ASN A 1 74  ? -21.155 4.427   4.222   1.00 0.00 ? 74  ASN A C    4  
ATOM 8175  O O    . ASN A 1 74  ? -21.893 3.663   3.602   1.00 0.00 ? 74  ASN A O    4  
ATOM 8176  C CB   . ASN A 1 74  ? -20.934 3.994   6.650   1.00 0.00 ? 74  ASN A CB   4  
ATOM 8177  C CG   . ASN A 1 74  ? -22.022 2.926   6.773   1.00 0.00 ? 74  ASN A CG   4  
ATOM 8178  O OD1  . ASN A 1 74  ? -21.854 1.783   6.382   1.00 0.00 ? 74  ASN A OD1  4  
ATOM 8179  N ND2  . ASN A 1 74  ? -23.145 3.361   7.338   1.00 0.00 ? 74  ASN A ND2  4  
ATOM 8180  H H    . ASN A 1 74  ? -18.783 5.134   6.165   1.00 0.00 ? 74  ASN A H    4  
ATOM 8181  H HA   . ASN A 1 74  ? -19.900 2.864   5.111   1.00 0.00 ? 74  ASN A HA   4  
ATOM 8182  H HB2  . ASN A 1 74  ? -20.214 3.881   7.460   1.00 0.00 ? 74  ASN A HB2  4  
ATOM 8183  H HB3  . ASN A 1 74  ? -21.377 4.984   6.754   1.00 0.00 ? 74  ASN A HB3  4  
ATOM 8184  H HD21 . ASN A 1 74  ? -23.218 4.312   7.636   1.00 0.00 ? 74  ASN A HD21 4  
ATOM 8185  H HD22 . ASN A 1 74  ? -23.916 2.737   7.463   1.00 0.00 ? 74  ASN A HD22 4  
ATOM 8186  N N    . GLU A 1 75  ? -21.096 5.736   4.029   1.00 0.00 ? 75  GLU A N    4  
ATOM 8187  C CA   . GLU A 1 75  ? -21.933 6.385   3.034   1.00 0.00 ? 75  GLU A CA   4  
ATOM 8188  C C    . GLU A 1 75  ? -21.549 5.914   1.629   1.00 0.00 ? 75  GLU A C    4  
ATOM 8189  O O    . GLU A 1 75  ? -22.365 5.322   0.925   1.00 0.00 ? 75  GLU A O    4  
ATOM 8190  C CB   . GLU A 1 75  ? -21.840 7.908   3.146   1.00 0.00 ? 75  GLU A CB   4  
ATOM 8191  C CG   . GLU A 1 75  ? -23.203 8.559   2.903   1.00 0.00 ? 75  GLU A CG   4  
ATOM 8192  C CD   . GLU A 1 75  ? -23.175 10.044  3.276   1.00 0.00 ? 75  GLU A CD   4  
ATOM 8193  O OE1  . GLU A 1 75  ? -22.575 10.813  2.495   1.00 0.00 ? 75  GLU A OE1  4  
ATOM 8194  O OE2  . GLU A 1 75  ? -23.755 10.374  4.333   1.00 0.00 ? 75  GLU A OE2  4  
ATOM 8195  H H    . GLU A 1 75  ? -20.493 6.351   4.538   1.00 0.00 ? 75  GLU A H    4  
ATOM 8196  H HA   . GLU A 1 75  ? -22.952 6.071   3.263   1.00 0.00 ? 75  GLU A HA   4  
ATOM 8197  H HB2  . GLU A 1 75  ? -21.474 8.181   4.136   1.00 0.00 ? 75  GLU A HB2  4  
ATOM 8198  H HB3  . GLU A 1 75  ? -21.119 8.286   2.423   1.00 0.00 ? 75  GLU A HB3  4  
ATOM 8199  H HG2  . GLU A 1 75  ? -23.483 8.449   1.856   1.00 0.00 ? 75  GLU A HG2  4  
ATOM 8200  H HG3  . GLU A 1 75  ? -23.965 8.047   3.492   1.00 0.00 ? 75  GLU A HG3  4  
ATOM 8201  N N    . GLU A 1 76  ? -20.307 6.195   1.265   1.00 0.00 ? 76  GLU A N    4  
ATOM 8202  C CA   . GLU A 1 76  ? -19.805 5.808   -0.042  1.00 0.00 ? 76  GLU A CA   4  
ATOM 8203  C C    . GLU A 1 76  ? -20.181 4.356   -0.347  1.00 0.00 ? 76  GLU A C    4  
ATOM 8204  O O    . GLU A 1 76  ? -20.613 4.043   -1.455  1.00 0.00 ? 76  GLU A O    4  
ATOM 8205  C CB   . GLU A 1 76  ? -18.291 6.012   -0.131  1.00 0.00 ? 76  GLU A CB   4  
ATOM 8206  C CG   . GLU A 1 76  ? -17.895 6.604   -1.484  1.00 0.00 ? 76  GLU A CG   4  
ATOM 8207  C CD   . GLU A 1 76  ? -18.640 7.913   -1.749  1.00 0.00 ? 76  GLU A CD   4  
ATOM 8208  O OE1  . GLU A 1 76  ? -18.870 8.645   -0.763  1.00 0.00 ? 76  GLU A OE1  4  
ATOM 8209  O OE2  . GLU A 1 76  ? -18.963 8.154   -2.932  1.00 0.00 ? 76  GLU A OE2  4  
ATOM 8210  H H    . GLU A 1 76  ? -19.649 6.677   1.845   1.00 0.00 ? 76  GLU A H    4  
ATOM 8211  H HA   . GLU A 1 76  ? -20.296 6.475   -0.750  1.00 0.00 ? 76  GLU A HA   4  
ATOM 8212  H HB2  . GLU A 1 76  ? -17.963 6.675   0.671   1.00 0.00 ? 76  GLU A HB2  4  
ATOM 8213  H HB3  . GLU A 1 76  ? -17.782 5.059   0.017   1.00 0.00 ? 76  GLU A HB3  4  
ATOM 8214  H HG2  . GLU A 1 76  ? -16.820 6.780   -1.508  1.00 0.00 ? 76  GLU A HG2  4  
ATOM 8215  H HG3  . GLU A 1 76  ? -18.118 5.888   -2.276  1.00 0.00 ? 76  GLU A HG3  4  
ATOM 8216  N N    . ALA A 1 77  ? -20.003 3.509   0.657   1.00 0.00 ? 77  ALA A N    4  
ATOM 8217  C CA   . ALA A 1 77  ? -20.319 2.098   0.510   1.00 0.00 ? 77  ALA A CA   4  
ATOM 8218  C C    . ALA A 1 77  ? -21.803 1.945   0.173   1.00 0.00 ? 77  ALA A C    4  
ATOM 8219  O O    . ALA A 1 77  ? -22.161 1.221   -0.755  1.00 0.00 ? 77  ALA A O    4  
ATOM 8220  C CB   . ALA A 1 77  ? -19.931 1.352   1.788   1.00 0.00 ? 77  ALA A CB   4  
ATOM 8221  H H    . ALA A 1 77  ? -19.652 3.773   1.555   1.00 0.00 ? 77  ALA A H    4  
ATOM 8222  H HA   . ALA A 1 77  ? -19.725 1.710   -0.318  1.00 0.00 ? 77  ALA A HA   4  
ATOM 8223  H HB1  . ALA A 1 77  ? -19.185 1.931   2.334   1.00 0.00 ? 77  ALA A HB1  4  
ATOM 8224  H HB2  . ALA A 1 77  ? -20.814 1.218   2.413   1.00 0.00 ? 77  ALA A HB2  4  
ATOM 8225  H HB3  . ALA A 1 77  ? -19.517 0.378   1.529   1.00 0.00 ? 77  ALA A HB3  4  
ATOM 8226  N N    . ALA A 1 78  ? -22.627 2.638   0.944   1.00 0.00 ? 78  ALA A N    4  
ATOM 8227  C CA   . ALA A 1 78  ? -24.066 2.588   0.740   1.00 0.00 ? 78  ALA A CA   4  
ATOM 8228  C C    . ALA A 1 78  ? -24.378 2.896   -0.726  1.00 0.00 ? 78  ALA A C    4  
ATOM 8229  O O    . ALA A 1 78  ? -25.133 2.169   -1.370  1.00 0.00 ? 78  ALA A O    4  
ATOM 8230  C CB   . ALA A 1 78  ? -24.753 3.560   1.701   1.00 0.00 ? 78  ALA A CB   4  
ATOM 8231  H H    . ALA A 1 78  ? -22.328 3.225   1.698   1.00 0.00 ? 78  ALA A H    4  
ATOM 8232  H HA   . ALA A 1 78  ? -24.398 1.575   0.969   1.00 0.00 ? 78  ALA A HA   4  
ATOM 8233  H HB1  . ALA A 1 78  ? -24.058 4.355   1.972   1.00 0.00 ? 78  ALA A HB1  4  
ATOM 8234  H HB2  . ALA A 1 78  ? -25.627 3.993   1.214   1.00 0.00 ? 78  ALA A HB2  4  
ATOM 8235  H HB3  . ALA A 1 78  ? -25.063 3.026   2.598   1.00 0.00 ? 78  ALA A HB3  4  
ATOM 8236  N N    . GLU A 1 79  ? -23.783 3.976   -1.210  1.00 0.00 ? 79  GLU A N    4  
ATOM 8237  C CA   . GLU A 1 79  ? -23.989 4.390   -2.588  1.00 0.00 ? 79  GLU A CA   4  
ATOM 8238  C C    . GLU A 1 79  ? -23.538 3.286   -3.546  1.00 0.00 ? 79  GLU A C    4  
ATOM 8239  O O    . GLU A 1 79  ? -24.168 3.058   -4.577  1.00 0.00 ? 79  GLU A O    4  
ATOM 8240  C CB   . GLU A 1 79  ? -23.259 5.702   -2.881  1.00 0.00 ? 79  GLU A CB   4  
ATOM 8241  C CG   . GLU A 1 79  ? -24.245 6.796   -3.299  1.00 0.00 ? 79  GLU A CG   4  
ATOM 8242  C CD   . GLU A 1 79  ? -23.515 7.968   -3.960  1.00 0.00 ? 79  GLU A CD   4  
ATOM 8243  O OE1  . GLU A 1 79  ? -22.896 7.726   -5.018  1.00 0.00 ? 79  GLU A OE1  4  
ATOM 8244  O OE2  . GLU A 1 79  ? -23.594 9.078   -3.391  1.00 0.00 ? 79  GLU A OE2  4  
ATOM 8245  H H    . GLU A 1 79  ? -23.171 4.563   -0.679  1.00 0.00 ? 79  GLU A H    4  
ATOM 8246  H HA   . GLU A 1 79  ? -25.063 4.549   -2.685  1.00 0.00 ? 79  GLU A HA   4  
ATOM 8247  H HB2  . GLU A 1 79  ? -22.710 6.023   -1.995  1.00 0.00 ? 79  GLU A HB2  4  
ATOM 8248  H HB3  . GLU A 1 79  ? -22.526 5.547   -3.672  1.00 0.00 ? 79  GLU A HB3  4  
ATOM 8249  H HG2  . GLU A 1 79  ? -24.979 6.383   -3.991  1.00 0.00 ? 79  GLU A HG2  4  
ATOM 8250  H HG3  . GLU A 1 79  ? -24.793 7.150   -2.426  1.00 0.00 ? 79  GLU A HG3  4  
ATOM 8251  N N    . TRP A 1 80  ? -22.449 2.630   -3.173  1.00 0.00 ? 80  TRP A N    4  
ATOM 8252  C CA   . TRP A 1 80  ? -21.905 1.556   -3.987  1.00 0.00 ? 80  TRP A CA   4  
ATOM 8253  C C    . TRP A 1 80  ? -22.995 0.496   -4.158  1.00 0.00 ? 80  TRP A C    4  
ATOM 8254  O O    . TRP A 1 80  ? -23.260 0.048   -5.272  1.00 0.00 ? 80  TRP A O    4  
ATOM 8255  C CB   . TRP A 1 80  ? -20.621 0.999   -3.371  1.00 0.00 ? 80  TRP A CB   4  
ATOM 8256  C CG   . TRP A 1 80  ? -19.515 0.714   -4.391  1.00 0.00 ? 80  TRP A CG   4  
ATOM 8257  C CD1  . TRP A 1 80  ? -19.049 -0.476  -4.791  1.00 0.00 ? 80  TRP A CD1  4  
ATOM 8258  C CD2  . TRP A 1 80  ? -18.753 1.693   -5.127  1.00 0.00 ? 80  TRP A CD2  4  
ATOM 8259  N NE1  . TRP A 1 80  ? -18.045 -0.337  -5.728  1.00 0.00 ? 80  TRP A NE1  4  
ATOM 8260  C CE2  . TRP A 1 80  ? -17.860 1.024   -5.939  1.00 0.00 ? 80  TRP A CE2  4  
ATOM 8261  C CE3  . TRP A 1 80  ? -18.816 3.097   -5.109  1.00 0.00 ? 80  TRP A CE3  4  
ATOM 8262  C CZ2  . TRP A 1 80  ? -16.962 1.676   -6.792  1.00 0.00 ? 80  TRP A CZ2  4  
ATOM 8263  C CZ3  . TRP A 1 80  ? -17.912 3.735   -5.967  1.00 0.00 ? 80  TRP A CZ3  4  
ATOM 8264  C CH2  . TRP A 1 80  ? -17.007 3.076   -6.791  1.00 0.00 ? 80  TRP A CH2  4  
ATOM 8265  H H    . TRP A 1 80  ? -21.941 2.821   -2.332  1.00 0.00 ? 80  TRP A H    4  
ATOM 8266  H HA   . TRP A 1 80  ? -21.638 1.976   -4.956  1.00 0.00 ? 80  TRP A HA   4  
ATOM 8267  H HB2  . TRP A 1 80  ? -20.246 1.707   -2.633  1.00 0.00 ? 80  TRP A HB2  4  
ATOM 8268  H HB3  . TRP A 1 80  ? -20.854 0.077   -2.838  1.00 0.00 ? 80  TRP A HB3  4  
ATOM 8269  H HD1  . TRP A 1 80  ? -19.415 -1.435  -4.423  1.00 0.00 ? 80  TRP A HD1  4  
ATOM 8270  H HE1  . TRP A 1 80  ? -17.498 -1.146  -6.213  1.00 0.00 ? 80  TRP A HE1  4  
ATOM 8271  H HE3  . TRP A 1 80  ? -19.512 3.649   -4.477  1.00 0.00 ? 80  TRP A HE3  4  
ATOM 8272  H HZ2  . TRP A 1 80  ? -16.266 1.125   -7.425  1.00 0.00 ? 80  TRP A HZ2  4  
ATOM 8273  H HZ3  . TRP A 1 80  ? -17.919 4.824   -5.992  1.00 0.00 ? 80  TRP A HZ3  4  
ATOM 8274  H HH2  . TRP A 1 80  ? -16.334 3.646   -7.432  1.00 0.00 ? 80  TRP A HH2  4  
ATOM 8275  N N    . ASP A 1 81  ? -23.597 0.125   -3.038  1.00 0.00 ? 81  ASP A N    4  
ATOM 8276  C CA   . ASP A 1 81  ? -24.652 -0.874  -3.050  1.00 0.00 ? 81  ASP A CA   4  
ATOM 8277  C C    . ASP A 1 81  ? -25.811 -0.375  -3.914  1.00 0.00 ? 81  ASP A C    4  
ATOM 8278  O O    . ASP A 1 81  ? -26.441 -1.156  -4.625  1.00 0.00 ? 81  ASP A O    4  
ATOM 8279  C CB   . ASP A 1 81  ? -25.188 -1.127  -1.639  1.00 0.00 ? 81  ASP A CB   4  
ATOM 8280  C CG   . ASP A 1 81  ? -25.967 -2.433  -1.468  1.00 0.00 ? 81  ASP A CG   4  
ATOM 8281  O OD1  . ASP A 1 81  ? -25.696 -3.362  -2.258  1.00 0.00 ? 81  ASP A OD1  4  
ATOM 8282  O OD2  . ASP A 1 81  ? -26.815 -2.472  -0.550  1.00 0.00 ? 81  ASP A OD2  4  
ATOM 8283  H H    . ASP A 1 81  ? -23.375 0.494   -2.135  1.00 0.00 ? 81  ASP A H    4  
ATOM 8284  H HA   . ASP A 1 81  ? -24.189 -1.774  -3.453  1.00 0.00 ? 81  ASP A HA   4  
ATOM 8285  H HB2  . ASP A 1 81  ? -24.349 -1.127  -0.943  1.00 0.00 ? 81  ASP A HB2  4  
ATOM 8286  H HB3  . ASP A 1 81  ? -25.834 -0.296  -1.359  1.00 0.00 ? 81  ASP A HB3  4  
ATOM 8287  N N    . ARG A 1 82  ? -26.058 0.924   -3.823  1.00 0.00 ? 82  ARG A N    4  
ATOM 8288  C CA   . ARG A 1 82  ? -27.130 1.537   -4.589  1.00 0.00 ? 82  ARG A CA   4  
ATOM 8289  C C    . ARG A 1 82  ? -26.826 1.461   -6.085  1.00 0.00 ? 82  ARG A C    4  
ATOM 8290  O O    . ARG A 1 82  ? -27.721 1.217   -6.893  1.00 0.00 ? 82  ARG A O    4  
ATOM 8291  C CB   . ARG A 1 82  ? -27.325 3.001   -4.188  1.00 0.00 ? 82  ARG A CB   4  
ATOM 8292  C CG   . ARG A 1 82  ? -28.809 3.323   -3.993  1.00 0.00 ? 82  ARG A CG   4  
ATOM 8293  C CD   . ARG A 1 82  ? -29.068 3.883   -2.594  1.00 0.00 ? 82  ARG A CD   4  
ATOM 8294  N NE   . ARG A 1 82  ? -30.284 3.263   -2.019  1.00 0.00 ? 82  ARG A NE   4  
ATOM 8295  C CZ   . ARG A 1 82  ? -30.874 3.674   -0.888  1.00 0.00 ? 82  ARG A CZ   4  
ATOM 8296  N NH1  . ARG A 1 82  ? -30.364 4.706   -0.203  1.00 0.00 ? 82  ARG A NH1  4  
ATOM 8297  N NH2  . ARG A 1 82  ? -31.973 3.052   -0.441  1.00 0.00 ? 82  ARG A NH2  4  
ATOM 8298  H H    . ARG A 1 82  ? -25.540 1.553   -3.243  1.00 0.00 ? 82  ARG A H    4  
ATOM 8299  H HA   . ARG A 1 82  ? -28.019 0.956   -4.338  1.00 0.00 ? 82  ARG A HA   4  
ATOM 8300  H HB2  . ARG A 1 82  ? -26.781 3.204   -3.266  1.00 0.00 ? 82  ARG A HB2  4  
ATOM 8301  H HB3  . ARG A 1 82  ? -26.906 3.650   -4.956  1.00 0.00 ? 82  ARG A HB3  4  
ATOM 8302  H HG2  . ARG A 1 82  ? -29.128 4.047   -4.744  1.00 0.00 ? 82  ARG A HG2  4  
ATOM 8303  H HG3  . ARG A 1 82  ? -29.403 2.423   -4.145  1.00 0.00 ? 82  ARG A HG3  4  
ATOM 8304  H HD2  . ARG A 1 82  ? -28.211 3.687   -1.949  1.00 0.00 ? 82  ARG A HD2  4  
ATOM 8305  H HD3  . ARG A 1 82  ? -29.190 4.965   -2.642  1.00 0.00 ? 82  ARG A HD3  4  
ATOM 8306  H HE   . ARG A 1 82  ? -30.689 2.489   -2.505  1.00 0.00 ? 82  ARG A HE   4  
ATOM 8307  H HH11 . ARG A 1 82  ? -29.543 5.171   -0.537  1.00 0.00 ? 82  ARG A HH11 4  
ATOM 8308  H HH12 . ARG A 1 82  ? -30.804 5.013   0.640   1.00 0.00 ? 82  ARG A HH12 4  
ATOM 8309  H HH21 . ARG A 1 82  ? -32.353 2.280   -0.952  1.00 0.00 ? 82  ARG A HH21 4  
ATOM 8310  H HH22 . ARG A 1 82  ? -32.413 3.358   0.402   1.00 0.00 ? 82  ARG A HH22 4  
ATOM 8311  N N    . LEU A 1 83  ? -25.559 1.673   -6.410  1.00 0.00 ? 83  LEU A N    4  
ATOM 8312  C CA   . LEU A 1 83  ? -25.126 1.632   -7.797  1.00 0.00 ? 83  LEU A CA   4  
ATOM 8313  C C    . LEU A 1 83  ? -24.908 0.177   -8.215  1.00 0.00 ? 83  LEU A C    4  
ATOM 8314  O O    . LEU A 1 83  ? -25.647 -0.350  -9.047  1.00 0.00 ? 83  LEU A O    4  
ATOM 8315  C CB   . LEU A 1 83  ? -23.895 2.519   -8.000  1.00 0.00 ? 83  LEU A CB   4  
ATOM 8316  C CG   . LEU A 1 83  ? -24.101 4.017   -7.755  1.00 0.00 ? 83  LEU A CG   4  
ATOM 8317  C CD1  . LEU A 1 83  ? -22.957 4.597   -6.920  1.00 0.00 ? 83  LEU A CD1  4  
ATOM 8318  C CD2  . LEU A 1 83  ? -24.286 4.767   -9.076  1.00 0.00 ? 83  LEU A CD2  4  
ATOM 8319  H H    . LEU A 1 83  ? -24.838 1.871   -5.747  1.00 0.00 ? 83  LEU A H    4  
ATOM 8320  H HA   . LEU A 1 83  ? -25.928 2.051   -8.403  1.00 0.00 ? 83  LEU A HA   4  
ATOM 8321  H HB2  . LEU A 1 83  ? -23.105 2.169   -7.337  1.00 0.00 ? 83  LEU A HB2  4  
ATOM 8322  H HB3  . LEU A 1 83  ? -23.539 2.384   -9.021  1.00 0.00 ? 83  LEU A HB3  4  
ATOM 8323  H HG   . LEU A 1 83  ? -25.018 4.145   -7.180  1.00 0.00 ? 83  LEU A HG   4  
ATOM 8324  H HD11 . LEU A 1 83  ? -22.059 3.997   -7.068  1.00 0.00 ? 83  LEU A HD11 4  
ATOM 8325  H HD12 . LEU A 1 83  ? -22.764 5.623   -7.233  1.00 0.00 ? 83  LEU A HD12 4  
ATOM 8326  H HD13 . LEU A 1 83  ? -23.235 4.584   -5.866  1.00 0.00 ? 83  LEU A HD13 4  
ATOM 8327  H HD21 . LEU A 1 83  ? -24.392 4.051   -9.889  1.00 0.00 ? 83  LEU A HD21 4  
ATOM 8328  H HD22 . LEU A 1 83  ? -25.180 5.388   -9.018  1.00 0.00 ? 83  LEU A HD22 4  
ATOM 8329  H HD23 . LEU A 1 83  ? -23.416 5.399   -9.259  1.00 0.00 ? 83  LEU A HD23 4  
ATOM 8330  N N    . HIS A 1 84  ? -23.894 -0.432  -7.620  1.00 0.00 ? 84  HIS A N    4  
ATOM 8331  C CA   . HIS A 1 84  ? -23.572 -1.817  -7.922  1.00 0.00 ? 84  HIS A CA   4  
ATOM 8332  C C    . HIS A 1 84  ? -24.663 -2.731  -7.362  1.00 0.00 ? 84  HIS A C    4  
ATOM 8333  O O    . HIS A 1 84  ? -25.322 -2.390  -6.381  1.00 0.00 ? 84  HIS A O    4  
ATOM 8334  C CB   . HIS A 1 84  ? -22.176 -2.174  -7.405  1.00 0.00 ? 84  HIS A CB   4  
ATOM 8335  C CG   . HIS A 1 84  ? -21.064 -1.368  -8.032  1.00 0.00 ? 84  HIS A CG   4  
ATOM 8336  N ND1  . HIS A 1 84  ? -20.157 -1.909  -8.926  1.00 0.00 ? 84  HIS A ND1  4  
ATOM 8337  C CD2  . HIS A 1 84  ? -20.724 -0.055  -7.885  1.00 0.00 ? 84  HIS A CD2  4  
ATOM 8338  C CE1  . HIS A 1 84  ? -19.312 -0.957  -9.293  1.00 0.00 ? 84  HIS A CE1  4  
ATOM 8339  N NE2  . HIS A 1 84  ? -19.664 0.191   -8.647  1.00 0.00 ? 84  HIS A NE2  4  
ATOM 8340  H H    . HIS A 1 84  ? -23.299 0.003   -6.945  1.00 0.00 ? 84  HIS A H    4  
ATOM 8341  H HA   . HIS A 1 84  ? -23.556 -1.905  -9.007  1.00 0.00 ? 84  HIS A HA   4  
ATOM 8342  H HB2  . HIS A 1 84  ? -22.151 -2.030  -6.325  1.00 0.00 ? 84  HIS A HB2  4  
ATOM 8343  H HB3  . HIS A 1 84  ? -21.992 -3.232  -7.589  1.00 0.00 ? 84  HIS A HB3  4  
ATOM 8344  H HD1  . HIS A 1 84  ? -20.141 -2.858  -9.240  1.00 0.00 ? 84  HIS A HD1  4  
ATOM 8345  H HD2  . HIS A 1 84  ? -21.234 0.669   -7.250  1.00 0.00 ? 84  HIS A HD2  4  
ATOM 8346  H HE1  . HIS A 1 84  ? -18.482 -1.072  -9.990  1.00 0.00 ? 84  HIS A HE1  4  
ATOM 8347  H HE2  . HIS A 1 84  ? -19.237 1.086   -8.777  1.00 0.00 ? 84  HIS A HE2  4  
ATOM 8348  N N    . PRO A 1 85  ? -24.824 -3.907  -8.027  1.00 0.00 ? 85  PRO A N    4  
ATOM 8349  C CA   . PRO A 1 85  ? -25.824 -4.874  -7.606  1.00 0.00 ? 85  PRO A CA   4  
ATOM 8350  C C    . PRO A 1 85  ? -25.378 -5.610  -6.342  1.00 0.00 ? 85  PRO A C    4  
ATOM 8351  O O    . PRO A 1 85  ? -24.451 -5.175  -5.661  1.00 0.00 ? 85  PRO A O    4  
ATOM 8352  C CB   . PRO A 1 85  ? -26.004 -5.797  -8.800  1.00 0.00 ? 85  PRO A CB   4  
ATOM 8353  C CG   . PRO A 1 85  ? -24.773 -5.600  -9.669  1.00 0.00 ? 85  PRO A CG   4  
ATOM 8354  C CD   . PRO A 1 85  ? -24.062 -4.345  -9.193  1.00 0.00 ? 85  PRO A CD   4  
ATOM 8355  H HA   . PRO A 1 85  ? -26.677 -4.409  -7.365  1.00 0.00 ? 85  PRO A HA   4  
ATOM 8356  H HB2  . PRO A 1 85  ? -26.096 -6.835  -8.481  1.00 0.00 ? 85  PRO A HB2  4  
ATOM 8357  H HB3  . PRO A 1 85  ? -26.914 -5.553  -9.350  1.00 0.00 ? 85  PRO A HB3  4  
ATOM 8358  H HG2  . PRO A 1 85  ? -24.113 -6.465  -9.596  1.00 0.00 ? 85  PRO A HG2  4  
ATOM 8359  H HG3  . PRO A 1 85  ? -25.057 -5.504  -10.717 1.00 0.00 ? 85  PRO A HG3  4  
ATOM 8360  H HD2  . PRO A 1 85  ? -23.024 -4.553  -8.931  1.00 0.00 ? 85  PRO A HD2  4  
ATOM 8361  H HD3  . PRO A 1 85  ? -24.048 -3.579  -9.967  1.00 0.00 ? 85  PRO A HD3  4  
ATOM 8362  N N    . VAL A 1 86  ? -26.057 -6.714  -6.068  1.00 0.00 ? 86  VAL A N    4  
ATOM 8363  C CA   . VAL A 1 86  ? -25.742 -7.515  -4.897  1.00 0.00 ? 86  VAL A CA   4  
ATOM 8364  C C    . VAL A 1 86  ? -25.963 -6.677  -3.637  1.00 0.00 ? 86  VAL A C    4  
ATOM 8365  O O    . VAL A 1 86  ? -25.266 -5.689  -3.413  1.00 0.00 ? 86  VAL A O    4  
ATOM 8366  C CB   . VAL A 1 86  ? -24.319 -8.065  -5.008  1.00 0.00 ? 86  VAL A CB   4  
ATOM 8367  C CG1  . VAL A 1 86  ? -23.780 -7.911  -6.431  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 8368  C CG2  . VAL A 1 86  ? -23.390 -7.390  -3.995  1.00 0.00 ? 86  VAL A CG2  4  
ATOM 8369  H H    . VAL A 1 86  ? -26.809 -7.061  -6.628  1.00 0.00 ? 86  VAL A H    4  
ATOM 8370  H HA   . VAL A 1 86  ? -26.430 -8.360  -4.882  1.00 0.00 ? 86  VAL A HA   4  
ATOM 8371  H HB   . VAL A 1 86  ? -24.351 -9.129  -4.775  1.00 0.00 ? 86  VAL A HB   4  
ATOM 8372  H HG11 . VAL A 1 86  ? -24.587 -8.080  -7.145  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 8373  H HG12 . VAL A 1 86  ? -23.383 -6.905  -6.563  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 8374  H HG13 . VAL A 1 86  ? -22.987 -8.640  -6.601  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 8375  H HG21 . VAL A 1 86  ? -23.808 -7.495  -2.994  1.00 0.00 ? 86  VAL A HG21 4  
ATOM 8376  H HG22 . VAL A 1 86  ? -22.409 -7.864  -4.031  1.00 0.00 ? 86  VAL A HG22 4  
ATOM 8377  H HG23 . VAL A 1 86  ? -23.292 -6.333  -4.239  1.00 0.00 ? 86  VAL A HG23 4  
ATOM 8378  N N    . HIS A 1 87  ? -26.936 -7.104  -2.845  1.00 0.00 ? 87  HIS A N    4  
ATOM 8379  C CA   . HIS A 1 87  ? -27.258 -6.406  -1.612  1.00 0.00 ? 87  HIS A CA   4  
ATOM 8380  C C    . HIS A 1 87  ? -27.793 -7.403  -0.582  1.00 0.00 ? 87  HIS A C    4  
ATOM 8381  O O    . HIS A 1 87  ? -28.173 -8.519  -0.932  1.00 0.00 ? 87  HIS A O    4  
ATOM 8382  C CB   . HIS A 1 87  ? -28.227 -5.251  -1.878  1.00 0.00 ? 87  HIS A CB   4  
ATOM 8383  C CG   . HIS A 1 87  ? -29.235 -5.030  -0.777  1.00 0.00 ? 87  HIS A CG   4  
ATOM 8384  N ND1  . HIS A 1 87  ? -30.441 -5.708  -0.716  1.00 0.00 ? 87  HIS A ND1  4  
ATOM 8385  C CD2  . HIS A 1 87  ? -29.205 -4.200  0.306   1.00 0.00 ? 87  HIS A CD2  4  
ATOM 8386  C CE1  . HIS A 1 87  ? -31.099 -5.297  0.357   1.00 0.00 ? 87  HIS A CE1  4  
ATOM 8387  N NE2  . HIS A 1 87  ? -30.332 -4.362  0.990   1.00 0.00 ? 87  HIS A NE2  4  
ATOM 8388  H H    . HIS A 1 87  ? -27.498 -7.909  -3.033  1.00 0.00 ? 87  HIS A H    4  
ATOM 8389  H HA   . HIS A 1 87  ? -26.326 -5.978  -1.242  1.00 0.00 ? 87  HIS A HA   4  
ATOM 8390  H HB2  . HIS A 1 87  ? -27.654 -4.335  -2.021  1.00 0.00 ? 87  HIS A HB2  4  
ATOM 8391  H HB3  . HIS A 1 87  ? -28.758 -5.445  -2.810  1.00 0.00 ? 87  HIS A HB3  4  
ATOM 8392  H HD1  . HIS A 1 87  ? -30.761 -6.392  -1.372  1.00 0.00 ? 87  HIS A HD1  4  
ATOM 8393  H HD2  . HIS A 1 87  ? -28.395 -3.521  0.566   1.00 0.00 ? 87  HIS A HD2  4  
ATOM 8394  H HE1  . HIS A 1 87  ? -32.081 -5.644  0.679   1.00 0.00 ? 87  HIS A HE1  4  
ATOM 8395  H HE2  . HIS A 1 87  ? -30.553 -3.921  1.858   1.00 0.00 ? 87  HIS A HE2  4  
ATOM 8396  N N    . ALA A 1 88  ? -27.805 -6.964  0.668   1.00 0.00 ? 88  ALA A N    4  
ATOM 8397  C CA   . ALA A 1 88  ? -28.286 -7.804  1.752   1.00 0.00 ? 88  ALA A CA   4  
ATOM 8398  C C    . ALA A 1 88  ? -27.681 -9.202  1.615   1.00 0.00 ? 88  ALA A C    4  
ATOM 8399  O O    . ALA A 1 88  ? -28.225 -10.052 0.911   1.00 0.00 ? 88  ALA A O    4  
ATOM 8400  C CB   . ALA A 1 88  ? -29.816 -7.827  1.739   1.00 0.00 ? 88  ALA A CB   4  
ATOM 8401  H H    . ALA A 1 88  ? -27.494 -6.055  0.945   1.00 0.00 ? 88  ALA A H    4  
ATOM 8402  H HA   . ALA A 1 88  ? -27.950 -7.362  2.690   1.00 0.00 ? 88  ALA A HA   4  
ATOM 8403  H HB1  . ALA A 1 88  ? -30.178 -7.430  0.790   1.00 0.00 ? 88  ALA A HB1  4  
ATOM 8404  H HB2  . ALA A 1 88  ? -30.165 -8.853  1.861   1.00 0.00 ? 88  ALA A HB2  4  
ATOM 8405  H HB3  . ALA A 1 88  ? -30.196 -7.214  2.557   1.00 0.00 ? 88  ALA A HB3  4  
ATOM 8406  N N    . GLY A 1 89  ? -26.563 -9.398  2.299   1.00 0.00 ? 89  GLY A N    4  
ATOM 8407  C CA   . GLY A 1 89  ? -25.879 -10.679 2.262   1.00 0.00 ? 89  GLY A CA   4  
ATOM 8408  C C    . GLY A 1 89  ? -24.408 -10.504 1.875   1.00 0.00 ? 89  GLY A C    4  
ATOM 8409  O O    . GLY A 1 89  ? -24.102 -10.110 0.750   1.00 0.00 ? 89  GLY A O    4  
ATOM 8410  H H    . GLY A 1 89  ? -26.127 -8.701  2.869   1.00 0.00 ? 89  GLY A H    4  
ATOM 8411  H HA2  . GLY A 1 89  ? -25.946 -11.159 3.238   1.00 0.00 ? 89  GLY A HA2  4  
ATOM 8412  H HA3  . GLY A 1 89  ? -26.370 -11.338 1.548   1.00 0.00 ? 89  GLY A HA3  4  
ATOM 8413  N N    . PRO A 1 90  ? -23.515 -10.812 2.853   1.00 0.00 ? 90  PRO A N    4  
ATOM 8414  C CA   . PRO A 1 90  ? -22.085 -10.693 2.626   1.00 0.00 ? 90  PRO A CA   4  
ATOM 8415  C C    . PRO A 1 90  ? -21.573 -11.837 1.749   1.00 0.00 ? 90  PRO A C    4  
ATOM 8416  O O    . PRO A 1 90  ? -20.643 -12.547 2.129   1.00 0.00 ? 90  PRO A O    4  
ATOM 8417  C CB   . PRO A 1 90  ? -21.465 -10.685 4.013   1.00 0.00 ? 90  PRO A CB   4  
ATOM 8418  C CG   . PRO A 1 90  ? -22.519 -11.265 4.944   1.00 0.00 ? 90  PRO A CG   4  
ATOM 8419  C CD   . PRO A 1 90  ? -23.842 -11.281 4.197   1.00 0.00 ? 90  PRO A CD   4  
ATOM 8420  H HA   . PRO A 1 90  ? -21.883 -9.852  2.124   1.00 0.00 ? 90  PRO A HA   4  
ATOM 8421  H HB2  . PRO A 1 90  ? -20.553 -11.281 4.037   1.00 0.00 ? 90  PRO A HB2  4  
ATOM 8422  H HB3  . PRO A 1 90  ? -21.194 -9.674  4.314   1.00 0.00 ? 90  PRO A HB3  4  
ATOM 8423  H HG2  . PRO A 1 90  ? -22.242 -12.273 5.253   1.00 0.00 ? 90  PRO A HG2  4  
ATOM 8424  H HG3  . PRO A 1 90  ? -22.599 -10.665 5.850   1.00 0.00 ? 90  PRO A HG3  4  
ATOM 8425  H HD2  . PRO A 1 90  ? -24.271 -12.283 4.173   1.00 0.00 ? 90  PRO A HD2  4  
ATOM 8426  H HD3  . PRO A 1 90  ? -24.575 -10.632 4.675   1.00 0.00 ? 90  PRO A HD3  4  
ATOM 8427  N N    . ILE A 1 91  ? -22.201 -11.980 0.591   1.00 0.00 ? 91  ILE A N    4  
ATOM 8428  C CA   . ILE A 1 91  ? -21.820 -13.026 -0.343  1.00 0.00 ? 91  ILE A CA   4  
ATOM 8429  C C    . ILE A 1 91  ? -21.700 -14.354 0.406   1.00 0.00 ? 91  ILE A C    4  
ATOM 8430  O O    . ILE A 1 91  ? -22.004 -14.430 1.595   1.00 0.00 ? 91  ILE A O    4  
ATOM 8431  C CB   . ILE A 1 91  ? -20.551 -12.631 -1.101  1.00 0.00 ? 91  ILE A CB   4  
ATOM 8432  C CG1  . ILE A 1 91  ? -20.706 -12.887 -2.602  1.00 0.00 ? 91  ILE A CG1  4  
ATOM 8433  C CG2  . ILE A 1 91  ? -19.324 -13.337 -0.523  1.00 0.00 ? 91  ILE A CG2  4  
ATOM 8434  C CD1  . ILE A 1 91  ? -20.770 -11.571 -3.380  1.00 0.00 ? 91  ILE A CD1  4  
ATOM 8435  H H    . ILE A 1 91  ? -22.956 -11.398 0.290   1.00 0.00 ? 91  ILE A H    4  
ATOM 8436  H HA   . ILE A 1 91  ? -22.620 -13.114 -1.078  1.00 0.00 ? 91  ILE A HA   4  
ATOM 8437  H HB   . ILE A 1 91  ? -20.396 -11.559 -0.972  1.00 0.00 ? 91  ILE A HB   4  
ATOM 8438  H HG12 . ILE A 1 91  ? -19.868 -13.485 -2.960  1.00 0.00 ? 91  ILE A HG12 4  
ATOM 8439  H HG13 . ILE A 1 91  ? -21.612 -13.466 -2.784  1.00 0.00 ? 91  ILE A HG13 4  
ATOM 8440  H HG21 . ILE A 1 91  ? -19.469 -13.502 0.545   1.00 0.00 ? 91  ILE A HG21 4  
ATOM 8441  H HG22 . ILE A 1 91  ? -19.188 -14.297 -1.023  1.00 0.00 ? 91  ILE A HG22 4  
ATOM 8442  H HG23 . ILE A 1 91  ? -18.441 -12.719 -0.678  1.00 0.00 ? 91  ILE A HG23 4  
ATOM 8443  H HD11 . ILE A 1 91  ? -21.044 -10.762 -2.703  1.00 0.00 ? 91  ILE A HD11 4  
ATOM 8444  H HD12 . ILE A 1 91  ? -19.795 -11.362 -3.819  1.00 0.00 ? 91  ILE A HD12 4  
ATOM 8445  H HD13 . ILE A 1 91  ? -21.516 -11.652 -4.170  1.00 0.00 ? 91  ILE A HD13 4  
ATOM 8446  N N    . ALA A 1 92  ? -21.257 -15.369 -0.321  1.00 0.00 ? 92  ALA A N    4  
ATOM 8447  C CA   . ALA A 1 92  ? -21.092 -16.691 0.260   1.00 0.00 ? 92  ALA A CA   4  
ATOM 8448  C C    . ALA A 1 92  ? -19.677 -16.822 0.826   1.00 0.00 ? 92  ALA A C    4  
ATOM 8449  O O    . ALA A 1 92  ? -18.758 -16.143 0.373   1.00 0.00 ? 92  ALA A O    4  
ATOM 8450  C CB   . ALA A 1 92  ? -21.398 -17.755 -0.797  1.00 0.00 ? 92  ALA A CB   4  
ATOM 8451  H H    . ALA A 1 92  ? -21.011 -15.299 -1.288  1.00 0.00 ? 92  ALA A H    4  
ATOM 8452  H HA   . ALA A 1 92  ? -21.812 -16.787 1.073   1.00 0.00 ? 92  ALA A HA   4  
ATOM 8453  H HB1  . ALA A 1 92  ? -21.607 -17.270 -1.750  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 8454  H HB2  . ALA A 1 92  ? -20.538 -18.415 -0.906  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 8455  H HB3  . ALA A 1 92  ? -22.267 -18.336 -0.487  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 8456  N N    . PRO A 1 93  ? -19.545 -17.723 1.837   1.00 0.00 ? 93  PRO A N    4  
ATOM 8457  C CA   . PRO A 1 93  ? -18.258 -17.952 2.471   1.00 0.00 ? 93  PRO A CA   4  
ATOM 8458  C C    . PRO A 1 93  ? -17.340 -18.778 1.567   1.00 0.00 ? 93  PRO A C    4  
ATOM 8459  O O    . PRO A 1 93  ? -17.276 -20.000 1.694   1.00 0.00 ? 93  PRO A O    4  
ATOM 8460  C CB   . PRO A 1 93  ? -18.584 -18.648 3.783   1.00 0.00 ? 93  PRO A CB   4  
ATOM 8461  C CG   . PRO A 1 93  ? -19.991 -19.198 3.624   1.00 0.00 ? 93  PRO A CG   4  
ATOM 8462  C CD   . PRO A 1 93  ? -20.612 -18.544 2.400   1.00 0.00 ? 93  PRO A CD   4  
ATOM 8463  H HA   . PRO A 1 93  ? -17.784 -17.083 2.620   1.00 0.00 ? 93  PRO A HA   4  
ATOM 8464  H HB2  . PRO A 1 93  ? -17.872 -19.448 3.988   1.00 0.00 ? 93  PRO A HB2  4  
ATOM 8465  H HB3  . PRO A 1 93  ? -18.528 -17.950 4.619   1.00 0.00 ? 93  PRO A HB3  4  
ATOM 8466  H HG2  . PRO A 1 93  ? -19.966 -20.282 3.507   1.00 0.00 ? 93  PRO A HG2  4  
ATOM 8467  H HG3  . PRO A 1 93  ? -20.586 -18.987 4.514   1.00 0.00 ? 93  PRO A HG3  4  
ATOM 8468  H HD2  . PRO A 1 93  ? -20.958 -19.290 1.686   1.00 0.00 ? 93  PRO A HD2  4  
ATOM 8469  H HD3  . PRO A 1 93  ? -21.477 -17.938 2.672   1.00 0.00 ? 93  PRO A HD3  4  
ATOM 8470  N N    . GLY A 1 94  ? -16.655 -18.078 0.676   1.00 0.00 ? 94  GLY A N    4  
ATOM 8471  C CA   . GLY A 1 94  ? -15.744 -18.733 -0.249  1.00 0.00 ? 94  GLY A CA   4  
ATOM 8472  C C    . GLY A 1 94  ? -16.024 -18.303 -1.691  1.00 0.00 ? 94  GLY A C    4  
ATOM 8473  O O    . GLY A 1 94  ? -15.340 -18.738 -2.615  1.00 0.00 ? 94  GLY A O    4  
ATOM 8474  H H    . GLY A 1 94  ? -16.713 -17.085 0.579   1.00 0.00 ? 94  GLY A H    4  
ATOM 8475  H HA2  . GLY A 1 94  ? -14.716 -18.488 0.014   1.00 0.00 ? 94  GLY A HA2  4  
ATOM 8476  H HA3  . GLY A 1 94  ? -15.846 -19.814 -0.162  1.00 0.00 ? 94  GLY A HA3  4  
ATOM 8477  N N    . GLN A 1 95  ? -17.031 -17.454 -1.836  1.00 0.00 ? 95  GLN A N    4  
ATOM 8478  C CA   . GLN A 1 95  ? -17.411 -16.961 -3.149  1.00 0.00 ? 95  GLN A CA   4  
ATOM 8479  C C    . GLN A 1 95  ? -16.968 -15.505 -3.318  1.00 0.00 ? 95  GLN A C    4  
ATOM 8480  O O    . GLN A 1 95  ? -16.993 -14.731 -2.362  1.00 0.00 ? 95  GLN A O    4  
ATOM 8481  C CB   . GLN A 1 95  ? -18.916 -17.106 -3.376  1.00 0.00 ? 95  GLN A CB   4  
ATOM 8482  C CG   . GLN A 1 95  ? -19.390 -18.518 -3.024  1.00 0.00 ? 95  GLN A CG   4  
ATOM 8483  C CD   . GLN A 1 95  ? -18.996 -19.516 -4.115  1.00 0.00 ? 95  GLN A CD   4  
ATOM 8484  O OE1  . GLN A 1 95  ? -17.879 -19.527 -4.609  1.00 0.00 ? 95  GLN A OE1  4  
ATOM 8485  N NE2  . GLN A 1 95  ? -19.971 -20.350 -4.464  1.00 0.00 ? 95  GLN A NE2  4  
ATOM 8486  H H    . GLN A 1 95  ? -17.582 -17.105 -1.078  1.00 0.00 ? 95  GLN A H    4  
ATOM 8487  H HA   . GLN A 1 95  ? -16.879 -17.593 -3.861  1.00 0.00 ? 95  GLN A HA   4  
ATOM 8488  H HB2  . GLN A 1 95  ? -19.451 -16.377 -2.767  1.00 0.00 ? 95  GLN A HB2  4  
ATOM 8489  H HB3  . GLN A 1 95  ? -19.154 -16.887 -4.417  1.00 0.00 ? 95  GLN A HB3  4  
ATOM 8490  H HG2  . GLN A 1 95  ? -18.956 -18.825 -2.073  1.00 0.00 ? 95  GLN A HG2  4  
ATOM 8491  H HG3  . GLN A 1 95  ? -20.472 -18.521 -2.898  1.00 0.00 ? 95  GLN A HG3  4  
ATOM 8492  H HE21 . GLN A 1 95  ? -20.865 -20.288 -4.019  1.00 0.00 ? 95  GLN A HE21 4  
ATOM 8493  H HE22 . GLN A 1 95  ? -19.810 -21.040 -5.169  1.00 0.00 ? 95  GLN A HE22 4  
ATOM 8494  N N    . MET A 1 96  ? -16.573 -15.177 -4.539  1.00 0.00 ? 96  MET A N    4  
ATOM 8495  C CA   . MET A 1 96  ? -16.127 -13.829 -4.844  1.00 0.00 ? 96  MET A CA   4  
ATOM 8496  C C    . MET A 1 96  ? -16.944 -13.227 -5.989  1.00 0.00 ? 96  MET A C    4  
ATOM 8497  O O    . MET A 1 96  ? -16.739 -13.572 -7.151  1.00 0.00 ? 96  MET A O    4  
ATOM 8498  C CB   . MET A 1 96  ? -14.648 -13.857 -5.233  1.00 0.00 ? 96  MET A CB   4  
ATOM 8499  C CG   . MET A 1 96  ? -14.047 -12.450 -5.208  1.00 0.00 ? 96  MET A CG   4  
ATOM 8500  S SD   . MET A 1 96  ? -12.810 -12.291 -6.486  1.00 0.00 ? 96  MET A SD   4  
ATOM 8501  C CE   . MET A 1 96  ? -12.368 -10.575 -6.277  1.00 0.00 ? 96  MET A CE   4  
ATOM 8502  H H    . MET A 1 96  ? -16.556 -15.813 -5.311  1.00 0.00 ? 96  MET A H    4  
ATOM 8503  H HA   . MET A 1 96  ? -16.287 -13.254 -3.933  1.00 0.00 ? 96  MET A HA   4  
ATOM 8504  H HB2  . MET A 1 96  ? -14.100 -14.503 -4.546  1.00 0.00 ? 96  MET A HB2  4  
ATOM 8505  H HB3  . MET A 1 96  ? -14.537 -14.285 -6.230  1.00 0.00 ? 96  MET A HB3  4  
ATOM 8506  H HG2  . MET A 1 96  ? -14.832 -11.708 -5.356  1.00 0.00 ? 96  MET A HG2  4  
ATOM 8507  H HG3  . MET A 1 96  ? -13.602 -12.253 -4.234  1.00 0.00 ? 96  MET A HG3  4  
ATOM 8508  H HE1  . MET A 1 96  ? -12.793 -10.201 -5.346  1.00 0.00 ? 96  MET A HE1  4  
ATOM 8509  H HE2  . MET A 1 96  ? -11.282 -10.481 -6.243  1.00 0.00 ? 96  MET A HE2  4  
ATOM 8510  H HE3  . MET A 1 96  ? -12.757 -9.994  -7.113  1.00 0.00 ? 96  MET A HE3  4  
ATOM 8511  N N    . ARG A 1 97  ? -17.854 -12.337 -5.620  1.00 0.00 ? 97  ARG A N    4  
ATOM 8512  C CA   . ARG A 1 97  ? -18.703 -11.684 -6.600  1.00 0.00 ? 97  ARG A CA   4  
ATOM 8513  C C    . ARG A 1 97  ? -18.575 -10.163 -6.485  1.00 0.00 ? 97  ARG A C    4  
ATOM 8514  O O    . ARG A 1 97  ? -17.824 -9.661  -5.650  1.00 0.00 ? 97  ARG A O    4  
ATOM 8515  C CB   . ARG A 1 97  ? -20.168 -12.080 -6.412  1.00 0.00 ? 97  ARG A CB   4  
ATOM 8516  C CG   . ARG A 1 97  ? -20.656 -12.946 -7.576  1.00 0.00 ? 97  ARG A CG   4  
ATOM 8517  C CD   . ARG A 1 97  ? -21.726 -12.217 -8.391  1.00 0.00 ? 97  ARG A CD   4  
ATOM 8518  N NE   . ARG A 1 97  ? -23.071 -12.694 -7.999  1.00 0.00 ? 97  ARG A NE   4  
ATOM 8519  C CZ   . ARG A 1 97  ? -24.216 -12.217 -8.508  1.00 0.00 ? 97  ARG A CZ   4  
ATOM 8520  N NH1  . ARG A 1 97  ? -24.184 -11.247 -9.432  1.00 0.00 ? 97  ARG A NH1  4  
ATOM 8521  N NH2  . ARG A 1 97  ? -25.391 -12.710 -8.094  1.00 0.00 ? 97  ARG A NH2  4  
ATOM 8522  H H    . ARG A 1 97  ? -18.014 -12.062 -4.672  1.00 0.00 ? 97  ARG A H    4  
ATOM 8523  H HA   . ARG A 1 97  ? -18.337 -12.035 -7.565  1.00 0.00 ? 97  ARG A HA   4  
ATOM 8524  H HB2  . ARG A 1 97  ? -20.284 -12.626 -5.475  1.00 0.00 ? 97  ARG A HB2  4  
ATOM 8525  H HB3  . ARG A 1 97  ? -20.785 -11.184 -6.338  1.00 0.00 ? 97  ARG A HB3  4  
ATOM 8526  H HG2  . ARG A 1 97  ? -19.815 -13.202 -8.221  1.00 0.00 ? 97  ARG A HG2  4  
ATOM 8527  H HG3  . ARG A 1 97  ? -21.060 -13.883 -7.193  1.00 0.00 ? 97  ARG A HG3  4  
ATOM 8528  H HD2  . ARG A 1 97  ? -21.651 -11.143 -8.227  1.00 0.00 ? 97  ARG A HD2  4  
ATOM 8529  H HD3  . ARG A 1 97  ? -21.566 -12.391 -9.454  1.00 0.00 ? 97  ARG A HD3  4  
ATOM 8530  H HE   . ARG A 1 97  ? -23.131 -13.417 -7.311  1.00 0.00 ? 97  ARG A HE   4  
ATOM 8531  H HH11 . ARG A 1 97  ? -23.307 -10.879 -9.742  1.00 0.00 ? 97  ARG A HH11 4  
ATOM 8532  H HH12 . ARG A 1 97  ? -25.038 -10.891 -9.813  1.00 0.00 ? 97  ARG A HH12 4  
ATOM 8533  H HH21 . ARG A 1 97  ? -25.414 -13.434 -7.404  1.00 0.00 ? 97  ARG A HH21 4  
ATOM 8534  H HH22 . ARG A 1 97  ? -26.245 -12.353 -8.474  1.00 0.00 ? 97  ARG A HH22 4  
ATOM 8535  N N    . GLU A 1 98  ? -19.319 -9.472  -7.335  1.00 0.00 ? 98  GLU A N    4  
ATOM 8536  C CA   . GLU A 1 98  ? -19.299 -8.019  -7.339  1.00 0.00 ? 98  GLU A CA   4  
ATOM 8537  C C    . GLU A 1 98  ? -19.628 -7.480  -5.944  1.00 0.00 ? 98  GLU A C    4  
ATOM 8538  O O    . GLU A 1 98  ? -20.730 -7.686  -5.440  1.00 0.00 ? 98  GLU A O    4  
ATOM 8539  C CB   . GLU A 1 98  ? -20.265 -7.459  -8.385  1.00 0.00 ? 98  GLU A CB   4  
ATOM 8540  C CG   . GLU A 1 98  ? -19.680 -6.219  -9.063  1.00 0.00 ? 98  GLU A CG   4  
ATOM 8541  C CD   . GLU A 1 98  ? -20.033 -6.191  -10.552 1.00 0.00 ? 98  GLU A CD   4  
ATOM 8542  O OE1  . GLU A 1 98  ? -19.583 -7.117  -11.259 1.00 0.00 ? 98  GLU A OE1  4  
ATOM 8543  O OE2  . GLU A 1 98  ? -20.745 -5.243  -10.948 1.00 0.00 ? 98  GLU A OE2  4  
ATOM 8544  H H    . GLU A 1 98  ? -19.928 -9.887  -8.011  1.00 0.00 ? 98  GLU A H    4  
ATOM 8545  H HA   . GLU A 1 98  ? -18.280 -7.745  -7.611  1.00 0.00 ? 98  GLU A HA   4  
ATOM 8546  H HB2  . GLU A 1 98  ? -20.478 -8.222  -9.134  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 8547  H HB3  . GLU A 1 98  ? -21.213 -7.206  -7.910  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 8548  H HG2  . GLU A 1 98  ? -20.062 -5.321  -8.578  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 8549  H HG3  . GLU A 1 98  ? -18.597 -6.211  -8.943  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 8550  N N    . PRO A 1 99  ? -18.624 -6.783  -5.347  1.00 0.00 ? 99  PRO A N    4  
ATOM 8551  C CA   . PRO A 1 99  ? -18.796 -6.213  -4.021  1.00 0.00 ? 99  PRO A CA   4  
ATOM 8552  C C    . PRO A 1 99  ? -19.681 -4.966  -4.071  1.00 0.00 ? 99  PRO A C    4  
ATOM 8553  O O    . PRO A 1 99  ? -19.752 -4.292  -5.098  1.00 0.00 ? 99  PRO A O    4  
ATOM 8554  C CB   . PRO A 1 99  ? -17.386 -5.922  -3.533  1.00 0.00 ? 99  PRO A CB   4  
ATOM 8555  C CG   . PRO A 1 99  ? -16.510 -5.906  -4.775  1.00 0.00 ? 99  PRO A CG   4  
ATOM 8556  C CD   . PRO A 1 99  ? -17.305 -6.519  -5.915  1.00 0.00 ? 99  PRO A CD   4  
ATOM 8557  H HA   . PRO A 1 99  ? -19.269 -6.860  -3.424  1.00 0.00 ? 99  PRO A HA   4  
ATOM 8558  H HB2  . PRO A 1 99  ? -17.343 -4.966  -3.011  1.00 0.00 ? 99  PRO A HB2  4  
ATOM 8559  H HB3  . PRO A 1 99  ? -17.052 -6.685  -2.829  1.00 0.00 ? 99  PRO A HB3  4  
ATOM 8560  H HG2  . PRO A 1 99  ? -16.215 -4.886  -5.020  1.00 0.00 ? 99  PRO A HG2  4  
ATOM 8561  H HG3  . PRO A 1 99  ? -15.593 -6.470  -4.602  1.00 0.00 ? 99  PRO A HG3  4  
ATOM 8562  H HD2  . PRO A 1 99  ? -17.369 -5.840  -6.764  1.00 0.00 ? 99  PRO A HD2  4  
ATOM 8563  H HD3  . PRO A 1 99  ? -16.839 -7.437  -6.275  1.00 0.00 ? 99  PRO A HD3  4  
ATOM 8564  N N    . ARG A 1 100 ? -20.331 -4.695  -2.950  1.00 0.00 ? 100 ARG A N    4  
ATOM 8565  C CA   . ARG A 1 100 ? -21.208 -3.541  -2.852  1.00 0.00 ? 100 ARG A CA   4  
ATOM 8566  C C    . ARG A 1 100 ? -20.507 -2.404  -2.106  1.00 0.00 ? 100 ARG A C    4  
ATOM 8567  O O    . ARG A 1 100 ? -21.158 -1.598  -1.442  1.00 0.00 ? 100 ARG A O    4  
ATOM 8568  C CB   . ARG A 1 100 ? -22.506 -3.895  -2.124  1.00 0.00 ? 100 ARG A CB   4  
ATOM 8569  C CG   . ARG A 1 100 ? -22.232 -4.272  -0.667  1.00 0.00 ? 100 ARG A CG   4  
ATOM 8570  C CD   . ARG A 1 100 ? -22.183 -5.792  -0.494  1.00 0.00 ? 100 ARG A CD   4  
ATOM 8571  N NE   . ARG A 1 100 ? -23.490 -6.289  -0.012  1.00 0.00 ? 100 ARG A NE   4  
ATOM 8572  C CZ   . ARG A 1 100 ? -23.986 -6.037  1.207   1.00 0.00 ? 100 ARG A CZ   4  
ATOM 8573  N NH1  . ARG A 1 100 ? -23.288 -5.290  2.074   1.00 0.00 ? 100 ARG A NH1  4  
ATOM 8574  N NH2  . ARG A 1 100 ? -25.182 -6.530  1.559   1.00 0.00 ? 100 ARG A NH2  4  
ATOM 8575  H H    . ARG A 1 100 ? -20.267 -5.248  -2.118  1.00 0.00 ? 100 ARG A H    4  
ATOM 8576  H HA   . ARG A 1 100 ? -21.417 -3.262  -3.885  1.00 0.00 ? 100 ARG A HA   4  
ATOM 8577  H HB2  . ARG A 1 100 ? -23.191 -3.048  -2.161  1.00 0.00 ? 100 ARG A HB2  4  
ATOM 8578  H HB3  . ARG A 1 100 ? -22.999 -4.724  -2.632  1.00 0.00 ? 100 ARG A HB3  4  
ATOM 8579  H HG2  . ARG A 1 100 ? -21.288 -3.835  -0.345  1.00 0.00 ? 100 ARG A HG2  4  
ATOM 8580  H HG3  . ARG A 1 100 ? -23.010 -3.855  -0.027  1.00 0.00 ? 100 ARG A HG3  4  
ATOM 8581  H HD2  . ARG A 1 100 ? -21.932 -6.266  -1.443  1.00 0.00 ? 100 ARG A HD2  4  
ATOM 8582  H HD3  . ARG A 1 100 ? -21.398 -6.060  0.213   1.00 0.00 ? 100 ARG A HD3  4  
ATOM 8583  H HE   . ARG A 1 100 ? -24.037 -6.850  -0.634  1.00 0.00 ? 100 ARG A HE   4  
ATOM 8584  H HH11 . ARG A 1 100 ? -22.396 -4.923  1.810   1.00 0.00 ? 100 ARG A HH11 4  
ATOM 8585  H HH12 . ARG A 1 100 ? -23.659 -5.102  2.983   1.00 0.00 ? 100 ARG A HH12 4  
ATOM 8586  H HH21 . ARG A 1 100 ? -25.703 -7.087  0.913   1.00 0.00 ? 100 ARG A HH21 4  
ATOM 8587  H HH22 . ARG A 1 100 ? -25.552 -6.341  2.468   1.00 0.00 ? 100 ARG A HH22 4  
ATOM 8588  N N    . GLY A 1 101 ? -19.189 -2.373  -2.242  1.00 0.00 ? 101 GLY A N    4  
ATOM 8589  C CA   . GLY A 1 101 ? -18.393 -1.348  -1.589  1.00 0.00 ? 101 GLY A CA   4  
ATOM 8590  C C    . GLY A 1 101 ? -17.969 -1.792  -0.188  1.00 0.00 ? 101 GLY A C    4  
ATOM 8591  O O    . GLY A 1 101 ? -16.786 -1.751  0.148   1.00 0.00 ? 101 GLY A O    4  
ATOM 8592  H H    . GLY A 1 101 ? -18.668 -3.032  -2.784  1.00 0.00 ? 101 GLY A H    4  
ATOM 8593  H HA2  . GLY A 1 101 ? -17.509 -1.132  -2.189  1.00 0.00 ? 101 GLY A HA2  4  
ATOM 8594  H HA3  . GLY A 1 101 ? -18.967 -0.424  -1.523  1.00 0.00 ? 101 GLY A HA3  4  
ATOM 8595  N N    . SER A 1 102 ? -18.956 -2.208  0.591   1.00 0.00 ? 102 SER A N    4  
ATOM 8596  C CA   . SER A 1 102 ? -18.700 -2.661  1.948   1.00 0.00 ? 102 SER A CA   4  
ATOM 8597  C C    . SER A 1 102 ? -17.458 -3.554  1.976   1.00 0.00 ? 102 SER A C    4  
ATOM 8598  O O    . SER A 1 102 ? -16.652 -3.475  2.902   1.00 0.00 ? 102 SER A O    4  
ATOM 8599  C CB   . SER A 1 102 ? -19.906 -3.411  2.516   1.00 0.00 ? 102 SER A CB   4  
ATOM 8600  O OG   . SER A 1 102 ? -19.762 -3.676  3.908   1.00 0.00 ? 102 SER A OG   4  
ATOM 8601  H H    . SER A 1 102 ? -19.915 -2.240  0.309   1.00 0.00 ? 102 SER A H    4  
ATOM 8602  H HA   . SER A 1 102 ? -18.531 -1.753  2.527   1.00 0.00 ? 102 SER A HA   4  
ATOM 8603  H HB2  . SER A 1 102 ? -20.809 -2.824  2.350   1.00 0.00 ? 102 SER A HB2  4  
ATOM 8604  H HB3  . SER A 1 102 ? -20.034 -4.351  1.979   1.00 0.00 ? 102 SER A HB3  4  
ATOM 8605  H HG   . SER A 1 102 ? -18.976 -4.275  4.063   1.00 0.00 ? 102 SER A HG   4  
ATOM 8606  N N    . ASP A 1 103 ? -17.341 -4.384  0.949   1.00 0.00 ? 103 ASP A N    4  
ATOM 8607  C CA   . ASP A 1 103 ? -16.212 -5.291  0.845   1.00 0.00 ? 103 ASP A CA   4  
ATOM 8608  C C    . ASP A 1 103 ? -14.920 -4.479  0.728   1.00 0.00 ? 103 ASP A C    4  
ATOM 8609  O O    . ASP A 1 103 ? -13.915 -4.812  1.353   1.00 0.00 ? 103 ASP A O    4  
ATOM 8610  C CB   . ASP A 1 103 ? -16.328 -6.175  -0.399  1.00 0.00 ? 103 ASP A CB   4  
ATOM 8611  C CG   . ASP A 1 103 ? -14.996 -6.659  -0.975  1.00 0.00 ? 103 ASP A CG   4  
ATOM 8612  O OD1  . ASP A 1 103 ? -14.038 -6.764  -0.179  1.00 0.00 ? 103 ASP A OD1  4  
ATOM 8613  O OD2  . ASP A 1 103 ? -14.966 -6.914  -2.198  1.00 0.00 ? 103 ASP A OD2  4  
ATOM 8614  H H    . ASP A 1 103 ? -18.001 -4.442  0.200   1.00 0.00 ? 103 ASP A H    4  
ATOM 8615  H HA   . ASP A 1 103 ? -16.244 -5.895  1.752   1.00 0.00 ? 103 ASP A HA   4  
ATOM 8616  H HB2  . ASP A 1 103 ? -16.938 -7.044  -0.152  1.00 0.00 ? 103 ASP A HB2  4  
ATOM 8617  H HB3  . ASP A 1 103 ? -16.861 -5.621  -1.171  1.00 0.00 ? 103 ASP A HB3  4  
ATOM 8618  N N    . ILE A 1 104 ? -14.990 -3.429  -0.077  1.00 0.00 ? 104 ILE A N    4  
ATOM 8619  C CA   . ILE A 1 104 ? -13.838 -2.567  -0.283  1.00 0.00 ? 104 ILE A CA   4  
ATOM 8620  C C    . ILE A 1 104 ? -13.359 -2.030  1.067   1.00 0.00 ? 104 ILE A C    4  
ATOM 8621  O O    . ILE A 1 104 ? -12.228 -1.563  1.188   1.00 0.00 ? 104 ILE A O    4  
ATOM 8622  C CB   . ILE A 1 104 ? -14.165 -1.471  -1.299  1.00 0.00 ? 104 ILE A CB   4  
ATOM 8623  C CG1  . ILE A 1 104 ? -14.649 -2.074  -2.620  1.00 0.00 ? 104 ILE A CG1  4  
ATOM 8624  C CG2  . ILE A 1 104 ? -12.973 -0.534  -1.499  1.00 0.00 ? 104 ILE A CG2  4  
ATOM 8625  C CD1  . ILE A 1 104 ? -15.457 -1.054  -3.426  1.00 0.00 ? 104 ILE A CD1  4  
ATOM 8626  H H    . ILE A 1 104 ? -15.811 -3.165  -0.582  1.00 0.00 ? 104 ILE A H    4  
ATOM 8627  H HA   . ILE A 1 104 ? -13.046 -3.178  -0.713  1.00 0.00 ? 104 ILE A HA   4  
ATOM 8628  H HB   . ILE A 1 104 ? -14.983 -0.870  -0.902  1.00 0.00 ? 104 ILE A HB   4  
ATOM 8629  H HG12 . ILE A 1 104 ? -13.793 -2.409  -3.206  1.00 0.00 ? 104 ILE A HG12 4  
ATOM 8630  H HG13 . ILE A 1 104 ? -15.261 -2.953  -2.420  1.00 0.00 ? 104 ILE A HG13 4  
ATOM 8631  H HG21 . ILE A 1 104 ? -12.143 -0.865  -0.874  1.00 0.00 ? 104 ILE A HG21 4  
ATOM 8632  H HG22 . ILE A 1 104 ? -12.668 -0.552  -2.547  1.00 0.00 ? 104 ILE A HG22 4  
ATOM 8633  H HG23 . ILE A 1 104 ? -13.255 0.480   -1.220  1.00 0.00 ? 104 ILE A HG23 4  
ATOM 8634  H HD11 . ILE A 1 104 ? -15.723 -0.213  -2.784  1.00 0.00 ? 104 ILE A HD11 4  
ATOM 8635  H HD12 . ILE A 1 104 ? -14.859 -0.697  -4.264  1.00 0.00 ? 104 ILE A HD12 4  
ATOM 8636  H HD13 . ILE A 1 104 ? -16.365 -1.525  -3.802  1.00 0.00 ? 104 ILE A HD13 4  
ATOM 8637  N N    . ALA A 1 105 ? -14.245 -2.116  2.049   1.00 0.00 ? 105 ALA A N    4  
ATOM 8638  C CA   . ALA A 1 105 ? -13.927 -1.644  3.387   1.00 0.00 ? 105 ALA A CA   4  
ATOM 8639  C C    . ALA A 1 105 ? -13.067 -2.690  4.099   1.00 0.00 ? 105 ALA A C    4  
ATOM 8640  O O    . ALA A 1 105 ? -12.362 -2.371  5.056   1.00 0.00 ? 105 ALA A O    4  
ATOM 8641  C CB   . ALA A 1 105 ? -15.222 -1.340  4.142   1.00 0.00 ? 105 ALA A CB   4  
ATOM 8642  H H    . ALA A 1 105 ? -15.164 -2.496  1.942   1.00 0.00 ? 105 ALA A H    4  
ATOM 8643  H HA   . ALA A 1 105 ? -13.354 -0.723  3.286   1.00 0.00 ? 105 ALA A HA   4  
ATOM 8644  H HB1  . ALA A 1 105 ? -15.015 -0.635  4.947   1.00 0.00 ? 105 ALA A HB1  4  
ATOM 8645  H HB2  . ALA A 1 105 ? -15.949 -0.905  3.456   1.00 0.00 ? 105 ALA A HB2  4  
ATOM 8646  H HB3  . ALA A 1 105 ? -15.624 -2.263  4.560   1.00 0.00 ? 105 ALA A HB3  4  
ATOM 8647  N N    . GLY A 1 106 ? -13.156 -3.917  3.608   1.00 0.00 ? 106 GLY A N    4  
ATOM 8648  C CA   . GLY A 1 106 ? -12.394 -5.012  4.186   1.00 0.00 ? 106 GLY A CA   4  
ATOM 8649  C C    . GLY A 1 106 ? -13.029 -5.490  5.493   1.00 0.00 ? 106 GLY A C    4  
ATOM 8650  O O    . GLY A 1 106 ? -12.395 -6.197  6.274   1.00 0.00 ? 106 GLY A O    4  
ATOM 8651  H H    . GLY A 1 106 ? -13.731 -4.167  2.830   1.00 0.00 ? 106 GLY A H    4  
ATOM 8652  H HA2  . GLY A 1 106 ? -12.345 -5.838  3.478   1.00 0.00 ? 106 GLY A HA2  4  
ATOM 8653  H HA3  . GLY A 1 106 ? -11.371 -4.689  4.372   1.00 0.00 ? 106 GLY A HA3  4  
ATOM 8654  N N    . THR A 1 107 ? -14.275 -5.084  5.691   1.00 0.00 ? 107 THR A N    4  
ATOM 8655  C CA   . THR A 1 107 ? -15.004 -5.464  6.891   1.00 0.00 ? 107 THR A CA   4  
ATOM 8656  C C    . THR A 1 107 ? -15.557 -6.884  6.752   1.00 0.00 ? 107 THR A C    4  
ATOM 8657  O O    . THR A 1 107 ? -15.620 -7.626  7.731   1.00 0.00 ? 107 THR A O    4  
ATOM 8658  C CB   . THR A 1 107 ? -16.087 -4.411  7.138   1.00 0.00 ? 107 THR A CB   4  
ATOM 8659  O OG1  . THR A 1 107 ? -15.357 -3.239  7.493   1.00 0.00 ? 107 THR A OG1  4  
ATOM 8660  C CG2  . THR A 1 107 ? -16.927 -4.717  8.380   1.00 0.00 ? 107 THR A CG2  4  
ATOM 8661  H H    . THR A 1 107 ? -14.785 -4.510  5.052   1.00 0.00 ? 107 THR A H    4  
ATOM 8662  H HA   . THR A 1 107 ? -14.306 -5.472  7.728   1.00 0.00 ? 107 THR A HA   4  
ATOM 8663  H HB   . THR A 1 107 ? -16.719 -4.290  6.260   1.00 0.00 ? 107 THR A HB   4  
ATOM 8664  H HG1  . THR A 1 107 ? -14.911 -3.369  8.378   1.00 0.00 ? 107 THR A HG1  4  
ATOM 8665  H HG21 . THR A 1 107 ? -16.297 -5.175  9.142   1.00 0.00 ? 107 THR A HG21 4  
ATOM 8666  H HG22 . THR A 1 107 ? -17.352 -3.791  8.768   1.00 0.00 ? 107 THR A HG22 4  
ATOM 8667  H HG23 . THR A 1 107 ? -17.732 -5.403  8.113   1.00 0.00 ? 107 THR A HG23 4  
ATOM 8668  N N    . THR A 1 108 ? -15.943 -7.218  5.530   1.00 0.00 ? 108 THR A N    4  
ATOM 8669  C CA   . THR A 1 108 ? -16.489 -8.535  5.252   1.00 0.00 ? 108 THR A CA   4  
ATOM 8670  C C    . THR A 1 108 ? -15.426 -9.426  4.606   1.00 0.00 ? 108 THR A C    4  
ATOM 8671  O O    . THR A 1 108 ? -15.477 -10.649 4.730   1.00 0.00 ? 108 THR A O    4  
ATOM 8672  C CB   . THR A 1 108 ? -17.739 -8.356  4.387   1.00 0.00 ? 108 THR A CB   4  
ATOM 8673  O OG1  . THR A 1 108 ? -18.699 -7.794  5.278   1.00 0.00 ? 108 THR A OG1  4  
ATOM 8674  C CG2  . THR A 1 108 ? -18.357 -9.691  3.967   1.00 0.00 ? 108 THR A CG2  4  
ATOM 8675  H H    . THR A 1 108 ? -15.888 -6.607  4.740   1.00 0.00 ? 108 THR A H    4  
ATOM 8676  H HA   . THR A 1 108 ? -16.763 -9.000  6.198   1.00 0.00 ? 108 THR A HA   4  
ATOM 8677  H HB   . THR A 1 108 ? -17.525 -7.736  3.518   1.00 0.00 ? 108 THR A HB   4  
ATOM 8678  H HG1  . THR A 1 108 ? -18.758 -8.347  6.110   1.00 0.00 ? 108 THR A HG1  4  
ATOM 8679  H HG21 . THR A 1 108 ? -17.619 -10.485 4.084   1.00 0.00 ? 108 THR A HG21 4  
ATOM 8680  H HG22 . THR A 1 108 ? -19.222 -9.904  4.594   1.00 0.00 ? 108 THR A HG22 4  
ATOM 8681  H HG23 . THR A 1 108 ? -18.668 -9.636  2.925   1.00 0.00 ? 108 THR A HG23 4  
ATOM 8682  N N    . SER A 1 109 ? -14.487 -8.780  3.931   1.00 0.00 ? 109 SER A N    4  
ATOM 8683  C CA   . SER A 1 109 ? -13.415 -9.499  3.265   1.00 0.00 ? 109 SER A CA   4  
ATOM 8684  C C    . SER A 1 109 ? -12.075 -9.170  3.928   1.00 0.00 ? 109 SER A C    4  
ATOM 8685  O O    . SER A 1 109 ? -11.960 -8.179  4.646   1.00 0.00 ? 109 SER A O    4  
ATOM 8686  C CB   . SER A 1 109 ? -13.366 -9.159  1.774   1.00 0.00 ? 109 SER A CB   4  
ATOM 8687  O OG   . SER A 1 109 ? -12.518 -8.045  1.507   1.00 0.00 ? 109 SER A OG   4  
ATOM 8688  H H    . SER A 1 109 ? -14.453 -7.785  3.835   1.00 0.00 ? 109 SER A H    4  
ATOM 8689  H HA   . SER A 1 109 ? -13.654 -10.554 3.389   1.00 0.00 ? 109 SER A HA   4  
ATOM 8690  H HB2  . SER A 1 109 ? -13.012 -10.027 1.216   1.00 0.00 ? 109 SER A HB2  4  
ATOM 8691  H HB3  . SER A 1 109 ? -14.373 -8.942  1.419   1.00 0.00 ? 109 SER A HB3  4  
ATOM 8692  H HG   . SER A 1 109 ? -12.895 -7.221  1.927   1.00 0.00 ? 109 SER A HG   4  
ATOM 8693  N N    . THR A 1 110 ? -11.095 -10.021 3.662   1.00 0.00 ? 110 THR A N    4  
ATOM 8694  C CA   . THR A 1 110 ? -9.768  -9.834  4.223   1.00 0.00 ? 110 THR A CA   4  
ATOM 8695  C C    . THR A 1 110 ? -8.835  -9.200  3.189   1.00 0.00 ? 110 THR A C    4  
ATOM 8696  O O    . THR A 1 110 ? -9.250  -8.916  2.066   1.00 0.00 ? 110 THR A O    4  
ATOM 8697  C CB   . THR A 1 110 ? -9.276  -11.189 4.734   1.00 0.00 ? 110 THR A CB   4  
ATOM 8698  O OG1  . THR A 1 110 ? -9.173  -11.988 3.559   1.00 0.00 ? 110 THR A OG1  4  
ATOM 8699  C CG2  . THR A 1 110 ? -10.323 -11.911 5.585   1.00 0.00 ? 110 THR A CG2  4  
ATOM 8700  H H    . THR A 1 110 ? -11.196 -10.826 3.076   1.00 0.00 ? 110 THR A H    4  
ATOM 8701  H HA   . THR A 1 110 ? -9.843  -9.136  5.057   1.00 0.00 ? 110 THR A HA   4  
ATOM 8702  H HB   . THR A 1 110 ? -8.338  -11.082 5.280   1.00 0.00 ? 110 THR A HB   4  
ATOM 8703  H HG1  . THR A 1 110 ? -8.457  -12.676 3.673   1.00 0.00 ? 110 THR A HG1  4  
ATOM 8704  H HG21 . THR A 1 110 ? -10.662 -11.249 6.382   1.00 0.00 ? 110 THR A HG21 4  
ATOM 8705  H HG22 . THR A 1 110 ? -11.171 -12.189 4.958   1.00 0.00 ? 110 THR A HG22 4  
ATOM 8706  H HG23 . THR A 1 110 ? -9.883  -12.808 6.020   1.00 0.00 ? 110 THR A HG23 4  
ATOM 8707  N N    . LEU A 1 111 ? -7.595  -8.996  3.605   1.00 0.00 ? 111 LEU A N    4  
ATOM 8708  C CA   . LEU A 1 111 ? -6.601  -8.400  2.728   1.00 0.00 ? 111 LEU A CA   4  
ATOM 8709  C C    . LEU A 1 111 ? -6.495  -9.228  1.446   1.00 0.00 ? 111 LEU A C    4  
ATOM 8710  O O    . LEU A 1 111 ? -6.590  -8.688  0.345   1.00 0.00 ? 111 LEU A O    4  
ATOM 8711  C CB   . LEU A 1 111 ? -5.269  -8.233  3.464   1.00 0.00 ? 111 LEU A CB   4  
ATOM 8712  C CG   . LEU A 1 111 ? -4.028  -8.087  2.580   1.00 0.00 ? 111 LEU A CG   4  
ATOM 8713  C CD1  . LEU A 1 111 ? -4.034  -6.745  1.844   1.00 0.00 ? 111 LEU A CD1  4  
ATOM 8714  C CD2  . LEU A 1 111 ? -2.749  -8.289  3.395   1.00 0.00 ? 111 LEU A CD2  4  
ATOM 8715  H H    . LEU A 1 111 ? -7.265  -9.229  4.520   1.00 0.00 ? 111 LEU A H    4  
ATOM 8716  H HA   . LEU A 1 111 ? -6.951  -7.402  2.467   1.00 0.00 ? 111 LEU A HA   4  
ATOM 8717  H HB2  . LEU A 1 111 ? -5.339  -7.356  4.106   1.00 0.00 ? 111 LEU A HB2  4  
ATOM 8718  H HB3  . LEU A 1 111 ? -5.126  -9.095  4.117   1.00 0.00 ? 111 LEU A HB3  4  
ATOM 8719  H HG   . LEU A 1 111 ? -4.055  -8.870  1.822   1.00 0.00 ? 111 LEU A HG   4  
ATOM 8720  H HD11 . LEU A 1 111 ? -4.937  -6.669  1.238   1.00 0.00 ? 111 LEU A HD11 4  
ATOM 8721  H HD12 . LEU A 1 111 ? -4.014  -5.933  2.571   1.00 0.00 ? 111 LEU A HD12 4  
ATOM 8722  H HD13 . LEU A 1 111 ? -3.158  -6.681  1.200   1.00 0.00 ? 111 LEU A HD13 4  
ATOM 8723  H HD21 . LEU A 1 111 ? -2.945  -8.061  4.442   1.00 0.00 ? 111 LEU A HD21 4  
ATOM 8724  H HD22 . LEU A 1 111 ? -2.418  -9.323  3.302   1.00 0.00 ? 111 LEU A HD22 4  
ATOM 8725  H HD23 . LEU A 1 111 ? -1.971  -7.624  3.018   1.00 0.00 ? 111 LEU A HD23 4  
ATOM 8726  N N    . GLN A 1 112 ? -6.300  -10.526 1.632   1.00 0.00 ? 112 GLN A N    4  
ATOM 8727  C CA   . GLN A 1 112 ? -6.181  -11.434 0.504   1.00 0.00 ? 112 GLN A CA   4  
ATOM 8728  C C    . GLN A 1 112 ? -7.305  -11.180 -0.503  1.00 0.00 ? 112 GLN A C    4  
ATOM 8729  O O    . GLN A 1 112 ? -7.059  -11.085 -1.704  1.00 0.00 ? 112 GLN A O    4  
ATOM 8730  C CB   . GLN A 1 112 ? -6.181  -12.891 0.971   1.00 0.00 ? 112 GLN A CB   4  
ATOM 8731  C CG   . GLN A 1 112 ? -5.874  -13.838 -0.191  1.00 0.00 ? 112 GLN A CG   4  
ATOM 8732  C CD   . GLN A 1 112 ? -7.118  -14.638 -0.589  1.00 0.00 ? 112 GLN A CD   4  
ATOM 8733  O OE1  . GLN A 1 112 ? -7.932  -14.211 -1.391  1.00 0.00 ? 112 GLN A OE1  4  
ATOM 8734  N NE2  . GLN A 1 112 ? -7.217  -15.818 0.016   1.00 0.00 ? 112 GLN A NE2  4  
ATOM 8735  H H    . GLN A 1 112 ? -6.224  -10.956 2.531   1.00 0.00 ? 112 GLN A H    4  
ATOM 8736  H HA   . GLN A 1 112 ? -5.218  -11.204 0.048   1.00 0.00 ? 112 GLN A HA   4  
ATOM 8737  H HB2  . GLN A 1 112 ? -5.440  -13.024 1.759   1.00 0.00 ? 112 GLN A HB2  4  
ATOM 8738  H HB3  . GLN A 1 112 ? -7.151  -13.139 1.400   1.00 0.00 ? 112 GLN A HB3  4  
ATOM 8739  H HG2  . GLN A 1 112 ? -5.516  -13.266 -1.047  1.00 0.00 ? 112 GLN A HG2  4  
ATOM 8740  H HG3  . GLN A 1 112 ? -5.074  -14.521 0.093   1.00 0.00 ? 112 GLN A HG3  4  
ATOM 8741  H HE21 . GLN A 1 112 ? -6.514  -16.108 0.665   1.00 0.00 ? 112 GLN A HE21 4  
ATOM 8742  H HE22 . GLN A 1 112 ? -7.996  -16.415 -0.178  1.00 0.00 ? 112 GLN A HE22 4  
ATOM 8743  N N    . GLU A 1 113 ? -8.517  -11.078 0.025   1.00 0.00 ? 113 GLU A N    4  
ATOM 8744  C CA   . GLU A 1 113 ? -9.679  -10.837 -0.812  1.00 0.00 ? 113 GLU A CA   4  
ATOM 8745  C C    . GLU A 1 113 ? -9.533  -9.507  -1.555  1.00 0.00 ? 113 GLU A C    4  
ATOM 8746  O O    . GLU A 1 113 ? -9.888  -9.405  -2.728  1.00 0.00 ? 113 GLU A O    4  
ATOM 8747  C CB   . GLU A 1 113 ? -10.966 -10.863 0.015   1.00 0.00 ? 113 GLU A CB   4  
ATOM 8748  C CG   . GLU A 1 113 ? -12.060 -11.659 -0.698  1.00 0.00 ? 113 GLU A CG   4  
ATOM 8749  C CD   . GLU A 1 113 ? -12.305 -13.000 -0.002  1.00 0.00 ? 113 GLU A CD   4  
ATOM 8750  O OE1  . GLU A 1 113 ? -11.317 -13.752 0.145   1.00 0.00 ? 113 GLU A OE1  4  
ATOM 8751  O OE2  . GLU A 1 113 ? -13.475 -13.243 0.366   1.00 0.00 ? 113 GLU A OE2  4  
ATOM 8752  H H    . GLU A 1 113 ? -8.708  -11.155 1.003   1.00 0.00 ? 113 GLU A H    4  
ATOM 8753  H HA   . GLU A 1 113 ? -9.697  -11.659 -1.527  1.00 0.00 ? 113 GLU A HA   4  
ATOM 8754  H HB2  . GLU A 1 113 ? -10.766 -11.307 0.991   1.00 0.00 ? 113 GLU A HB2  4  
ATOM 8755  H HB3  . GLU A 1 113 ? -11.310 -9.845  0.193   1.00 0.00 ? 113 GLU A HB3  4  
ATOM 8756  H HG2  . GLU A 1 113 ? -12.984 -11.081 -0.715  1.00 0.00 ? 113 GLU A HG2  4  
ATOM 8757  H HG3  . GLU A 1 113 ? -11.772 -11.831 -1.735  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 8758  N N    . GLN A 1 114 ? -9.009  -8.521  -0.841  1.00 0.00 ? 114 GLN A N    4  
ATOM 8759  C CA   . GLN A 1 114 ? -8.811  -7.203  -1.418  1.00 0.00 ? 114 GLN A CA   4  
ATOM 8760  C C    . GLN A 1 114 ? -7.893  -7.289  -2.639  1.00 0.00 ? 114 GLN A C    4  
ATOM 8761  O O    . GLN A 1 114 ? -8.194  -6.721  -3.687  1.00 0.00 ? 114 GLN A O    4  
ATOM 8762  C CB   . GLN A 1 114 ? -8.251  -6.229  -0.379  1.00 0.00 ? 114 GLN A CB   4  
ATOM 8763  C CG   . GLN A 1 114 ? -8.978  -4.883  -0.441  1.00 0.00 ? 114 GLN A CG   4  
ATOM 8764  C CD   . GLN A 1 114 ? -8.013  -3.755  -0.810  1.00 0.00 ? 114 GLN A CD   4  
ATOM 8765  O OE1  . GLN A 1 114 ? -7.083  -3.926  -1.581  1.00 0.00 ? 114 GLN A OE1  4  
ATOM 8766  N NE2  . GLN A 1 114 ? -8.283  -2.595  -0.216  1.00 0.00 ? 114 GLN A NE2  4  
ATOM 8767  H H    . GLN A 1 114 ? -8.723  -8.613  0.113   1.00 0.00 ? 114 GLN A H    4  
ATOM 8768  H HA   . GLN A 1 114 ? -9.803  -6.869  -1.723  1.00 0.00 ? 114 GLN A HA   4  
ATOM 8769  H HB2  . GLN A 1 114 ? -8.354  -6.656  0.618   1.00 0.00 ? 114 GLN A HB2  4  
ATOM 8770  H HB3  . GLN A 1 114 ? -7.186  -6.078  -0.553  1.00 0.00 ? 114 GLN A HB3  4  
ATOM 8771  H HG2  . GLN A 1 114 ? -9.782  -4.934  -1.176  1.00 0.00 ? 114 GLN A HG2  4  
ATOM 8772  H HG3  . GLN A 1 114 ? -9.441  -4.671  0.523   1.00 0.00 ? 114 GLN A HG3  4  
ATOM 8773  H HE21 . GLN A 1 114 ? -9.062  -2.523  0.407   1.00 0.00 ? 114 GLN A HE21 4  
ATOM 8774  H HE22 . GLN A 1 114 ? -7.708  -1.797  -0.394  1.00 0.00 ? 114 GLN A HE22 4  
ATOM 8775  N N    . ILE A 1 115 ? -6.792  -8.005  -2.461  1.00 0.00 ? 115 ILE A N    4  
ATOM 8776  C CA   . ILE A 1 115 ? -5.828  -8.172  -3.535  1.00 0.00 ? 115 ILE A CA   4  
ATOM 8777  C C    . ILE A 1 115 ? -6.494  -8.904  -4.701  1.00 0.00 ? 115 ILE A C    4  
ATOM 8778  O O    . ILE A 1 115 ? -6.196  -8.629  -5.863  1.00 0.00 ? 115 ILE A O    4  
ATOM 8779  C CB   . ILE A 1 115 ? -4.564  -8.861  -3.018  1.00 0.00 ? 115 ILE A CB   4  
ATOM 8780  C CG1  . ILE A 1 115 ? -3.498  -7.834  -2.632  1.00 0.00 ? 115 ILE A CG1  4  
ATOM 8781  C CG2  . ILE A 1 115 ? -4.038  -9.878  -4.033  1.00 0.00 ? 115 ILE A CG2  4  
ATOM 8782  C CD1  . ILE A 1 115 ? -3.992  -6.927  -1.504  1.00 0.00 ? 115 ILE A CD1  4  
ATOM 8783  H H    . ILE A 1 115 ? -6.555  -8.463  -1.605  1.00 0.00 ? 115 ILE A H    4  
ATOM 8784  H HA   . ILE A 1 115 ? -5.537  -7.177  -3.872  1.00 0.00 ? 115 ILE A HA   4  
ATOM 8785  H HB   . ILE A 1 115 ? -4.821  -9.413  -2.114  1.00 0.00 ? 115 ILE A HB   4  
ATOM 8786  H HG12 . ILE A 1 115 ? -2.589  -8.348  -2.318  1.00 0.00 ? 115 ILE A HG12 4  
ATOM 8787  H HG13 . ILE A 1 115 ? -3.238  -7.230  -3.501  1.00 0.00 ? 115 ILE A HG13 4  
ATOM 8788  H HG21 . ILE A 1 115 ? -4.825  -10.597 -4.268  1.00 0.00 ? 115 ILE A HG21 4  
ATOM 8789  H HG22 . ILE A 1 115 ? -3.735  -9.360  -4.943  1.00 0.00 ? 115 ILE A HG22 4  
ATOM 8790  H HG23 . ILE A 1 115 ? -3.181  -10.404 -3.612  1.00 0.00 ? 115 ILE A HG23 4  
ATOM 8791  H HD11 . ILE A 1 115 ? -4.922  -6.445  -1.807  1.00 0.00 ? 115 ILE A HD11 4  
ATOM 8792  H HD12 . ILE A 1 115 ? -4.168  -7.524  -0.609  1.00 0.00 ? 115 ILE A HD12 4  
ATOM 8793  H HD13 . ILE A 1 115 ? -3.242  -6.166  -1.293  1.00 0.00 ? 115 ILE A HD13 4  
ATOM 8794  N N    . GLY A 1 116 ? -7.382  -9.823  -4.352  1.00 0.00 ? 116 GLY A N    4  
ATOM 8795  C CA   . GLY A 1 116 ? -8.092  -10.598 -5.356  1.00 0.00 ? 116 GLY A CA   4  
ATOM 8796  C C    . GLY A 1 116 ? -8.925  -9.688  -6.262  1.00 0.00 ? 116 GLY A C    4  
ATOM 8797  O O    . GLY A 1 116 ? -8.796  -9.736  -7.485  1.00 0.00 ? 116 GLY A O    4  
ATOM 8798  H H    . GLY A 1 116 ? -7.618  -10.042 -3.406  1.00 0.00 ? 116 GLY A H    4  
ATOM 8799  H HA2  . GLY A 1 116 ? -7.379  -11.162 -5.958  1.00 0.00 ? 116 GLY A HA2  4  
ATOM 8800  H HA3  . GLY A 1 116 ? -8.742  -11.323 -4.868  1.00 0.00 ? 116 GLY A HA3  4  
ATOM 8801  N N    . TRP A 1 117 ? -9.761  -8.880  -5.628  1.00 0.00 ? 117 TRP A N    4  
ATOM 8802  C CA   . TRP A 1 117 ? -10.615 -7.961  -6.361  1.00 0.00 ? 117 TRP A CA   4  
ATOM 8803  C C    . TRP A 1 117 ? -9.720  -7.082  -7.237  1.00 0.00 ? 117 TRP A C    4  
ATOM 8804  O O    . TRP A 1 117 ? -10.030 -6.844  -8.404  1.00 0.00 ? 117 TRP A O    4  
ATOM 8805  C CB   . TRP A 1 117 ? -11.497 -7.152  -5.407  1.00 0.00 ? 117 TRP A CB   4  
ATOM 8806  C CG   . TRP A 1 117 ? -12.838 -7.816  -5.086  1.00 0.00 ? 117 TRP A CG   4  
ATOM 8807  C CD1  . TRP A 1 117 ? -13.849 -8.080  -5.924  1.00 0.00 ? 117 TRP A CD1  4  
ATOM 8808  C CD2  . TRP A 1 117 ? -13.273 -8.292  -3.794  1.00 0.00 ? 117 TRP A CD2  4  
ATOM 8809  N NE1  . TRP A 1 117 ? -14.901 -8.689  -5.270  1.00 0.00 ? 117 TRP A NE1  4  
ATOM 8810  C CE2  . TRP A 1 117 ? -14.540 -8.822  -3.934  1.00 0.00 ? 117 TRP A CE2  4  
ATOM 8811  C CE3  . TRP A 1 117 ? -12.619 -8.276  -2.550  1.00 0.00 ? 117 TRP A CE3  4  
ATOM 8812  C CZ2  . TRP A 1 117 ? -15.261 -9.376  -2.870  1.00 0.00 ? 117 TRP A CZ2  4  
ATOM 8813  C CZ3  . TRP A 1 117 ? -13.353 -8.833  -1.497  1.00 0.00 ? 117 TRP A CZ3  4  
ATOM 8814  C CH2  . TRP A 1 117 ? -14.629 -9.370  -1.620  1.00 0.00 ? 117 TRP A CH2  4  
ATOM 8815  H H    . TRP A 1 117 ? -9.861  -8.846  -4.633  1.00 0.00 ? 117 TRP A H    4  
ATOM 8816  H HA   . TRP A 1 117 ? -11.283 -8.553  -6.986  1.00 0.00 ? 117 TRP A HA   4  
ATOM 8817  H HB2  . TRP A 1 117 ? -10.953 -6.987  -4.477  1.00 0.00 ? 117 TRP A HB2  4  
ATOM 8818  H HB3  . TRP A 1 117 ? -11.684 -6.172  -5.845  1.00 0.00 ? 117 TRP A HB3  4  
ATOM 8819  H HD1  . TRP A 1 117 ? -13.843 -7.844  -6.987  1.00 0.00 ? 117 TRP A HD1  4  
ATOM 8820  H HE1  . TRP A 1 117 ? -15.842 -9.007  -5.718  1.00 0.00 ? 117 TRP A HE1  4  
ATOM 8821  H HE3  . TRP A 1 117 ? -11.618 -7.864  -2.414  1.00 0.00 ? 117 TRP A HE3  4  
ATOM 8822  H HZ2  . TRP A 1 117 ? -16.260 -9.788  -3.006  1.00 0.00 ? 117 TRP A HZ2  4  
ATOM 8823  H HZ3  . TRP A 1 117 ? -12.891 -8.846  -0.509  1.00 0.00 ? 117 TRP A HZ3  4  
ATOM 8824  H HH2  . TRP A 1 117 ? -15.134 -9.786  -0.749  1.00 0.00 ? 117 TRP A HH2  4  
ATOM 8825  N N    . MET A 1 118 ? -8.629  -6.624  -6.641  1.00 0.00 ? 118 MET A N    4  
ATOM 8826  C CA   . MET A 1 118 ? -7.688  -5.776  -7.354  1.00 0.00 ? 118 MET A CA   4  
ATOM 8827  C C    . MET A 1 118 ? -6.907  -6.579  -8.397  1.00 0.00 ? 118 MET A C    4  
ATOM 8828  O O    . MET A 1 118 ? -6.301  -6.005  -9.300  1.00 0.00 ? 118 MET A O    4  
ATOM 8829  C CB   . MET A 1 118 ? -6.711  -5.148  -6.357  1.00 0.00 ? 118 MET A CB   4  
ATOM 8830  C CG   . MET A 1 118 ? -5.932  -4.001  -7.003  1.00 0.00 ? 118 MET A CG   4  
ATOM 8831  S SD   . MET A 1 118 ? -6.352  -2.456  -6.214  1.00 0.00 ? 118 MET A SD   4  
ATOM 8832  C CE   . MET A 1 118 ? -5.577  -2.698  -4.626  1.00 0.00 ? 118 MET A CE   4  
ATOM 8833  H H    . MET A 1 118 ? -8.385  -6.821  -5.692  1.00 0.00 ? 118 MET A H    4  
ATOM 8834  H HA   . MET A 1 118 ? -8.293  -5.016  -7.848  1.00 0.00 ? 118 MET A HA   4  
ATOM 8835  H HB2  . MET A 1 118 ? -7.259  -4.777  -5.490  1.00 0.00 ? 118 MET A HB2  4  
ATOM 8836  H HB3  . MET A 1 118 ? -6.017  -5.907  -5.996  1.00 0.00 ? 118 MET A HB3  4  
ATOM 8837  H HG2  . MET A 1 118 ? -4.861  -4.183  -6.915  1.00 0.00 ? 118 MET A HG2  4  
ATOM 8838  H HG3  . MET A 1 118 ? -6.160  -3.949  -8.067  1.00 0.00 ? 118 MET A HG3  4  
ATOM 8839  H HE1  . MET A 1 118 ? -4.528  -2.962  -4.769  1.00 0.00 ? 118 MET A HE1  4  
ATOM 8840  H HE2  . MET A 1 118 ? -5.642  -1.777  -4.045  1.00 0.00 ? 118 MET A HE2  4  
ATOM 8841  H HE3  . MET A 1 118 ? -6.085  -3.501  -4.091  1.00 0.00 ? 118 MET A HE3  4  
ATOM 8842  N N    . THR A 1 119 ? -6.949  -7.893  -8.237  1.00 0.00 ? 119 THR A N    4  
ATOM 8843  C CA   . THR A 1 119 ? -6.254  -8.781  -9.153  1.00 0.00 ? 119 THR A CA   4  
ATOM 8844  C C    . THR A 1 119 ? -7.258  -9.602  -9.966  1.00 0.00 ? 119 THR A C    4  
ATOM 8845  O O    . THR A 1 119 ? -6.917  -10.658 -10.495 1.00 0.00 ? 119 THR A O    4  
ATOM 8846  C CB   . THR A 1 119 ? -5.286  -9.640  -8.337  1.00 0.00 ? 119 THR A CB   4  
ATOM 8847  O OG1  . THR A 1 119 ? -4.405  -8.695  -7.736  1.00 0.00 ? 119 THR A OG1  4  
ATOM 8848  C CG2  . THR A 1 119 ? -4.372  -10.492 -9.220  1.00 0.00 ? 119 THR A CG2  4  
ATOM 8849  H H    . THR A 1 119 ? -7.446  -8.352  -7.500  1.00 0.00 ? 119 THR A H    4  
ATOM 8850  H HA   . THR A 1 119 ? -5.692  -8.173  -9.862  1.00 0.00 ? 119 THR A HA   4  
ATOM 8851  H HB   . THR A 1 119 ? -5.826  -10.261 -7.621  1.00 0.00 ? 119 THR A HB   4  
ATOM 8852  H HG1  . THR A 1 119 ? -3.818  -9.151  -7.068  1.00 0.00 ? 119 THR A HG1  4  
ATOM 8853  H HG21 . THR A 1 119 ? -3.995  -9.887  -10.044 1.00 0.00 ? 119 THR A HG21 4  
ATOM 8854  H HG22 . THR A 1 119 ? -3.535  -10.861 -8.626  1.00 0.00 ? 119 THR A HG22 4  
ATOM 8855  H HG23 . THR A 1 119 ? -4.936  -11.337 -9.617  1.00 0.00 ? 119 THR A HG23 4  
ATOM 8856  N N    . HIS A 1 120 ? -8.475  -9.084  -10.039 1.00 0.00 ? 120 HIS A N    4  
ATOM 8857  C CA   . HIS A 1 120 ? -9.531  -9.756  -10.778 1.00 0.00 ? 120 HIS A CA   4  
ATOM 8858  C C    . HIS A 1 120 ? -9.578  -9.218  -12.209 1.00 0.00 ? 120 HIS A C    4  
ATOM 8859  O O    . HIS A 1 120 ? -8.871  -8.269  -12.543 1.00 0.00 ? 120 HIS A O    4  
ATOM 8860  C CB   . HIS A 1 120 ? -10.871 -9.625  -10.050 1.00 0.00 ? 120 HIS A CB   4  
ATOM 8861  C CG   . HIS A 1 120 ? -11.541 -10.947 -9.756  1.00 0.00 ? 120 HIS A CG   4  
ATOM 8862  N ND1  . HIS A 1 120 ? -10.832 -12.116 -9.547  1.00 0.00 ? 120 HIS A ND1  4  
ATOM 8863  C CD2  . HIS A 1 120 ? -12.862 -11.269 -9.637  1.00 0.00 ? 120 HIS A CD2  4  
ATOM 8864  C CE1  . HIS A 1 120 ? -11.697 -13.093 -9.315  1.00 0.00 ? 120 HIS A CE1  4  
ATOM 8865  N NE2  . HIS A 1 120 ? -12.954 -12.566 -9.371  1.00 0.00 ? 120 HIS A NE2  4  
ATOM 8866  H H    . HIS A 1 120 ? -8.744  -8.225  -9.605  1.00 0.00 ? 120 HIS A H    4  
ATOM 8867  H HA   . HIS A 1 120 ? -9.270  -10.815 -10.804 1.00 0.00 ? 120 HIS A HA   4  
ATOM 8868  H HB2  . HIS A 1 120 ? -10.713 -9.092  -9.113  1.00 0.00 ? 120 HIS A HB2  4  
ATOM 8869  H HB3  . HIS A 1 120 ? -11.543 -9.016  -10.655 1.00 0.00 ? 120 HIS A HB3  4  
ATOM 8870  H HD1  . HIS A 1 120 ? -9.837  -12.209 -9.568  1.00 0.00 ? 120 HIS A HD1  4  
ATOM 8871  H HD2  . HIS A 1 120 ? -13.698 -10.578 -9.742  1.00 0.00 ? 120 HIS A HD2  4  
ATOM 8872  H HE1  . HIS A 1 120 ? -11.448 -14.135 -9.113  1.00 0.00 ? 120 HIS A HE1  4  
ATOM 8873  H HE2  . HIS A 1 120 ? -13.802 -13.060 -9.179  1.00 0.00 ? 120 HIS A HE2  4  
ATOM 8874  N N    . ASN A 1 121 ? -10.419 -9.848  -13.017 1.00 0.00 ? 121 ASN A N    4  
ATOM 8875  C CA   . ASN A 1 121 ? -10.567 -9.444  -14.404 1.00 0.00 ? 121 ASN A CA   4  
ATOM 8876  C C    . ASN A 1 121 ? -12.049 -9.218  -14.709 1.00 0.00 ? 121 ASN A C    4  
ATOM 8877  O O    . ASN A 1 121 ? -12.812 -10.173 -14.847 1.00 0.00 ? 121 ASN A O    4  
ATOM 8878  C CB   . ASN A 1 121 ? -10.051 -10.530 -15.351 1.00 0.00 ? 121 ASN A CB   4  
ATOM 8879  C CG   . ASN A 1 121 ? -8.534  -10.689 -15.228 1.00 0.00 ? 121 ASN A CG   4  
ATOM 8880  O OD1  . ASN A 1 121 ? -7.921  -10.303 -14.246 1.00 0.00 ? 121 ASN A OD1  4  
ATOM 8881  N ND2  . ASN A 1 121 ? -7.965  -11.279 -16.275 1.00 0.00 ? 121 ASN A ND2  4  
ATOM 8882  H H    . ASN A 1 121 ? -10.990 -10.619 -12.737 1.00 0.00 ? 121 ASN A H    4  
ATOM 8883  H HA   . ASN A 1 121 ? -9.977  -8.534  -14.503 1.00 0.00 ? 121 ASN A HA   4  
ATOM 8884  H HB2  . ASN A 1 121 ? -10.540 -11.478 -15.126 1.00 0.00 ? 121 ASN A HB2  4  
ATOM 8885  H HB3  . ASN A 1 121 ? -10.310 -10.274 -16.379 1.00 0.00 ? 121 ASN A HB3  4  
ATOM 8886  H HD21 . ASN A 1 121 ? -8.525  -11.573 -17.049 1.00 0.00 ? 121 ASN A HD21 4  
ATOM 8887  H HD22 . ASN A 1 121 ? -6.976  -11.429 -16.288 1.00 0.00 ? 121 ASN A HD22 4  
ATOM 8888  N N    . PRO A 1 122 ? -12.422 -7.913  -14.808 1.00 0.00 ? 122 PRO A N    4  
ATOM 8889  C CA   . PRO A 1 122 ? -11.455 -6.843  -14.631 1.00 0.00 ? 122 PRO A CA   4  
ATOM 8890  C C    . PRO A 1 122 ? -11.099 -6.664  -13.154 1.00 0.00 ? 122 PRO A C    4  
ATOM 8891  O O    . PRO A 1 122 ? -11.855 -7.074  -12.275 1.00 0.00 ? 122 PRO A O    4  
ATOM 8892  C CB   . PRO A 1 122 ? -12.115 -5.613  -15.236 1.00 0.00 ? 122 PRO A CB   4  
ATOM 8893  C CG   . PRO A 1 122 ? -13.600 -5.930  -15.308 1.00 0.00 ? 122 PRO A CG   4  
ATOM 8894  C CD   . PRO A 1 122 ? -13.769 -7.425  -15.090 1.00 0.00 ? 122 PRO A CD   4  
ATOM 8895  H HA   . PRO A 1 122 ? -10.598 -7.069  -15.094 1.00 0.00 ? 122 PRO A HA   4  
ATOM 8896  H HB2  . PRO A 1 122 ? -11.933 -4.731  -14.621 1.00 0.00 ? 122 PRO A HB2  4  
ATOM 8897  H HB3  . PRO A 1 122 ? -11.711 -5.401  -16.226 1.00 0.00 ? 122 PRO A HB3  4  
ATOM 8898  H HG2  . PRO A 1 122 ? -14.147 -5.369  -14.551 1.00 0.00 ? 122 PRO A HG2  4  
ATOM 8899  H HG3  . PRO A 1 122 ? -14.006 -5.637  -16.276 1.00 0.00 ? 122 PRO A HG3  4  
ATOM 8900  H HD2  . PRO A 1 122 ? -14.446 -7.630  -14.260 1.00 0.00 ? 122 PRO A HD2  4  
ATOM 8901  H HD3  . PRO A 1 122 ? -14.189 -7.909  -15.971 1.00 0.00 ? 122 PRO A HD3  4  
ATOM 8902  N N    . PRO A 1 123 ? -9.915  -6.037  -12.920 1.00 0.00 ? 123 PRO A N    4  
ATOM 8903  C CA   . PRO A 1 123 ? -9.448  -5.800  -11.565 1.00 0.00 ? 123 PRO A CA   4  
ATOM 8904  C C    . PRO A 1 123 ? -10.225 -4.655  -10.911 1.00 0.00 ? 123 PRO A C    4  
ATOM 8905  O O    . PRO A 1 123 ? -10.178 -3.520  -11.382 1.00 0.00 ? 123 PRO A O    4  
ATOM 8906  C CB   . PRO A 1 123 ? -7.964  -5.507  -11.706 1.00 0.00 ? 123 PRO A CB   4  
ATOM 8907  C CG   . PRO A 1 123 ? -7.748  -5.133  -13.163 1.00 0.00 ? 123 PRO A CG   4  
ATOM 8908  C CD   . PRO A 1 123 ? -8.993  -5.539  -13.936 1.00 0.00 ? 123 PRO A CD   4  
ATOM 8909  H HA   . PRO A 1 123 ? -9.616  -6.604  -10.995 1.00 0.00 ? 123 PRO A HA   4  
ATOM 8910  H HB2  . PRO A 1 123 ? -7.661  -4.694  -11.045 1.00 0.00 ? 123 PRO A HB2  4  
ATOM 8911  H HB3  . PRO A 1 123 ? -7.367  -6.377  -11.432 1.00 0.00 ? 123 PRO A HB3  4  
ATOM 8912  H HG2  . PRO A 1 123 ? -7.570  -4.063  -13.260 1.00 0.00 ? 123 PRO A HG2  4  
ATOM 8913  H HG3  . PRO A 1 123 ? -6.869  -5.641  -13.560 1.00 0.00 ? 123 PRO A HG3  4  
ATOM 8914  H HD2  . PRO A 1 123 ? -9.418  -4.692  -14.475 1.00 0.00 ? 123 PRO A HD2  4  
ATOM 8915  H HD3  . PRO A 1 123 ? -8.767  -6.307  -14.677 1.00 0.00 ? 123 PRO A HD3  4  
ATOM 8916  N N    . ILE A 1 124 ? -10.921 -4.992  -9.834  1.00 0.00 ? 124 ILE A N    4  
ATOM 8917  C CA   . ILE A 1 124 ? -11.705 -4.007  -9.111  1.00 0.00 ? 124 ILE A CA   4  
ATOM 8918  C C    . ILE A 1 124 ? -10.763 -3.061  -8.362  1.00 0.00 ? 124 ILE A C    4  
ATOM 8919  O O    . ILE A 1 124 ? -9.875  -3.509  -7.640  1.00 0.00 ? 124 ILE A O    4  
ATOM 8920  C CB   . ILE A 1 124 ? -12.730 -4.695  -8.209  1.00 0.00 ? 124 ILE A CB   4  
ATOM 8921  C CG1  . ILE A 1 124 ? -13.762 -5.463  -9.037  1.00 0.00 ? 124 ILE A CG1  4  
ATOM 8922  C CG2  . ILE A 1 124 ? -13.388 -3.691  -7.260  1.00 0.00 ? 124 ILE A CG2  4  
ATOM 8923  C CD1  . ILE A 1 124 ? -13.365 -6.934  -9.181  1.00 0.00 ? 124 ILE A CD1  4  
ATOM 8924  H H    . ILE A 1 124 ? -10.952 -5.918  -9.458  1.00 0.00 ? 124 ILE A H    4  
ATOM 8925  H HA   . ILE A 1 124 ? -12.262 -3.427  -9.848  1.00 0.00 ? 124 ILE A HA   4  
ATOM 8926  H HB   . ILE A 1 124 ? -12.206 -5.425  -7.591  1.00 0.00 ? 124 ILE A HB   4  
ATOM 8927  H HG12 . ILE A 1 124 ? -14.741 -5.392  -8.562  1.00 0.00 ? 124 ILE A HG12 4  
ATOM 8928  H HG13 . ILE A 1 124 ? -13.853 -5.009  -10.024 1.00 0.00 ? 124 ILE A HG13 4  
ATOM 8929  H HG21 . ILE A 1 124 ? -12.703 -2.866  -7.072  1.00 0.00 ? 124 ILE A HG21 4  
ATOM 8930  H HG22 . ILE A 1 124 ? -14.303 -3.308  -7.714  1.00 0.00 ? 124 ILE A HG22 4  
ATOM 8931  H HG23 . ILE A 1 124 ? -13.629 -4.185  -6.318  1.00 0.00 ? 124 ILE A HG23 4  
ATOM 8932  H HD11 . ILE A 1 124 ? -12.610 -7.182  -8.436  1.00 0.00 ? 124 ILE A HD11 4  
ATOM 8933  H HD12 . ILE A 1 124 ? -14.243 -7.564  -9.033  1.00 0.00 ? 124 ILE A HD12 4  
ATOM 8934  H HD13 . ILE A 1 124 ? -12.960 -7.104  -10.179 1.00 0.00 ? 124 ILE A HD13 4  
ATOM 8935  N N    . PRO A 1 125 ? -10.996 -1.737  -8.567  1.00 0.00 ? 125 PRO A N    4  
ATOM 8936  C CA   . PRO A 1 125 ? -10.180 -0.725  -7.920  1.00 0.00 ? 125 PRO A CA   4  
ATOM 8937  C C    . PRO A 1 125 ? -10.539 -0.595  -6.439  1.00 0.00 ? 125 PRO A C    4  
ATOM 8938  O O    . PRO A 1 125 ? -10.741 0.511   -5.939  1.00 0.00 ? 125 PRO A O    4  
ATOM 8939  C CB   . PRO A 1 125 ? -10.436 0.550   -8.707  1.00 0.00 ? 125 PRO A CB   4  
ATOM 8940  C CG   . PRO A 1 125 ? -11.730 0.316   -9.469  1.00 0.00 ? 125 PRO A CG   4  
ATOM 8941  C CD   . PRO A 1 125 ? -12.041 -1.171  -9.417  1.00 0.00 ? 125 PRO A CD   4  
ATOM 8942  H HA   . PRO A 1 125 ? -9.215  -0.988  -7.945  1.00 0.00 ? 125 PRO A HA   4  
ATOM 8943  H HB2  . PRO A 1 125 ? -10.524 1.409   -8.042  1.00 0.00 ? 125 PRO A HB2  4  
ATOM 8944  H HB3  . PRO A 1 125 ? -9.613  0.759   -9.391  1.00 0.00 ? 125 PRO A HB3  4  
ATOM 8945  H HG2  . PRO A 1 125 ? -12.544 0.892   -9.025  1.00 0.00 ? 125 PRO A HG2  4  
ATOM 8946  H HG3  . PRO A 1 125 ? -11.631 0.649   -10.502 1.00 0.00 ? 125 PRO A HG3  4  
ATOM 8947  H HD2  . PRO A 1 125 ? -13.032 -1.354  -9.002  1.00 0.00 ? 125 PRO A HD2  4  
ATOM 8948  H HD3  . PRO A 1 125 ? -12.025 -1.613  -10.412 1.00 0.00 ? 125 PRO A HD3  4  
ATOM 8949  N N    . VAL A 1 126 ? -10.610 -1.740  -5.777  1.00 0.00 ? 126 VAL A N    4  
ATOM 8950  C CA   . VAL A 1 126 ? -10.942 -1.768  -4.363  1.00 0.00 ? 126 VAL A CA   4  
ATOM 8951  C C    . VAL A 1 126 ? -10.013 -0.817  -3.606  1.00 0.00 ? 126 VAL A C    4  
ATOM 8952  O O    . VAL A 1 126 ? -10.419 -0.197  -2.625  1.00 0.00 ? 126 VAL A O    4  
ATOM 8953  C CB   . VAL A 1 126 ? -10.881 -3.205  -3.839  1.00 0.00 ? 126 VAL A CB   4  
ATOM 8954  C CG1  . VAL A 1 126 ? -9.588  -3.894  -4.279  1.00 0.00 ? 126 VAL A CG1  4  
ATOM 8955  C CG2  . VAL A 1 126 ? -11.031 -3.241  -2.317  1.00 0.00 ? 126 VAL A CG2  4  
ATOM 8956  H H    . VAL A 1 126 ? -10.445 -2.635  -6.190  1.00 0.00 ? 126 VAL A H    4  
ATOM 8957  H HA   . VAL A 1 126 ? -11.968 -1.414  -4.258  1.00 0.00 ? 126 VAL A HA   4  
ATOM 8958  H HB   . VAL A 1 126 ? -11.717 -3.755  -4.271  1.00 0.00 ? 126 VAL A HB   4  
ATOM 8959  H HG11 . VAL A 1 126 ? -9.017  -3.221  -4.917  1.00 0.00 ? 126 VAL A HG11 4  
ATOM 8960  H HG12 . VAL A 1 126 ? -8.997  -4.152  -3.401  1.00 0.00 ? 126 VAL A HG12 4  
ATOM 8961  H HG13 . VAL A 1 126 ? -9.831  -4.802  -4.834  1.00 0.00 ? 126 VAL A HG13 4  
ATOM 8962  H HG21 . VAL A 1 126 ? -11.718 -2.455  -2.001  1.00 0.00 ? 126 VAL A HG21 4  
ATOM 8963  H HG22 . VAL A 1 126 ? -11.425 -4.211  -2.014  1.00 0.00 ? 126 VAL A HG22 4  
ATOM 8964  H HG23 . VAL A 1 126 ? -10.058 -3.082  -1.852  1.00 0.00 ? 126 VAL A HG23 4  
ATOM 8965  N N    . GLY A 1 127 ? -8.783  -0.732  -4.091  1.00 0.00 ? 127 GLY A N    4  
ATOM 8966  C CA   . GLY A 1 127 ? -7.793  0.133   -3.472  1.00 0.00 ? 127 GLY A CA   4  
ATOM 8967  C C    . GLY A 1 127 ? -8.136  1.607   -3.695  1.00 0.00 ? 127 GLY A C    4  
ATOM 8968  O O    . GLY A 1 127 ? -8.509  2.310   -2.758  1.00 0.00 ? 127 GLY A O    4  
ATOM 8969  H H    . GLY A 1 127 ? -8.460  -1.240  -4.890  1.00 0.00 ? 127 GLY A H    4  
ATOM 8970  H HA2  . GLY A 1 127 ? -7.740  -0.074  -2.404  1.00 0.00 ? 127 GLY A HA2  4  
ATOM 8971  H HA3  . GLY A 1 127 ? -6.808  -0.080  -3.888  1.00 0.00 ? 127 GLY A HA3  4  
ATOM 8972  N N    . GLU A 1 128 ? -7.999  2.032   -4.944  1.00 0.00 ? 128 GLU A N    4  
ATOM 8973  C CA   . GLU A 1 128 ? -8.291  3.409   -5.302  1.00 0.00 ? 128 GLU A CA   4  
ATOM 8974  C C    . GLU A 1 128 ? -9.635  3.839   -4.708  1.00 0.00 ? 128 GLU A C    4  
ATOM 8975  O O    . GLU A 1 128 ? -9.786  4.975   -4.264  1.00 0.00 ? 128 GLU A O    4  
ATOM 8976  C CB   . GLU A 1 128 ? -8.278  3.595   -6.820  1.00 0.00 ? 128 GLU A CB   4  
ATOM 8977  C CG   . GLU A 1 128 ? -6.963  4.228   -7.283  1.00 0.00 ? 128 GLU A CG   4  
ATOM 8978  C CD   . GLU A 1 128 ? -7.131  4.906   -8.644  1.00 0.00 ? 128 GLU A CD   4  
ATOM 8979  O OE1  . GLU A 1 128 ? -7.786  4.287   -9.510  1.00 0.00 ? 128 GLU A OE1  4  
ATOM 8980  O OE2  . GLU A 1 128 ? -6.600  6.029   -8.788  1.00 0.00 ? 128 GLU A OE2  4  
ATOM 8981  H H    . GLU A 1 128 ? -7.696  1.453   -5.700  1.00 0.00 ? 128 GLU A H    4  
ATOM 8982  H HA   . GLU A 1 128 ? -7.488  4.000   -4.862  1.00 0.00 ? 128 GLU A HA   4  
ATOM 8983  H HB2  . GLU A 1 128 ? -8.413  2.632   -7.310  1.00 0.00 ? 128 GLU A HB2  4  
ATOM 8984  H HB3  . GLU A 1 128 ? -9.114  4.226   -7.121  1.00 0.00 ? 128 GLU A HB3  4  
ATOM 8985  H HG2  . GLU A 1 128 ? -6.628  4.960   -6.547  1.00 0.00 ? 128 GLU A HG2  4  
ATOM 8986  H HG3  . GLU A 1 128 ? -6.190  3.463   -7.347  1.00 0.00 ? 128 GLU A HG3  4  
ATOM 8987  N N    . ILE A 1 129 ? -10.576 2.906   -4.722  1.00 0.00 ? 129 ILE A N    4  
ATOM 8988  C CA   . ILE A 1 129 ? -11.903 3.175   -4.191  1.00 0.00 ? 129 ILE A CA   4  
ATOM 8989  C C    . ILE A 1 129 ? -11.790 3.539   -2.709  1.00 0.00 ? 129 ILE A C    4  
ATOM 8990  O O    . ILE A 1 129 ? -12.235 4.607   -2.294  1.00 0.00 ? 129 ILE A O    4  
ATOM 8991  C CB   . ILE A 1 129 ? -12.838 1.995   -4.465  1.00 0.00 ? 129 ILE A CB   4  
ATOM 8992  C CG1  . ILE A 1 129 ? -13.090 1.833   -5.966  1.00 0.00 ? 129 ILE A CG1  4  
ATOM 8993  C CG2  . ILE A 1 129 ? -14.141 2.134   -3.677  1.00 0.00 ? 129 ILE A CG2  4  
ATOM 8994  C CD1  . ILE A 1 129 ? -13.283 0.360   -6.334  1.00 0.00 ? 129 ILE A CD1  4  
ATOM 8995  H H    . ILE A 1 129 ? -10.445 1.984   -5.087  1.00 0.00 ? 129 ILE A H    4  
ATOM 8996  H HA   . ILE A 1 129 ? -12.302 4.034   -4.729  1.00 0.00 ? 129 ILE A HA   4  
ATOM 8997  H HB   . ILE A 1 129 ? -12.348 1.083   -4.122  1.00 0.00 ? 129 ILE A HB   4  
ATOM 8998  H HG12 . ILE A 1 129 ? -13.975 2.402   -6.253  1.00 0.00 ? 129 ILE A HG12 4  
ATOM 8999  H HG13 . ILE A 1 129 ? -12.251 2.245   -6.527  1.00 0.00 ? 129 ILE A HG13 4  
ATOM 9000  H HG21 . ILE A 1 129 ? -14.119 3.057   -3.099  1.00 0.00 ? 129 ILE A HG21 4  
ATOM 9001  H HG22 . ILE A 1 129 ? -14.983 2.157   -4.367  1.00 0.00 ? 129 ILE A HG22 4  
ATOM 9002  H HG23 . ILE A 1 129 ? -14.248 1.285   -3.001  1.00 0.00 ? 129 ILE A HG23 4  
ATOM 9003  H HD11 . ILE A 1 129 ? -12.987 -0.266  -5.493  1.00 0.00 ? 129 ILE A HD11 4  
ATOM 9004  H HD12 . ILE A 1 129 ? -14.332 0.180   -6.570  1.00 0.00 ? 129 ILE A HD12 4  
ATOM 9005  H HD13 . ILE A 1 129 ? -12.669 0.119   -7.201  1.00 0.00 ? 129 ILE A HD13 4  
ATOM 9006  N N    . TYR A 1 130 ? -11.193 2.629   -1.953  1.00 0.00 ? 130 TYR A N    4  
ATOM 9007  C CA   . TYR A 1 130 ? -11.017 2.841   -0.526  1.00 0.00 ? 130 TYR A CA   4  
ATOM 9008  C C    . TYR A 1 130 ? -10.237 4.129   -0.256  1.00 0.00 ? 130 TYR A C    4  
ATOM 9009  O O    . TYR A 1 130 ? -10.547 4.860   0.682   1.00 0.00 ? 130 TYR A O    4  
ATOM 9010  C CB   . TYR A 1 130 ? -10.200 1.649   -0.021  1.00 0.00 ? 130 TYR A CB   4  
ATOM 9011  C CG   . TYR A 1 130 ? -10.401 1.342   1.464   1.00 0.00 ? 130 TYR A CG   4  
ATOM 9012  C CD1  . TYR A 1 130 ? -11.669 1.373   2.009   1.00 0.00 ? 130 TYR A CD1  4  
ATOM 9013  C CD2  . TYR A 1 130 ? -9.316  1.035   2.258   1.00 0.00 ? 130 TYR A CD2  4  
ATOM 9014  C CE1  . TYR A 1 130 ? -11.858 1.085   3.408   1.00 0.00 ? 130 TYR A CE1  4  
ATOM 9015  C CE2  . TYR A 1 130 ? -9.505  0.747   3.656   1.00 0.00 ? 130 TYR A CE2  4  
ATOM 9016  C CZ   . TYR A 1 130 ? -10.767 0.786   4.162   1.00 0.00 ? 130 TYR A CZ   4  
ATOM 9017  O OH   . TYR A 1 130 ? -10.945 0.513   5.483   1.00 0.00 ? 130 TYR A OH   4  
ATOM 9018  H H    . TYR A 1 130 ? -10.834 1.762   -2.300  1.00 0.00 ? 130 TYR A H    4  
ATOM 9019  H HA   . TYR A 1 130 ? -12.005 2.920   -0.074  1.00 0.00 ? 130 TYR A HA   4  
ATOM 9020  H HB2  . TYR A 1 130 ? -10.467 0.766   -0.604  1.00 0.00 ? 130 TYR A HB2  4  
ATOM 9021  H HB3  . TYR A 1 130 ? -9.144  1.843   -0.202  1.00 0.00 ? 130 TYR A HB3  4  
ATOM 9022  H HD1  . TYR A 1 130 ? -12.527 1.616   1.382   1.00 0.00 ? 130 TYR A HD1  4  
ATOM 9023  H HD2  . TYR A 1 130 ? -8.315  1.011   1.827   1.00 0.00 ? 130 TYR A HD2  4  
ATOM 9024  H HE1  . TYR A 1 130 ? -12.853 1.106   3.851   1.00 0.00 ? 130 TYR A HE1  4  
ATOM 9025  H HE2  . TYR A 1 130 ? -8.656  0.502   4.295   1.00 0.00 ? 130 TYR A HE2  4  
ATOM 9026  H HH   . TYR A 1 130 ? -11.369 -0.386  5.592   1.00 0.00 ? 130 TYR A HH   4  
ATOM 9027  N N    . LYS A 1 131 ? -9.239  4.367   -1.096  1.00 0.00 ? 131 LYS A N    4  
ATOM 9028  C CA   . LYS A 1 131 ? -8.413  5.554   -0.959  1.00 0.00 ? 131 LYS A CA   4  
ATOM 9029  C C    . LYS A 1 131 ? -9.303  6.797   -1.005  1.00 0.00 ? 131 LYS A C    4  
ATOM 9030  O O    . LYS A 1 131 ? -9.147  7.707   -0.192  1.00 0.00 ? 131 LYS A O    4  
ATOM 9031  C CB   . LYS A 1 131 ? -7.300  5.555   -2.007  1.00 0.00 ? 131 LYS A CB   4  
ATOM 9032  C CG   . LYS A 1 131 ? -6.804  6.978   -2.280  1.00 0.00 ? 131 LYS A CG   4  
ATOM 9033  C CD   . LYS A 1 131 ? -7.499  7.574   -3.506  1.00 0.00 ? 131 LYS A CD   4  
ATOM 9034  C CE   . LYS A 1 131 ? -6.914  7.004   -4.800  1.00 0.00 ? 131 LYS A CE   4  
ATOM 9035  N NZ   . LYS A 1 131 ? -7.020  7.992   -5.896  1.00 0.00 ? 131 LYS A NZ   4  
ATOM 9036  H H    . LYS A 1 131 ? -8.994  3.766   -1.856  1.00 0.00 ? 131 LYS A H    4  
ATOM 9037  H HA   . LYS A 1 131 ? -7.935  5.507   0.019   1.00 0.00 ? 131 LYS A HA   4  
ATOM 9038  H HB2  . LYS A 1 131 ? -6.470  4.937   -1.664  1.00 0.00 ? 131 LYS A HB2  4  
ATOM 9039  H HB3  . LYS A 1 131 ? -7.666  5.110   -2.933  1.00 0.00 ? 131 LYS A HB3  4  
ATOM 9040  H HG2  . LYS A 1 131 ? -6.994  7.605   -1.410  1.00 0.00 ? 131 LYS A HG2  4  
ATOM 9041  H HG3  . LYS A 1 131 ? -5.726  6.967   -2.438  1.00 0.00 ? 131 LYS A HG3  4  
ATOM 9042  H HD2  . LYS A 1 131 ? -8.568  7.362   -3.462  1.00 0.00 ? 131 LYS A HD2  4  
ATOM 9043  H HD3  . LYS A 1 131 ? -7.388  8.658   -3.500  1.00 0.00 ? 131 LYS A HD3  4  
ATOM 9044  H HE2  . LYS A 1 131 ? -5.869  6.733   -4.645  1.00 0.00 ? 131 LYS A HE2  4  
ATOM 9045  H HE3  . LYS A 1 131 ? -7.443  6.090   -5.073  1.00 0.00 ? 131 LYS A HE3  4  
ATOM 9046  H HZ1  . LYS A 1 131 ? -6.623  8.860   -5.601  1.00 0.00 ? 131 LYS A HZ1  4  
ATOM 9047  H HZ2  . LYS A 1 131 ? -6.526  7.654   -6.697  1.00 0.00 ? 131 LYS A HZ2  4  
ATOM 9048  H HZ3  . LYS A 1 131 ? -7.982  8.128   -6.131  1.00 0.00 ? 131 LYS A HZ3  4  
ATOM 9049  N N    . ARG A 1 132 ? -10.217 6.797   -1.964  1.00 0.00 ? 132 ARG A N    4  
ATOM 9050  C CA   . ARG A 1 132 ? -11.131 7.914   -2.127  1.00 0.00 ? 132 ARG A CA   4  
ATOM 9051  C C    . ARG A 1 132 ? -12.106 7.979   -0.949  1.00 0.00 ? 132 ARG A C    4  
ATOM 9052  O O    . ARG A 1 132 ? -12.506 9.063   -0.529  1.00 0.00 ? 132 ARG A O    4  
ATOM 9053  C CB   . ARG A 1 132 ? -11.924 7.792   -3.430  1.00 0.00 ? 132 ARG A CB   4  
ATOM 9054  C CG   . ARG A 1 132 ? -12.189 9.168   -4.043  1.00 0.00 ? 132 ARG A CG   4  
ATOM 9055  C CD   . ARG A 1 132 ? -11.103 9.534   -5.056  1.00 0.00 ? 132 ARG A CD   4  
ATOM 9056  N NE   . ARG A 1 132 ? -10.121 10.453  -4.438  1.00 0.00 ? 132 ARG A NE   4  
ATOM 9057  C CZ   . ARG A 1 132 ? -10.390 11.720  -4.097  1.00 0.00 ? 132 ARG A CZ   4  
ATOM 9058  N NH1  . ARG A 1 132 ? -11.611 12.228  -4.313  1.00 0.00 ? 132 ARG A NH1  4  
ATOM 9059  N NH2  . ARG A 1 132 ? -9.437  12.480  -3.541  1.00 0.00 ? 132 ARG A NH2  4  
ATOM 9060  H H    . ARG A 1 132 ? -10.337 6.053   -2.622  1.00 0.00 ? 132 ARG A H    4  
ATOM 9061  H HA   . ARG A 1 132 ? -10.492 8.796   -2.156  1.00 0.00 ? 132 ARG A HA   4  
ATOM 9062  H HB2  . ARG A 1 132 ? -11.373 7.173   -4.138  1.00 0.00 ? 132 ARG A HB2  4  
ATOM 9063  H HB3  . ARG A 1 132 ? -12.872 7.287   -3.236  1.00 0.00 ? 132 ARG A HB3  4  
ATOM 9064  H HG2  . ARG A 1 132 ? -13.163 9.172   -4.530  1.00 0.00 ? 132 ARG A HG2  4  
ATOM 9065  H HG3  . ARG A 1 132 ? -12.223 9.921   -3.255  1.00 0.00 ? 132 ARG A HG3  4  
ATOM 9066  H HD2  . ARG A 1 132 ? -10.600 8.632   -5.406  1.00 0.00 ? 132 ARG A HD2  4  
ATOM 9067  H HD3  . ARG A 1 132 ? -11.554 10.005  -5.930  1.00 0.00 ? 132 ARG A HD3  4  
ATOM 9068  H HE   . ARG A 1 132 ? -9.199  10.106  -4.264  1.00 0.00 ? 132 ARG A HE   4  
ATOM 9069  H HH11 . ARG A 1 132 ? -12.323 11.660  -4.728  1.00 0.00 ? 132 ARG A HH11 4  
ATOM 9070  H HH12 . ARG A 1 132 ? -11.812 13.174  -4.059  1.00 0.00 ? 132 ARG A HH12 4  
ATOM 9071  H HH21 . ARG A 1 132 ? -8.526  12.102  -3.380  1.00 0.00 ? 132 ARG A HH21 4  
ATOM 9072  H HH22 . ARG A 1 132 ? -9.637  13.426  -3.287  1.00 0.00 ? 132 ARG A HH22 4  
ATOM 9073  N N    . TRP A 1 133 ? -12.457 6.803   -0.448  1.00 0.00 ? 133 TRP A N    4  
ATOM 9074  C CA   . TRP A 1 133 ? -13.377 6.713   0.673   1.00 0.00 ? 133 TRP A CA   4  
ATOM 9075  C C    . TRP A 1 133 ? -12.726 7.400   1.875   1.00 0.00 ? 133 TRP A C    4  
ATOM 9076  O O    . TRP A 1 133 ? -13.198 8.440   2.331   1.00 0.00 ? 133 TRP A O    4  
ATOM 9077  C CB   . TRP A 1 133 ? -13.760 5.258   0.951   1.00 0.00 ? 133 TRP A CB   4  
ATOM 9078  C CG   . TRP A 1 133 ? -14.789 4.687   -0.026  1.00 0.00 ? 133 TRP A CG   4  
ATOM 9079  C CD1  . TRP A 1 133 ? -15.120 5.150   -1.239  1.00 0.00 ? 133 TRP A CD1  4  
ATOM 9080  C CD2  . TRP A 1 133 ? -15.613 3.520   0.177   1.00 0.00 ? 133 TRP A CD2  4  
ATOM 9081  N NE1  . TRP A 1 133 ? -16.092 4.370   -1.830  1.00 0.00 ? 133 TRP A NE1  4  
ATOM 9082  C CE2  . TRP A 1 133 ? -16.402 3.347   -0.942  1.00 0.00 ? 133 TRP A CE2  4  
ATOM 9083  C CE3  . TRP A 1 133 ? -15.689 2.638   1.270   1.00 0.00 ? 133 TRP A CE3  4  
ATOM 9084  C CZ2  . TRP A 1 133 ? -17.324 2.302   -1.077  1.00 0.00 ? 133 TRP A CZ2  4  
ATOM 9085  C CZ3  . TRP A 1 133 ? -16.616 1.600   1.120   1.00 0.00 ? 133 TRP A CZ3  4  
ATOM 9086  C CH2  . TRP A 1 133 ? -17.417 1.413   0.001   1.00 0.00 ? 133 TRP A CH2  4  
ATOM 9087  H H    . TRP A 1 133 ? -12.126 5.926   -0.795  1.00 0.00 ? 133 TRP A H    4  
ATOM 9088  H HA   . TRP A 1 133 ? -14.292 7.234   0.396   1.00 0.00 ? 133 TRP A HA   4  
ATOM 9089  H HB2  . TRP A 1 133 ? -12.860 4.643   0.917   1.00 0.00 ? 133 TRP A HB2  4  
ATOM 9090  H HB3  . TRP A 1 133 ? -14.156 5.185   1.964   1.00 0.00 ? 133 TRP A HB3  4  
ATOM 9091  H HD1  . TRP A 1 133 ? -14.676 6.032   -1.702  1.00 0.00 ? 133 TRP A HD1  4  
ATOM 9092  H HE1  . TRP A 1 133 ? -16.536 4.528   -2.814  1.00 0.00 ? 133 TRP A HE1  4  
ATOM 9093  H HE3  . TRP A 1 133 ? -15.077 2.754   2.165   1.00 0.00 ? 133 TRP A HE3  4  
ATOM 9094  H HZ2  . TRP A 1 133 ? -17.935 2.187   -1.971  1.00 0.00 ? 133 TRP A HZ2  4  
ATOM 9095  H HZ3  . TRP A 1 133 ? -16.715 0.888   1.940   1.00 0.00 ? 133 TRP A HZ3  4  
ATOM 9096  H HH2  . TRP A 1 133 ? -18.115 0.576   -0.040  1.00 0.00 ? 133 TRP A HH2  4  
ATOM 9097  N N    . ILE A 1 134 ? -11.651 6.791   2.354   1.00 0.00 ? 134 ILE A N    4  
ATOM 9098  C CA   . ILE A 1 134 ? -10.930 7.331   3.495   1.00 0.00 ? 134 ILE A CA   4  
ATOM 9099  C C    . ILE A 1 134 ? -10.749 8.838   3.310   1.00 0.00 ? 134 ILE A C    4  
ATOM 9100  O O    . ILE A 1 134 ? -11.036 9.617   4.218   1.00 0.00 ? 134 ILE A O    4  
ATOM 9101  C CB   . ILE A 1 134 ? -9.617  6.574   3.706   1.00 0.00 ? 134 ILE A CB   4  
ATOM 9102  C CG1  . ILE A 1 134 ? -9.871  5.192   4.311   1.00 0.00 ? 134 ILE A CG1  4  
ATOM 9103  C CG2  . ILE A 1 134 ? -8.640  7.397   4.547   1.00 0.00 ? 134 ILE A CG2  4  
ATOM 9104  C CD1  . ILE A 1 134 ? -8.554  4.467   4.594   1.00 0.00 ? 134 ILE A CD1  4  
ATOM 9105  H H    . ILE A 1 134 ? -11.273 5.944   1.978   1.00 0.00 ? 134 ILE A H    4  
ATOM 9106  H HA   . ILE A 1 134 ? -11.545 7.162   4.379   1.00 0.00 ? 134 ILE A HA   4  
ATOM 9107  H HB   . ILE A 1 134 ? -9.152  6.419   2.732   1.00 0.00 ? 134 ILE A HB   4  
ATOM 9108  H HG12 . ILE A 1 134 ? -10.440 5.296   5.235   1.00 0.00 ? 134 ILE A HG12 4  
ATOM 9109  H HG13 . ILE A 1 134 ? -10.479 4.598   3.628   1.00 0.00 ? 134 ILE A HG13 4  
ATOM 9110  H HG21 . ILE A 1 134 ? -8.575  8.409   4.144   1.00 0.00 ? 134 ILE A HG21 4  
ATOM 9111  H HG22 . ILE A 1 134 ? -8.993  7.439   5.577   1.00 0.00 ? 134 ILE A HG22 4  
ATOM 9112  H HG23 . ILE A 1 134 ? -7.655  6.932   4.519   1.00 0.00 ? 134 ILE A HG23 4  
ATOM 9113  H HD11 . ILE A 1 134 ? -7.919  5.097   5.217   1.00 0.00 ? 134 ILE A HD11 4  
ATOM 9114  H HD12 . ILE A 1 134 ? -8.760  3.531   5.115   1.00 0.00 ? 134 ILE A HD12 4  
ATOM 9115  H HD13 . ILE A 1 134 ? -8.047  4.256   3.653   1.00 0.00 ? 134 ILE A HD13 4  
ATOM 9116  N N    . ILE A 1 135 ? -10.273 9.205   2.129   1.00 0.00 ? 135 ILE A N    4  
ATOM 9117  C CA   . ILE A 1 135 ? -10.051 10.606  1.814   1.00 0.00 ? 135 ILE A CA   4  
ATOM 9118  C C    . ILE A 1 135 ? -11.371 11.368  1.933   1.00 0.00 ? 135 ILE A C    4  
ATOM 9119  O O    . ILE A 1 135 ? -11.388 12.529  2.337   1.00 0.00 ? 135 ILE A O    4  
ATOM 9120  C CB   . ILE A 1 135 ? -9.381  10.747  0.445   1.00 0.00 ? 135 ILE A CB   4  
ATOM 9121  C CG1  . ILE A 1 135 ? -7.859  10.822  0.584   1.00 0.00 ? 135 ILE A CG1  4  
ATOM 9122  C CG2  . ILE A 1 135 ? -9.947  11.943  -0.321  1.00 0.00 ? 135 ILE A CG2  4  
ATOM 9123  C CD1  . ILE A 1 135 ? -7.337  9.716   1.503   1.00 0.00 ? 135 ILE A CD1  4  
ATOM 9124  H H    . ILE A 1 135 ? -10.043 8.564   1.396   1.00 0.00 ? 135 ILE A H    4  
ATOM 9125  H HA   . ILE A 1 135 ? -9.355  11.001  2.554   1.00 0.00 ? 135 ILE A HA   4  
ATOM 9126  H HB   . ILE A 1 135 ? -9.608  9.854   -0.139  1.00 0.00 ? 135 ILE A HB   4  
ATOM 9127  H HG12 . ILE A 1 135 ? -7.396  10.732  -0.399  1.00 0.00 ? 135 ILE A HG12 4  
ATOM 9128  H HG13 . ILE A 1 135 ? -7.575  11.796  0.982   1.00 0.00 ? 135 ILE A HG13 4  
ATOM 9129  H HG21 . ILE A 1 135 ? -9.896  12.833  0.306   1.00 0.00 ? 135 ILE A HG21 4  
ATOM 9130  H HG22 . ILE A 1 135 ? -9.363  12.104  -1.227  1.00 0.00 ? 135 ILE A HG22 4  
ATOM 9131  H HG23 . ILE A 1 135 ? -10.985 11.746  -0.588  1.00 0.00 ? 135 ILE A HG23 4  
ATOM 9132  H HD11 . ILE A 1 135 ? -7.719  8.753   1.166   1.00 0.00 ? 135 ILE A HD11 4  
ATOM 9133  H HD12 . ILE A 1 135 ? -6.247  9.704   1.475   1.00 0.00 ? 135 ILE A HD12 4  
ATOM 9134  H HD13 . ILE A 1 135 ? -7.672  9.902   2.523   1.00 0.00 ? 135 ILE A HD13 4  
ATOM 9135  N N    . LEU A 1 136 ? -12.447 10.683  1.575   1.00 0.00 ? 136 LEU A N    4  
ATOM 9136  C CA   . LEU A 1 136 ? -13.770 11.281  1.638   1.00 0.00 ? 136 LEU A CA   4  
ATOM 9137  C C    . LEU A 1 136 ? -14.054 11.733  3.071   1.00 0.00 ? 136 LEU A C    4  
ATOM 9138  O O    . LEU A 1 136 ? -14.486 12.863  3.295   1.00 0.00 ? 136 LEU A O    4  
ATOM 9139  C CB   . LEU A 1 136 ? -14.821 10.318  1.077   1.00 0.00 ? 136 LEU A CB   4  
ATOM 9140  C CG   . LEU A 1 136 ? -15.778 10.902  0.037   1.00 0.00 ? 136 LEU A CG   4  
ATOM 9141  C CD1  . LEU A 1 136 ? -16.111 9.870   -1.041  1.00 0.00 ? 136 LEU A CD1  4  
ATOM 9142  C CD2  . LEU A 1 136 ? -17.037 11.461  0.704   1.00 0.00 ? 136 LEU A CD2  4  
ATOM 9143  H H    . LEU A 1 136 ? -12.426 9.738   1.247   1.00 0.00 ? 136 LEU A H    4  
ATOM 9144  H HA   . LEU A 1 136 ? -13.763 12.160  0.992   1.00 0.00 ? 136 LEU A HA   4  
ATOM 9145  H HB2  . LEU A 1 136 ? -14.304 9.468   0.631   1.00 0.00 ? 136 LEU A HB2  4  
ATOM 9146  H HB3  . LEU A 1 136 ? -15.410 9.931   1.909   1.00 0.00 ? 136 LEU A HB3  4  
ATOM 9147  H HG   . LEU A 1 136 ? -15.279 11.735  -0.458  1.00 0.00 ? 136 LEU A HG   4  
ATOM 9148  H HD11 . LEU A 1 136 ? -16.304 8.905   -0.573  1.00 0.00 ? 136 LEU A HD11 4  
ATOM 9149  H HD12 . LEU A 1 136 ? -16.997 10.191  -1.590  1.00 0.00 ? 136 LEU A HD12 4  
ATOM 9150  H HD13 . LEU A 1 136 ? -15.270 9.778   -1.729  1.00 0.00 ? 136 LEU A HD13 4  
ATOM 9151  H HD21 . LEU A 1 136 ? -16.801 11.774  1.721   1.00 0.00 ? 136 LEU A HD21 4  
ATOM 9152  H HD22 . LEU A 1 136 ? -17.399 12.318  0.135   1.00 0.00 ? 136 LEU A HD22 4  
ATOM 9153  H HD23 . LEU A 1 136 ? -17.807 10.690  0.730   1.00 0.00 ? 136 LEU A HD23 4  
ATOM 9154  N N    . GLY A 1 137 ? -13.798 10.829  4.005   1.00 0.00 ? 137 GLY A N    4  
ATOM 9155  C CA   . GLY A 1 137 ? -14.020 11.121  5.411   1.00 0.00 ? 137 GLY A CA   4  
ATOM 9156  C C    . GLY A 1 137 ? -13.097 12.242  5.890   1.00 0.00 ? 137 GLY A C    4  
ATOM 9157  O O    . GLY A 1 137 ? -13.551 13.207  6.503   1.00 0.00 ? 137 GLY A O    4  
ATOM 9158  H H    . GLY A 1 137 ? -13.447 9.912   3.814   1.00 0.00 ? 137 GLY A H    4  
ATOM 9159  H HA2  . GLY A 1 137 ? -15.060 11.410  5.566   1.00 0.00 ? 137 GLY A HA2  4  
ATOM 9160  H HA3  . GLY A 1 137 ? -13.847 10.223  6.004   1.00 0.00 ? 137 GLY A HA3  4  
ATOM 9161  N N    . LEU A 1 138 ? -11.815 12.079  5.592   1.00 0.00 ? 138 LEU A N    4  
ATOM 9162  C CA   . LEU A 1 138 ? -10.824 13.065  5.985   1.00 0.00 ? 138 LEU A CA   4  
ATOM 9163  C C    . LEU A 1 138 ? -11.251 14.443  5.476   1.00 0.00 ? 138 LEU A C    4  
ATOM 9164  O O    . LEU A 1 138 ? -11.152 15.434  6.196   1.00 0.00 ? 138 LEU A O    4  
ATOM 9165  C CB   . LEU A 1 138 ? -9.431  12.641  5.515   1.00 0.00 ? 138 LEU A CB   4  
ATOM 9166  C CG   . LEU A 1 138 ? -8.663  11.707  6.453   1.00 0.00 ? 138 LEU A CG   4  
ATOM 9167  C CD1  . LEU A 1 138 ? -7.366  11.222  5.802   1.00 0.00 ? 138 LEU A CD1  4  
ATOM 9168  C CD2  . LEU A 1 138 ? -8.410  12.376  7.806   1.00 0.00 ? 138 LEU A CD2  4  
ATOM 9169  H H    . LEU A 1 138 ? -11.454 11.291  5.093   1.00 0.00 ? 138 LEU A H    4  
ATOM 9170  H HA   . LEU A 1 138 ? -10.802 13.092  7.075   1.00 0.00 ? 138 LEU A HA   4  
ATOM 9171  H HB2  . LEU A 1 138 ? -9.529  12.151  4.547   1.00 0.00 ? 138 LEU A HB2  4  
ATOM 9172  H HB3  . LEU A 1 138 ? -8.833  13.539  5.359   1.00 0.00 ? 138 LEU A HB3  4  
ATOM 9173  H HG   . LEU A 1 138 ? -9.278  10.827  6.639   1.00 0.00 ? 138 LEU A HG   4  
ATOM 9174  H HD11 . LEU A 1 138 ? -7.134  11.850  4.942   1.00 0.00 ? 138 LEU A HD11 4  
ATOM 9175  H HD12 . LEU A 1 138 ? -6.552  11.280  6.525   1.00 0.00 ? 138 LEU A HD12 4  
ATOM 9176  H HD13 . LEU A 1 138 ? -7.488  10.190  5.475   1.00 0.00 ? 138 LEU A HD13 4  
ATOM 9177  H HD21 . LEU A 1 138 ? -7.990  13.369  7.647   1.00 0.00 ? 138 LEU A HD21 4  
ATOM 9178  H HD22 . LEU A 1 138 ? -9.350  12.461  8.351   1.00 0.00 ? 138 LEU A HD22 4  
ATOM 9179  H HD23 . LEU A 1 138 ? -7.708  11.773  8.384   1.00 0.00 ? 138 LEU A HD23 4  
ATOM 9180  N N    . ASN A 1 139 ? -11.719 14.461  4.236   1.00 0.00 ? 139 ASN A N    4  
ATOM 9181  C CA   . ASN A 1 139 ? -12.162 15.701  3.621   1.00 0.00 ? 139 ASN A CA   4  
ATOM 9182  C C    . ASN A 1 139 ? -13.319 16.283  4.435   1.00 0.00 ? 139 ASN A C    4  
ATOM 9183  O O    . ASN A 1 139 ? -13.335 17.477  4.731   1.00 0.00 ? 139 ASN A O    4  
ATOM 9184  C CB   . ASN A 1 139 ? -12.662 15.461  2.195   1.00 0.00 ? 139 ASN A CB   4  
ATOM 9185  C CG   . ASN A 1 139 ? -12.781 16.778  1.427   1.00 0.00 ? 139 ASN A CG   4  
ATOM 9186  O OD1  . ASN A 1 139 ? -11.851 17.564  1.342   1.00 0.00 ? 139 ASN A OD1  4  
ATOM 9187  N ND2  . ASN A 1 139 ? -13.975 16.976  0.873   1.00 0.00 ? 139 ASN A ND2  4  
ATOM 9188  H H    . ASN A 1 139 ? -11.797 13.650  3.655   1.00 0.00 ? 139 ASN A H    4  
ATOM 9189  H HA   . ASN A 1 139 ? -11.286 16.348  3.619   1.00 0.00 ? 139 ASN A HA   4  
ATOM 9190  H HB2  . ASN A 1 139 ? -11.977 14.793  1.674   1.00 0.00 ? 139 ASN A HB2  4  
ATOM 9191  H HB3  . ASN A 1 139 ? -13.632 14.964  2.224   1.00 0.00 ? 139 ASN A HB3  4  
ATOM 9192  H HD21 . ASN A 1 139 ? -14.695 16.291  0.981   1.00 0.00 ? 139 ASN A HD21 4  
ATOM 9193  H HD22 . ASN A 1 139 ? -14.151 17.809  0.349   1.00 0.00 ? 139 ASN A HD22 4  
ATOM 9194  N N    . LYS A 1 140 ? -14.259 15.414  4.774   1.00 0.00 ? 140 LYS A N    4  
ATOM 9195  C CA   . LYS A 1 140 ? -15.417 15.827  5.549   1.00 0.00 ? 140 LYS A CA   4  
ATOM 9196  C C    . LYS A 1 140 ? -14.954 16.348  6.911   1.00 0.00 ? 140 LYS A C    4  
ATOM 9197  O O    . LYS A 1 140 ? -15.531 17.294  7.447   1.00 0.00 ? 140 LYS A O    4  
ATOM 9198  C CB   . LYS A 1 140 ? -16.435 14.689  5.640   1.00 0.00 ? 140 LYS A CB   4  
ATOM 9199  C CG   . LYS A 1 140 ? -17.865 15.234  5.685   1.00 0.00 ? 140 LYS A CG   4  
ATOM 9200  C CD   . LYS A 1 140 ? -18.866 14.121  5.998   1.00 0.00 ? 140 LYS A CD   4  
ATOM 9201  C CE   . LYS A 1 140 ? -20.198 14.701  6.475   1.00 0.00 ? 140 LYS A CE   4  
ATOM 9202  N NZ   . LYS A 1 140 ? -21.206 14.647  5.393   1.00 0.00 ? 140 LYS A NZ   4  
ATOM 9203  H H    . LYS A 1 140 ? -14.239 14.444  4.530   1.00 0.00 ? 140 LYS A H    4  
ATOM 9204  H HA   . LYS A 1 140 ? -15.894 16.645  5.010   1.00 0.00 ? 140 LYS A HA   4  
ATOM 9205  H HB2  . LYS A 1 140 ? -16.322 14.026  4.782   1.00 0.00 ? 140 LYS A HB2  4  
ATOM 9206  H HB3  . LYS A 1 140 ? -16.241 14.092  6.531   1.00 0.00 ? 140 LYS A HB3  4  
ATOM 9207  H HG2  . LYS A 1 140 ? -17.935 16.016  6.442   1.00 0.00 ? 140 LYS A HG2  4  
ATOM 9208  H HG3  . LYS A 1 140 ? -18.112 15.693  4.729   1.00 0.00 ? 140 LYS A HG3  4  
ATOM 9209  H HD2  . LYS A 1 140 ? -19.028 13.512  5.109   1.00 0.00 ? 140 LYS A HD2  4  
ATOM 9210  H HD3  . LYS A 1 140 ? -18.456 13.464  6.765   1.00 0.00 ? 140 LYS A HD3  4  
ATOM 9211  H HE2  . LYS A 1 140 ? -20.556 14.143  7.341   1.00 0.00 ? 140 LYS A HE2  4  
ATOM 9212  H HE3  . LYS A 1 140 ? -20.058 15.733  6.798   1.00 0.00 ? 140 LYS A HE3  4  
ATOM 9213  H HZ1  . LYS A 1 140 ? -20.888 14.029  4.673   1.00 0.00 ? 140 LYS A HZ1  4  
ATOM 9214  H HZ2  . LYS A 1 140 ? -22.073 14.311  5.760   1.00 0.00 ? 140 LYS A HZ2  4  
ATOM 9215  H HZ3  . LYS A 1 140 ? -21.336 15.562  5.012   1.00 0.00 ? 140 LYS A HZ3  4  
ATOM 9216  N N    . ILE A 1 141 ? -13.917 15.709  7.433   1.00 0.00 ? 141 ILE A N    4  
ATOM 9217  C CA   . ILE A 1 141 ? -13.370 16.096  8.722   1.00 0.00 ? 141 ILE A CA   4  
ATOM 9218  C C    . ILE A 1 141 ? -12.734 17.483  8.606   1.00 0.00 ? 141 ILE A C    4  
ATOM 9219  O O    . ILE A 1 141 ? -13.003 18.364  9.420   1.00 0.00 ? 141 ILE A O    4  
ATOM 9220  C CB   . ILE A 1 141 ? -12.414 15.022  9.244   1.00 0.00 ? 141 ILE A CB   4  
ATOM 9221  C CG1  . ILE A 1 141 ? -13.156 13.711  9.512   1.00 0.00 ? 141 ILE A CG1  4  
ATOM 9222  C CG2  . ILE A 1 141 ? -11.656 15.515  10.477  1.00 0.00 ? 141 ILE A CG2  4  
ATOM 9223  C CD1  . ILE A 1 141 ? -12.174 12.560  9.737   1.00 0.00 ? 141 ILE A CD1  4  
ATOM 9224  H H    . ILE A 1 141 ? -13.454 14.941  6.990   1.00 0.00 ? 141 ILE A H    4  
ATOM 9225  H HA   . ILE A 1 141 ? -14.202 16.157  9.425   1.00 0.00 ? 141 ILE A HA   4  
ATOM 9226  H HB   . ILE A 1 141 ? -11.674 14.820  8.469   1.00 0.00 ? 141 ILE A HB   4  
ATOM 9227  H HG12 . ILE A 1 141 ? -13.796 13.824  10.387  1.00 0.00 ? 141 ILE A HG12 4  
ATOM 9228  H HG13 . ILE A 1 141 ? -13.809 13.478  8.670   1.00 0.00 ? 141 ILE A HG13 4  
ATOM 9229  H HG21 . ILE A 1 141 ? -12.360 15.945  11.189  1.00 0.00 ? 141 ILE A HG21 4  
ATOM 9230  H HG22 . ILE A 1 141 ? -11.134 14.678  10.942  1.00 0.00 ? 141 ILE A HG22 4  
ATOM 9231  H HG23 . ILE A 1 141 ? -10.932 16.273  10.179  1.00 0.00 ? 141 ILE A HG23 4  
ATOM 9232  H HD11 . ILE A 1 141 ? -11.490 12.496  8.891   1.00 0.00 ? 141 ILE A HD11 4  
ATOM 9233  H HD12 . ILE A 1 141 ? -11.607 12.741  10.651  1.00 0.00 ? 141 ILE A HD12 4  
ATOM 9234  H HD13 . ILE A 1 141 ? -12.725 11.625  9.831   1.00 0.00 ? 141 ILE A HD13 4  
ATOM 9235  N N    . VAL A 1 142 ? -11.901 17.632  7.586   1.00 0.00 ? 142 VAL A N    4  
ATOM 9236  C CA   . VAL A 1 142 ? -11.223 18.896  7.352   1.00 0.00 ? 142 VAL A CA   4  
ATOM 9237  C C    . VAL A 1 142 ? -12.260 19.976  7.038   1.00 0.00 ? 142 VAL A C    4  
ATOM 9238  O O    . VAL A 1 142 ? -12.053 21.149  7.343   1.00 0.00 ? 142 VAL A O    4  
ATOM 9239  C CB   . VAL A 1 142 ? -10.176 18.732  6.248   1.00 0.00 ? 142 VAL A CB   4  
ATOM 9240  C CG1  . VAL A 1 142 ? -9.584  20.085  5.849   1.00 0.00 ? 142 VAL A CG1  4  
ATOM 9241  C CG2  . VAL A 1 142 ? -9.077  17.758  6.676   1.00 0.00 ? 142 VAL A CG2  4  
ATOM 9242  H H    . VAL A 1 142 ? -11.687 16.910  6.928   1.00 0.00 ? 142 VAL A H    4  
ATOM 9243  H HA   . VAL A 1 142 ? -10.704 19.166  8.272   1.00 0.00 ? 142 VAL A HA   4  
ATOM 9244  H HB   . VAL A 1 142 ? -10.674 18.313  5.374   1.00 0.00 ? 142 VAL A HB   4  
ATOM 9245  H HG11 . VAL A 1 142 ? -10.186 20.886  6.279   1.00 0.00 ? 142 VAL A HG11 4  
ATOM 9246  H HG12 . VAL A 1 142 ? -8.563  20.159  6.220   1.00 0.00 ? 142 VAL A HG12 4  
ATOM 9247  H HG13 . VAL A 1 142 ? -9.584  20.175  4.762   1.00 0.00 ? 142 VAL A HG13 4  
ATOM 9248  H HG21 . VAL A 1 142 ? -8.700  18.043  7.657   1.00 0.00 ? 142 VAL A HG21 4  
ATOM 9249  H HG22 . VAL A 1 142 ? -9.485  16.748  6.722   1.00 0.00 ? 142 VAL A HG22 4  
ATOM 9250  H HG23 . VAL A 1 142 ? -8.263  17.788  5.950   1.00 0.00 ? 142 VAL A HG23 4  
ATOM 9251  N N    . ARG A 1 143 ? -13.355 19.540  6.430   1.00 0.00 ? 143 ARG A N    4  
ATOM 9252  C CA   . ARG A 1 143 ? -14.425 20.455  6.070   1.00 0.00 ? 143 ARG A CA   4  
ATOM 9253  C C    . ARG A 1 143 ? -15.003 21.115  7.324   1.00 0.00 ? 143 ARG A C    4  
ATOM 9254  O O    . ARG A 1 143 ? -15.182 22.331  7.363   1.00 0.00 ? 143 ARG A O    4  
ATOM 9255  C CB   . ARG A 1 143 ? -15.545 19.727  5.324   1.00 0.00 ? 143 ARG A CB   4  
ATOM 9256  C CG   . ARG A 1 143 ? -15.360 19.842  3.809   1.00 0.00 ? 143 ARG A CG   4  
ATOM 9257  C CD   . ARG A 1 143 ? -15.843 21.201  3.300   1.00 0.00 ? 143 ARG A CD   4  
ATOM 9258  N NE   . ARG A 1 143 ? -15.367 21.421  1.916   1.00 0.00 ? 143 ARG A NE   4  
ATOM 9259  C CZ   . ARG A 1 143 ? -14.083 21.600  1.582   1.00 0.00 ? 143 ARG A CZ   4  
ATOM 9260  N NH1  . ARG A 1 143 ? -13.135 21.585  2.530   1.00 0.00 ? 143 ARG A NH1  4  
ATOM 9261  N NH2  . ARG A 1 143 ? -13.744 21.793  0.301   1.00 0.00 ? 143 ARG A NH2  4  
ATOM 9262  H H    . ARG A 1 143 ? -13.515 18.584  6.185   1.00 0.00 ? 143 ARG A H    4  
ATOM 9263  H HA   . ARG A 1 143 ? -13.955 21.192  5.420   1.00 0.00 ? 143 ARG A HA   4  
ATOM 9264  H HB2  . ARG A 1 143 ? -15.556 18.676  5.614   1.00 0.00 ? 143 ARG A HB2  4  
ATOM 9265  H HB3  . ARG A 1 143 ? -16.510 20.145  5.609   1.00 0.00 ? 143 ARG A HB3  4  
ATOM 9266  H HG2  . ARG A 1 143 ? -14.308 19.708  3.557   1.00 0.00 ? 143 ARG A HG2  4  
ATOM 9267  H HG3  . ARG A 1 143 ? -15.911 19.045  3.310   1.00 0.00 ? 143 ARG A HG3  4  
ATOM 9268  H HD2  . ARG A 1 143 ? -16.932 21.245  3.331   1.00 0.00 ? 143 ARG A HD2  4  
ATOM 9269  H HD3  . ARG A 1 143 ? -15.474 21.995  3.950   1.00 0.00 ? 143 ARG A HD3  4  
ATOM 9270  H HE   . ARG A 1 143 ? -16.048 21.438  1.184   1.00 0.00 ? 143 ARG A HE   4  
ATOM 9271  H HH11 . ARG A 1 143 ? -13.388 21.441  3.487   1.00 0.00 ? 143 ARG A HH11 4  
ATOM 9272  H HH12 . ARG A 1 143 ? -12.177 21.719  2.282   1.00 0.00 ? 143 ARG A HH12 4  
ATOM 9273  H HH21 . ARG A 1 143 ? -14.450 21.803  -0.407  1.00 0.00 ? 143 ARG A HH21 4  
ATOM 9274  H HH22 . ARG A 1 143 ? -12.784 21.926  0.051   1.00 0.00 ? 143 ARG A HH22 4  
ATOM 9275  N N    . MET A 1 144 ? -15.278 20.284  8.319   1.00 0.00 ? 144 MET A N    4  
ATOM 9276  C CA   . MET A 1 144 ? -15.831 20.772  9.570   1.00 0.00 ? 144 MET A CA   4  
ATOM 9277  C C    . MET A 1 144 ? -14.811 21.628  10.324  1.00 0.00 ? 144 MET A C    4  
ATOM 9278  O O    . MET A 1 144 ? -15.152 22.686  10.849  1.00 0.00 ? 144 MET A O    4  
ATOM 9279  C CB   . MET A 1 144 ? -16.246 19.585  10.442  1.00 0.00 ? 144 MET A CB   4  
ATOM 9280  C CG   . MET A 1 144 ? -16.807 20.060  11.784  1.00 0.00 ? 144 MET A CG   4  
ATOM 9281  S SD   . MET A 1 144 ? -17.034 18.668  12.878  1.00 0.00 ? 144 MET A SD   4  
ATOM 9282  C CE   . MET A 1 144 ? -15.338 18.358  13.341  1.00 0.00 ? 144 MET A CE   4  
ATOM 9283  H H    . MET A 1 144 ? -15.129 19.296  8.279   1.00 0.00 ? 144 MET A H    4  
ATOM 9284  H HA   . MET A 1 144 ? -16.692 21.380  9.292   1.00 0.00 ? 144 MET A HA   4  
ATOM 9285  H HB2  . MET A 1 144 ? -16.997 18.991  9.921   1.00 0.00 ? 144 MET A HB2  4  
ATOM 9286  H HB3  . MET A 1 144 ? -15.387 18.936  10.612  1.00 0.00 ? 144 MET A HB3  4  
ATOM 9287  H HG2  . MET A 1 144 ? -16.126 20.782  12.237  1.00 0.00 ? 144 MET A HG2  4  
ATOM 9288  H HG3  . MET A 1 144 ? -17.757 20.572  11.630  1.00 0.00 ? 144 MET A HG3  4  
ATOM 9289  H HE1  . MET A 1 144 ? -14.681 18.628  12.516  1.00 0.00 ? 144 MET A HE1  4  
ATOM 9290  H HE2  . MET A 1 144 ? -15.085 18.954  14.217  1.00 0.00 ? 144 MET A HE2  4  
ATOM 9291  H HE3  . MET A 1 144 ? -15.213 17.300  13.573  1.00 0.00 ? 144 MET A HE3  4  
ATOM 9292  N N    . TYR A 1 145 ? -13.581 21.137  10.354  1.00 0.00 ? 145 TYR A N    4  
ATOM 9293  C CA   . TYR A 1 145 ? -12.509 21.844  11.034  1.00 0.00 ? 145 TYR A CA   4  
ATOM 9294  C C    . TYR A 1 145 ? -12.415 23.293  10.551  1.00 0.00 ? 145 TYR A C    4  
ATOM 9295  O O    . TYR A 1 145 ? -12.384 24.220  11.359  1.00 0.00 ? 145 TYR A O    4  
ATOM 9296  C CB   . TYR A 1 145 ? -11.219 21.111  10.664  1.00 0.00 ? 145 TYR A CB   4  
ATOM 9297  C CG   . TYR A 1 145 ? -10.698 20.177  11.759  1.00 0.00 ? 145 TYR A CG   4  
ATOM 9298  C CD1  . TYR A 1 145 ? -11.519 19.194  12.275  1.00 0.00 ? 145 TYR A CD1  4  
ATOM 9299  C CD2  . TYR A 1 145 ? -9.409  20.318  12.230  1.00 0.00 ? 145 TYR A CD2  4  
ATOM 9300  C CE1  . TYR A 1 145 ? -11.029 18.315  13.305  1.00 0.00 ? 145 TYR A CE1  4  
ATOM 9301  C CE2  . TYR A 1 145 ? -8.919  19.439  13.261  1.00 0.00 ? 145 TYR A CE2  4  
ATOM 9302  C CZ   . TYR A 1 145 ? -9.752  18.481  13.747  1.00 0.00 ? 145 TYR A CZ   4  
ATOM 9303  O OH   . TYR A 1 145 ? -9.290  17.652  14.720  1.00 0.00 ? 145 TYR A OH   4  
ATOM 9304  H H    . TYR A 1 145 ? -13.312 20.275  9.923   1.00 0.00 ? 145 TYR A H    4  
ATOM 9305  H HA   . TYR A 1 145 ? -12.728 21.838  12.102  1.00 0.00 ? 145 TYR A HA   4  
ATOM 9306  H HB2  . TYR A 1 145 ? -11.390 20.531  9.758   1.00 0.00 ? 145 TYR A HB2  4  
ATOM 9307  H HB3  . TYR A 1 145 ? -10.449 21.846  10.431  1.00 0.00 ? 145 TYR A HB3  4  
ATOM 9308  H HD1  . TYR A 1 145 ? -12.537 19.083  11.903  1.00 0.00 ? 145 TYR A HD1  4  
ATOM 9309  H HD2  . TYR A 1 145 ? -8.762  21.094  11.822  1.00 0.00 ? 145 TYR A HD2  4  
ATOM 9310  H HE1  . TYR A 1 145 ? -11.666 17.536  13.722  1.00 0.00 ? 145 TYR A HE1  4  
ATOM 9311  H HE2  . TYR A 1 145 ? -7.903  19.539  13.641  1.00 0.00 ? 145 TYR A HE2  4  
ATOM 9312  H HH   . TYR A 1 145 ? -10.055 17.189  15.168  1.00 0.00 ? 145 TYR A HH   4  
ATOM 9313  N N    . SER A 1 146 ? -12.370 23.442  9.236   1.00 0.00 ? 146 SER A N    4  
ATOM 9314  C CA   . SER A 1 146 ? -12.280 24.763  8.636   1.00 0.00 ? 146 SER A CA   4  
ATOM 9315  C C    . SER A 1 146 ? -11.341 25.648  9.457   1.00 0.00 ? 146 SER A C    4  
ATOM 9316  O O    . SER A 1 146 ? -11.775 26.627  10.061  1.00 0.00 ? 146 SER A O    4  
ATOM 9317  C CB   . SER A 1 146 ? -13.660 25.413  8.524   1.00 0.00 ? 146 SER A CB   4  
ATOM 9318  O OG   . SER A 1 146 ? -14.169 25.807  9.795   1.00 0.00 ? 146 SER A OG   4  
ATOM 9319  H H    . SER A 1 146 ? -12.396 22.683  8.585   1.00 0.00 ? 146 SER A H    4  
ATOM 9320  H HA   . SER A 1 146 ? -11.874 24.599  7.637   1.00 0.00 ? 146 SER A HA   4  
ATOM 9321  H HB2  . SER A 1 146 ? -13.598 26.285  7.872   1.00 0.00 ? 146 SER A HB2  4  
ATOM 9322  H HB3  . SER A 1 146 ? -14.353 24.714  8.056   1.00 0.00 ? 146 SER A HB3  4  
ATOM 9323  H HG   . SER A 1 146 ? -13.627 25.390  10.525  1.00 0.00 ? 146 SER A HG   4  
ATOM 9324  N N    . PRO A 1 147 ? -10.037 25.261  9.454   1.00 0.00 ? 147 PRO A N    4  
ATOM 9325  C CA   . PRO A 1 147 ? -9.033  26.008  10.192  1.00 0.00 ? 147 PRO A CA   4  
ATOM 9326  C C    . PRO A 1 147 ? -8.684  27.314  9.475   1.00 0.00 ? 147 PRO A C    4  
ATOM 9327  O O    . PRO A 1 147 ? -9.221  27.603  8.406   1.00 0.00 ? 147 PRO A O    4  
ATOM 9328  C CB   . PRO A 1 147 ? -7.849  25.063  10.313  1.00 0.00 ? 147 PRO A CB   4  
ATOM 9329  C CG   . PRO A 1 147 ? -8.053  24.000  9.247   1.00 0.00 ? 147 PRO A CG   4  
ATOM 9330  C CD   . PRO A 1 147 ? -9.485  24.107  8.750   1.00 0.00 ? 147 PRO A CD   4  
ATOM 9331  H HA   . PRO A 1 147 ? -9.388  26.276  11.088  1.00 0.00 ? 147 PRO A HA   4  
ATOM 9332  H HB2  . PRO A 1 147 ? -6.908  25.592  10.162  1.00 0.00 ? 147 PRO A HB2  4  
ATOM 9333  H HB3  . PRO A 1 147 ? -7.806  24.616  11.307  1.00 0.00 ? 147 PRO A HB3  4  
ATOM 9334  H HG2  . PRO A 1 147 ? -7.353  24.146  8.424   1.00 0.00 ? 147 PRO A HG2  4  
ATOM 9335  H HG3  . PRO A 1 147 ? -7.864  23.008  9.655   1.00 0.00 ? 147 PRO A HG3  4  
ATOM 9336  H HD2  . PRO A 1 147 ? -9.522  24.248  7.670   1.00 0.00 ? 147 PRO A HD2  4  
ATOM 9337  H HD3  . PRO A 1 147 ? -10.050 23.202  8.972   1.00 0.00 ? 147 PRO A HD3  4  
ATOM 9338  N N    . THR A 1 148 ? -7.785  28.069  10.090  1.00 0.00 ? 148 THR A N    4  
ATOM 9339  C CA   . THR A 1 148 ? -7.358  29.337  9.524   1.00 0.00 ? 148 THR A CA   4  
ATOM 9340  C C    . THR A 1 148 ? -5.915  29.643  9.929   1.00 0.00 ? 148 THR A C    4  
ATOM 9341  O O    . THR A 1 148 ? -5.647  30.666  10.557  1.00 0.00 ? 148 THR A O    4  
ATOM 9342  C CB   . THR A 1 148 ? -8.355  30.411  9.964   1.00 0.00 ? 148 THR A CB   4  
ATOM 9343  O OG1  . THR A 1 148 ? -7.848  31.612  9.387   1.00 0.00 ? 148 THR A OG1  4  
ATOM 9344  C CG2  . THR A 1 148 ? -8.305  30.673  11.471  1.00 0.00 ? 148 THR A CG2  4  
ATOM 9345  H H    . THR A 1 148 ? -7.353  27.827  10.959  1.00 0.00 ? 148 THR A H    4  
ATOM 9346  H HA   . THR A 1 148 ? -7.374  29.250  8.437   1.00 0.00 ? 148 THR A HA   4  
ATOM 9347  H HB   . THR A 1 148 ? -9.366  30.158  9.646   1.00 0.00 ? 148 THR A HB   4  
ATOM 9348  H HG1  . THR A 1 148 ? -7.708  31.486  8.405   1.00 0.00 ? 148 THR A HG1  4  
ATOM 9349  H HG21 . THR A 1 148 ? -8.214  29.725  12.002  1.00 0.00 ? 148 THR A HG21 4  
ATOM 9350  H HG22 . THR A 1 148 ? -7.445  31.303  11.703  1.00 0.00 ? 148 THR A HG22 4  
ATOM 9351  H HG23 . THR A 1 148 ? -9.219  31.178  11.782  1.00 0.00 ? 148 THR A HG23 4  
ATOM 9352  N N    . SER A 1 149 ? -5.024  28.737  9.555   1.00 0.00 ? 149 SER A N    4  
ATOM 9353  C CA   . SER A 1 149 ? -3.615  28.898  9.871   1.00 0.00 ? 149 SER A CA   4  
ATOM 9354  C C    . SER A 1 149 ? -3.400  28.763  11.380  1.00 0.00 ? 149 SER A C    4  
ATOM 9355  O O    . SER A 1 149 ? -3.756  29.658  12.144  1.00 0.00 ? 149 SER A O    4  
ATOM 9356  C CB   . SER A 1 149 ? -3.091  30.248  9.378   1.00 0.00 ? 149 SER A CB   4  
ATOM 9357  O OG   . SER A 1 149 ? -2.197  30.103  8.277   1.00 0.00 ? 149 SER A OG   4  
ATOM 9358  H H    . SER A 1 149 ? -5.251  27.908  9.044   1.00 0.00 ? 149 SER A H    4  
ATOM 9359  H HA   . SER A 1 149 ? -3.106  28.094  9.338   1.00 0.00 ? 149 SER A HA   4  
ATOM 9360  H HB2  . SER A 1 149 ? -3.929  30.877  9.083   1.00 0.00 ? 149 SER A HB2  4  
ATOM 9361  H HB3  . SER A 1 149 ? -2.579  30.758  10.194  1.00 0.00 ? 149 SER A HB3  4  
ATOM 9362  H HG   . SER A 1 149 ? -1.547  29.365  8.459   1.00 0.00 ? 149 SER A HG   4  
ATOM 9363  N N    . ILE A 1 150 ? -2.817  27.637  11.764  1.00 0.00 ? 150 ILE A N    4  
ATOM 9364  C CA   . ILE A 1 150 ? -2.549  27.374  13.168  1.00 0.00 ? 150 ILE A CA   4  
ATOM 9365  C C    . ILE A 1 150 ? -1.258  26.562  13.293  1.00 0.00 ? 150 ILE A C    4  
ATOM 9366  O O    . ILE A 1 150 ? -0.913  25.795  12.395  1.00 0.00 ? 150 ILE A O    4  
ATOM 9367  C CB   . ILE A 1 150 ? -3.759  26.710  13.828  1.00 0.00 ? 150 ILE A CB   4  
ATOM 9368  C CG1  . ILE A 1 150 ? -3.729  26.903  15.345  1.00 0.00 ? 150 ILE A CG1  4  
ATOM 9369  C CG2  . ILE A 1 150 ? -3.855  25.234  13.440  1.00 0.00 ? 150 ILE A CG2  4  
ATOM 9370  C CD1  . ILE A 1 150 ? -4.506  28.157  15.754  1.00 0.00 ? 150 ILE A CD1  4  
ATOM 9371  H H    . ILE A 1 150 ? -2.530  26.914  11.135  1.00 0.00 ? 150 ILE A H    4  
ATOM 9372  H HA   . ILE A 1 150 ? -2.401  28.335  13.658  1.00 0.00 ? 150 ILE A HA   4  
ATOM 9373  H HB   . ILE A 1 150 ? -4.660  27.199  13.459  1.00 0.00 ? 150 ILE A HB   4  
ATOM 9374  H HG12 . ILE A 1 150 ? -4.160  26.030  15.835  1.00 0.00 ? 150 ILE A HG12 4  
ATOM 9375  H HG13 . ILE A 1 150 ? -2.697  26.984  15.685  1.00 0.00 ? 150 ILE A HG13 4  
ATOM 9376  H HG21 . ILE A 1 150 ? -2.897  24.746  13.623  1.00 0.00 ? 150 ILE A HG21 4  
ATOM 9377  H HG22 . ILE A 1 150 ? -4.628  24.750  14.038  1.00 0.00 ? 150 ILE A HG22 4  
ATOM 9378  H HG23 . ILE A 1 150 ? -4.108  25.151  12.383  1.00 0.00 ? 150 ILE A HG23 4  
ATOM 9379  H HD11 . ILE A 1 150 ? -5.533  28.079  15.399  1.00 0.00 ? 150 ILE A HD11 4  
ATOM 9380  H HD12 . ILE A 1 150 ? -4.502  28.249  16.840  1.00 0.00 ? 150 ILE A HD12 4  
ATOM 9381  H HD13 . ILE A 1 150 ? -4.034  29.035  15.313  1.00 0.00 ? 150 ILE A HD13 4  
ATOM 9382  N N    . LEU A 1 151 ? -0.580  26.758  14.413  1.00 0.00 ? 151 LEU A N    4  
ATOM 9383  C CA   . LEU A 1 151 ? 0.666   26.053  14.667  1.00 0.00 ? 151 LEU A CA   4  
ATOM 9384  C C    . LEU A 1 151 ? 1.524   26.071  13.402  1.00 0.00 ? 151 LEU A C    4  
ATOM 9385  O O    . LEU A 1 151 ? 2.748   26.158  13.478  1.00 0.00 ? 151 LEU A O    4  
ATOM 9386  C CB   . LEU A 1 151 ? 0.387   24.647  15.203  1.00 0.00 ? 151 LEU A CB   4  
ATOM 9387  C CG   . LEU A 1 151 ? 1.464   24.047  16.107  1.00 0.00 ? 151 LEU A CG   4  
ATOM 9388  C CD1  . LEU A 1 151 ? 1.192   24.374  17.577  1.00 0.00 ? 151 LEU A CD1  4  
ATOM 9389  C CD2  . LEU A 1 151 ? 1.603   22.542  15.871  1.00 0.00 ? 151 LEU A CD2  4  
ATOM 9390  H H    . LEU A 1 151 ? -0.867  27.383  15.139  1.00 0.00 ? 151 LEU A H    4  
ATOM 9391  H HA   . LEU A 1 151 ? 1.194   26.597  15.450  1.00 0.00 ? 151 LEU A HA   4  
ATOM 9392  H HB2  . LEU A 1 151 ? -0.553  24.670  15.756  1.00 0.00 ? 151 LEU A HB2  4  
ATOM 9393  H HB3  . LEU A 1 151 ? 0.240   23.980  14.353  1.00 0.00 ? 151 LEU A HB3  4  
ATOM 9394  H HG   . LEU A 1 151 ? 2.421   24.503  15.848  1.00 0.00 ? 151 LEU A HG   4  
ATOM 9395  H HD11 . LEU A 1 151 ? 0.125   24.277  17.777  1.00 0.00 ? 151 LEU A HD11 4  
ATOM 9396  H HD12 . LEU A 1 151 ? 1.745   23.681  18.211  1.00 0.00 ? 151 LEU A HD12 4  
ATOM 9397  H HD13 . LEU A 1 151 ? 1.511   25.394  17.788  1.00 0.00 ? 151 LEU A HD13 4  
ATOM 9398  H HD21 . LEU A 1 151 ? 1.197   22.289  14.890  1.00 0.00 ? 151 LEU A HD21 4  
ATOM 9399  H HD22 . LEU A 1 151 ? 2.656   22.263  15.909  1.00 0.00 ? 151 LEU A HD22 4  
ATOM 9400  H HD23 . LEU A 1 151 ? 1.056   22.000  16.642  1.00 0.00 ? 151 LEU A HD23 4  
ATOM 9401  N N    . PRO A 1 1   ? 1.373   0.119   -0.421  1.00 0.00 ? 1   PRO A N    5  
ATOM 9402  C CA   . PRO A 1 1   ? 2.117   0.043   -1.666  1.00 0.00 ? 1   PRO A CA   5  
ATOM 9403  C C    . PRO A 1 1   ? 2.069   -1.372  -2.248  1.00 0.00 ? 1   PRO A C    5  
ATOM 9404  O O    . PRO A 1 1   ? 2.408   -2.339  -1.567  1.00 0.00 ? 1   PRO A O    5  
ATOM 9405  C CB   . PRO A 1 1   ? 3.525   0.492   -1.311  1.00 0.00 ? 1   PRO A CB   5  
ATOM 9406  C CG   . PRO A 1 1   ? 3.637   0.356   0.199   1.00 0.00 ? 1   PRO A CG   5  
ATOM 9407  C CD   . PRO A 1 1   ? 2.234   0.178   0.756   1.00 0.00 ? 1   PRO A CD   5  
ATOM 9408  H HA   . PRO A 1 1   ? 1.702   0.636   -2.356  1.00 0.00 ? 1   PRO A HA   5  
ATOM 9409  H HB2  . PRO A 1 1   ? 4.270   -0.125  -1.814  1.00 0.00 ? 1   PRO A HB2  5  
ATOM 9410  H HB3  . PRO A 1 1   ? 3.698   1.520   -1.624  1.00 0.00 ? 1   PRO A HB3  5  
ATOM 9411  H HG2  . PRO A 1 1   ? 4.263   -0.496  0.460   1.00 0.00 ? 1   PRO A HG2  5  
ATOM 9412  H HG3  . PRO A 1 1   ? 4.108   1.241   0.628   1.00 0.00 ? 1   PRO A HG3  5  
ATOM 9413  H HD2  . PRO A 1 1   ? 2.157   -0.734  1.350   1.00 0.00 ? 1   PRO A HD2  5  
ATOM 9414  H HD3  . PRO A 1 1   ? 1.959   1.007   1.408   1.00 0.00 ? 1   PRO A HD3  5  
ATOM 9415  N N    . ILE A 1 2   ? 1.646   -1.448  -3.501  1.00 0.00 ? 2   ILE A N    5  
ATOM 9416  C CA   . ILE A 1 2   ? 1.550   -2.728  -4.182  1.00 0.00 ? 2   ILE A CA   5  
ATOM 9417  C C    . ILE A 1 2   ? 2.508   -2.739  -5.374  1.00 0.00 ? 2   ILE A C    5  
ATOM 9418  O O    . ILE A 1 2   ? 2.841   -1.687  -5.918  1.00 0.00 ? 2   ILE A O    5  
ATOM 9419  C CB   . ILE A 1 2   ? 0.096   -3.026  -4.558  1.00 0.00 ? 2   ILE A CB   5  
ATOM 9420  C CG1  . ILE A 1 2   ? -0.593  -3.852  -3.468  1.00 0.00 ? 2   ILE A CG1  5  
ATOM 9421  C CG2  . ILE A 1 2   ? 0.012   -3.701  -5.928  1.00 0.00 ? 2   ILE A CG2  5  
ATOM 9422  C CD1  . ILE A 1 2   ? -2.110  -3.665  -3.517  1.00 0.00 ? 2   ILE A CD1  5  
ATOM 9423  H H    . ILE A 1 2   ? 1.373   -0.656  -4.048  1.00 0.00 ? 2   ILE A H    5  
ATOM 9424  H HA   . ILE A 1 2   ? 1.865   -3.497  -3.478  1.00 0.00 ? 2   ILE A HA   5  
ATOM 9425  H HB   . ILE A 1 2   ? -0.439  -2.079  -4.631  1.00 0.00 ? 2   ILE A HB   5  
ATOM 9426  H HG12 . ILE A 1 2   ? -0.348  -4.906  -3.597  1.00 0.00 ? 2   ILE A HG12 5  
ATOM 9427  H HG13 . ILE A 1 2   ? -0.217  -3.554  -2.490  1.00 0.00 ? 2   ILE A HG13 5  
ATOM 9428  H HG21 . ILE A 1 2   ? 0.519   -3.083  -6.669  1.00 0.00 ? 2   ILE A HG21 5  
ATOM 9429  H HG22 . ILE A 1 2   ? 0.491   -4.679  -5.881  1.00 0.00 ? 2   ILE A HG22 5  
ATOM 9430  H HG23 . ILE A 1 2   ? -1.034  -3.822  -6.210  1.00 0.00 ? 2   ILE A HG23 5  
ATOM 9431  H HD11 . ILE A 1 2   ? -2.454  -3.753  -4.548  1.00 0.00 ? 2   ILE A HD11 5  
ATOM 9432  H HD12 . ILE A 1 2   ? -2.590  -4.430  -2.907  1.00 0.00 ? 2   ILE A HD12 5  
ATOM 9433  H HD13 . ILE A 1 2   ? -2.367  -2.678  -3.132  1.00 0.00 ? 2   ILE A HD13 5  
ATOM 9434  N N    . VAL A 1 3   ? 2.924   -3.941  -5.747  1.00 0.00 ? 3   VAL A N    5  
ATOM 9435  C CA   . VAL A 1 3   ? 3.837   -4.103  -6.865  1.00 0.00 ? 3   VAL A CA   5  
ATOM 9436  C C    . VAL A 1 3   ? 3.576   -5.451  -7.540  1.00 0.00 ? 3   VAL A C    5  
ATOM 9437  O O    . VAL A 1 3   ? 2.892   -6.306  -6.981  1.00 0.00 ? 3   VAL A O    5  
ATOM 9438  C CB   . VAL A 1 3   ? 5.282   -3.943  -6.389  1.00 0.00 ? 3   VAL A CB   5  
ATOM 9439  C CG1  . VAL A 1 3   ? 5.379   -2.900  -5.274  1.00 0.00 ? 3   VAL A CG1  5  
ATOM 9440  C CG2  . VAL A 1 3   ? 5.862   -5.284  -5.936  1.00 0.00 ? 3   VAL A CG2  5  
ATOM 9441  H H    . VAL A 1 3   ? 2.648   -4.792  -5.301  1.00 0.00 ? 3   VAL A H    5  
ATOM 9442  H HA   . VAL A 1 3   ? 3.627   -3.307  -7.580  1.00 0.00 ? 3   VAL A HA   5  
ATOM 9443  H HB   . VAL A 1 3   ? 5.876   -3.589  -7.231  1.00 0.00 ? 3   VAL A HB   5  
ATOM 9444  H HG11 . VAL A 1 3   ? 4.697   -3.165  -4.467  1.00 0.00 ? 3   VAL A HG11 5  
ATOM 9445  H HG12 . VAL A 1 3   ? 6.399   -2.869  -4.892  1.00 0.00 ? 3   VAL A HG12 5  
ATOM 9446  H HG13 . VAL A 1 3   ? 5.111   -1.920  -5.669  1.00 0.00 ? 3   VAL A HG13 5  
ATOM 9447  H HG21 . VAL A 1 3   ? 5.142   -5.795  -5.297  1.00 0.00 ? 3   VAL A HG21 5  
ATOM 9448  H HG22 . VAL A 1 3   ? 6.074   -5.901  -6.809  1.00 0.00 ? 3   VAL A HG22 5  
ATOM 9449  H HG23 . VAL A 1 3   ? 6.783   -5.113  -5.379  1.00 0.00 ? 3   VAL A HG23 5  
ATOM 9450  N N    . GLN A 1 4   ? 4.135   -5.599  -8.732  1.00 0.00 ? 4   GLN A N    5  
ATOM 9451  C CA   . GLN A 1 4   ? 3.972   -6.828  -9.489  1.00 0.00 ? 4   GLN A CA   5  
ATOM 9452  C C    . GLN A 1 4   ? 5.293   -7.596  -9.546  1.00 0.00 ? 4   GLN A C    5  
ATOM 9453  O O    . GLN A 1 4   ? 6.354   -7.000  -9.731  1.00 0.00 ? 4   GLN A O    5  
ATOM 9454  C CB   . GLN A 1 4   ? 3.443   -6.540  -10.895 1.00 0.00 ? 4   GLN A CB   5  
ATOM 9455  C CG   . GLN A 1 4   ? 4.481   -5.786  -11.728 1.00 0.00 ? 4   GLN A CG   5  
ATOM 9456  C CD   . GLN A 1 4   ? 3.811   -4.994  -12.853 1.00 0.00 ? 4   GLN A CD   5  
ATOM 9457  O OE1  . GLN A 1 4   ? 3.738   -5.426  -13.991 1.00 0.00 ? 4   GLN A OE1  5  
ATOM 9458  N NE2  . GLN A 1 4   ? 3.330   -3.814  -12.472 1.00 0.00 ? 4   GLN A NE2  5  
ATOM 9459  H H    . GLN A 1 4   ? 4.691   -4.897  -9.180  1.00 0.00 ? 4   GLN A H    5  
ATOM 9460  H HA   . GLN A 1 4   ? 3.229   -7.409  -8.940  1.00 0.00 ? 4   GLN A HA   5  
ATOM 9461  H HB2  . GLN A 1 4   ? 3.185   -7.477  -11.390 1.00 0.00 ? 4   GLN A HB2  5  
ATOM 9462  H HB3  . GLN A 1 4   ? 2.527   -5.953  -10.830 1.00 0.00 ? 4   GLN A HB3  5  
ATOM 9463  H HG2  . GLN A 1 4   ? 5.043   -5.108  -11.086 1.00 0.00 ? 4   GLN A HG2  5  
ATOM 9464  H HG3  . GLN A 1 4   ? 5.196   -6.491  -12.150 1.00 0.00 ? 4   GLN A HG3  5  
ATOM 9465  H HE21 . GLN A 1 4   ? 3.424   -3.519  -11.521 1.00 0.00 ? 4   GLN A HE21 5  
ATOM 9466  H HE22 . GLN A 1 4   ? 2.873   -3.222  -13.137 1.00 0.00 ? 4   GLN A HE22 5  
ATOM 9467  N N    . ASN A 1 5   ? 5.188   -8.907  -9.385  1.00 0.00 ? 5   ASN A N    5  
ATOM 9468  C CA   . ASN A 1 5   ? 6.362   -9.762  -9.417  1.00 0.00 ? 5   ASN A CA   5  
ATOM 9469  C C    . ASN A 1 5   ? 6.666   -10.151 -10.865 1.00 0.00 ? 5   ASN A C    5  
ATOM 9470  O O    . ASN A 1 5   ? 6.569   -11.321 -11.230 1.00 0.00 ? 5   ASN A O    5  
ATOM 9471  C CB   . ASN A 1 5   ? 6.128   -11.048 -8.621  1.00 0.00 ? 5   ASN A CB   5  
ATOM 9472  C CG   . ASN A 1 5   ? 4.637   -11.386 -8.551  1.00 0.00 ? 5   ASN A CG   5  
ATOM 9473  O OD1  . ASN A 1 5   ? 4.057   -11.946 -9.466  1.00 0.00 ? 5   ASN A OD1  5  
ATOM 9474  N ND2  . ASN A 1 5   ? 4.052   -11.015 -7.415  1.00 0.00 ? 5   ASN A ND2  5  
ATOM 9475  H H    . ASN A 1 5   ? 4.321   -9.384  -9.235  1.00 0.00 ? 5   ASN A H    5  
ATOM 9476  H HA   . ASN A 1 5   ? 7.159   -9.171  -8.967  1.00 0.00 ? 5   ASN A HA   5  
ATOM 9477  H HB2  . ASN A 1 5   ? 6.669   -11.872 -9.087  1.00 0.00 ? 5   ASN A HB2  5  
ATOM 9478  H HB3  . ASN A 1 5   ? 6.526   -10.934 -7.613  1.00 0.00 ? 5   ASN A HB3  5  
ATOM 9479  H HD21 . ASN A 1 5   ? 4.586   -10.560 -6.703  1.00 0.00 ? 5   ASN A HD21 5  
ATOM 9480  H HD22 . ASN A 1 5   ? 3.078   -11.192 -7.274  1.00 0.00 ? 5   ASN A HD22 5  
ATOM 9481  N N    . LEU A 1 6   ? 7.027   -9.147  -11.650 1.00 0.00 ? 6   LEU A N    5  
ATOM 9482  C CA   . LEU A 1 6   ? 7.345   -9.369  -13.050 1.00 0.00 ? 6   LEU A CA   5  
ATOM 9483  C C    . LEU A 1 6   ? 6.052   -9.388  -13.867 1.00 0.00 ? 6   LEU A C    5  
ATOM 9484  O O    . LEU A 1 6   ? 5.951   -8.717  -14.893 1.00 0.00 ? 6   LEU A O    5  
ATOM 9485  C CB   . LEU A 1 6   ? 8.193   -10.632 -13.213 1.00 0.00 ? 6   LEU A CB   5  
ATOM 9486  C CG   . LEU A 1 6   ? 9.467   -10.482 -14.047 1.00 0.00 ? 6   LEU A CG   5  
ATOM 9487  C CD1  . LEU A 1 6   ? 10.503  -9.623  -13.318 1.00 0.00 ? 6   LEU A CD1  5  
ATOM 9488  C CD2  . LEU A 1 6   ? 10.030  -11.849 -14.439 1.00 0.00 ? 6   LEU A CD2  5  
ATOM 9489  H H    . LEU A 1 6   ? 7.104   -8.197  -11.345 1.00 0.00 ? 6   LEU A H    5  
ATOM 9490  H HA   . LEU A 1 6   ? 7.953   -8.527  -13.385 1.00 0.00 ? 6   LEU A HA   5  
ATOM 9491  H HB2  . LEU A 1 6   ? 8.472   -10.989 -12.222 1.00 0.00 ? 6   LEU A HB2  5  
ATOM 9492  H HB3  . LEU A 1 6   ? 7.575   -11.406 -13.668 1.00 0.00 ? 6   LEU A HB3  5  
ATOM 9493  H HG   . LEU A 1 6   ? 9.211   -9.962  -14.971 1.00 0.00 ? 6   LEU A HG   5  
ATOM 9494  H HD11 . LEU A 1 6   ? 10.036  -8.695  -12.986 1.00 0.00 ? 6   LEU A HD11 5  
ATOM 9495  H HD12 . LEU A 1 6   ? 10.882  -10.168 -12.454 1.00 0.00 ? 6   LEU A HD12 5  
ATOM 9496  H HD13 . LEU A 1 6   ? 11.327  -9.395  -13.994 1.00 0.00 ? 6   LEU A HD13 5  
ATOM 9497  H HD21 . LEU A 1 6   ? 9.290   -12.392 -15.027 1.00 0.00 ? 6   LEU A HD21 5  
ATOM 9498  H HD22 . LEU A 1 6   ? 10.936  -11.713 -15.031 1.00 0.00 ? 6   LEU A HD22 5  
ATOM 9499  H HD23 . LEU A 1 6   ? 10.267  -12.416 -13.539 1.00 0.00 ? 6   LEU A HD23 5  
ATOM 9500  N N    . GLN A 1 7   ? 5.094   -10.163 -13.380 1.00 0.00 ? 7   GLN A N    5  
ATOM 9501  C CA   . GLN A 1 7   ? 3.811   -10.279 -14.052 1.00 0.00 ? 7   GLN A CA   5  
ATOM 9502  C C    . GLN A 1 7   ? 3.045   -11.495 -13.528 1.00 0.00 ? 7   GLN A C    5  
ATOM 9503  O O    . GLN A 1 7   ? 1.818   -11.543 -13.610 1.00 0.00 ? 7   GLN A O    5  
ATOM 9504  C CB   . GLN A 1 7   ? 3.990   -10.354 -15.569 1.00 0.00 ? 7   GLN A CB   5  
ATOM 9505  C CG   . GLN A 1 7   ? 5.061   -11.383 -15.944 1.00 0.00 ? 7   GLN A CG   5  
ATOM 9506  C CD   . GLN A 1 7   ? 6.303   -10.697 -16.515 1.00 0.00 ? 7   GLN A CD   5  
ATOM 9507  O OE1  . GLN A 1 7   ? 6.225   -9.737  -17.263 1.00 0.00 ? 7   GLN A OE1  5  
ATOM 9508  N NE2  . GLN A 1 7   ? 7.451   -11.242 -16.121 1.00 0.00 ? 7   GLN A NE2  5  
ATOM 9509  H H    . GLN A 1 7   ? 5.183   -10.706 -12.545 1.00 0.00 ? 7   GLN A H    5  
ATOM 9510  H HA   . GLN A 1 7   ? 3.270   -9.366  -13.802 1.00 0.00 ? 7   GLN A HA   5  
ATOM 9511  H HB2  . GLN A 1 7   ? 3.044   -10.622 -16.038 1.00 0.00 ? 7   GLN A HB2  5  
ATOM 9512  H HB3  . GLN A 1 7   ? 4.272   -9.375  -15.955 1.00 0.00 ? 7   GLN A HB3  5  
ATOM 9513  H HG2  . GLN A 1 7   ? 5.334   -11.965 -15.064 1.00 0.00 ? 7   GLN A HG2  5  
ATOM 9514  H HG3  . GLN A 1 7   ? 4.657   -12.082 -16.675 1.00 0.00 ? 7   GLN A HG3  5  
ATOM 9515  H HE21 . GLN A 1 7   ? 7.445   -12.030 -15.505 1.00 0.00 ? 7   GLN A HE21 5  
ATOM 9516  H HE22 . GLN A 1 7   ? 8.320   -10.865 -16.442 1.00 0.00 ? 7   GLN A HE22 5  
ATOM 9517  N N    . GLY A 1 8   ? 3.800   -12.448 -13.002 1.00 0.00 ? 8   GLY A N    5  
ATOM 9518  C CA   . GLY A 1 8   ? 3.208   -13.662 -12.467 1.00 0.00 ? 8   GLY A CA   5  
ATOM 9519  C C    . GLY A 1 8   ? 1.979   -13.342 -11.613 1.00 0.00 ? 8   GLY A C    5  
ATOM 9520  O O    . GLY A 1 8   ? 1.104   -14.189 -11.435 1.00 0.00 ? 8   GLY A O    5  
ATOM 9521  H H    . GLY A 1 8   ? 4.797   -12.402 -12.940 1.00 0.00 ? 8   GLY A H    5  
ATOM 9522  H HA2  . GLY A 1 8   ? 2.925   -14.325 -13.284 1.00 0.00 ? 8   GLY A HA2  5  
ATOM 9523  H HA3  . GLY A 1 8   ? 3.944   -14.195 -11.864 1.00 0.00 ? 8   GLY A HA3  5  
ATOM 9524  N N    . GLN A 1 9   ? 1.951   -12.117 -11.108 1.00 0.00 ? 9   GLN A N    5  
ATOM 9525  C CA   . GLN A 1 9   ? 0.844   -11.675 -10.278 1.00 0.00 ? 9   GLN A CA   5  
ATOM 9526  C C    . GLN A 1 9   ? 1.252   -10.447 -9.460  1.00 0.00 ? 9   GLN A C    5  
ATOM 9527  O O    . GLN A 1 9   ? 2.438   -10.196 -9.261  1.00 0.00 ? 9   GLN A O    5  
ATOM 9528  C CB   . GLN A 1 9   ? 0.356   -12.803 -9.368  1.00 0.00 ? 9   GLN A CB   5  
ATOM 9529  C CG   . GLN A 1 9   ? -0.966  -13.384 -9.875  1.00 0.00 ? 9   GLN A CG   5  
ATOM 9530  C CD   . GLN A 1 9   ? -1.972  -13.540 -8.733  1.00 0.00 ? 9   GLN A CD   5  
ATOM 9531  O OE1  . GLN A 1 9   ? -3.128  -13.164 -8.834  1.00 0.00 ? 9   GLN A OE1  5  
ATOM 9532  N NE2  . GLN A 1 9   ? -1.467  -14.112 -7.643  1.00 0.00 ? 9   GLN A NE2  5  
ATOM 9533  H H    . GLN A 1 9   ? 2.667   -11.434 -11.258 1.00 0.00 ? 9   GLN A H    5  
ATOM 9534  H HA   . GLN A 1 9   ? 0.048   -11.408 -10.975 1.00 0.00 ? 9   GLN A HA   5  
ATOM 9535  H HB2  . GLN A 1 9   ? 1.109   -13.589 -9.322  1.00 0.00 ? 9   GLN A HB2  5  
ATOM 9536  H HB3  . GLN A 1 9   ? 0.226   -12.427 -8.353  1.00 0.00 ? 9   GLN A HB3  5  
ATOM 9537  H HG2  . GLN A 1 9   ? -1.382  -12.734 -10.645 1.00 0.00 ? 9   GLN A HG2  5  
ATOM 9538  H HG3  . GLN A 1 9   ? -0.787  -14.353 -10.341 1.00 0.00 ? 9   GLN A HG3  5  
ATOM 9539  H HE21 . GLN A 1 9   ? -0.509  -14.397 -7.625  1.00 0.00 ? 9   GLN A HE21 5  
ATOM 9540  H HE22 . GLN A 1 9   ? -2.047  -14.257 -6.841  1.00 0.00 ? 9   GLN A HE22 5  
ATOM 9541  N N    . MET A 1 10  ? 0.243   -9.715  -9.009  1.00 0.00 ? 10  MET A N    5  
ATOM 9542  C CA   . MET A 1 10  ? 0.481   -8.521  -8.217  1.00 0.00 ? 10  MET A CA   5  
ATOM 9543  C C    . MET A 1 10  ? 0.421   -8.834  -6.721  1.00 0.00 ? 10  MET A C    5  
ATOM 9544  O O    . MET A 1 10  ? -0.533  -9.451  -6.250  1.00 0.00 ? 10  MET A O    5  
ATOM 9545  C CB   . MET A 1 10  ? -0.569  -7.463  -8.560  1.00 0.00 ? 10  MET A CB   5  
ATOM 9546  C CG   . MET A 1 10  ? -0.024  -6.053  -8.326  1.00 0.00 ? 10  MET A CG   5  
ATOM 9547  S SD   . MET A 1 10  ? -0.474  -4.991  -9.689  1.00 0.00 ? 10  MET A SD   5  
ATOM 9548  C CE   . MET A 1 10  ? 0.850   -3.795  -9.600  1.00 0.00 ? 10  MET A CE   5  
ATOM 9549  H H    . MET A 1 10  ? -0.720  -9.927  -9.176  1.00 0.00 ? 10  MET A H    5  
ATOM 9550  H HA   . MET A 1 10  ? 1.484   -8.186  -8.485  1.00 0.00 ? 10  MET A HA   5  
ATOM 9551  H HB2  . MET A 1 10  ? -0.873  -7.571  -9.601  1.00 0.00 ? 10  MET A HB2  5  
ATOM 9552  H HB3  . MET A 1 10  ? -1.459  -7.617  -7.950  1.00 0.00 ? 10  MET A HB3  5  
ATOM 9553  H HG2  . MET A 1 10  ? -0.420  -5.649  -7.394  1.00 0.00 ? 10  MET A HG2  5  
ATOM 9554  H HG3  . MET A 1 10  ? 1.061   -6.086  -8.224  1.00 0.00 ? 10  MET A HG3  5  
ATOM 9555  H HE1  . MET A 1 10  ? 1.012   -3.509  -8.561  1.00 0.00 ? 10  MET A HE1  5  
ATOM 9556  H HE2  . MET A 1 10  ? 1.763   -4.233  -10.003 1.00 0.00 ? 10  MET A HE2  5  
ATOM 9557  H HE3  . MET A 1 10  ? 0.582   -2.913  -10.181 1.00 0.00 ? 10  MET A HE3  5  
ATOM 9558  N N    . VAL A 1 11  ? 1.452   -8.394  -6.015  1.00 0.00 ? 11  VAL A N    5  
ATOM 9559  C CA   . VAL A 1 11  ? 1.529   -8.619  -4.581  1.00 0.00 ? 11  VAL A CA   5  
ATOM 9560  C C    . VAL A 1 11  ? 1.827   -7.294  -3.876  1.00 0.00 ? 11  VAL A C    5  
ATOM 9561  O O    . VAL A 1 11  ? 2.403   -6.386  -4.472  1.00 0.00 ? 11  VAL A O    5  
ATOM 9562  C CB   . VAL A 1 11  ? 2.562   -9.704  -4.277  1.00 0.00 ? 11  VAL A CB   5  
ATOM 9563  C CG1  . VAL A 1 11  ? 2.113   -11.060 -4.826  1.00 0.00 ? 11  VAL A CG1  5  
ATOM 9564  C CG2  . VAL A 1 11  ? 3.938   -9.320  -4.824  1.00 0.00 ? 11  VAL A CG2  5  
ATOM 9565  H H    . VAL A 1 11  ? 2.224   -7.892  -6.405  1.00 0.00 ? 11  VAL A H    5  
ATOM 9566  H HA   . VAL A 1 11  ? 0.553   -8.979  -4.252  1.00 0.00 ? 11  VAL A HA   5  
ATOM 9567  H HB   . VAL A 1 11  ? 2.645   -9.793  -3.193  1.00 0.00 ? 11  VAL A HB   5  
ATOM 9568  H HG11 . VAL A 1 11  ? 1.626   -10.918 -5.791  1.00 0.00 ? 11  VAL A HG11 5  
ATOM 9569  H HG12 . VAL A 1 11  ? 2.981   -11.708 -4.950  1.00 0.00 ? 11  VAL A HG12 5  
ATOM 9570  H HG13 . VAL A 1 11  ? 1.412   -11.520 -4.130  1.00 0.00 ? 11  VAL A HG13 5  
ATOM 9571  H HG21 . VAL A 1 11  ? 3.838   -8.983  -5.855  1.00 0.00 ? 11  VAL A HG21 5  
ATOM 9572  H HG22 . VAL A 1 11  ? 4.359   -8.517  -4.218  1.00 0.00 ? 11  VAL A HG22 5  
ATOM 9573  H HG23 . VAL A 1 11  ? 4.599   -10.187 -4.787  1.00 0.00 ? 11  VAL A HG23 5  
ATOM 9574  N N    . HIS A 1 12  ? 1.421   -7.227  -2.617  1.00 0.00 ? 12  HIS A N    5  
ATOM 9575  C CA   . HIS A 1 12  ? 1.638   -6.028  -1.824  1.00 0.00 ? 12  HIS A CA   5  
ATOM 9576  C C    . HIS A 1 12  ? 2.924   -6.178  -1.009  1.00 0.00 ? 12  HIS A C    5  
ATOM 9577  O O    . HIS A 1 12  ? 3.345   -7.293  -0.705  1.00 0.00 ? 12  HIS A O    5  
ATOM 9578  C CB   . HIS A 1 12  ? 0.416   -5.725  -0.953  1.00 0.00 ? 12  HIS A CB   5  
ATOM 9579  C CG   . HIS A 1 12  ? 0.031   -6.849  -0.022  1.00 0.00 ? 12  HIS A CG   5  
ATOM 9580  N ND1  . HIS A 1 12  ? 0.817   -7.238  1.048   1.00 0.00 ? 12  HIS A ND1  5  
ATOM 9581  C CD2  . HIS A 1 12  ? -1.063  -7.662  -0.012  1.00 0.00 ? 12  HIS A CD2  5  
ATOM 9582  C CE1  . HIS A 1 12  ? 0.213   -8.241  1.669   1.00 0.00 ? 12  HIS A CE1  5  
ATOM 9583  N NE2  . HIS A 1 12  ? -0.952  -8.503  1.010   1.00 0.00 ? 12  HIS A NE2  5  
ATOM 9584  H H    . HIS A 1 12  ? 0.953   -7.970  -2.139  1.00 0.00 ? 12  HIS A H    5  
ATOM 9585  H HA   . HIS A 1 12  ? 1.758   -5.205  -2.528  1.00 0.00 ? 12  HIS A HA   5  
ATOM 9586  H HB2  . HIS A 1 12  ? 0.617   -4.830  -0.363  1.00 0.00 ? 12  HIS A HB2  5  
ATOM 9587  H HB3  . HIS A 1 12  ? -0.431  -5.496  -1.601  1.00 0.00 ? 12  HIS A HB3  5  
ATOM 9588  H HD1  . HIS A 1 12  ? 1.693   -6.831  1.310   1.00 0.00 ? 12  HIS A HD1  5  
ATOM 9589  H HD2  . HIS A 1 12  ? -1.890  -7.627  -0.721  1.00 0.00 ? 12  HIS A HD2  5  
ATOM 9590  H HE1  . HIS A 1 12  ? 0.582   -8.765  2.550   1.00 0.00 ? 12  HIS A HE1  5  
ATOM 9591  H HE2  . HIS A 1 12  ? -1.640  -9.173  1.289   1.00 0.00 ? 12  HIS A HE2  5  
ATOM 9592  N N    . GLN A 1 13  ? 3.513   -5.038  -0.679  1.00 0.00 ? 13  GLN A N    5  
ATOM 9593  C CA   . GLN A 1 13  ? 4.743   -5.027  0.094   1.00 0.00 ? 13  GLN A CA   5  
ATOM 9594  C C    . GLN A 1 13  ? 4.516   -4.342  1.443   1.00 0.00 ? 13  GLN A C    5  
ATOM 9595  O O    . GLN A 1 13  ? 5.365   -3.583  1.909   1.00 0.00 ? 13  GLN A O    5  
ATOM 9596  C CB   . GLN A 1 13  ? 5.874   -4.348  -0.682  1.00 0.00 ? 13  GLN A CB   5  
ATOM 9597  C CG   . GLN A 1 13  ? 7.058   -5.298  -0.868  1.00 0.00 ? 13  GLN A CG   5  
ATOM 9598  C CD   . GLN A 1 13  ? 7.980   -4.812  -1.990  1.00 0.00 ? 13  GLN A CD   5  
ATOM 9599  O OE1  . GLN A 1 13  ? 9.174   -4.632  -1.813  1.00 0.00 ? 13  GLN A OE1  5  
ATOM 9600  N NE2  . GLN A 1 13  ? 7.360   -4.611  -3.149  1.00 0.00 ? 13  GLN A NE2  5  
ATOM 9601  H H    . GLN A 1 13  ? 3.165   -4.134  -0.931  1.00 0.00 ? 13  GLN A H    5  
ATOM 9602  H HA   . GLN A 1 13  ? 4.997   -6.076  0.249   1.00 0.00 ? 13  GLN A HA   5  
ATOM 9603  H HB2  . GLN A 1 13  ? 5.507   -4.023  -1.656  1.00 0.00 ? 13  GLN A HB2  5  
ATOM 9604  H HB3  . GLN A 1 13  ? 6.200   -3.454  -0.150  1.00 0.00 ? 13  GLN A HB3  5  
ATOM 9605  H HG2  . GLN A 1 13  ? 7.620   -5.371  0.063   1.00 0.00 ? 13  GLN A HG2  5  
ATOM 9606  H HG3  . GLN A 1 13  ? 6.694   -6.299  -1.100  1.00 0.00 ? 13  GLN A HG3  5  
ATOM 9607  H HE21 . GLN A 1 13  ? 6.377   -4.779  -3.227  1.00 0.00 ? 13  GLN A HE21 5  
ATOM 9608  H HE22 . GLN A 1 13  ? 7.878   -4.294  -3.944  1.00 0.00 ? 13  GLN A HE22 5  
ATOM 9609  N N    . ALA A 1 14  ? 3.367   -4.636  2.034   1.00 0.00 ? 14  ALA A N    5  
ATOM 9610  C CA   . ALA A 1 14  ? 3.018   -4.058  3.321   1.00 0.00 ? 14  ALA A CA   5  
ATOM 9611  C C    . ALA A 1 14  ? 3.318   -2.559  3.300   1.00 0.00 ? 14  ALA A C    5  
ATOM 9612  O O    . ALA A 1 14  ? 3.667   -2.006  2.257   1.00 0.00 ? 14  ALA A O    5  
ATOM 9613  C CB   . ALA A 1 14  ? 3.775   -4.788  4.431   1.00 0.00 ? 14  ALA A CB   5  
ATOM 9614  H H    . ALA A 1 14  ? 2.682   -5.255  1.648   1.00 0.00 ? 14  ALA A H    5  
ATOM 9615  H HA   . ALA A 1 14  ? 1.948   -4.204  3.470   1.00 0.00 ? 14  ALA A HA   5  
ATOM 9616  H HB1  . ALA A 1 14  ? 4.823   -4.488  4.415   1.00 0.00 ? 14  ALA A HB1  5  
ATOM 9617  H HB2  . ALA A 1 14  ? 3.339   -4.534  5.397   1.00 0.00 ? 14  ALA A HB2  5  
ATOM 9618  H HB3  . ALA A 1 14  ? 3.703   -5.864  4.273   1.00 0.00 ? 14  ALA A HB3  5  
ATOM 9619  N N    . ILE A 1 15  ? 3.171   -1.941  4.462   1.00 0.00 ? 15  ILE A N    5  
ATOM 9620  C CA   . ILE A 1 15  ? 3.423   -0.516  4.591   1.00 0.00 ? 15  ILE A CA   5  
ATOM 9621  C C    . ILE A 1 15  ? 4.919   -0.283  4.808   1.00 0.00 ? 15  ILE A C    5  
ATOM 9622  O O    . ILE A 1 15  ? 5.707   -1.227  4.786   1.00 0.00 ? 15  ILE A O    5  
ATOM 9623  C CB   . ILE A 1 15  ? 2.540   0.087   5.686   1.00 0.00 ? 15  ILE A CB   5  
ATOM 9624  C CG1  . ILE A 1 15  ? 2.169   1.534   5.356   1.00 0.00 ? 15  ILE A CG1  5  
ATOM 9625  C CG2  . ILE A 1 15  ? 3.210   -0.033  7.057   1.00 0.00 ? 15  ILE A CG2  5  
ATOM 9626  C CD1  . ILE A 1 15  ? 0.672   1.776   5.564   1.00 0.00 ? 15  ILE A CD1  5  
ATOM 9627  H H    . ILE A 1 15  ? 2.888   -2.398  5.306   1.00 0.00 ? 15  ILE A H    5  
ATOM 9628  H HA   . ILE A 1 15  ? 3.133   -0.047  3.650   1.00 0.00 ? 15  ILE A HA   5  
ATOM 9629  H HB   . ILE A 1 15  ? 1.613   -0.483  5.729   1.00 0.00 ? 15  ILE A HB   5  
ATOM 9630  H HG12 . ILE A 1 15  ? 2.742   2.214   5.986   1.00 0.00 ? 15  ILE A HG12 5  
ATOM 9631  H HG13 . ILE A 1 15  ? 2.436   1.755   4.323   1.00 0.00 ? 15  ILE A HG13 5  
ATOM 9632  H HG21 . ILE A 1 15  ? 3.913   -0.866  7.046   1.00 0.00 ? 15  ILE A HG21 5  
ATOM 9633  H HG22 . ILE A 1 15  ? 3.743   0.889   7.283   1.00 0.00 ? 15  ILE A HG22 5  
ATOM 9634  H HG23 . ILE A 1 15  ? 2.450   -0.210  7.818   1.00 0.00 ? 15  ILE A HG23 5  
ATOM 9635  H HD11 . ILE A 1 15  ? 0.302   1.110   6.343   1.00 0.00 ? 15  ILE A HD11 5  
ATOM 9636  H HD12 . ILE A 1 15  ? 0.510   2.811   5.864   1.00 0.00 ? 15  ILE A HD12 5  
ATOM 9637  H HD13 . ILE A 1 15  ? 0.139   1.580   4.633   1.00 0.00 ? 15  ILE A HD13 5  
ATOM 9638  N N    . SER A 1 16  ? 5.265   0.979   5.014   1.00 0.00 ? 16  SER A N    5  
ATOM 9639  C CA   . SER A 1 16  ? 6.654   1.347   5.235   1.00 0.00 ? 16  SER A CA   5  
ATOM 9640  C C    . SER A 1 16  ? 6.781   2.156   6.527   1.00 0.00 ? 16  SER A C    5  
ATOM 9641  O O    . SER A 1 16  ? 5.867   2.893   6.894   1.00 0.00 ? 16  SER A O    5  
ATOM 9642  C CB   . SER A 1 16  ? 7.208   2.145   4.053   1.00 0.00 ? 16  SER A CB   5  
ATOM 9643  O OG   . SER A 1 16  ? 8.218   3.065   4.456   1.00 0.00 ? 16  SER A OG   5  
ATOM 9644  H H    . SER A 1 16  ? 4.619   1.741   5.030   1.00 0.00 ? 16  SER A H    5  
ATOM 9645  H HA   . SER A 1 16  ? 7.192   0.404   5.319   1.00 0.00 ? 16  SER A HA   5  
ATOM 9646  H HB2  . SER A 1 16  ? 7.617   1.458   3.312   1.00 0.00 ? 16  SER A HB2  5  
ATOM 9647  H HB3  . SER A 1 16  ? 6.395   2.688   3.569   1.00 0.00 ? 16  SER A HB3  5  
ATOM 9648  H HG   . SER A 1 16  ? 8.754   3.354   3.662   1.00 0.00 ? 16  SER A HG   5  
ATOM 9649  N N    . PRO A 1 17  ? 7.951   1.987   7.198   1.00 0.00 ? 17  PRO A N    5  
ATOM 9650  C CA   . PRO A 1 17  ? 8.210   2.693   8.442   1.00 0.00 ? 17  PRO A CA   5  
ATOM 9651  C C    . PRO A 1 17  ? 8.532   4.166   8.180   1.00 0.00 ? 17  PRO A C    5  
ATOM 9652  O O    . PRO A 1 17  ? 8.147   5.037   8.957   1.00 0.00 ? 17  PRO A O    5  
ATOM 9653  C CB   . PRO A 1 17  ? 9.359   1.939   9.091   1.00 0.00 ? 17  PRO A CB   5  
ATOM 9654  C CG   . PRO A 1 17  ? 10.005  1.128   7.979   1.00 0.00 ? 17  PRO A CG   5  
ATOM 9655  C CD   . PRO A 1 17  ? 9.055   1.123   6.793   1.00 0.00 ? 17  PRO A CD   5  
ATOM 9656  H HA   . PRO A 1 17  ? 7.392   2.691   9.018   1.00 0.00 ? 17  PRO A HA   5  
ATOM 9657  H HB2  . PRO A 1 17  ? 10.074  2.628   9.539   1.00 0.00 ? 17  PRO A HB2  5  
ATOM 9658  H HB3  . PRO A 1 17  ? 8.999   1.290   9.889   1.00 0.00 ? 17  PRO A HB3  5  
ATOM 9659  H HG2  . PRO A 1 17  ? 10.965  1.564   7.698   1.00 0.00 ? 17  PRO A HG2  5  
ATOM 9660  H HG3  . PRO A 1 17  ? 10.204  0.110   8.315   1.00 0.00 ? 17  PRO A HG3  5  
ATOM 9661  H HD2  . PRO A 1 17  ? 9.543   1.499   5.894   1.00 0.00 ? 17  PRO A HD2  5  
ATOM 9662  H HD3  . PRO A 1 17  ? 8.708   0.114   6.569   1.00 0.00 ? 17  PRO A HD3  5  
ATOM 9663  N N    . ARG A 1 18  ? 9.237   4.397   7.082   1.00 0.00 ? 18  ARG A N    5  
ATOM 9664  C CA   . ARG A 1 18  ? 9.617   5.749   6.707   1.00 0.00 ? 18  ARG A CA   5  
ATOM 9665  C C    . ARG A 1 18  ? 8.377   6.561   6.326   1.00 0.00 ? 18  ARG A C    5  
ATOM 9666  O O    . ARG A 1 18  ? 8.308   7.758   6.597   1.00 0.00 ? 18  ARG A O    5  
ATOM 9667  C CB   . ARG A 1 18  ? 10.595  5.741   5.532   1.00 0.00 ? 18  ARG A CB   5  
ATOM 9668  C CG   . ARG A 1 18  ? 11.915  6.414   5.912   1.00 0.00 ? 18  ARG A CG   5  
ATOM 9669  C CD   . ARG A 1 18  ? 12.322  7.453   4.865   1.00 0.00 ? 18  ARG A CD   5  
ATOM 9670  N NE   . ARG A 1 18  ? 12.841  8.668   5.532   1.00 0.00 ? 18  ARG A NE   5  
ATOM 9671  C CZ   . ARG A 1 18  ? 13.277  9.755   4.881   1.00 0.00 ? 18  ARG A CZ   5  
ATOM 9672  N NH1  . ARG A 1 18  ? 13.257  9.785   3.541   1.00 0.00 ? 18  ARG A NH1  5  
ATOM 9673  N NH2  . ARG A 1 18  ? 13.730  10.811  5.569   1.00 0.00 ? 18  ARG A NH2  5  
ATOM 9674  H H    . ARG A 1 18  ? 9.547   3.683   6.455   1.00 0.00 ? 18  ARG A H    5  
ATOM 9675  H HA   . ARG A 1 18  ? 10.097  6.159   7.596   1.00 0.00 ? 18  ARG A HA   5  
ATOM 9676  H HB2  . ARG A 1 18  ? 10.783  4.714   5.218   1.00 0.00 ? 18  ARG A HB2  5  
ATOM 9677  H HB3  . ARG A 1 18  ? 10.151  6.257   4.681   1.00 0.00 ? 18  ARG A HB3  5  
ATOM 9678  H HG2  . ARG A 1 18  ? 11.815  6.893   6.885   1.00 0.00 ? 18  ARG A HG2  5  
ATOM 9679  H HG3  . ARG A 1 18  ? 12.697  5.662   6.006   1.00 0.00 ? 18  ARG A HG3  5  
ATOM 9680  H HD2  . ARG A 1 18  ? 13.083  7.037   4.205   1.00 0.00 ? 18  ARG A HD2  5  
ATOM 9681  H HD3  . ARG A 1 18  ? 11.465  7.708   4.241   1.00 0.00 ? 18  ARG A HD3  5  
ATOM 9682  H HE   . ARG A 1 18  ? 12.869  8.678   6.532   1.00 0.00 ? 18  ARG A HE   5  
ATOM 9683  H HH11 . ARG A 1 18  ? 12.919  8.997   3.028   1.00 0.00 ? 18  ARG A HH11 5  
ATOM 9684  H HH12 . ARG A 1 18  ? 13.583  10.597  3.056   1.00 0.00 ? 18  ARG A HH12 5  
ATOM 9685  H HH21 . ARG A 1 18  ? 13.744  10.788  6.569   1.00 0.00 ? 18  ARG A HH21 5  
ATOM 9686  H HH22 . ARG A 1 18  ? 14.055  11.622  5.083   1.00 0.00 ? 18  ARG A HH22 5  
ATOM 9687  N N    . THR A 1 19  ? 7.430   5.877   5.701   1.00 0.00 ? 19  THR A N    5  
ATOM 9688  C CA   . THR A 1 19  ? 6.197   6.520   5.279   1.00 0.00 ? 19  THR A CA   5  
ATOM 9689  C C    . THR A 1 19  ? 5.312   6.822   6.490   1.00 0.00 ? 19  THR A C    5  
ATOM 9690  O O    . THR A 1 19  ? 4.893   7.963   6.687   1.00 0.00 ? 19  THR A O    5  
ATOM 9691  C CB   . THR A 1 19  ? 5.523   5.617   4.244   1.00 0.00 ? 19  THR A CB   5  
ATOM 9692  O OG1  . THR A 1 19  ? 5.590   6.366   3.034   1.00 0.00 ? 19  THR A OG1  5  
ATOM 9693  C CG2  . THR A 1 19  ? 4.023   5.452   4.499   1.00 0.00 ? 19  THR A CG2  5  
ATOM 9694  H H    . THR A 1 19  ? 7.494   4.903   5.484   1.00 0.00 ? 19  THR A H    5  
ATOM 9695  H HA   . THR A 1 19  ? 6.448   7.476   4.819   1.00 0.00 ? 19  THR A HA   5  
ATOM 9696  H HB   . THR A 1 19  ? 6.018   4.647   4.192   1.00 0.00 ? 19  THR A HB   5  
ATOM 9697  H HG1  . THR A 1 19  ? 6.533   6.648   2.857   1.00 0.00 ? 19  THR A HG1  5  
ATOM 9698  H HG21 . THR A 1 19  ? 3.606   6.401   4.838   1.00 0.00 ? 19  THR A HG21 5  
ATOM 9699  H HG22 . THR A 1 19  ? 3.529   5.148   3.576   1.00 0.00 ? 19  THR A HG22 5  
ATOM 9700  H HG23 . THR A 1 19  ? 3.866   4.692   5.263   1.00 0.00 ? 19  THR A HG23 5  
ATOM 9701  N N    . LEU A 1 20  ? 5.052   5.783   7.267   1.00 0.00 ? 20  LEU A N    5  
ATOM 9702  C CA   . LEU A 1 20  ? 4.225   5.922   8.454   1.00 0.00 ? 20  LEU A CA   5  
ATOM 9703  C C    . LEU A 1 20  ? 4.891   6.901   9.423   1.00 0.00 ? 20  LEU A C    5  
ATOM 9704  O O    . LEU A 1 20  ? 4.213   7.690   10.078  1.00 0.00 ? 20  LEU A O    5  
ATOM 9705  C CB   . LEU A 1 20  ? 3.931   4.552   9.068   1.00 0.00 ? 20  LEU A CB   5  
ATOM 9706  C CG   . LEU A 1 20  ? 2.761   3.780   8.456   1.00 0.00 ? 20  LEU A CG   5  
ATOM 9707  C CD1  . LEU A 1 20  ? 2.742   2.331   8.948   1.00 0.00 ? 20  LEU A CD1  5  
ATOM 9708  C CD2  . LEU A 1 20  ? 1.433   4.494   8.723   1.00 0.00 ? 20  LEU A CD2  5  
ATOM 9709  H H    . LEU A 1 20  ? 5.397   4.859   7.100   1.00 0.00 ? 20  LEU A H    5  
ATOM 9710  H HA   . LEU A 1 20  ? 3.271   6.345   8.138   1.00 0.00 ? 20  LEU A HA   5  
ATOM 9711  H HB2  . LEU A 1 20  ? 4.828   3.939   8.983   1.00 0.00 ? 20  LEU A HB2  5  
ATOM 9712  H HB3  . LEU A 1 20  ? 3.736   4.687   10.131  1.00 0.00 ? 20  LEU A HB3  5  
ATOM 9713  H HG   . LEU A 1 20  ? 2.898   3.751   7.374   1.00 0.00 ? 20  LEU A HG   5  
ATOM 9714  H HD11 . LEU A 1 20  ? 3.761   1.945   8.977   1.00 0.00 ? 20  LEU A HD11 5  
ATOM 9715  H HD12 . LEU A 1 20  ? 2.309   2.293   9.948   1.00 0.00 ? 20  LEU A HD12 5  
ATOM 9716  H HD13 . LEU A 1 20  ? 2.142   1.725   8.269   1.00 0.00 ? 20  LEU A HD13 5  
ATOM 9717  H HD21 . LEU A 1 20  ? 1.374   4.768   9.776   1.00 0.00 ? 20  LEU A HD21 5  
ATOM 9718  H HD22 . LEU A 1 20  ? 1.374   5.392   8.110   1.00 0.00 ? 20  LEU A HD22 5  
ATOM 9719  H HD23 . LEU A 1 20  ? 0.607   3.829   8.475   1.00 0.00 ? 20  LEU A HD23 5  
ATOM 9720  N N    . ASN A 1 21  ? 6.212   6.815   9.484   1.00 0.00 ? 21  ASN A N    5  
ATOM 9721  C CA   . ASN A 1 21  ? 6.978   7.684   10.362  1.00 0.00 ? 21  ASN A CA   5  
ATOM 9722  C C    . ASN A 1 21  ? 6.729   9.142   9.976   1.00 0.00 ? 21  ASN A C    5  
ATOM 9723  O O    . ASN A 1 21  ? 6.302   9.944   10.804  1.00 0.00 ? 21  ASN A O    5  
ATOM 9724  C CB   . ASN A 1 21  ? 8.478   7.410   10.236  1.00 0.00 ? 21  ASN A CB   5  
ATOM 9725  C CG   . ASN A 1 21  ? 9.290   8.423   11.044  1.00 0.00 ? 21  ASN A CG   5  
ATOM 9726  O OD1  . ASN A 1 21  ? 9.496   8.281   12.238  1.00 0.00 ? 21  ASN A OD1  5  
ATOM 9727  N ND2  . ASN A 1 21  ? 9.738   9.451   10.330  1.00 0.00 ? 21  ASN A ND2  5  
ATOM 9728  H H    . ASN A 1 21  ? 6.756   6.171   8.948   1.00 0.00 ? 21  ASN A H    5  
ATOM 9729  H HA   . ASN A 1 21  ? 6.628   7.453   11.369  1.00 0.00 ? 21  ASN A HA   5  
ATOM 9730  H HB2  . ASN A 1 21  ? 8.698   6.401   10.584  1.00 0.00 ? 21  ASN A HB2  5  
ATOM 9731  H HB3  . ASN A 1 21  ? 8.772   7.457   9.187   1.00 0.00 ? 21  ASN A HB3  5  
ATOM 9732  H HD21 . ASN A 1 21  ? 9.534   9.508   9.352   1.00 0.00 ? 21  ASN A HD21 5  
ATOM 9733  H HD22 . ASN A 1 21  ? 10.280  10.167  10.769  1.00 0.00 ? 21  ASN A HD22 5  
ATOM 9734  N N    . ALA A 1 22  ? 7.006   9.442   8.715   1.00 0.00 ? 22  ALA A N    5  
ATOM 9735  C CA   . ALA A 1 22  ? 6.817   10.791  8.207   1.00 0.00 ? 22  ALA A CA   5  
ATOM 9736  C C    . ALA A 1 22  ? 5.365   11.217  8.433   1.00 0.00 ? 22  ALA A C    5  
ATOM 9737  O O    . ALA A 1 22  ? 5.105   12.332  8.884   1.00 0.00 ? 22  ALA A O    5  
ATOM 9738  C CB   . ALA A 1 22  ? 7.217   10.842  6.732   1.00 0.00 ? 22  ALA A CB   5  
ATOM 9739  H H    . ALA A 1 22  ? 7.353   8.784   8.047   1.00 0.00 ? 22  ALA A H    5  
ATOM 9740  H HA   . ALA A 1 22  ? 7.474   11.452  8.772   1.00 0.00 ? 22  ALA A HA   5  
ATOM 9741  H HB1  . ALA A 1 22  ? 6.333   10.698  6.110   1.00 0.00 ? 22  ALA A HB1  5  
ATOM 9742  H HB2  . ALA A 1 22  ? 7.940   10.053  6.523   1.00 0.00 ? 22  ALA A HB2  5  
ATOM 9743  H HB3  . ALA A 1 22  ? 7.664   11.811  6.509   1.00 0.00 ? 22  ALA A HB3  5  
ATOM 9744  N N    . TRP A 1 23  ? 4.457   10.308  8.109   1.00 0.00 ? 23  TRP A N    5  
ATOM 9745  C CA   . TRP A 1 23  ? 3.039   10.576  8.271   1.00 0.00 ? 23  TRP A CA   5  
ATOM 9746  C C    . TRP A 1 23  ? 2.806   11.033  9.712   1.00 0.00 ? 23  TRP A C    5  
ATOM 9747  O O    . TRP A 1 23  ? 2.366   12.157  9.947   1.00 0.00 ? 23  TRP A O    5  
ATOM 9748  C CB   . TRP A 1 23  ? 2.203   9.353   7.889   1.00 0.00 ? 23  TRP A CB   5  
ATOM 9749  C CG   . TRP A 1 23  ? 0.757   9.406   8.389   1.00 0.00 ? 23  TRP A CG   5  
ATOM 9750  C CD1  . TRP A 1 23  ? 0.143   8.560   9.228   1.00 0.00 ? 23  TRP A CD1  5  
ATOM 9751  C CD2  . TRP A 1 23  ? -0.235  10.395  8.045   1.00 0.00 ? 23  TRP A CD2  5  
ATOM 9752  N NE1  . TRP A 1 23  ? -1.167  8.931   9.449   1.00 0.00 ? 23  TRP A NE1  5  
ATOM 9753  C CE2  . TRP A 1 23  ? -1.405  10.082  8.707   1.00 0.00 ? 23  TRP A CE2  5  
ATOM 9754  C CE3  . TRP A 1 23  ? -0.148  11.518  7.202   1.00 0.00 ? 23  TRP A CE3  5  
ATOM 9755  C CZ2  . TRP A 1 23  ? -2.576  10.842  8.595   1.00 0.00 ? 23  TRP A CZ2  5  
ATOM 9756  C CZ3  . TRP A 1 23  ? -1.327  12.266  7.102   1.00 0.00 ? 23  TRP A CZ3  5  
ATOM 9757  C CH2  . TRP A 1 23  ? -2.513  11.964  7.761   1.00 0.00 ? 23  TRP A CH2  5  
ATOM 9758  H H    . TRP A 1 23  ? 4.678   9.404   7.743   1.00 0.00 ? 23  TRP A H    5  
ATOM 9759  H HA   . TRP A 1 23  ? 2.770   11.374  7.579   1.00 0.00 ? 23  TRP A HA   5  
ATOM 9760  H HB2  . TRP A 1 23  ? 2.197   9.255   6.803   1.00 0.00 ? 23  TRP A HB2  5  
ATOM 9761  H HB3  . TRP A 1 23  ? 2.682   8.459   8.288   1.00 0.00 ? 23  TRP A HB3  5  
ATOM 9762  H HD1  . TRP A 1 23  ? 0.619   7.690   9.679   1.00 0.00 ? 23  TRP A HD1  5  
ATOM 9763  H HE1  . TRP A 1 23  ? -1.885  8.416   10.088  1.00 0.00 ? 23  TRP A HE1  5  
ATOM 9764  H HE3  . TRP A 1 23  ? 0.764   11.786  6.668   1.00 0.00 ? 23  TRP A HE3  5  
ATOM 9765  H HZ2  . TRP A 1 23  ? -3.488  10.573  9.129   1.00 0.00 ? 23  TRP A HZ2  5  
ATOM 9766  H HZ3  . TRP A 1 23  ? -1.314  13.147  6.460   1.00 0.00 ? 23  TRP A HZ3  5  
ATOM 9767  H HH2  . TRP A 1 23  ? -3.389  12.598  7.629   1.00 0.00 ? 23  TRP A HH2  5  
ATOM 9768  N N    . VAL A 1 24  ? 3.110   10.138  10.640  1.00 0.00 ? 24  VAL A N    5  
ATOM 9769  C CA   . VAL A 1 24  ? 2.939   10.435  12.052  1.00 0.00 ? 24  VAL A CA   5  
ATOM 9770  C C    . VAL A 1 24  ? 3.494   11.830  12.346  1.00 0.00 ? 24  VAL A C    5  
ATOM 9771  O O    . VAL A 1 24  ? 2.875   12.609  13.068  1.00 0.00 ? 24  VAL A O    5  
ATOM 9772  C CB   . VAL A 1 24  ? 3.591   9.341   12.900  1.00 0.00 ? 24  VAL A CB   5  
ATOM 9773  C CG1  . VAL A 1 24  ? 3.434   9.638   14.393  1.00 0.00 ? 24  VAL A CG1  5  
ATOM 9774  C CG2  . VAL A 1 24  ? 3.021   7.965   12.551  1.00 0.00 ? 24  VAL A CG2  5  
ATOM 9775  H H    . VAL A 1 24  ? 3.467   9.225   10.441  1.00 0.00 ? 24  VAL A H    5  
ATOM 9776  H HA   . VAL A 1 24  ? 1.869   10.432  12.261  1.00 0.00 ? 24  VAL A HA   5  
ATOM 9777  H HB   . VAL A 1 24  ? 4.656   9.330   12.671  1.00 0.00 ? 24  VAL A HB   5  
ATOM 9778  H HG11 . VAL A 1 24  ? 2.378   9.767   14.628  1.00 0.00 ? 24  VAL A HG11 5  
ATOM 9779  H HG12 . VAL A 1 24  ? 3.836   8.807   14.972  1.00 0.00 ? 24  VAL A HG12 5  
ATOM 9780  H HG13 . VAL A 1 24  ? 3.976   10.550  14.641  1.00 0.00 ? 24  VAL A HG13 5  
ATOM 9781  H HG21 . VAL A 1 24  ? 2.288   8.067   11.752  1.00 0.00 ? 24  VAL A HG21 5  
ATOM 9782  H HG22 . VAL A 1 24  ? 3.828   7.309   12.223  1.00 0.00 ? 24  VAL A HG22 5  
ATOM 9783  H HG23 . VAL A 1 24  ? 2.541   7.536   13.432  1.00 0.00 ? 24  VAL A HG23 5  
ATOM 9784  N N    . LYS A 1 25  ? 4.657   12.103  11.771  1.00 0.00 ? 25  LYS A N    5  
ATOM 9785  C CA   . LYS A 1 25  ? 5.302   13.391  11.963  1.00 0.00 ? 25  LYS A CA   5  
ATOM 9786  C C    . LYS A 1 25  ? 4.390   14.498  11.432  1.00 0.00 ? 25  LYS A C    5  
ATOM 9787  O O    . LYS A 1 25  ? 4.252   15.547  12.058  1.00 0.00 ? 25  LYS A O    5  
ATOM 9788  C CB   . LYS A 1 25  ? 6.698   13.389  11.334  1.00 0.00 ? 25  LYS A CB   5  
ATOM 9789  C CG   . LYS A 1 25  ? 7.741   13.928  12.314  1.00 0.00 ? 25  LYS A CG   5  
ATOM 9790  C CD   . LYS A 1 25  ? 9.094   14.119  11.625  1.00 0.00 ? 25  LYS A CD   5  
ATOM 9791  C CE   . LYS A 1 25  ? 10.136  14.662  12.603  1.00 0.00 ? 25  LYS A CE   5  
ATOM 9792  N NZ   . LYS A 1 25  ? 11.247  13.697  12.766  1.00 0.00 ? 25  LYS A NZ   5  
ATOM 9793  H H    . LYS A 1 25  ? 5.154   11.463  11.185  1.00 0.00 ? 25  LYS A H    5  
ATOM 9794  H HA   . LYS A 1 25  ? 5.432   13.534  13.035  1.00 0.00 ? 25  LYS A HA   5  
ATOM 9795  H HB2  . LYS A 1 25  ? 6.964   12.375  11.034  1.00 0.00 ? 25  LYS A HB2  5  
ATOM 9796  H HB3  . LYS A 1 25  ? 6.693   13.997  10.429  1.00 0.00 ? 25  LYS A HB3  5  
ATOM 9797  H HG2  . LYS A 1 25  ? 7.402   14.879  12.724  1.00 0.00 ? 25  LYS A HG2  5  
ATOM 9798  H HG3  . LYS A 1 25  ? 7.849   13.240  13.151  1.00 0.00 ? 25  LYS A HG3  5  
ATOM 9799  H HD2  . LYS A 1 25  ? 9.435   13.167  11.216  1.00 0.00 ? 25  LYS A HD2  5  
ATOM 9800  H HD3  . LYS A 1 25  ? 8.985   14.804  10.785  1.00 0.00 ? 25  LYS A HD3  5  
ATOM 9801  H HE2  . LYS A 1 25  ? 10.524  15.614  12.240  1.00 0.00 ? 25  LYS A HE2  5  
ATOM 9802  H HE3  . LYS A 1 25  ? 9.670   14.855  13.570  1.00 0.00 ? 25  LYS A HE3  5  
ATOM 9803  H HZ1  . LYS A 1 25  ? 11.508  13.335  11.871  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 9804  H HZ2  . LYS A 1 25  ? 12.031  14.160  13.181  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 9805  H HZ3  . LYS A 1 25  ? 10.952  12.947  13.356  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 9806  N N    . VAL A 1 26  ? 3.790   14.226  10.282  1.00 0.00 ? 26  VAL A N    5  
ATOM 9807  C CA   . VAL A 1 26  ? 2.895   15.186  9.660   1.00 0.00 ? 26  VAL A CA   5  
ATOM 9808  C C    . VAL A 1 26  ? 1.696   15.429  10.578  1.00 0.00 ? 26  VAL A C    5  
ATOM 9809  O O    . VAL A 1 26  ? 1.526   16.526  11.107  1.00 0.00 ? 26  VAL A O    5  
ATOM 9810  C CB   . VAL A 1 26  ? 2.491   14.699  8.266   1.00 0.00 ? 26  VAL A CB   5  
ATOM 9811  C CG1  . VAL A 1 26  ? 1.419   15.605  7.658   1.00 0.00 ? 26  VAL A CG1  5  
ATOM 9812  C CG2  . VAL A 1 26  ? 3.710   14.595  7.347   1.00 0.00 ? 26  VAL A CG2  5  
ATOM 9813  H H    . VAL A 1 26  ? 3.907   13.369  9.779   1.00 0.00 ? 26  VAL A H    5  
ATOM 9814  H HA   . VAL A 1 26  ? 3.444   16.120  9.544   1.00 0.00 ? 26  VAL A HA   5  
ATOM 9815  H HB   . VAL A 1 26  ? 2.065   13.701  8.371   1.00 0.00 ? 26  VAL A HB   5  
ATOM 9816  H HG11 . VAL A 1 26  ? 0.695   15.878  8.425   1.00 0.00 ? 26  VAL A HG11 5  
ATOM 9817  H HG12 . VAL A 1 26  ? 1.888   16.508  7.264   1.00 0.00 ? 26  VAL A HG12 5  
ATOM 9818  H HG13 . VAL A 1 26  ? 0.913   15.078  6.849   1.00 0.00 ? 26  VAL A HG13 5  
ATOM 9819  H HG21 . VAL A 1 26  ? 4.596   14.938  7.880   1.00 0.00 ? 26  VAL A HG21 5  
ATOM 9820  H HG22 . VAL A 1 26  ? 3.848   13.558  7.042   1.00 0.00 ? 26  VAL A HG22 5  
ATOM 9821  H HG23 . VAL A 1 26  ? 3.553   15.216  6.465   1.00 0.00 ? 26  VAL A HG23 5  
ATOM 9822  N N    . VAL A 1 27  ? 0.894   14.387  10.740  1.00 0.00 ? 27  VAL A N    5  
ATOM 9823  C CA   . VAL A 1 27  ? -0.284  14.472  11.587  1.00 0.00 ? 27  VAL A CA   5  
ATOM 9824  C C    . VAL A 1 27  ? 0.066   15.237  12.865  1.00 0.00 ? 27  VAL A C    5  
ATOM 9825  O O    . VAL A 1 27  ? -0.729  16.042  13.348  1.00 0.00 ? 27  VAL A O    5  
ATOM 9826  C CB   . VAL A 1 27  ? -0.835  13.072  11.860  1.00 0.00 ? 27  VAL A CB   5  
ATOM 9827  C CG1  . VAL A 1 27  ? -2.046  13.132  12.793  1.00 0.00 ? 27  VAL A CG1  5  
ATOM 9828  C CG2  . VAL A 1 27  ? -1.183  12.355  10.555  1.00 0.00 ? 27  VAL A CG2  5  
ATOM 9829  H H    . VAL A 1 27  ? 1.040   13.497  10.307  1.00 0.00 ? 27  VAL A H    5  
ATOM 9830  H HA   . VAL A 1 27  ? -1.042  15.032  11.039  1.00 0.00 ? 27  VAL A HA   5  
ATOM 9831  H HB   . VAL A 1 27  ? -0.055  12.496  12.360  1.00 0.00 ? 27  VAL A HB   5  
ATOM 9832  H HG11 . VAL A 1 27  ? -1.864  13.865  13.579  1.00 0.00 ? 27  VAL A HG11 5  
ATOM 9833  H HG12 . VAL A 1 27  ? -2.929  13.423  12.224  1.00 0.00 ? 27  VAL A HG12 5  
ATOM 9834  H HG13 . VAL A 1 27  ? -2.209  12.152  13.240  1.00 0.00 ? 27  VAL A HG13 5  
ATOM 9835  H HG21 . VAL A 1 27  ? -1.276  13.086  9.752   1.00 0.00 ? 27  VAL A HG21 5  
ATOM 9836  H HG22 . VAL A 1 27  ? -0.395  11.644  10.309  1.00 0.00 ? 27  VAL A HG22 5  
ATOM 9837  H HG23 . VAL A 1 27  ? -2.128  11.823  10.673  1.00 0.00 ? 27  VAL A HG23 5  
ATOM 9838  N N    . GLU A 1 28  ? 1.257   14.960  13.375  1.00 0.00 ? 28  GLU A N    5  
ATOM 9839  C CA   . GLU A 1 28  ? 1.722   15.612  14.587  1.00 0.00 ? 28  GLU A CA   5  
ATOM 9840  C C    . GLU A 1 28  ? 1.777   17.128  14.388  1.00 0.00 ? 28  GLU A C    5  
ATOM 9841  O O    . GLU A 1 28  ? 1.259   17.884  15.207  1.00 0.00 ? 28  GLU A O    5  
ATOM 9842  C CB   . GLU A 1 28  ? 3.085   15.066  15.015  1.00 0.00 ? 28  GLU A CB   5  
ATOM 9843  C CG   . GLU A 1 28  ? 2.942   14.084  16.180  1.00 0.00 ? 28  GLU A CG   5  
ATOM 9844  C CD   . GLU A 1 28  ? 3.538   14.665  17.463  1.00 0.00 ? 28  GLU A CD   5  
ATOM 9845  O OE1  . GLU A 1 28  ? 3.027   15.718  17.900  1.00 0.00 ? 28  GLU A OE1  5  
ATOM 9846  O OE2  . GLU A 1 28  ? 4.492   14.043  17.978  1.00 0.00 ? 28  GLU A OE2  5  
ATOM 9847  H H    . GLU A 1 28  ? 1.897   14.304  12.976  1.00 0.00 ? 28  GLU A H    5  
ATOM 9848  H HA   . GLU A 1 28  ? 0.983   15.365  15.351  1.00 0.00 ? 28  GLU A HA   5  
ATOM 9849  H HB2  . GLU A 1 28  ? 3.563   14.567  14.172  1.00 0.00 ? 28  GLU A HB2  5  
ATOM 9850  H HB3  . GLU A 1 28  ? 3.736   15.890  15.308  1.00 0.00 ? 28  GLU A HB3  5  
ATOM 9851  H HG2  . GLU A 1 28  ? 1.888   13.852  16.337  1.00 0.00 ? 28  GLU A HG2  5  
ATOM 9852  H HG3  . GLU A 1 28  ? 3.442   13.147  15.934  1.00 0.00 ? 28  GLU A HG3  5  
ATOM 9853  N N    . GLU A 1 29  ? 2.408   17.526  13.293  1.00 0.00 ? 29  GLU A N    5  
ATOM 9854  C CA   . GLU A 1 29  ? 2.537   18.938  12.974  1.00 0.00 ? 29  GLU A CA   5  
ATOM 9855  C C    . GLU A 1 29  ? 1.351   19.401  12.126  1.00 0.00 ? 29  GLU A C    5  
ATOM 9856  O O    . GLU A 1 29  ? 1.340   20.527  11.632  1.00 0.00 ? 29  GLU A O    5  
ATOM 9857  C CB   . GLU A 1 29  ? 3.863   19.221  12.265  1.00 0.00 ? 29  GLU A CB   5  
ATOM 9858  C CG   . GLU A 1 29  ? 4.386   20.614  12.619  1.00 0.00 ? 29  GLU A CG   5  
ATOM 9859  C CD   . GLU A 1 29  ? 5.508   21.036  11.667  1.00 0.00 ? 29  GLU A CD   5  
ATOM 9860  O OE1  . GLU A 1 29  ? 6.355   20.166  11.368  1.00 0.00 ? 29  GLU A OE1  5  
ATOM 9861  O OE2  . GLU A 1 29  ? 5.493   22.218  11.261  1.00 0.00 ? 29  GLU A OE2  5  
ATOM 9862  H H    . GLU A 1 29  ? 2.826   16.903  12.631  1.00 0.00 ? 29  GLU A H    5  
ATOM 9863  H HA   . GLU A 1 29  ? 2.528   19.453  13.935  1.00 0.00 ? 29  GLU A HA   5  
ATOM 9864  H HB2  . GLU A 1 29  ? 4.599   18.468  12.549  1.00 0.00 ? 29  GLU A HB2  5  
ATOM 9865  H HB3  . GLU A 1 29  ? 3.726   19.143  11.186  1.00 0.00 ? 29  GLU A HB3  5  
ATOM 9866  H HG2  . GLU A 1 29  ? 3.572   21.337  12.570  1.00 0.00 ? 29  GLU A HG2  5  
ATOM 9867  H HG3  . GLU A 1 29  ? 4.755   20.618  13.645  1.00 0.00 ? 29  GLU A HG3  5  
ATOM 9868  N N    . LYS A 1 30  ? 0.382   18.508  11.984  1.00 0.00 ? 30  LYS A N    5  
ATOM 9869  C CA   . LYS A 1 30  ? -0.806  18.812  11.204  1.00 0.00 ? 30  LYS A CA   5  
ATOM 9870  C C    . LYS A 1 30  ? -2.041  18.699  12.099  1.00 0.00 ? 30  LYS A C    5  
ATOM 9871  O O    . LYS A 1 30  ? -2.564  19.707  12.573  1.00 0.00 ? 30  LYS A O    5  
ATOM 9872  C CB   . LYS A 1 30  ? -0.867  17.929  9.956   1.00 0.00 ? 30  LYS A CB   5  
ATOM 9873  C CG   . LYS A 1 30  ? -0.164  18.601  8.774   1.00 0.00 ? 30  LYS A CG   5  
ATOM 9874  C CD   . LYS A 1 30  ? 1.356   18.516  8.921   1.00 0.00 ? 30  LYS A CD   5  
ATOM 9875  C CE   . LYS A 1 30  ? 2.058   19.006  7.653   1.00 0.00 ? 30  LYS A CE   5  
ATOM 9876  N NZ   . LYS A 1 30  ? 3.448   18.502  7.603   1.00 0.00 ? 30  LYS A NZ   5  
ATOM 9877  H H    . LYS A 1 30  ? 0.399   17.594  12.390  1.00 0.00 ? 30  LYS A H    5  
ATOM 9878  H HA   . LYS A 1 30  ? -0.719  19.845  10.864  1.00 0.00 ? 30  LYS A HA   5  
ATOM 9879  H HB2  . LYS A 1 30  ? -0.400  16.967  10.163  1.00 0.00 ? 30  LYS A HB2  5  
ATOM 9880  H HB3  . LYS A 1 30  ? -1.908  17.728  9.699   1.00 0.00 ? 30  LYS A HB3  5  
ATOM 9881  H HG2  . LYS A 1 30  ? -0.470  18.120  7.845   1.00 0.00 ? 30  LYS A HG2  5  
ATOM 9882  H HG3  . LYS A 1 30  ? -0.470  19.644  8.710   1.00 0.00 ? 30  LYS A HG3  5  
ATOM 9883  H HD2  . LYS A 1 30  ? 1.676   19.117  9.773   1.00 0.00 ? 30  LYS A HD2  5  
ATOM 9884  H HD3  . LYS A 1 30  ? 1.649   17.487  9.130   1.00 0.00 ? 30  LYS A HD3  5  
ATOM 9885  H HE2  . LYS A 1 30  ? 1.510   18.668  6.774   1.00 0.00 ? 30  LYS A HE2  5  
ATOM 9886  H HE3  . LYS A 1 30  ? 2.059   20.095  7.628   1.00 0.00 ? 30  LYS A HE3  5  
ATOM 9887  H HZ1  . LYS A 1 30  ? 3.517   17.659  8.136   1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 9888  H HZ2  . LYS A 1 30  ? 3.701   18.316  6.653   1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 9889  H HZ3  . LYS A 1 30  ? 4.066   19.190  7.985   1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 9890  N N    . ALA A 1 31  ? -2.473  17.463  12.303  1.00 0.00 ? 31  ALA A N    5  
ATOM 9891  C CA   . ALA A 1 31  ? -3.638  17.205  13.133  1.00 0.00 ? 31  ALA A CA   5  
ATOM 9892  C C    . ALA A 1 31  ? -4.904  17.342  12.284  1.00 0.00 ? 31  ALA A C    5  
ATOM 9893  O O    . ALA A 1 31  ? -5.768  18.166  12.581  1.00 0.00 ? 31  ALA A O    5  
ATOM 9894  C CB   . ALA A 1 31  ? -3.633  18.155  14.331  1.00 0.00 ? 31  ALA A CB   5  
ATOM 9895  H H    . ALA A 1 31  ? -2.043  16.648  11.913  1.00 0.00 ? 31  ALA A H    5  
ATOM 9896  H HA   . ALA A 1 31  ? -3.565  16.180  13.498  1.00 0.00 ? 31  ALA A HA   5  
ATOM 9897  H HB1  . ALA A 1 31  ? -4.343  18.964  14.156  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 9898  H HB2  . ALA A 1 31  ? -2.633  18.572  14.459  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 9899  H HB3  . ALA A 1 31  ? -3.918  17.609  15.230  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 9900  N N    . PHE A 1 32  ? -4.974  16.522  11.247  1.00 0.00 ? 32  PHE A N    5  
ATOM 9901  C CA   . PHE A 1 32  ? -6.120  16.541  10.354  1.00 0.00 ? 32  PHE A CA   5  
ATOM 9902  C C    . PHE A 1 32  ? -6.335  17.938  9.768   1.00 0.00 ? 32  PHE A C    5  
ATOM 9903  O O    . PHE A 1 32  ? -7.435  18.483  9.842   1.00 0.00 ? 32  PHE A O    5  
ATOM 9904  C CB   . PHE A 1 32  ? -7.343  16.156  11.187  1.00 0.00 ? 32  PHE A CB   5  
ATOM 9905  C CG   . PHE A 1 32  ? -7.561  14.647  11.313  1.00 0.00 ? 32  PHE A CG   5  
ATOM 9906  C CD1  . PHE A 1 32  ? -6.664  13.885  11.994  1.00 0.00 ? 32  PHE A CD1  5  
ATOM 9907  C CD2  . PHE A 1 32  ? -8.652  14.068  10.744  1.00 0.00 ? 32  PHE A CD2  5  
ATOM 9908  C CE1  . PHE A 1 32  ? -6.866  12.484  12.111  1.00 0.00 ? 32  PHE A CE1  5  
ATOM 9909  C CE2  . PHE A 1 32  ? -8.854  12.667  10.861  1.00 0.00 ? 32  PHE A CE2  5  
ATOM 9910  C CZ   . PHE A 1 32  ? -7.957  11.904  11.542  1.00 0.00 ? 32  PHE A CZ   5  
ATOM 9911  H H    . PHE A 1 32  ? -4.267  15.854  11.013  1.00 0.00 ? 32  PHE A H    5  
ATOM 9912  H HA   . PHE A 1 32  ? -5.913  15.839  9.546   1.00 0.00 ? 32  PHE A HA   5  
ATOM 9913  H HB2  . PHE A 1 32  ? -7.239  16.582  12.185  1.00 0.00 ? 32  PHE A HB2  5  
ATOM 9914  H HB3  . PHE A 1 32  ? -8.231  16.605  10.740  1.00 0.00 ? 32  PHE A HB3  5  
ATOM 9915  H HD1  . PHE A 1 32  ? -5.790  14.349  12.450  1.00 0.00 ? 32  PHE A HD1  5  
ATOM 9916  H HD2  . PHE A 1 32  ? -9.371  14.678  10.198  1.00 0.00 ? 32  PHE A HD2  5  
ATOM 9917  H HE1  . PHE A 1 32  ? -6.147  11.873  12.657  1.00 0.00 ? 32  PHE A HE1  5  
ATOM 9918  H HE2  . PHE A 1 32  ? -9.728  12.202  10.404  1.00 0.00 ? 32  PHE A HE2  5  
ATOM 9919  H HZ   . PHE A 1 32  ? -8.113  10.830  11.631  1.00 0.00 ? 32  PHE A HZ   5  
ATOM 9920  N N    . SER A 1 33  ? -5.267  18.477  9.199   1.00 0.00 ? 33  SER A N    5  
ATOM 9921  C CA   . SER A 1 33  ? -5.325  19.800  8.601   1.00 0.00 ? 33  SER A CA   5  
ATOM 9922  C C    . SER A 1 33  ? -5.884  19.709  7.180   1.00 0.00 ? 33  SER A C    5  
ATOM 9923  O O    . SER A 1 33  ? -6.086  18.613  6.658   1.00 0.00 ? 33  SER A O    5  
ATOM 9924  C CB   . SER A 1 33  ? -3.945  20.460  8.588   1.00 0.00 ? 33  SER A CB   5  
ATOM 9925  O OG   . SER A 1 33  ? -3.330  20.386  7.304   1.00 0.00 ? 33  SER A OG   5  
ATOM 9926  H H    . SER A 1 33  ? -4.376  18.027  9.143   1.00 0.00 ? 33  SER A H    5  
ATOM 9927  H HA   . SER A 1 33  ? -5.996  20.377  9.240   1.00 0.00 ? 33  SER A HA   5  
ATOM 9928  H HB2  . SER A 1 33  ? -4.038  21.504  8.885   1.00 0.00 ? 33  SER A HB2  5  
ATOM 9929  H HB3  . SER A 1 33  ? -3.304  19.976  9.325   1.00 0.00 ? 33  SER A HB3  5  
ATOM 9930  H HG   . SER A 1 33  ? -2.619  19.682  7.306   1.00 0.00 ? 33  SER A HG   5  
ATOM 9931  N N    . PRO A 1 34  ? -6.123  20.905  6.579   1.00 0.00 ? 34  PRO A N    5  
ATOM 9932  C CA   . PRO A 1 34  ? -6.655  20.970  5.228   1.00 0.00 ? 34  PRO A CA   5  
ATOM 9933  C C    . PRO A 1 34  ? -5.576  20.627  4.198   1.00 0.00 ? 34  PRO A C    5  
ATOM 9934  O O    . PRO A 1 34  ? -5.843  20.605  2.997   1.00 0.00 ? 34  PRO A O    5  
ATOM 9935  C CB   . PRO A 1 34  ? -7.187  22.385  5.081   1.00 0.00 ? 34  PRO A CB   5  
ATOM 9936  C CG   . PRO A 1 34  ? -6.522  23.197  6.182   1.00 0.00 ? 34  PRO A CG   5  
ATOM 9937  C CD   . PRO A 1 34  ? -5.895  22.221  7.166   1.00 0.00 ? 34  PRO A CD   5  
ATOM 9938  H HA   . PRO A 1 34  ? -7.376  20.287  5.105   1.00 0.00 ? 34  PRO A HA   5  
ATOM 9939  H HB2  . PRO A 1 34  ? -6.950  22.793  4.099   1.00 0.00 ? 34  PRO A HB2  5  
ATOM 9940  H HB3  . PRO A 1 34  ? -8.273  22.407  5.183   1.00 0.00 ? 34  PRO A HB3  5  
ATOM 9941  H HG2  . PRO A 1 34  ? -5.763  23.857  5.763   1.00 0.00 ? 34  PRO A HG2  5  
ATOM 9942  H HG3  . PRO A 1 34  ? -7.253  23.829  6.685   1.00 0.00 ? 34  PRO A HG3  5  
ATOM 9943  H HD2  . PRO A 1 34  ? -4.831  22.419  7.295   1.00 0.00 ? 34  PRO A HD2  5  
ATOM 9944  H HD3  . PRO A 1 34  ? -6.357  22.301  8.150   1.00 0.00 ? 34  PRO A HD3  5  
ATOM 9945  N N    . GLU A 1 35  ? -4.379  20.370  4.704   1.00 0.00 ? 35  GLU A N    5  
ATOM 9946  C CA   . GLU A 1 35  ? -3.259  20.030  3.843   1.00 0.00 ? 35  GLU A CA   5  
ATOM 9947  C C    . GLU A 1 35  ? -2.783  18.605  4.129   1.00 0.00 ? 35  GLU A C    5  
ATOM 9948  O O    . GLU A 1 35  ? -1.661  18.240  3.781   1.00 0.00 ? 35  GLU A O    5  
ATOM 9949  C CB   . GLU A 1 35  ? -2.116  21.034  4.009   1.00 0.00 ? 35  GLU A CB   5  
ATOM 9950  C CG   . GLU A 1 35  ? -2.071  22.013  2.834   1.00 0.00 ? 35  GLU A CG   5  
ATOM 9951  C CD   . GLU A 1 35  ? -0.754  22.794  2.821   1.00 0.00 ? 35  GLU A CD   5  
ATOM 9952  O OE1  . GLU A 1 35  ? -0.546  23.569  3.778   1.00 0.00 ? 35  GLU A OE1  5  
ATOM 9953  O OE2  . GLU A 1 35  ? 0.012   22.597  1.854   1.00 0.00 ? 35  GLU A OE2  5  
ATOM 9954  H H    . GLU A 1 35  ? -4.169  20.391  5.682   1.00 0.00 ? 35  GLU A H    5  
ATOM 9955  H HA   . GLU A 1 35  ? -3.646  20.095  2.826   1.00 0.00 ? 35  GLU A HA   5  
ATOM 9956  H HB2  . GLU A 1 35  ? -2.243  21.584  4.941   1.00 0.00 ? 35  GLU A HB2  5  
ATOM 9957  H HB3  . GLU A 1 35  ? -1.167  20.501  4.080   1.00 0.00 ? 35  GLU A HB3  5  
ATOM 9958  H HG2  . GLU A 1 35  ? -2.183  21.468  1.896   1.00 0.00 ? 35  GLU A HG2  5  
ATOM 9959  H HG3  . GLU A 1 35  ? -2.909  22.706  2.901   1.00 0.00 ? 35  GLU A HG3  5  
ATOM 9960  N N    . VAL A 1 36  ? -3.660  17.838  4.758   1.00 0.00 ? 36  VAL A N    5  
ATOM 9961  C CA   . VAL A 1 36  ? -3.343  16.460  5.095   1.00 0.00 ? 36  VAL A CA   5  
ATOM 9962  C C    . VAL A 1 36  ? -4.175  15.521  4.218   1.00 0.00 ? 36  VAL A C    5  
ATOM 9963  O O    . VAL A 1 36  ? -3.798  14.370  4.004   1.00 0.00 ? 36  VAL A O    5  
ATOM 9964  C CB   . VAL A 1 36  ? -3.556  16.224  6.592   1.00 0.00 ? 36  VAL A CB   5  
ATOM 9965  C CG1  . VAL A 1 36  ? -3.977  14.779  6.864   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 9966  C CG2  . VAL A 1 36  ? -2.302  16.590  7.388   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 9967  H H    . VAL A 1 36  ? -4.571  18.142  5.038   1.00 0.00 ? 36  VAL A H    5  
ATOM 9968  H HA   . VAL A 1 36  ? -2.287  16.302  4.875   1.00 0.00 ? 36  VAL A HA   5  
ATOM 9969  H HB   . VAL A 1 36  ? -4.365  16.876  6.922   1.00 0.00 ? 36  VAL A HB   5  
ATOM 9970  H HG11 . VAL A 1 36  ? -3.399  14.106  6.231   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 9971  H HG12 . VAL A 1 36  ? -3.794  14.538  7.912   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 9972  H HG13 . VAL A 1 36  ? -5.038  14.662  6.646   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 9973  H HG21 . VAL A 1 36  ? -1.428  16.526  6.740   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 9974  H HG22 . VAL A 1 36  ? -2.399  17.607  7.770   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 9975  H HG23 . VAL A 1 36  ? -2.188  15.899  8.223   1.00 0.00 ? 36  VAL A HG23 5  
ATOM 9976  N N    . ILE A 1 37  ? -5.289  16.048  3.733   1.00 0.00 ? 37  ILE A N    5  
ATOM 9977  C CA   . ILE A 1 37  ? -6.176  15.272  2.884   1.00 0.00 ? 37  ILE A CA   5  
ATOM 9978  C C    . ILE A 1 37  ? -5.441  14.892  1.597   1.00 0.00 ? 37  ILE A C    5  
ATOM 9979  O O    . ILE A 1 37  ? -5.557  13.763  1.122   1.00 0.00 ? 37  ILE A O    5  
ATOM 9980  C CB   . ILE A 1 37  ? -7.485  16.027  2.643   1.00 0.00 ? 37  ILE A CB   5  
ATOM 9981  C CG1  . ILE A 1 37  ? -8.426  15.890  3.842   1.00 0.00 ? 37  ILE A CG1  5  
ATOM 9982  C CG2  . ILE A 1 37  ? -8.147  15.577  1.340   1.00 0.00 ? 37  ILE A CG2  5  
ATOM 9983  C CD1  . ILE A 1 37  ? -9.007  17.247  4.241   1.00 0.00 ? 37  ILE A CD1  5  
ATOM 9984  H H    . ILE A 1 37  ? -5.588  16.985  3.912   1.00 0.00 ? 37  ILE A H    5  
ATOM 9985  H HA   . ILE A 1 37  ? -6.427  14.358  3.422   1.00 0.00 ? 37  ILE A HA   5  
ATOM 9986  H HB   . ILE A 1 37  ? -7.252  17.087  2.537   1.00 0.00 ? 37  ILE A HB   5  
ATOM 9987  H HG12 . ILE A 1 37  ? -9.235  15.202  3.597   1.00 0.00 ? 37  ILE A HG12 5  
ATOM 9988  H HG13 . ILE A 1 37  ? -7.886  15.459  4.685   1.00 0.00 ? 37  ILE A HG13 5  
ATOM 9989  H HG21 . ILE A 1 37  ? -7.944  14.518  1.176   1.00 0.00 ? 37  ILE A HG21 5  
ATOM 9990  H HG22 . ILE A 1 37  ? -9.223  15.735  1.406   1.00 0.00 ? 37  ILE A HG22 5  
ATOM 9991  H HG23 . ILE A 1 37  ? -7.745  16.156  0.509   1.00 0.00 ? 37  ILE A HG23 5  
ATOM 9992  H HD11 . ILE A 1 37  ? -8.197  17.963  4.381   1.00 0.00 ? 37  ILE A HD11 5  
ATOM 9993  H HD12 . ILE A 1 37  ? -9.674  17.602  3.456   1.00 0.00 ? 37  ILE A HD12 5  
ATOM 9994  H HD13 . ILE A 1 37  ? -9.565  17.144  5.172   1.00 0.00 ? 37  ILE A HD13 5  
ATOM 9995  N N    . PRO A 1 38  ? -4.680  15.881  1.057   1.00 0.00 ? 38  PRO A N    5  
ATOM 9996  C CA   . PRO A 1 38  ? -3.926  15.661  -0.165  1.00 0.00 ? 38  PRO A CA   5  
ATOM 9997  C C    . PRO A 1 38  ? -2.685  14.807  0.102   1.00 0.00 ? 38  PRO A C    5  
ATOM 9998  O O    . PRO A 1 38  ? -2.302  13.983  -0.728  1.00 0.00 ? 38  PRO A O    5  
ATOM 9999  C CB   . PRO A 1 38  ? -3.590  17.052  -0.676  1.00 0.00 ? 38  PRO A CB   5  
ATOM 10000 C CG   . PRO A 1 38  ? -3.762  17.985  0.512   1.00 0.00 ? 38  PRO A CG   5  
ATOM 10001 C CD   . PRO A 1 38  ? -4.519  17.230  1.591   1.00 0.00 ? 38  PRO A CD   5  
ATOM 10002 H HA   . PRO A 1 38  ? -4.474  15.147  -0.825  1.00 0.00 ? 38  PRO A HA   5  
ATOM 10003 H HB2  . PRO A 1 38  ? -2.569  17.093  -1.059  1.00 0.00 ? 38  PRO A HB2  5  
ATOM 10004 H HB3  . PRO A 1 38  ? -4.248  17.338  -1.496  1.00 0.00 ? 38  PRO A HB3  5  
ATOM 10005 H HG2  . PRO A 1 38  ? -2.792  18.313  0.884   1.00 0.00 ? 38  PRO A HG2  5  
ATOM 10006 H HG3  . PRO A 1 38  ? -4.309  18.882  0.218   1.00 0.00 ? 38  PRO A HG3  5  
ATOM 10007 H HD2  . PRO A 1 38  ? -3.966  17.220  2.530   1.00 0.00 ? 38  PRO A HD2  5  
ATOM 10008 H HD3  . PRO A 1 38  ? -5.485  17.692  1.795   1.00 0.00 ? 38  PRO A HD3  5  
ATOM 10009 N N    . MET A 1 39  ? -2.090  15.032  1.264   1.00 0.00 ? 39  MET A N    5  
ATOM 10010 C CA   . MET A 1 39  ? -0.901  14.294  1.652   1.00 0.00 ? 39  MET A CA   5  
ATOM 10011 C C    . MET A 1 39  ? -1.220  12.813  1.867   1.00 0.00 ? 39  MET A C    5  
ATOM 10012 O O    . MET A 1 39  ? -0.420  11.945  1.522   1.00 0.00 ? 39  MET A O    5  
ATOM 10013 C CB   . MET A 1 39  ? -0.329  14.885  2.942   1.00 0.00 ? 39  MET A CB   5  
ATOM 10014 C CG   . MET A 1 39  ? 1.164   15.185  2.793   1.00 0.00 ? 39  MET A CG   5  
ATOM 10015 S SD   . MET A 1 39  ? 1.942   15.222  4.399   1.00 0.00 ? 39  MET A SD   5  
ATOM 10016 C CE   . MET A 1 39  ? 1.719   13.521  4.891   1.00 0.00 ? 39  MET A CE   5  
ATOM 10017 H H    . MET A 1 39  ? -2.407  15.704  1.934   1.00 0.00 ? 39  MET A H    5  
ATOM 10018 H HA   . MET A 1 39  ? -0.204  14.405  0.821   1.00 0.00 ? 39  MET A HA   5  
ATOM 10019 H HB2  . MET A 1 39  ? -0.865  15.801  3.195   1.00 0.00 ? 39  MET A HB2  5  
ATOM 10020 H HB3  . MET A 1 39  ? -0.484  14.189  3.766   1.00 0.00 ? 39  MET A HB3  5  
ATOM 10021 H HG2  . MET A 1 39  ? 1.635   14.426  2.169   1.00 0.00 ? 39  MET A HG2  5  
ATOM 10022 H HG3  . MET A 1 39  ? 1.303   16.143  2.291   1.00 0.00 ? 39  MET A HG3  5  
ATOM 10023 H HE1  . MET A 1 39  ? 1.740   12.881  4.009   1.00 0.00 ? 39  MET A HE1  5  
ATOM 10024 H HE2  . MET A 1 39  ? 2.520   13.230  5.570   1.00 0.00 ? 39  MET A HE2  5  
ATOM 10025 H HE3  . MET A 1 39  ? 0.758   13.411  5.395   1.00 0.00 ? 39  MET A HE3  5  
ATOM 10026 N N    . PHE A 1 40  ? -2.392  12.570  2.436   1.00 0.00 ? 40  PHE A N    5  
ATOM 10027 C CA   . PHE A 1 40  ? -2.828  11.210  2.703   1.00 0.00 ? 40  PHE A CA   5  
ATOM 10028 C C    . PHE A 1 40  ? -3.248  10.506  1.410   1.00 0.00 ? 40  PHE A C    5  
ATOM 10029 O O    . PHE A 1 40  ? -2.902  9.347   1.190   1.00 0.00 ? 40  PHE A O    5  
ATOM 10030 C CB   . PHE A 1 40  ? -4.036  11.301  3.636   1.00 0.00 ? 40  PHE A CB   5  
ATOM 10031 C CG   . PHE A 1 40  ? -4.195  10.099  4.568   1.00 0.00 ? 40  PHE A CG   5  
ATOM 10032 C CD1  . PHE A 1 40  ? -3.357  9.945   5.628   1.00 0.00 ? 40  PHE A CD1  5  
ATOM 10033 C CD2  . PHE A 1 40  ? -5.175  9.184   4.338   1.00 0.00 ? 40  PHE A CD2  5  
ATOM 10034 C CE1  . PHE A 1 40  ? -3.504  8.829   6.493   1.00 0.00 ? 40  PHE A CE1  5  
ATOM 10035 C CE2  . PHE A 1 40  ? -5.322  8.068   5.204   1.00 0.00 ? 40  PHE A CE2  5  
ATOM 10036 C CZ   . PHE A 1 40  ? -4.484  7.915   6.263   1.00 0.00 ? 40  PHE A CZ   5  
ATOM 10037 H H    . PHE A 1 40  ? -3.037  13.282  2.715   1.00 0.00 ? 40  PHE A H    5  
ATOM 10038 H HA   . PHE A 1 40  ? -1.984  10.681  3.144   1.00 0.00 ? 40  PHE A HA   5  
ATOM 10039 H HB2  . PHE A 1 40  ? -3.950  12.207  4.238   1.00 0.00 ? 40  PHE A HB2  5  
ATOM 10040 H HB3  . PHE A 1 40  ? -4.940  11.403  3.034   1.00 0.00 ? 40  PHE A HB3  5  
ATOM 10041 H HD1  . PHE A 1 40  ? -2.571  10.678  5.813   1.00 0.00 ? 40  PHE A HD1  5  
ATOM 10042 H HD2  . PHE A 1 40  ? -5.848  9.307   3.489   1.00 0.00 ? 40  PHE A HD2  5  
ATOM 10043 H HE1  . PHE A 1 40  ? -2.831  8.705   7.343   1.00 0.00 ? 40  PHE A HE1  5  
ATOM 10044 H HE2  . PHE A 1 40  ? -6.108  7.335   5.019   1.00 0.00 ? 40  PHE A HE2  5  
ATOM 10045 H HZ   . PHE A 1 40  ? -4.596  7.058   6.928   1.00 0.00 ? 40  PHE A HZ   5  
ATOM 10046 N N    . SER A 1 41  ? -3.988  11.238  0.589   1.00 0.00 ? 41  SER A N    5  
ATOM 10047 C CA   . SER A 1 41  ? -4.459  10.698  -0.675  1.00 0.00 ? 41  SER A CA   5  
ATOM 10048 C C    . SER A 1 41  ? -3.268  10.303  -1.551  1.00 0.00 ? 41  SER A C    5  
ATOM 10049 O O    . SER A 1 41  ? -3.309  9.281   -2.233  1.00 0.00 ? 41  SER A O    5  
ATOM 10050 C CB   . SER A 1 41  ? -5.345  11.708  -1.408  1.00 0.00 ? 41  SER A CB   5  
ATOM 10051 O OG   . SER A 1 41  ? -4.578  12.660  -2.138  1.00 0.00 ? 41  SER A OG   5  
ATOM 10052 H H    . SER A 1 41  ? -4.265  12.181  0.777   1.00 0.00 ? 41  SER A H    5  
ATOM 10053 H HA   . SER A 1 41  ? -5.049  9.821   -0.412  1.00 0.00 ? 41  SER A HA   5  
ATOM 10054 H HB2  . SER A 1 41  ? -6.010  11.178  -2.090  1.00 0.00 ? 41  SER A HB2  5  
ATOM 10055 H HB3  . SER A 1 41  ? -5.976  12.227  -0.686  1.00 0.00 ? 41  SER A HB3  5  
ATOM 10056 H HG   . SER A 1 41  ? -3.804  12.971  -1.587  1.00 0.00 ? 41  SER A HG   5  
ATOM 10057 N N    . ALA A 1 42  ? -2.237  11.133  -1.503  1.00 0.00 ? 42  ALA A N    5  
ATOM 10058 C CA   . ALA A 1 42  ? -1.037  10.883  -2.283  1.00 0.00 ? 42  ALA A CA   5  
ATOM 10059 C C    . ALA A 1 42  ? -0.310  9.664   -1.715  1.00 0.00 ? 42  ALA A C    5  
ATOM 10060 O O    . ALA A 1 42  ? 0.087   8.770   -2.461  1.00 0.00 ? 42  ALA A O    5  
ATOM 10061 C CB   . ALA A 1 42  ? -0.161  12.137  -2.288  1.00 0.00 ? 42  ALA A CB   5  
ATOM 10062 H H    . ALA A 1 42  ? -2.213  11.963  -0.944  1.00 0.00 ? 42  ALA A H    5  
ATOM 10063 H HA   . ALA A 1 42  ? -1.347  10.668  -3.306  1.00 0.00 ? 42  ALA A HA   5  
ATOM 10064 H HB1  . ALA A 1 42  ? -0.044  12.503  -1.268  1.00 0.00 ? 42  ALA A HB1  5  
ATOM 10065 H HB2  . ALA A 1 42  ? 0.819   11.893  -2.701  1.00 0.00 ? 42  ALA A HB2  5  
ATOM 10066 H HB3  . ALA A 1 42  ? -0.631  12.908  -2.899  1.00 0.00 ? 42  ALA A HB3  5  
ATOM 10067 N N    . LEU A 1 43  ? -0.156  9.667   -0.399  1.00 0.00 ? 43  LEU A N    5  
ATOM 10068 C CA   . LEU A 1 43  ? 0.518   8.572   0.279   1.00 0.00 ? 43  LEU A CA   5  
ATOM 10069 C C    . LEU A 1 43  ? -0.281  7.284   0.075   1.00 0.00 ? 43  LEU A C    5  
ATOM 10070 O O    . LEU A 1 43  ? 0.277   6.188   0.121   1.00 0.00 ? 43  LEU A O    5  
ATOM 10071 C CB   . LEU A 1 43  ? 0.761   8.920   1.749   1.00 0.00 ? 43  LEU A CB   5  
ATOM 10072 C CG   . LEU A 1 43  ? 2.160   9.431   2.095   1.00 0.00 ? 43  LEU A CG   5  
ATOM 10073 C CD1  . LEU A 1 43  ? 2.100   10.846  2.671   1.00 0.00 ? 43  LEU A CD1  5  
ATOM 10074 C CD2  . LEU A 1 43  ? 2.881   8.460   3.032   1.00 0.00 ? 43  LEU A CD2  5  
ATOM 10075 H H    . LEU A 1 43  ? -0.481  10.398  0.200   1.00 0.00 ? 43  LEU A H    5  
ATOM 10076 H HA   . LEU A 1 43  ? 1.495   8.450   -0.189  1.00 0.00 ? 43  LEU A HA   5  
ATOM 10077 H HB2  . LEU A 1 43  ? 0.035   9.677   2.047   1.00 0.00 ? 43  LEU A HB2  5  
ATOM 10078 H HB3  . LEU A 1 43  ? 0.560   8.032   2.349   1.00 0.00 ? 43  LEU A HB3  5  
ATOM 10079 H HG   . LEU A 1 43  ? 2.743   9.481   1.175   1.00 0.00 ? 43  LEU A HG   5  
ATOM 10080 H HD11 . LEU A 1 43  ? 1.451   10.855  3.546   1.00 0.00 ? 43  LEU A HD11 5  
ATOM 10081 H HD12 . LEU A 1 43  ? 3.103   11.163  2.959   1.00 0.00 ? 43  LEU A HD12 5  
ATOM 10082 H HD13 . LEU A 1 43  ? 1.706   11.529  1.918   1.00 0.00 ? 43  LEU A HD13 5  
ATOM 10083 H HD21 . LEU A 1 43  ? 2.897   7.466   2.585   1.00 0.00 ? 43  LEU A HD21 5  
ATOM 10084 H HD22 . LEU A 1 43  ? 3.904   8.802   3.193   1.00 0.00 ? 43  LEU A HD22 5  
ATOM 10085 H HD23 . LEU A 1 43  ? 2.358   8.420   3.987   1.00 0.00 ? 43  LEU A HD23 5  
ATOM 10086 N N    . SER A 1 44  ? -1.576  7.456   -0.147  1.00 0.00 ? 44  SER A N    5  
ATOM 10087 C CA   . SER A 1 44  ? -2.458  6.321   -0.358  1.00 0.00 ? 44  SER A CA   5  
ATOM 10088 C C    . SER A 1 44  ? -2.788  6.184   -1.846  1.00 0.00 ? 44  SER A C    5  
ATOM 10089 O O    . SER A 1 44  ? -3.907  5.821   -2.205  1.00 0.00 ? 44  SER A O    5  
ATOM 10090 C CB   . SER A 1 44  ? -3.743  6.462   0.460   1.00 0.00 ? 44  SER A CB   5  
ATOM 10091 O OG   . SER A 1 44  ? -4.637  7.414   -0.110  1.00 0.00 ? 44  SER A OG   5  
ATOM 10092 H H    . SER A 1 44  ? -2.023  8.350   -0.183  1.00 0.00 ? 44  SER A H    5  
ATOM 10093 H HA   . SER A 1 44  ? -1.899  5.453   -0.008  1.00 0.00 ? 44  SER A HA   5  
ATOM 10094 H HB2  . SER A 1 44  ? -4.239  5.494   0.526   1.00 0.00 ? 44  SER A HB2  5  
ATOM 10095 H HB3  . SER A 1 44  ? -3.494  6.763   1.478   1.00 0.00 ? 44  SER A HB3  5  
ATOM 10096 H HG   . SER A 1 44  ? -4.799  7.197   -1.073  1.00 0.00 ? 44  SER A HG   5  
ATOM 10097 N N    . GLU A 1 45  ? -1.794  6.482   -2.669  1.00 0.00 ? 45  GLU A N    5  
ATOM 10098 C CA   . GLU A 1 45  ? -1.965  6.396   -4.110  1.00 0.00 ? 45  GLU A CA   5  
ATOM 10099 C C    . GLU A 1 45  ? -2.525  5.026   -4.498  1.00 0.00 ? 45  GLU A C    5  
ATOM 10100 O O    . GLU A 1 45  ? -3.531  4.939   -5.200  1.00 0.00 ? 45  GLU A O    5  
ATOM 10101 C CB   . GLU A 1 45  ? -0.647  6.674   -4.835  1.00 0.00 ? 45  GLU A CB   5  
ATOM 10102 C CG   . GLU A 1 45  ? -0.696  8.019   -5.564  1.00 0.00 ? 45  GLU A CG   5  
ATOM 10103 C CD   . GLU A 1 45  ? 0.608   8.279   -6.322  1.00 0.00 ? 45  GLU A CD   5  
ATOM 10104 O OE1  . GLU A 1 45  ? 1.085   7.327   -6.976  1.00 0.00 ? 45  GLU A OE1  5  
ATOM 10105 O OE2  . GLU A 1 45  ? 1.099   9.425   -6.228  1.00 0.00 ? 45  GLU A OE2  5  
ATOM 10106 H H    . GLU A 1 45  ? -0.887  6.776   -2.367  1.00 0.00 ? 45  GLU A H    5  
ATOM 10107 H HA   . GLU A 1 45  ? -2.683  7.175   -4.362  1.00 0.00 ? 45  GLU A HA   5  
ATOM 10108 H HB2  . GLU A 1 45  ? 0.175   6.674   -4.119  1.00 0.00 ? 45  GLU A HB2  5  
ATOM 10109 H HB3  . GLU A 1 45  ? -0.446  5.876   -5.549  1.00 0.00 ? 45  GLU A HB3  5  
ATOM 10110 H HG2  . GLU A 1 45  ? -1.534  8.027   -6.262  1.00 0.00 ? 45  GLU A HG2  5  
ATOM 10111 H HG3  . GLU A 1 45  ? -0.869  8.820   -4.846  1.00 0.00 ? 45  GLU A HG3  5  
ATOM 10112 N N    . GLY A 1 46  ? -1.851  3.989   -4.022  1.00 0.00 ? 46  GLY A N    5  
ATOM 10113 C CA   . GLY A 1 46  ? -2.269  2.628   -4.309  1.00 0.00 ? 46  GLY A CA   5  
ATOM 10114 C C    . GLY A 1 46  ? -1.931  1.693   -3.147  1.00 0.00 ? 46  GLY A C    5  
ATOM 10115 O O    . GLY A 1 46  ? -1.218  0.707   -3.326  1.00 0.00 ? 46  GLY A O    5  
ATOM 10116 H H    . GLY A 1 46  ? -1.033  4.069   -3.451  1.00 0.00 ? 46  GLY A H    5  
ATOM 10117 H HA2  . GLY A 1 46  ? -3.342  2.606   -4.499  1.00 0.00 ? 46  GLY A HA2  5  
ATOM 10118 H HA3  . GLY A 1 46  ? -1.778  2.278   -5.218  1.00 0.00 ? 46  GLY A HA3  5  
ATOM 10119 N N    . ALA A 1 47  ? -2.458  2.037   -1.981  1.00 0.00 ? 47  ALA A N    5  
ATOM 10120 C CA   . ALA A 1 47  ? -2.221  1.240   -0.789  1.00 0.00 ? 47  ALA A CA   5  
ATOM 10121 C C    . ALA A 1 47  ? -3.364  0.238   -0.615  1.00 0.00 ? 47  ALA A C    5  
ATOM 10122 O O    . ALA A 1 47  ? -4.437  0.409   -1.191  1.00 0.00 ? 47  ALA A O    5  
ATOM 10123 C CB   . ALA A 1 47  ? -2.066  2.165   0.420   1.00 0.00 ? 47  ALA A CB   5  
ATOM 10124 H H    . ALA A 1 47  ? -3.037  2.840   -1.844  1.00 0.00 ? 47  ALA A H    5  
ATOM 10125 H HA   . ALA A 1 47  ? -1.289  0.694   -0.934  1.00 0.00 ? 47  ALA A HA   5  
ATOM 10126 H HB1  . ALA A 1 47  ? -1.561  3.081   0.115   1.00 0.00 ? 47  ALA A HB1  5  
ATOM 10127 H HB2  . ALA A 1 47  ? -3.051  2.408   0.819   1.00 0.00 ? 47  ALA A HB2  5  
ATOM 10128 H HB3  . ALA A 1 47  ? -1.477  1.663   1.188   1.00 0.00 ? 47  ALA A HB3  5  
ATOM 10129 N N    . THR A 1 48  ? -3.096  -0.785  0.183   1.00 0.00 ? 48  THR A N    5  
ATOM 10130 C CA   . THR A 1 48  ? -4.089  -1.814  0.440   1.00 0.00 ? 48  THR A CA   5  
ATOM 10131 C C    . THR A 1 48  ? -4.998  -1.401  1.599   1.00 0.00 ? 48  THR A C    5  
ATOM 10132 O O    . THR A 1 48  ? -4.941  -0.262  2.060   1.00 0.00 ? 48  THR A O    5  
ATOM 10133 C CB   . THR A 1 48  ? -3.350  -3.131  0.688   1.00 0.00 ? 48  THR A CB   5  
ATOM 10134 O OG1  . THR A 1 48  ? -3.193  -3.180  2.103   1.00 0.00 ? 48  THR A OG1  5  
ATOM 10135 C CG2  . THR A 1 48  ? -1.916  -3.109  0.154   1.00 0.00 ? 48  THR A CG2  5  
ATOM 10136 H H    . THR A 1 48  ? -2.220  -0.916  0.648   1.00 0.00 ? 48  THR A H    5  
ATOM 10137 H HA   . THR A 1 48  ? -4.720  -1.912  -0.443  1.00 0.00 ? 48  THR A HA   5  
ATOM 10138 H HB   . THR A 1 48  ? -3.906  -3.973  0.275   1.00 0.00 ? 48  THR A HB   5  
ATOM 10139 H HG1  . THR A 1 48  ? -2.833  -4.072  2.377   1.00 0.00 ? 48  THR A HG1  5  
ATOM 10140 H HG21 . THR A 1 48  ? -1.871  -2.485  -0.738  1.00 0.00 ? 48  THR A HG21 5  
ATOM 10141 H HG22 . THR A 1 48  ? -1.252  -2.703  0.916   1.00 0.00 ? 48  THR A HG22 5  
ATOM 10142 H HG23 . THR A 1 48  ? -1.606  -4.123  -0.097  1.00 0.00 ? 48  THR A HG23 5  
ATOM 10143 N N    . PRO A 1 49  ? -5.837  -2.373  2.046   1.00 0.00 ? 49  PRO A N    5  
ATOM 10144 C CA   . PRO A 1 49  ? -6.757  -2.121  3.142   1.00 0.00 ? 49  PRO A CA   5  
ATOM 10145 C C    . PRO A 1 49  ? -6.019  -2.093  4.482   1.00 0.00 ? 49  PRO A C    5  
ATOM 10146 O O    . PRO A 1 49  ? -6.365  -1.313  5.369   1.00 0.00 ? 49  PRO A O    5  
ATOM 10147 C CB   . PRO A 1 49  ? -7.788  -3.235  3.055   1.00 0.00 ? 49  PRO A CB   5  
ATOM 10148 C CG   . PRO A 1 49  ? -7.150  -4.327  2.209   1.00 0.00 ? 49  PRO A CG   5  
ATOM 10149 C CD   . PRO A 1 49  ? -5.931  -3.732  1.523   1.00 0.00 ? 49  PRO A CD   5  
ATOM 10150 H HA   . PRO A 1 49  ? -7.178  -1.219  3.041   1.00 0.00 ? 49  PRO A HA   5  
ATOM 10151 H HB2  . PRO A 1 49  ? -8.044  -3.608  4.046   1.00 0.00 ? 49  PRO A HB2  5  
ATOM 10152 H HB3  . PRO A 1 49  ? -8.711  -2.878  2.599   1.00 0.00 ? 49  PRO A HB3  5  
ATOM 10153 H HG2  . PRO A 1 49  ? -6.862  -5.172  2.833   1.00 0.00 ? 49  PRO A HG2  5  
ATOM 10154 H HG3  . PRO A 1 49  ? -7.859  -4.701  1.472   1.00 0.00 ? 49  PRO A HG3  5  
ATOM 10155 H HD2  . PRO A 1 49  ? -5.032  -4.306  1.746   1.00 0.00 ? 49  PRO A HD2  5  
ATOM 10156 H HD3  . PRO A 1 49  ? -6.048  -3.732  0.439   1.00 0.00 ? 49  PRO A HD3  5  
ATOM 10157 N N    . GLN A 1 50  ? -5.017  -2.951  4.587   1.00 0.00 ? 50  GLN A N    5  
ATOM 10158 C CA   . GLN A 1 50  ? -4.228  -3.035  5.805   1.00 0.00 ? 50  GLN A CA   5  
ATOM 10159 C C    . GLN A 1 50  ? -3.263  -1.850  5.894   1.00 0.00 ? 50  GLN A C    5  
ATOM 10160 O O    . GLN A 1 50  ? -2.930  -1.398  6.989   1.00 0.00 ? 50  GLN A O    5  
ATOM 10161 C CB   . GLN A 1 50  ? -3.472  -4.363  5.878   1.00 0.00 ? 50  GLN A CB   5  
ATOM 10162 C CG   . GLN A 1 50  ? -2.443  -4.472  4.750   1.00 0.00 ? 50  GLN A CG   5  
ATOM 10163 C CD   . GLN A 1 50  ? -1.067  -4.855  5.297   1.00 0.00 ? 50  GLN A CD   5  
ATOM 10164 O OE1  . GLN A 1 50  ? -0.530  -4.227  6.195   1.00 0.00 ? 50  GLN A OE1  5  
ATOM 10165 N NE2  . GLN A 1 50  ? -0.528  -5.919  4.708   1.00 0.00 ? 50  GLN A NE2  5  
ATOM 10166 H H    . GLN A 1 50  ? -4.741  -3.581  3.862   1.00 0.00 ? 50  GLN A H    5  
ATOM 10167 H HA   . GLN A 1 50  ? -4.948  -2.988  6.620   1.00 0.00 ? 50  GLN A HA   5  
ATOM 10168 H HB2  . GLN A 1 50  ? -2.969  -4.446  6.842   1.00 0.00 ? 50  GLN A HB2  5  
ATOM 10169 H HB3  . GLN A 1 50  ? -4.177  -5.191  5.814   1.00 0.00 ? 50  GLN A HB3  5  
ATOM 10170 H HG2  . GLN A 1 50  ? -2.771  -5.217  4.025   1.00 0.00 ? 50  GLN A HG2  5  
ATOM 10171 H HG3  . GLN A 1 50  ? -2.377  -3.522  4.221   1.00 0.00 ? 50  GLN A HG3  5  
ATOM 10172 H HE21 . GLN A 1 50  ? -1.022  -6.390  3.977   1.00 0.00 ? 50  GLN A HE21 5  
ATOM 10173 H HE22 . GLN A 1 50  ? 0.371   -6.249  4.997   1.00 0.00 ? 50  GLN A HE22 5  
ATOM 10174 N N    . ASP A 1 51  ? -2.845  -1.380  4.729   1.00 0.00 ? 51  ASP A N    5  
ATOM 10175 C CA   . ASP A 1 51  ? -1.925  -0.255  4.662   1.00 0.00 ? 51  ASP A CA   5  
ATOM 10176 C C    . ASP A 1 51  ? -2.660  1.022   5.075   1.00 0.00 ? 51  ASP A C    5  
ATOM 10177 O O    . ASP A 1 51  ? -2.258  1.692   6.025   1.00 0.00 ? 51  ASP A O    5  
ATOM 10178 C CB   . ASP A 1 51  ? -1.398  -0.059  3.239   1.00 0.00 ? 51  ASP A CB   5  
ATOM 10179 C CG   . ASP A 1 51  ? -0.277  -1.015  2.827   1.00 0.00 ? 51  ASP A CG   5  
ATOM 10180 O OD1  . ASP A 1 51  ? 0.264   -1.679  3.737   1.00 0.00 ? 51  ASP A OD1  5  
ATOM 10181 O OD2  . ASP A 1 51  ? 0.013   -1.060  1.612   1.00 0.00 ? 51  ASP A OD2  5  
ATOM 10182 H H    . ASP A 1 51  ? -3.121  -1.753  3.843   1.00 0.00 ? 51  ASP A H    5  
ATOM 10183 H HA   . ASP A 1 51  ? -1.114  -0.509  5.342   1.00 0.00 ? 51  ASP A HA   5  
ATOM 10184 H HB2  . ASP A 1 51  ? -2.228  -0.174  2.542   1.00 0.00 ? 51  ASP A HB2  5  
ATOM 10185 H HB3  . ASP A 1 51  ? -1.037  0.965   3.140   1.00 0.00 ? 51  ASP A HB3  5  
ATOM 10186 N N    . LEU A 1 52  ? -3.721  1.321   4.340   1.00 0.00 ? 52  LEU A N    5  
ATOM 10187 C CA   . LEU A 1 52  ? -4.513  2.506   4.619   1.00 0.00 ? 52  LEU A CA   5  
ATOM 10188 C C    . LEU A 1 52  ? -5.002  2.459   6.068   1.00 0.00 ? 52  LEU A C    5  
ATOM 10189 O O    . LEU A 1 52  ? -4.903  3.449   6.792   1.00 0.00 ? 52  LEU A O    5  
ATOM 10190 C CB   . LEU A 1 52  ? -5.641  2.649   3.594   1.00 0.00 ? 52  LEU A CB   5  
ATOM 10191 C CG   . LEU A 1 52  ? -5.406  3.666   2.476   1.00 0.00 ? 52  LEU A CG   5  
ATOM 10192 C CD1  . LEU A 1 52  ? -6.600  3.714   1.519   1.00 0.00 ? 52  LEU A CD1  5  
ATOM 10193 C CD2  . LEU A 1 52  ? -5.074  5.044   3.048   1.00 0.00 ? 52  LEU A CD2  5  
ATOM 10194 H H    . LEU A 1 52  ? -4.040  0.770   3.569   1.00 0.00 ? 52  LEU A H    5  
ATOM 10195 H HA   . LEU A 1 52  ? -3.860  3.370   4.502   1.00 0.00 ? 52  LEU A HA   5  
ATOM 10196 H HB2  . LEU A 1 52  ? -5.819  1.673   3.141   1.00 0.00 ? 52  LEU A HB2  5  
ATOM 10197 H HB3  . LEU A 1 52  ? -6.553  2.925   4.124   1.00 0.00 ? 52  LEU A HB3  5  
ATOM 10198 H HG   . LEU A 1 52  ? -4.543  3.342   1.895   1.00 0.00 ? 52  LEU A HG   5  
ATOM 10199 H HD11 . LEU A 1 52  ? -7.205  2.817   1.648   1.00 0.00 ? 52  LEU A HD11 5  
ATOM 10200 H HD12 . LEU A 1 52  ? -7.205  4.595   1.738   1.00 0.00 ? 52  LEU A HD12 5  
ATOM 10201 H HD13 . LEU A 1 52  ? -6.241  3.766   0.492   1.00 0.00 ? 52  LEU A HD13 5  
ATOM 10202 H HD21 . LEU A 1 52  ? -5.605  5.184   3.991   1.00 0.00 ? 52  LEU A HD21 5  
ATOM 10203 H HD22 . LEU A 1 52  ? -4.000  5.117   3.222   1.00 0.00 ? 52  LEU A HD22 5  
ATOM 10204 H HD23 . LEU A 1 52  ? -5.381  5.816   2.342   1.00 0.00 ? 52  LEU A HD23 5  
ATOM 10205 N N    . ASN A 1 53  ? -5.518  1.300   6.448   1.00 0.00 ? 53  ASN A N    5  
ATOM 10206 C CA   . ASN A 1 53  ? -6.021  1.112   7.798   1.00 0.00 ? 53  ASN A CA   5  
ATOM 10207 C C    . ASN A 1 53  ? -4.903  1.404   8.800   1.00 0.00 ? 53  ASN A C    5  
ATOM 10208 O O    . ASN A 1 53  ? -5.138  2.034   9.831   1.00 0.00 ? 53  ASN A O    5  
ATOM 10209 C CB   . ASN A 1 53  ? -6.485  -0.330  8.016   1.00 0.00 ? 53  ASN A CB   5  
ATOM 10210 C CG   . ASN A 1 53  ? -7.118  -0.499  9.399   1.00 0.00 ? 53  ASN A CG   5  
ATOM 10211 O OD1  . ASN A 1 53  ? -7.281  0.445   10.156  1.00 0.00 ? 53  ASN A OD1  5  
ATOM 10212 N ND2  . ASN A 1 53  ? -7.464  -1.750  9.687   1.00 0.00 ? 53  ASN A ND2  5  
ATOM 10213 H H    . ASN A 1 53  ? -5.594  0.500   5.853   1.00 0.00 ? 53  ASN A H    5  
ATOM 10214 H HA   . ASN A 1 53  ? -6.857  1.804   7.891   1.00 0.00 ? 53  ASN A HA   5  
ATOM 10215 H HB2  . ASN A 1 53  ? -7.207  -0.604  7.247   1.00 0.00 ? 53  ASN A HB2  5  
ATOM 10216 H HB3  . ASN A 1 53  ? -5.638  -1.008  7.915   1.00 0.00 ? 53  ASN A HB3  5  
ATOM 10217 H HD21 . ASN A 1 53  ? -7.303  -2.479  9.021   1.00 0.00 ? 53  ASN A HD21 5  
ATOM 10218 H HD22 . ASN A 1 53  ? -7.885  -1.962  10.568  1.00 0.00 ? 53  ASN A HD22 5  
ATOM 10219 N N    . THR A 1 54  ? -3.710  0.935   8.463   1.00 0.00 ? 54  THR A N    5  
ATOM 10220 C CA   . THR A 1 54  ? -2.555  1.139   9.321   1.00 0.00 ? 54  THR A CA   5  
ATOM 10221 C C    . THR A 1 54  ? -2.282  2.633   9.501   1.00 0.00 ? 54  THR A C    5  
ATOM 10222 O O    . THR A 1 54  ? -1.968  3.082   10.602  1.00 0.00 ? 54  THR A O    5  
ATOM 10223 C CB   . THR A 1 54  ? -1.376  0.374   8.715   1.00 0.00 ? 54  THR A CB   5  
ATOM 10224 O OG1  . THR A 1 54  ? -1.316  -0.830  9.476   1.00 0.00 ? 54  THR A OG1  5  
ATOM 10225 C CG2  . THR A 1 54  ? -0.035  1.055   8.989   1.00 0.00 ? 54  THR A CG2  5  
ATOM 10226 H H    . THR A 1 54  ? -3.529  0.424   7.623   1.00 0.00 ? 54  THR A H    5  
ATOM 10227 H HA   . THR A 1 54  ? -2.784  0.734   10.307  1.00 0.00 ? 54  THR A HA   5  
ATOM 10228 H HB   . THR A 1 54  ? -1.523  0.217   7.647   1.00 0.00 ? 54  THR A HB   5  
ATOM 10229 H HG1  . THR A 1 54  ? -0.734  -1.498  9.013   1.00 0.00 ? 54  THR A HG1  5  
ATOM 10230 H HG21 . THR A 1 54  ? -0.057  1.522   9.974   1.00 0.00 ? 54  THR A HG21 5  
ATOM 10231 H HG22 . THR A 1 54  ? 0.763   0.314   8.956   1.00 0.00 ? 54  THR A HG22 5  
ATOM 10232 H HG23 . THR A 1 54  ? 0.147   1.819   8.231   1.00 0.00 ? 54  THR A HG23 5  
ATOM 10233 N N    . MET A 1 55  ? -2.413  3.363   8.403   1.00 0.00 ? 55  MET A N    5  
ATOM 10234 C CA   . MET A 1 55  ? -2.184  4.797   8.426   1.00 0.00 ? 55  MET A CA   5  
ATOM 10235 C C    . MET A 1 55  ? -3.229  5.506   9.291   1.00 0.00 ? 55  MET A C    5  
ATOM 10236 O O    . MET A 1 55  ? -2.908  6.454   10.005  1.00 0.00 ? 55  MET A O    5  
ATOM 10237 C CB   . MET A 1 55  ? -2.245  5.348   6.999   1.00 0.00 ? 55  MET A CB   5  
ATOM 10238 C CG   . MET A 1 55  ? -0.842  5.503   6.412   1.00 0.00 ? 55  MET A CG   5  
ATOM 10239 S SD   . MET A 1 55  ? -0.302  7.198   6.561   1.00 0.00 ? 55  MET A SD   5  
ATOM 10240 C CE   . MET A 1 55  ? -1.038  7.890   5.089   1.00 0.00 ? 55  MET A CE   5  
ATOM 10241 H H    . MET A 1 55  ? -2.670  2.990   7.511   1.00 0.00 ? 55  MET A H    5  
ATOM 10242 H HA   . MET A 1 55  ? -1.193  4.929   8.860   1.00 0.00 ? 55  MET A HA   5  
ATOM 10243 H HB2  . MET A 1 55  ? -2.834  4.677   6.372   1.00 0.00 ? 55  MET A HB2  5  
ATOM 10244 H HB3  . MET A 1 55  ? -2.753  6.311   6.998   1.00 0.00 ? 55  MET A HB3  5  
ATOM 10245 H HG2  . MET A 1 55  ? -0.146  4.845   6.930   1.00 0.00 ? 55  MET A HG2  5  
ATOM 10246 H HG3  . MET A 1 55  ? -0.842  5.205   5.363   1.00 0.00 ? 55  MET A HG3  5  
ATOM 10247 H HE1  . MET A 1 55  ? -2.021  7.445   4.932   1.00 0.00 ? 55  MET A HE1  5  
ATOM 10248 H HE2  . MET A 1 55  ? -1.142  8.969   5.207   1.00 0.00 ? 55  MET A HE2  5  
ATOM 10249 H HE3  . MET A 1 55  ? -0.401  7.677   4.231   1.00 0.00 ? 55  MET A HE3  5  
ATOM 10250 N N    . LEU A 1 56  ? -4.457  5.017   9.198   1.00 0.00 ? 56  LEU A N    5  
ATOM 10251 C CA   . LEU A 1 56  ? -5.551  5.591   9.964   1.00 0.00 ? 56  LEU A CA   5  
ATOM 10252 C C    . LEU A 1 56  ? -5.339  5.292   11.449  1.00 0.00 ? 56  LEU A C    5  
ATOM 10253 O O    . LEU A 1 56  ? -5.480  6.179   12.290  1.00 0.00 ? 56  LEU A O    5  
ATOM 10254 C CB   . LEU A 1 56  ? -6.896  5.104   9.424   1.00 0.00 ? 56  LEU A CB   5  
ATOM 10255 C CG   . LEU A 1 56  ? -7.152  5.351   7.935   1.00 0.00 ? 56  LEU A CG   5  
ATOM 10256 C CD1  . LEU A 1 56  ? -8.312  4.493   7.427   1.00 0.00 ? 56  LEU A CD1  5  
ATOM 10257 C CD2  . LEU A 1 56  ? -7.375  6.840   7.659   1.00 0.00 ? 56  LEU A CD2  5  
ATOM 10258 H H    . LEU A 1 56  ? -4.709  4.245   8.615   1.00 0.00 ? 56  LEU A H    5  
ATOM 10259 H HA   . LEU A 1 56  ? -5.518  6.671   9.820   1.00 0.00 ? 56  LEU A HA   5  
ATOM 10260 H HB2  . LEU A 1 56  ? -6.975  4.032   9.611   1.00 0.00 ? 56  LEU A HB2  5  
ATOM 10261 H HB3  . LEU A 1 56  ? -7.691  5.586   9.994   1.00 0.00 ? 56  LEU A HB3  5  
ATOM 10262 H HG   . LEU A 1 56  ? -6.263  5.052   7.381   1.00 0.00 ? 56  LEU A HG   5  
ATOM 10263 H HD11 . LEU A 1 56  ? -9.001  4.292   8.248   1.00 0.00 ? 56  LEU A HD11 5  
ATOM 10264 H HD12 . LEU A 1 56  ? -8.837  5.026   6.635   1.00 0.00 ? 56  LEU A HD12 5  
ATOM 10265 H HD13 . LEU A 1 56  ? -7.924  3.552   7.039   1.00 0.00 ? 56  LEU A HD13 5  
ATOM 10266 H HD21 . LEU A 1 56  ? -7.271  7.401   8.586   1.00 0.00 ? 56  LEU A HD21 5  
ATOM 10267 H HD22 . LEU A 1 56  ? -6.637  7.190   6.937   1.00 0.00 ? 56  LEU A HD22 5  
ATOM 10268 H HD23 . LEU A 1 56  ? -8.377  6.988   7.255   1.00 0.00 ? 56  LEU A HD23 5  
ATOM 10269 N N    . ASN A 1 57  ? -5.006  4.040   11.727  1.00 0.00 ? 57  ASN A N    5  
ATOM 10270 C CA   . ASN A 1 57  ? -4.774  3.613   13.097  1.00 0.00 ? 57  ASN A CA   5  
ATOM 10271 C C    . ASN A 1 57  ? -3.511  4.292   13.630  1.00 0.00 ? 57  ASN A C    5  
ATOM 10272 O O    . ASN A 1 57  ? -3.369  4.486   14.837  1.00 0.00 ? 57  ASN A O    5  
ATOM 10273 C CB   . ASN A 1 57  ? -4.566  2.099   13.174  1.00 0.00 ? 57  ASN A CB   5  
ATOM 10274 C CG   . ASN A 1 57  ? -5.216  1.521   14.433  1.00 0.00 ? 57  ASN A CG   5  
ATOM 10275 O OD1  . ASN A 1 57  ? -6.407  1.263   14.485  1.00 0.00 ? 57  ASN A OD1  5  
ATOM 10276 N ND2  . ASN A 1 57  ? -4.369  1.333   15.440  1.00 0.00 ? 57  ASN A ND2  5  
ATOM 10277 H H    . ASN A 1 57  ? -4.894  3.325   11.037  1.00 0.00 ? 57  ASN A H    5  
ATOM 10278 H HA   . ASN A 1 57  ? -5.669  3.909   13.644  1.00 0.00 ? 57  ASN A HA   5  
ATOM 10279 H HB2  . ASN A 1 57  ? -4.992  1.624   12.290  1.00 0.00 ? 57  ASN A HB2  5  
ATOM 10280 H HB3  . ASN A 1 57  ? -3.500  1.875   13.174  1.00 0.00 ? 57  ASN A HB3  5  
ATOM 10281 H HD21 . ASN A 1 57  ? -3.402  1.566   15.332  1.00 0.00 ? 57  ASN A HD21 5  
ATOM 10282 H HD22 . ASN A 1 57  ? -4.698  0.959   16.307  1.00 0.00 ? 57  ASN A HD22 5  
ATOM 10283 N N    . THR A 1 58  ? -2.625  4.634   12.706  1.00 0.00 ? 58  THR A N    5  
ATOM 10284 C CA   . THR A 1 58  ? -1.379  5.286   13.069  1.00 0.00 ? 58  THR A CA   5  
ATOM 10285 C C    . THR A 1 58  ? -1.655  6.669   13.663  1.00 0.00 ? 58  THR A C    5  
ATOM 10286 O O    . THR A 1 58  ? -0.978  7.092   14.600  1.00 0.00 ? 58  THR A O    5  
ATOM 10287 C CB   . THR A 1 58  ? -0.487  5.326   11.826  1.00 0.00 ? 58  THR A CB   5  
ATOM 10288 O OG1  . THR A 1 58  ? 0.424   4.248   12.018  1.00 0.00 ? 58  THR A OG1  5  
ATOM 10289 C CG2  . THR A 1 58  ? 0.408   6.567   11.788  1.00 0.00 ? 58  THR A CG2  5  
ATOM 10290 H H    . THR A 1 58  ? -2.748  4.473   11.727  1.00 0.00 ? 58  THR A H    5  
ATOM 10291 H HA   . THR A 1 58  ? -0.895  4.695   13.845  1.00 0.00 ? 58  THR A HA   5  
ATOM 10292 H HB   . THR A 1 58  ? -1.083  5.247   10.917  1.00 0.00 ? 58  THR A HB   5  
ATOM 10293 H HG1  . THR A 1 58  ? 0.932   4.377   12.870  1.00 0.00 ? 58  THR A HG1  5  
ATOM 10294 H HG21 . THR A 1 58  ? 0.821   6.748   12.779  1.00 0.00 ? 58  THR A HG21 5  
ATOM 10295 H HG22 . THR A 1 58  ? 1.219   6.407   11.078  1.00 0.00 ? 58  THR A HG22 5  
ATOM 10296 H HG23 . THR A 1 58  ? -0.181  7.431   11.476  1.00 0.00 ? 58  THR A HG23 5  
ATOM 10297 N N    . VAL A 1 59  ? -2.649  7.336   13.095  1.00 0.00 ? 59  VAL A N    5  
ATOM 10298 C CA   . VAL A 1 59  ? -3.021  8.661   13.558  1.00 0.00 ? 59  VAL A CA   5  
ATOM 10299 C C    . VAL A 1 59  ? -3.030  8.679   15.088  1.00 0.00 ? 59  VAL A C    5  
ATOM 10300 O O    . VAL A 1 59  ? -2.989  7.628   15.725  1.00 0.00 ? 59  VAL A O    5  
ATOM 10301 C CB   . VAL A 1 59  ? -4.364  9.070   12.948  1.00 0.00 ? 59  VAL A CB   5  
ATOM 10302 C CG1  . VAL A 1 59  ? -5.456  9.132   14.017  1.00 0.00 ? 59  VAL A CG1  5  
ATOM 10303 C CG2  . VAL A 1 59  ? -4.245  10.403  12.206  1.00 0.00 ? 59  VAL A CG2  5  
ATOM 10304 H H    . VAL A 1 59  ? -3.194  6.985   12.334  1.00 0.00 ? 59  VAL A H    5  
ATOM 10305 H HA   . VAL A 1 59  ? -2.263  9.359   13.203  1.00 0.00 ? 59  VAL A HA   5  
ATOM 10306 H HB   . VAL A 1 59  ? -4.648  8.308   12.222  1.00 0.00 ? 59  VAL A HB   5  
ATOM 10307 H HG11 . VAL A 1 59  ? -5.380  8.260   14.666  1.00 0.00 ? 59  VAL A HG11 5  
ATOM 10308 H HG12 . VAL A 1 59  ? -5.333  10.039  14.610  1.00 0.00 ? 59  VAL A HG12 5  
ATOM 10309 H HG13 . VAL A 1 59  ? -6.435  9.142   13.537  1.00 0.00 ? 59  VAL A HG13 5  
ATOM 10310 H HG21 . VAL A 1 59  ? -3.322  10.417  11.628  1.00 0.00 ? 59  VAL A HG21 5  
ATOM 10311 H HG22 . VAL A 1 59  ? -5.096  10.522  11.534  1.00 0.00 ? 59  VAL A HG22 5  
ATOM 10312 H HG23 . VAL A 1 59  ? -4.236  11.220  12.927  1.00 0.00 ? 59  VAL A HG23 5  
ATOM 10313 N N    . GLY A 1 60  ? -3.085  9.886   15.633  1.00 0.00 ? 60  GLY A N    5  
ATOM 10314 C CA   . GLY A 1 60  ? -3.100  10.054  17.076  1.00 0.00 ? 60  GLY A CA   5  
ATOM 10315 C C    . GLY A 1 60  ? -4.223  9.233   17.713  1.00 0.00 ? 60  GLY A C    5  
ATOM 10316 O O    . GLY A 1 60  ? -3.993  8.121   18.184  1.00 0.00 ? 60  GLY A O    5  
ATOM 10317 H H    . GLY A 1 60  ? -3.118  10.736  15.108  1.00 0.00 ? 60  GLY A H    5  
ATOM 10318 H HA2  . GLY A 1 60  ? -2.140  9.747   17.492  1.00 0.00 ? 60  GLY A HA2  5  
ATOM 10319 H HA3  . GLY A 1 60  ? -3.231  11.108  17.322  1.00 0.00 ? 60  GLY A HA3  5  
ATOM 10320 N N    . GLY A 1 61  ? -5.414  9.813   17.706  1.00 0.00 ? 61  GLY A N    5  
ATOM 10321 C CA   . GLY A 1 61  ? -6.573  9.150   18.278  1.00 0.00 ? 61  GLY A CA   5  
ATOM 10322 C C    . GLY A 1 61  ? -7.761  10.109  18.376  1.00 0.00 ? 61  GLY A C    5  
ATOM 10323 O O    . GLY A 1 61  ? -8.325  10.295  19.452  1.00 0.00 ? 61  GLY A O    5  
ATOM 10324 H H    . GLY A 1 61  ? -5.592  10.719  17.321  1.00 0.00 ? 61  GLY A H    5  
ATOM 10325 H HA2  . GLY A 1 61  ? -6.844  8.291   17.663  1.00 0.00 ? 61  GLY A HA2  5  
ATOM 10326 H HA3  . GLY A 1 61  ? -6.327  8.768   19.268  1.00 0.00 ? 61  GLY A HA3  5  
ATOM 10327 N N    . HIS A 1 62  ? -8.106  10.691  17.237  1.00 0.00 ? 62  HIS A N    5  
ATOM 10328 C CA   . HIS A 1 62  ? -9.216  11.627  17.181  1.00 0.00 ? 62  HIS A CA   5  
ATOM 10329 C C    . HIS A 1 62  ? -10.518 10.862  16.935  1.00 0.00 ? 62  HIS A C    5  
ATOM 10330 O O    . HIS A 1 62  ? -10.863 10.564  15.793  1.00 0.00 ? 62  HIS A O    5  
ATOM 10331 C CB   . HIS A 1 62  ? -8.960  12.713  16.133  1.00 0.00 ? 62  HIS A CB   5  
ATOM 10332 C CG   . HIS A 1 62  ? -7.653  13.445  16.317  1.00 0.00 ? 62  HIS A CG   5  
ATOM 10333 N ND1  . HIS A 1 62  ? -7.066  14.193  15.311  1.00 0.00 ? 62  HIS A ND1  5  
ATOM 10334 C CD2  . HIS A 1 62  ? -6.828  13.540  17.398  1.00 0.00 ? 62  HIS A CD2  5  
ATOM 10335 C CE1  . HIS A 1 62  ? -5.937  14.708  15.777  1.00 0.00 ? 62  HIS A CE1  5  
ATOM 10336 N NE2  . HIS A 1 62  ? -5.791  14.301  17.070  1.00 0.00 ? 62  HIS A NE2  5  
ATOM 10337 H H    . HIS A 1 62  ? -7.642  10.534  16.365  1.00 0.00 ? 62  HIS A H    5  
ATOM 10338 H HA   . HIS A 1 62  ? -9.267  12.111  18.156  1.00 0.00 ? 62  HIS A HA   5  
ATOM 10339 H HB2  . HIS A 1 62  ? -8.974  12.257  15.143  1.00 0.00 ? 62  HIS A HB2  5  
ATOM 10340 H HB3  . HIS A 1 62  ? -9.777  13.433  16.166  1.00 0.00 ? 62  HIS A HB3  5  
ATOM 10341 H HD1  . HIS A 1 62  ? -7.431  14.323  14.389  1.00 0.00 ? 62  HIS A HD1  5  
ATOM 10342 H HD2  . HIS A 1 62  ? -6.991  13.068  18.367  1.00 0.00 ? 62  HIS A HD2  5  
ATOM 10343 H HE1  . HIS A 1 62  ? -5.247  15.345  15.224  1.00 0.00 ? 62  HIS A HE1  5  
ATOM 10344 H HE2  . HIS A 1 62  ? -5.058  14.584  17.690  1.00 0.00 ? 62  HIS A HE2  5  
ATOM 10345 N N    . GLN A 1 63  ? -11.208 10.567  18.028  1.00 0.00 ? 63  GLN A N    5  
ATOM 10346 C CA   . GLN A 1 63  ? -12.465 9.843   17.946  1.00 0.00 ? 63  GLN A CA   5  
ATOM 10347 C C    . GLN A 1 63  ? -13.453 10.595  17.053  1.00 0.00 ? 63  GLN A C    5  
ATOM 10348 O O    . GLN A 1 63  ? -14.190 9.980   16.281  1.00 0.00 ? 63  GLN A O    5  
ATOM 10349 C CB   . GLN A 1 63  ? -13.055 9.608   19.338  1.00 0.00 ? 63  GLN A CB   5  
ATOM 10350 C CG   . GLN A 1 63  ? -13.322 10.935  20.052  1.00 0.00 ? 63  GLN A CG   5  
ATOM 10351 C CD   . GLN A 1 63  ? -14.000 10.704  21.404  1.00 0.00 ? 63  GLN A CD   5  
ATOM 10352 O OE1  . GLN A 1 63  ? -14.107 9.591   21.892  1.00 0.00 ? 63  GLN A OE1  5  
ATOM 10353 N NE2  . GLN A 1 63  ? -14.451 11.815  21.979  1.00 0.00 ? 63  GLN A NE2  5  
ATOM 10354 H H    . GLN A 1 63  ? -10.922 10.813  18.954  1.00 0.00 ? 63  GLN A H    5  
ATOM 10355 H HA   . GLN A 1 63  ? -12.218 8.881   17.497  1.00 0.00 ? 63  GLN A HA   5  
ATOM 10356 H HB2  . GLN A 1 63  ? -13.983 9.043   19.254  1.00 0.00 ? 63  GLN A HB2  5  
ATOM 10357 H HB3  . GLN A 1 63  ? -12.367 9.005   19.931  1.00 0.00 ? 63  GLN A HB3  5  
ATOM 10358 H HG2  . GLN A 1 63  ? -12.383 11.469  20.198  1.00 0.00 ? 63  GLN A HG2  5  
ATOM 10359 H HG3  . GLN A 1 63  ? -13.953 11.567  19.427  1.00 0.00 ? 63  GLN A HG3  5  
ATOM 10360 H HE21 . GLN A 1 63  ? -14.331 12.698  21.525  1.00 0.00 ? 63  GLN A HE21 5  
ATOM 10361 H HE22 . GLN A 1 63  ? -14.910 11.767  22.867  1.00 0.00 ? 63  GLN A HE22 5  
ATOM 10362 N N    . ALA A 1 64  ? -13.438 11.913  17.186  1.00 0.00 ? 64  ALA A N    5  
ATOM 10363 C CA   . ALA A 1 64  ? -14.324 12.755  16.400  1.00 0.00 ? 64  ALA A CA   5  
ATOM 10364 C C    . ALA A 1 64  ? -13.972 12.614  14.918  1.00 0.00 ? 64  ALA A C    5  
ATOM 10365 O O    . ALA A 1 64  ? -14.850 12.395  14.085  1.00 0.00 ? 64  ALA A O    5  
ATOM 10366 C CB   . ALA A 1 64  ? -14.222 14.201  16.889  1.00 0.00 ? 64  ALA A CB   5  
ATOM 10367 H H    . ALA A 1 64  ? -12.836 12.404  17.815  1.00 0.00 ? 64  ALA A H    5  
ATOM 10368 H HA   . ALA A 1 64  ? -15.344 12.402  16.557  1.00 0.00 ? 64  ALA A HA   5  
ATOM 10369 H HB1  . ALA A 1 64  ? -13.728 14.221  17.860  1.00 0.00 ? 64  ALA A HB1  5  
ATOM 10370 H HB2  . ALA A 1 64  ? -13.644 14.786  16.175  1.00 0.00 ? 64  ALA A HB2  5  
ATOM 10371 H HB3  . ALA A 1 64  ? -15.222 14.625  16.982  1.00 0.00 ? 64  ALA A HB3  5  
ATOM 10372 N N    . ALA A 1 65  ? -12.685 12.747  14.634  1.00 0.00 ? 65  ALA A N    5  
ATOM 10373 C CA   . ALA A 1 65  ? -12.205 12.638  13.266  1.00 0.00 ? 65  ALA A CA   5  
ATOM 10374 C C    . ALA A 1 65  ? -12.619 11.282  12.692  1.00 0.00 ? 65  ALA A C    5  
ATOM 10375 O O    . ALA A 1 65  ? -13.229 11.215  11.626  1.00 0.00 ? 65  ALA A O    5  
ATOM 10376 C CB   . ALA A 1 65  ? -10.690 12.845  13.238  1.00 0.00 ? 65  ALA A CB   5  
ATOM 10377 H H    . ALA A 1 65  ? -11.976 12.926  15.317  1.00 0.00 ? 65  ALA A H    5  
ATOM 10378 H HA   . ALA A 1 65  ? -12.678 13.430  12.684  1.00 0.00 ? 65  ALA A HA   5  
ATOM 10379 H HB1  . ALA A 1 65  ? -10.193 11.882  13.129  1.00 0.00 ? 65  ALA A HB1  5  
ATOM 10380 H HB2  . ALA A 1 65  ? -10.426 13.487  12.398  1.00 0.00 ? 65  ALA A HB2  5  
ATOM 10381 H HB3  . ALA A 1 65  ? -10.370 13.316  14.168  1.00 0.00 ? 65  ALA A HB3  5  
ATOM 10382 N N    . MET A 1 66  ? -12.270 10.234  13.425  1.00 0.00 ? 66  MET A N    5  
ATOM 10383 C CA   . MET A 1 66  ? -12.597 8.883   13.001  1.00 0.00 ? 66  MET A CA   5  
ATOM 10384 C C    . MET A 1 66  ? -14.111 8.701   12.870  1.00 0.00 ? 66  MET A C    5  
ATOM 10385 O O    . MET A 1 66  ? -14.577 7.931   12.033  1.00 0.00 ? 66  MET A O    5  
ATOM 10386 C CB   . MET A 1 66  ? -12.048 7.881   14.020  1.00 0.00 ? 66  MET A CB   5  
ATOM 10387 C CG   . MET A 1 66  ? -10.732 7.271   13.533  1.00 0.00 ? 66  MET A CG   5  
ATOM 10388 S SD   . MET A 1 66  ? -9.578  8.565   13.112  1.00 0.00 ? 66  MET A SD   5  
ATOM 10389 C CE   . MET A 1 66  ? -8.779  7.821   11.701  1.00 0.00 ? 66  MET A CE   5  
ATOM 10390 H H    . MET A 1 66  ? -11.774 10.297  14.290  1.00 0.00 ? 66  MET A H    5  
ATOM 10391 H HA   . MET A 1 66  ? -12.124 8.759   12.027  1.00 0.00 ? 66  MET A HA   5  
ATOM 10392 H HB2  . MET A 1 66  ? -11.891 8.380   14.976  1.00 0.00 ? 66  MET A HB2  5  
ATOM 10393 H HB3  . MET A 1 66  ? -12.780 7.092   14.189  1.00 0.00 ? 66  MET A HB3  5  
ATOM 10394 H HG2  . MET A 1 66  ? -10.310 6.633   14.309  1.00 0.00 ? 66  MET A HG2  5  
ATOM 10395 H HG3  . MET A 1 66  ? -10.915 6.639   12.664  1.00 0.00 ? 66  MET A HG3  5  
ATOM 10396 H HE1  . MET A 1 66  ? -9.453  7.098   11.241  1.00 0.00 ? 66  MET A HE1  5  
ATOM 10397 H HE2  . MET A 1 66  ? -8.528  8.596   10.975  1.00 0.00 ? 66  MET A HE2  5  
ATOM 10398 H HE3  . MET A 1 66  ? -7.868  7.317   12.023  1.00 0.00 ? 66  MET A HE3  5  
ATOM 10399 N N    . GLN A 1 67  ? -14.836 9.423   13.712  1.00 0.00 ? 67  GLN A N    5  
ATOM 10400 C CA   . GLN A 1 67  ? -16.288 9.351   13.701  1.00 0.00 ? 67  GLN A CA   5  
ATOM 10401 C C    . GLN A 1 67  ? -16.833 9.810   12.348  1.00 0.00 ? 67  GLN A C    5  
ATOM 10402 O O    . GLN A 1 67  ? -17.576 9.081   11.694  1.00 0.00 ? 67  GLN A O    5  
ATOM 10403 C CB   . GLN A 1 67  ? -16.886 10.176  14.842  1.00 0.00 ? 67  GLN A CB   5  
ATOM 10404 C CG   . GLN A 1 67  ? -17.767 9.308   15.743  1.00 0.00 ? 67  GLN A CG   5  
ATOM 10405 C CD   . GLN A 1 67  ? -17.010 8.065   16.214  1.00 0.00 ? 67  GLN A CD   5  
ATOM 10406 O OE1  . GLN A 1 67  ? -15.791 8.015   16.229  1.00 0.00 ? 67  GLN A OE1  5  
ATOM 10407 N NE2  . GLN A 1 67  ? -17.799 7.065   16.598  1.00 0.00 ? 67  GLN A NE2  5  
ATOM 10408 H H    . GLN A 1 67  ? -14.449 10.047  14.390  1.00 0.00 ? 67  GLN A H    5  
ATOM 10409 H HA   . GLN A 1 67  ? -16.526 8.299   13.858  1.00 0.00 ? 67  GLN A HA   5  
ATOM 10410 H HB2  . GLN A 1 67  ? -16.086 10.623  15.431  1.00 0.00 ? 67  GLN A HB2  5  
ATOM 10411 H HB3  . GLN A 1 67  ? -17.476 10.996  14.431  1.00 0.00 ? 67  GLN A HB3  5  
ATOM 10412 H HG2  . GLN A 1 67  ? -18.093 9.889   16.607  1.00 0.00 ? 67  GLN A HG2  5  
ATOM 10413 H HG3  . GLN A 1 67  ? -18.664 9.009   15.203  1.00 0.00 ? 67  GLN A HG3  5  
ATOM 10414 H HE21 . GLN A 1 67  ? -18.794 7.169   16.561  1.00 0.00 ? 67  GLN A HE21 5  
ATOM 10415 H HE22 . GLN A 1 67  ? -17.399 6.208   16.923  1.00 0.00 ? 67  GLN A HE22 5  
ATOM 10416 N N    . MET A 1 68  ? -16.439 11.017  11.966  1.00 0.00 ? 68  MET A N    5  
ATOM 10417 C CA   . MET A 1 68  ? -16.879 11.583  10.702  1.00 0.00 ? 68  MET A CA   5  
ATOM 10418 C C    . MET A 1 68  ? -16.442 10.705  9.528   1.00 0.00 ? 68  MET A C    5  
ATOM 10419 O O    . MET A 1 68  ? -17.210 10.488  8.591   1.00 0.00 ? 68  MET A O    5  
ATOM 10420 C CB   . MET A 1 68  ? -16.290 12.985  10.538  1.00 0.00 ? 68  MET A CB   5  
ATOM 10421 C CG   . MET A 1 68  ? -16.942 13.971  11.508  1.00 0.00 ? 68  MET A CG   5  
ATOM 10422 S SD   . MET A 1 68  ? -16.125 15.555  11.412  1.00 0.00 ? 68  MET A SD   5  
ATOM 10423 C CE   . MET A 1 68  ? -14.687 15.224  12.415  1.00 0.00 ? 68  MET A CE   5  
ATOM 10424 H H    . MET A 1 68  ? -15.834 11.603  12.504  1.00 0.00 ? 68  MET A H    5  
ATOM 10425 H HA   . MET A 1 68  ? -17.967 11.613  10.758  1.00 0.00 ? 68  MET A HA   5  
ATOM 10426 H HB2  . MET A 1 68  ? -15.214 12.955  10.714  1.00 0.00 ? 68  MET A HB2  5  
ATOM 10427 H HB3  . MET A 1 68  ? -16.436 13.327  9.514   1.00 0.00 ? 68  MET A HB3  5  
ATOM 10428 H HG2  . MET A 1 68  ? -18.000 14.083  11.270  1.00 0.00 ? 68  MET A HG2  5  
ATOM 10429 H HG3  . MET A 1 68  ? -16.884 13.584  12.526  1.00 0.00 ? 68  MET A HG3  5  
ATOM 10430 H HE1  . MET A 1 68  ? -14.639 14.158  12.642  1.00 0.00 ? 68  MET A HE1  5  
ATOM 10431 H HE2  . MET A 1 68  ? -13.789 15.519  11.873  1.00 0.00 ? 68  MET A HE2  5  
ATOM 10432 H HE3  . MET A 1 68  ? -14.754 15.790  13.344  1.00 0.00 ? 68  MET A HE3  5  
ATOM 10433 N N    . LEU A 1 69  ? -15.211 10.222  9.616   1.00 0.00 ? 69  LEU A N    5  
ATOM 10434 C CA   . LEU A 1 69  ? -14.664 9.372   8.573   1.00 0.00 ? 69  LEU A CA   5  
ATOM 10435 C C    . LEU A 1 69  ? -15.446 8.058   8.528   1.00 0.00 ? 69  LEU A C    5  
ATOM 10436 O O    . LEU A 1 69  ? -15.639 7.482   7.459   1.00 0.00 ? 69  LEU A O    5  
ATOM 10437 C CB   . LEU A 1 69  ? -13.158 9.186   8.769   1.00 0.00 ? 69  LEU A CB   5  
ATOM 10438 C CG   . LEU A 1 69  ? -12.433 8.388   7.682   1.00 0.00 ? 69  LEU A CG   5  
ATOM 10439 C CD1  . LEU A 1 69  ? -11.321 9.221   7.041   1.00 0.00 ? 69  LEU A CD1  5  
ATOM 10440 C CD2  . LEU A 1 69  ? -11.911 7.060   8.232   1.00 0.00 ? 69  LEU A CD2  5  
ATOM 10441 H H    . LEU A 1 69  ? -14.594 10.402  10.381  1.00 0.00 ? 69  LEU A H    5  
ATOM 10442 H HA   . LEU A 1 69  ? -14.803 9.890   7.624   1.00 0.00 ? 69  LEU A HA   5  
ATOM 10443 H HB2  . LEU A 1 69  ? -12.696 10.170  8.838   1.00 0.00 ? 69  LEU A HB2  5  
ATOM 10444 H HB3  . LEU A 1 69  ? -12.995 8.689   9.725   1.00 0.00 ? 69  LEU A HB3  5  
ATOM 10445 H HG   . LEU A 1 69  ? -13.152 8.152   6.896   1.00 0.00 ? 69  LEU A HG   5  
ATOM 10446 H HD11 . LEU A 1 69  ? -10.911 9.909   7.780   1.00 0.00 ? 69  LEU A HD11 5  
ATOM 10447 H HD12 . LEU A 1 69  ? -10.533 8.559   6.684   1.00 0.00 ? 69  LEU A HD12 5  
ATOM 10448 H HD13 . LEU A 1 69  ? -11.728 9.787   6.203   1.00 0.00 ? 69  LEU A HD13 5  
ATOM 10449 H HD21 . LEU A 1 69  ? -12.436 6.819   9.157   1.00 0.00 ? 69  LEU A HD21 5  
ATOM 10450 H HD22 . LEU A 1 69  ? -12.083 6.271   7.500   1.00 0.00 ? 69  LEU A HD22 5  
ATOM 10451 H HD23 . LEU A 1 69  ? -10.843 7.145   8.433   1.00 0.00 ? 69  LEU A HD23 5  
ATOM 10452 N N    . LYS A 1 70  ? -15.875 7.622   9.703   1.00 0.00 ? 70  LYS A N    5  
ATOM 10453 C CA   . LYS A 1 70  ? -16.631 6.385   9.812   1.00 0.00 ? 70  LYS A CA   5  
ATOM 10454 C C    . LYS A 1 70  ? -17.956 6.536   9.062   1.00 0.00 ? 70  LYS A C    5  
ATOM 10455 O O    . LYS A 1 70  ? -18.321 5.676   8.262   1.00 0.00 ? 70  LYS A O    5  
ATOM 10456 C CB   . LYS A 1 70  ? -16.797 5.987   11.281  1.00 0.00 ? 70  LYS A CB   5  
ATOM 10457 C CG   . LYS A 1 70  ? -15.865 4.828   11.642  1.00 0.00 ? 70  LYS A CG   5  
ATOM 10458 C CD   . LYS A 1 70  ? -15.851 4.589   13.153  1.00 0.00 ? 70  LYS A CD   5  
ATOM 10459 C CE   . LYS A 1 70  ? -14.982 3.381   13.509  1.00 0.00 ? 70  LYS A CE   5  
ATOM 10460 N NZ   . LYS A 1 70  ? -15.142 3.029   14.937  1.00 0.00 ? 70  LYS A NZ   5  
ATOM 10461 H H    . LYS A 1 70  ? -15.712 8.096   10.569  1.00 0.00 ? 70  LYS A H    5  
ATOM 10462 H HA   . LYS A 1 70  ? -16.048 5.602   9.330   1.00 0.00 ? 70  LYS A HA   5  
ATOM 10463 H HB2  . LYS A 1 70  ? -16.584 6.843   11.920  1.00 0.00 ? 70  LYS A HB2  5  
ATOM 10464 H HB3  . LYS A 1 70  ? -17.831 5.699   11.467  1.00 0.00 ? 70  LYS A HB3  5  
ATOM 10465 H HG2  . LYS A 1 70  ? -16.189 3.923   11.130  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 10466 H HG3  . LYS A 1 70  ? -14.856 5.047   11.295  1.00 0.00 ? 70  LYS A HG3  5  
ATOM 10467 H HD2  . LYS A 1 70  ? -15.473 5.476   13.663  1.00 0.00 ? 70  LYS A HD2  5  
ATOM 10468 H HD3  . LYS A 1 70  ? -16.868 4.427   13.509  1.00 0.00 ? 70  LYS A HD3  5  
ATOM 10469 H HE2  . LYS A 1 70  ? -15.258 2.530   12.884  1.00 0.00 ? 70  LYS A HE2  5  
ATOM 10470 H HE3  . LYS A 1 70  ? -13.936 3.604   13.299  1.00 0.00 ? 70  LYS A HE3  5  
ATOM 10471 H HZ1  . LYS A 1 70  ? -16.086 3.200   15.219  1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 10472 H HZ2  . LYS A 1 70  ? -14.927 2.061   15.068  1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 10473 H HZ3  . LYS A 1 70  ? -14.522 3.585   15.490  1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 10474 N N    . GLU A 1 71  ? -18.640 7.635   9.348   1.00 0.00 ? 71  GLU A N    5  
ATOM 10475 C CA   . GLU A 1 71  ? -19.916 7.909   8.709   1.00 0.00 ? 71  GLU A CA   5  
ATOM 10476 C C    . GLU A 1 71  ? -19.738 8.024   7.194   1.00 0.00 ? 71  GLU A C    5  
ATOM 10477 O O    . GLU A 1 71  ? -20.550 7.506   6.429   1.00 0.00 ? 71  GLU A O    5  
ATOM 10478 C CB   . GLU A 1 71  ? -20.555 9.174   9.284   1.00 0.00 ? 71  GLU A CB   5  
ATOM 10479 C CG   . GLU A 1 71  ? -21.260 8.879   10.610  1.00 0.00 ? 71  GLU A CG   5  
ATOM 10480 C CD   . GLU A 1 71  ? -21.733 10.171  11.279  1.00 0.00 ? 71  GLU A CD   5  
ATOM 10481 O OE1  . GLU A 1 71  ? -22.581 10.851  10.664  1.00 0.00 ? 71  GLU A OE1  5  
ATOM 10482 O OE2  . GLU A 1 71  ? -21.234 10.448  12.392  1.00 0.00 ? 71  GLU A OE2  5  
ATOM 10483 H H    . GLU A 1 71  ? -18.335 8.329   9.999   1.00 0.00 ? 71  GLU A H    5  
ATOM 10484 H HA   . GLU A 1 71  ? -20.547 7.052   8.944   1.00 0.00 ? 71  GLU A HA   5  
ATOM 10485 H HB2  . GLU A 1 71  ? -19.790 9.936   9.437   1.00 0.00 ? 71  GLU A HB2  5  
ATOM 10486 H HB3  . GLU A 1 71  ? -21.272 9.581   8.570   1.00 0.00 ? 71  GLU A HB3  5  
ATOM 10487 H HG2  . GLU A 1 71  ? -22.113 8.223   10.433  1.00 0.00 ? 71  GLU A HG2  5  
ATOM 10488 H HG3  . GLU A 1 71  ? -20.582 8.347   11.276  1.00 0.00 ? 71  GLU A HG3  5  
ATOM 10489 N N    . THR A 1 72  ? -18.670 8.707   6.806   1.00 0.00 ? 72  THR A N    5  
ATOM 10490 C CA   . THR A 1 72  ? -18.376 8.897   5.396   1.00 0.00 ? 72  THR A CA   5  
ATOM 10491 C C    . THR A 1 72  ? -18.155 7.546   4.711   1.00 0.00 ? 72  THR A C    5  
ATOM 10492 O O    . THR A 1 72  ? -18.866 7.200   3.769   1.00 0.00 ? 72  THR A O    5  
ATOM 10493 C CB   . THR A 1 72  ? -17.175 9.838   5.286   1.00 0.00 ? 72  THR A CB   5  
ATOM 10494 O OG1  . THR A 1 72  ? -17.753 11.104  4.982   1.00 0.00 ? 72  THR A OG1  5  
ATOM 10495 C CG2  . THR A 1 72  ? -16.298 9.528   4.072   1.00 0.00 ? 72  THR A CG2  5  
ATOM 10496 H H    . THR A 1 72  ? -18.015 9.125   7.434   1.00 0.00 ? 72  THR A H    5  
ATOM 10497 H HA   . THR A 1 72  ? -19.244 9.357   4.922   1.00 0.00 ? 72  THR A HA   5  
ATOM 10498 H HB   . THR A 1 72  ? -16.588 9.828   6.204   1.00 0.00 ? 72  THR A HB   5  
ATOM 10499 H HG1  . THR A 1 72  ? -17.237 11.833  5.432   1.00 0.00 ? 72  THR A HG1  5  
ATOM 10500 H HG21 . THR A 1 72  ? -16.891 9.016   3.315   1.00 0.00 ? 72  THR A HG21 5  
ATOM 10501 H HG22 . THR A 1 72  ? -15.907 10.458  3.659   1.00 0.00 ? 72  THR A HG22 5  
ATOM 10502 H HG23 . THR A 1 72  ? -15.468 8.890   4.377   1.00 0.00 ? 72  THR A HG23 5  
ATOM 10503 N N    . ILE A 1 73  ? -17.165 6.820   5.211   1.00 0.00 ? 73  ILE A N    5  
ATOM 10504 C CA   . ILE A 1 73  ? -16.842 5.516   4.659   1.00 0.00 ? 73  ILE A CA   5  
ATOM 10505 C C    . ILE A 1 73  ? -18.131 4.720   4.452   1.00 0.00 ? 73  ILE A C    5  
ATOM 10506 O O    . ILE A 1 73  ? -18.381 4.209   3.361   1.00 0.00 ? 73  ILE A O    5  
ATOM 10507 C CB   . ILE A 1 73  ? -15.813 4.803   5.539   1.00 0.00 ? 73  ILE A CB   5  
ATOM 10508 C CG1  . ILE A 1 73  ? -14.436 5.460   5.416   1.00 0.00 ? 73  ILE A CG1  5  
ATOM 10509 C CG2  . ILE A 1 73  ? -15.765 3.306   5.222   1.00 0.00 ? 73  ILE A CG2  5  
ATOM 10510 C CD1  . ILE A 1 73  ? -13.561 4.714   4.406   1.00 0.00 ? 73  ILE A CD1  5  
ATOM 10511 H H    . ILE A 1 73  ? -16.592 7.110   5.978   1.00 0.00 ? 73  ILE A H    5  
ATOM 10512 H HA   . ILE A 1 73  ? -16.376 5.679   3.687   1.00 0.00 ? 73  ILE A HA   5  
ATOM 10513 H HB   . ILE A 1 73  ? -16.126 4.902   6.578   1.00 0.00 ? 73  ILE A HB   5  
ATOM 10514 H HG12 . ILE A 1 73  ? -14.551 6.498   5.106   1.00 0.00 ? 73  ILE A HG12 5  
ATOM 10515 H HG13 . ILE A 1 73  ? -13.946 5.470   6.389   1.00 0.00 ? 73  ILE A HG13 5  
ATOM 10516 H HG21 . ILE A 1 73  ? -15.974 3.152   4.164   1.00 0.00 ? 73  ILE A HG21 5  
ATOM 10517 H HG22 . ILE A 1 73  ? -14.773 2.917   5.458   1.00 0.00 ? 73  ILE A HG22 5  
ATOM 10518 H HG23 . ILE A 1 73  ? -16.511 2.784   5.820   1.00 0.00 ? 73  ILE A HG23 5  
ATOM 10519 H HD11 . ILE A 1 73  ? -14.196 4.198   3.686   1.00 0.00 ? 73  ILE A HD11 5  
ATOM 10520 H HD12 . ILE A 1 73  ? -12.923 5.426   3.883   1.00 0.00 ? 73  ILE A HD12 5  
ATOM 10521 H HD13 . ILE A 1 73  ? -12.941 3.987   4.930   1.00 0.00 ? 73  ILE A HD13 5  
ATOM 10522 N N    . ASN A 1 74  ? -18.916 4.639   5.516   1.00 0.00 ? 74  ASN A N    5  
ATOM 10523 C CA   . ASN A 1 74  ? -20.174 3.913   5.464   1.00 0.00 ? 74  ASN A CA   5  
ATOM 10524 C C    . ASN A 1 74  ? -21.060 4.513   4.371   1.00 0.00 ? 74  ASN A C    5  
ATOM 10525 O O    . ASN A 1 74  ? -21.806 3.795   3.707   1.00 0.00 ? 74  ASN A O    5  
ATOM 10526 C CB   . ASN A 1 74  ? -20.926 4.020   6.793   1.00 0.00 ? 74  ASN A CB   5  
ATOM 10527 C CG   . ASN A 1 74  ? -21.873 2.834   6.984   1.00 0.00 ? 74  ASN A CG   5  
ATOM 10528 O OD1  . ASN A 1 74  ? -21.547 1.693   6.696   1.00 0.00 ? 74  ASN A OD1  5  
ATOM 10529 N ND2  . ASN A 1 74  ? -23.060 3.164   7.482   1.00 0.00 ? 74  ASN A ND2  5  
ATOM 10530 H H    . ASN A 1 74  ? -18.705 5.057   6.400   1.00 0.00 ? 74  ASN A H    5  
ATOM 10531 H HA   . ASN A 1 74  ? -19.900 2.879   5.258   1.00 0.00 ? 74  ASN A HA   5  
ATOM 10532 H HB2  . ASN A 1 74  ? -20.213 4.057   7.617   1.00 0.00 ? 74  ASN A HB2  5  
ATOM 10533 H HB3  . ASN A 1 74  ? -21.493 4.950   6.820   1.00 0.00 ? 74  ASN A HB3  5  
ATOM 10534 H HD21 . ASN A 1 74  ? -23.265 4.119   7.698   1.00 0.00 ? 74  ASN A HD21 5  
ATOM 10535 H HD22 . ASN A 1 74  ? -23.750 2.458   7.644   1.00 0.00 ? 74  ASN A HD22 5  
ATOM 10536 N N    . GLU A 1 75  ? -20.947 5.824   4.215   1.00 0.00 ? 75  GLU A N    5  
ATOM 10537 C CA   . GLU A 1 75  ? -21.728 6.529   3.214   1.00 0.00 ? 75  GLU A CA   5  
ATOM 10538 C C    . GLU A 1 75  ? -21.331 6.069   1.810   1.00 0.00 ? 75  GLU A C    5  
ATOM 10539 O O    . GLU A 1 75  ? -22.154 5.529   1.073   1.00 0.00 ? 75  GLU A O    5  
ATOM 10540 C CB   . GLU A 1 75  ? -21.569 8.044   3.359   1.00 0.00 ? 75  GLU A CB   5  
ATOM 10541 C CG   . GLU A 1 75  ? -22.861 8.684   3.869   1.00 0.00 ? 75  GLU A CG   5  
ATOM 10542 C CD   . GLU A 1 75  ? -22.941 10.157  3.462   1.00 0.00 ? 75  GLU A CD   5  
ATOM 10543 O OE1  . GLU A 1 75  ? -23.000 10.405  2.238   1.00 0.00 ? 75  GLU A OE1  5  
ATOM 10544 O OE2  . GLU A 1 75  ? -22.940 11.002  4.383   1.00 0.00 ? 75  GLU A OE2  5  
ATOM 10545 H H    . GLU A 1 75  ? -20.338 6.402   4.759   1.00 0.00 ? 75  GLU A H    5  
ATOM 10546 H HA   . GLU A 1 75  ? -22.766 6.259   3.411   1.00 0.00 ? 75  GLU A HA   5  
ATOM 10547 H HB2  . GLU A 1 75  ? -20.753 8.262   4.049   1.00 0.00 ? 75  GLU A HB2  5  
ATOM 10548 H HB3  . GLU A 1 75  ? -21.298 8.479   2.398   1.00 0.00 ? 75  GLU A HB3  5  
ATOM 10549 H HG2  . GLU A 1 75  ? -23.721 8.146   3.470   1.00 0.00 ? 75  GLU A HG2  5  
ATOM 10550 H HG3  . GLU A 1 75  ? -22.909 8.601   4.955   1.00 0.00 ? 75  GLU A HG3  5  
ATOM 10551 N N    . GLU A 1 76  ? -20.068 6.299   1.483   1.00 0.00 ? 76  GLU A N    5  
ATOM 10552 C CA   . GLU A 1 76  ? -19.550 5.914   0.181   1.00 0.00 ? 76  GLU A CA   5  
ATOM 10553 C C    . GLU A 1 76  ? -19.984 4.487   -0.162  1.00 0.00 ? 76  GLU A C    5  
ATOM 10554 O O    . GLU A 1 76  ? -20.369 4.207   -1.297  1.00 0.00 ? 76  GLU A O    5  
ATOM 10555 C CB   . GLU A 1 76  ? -18.027 6.050   0.133   1.00 0.00 ? 76  GLU A CB   5  
ATOM 10556 C CG   . GLU A 1 76  ? -17.577 6.721   -1.165  1.00 0.00 ? 76  GLU A CG   5  
ATOM 10557 C CD   . GLU A 1 76  ? -18.281 8.065   -1.360  1.00 0.00 ? 76  GLU A CD   5  
ATOM 10558 O OE1  . GLU A 1 76  ? -18.340 8.824   -0.369  1.00 0.00 ? 76  GLU A OE1  5  
ATOM 10559 O OE2  . GLU A 1 76  ? -18.746 8.302   -2.497  1.00 0.00 ? 76  GLU A OE2  5  
ATOM 10560 H H    . GLU A 1 76  ? -19.403 6.737   2.088   1.00 0.00 ? 76  GLU A H    5  
ATOM 10561 H HA   . GLU A 1 76  ? -19.993 6.615   -0.526  1.00 0.00 ? 76  GLU A HA   5  
ATOM 10562 H HB2  . GLU A 1 76  ? -17.684 6.634   0.987   1.00 0.00 ? 76  GLU A HB2  5  
ATOM 10563 H HB3  . GLU A 1 76  ? -17.567 5.065   0.215   1.00 0.00 ? 76  GLU A HB3  5  
ATOM 10564 H HG2  . GLU A 1 76  ? -16.498 6.873   -1.146  1.00 0.00 ? 76  GLU A HG2  5  
ATOM 10565 H HG3  . GLU A 1 76  ? -17.791 6.068   -2.011  1.00 0.00 ? 76  GLU A HG3  5  
ATOM 10566 N N    . ALA A 1 77  ? -19.907 3.622   0.838   1.00 0.00 ? 77  ALA A N    5  
ATOM 10567 C CA   . ALA A 1 77  ? -20.287 2.231   0.656   1.00 0.00 ? 77  ALA A CA   5  
ATOM 10568 C C    . ALA A 1 77  ? -21.761 2.159   0.254   1.00 0.00 ? 77  ALA A C    5  
ATOM 10569 O O    . ALA A 1 77  ? -22.114 1.475   -0.706  1.00 0.00 ? 77  ALA A O    5  
ATOM 10570 C CB   . ALA A 1 77  ? -19.992 1.450   1.938   1.00 0.00 ? 77  ALA A CB   5  
ATOM 10571 H H    . ALA A 1 77  ? -19.592 3.858   1.758   1.00 0.00 ? 77  ALA A H    5  
ATOM 10572 H HA   . ALA A 1 77  ? -19.678 1.823   -0.151  1.00 0.00 ? 77  ALA A HA   5  
ATOM 10573 H HB1  . ALA A 1 77  ? -19.560 2.120   2.682   1.00 0.00 ? 77  ALA A HB1  5  
ATOM 10574 H HB2  . ALA A 1 77  ? -19.288 0.646   1.721   1.00 0.00 ? 77  ALA A HB2  5  
ATOM 10575 H HB3  . ALA A 1 77  ? -20.918 1.026   2.327   1.00 0.00 ? 77  ALA A HB3  5  
ATOM 10576 N N    . ALA A 1 78  ? -22.584 2.872   1.009   1.00 0.00 ? 78  ALA A N    5  
ATOM 10577 C CA   . ALA A 1 78  ? -24.012 2.897   0.744   1.00 0.00 ? 78  ALA A CA   5  
ATOM 10578 C C    . ALA A 1 78  ? -24.247 3.262   -0.722  1.00 0.00 ? 78  ALA A C    5  
ATOM 10579 O O    . ALA A 1 78  ? -25.008 2.592   -1.418  1.00 0.00 ? 78  ALA A O    5  
ATOM 10580 C CB   . ALA A 1 78  ? -24.693 3.873   1.705   1.00 0.00 ? 78  ALA A CB   5  
ATOM 10581 H H    . ALA A 1 78  ? -22.289 3.425   1.788   1.00 0.00 ? 78  ALA A H    5  
ATOM 10582 H HA   . ALA A 1 78  ? -24.401 1.895   0.927   1.00 0.00 ? 78  ALA A HA   5  
ATOM 10583 H HB1  . ALA A 1 78  ? -25.734 3.579   1.845   1.00 0.00 ? 78  ALA A HB1  5  
ATOM 10584 H HB2  . ALA A 1 78  ? -24.652 4.880   1.289   1.00 0.00 ? 78  ALA A HB2  5  
ATOM 10585 H HB3  . ALA A 1 78  ? -24.179 3.856   2.665   1.00 0.00 ? 78  ALA A HB3  5  
ATOM 10586 N N    . GLU A 1 79  ? -23.579 4.324   -1.149  1.00 0.00 ? 79  GLU A N    5  
ATOM 10587 C CA   . GLU A 1 79  ? -23.707 4.787   -2.520  1.00 0.00 ? 79  GLU A CA   5  
ATOM 10588 C C    . GLU A 1 79  ? -23.257 3.695   -3.493  1.00 0.00 ? 79  GLU A C    5  
ATOM 10589 O O    . GLU A 1 79  ? -23.825 3.550   -4.575  1.00 0.00 ? 79  GLU A O    5  
ATOM 10590 C CB   . GLU A 1 79  ? -22.914 6.077   -2.740  1.00 0.00 ? 79  GLU A CB   5  
ATOM 10591 C CG   . GLU A 1 79  ? -23.846 7.242   -3.081  1.00 0.00 ? 79  GLU A CG   5  
ATOM 10592 C CD   . GLU A 1 79  ? -24.620 7.706   -1.845  1.00 0.00 ? 79  GLU A CD   5  
ATOM 10593 O OE1  . GLU A 1 79  ? -24.949 6.828   -1.020  1.00 0.00 ? 79  GLU A OE1  5  
ATOM 10594 O OE2  . GLU A 1 79  ? -24.864 8.928   -1.755  1.00 0.00 ? 79  GLU A OE2  5  
ATOM 10595 H H    . GLU A 1 79  ? -22.962 4.864   -0.577  1.00 0.00 ? 79  GLU A H    5  
ATOM 10596 H HA   . GLU A 1 79  ? -24.769 4.992   -2.660  1.00 0.00 ? 79  GLU A HA   5  
ATOM 10597 H HB2  . GLU A 1 79  ? -22.343 6.315   -1.841  1.00 0.00 ? 79  GLU A HB2  5  
ATOM 10598 H HB3  . GLU A 1 79  ? -22.194 5.934   -3.545  1.00 0.00 ? 79  GLU A HB3  5  
ATOM 10599 H HG2  . GLU A 1 79  ? -23.264 8.072   -3.483  1.00 0.00 ? 79  GLU A HG2  5  
ATOM 10600 H HG3  . GLU A 1 79  ? -24.544 6.937   -3.860  1.00 0.00 ? 79  GLU A HG3  5  
ATOM 10601 N N    . TRP A 1 80  ? -22.241 2.956   -3.074  1.00 0.00 ? 80  TRP A N    5  
ATOM 10602 C CA   . TRP A 1 80  ? -21.708 1.882   -3.895  1.00 0.00 ? 80  TRP A CA   5  
ATOM 10603 C C    . TRP A 1 80  ? -22.837 0.884   -4.158  1.00 0.00 ? 80  TRP A C    5  
ATOM 10604 O O    . TRP A 1 80  ? -23.047 0.466   -5.295  1.00 0.00 ? 80  TRP A O    5  
ATOM 10605 C CB   . TRP A 1 80  ? -20.485 1.242   -3.234  1.00 0.00 ? 80  TRP A CB   5  
ATOM 10606 C CG   . TRP A 1 80  ? -19.331 0.961   -4.198  1.00 0.00 ? 80  TRP A CG   5  
ATOM 10607 C CD1  . TRP A 1 80  ? -18.863 -0.228  -4.599  1.00 0.00 ? 80  TRP A CD1  5  
ATOM 10608 C CD2  . TRP A 1 80  ? -18.515 1.942   -4.871  1.00 0.00 ? 80  TRP A CD2  5  
ATOM 10609 N NE1  . TRP A 1 80  ? -17.808 -0.086  -5.478  1.00 0.00 ? 80  TRP A NE1  5  
ATOM 10610 C CE2  . TRP A 1 80  ? -17.589 1.276   -5.648  1.00 0.00 ? 80  TRP A CE2  5  
ATOM 10611 C CE3  . TRP A 1 80  ? -18.557 3.347   -4.823  1.00 0.00 ? 80  TRP A CE3  5  
ATOM 10612 C CZ2  . TRP A 1 80  ? -16.637 1.931   -6.437  1.00 0.00 ? 80  TRP A CZ2  5  
ATOM 10613 C CZ3  . TRP A 1 80  ? -17.597 3.987   -5.617  1.00 0.00 ? 80  TRP A CZ3  5  
ATOM 10614 C CH2  . TRP A 1 80  ? -16.659 3.331   -6.406  1.00 0.00 ? 80  TRP A CH2  5  
ATOM 10615 H H    . TRP A 1 80  ? -21.784 3.081   -2.193  1.00 0.00 ? 80  TRP A H    5  
ATOM 10616 H HA   . TRP A 1 80  ? -21.367 2.318   -4.834  1.00 0.00 ? 80  TRP A HA   5  
ATOM 10617 H HB2  . TRP A 1 80  ? -20.130 1.898   -2.438  1.00 0.00 ? 80  TRP A HB2  5  
ATOM 10618 H HB3  . TRP A 1 80  ? -20.788 0.306   -2.763  1.00 0.00 ? 80  TRP A HB3  5  
ATOM 10619 H HD1  . TRP A 1 80  ? -19.264 -1.188  -4.273  1.00 0.00 ? 80  TRP A HD1  5  
ATOM 10620 H HE1  . TRP A 1 80  ? -17.249 -0.894  -5.951  1.00 0.00 ? 80  TRP A HE1  5  
ATOM 10621 H HE3  . TRP A 1 80  ? -19.277 3.896   -4.218  1.00 0.00 ? 80  TRP A HE3  5  
ATOM 10622 H HZ2  . TRP A 1 80  ? -15.916 1.382   -7.043  1.00 0.00 ? 80  TRP A HZ2  5  
ATOM 10623 H HZ3  . TRP A 1 80  ? -17.586 5.077   -5.618  1.00 0.00 ? 80  TRP A HZ3  5  
ATOM 10624 H HH2  . TRP A 1 80  ? -15.945 3.904   -6.997  1.00 0.00 ? 80  TRP A HH2  5  
ATOM 10625 N N    . ASP A 1 81  ? -23.533 0.530   -3.088  1.00 0.00 ? 81  ASP A N    5  
ATOM 10626 C CA   . ASP A 1 81  ? -24.635 -0.411  -3.189  1.00 0.00 ? 81  ASP A CA   5  
ATOM 10627 C C    . ASP A 1 81  ? -25.684 0.141   -4.156  1.00 0.00 ? 81  ASP A C    5  
ATOM 10628 O O    . ASP A 1 81  ? -26.143 -0.569  -5.050  1.00 0.00 ? 81  ASP A O    5  
ATOM 10629 C CB   . ASP A 1 81  ? -25.307 -0.620  -1.831  1.00 0.00 ? 81  ASP A CB   5  
ATOM 10630 C CG   . ASP A 1 81  ? -26.259 -1.815  -1.758  1.00 0.00 ? 81  ASP A CG   5  
ATOM 10631 O OD1  . ASP A 1 81  ? -26.948 -2.056  -2.773  1.00 0.00 ? 81  ASP A OD1  5  
ATOM 10632 O OD2  . ASP A 1 81  ? -26.277 -2.463  -0.688  1.00 0.00 ? 81  ASP A OD2  5  
ATOM 10633 H H    . ASP A 1 81  ? -23.355 0.875   -2.165  1.00 0.00 ? 81  ASP A H    5  
ATOM 10634 H HA   . ASP A 1 81  ? -24.187 -1.339  -3.544  1.00 0.00 ? 81  ASP A HA   5  
ATOM 10635 H HB2  . ASP A 1 81  ? -24.533 -0.744  -1.074  1.00 0.00 ? 81  ASP A HB2  5  
ATOM 10636 H HB3  . ASP A 1 81  ? -25.862 0.284   -1.573  1.00 0.00 ? 81  ASP A HB3  5  
ATOM 10637 N N    . ARG A 1 82  ? -26.032 1.402   -3.944  1.00 0.00 ? 82  ARG A N    5  
ATOM 10638 C CA   . ARG A 1 82  ? -27.019 2.057   -4.787  1.00 0.00 ? 82  ARG A CA   5  
ATOM 10639 C C    . ARG A 1 82  ? -26.558 2.052   -6.246  1.00 0.00 ? 82  ARG A C    5  
ATOM 10640 O O    . ARG A 1 82  ? -27.369 1.887   -7.156  1.00 0.00 ? 82  ARG A O    5  
ATOM 10641 C CB   . ARG A 1 82  ? -27.253 3.501   -4.338  1.00 0.00 ? 82  ARG A CB   5  
ATOM 10642 C CG   . ARG A 1 82  ? -28.664 3.676   -3.771  1.00 0.00 ? 82  ARG A CG   5  
ATOM 10643 C CD   . ARG A 1 82  ? -28.663 3.536   -2.248  1.00 0.00 ? 82  ARG A CD   5  
ATOM 10644 N NE   . ARG A 1 82  ? -30.051 3.548   -1.737  1.00 0.00 ? 82  ARG A NE   5  
ATOM 10645 C CZ   . ARG A 1 82  ? -30.826 4.641   -1.691  1.00 0.00 ? 82  ARG A CZ   5  
ATOM 10646 N NH1  . ARG A 1 82  ? -30.351 5.816   -2.124  1.00 0.00 ? 82  ARG A NH1  5  
ATOM 10647 N NH2  . ARG A 1 82  ? -32.075 4.558   -1.212  1.00 0.00 ? 82  ARG A NH2  5  
ATOM 10648 H H    . ARG A 1 82  ? -25.653 1.971   -3.216  1.00 0.00 ? 82  ARG A H    5  
ATOM 10649 H HA   . ARG A 1 82  ? -27.927 1.469   -4.661  1.00 0.00 ? 82  ARG A HA   5  
ATOM 10650 H HB2  . ARG A 1 82  ? -26.517 3.776   -3.584  1.00 0.00 ? 82  ARG A HB2  5  
ATOM 10651 H HB3  . ARG A 1 82  ? -27.111 4.175   -5.183  1.00 0.00 ? 82  ARG A HB3  5  
ATOM 10652 H HG2  . ARG A 1 82  ? -29.053 4.655   -4.050  1.00 0.00 ? 82  ARG A HG2  5  
ATOM 10653 H HG3  . ARG A 1 82  ? -29.330 2.931   -4.207  1.00 0.00 ? 82  ARG A HG3  5  
ATOM 10654 H HD2  . ARG A 1 82  ? -28.169 2.609   -1.959  1.00 0.00 ? 82  ARG A HD2  5  
ATOM 10655 H HD3  . ARG A 1 82  ? -28.095 4.352   -1.799  1.00 0.00 ? 82  ARG A HD3  5  
ATOM 10656 H HE   . ARG A 1 82  ? -30.437 2.687   -1.405  1.00 0.00 ? 82  ARG A HE   5  
ATOM 10657 H HH11 . ARG A 1 82  ? -29.420 5.879   -2.482  1.00 0.00 ? 82  ARG A HH11 5  
ATOM 10658 H HH12 . ARG A 1 82  ? -30.930 6.632   -2.090  1.00 0.00 ? 82  ARG A HH12 5  
ATOM 10659 H HH21 . ARG A 1 82  ? -32.428 3.681   -0.888  1.00 0.00 ? 82  ARG A HH21 5  
ATOM 10660 H HH22 . ARG A 1 82  ? -32.652 5.373   -1.178  1.00 0.00 ? 82  ARG A HH22 5  
ATOM 10661 N N    . LEU A 1 83  ? -25.257 2.234   -6.424  1.00 0.00 ? 83  LEU A N    5  
ATOM 10662 C CA   . LEU A 1 83  ? -24.680 2.253   -7.756  1.00 0.00 ? 83  LEU A CA   5  
ATOM 10663 C C    . LEU A 1 83  ? -24.680 0.834   -8.328  1.00 0.00 ? 83  LEU A C    5  
ATOM 10664 O O    . LEU A 1 83  ? -25.219 0.595   -9.407  1.00 0.00 ? 83  LEU A O    5  
ATOM 10665 C CB   . LEU A 1 83  ? -23.296 2.905   -7.731  1.00 0.00 ? 83  LEU A CB   5  
ATOM 10666 C CG   . LEU A 1 83  ? -23.266 4.403   -7.420  1.00 0.00 ? 83  LEU A CG   5  
ATOM 10667 C CD1  . LEU A 1 83  ? -22.072 4.754   -6.530  1.00 0.00 ? 83  LEU A CD1  5  
ATOM 10668 C CD2  . LEU A 1 83  ? -23.286 5.231   -8.707  1.00 0.00 ? 83  LEU A CD2  5  
ATOM 10669 H H    . LEU A 1 83  ? -24.605 2.367   -5.678  1.00 0.00 ? 83  LEU A H    5  
ATOM 10670 H HA   . LEU A 1 83  ? -25.319 2.877   -8.381  1.00 0.00 ? 83  LEU A HA   5  
ATOM 10671 H HB2  . LEU A 1 83  ? -22.686 2.388   -6.991  1.00 0.00 ? 83  LEU A HB2  5  
ATOM 10672 H HB3  . LEU A 1 83  ? -22.824 2.746   -8.700  1.00 0.00 ? 83  LEU A HB3  5  
ATOM 10673 H HG   . LEU A 1 83  ? -24.168 4.654   -6.861  1.00 0.00 ? 83  LEU A HG   5  
ATOM 10674 H HD11 . LEU A 1 83  ? -21.969 4.002   -5.748  1.00 0.00 ? 83  LEU A HD11 5  
ATOM 10675 H HD12 . LEU A 1 83  ? -21.164 4.778   -7.133  1.00 0.00 ? 83  LEU A HD12 5  
ATOM 10676 H HD13 . LEU A 1 83  ? -22.232 5.732   -6.077  1.00 0.00 ? 83  LEU A HD13 5  
ATOM 10677 H HD21 . LEU A 1 83  ? -23.013 4.598   -9.550  1.00 0.00 ? 83  LEU A HD21 5  
ATOM 10678 H HD22 . LEU A 1 83  ? -24.286 5.634   -8.863  1.00 0.00 ? 83  LEU A HD22 5  
ATOM 10679 H HD23 . LEU A 1 83  ? -22.573 6.051   -8.622  1.00 0.00 ? 83  LEU A HD23 5  
ATOM 10680 N N    . HIS A 1 84  ? -24.070 -0.072  -7.578  1.00 0.00 ? 84  HIS A N    5  
ATOM 10681 C CA   . HIS A 1 84  ? -23.993 -1.461  -7.995  1.00 0.00 ? 84  HIS A CA   5  
ATOM 10682 C C    . HIS A 1 84  ? -24.795 -2.334  -7.027  1.00 0.00 ? 84  HIS A C    5  
ATOM 10683 O O    . HIS A 1 84  ? -24.268 -2.788  -6.014  1.00 0.00 ? 84  HIS A O    5  
ATOM 10684 C CB   . HIS A 1 84  ? -22.537 -1.909  -8.129  1.00 0.00 ? 84  HIS A CB   5  
ATOM 10685 C CG   . HIS A 1 84  ? -21.589 -0.805  -8.534  1.00 0.00 ? 84  HIS A CG   5  
ATOM 10686 N ND1  . HIS A 1 84  ? -21.000 -0.744  -9.785  1.00 0.00 ? 84  HIS A ND1  5  
ATOM 10687 C CD2  . HIS A 1 84  ? -21.136 0.280   -7.842  1.00 0.00 ? 84  HIS A CD2  5  
ATOM 10688 C CE1  . HIS A 1 84  ? -20.228 0.333   -9.832  1.00 0.00 ? 84  HIS A CE1  5  
ATOM 10689 N NE2  . HIS A 1 84  ? -20.315 0.965   -8.626  1.00 0.00 ? 84  HIS A NE2  5  
ATOM 10690 H H    . HIS A 1 84  ? -23.634 0.130   -6.701  1.00 0.00 ? 84  HIS A H    5  
ATOM 10691 H HA   . HIS A 1 84  ? -24.450 -1.516  -8.985  1.00 0.00 ? 84  HIS A HA   5  
ATOM 10692 H HB2  . HIS A 1 84  ? -22.206 -2.326  -7.177  1.00 0.00 ? 84  HIS A HB2  5  
ATOM 10693 H HB3  . HIS A 1 84  ? -22.479 -2.710  -8.865  1.00 0.00 ? 84  HIS A HB3  5  
ATOM 10694 H HD1  . HIS A 1 84  ? -21.133 -1.401  -10.527 1.00 0.00 ? 84  HIS A HD1  5  
ATOM 10695 H HD2  . HIS A 1 84  ? -21.406 0.539   -6.817  1.00 0.00 ? 84  HIS A HD2  5  
ATOM 10696 H HE1  . HIS A 1 84  ? -19.631 0.657   -10.683 1.00 0.00 ? 84  HIS A HE1  5  
ATOM 10697 H HE2  . HIS A 1 84  ? -19.882 1.837   -8.394  1.00 0.00 ? 84  HIS A HE2  5  
ATOM 10698 N N    . PRO A 1 85  ? -26.090 -2.547  -7.385  1.00 0.00 ? 85  PRO A N    5  
ATOM 10699 C CA   . PRO A 1 85  ? -26.970 -3.357  -6.560  1.00 0.00 ? 85  PRO A CA   5  
ATOM 10700 C C    . PRO A 1 85  ? -26.647 -4.845  -6.710  1.00 0.00 ? 85  PRO A C    5  
ATOM 10701 O O    . PRO A 1 85  ? -27.476 -5.618  -7.188  1.00 0.00 ? 85  PRO A O    5  
ATOM 10702 C CB   . PRO A 1 85  ? -28.375 -3.005  -7.020  1.00 0.00 ? 85  PRO A CB   5  
ATOM 10703 C CG   . PRO A 1 85  ? -28.217 -2.366  -8.389  1.00 0.00 ? 85  PRO A CG   5  
ATOM 10704 C CD   . PRO A 1 85  ? -26.748 -2.025  -8.578  1.00 0.00 ? 85  PRO A CD   5  
ATOM 10705 H HA   . PRO A 1 85  ? -26.832 -3.144  -5.592  1.00 0.00 ? 85  PRO A HA   5  
ATOM 10706 H HB2  . PRO A 1 85  ? -29.004 -3.894  -7.073  1.00 0.00 ? 85  PRO A HB2  5  
ATOM 10707 H HB3  . PRO A 1 85  ? -28.854 -2.318  -6.321  1.00 0.00 ? 85  PRO A HB3  5  
ATOM 10708 H HG2  . PRO A 1 85  ? -28.554 -3.048  -9.170  1.00 0.00 ? 85  PRO A HG2  5  
ATOM 10709 H HG3  . PRO A 1 85  ? -28.831 -1.468  -8.465  1.00 0.00 ? 85  PRO A HG3  5  
ATOM 10710 H HD2  . PRO A 1 85  ? -26.349 -2.483  -9.483  1.00 0.00 ? 85  PRO A HD2  5  
ATOM 10711 H HD3  . PRO A 1 85  ? -26.600 -0.949  -8.674  1.00 0.00 ? 85  PRO A HD3  5  
ATOM 10712 N N    . VAL A 1 86  ? -25.441 -5.201  -6.293  1.00 0.00 ? 86  VAL A N    5  
ATOM 10713 C CA   . VAL A 1 86  ? -24.998 -6.582  -6.375  1.00 0.00 ? 86  VAL A CA   5  
ATOM 10714 C C    . VAL A 1 86  ? -26.159 -7.508  -6.003  1.00 0.00 ? 86  VAL A C    5  
ATOM 10715 O O    . VAL A 1 86  ? -26.936 -7.203  -5.100  1.00 0.00 ? 86  VAL A O    5  
ATOM 10716 C CB   . VAL A 1 86  ? -23.763 -6.789  -5.497  1.00 0.00 ? 86  VAL A CB   5  
ATOM 10717 C CG1  . VAL A 1 86  ? -23.366 -8.266  -5.449  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 10718 C CG2  . VAL A 1 86  ? -22.597 -5.923  -5.978  1.00 0.00 ? 86  VAL A CG2  5  
ATOM 10719 H H    . VAL A 1 86  ? -24.773 -4.565  -5.905  1.00 0.00 ? 86  VAL A H    5  
ATOM 10720 H HA   . VAL A 1 86  ? -24.713 -6.776  -7.410  1.00 0.00 ? 86  VAL A HA   5  
ATOM 10721 H HB   . VAL A 1 86  ? -24.016 -6.478  -4.484  1.00 0.00 ? 86  VAL A HB   5  
ATOM 10722 H HG11 . VAL A 1 86  ? -24.264 -8.885  -5.447  1.00 0.00 ? 86  VAL A HG11 5  
ATOM 10723 H HG12 . VAL A 1 86  ? -22.760 -8.509  -6.322  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 10724 H HG13 . VAL A 1 86  ? -22.790 -8.458  -4.544  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 10725 H HG21 . VAL A 1 86  ? -22.953 -5.222  -6.732  1.00 0.00 ? 86  VAL A HG21 5  
ATOM 10726 H HG22 . VAL A 1 86  ? -22.183 -5.372  -5.134  1.00 0.00 ? 86  VAL A HG22 5  
ATOM 10727 H HG23 . VAL A 1 86  ? -21.825 -6.560  -6.409  1.00 0.00 ? 86  VAL A HG23 5  
ATOM 10728 N N    . HIS A 1 87  ? -26.238 -8.621  -6.719  1.00 0.00 ? 87  HIS A N    5  
ATOM 10729 C CA   . HIS A 1 87  ? -27.291 -9.593  -6.474  1.00 0.00 ? 87  HIS A CA   5  
ATOM 10730 C C    . HIS A 1 87  ? -27.169 -10.743 -7.476  1.00 0.00 ? 87  HIS A C    5  
ATOM 10731 O O    . HIS A 1 87  ? -28.098 -11.010 -8.236  1.00 0.00 ? 87  HIS A O    5  
ATOM 10732 C CB   . HIS A 1 87  ? -28.666 -8.924  -6.505  1.00 0.00 ? 87  HIS A CB   5  
ATOM 10733 C CG   . HIS A 1 87  ? -29.406 -8.981  -5.189  1.00 0.00 ? 87  HIS A CG   5  
ATOM 10734 N ND1  . HIS A 1 87  ? -29.948 -10.150 -4.684  1.00 0.00 ? 87  HIS A ND1  5  
ATOM 10735 C CD2  . HIS A 1 87  ? -29.687 -8.003  -4.281  1.00 0.00 ? 87  HIS A CD2  5  
ATOM 10736 C CE1  . HIS A 1 87  ? -30.527 -9.876  -3.525  1.00 0.00 ? 87  HIS A CE1  5  
ATOM 10737 N NE2  . HIS A 1 87  ? -30.365 -8.544  -3.277  1.00 0.00 ? 87  HIS A NE2  5  
ATOM 10738 H H    . HIS A 1 87  ? -25.602 -8.862  -7.451  1.00 0.00 ? 87  HIS A H    5  
ATOM 10739 H HA   . HIS A 1 87  ? -27.131 -9.980  -5.468  1.00 0.00 ? 87  HIS A HA   5  
ATOM 10740 H HB2  . HIS A 1 87  ? -28.545 -7.881  -6.796  1.00 0.00 ? 87  HIS A HB2  5  
ATOM 10741 H HB3  . HIS A 1 87  ? -29.274 -9.402  -7.272  1.00 0.00 ? 87  HIS A HB3  5  
ATOM 10742 H HD1  . HIS A 1 87  ? -29.909 -11.050 -5.120  1.00 0.00 ? 87  HIS A HD1  5  
ATOM 10743 H HD2  . HIS A 1 87  ? -29.402 -6.954  -4.367  1.00 0.00 ? 87  HIS A HD2  5  
ATOM 10744 H HE1  . HIS A 1 87  ? -31.043 -10.589 -2.881  1.00 0.00 ? 87  HIS A HE1  5  
ATOM 10745 H HE2  . HIS A 1 87  ? -30.650 -8.068  -2.445  1.00 0.00 ? 87  HIS A HE2  5  
ATOM 10746 N N    . ALA A 1 88  ? -26.014 -11.393 -7.445  1.00 0.00 ? 88  ALA A N    5  
ATOM 10747 C CA   . ALA A 1 88  ? -25.759 -12.509 -8.340  1.00 0.00 ? 88  ALA A CA   5  
ATOM 10748 C C    . ALA A 1 88  ? -26.730 -13.647 -8.020  1.00 0.00 ? 88  ALA A C    5  
ATOM 10749 O O    . ALA A 1 88  ? -27.540 -13.536 -7.101  1.00 0.00 ? 88  ALA A O    5  
ATOM 10750 C CB   . ALA A 1 88  ? -24.296 -12.939 -8.216  1.00 0.00 ? 88  ALA A CB   5  
ATOM 10751 H H    . ALA A 1 88  ? -25.264 -11.170 -6.824  1.00 0.00 ? 88  ALA A H    5  
ATOM 10752 H HA   . ALA A 1 88  ? -25.938 -12.164 -9.359  1.00 0.00 ? 88  ALA A HA   5  
ATOM 10753 H HB1  . ALA A 1 88  ? -23.665 -12.056 -8.114  1.00 0.00 ? 88  ALA A HB1  5  
ATOM 10754 H HB2  . ALA A 1 88  ? -24.003 -13.493 -9.107  1.00 0.00 ? 88  ALA A HB2  5  
ATOM 10755 H HB3  . ALA A 1 88  ? -24.177 -13.572 -7.337  1.00 0.00 ? 88  ALA A HB3  5  
ATOM 10756 N N    . GLY A 1 89  ? -26.616 -14.714 -8.797  1.00 0.00 ? 89  GLY A N    5  
ATOM 10757 C CA   . GLY A 1 89  ? -27.474 -15.871 -8.607  1.00 0.00 ? 89  GLY A CA   5  
ATOM 10758 C C    . GLY A 1 89  ? -26.996 -16.722 -7.429  1.00 0.00 ? 89  GLY A C    5  
ATOM 10759 O O    . GLY A 1 89  ? -26.545 -16.190 -6.416  1.00 0.00 ? 89  GLY A O    5  
ATOM 10760 H H    . GLY A 1 89  ? -25.954 -14.796 -9.541  1.00 0.00 ? 89  GLY A H    5  
ATOM 10761 H HA2  . GLY A 1 89  ? -28.499 -15.544 -8.431  1.00 0.00 ? 89  GLY A HA2  5  
ATOM 10762 H HA3  . GLY A 1 89  ? -27.484 -16.474 -9.515  1.00 0.00 ? 89  GLY A HA3  5  
ATOM 10763 N N    . PRO A 1 90  ? -27.112 -18.066 -7.606  1.00 0.00 ? 90  PRO A N    5  
ATOM 10764 C CA   . PRO A 1 90  ? -26.696 -18.996 -6.570  1.00 0.00 ? 90  PRO A CA   5  
ATOM 10765 C C    . PRO A 1 90  ? -25.171 -19.102 -6.508  1.00 0.00 ? 90  PRO A C    5  
ATOM 10766 O O    . PRO A 1 90  ? -24.604 -20.143 -6.836  1.00 0.00 ? 90  PRO A O    5  
ATOM 10767 C CB   . PRO A 1 90  ? -27.369 -20.311 -6.929  1.00 0.00 ? 90  PRO A CB   5  
ATOM 10768 C CG   . PRO A 1 90  ? -27.756 -20.195 -8.395  1.00 0.00 ? 90  PRO A CG   5  
ATOM 10769 C CD   . PRO A 1 90  ? -27.641 -18.733 -8.792  1.00 0.00 ? 90  PRO A CD   5  
ATOM 10770 H HA   . PRO A 1 90  ? -26.984 -18.666 -5.671  1.00 0.00 ? 90  PRO A HA   5  
ATOM 10771 H HB2  . PRO A 1 90  ? -26.694 -21.152 -6.769  1.00 0.00 ? 90  PRO A HB2  5  
ATOM 10772 H HB3  . PRO A 1 90  ? -28.246 -20.484 -6.306  1.00 0.00 ? 90  PRO A HB3  5  
ATOM 10773 H HG2  . PRO A 1 90  ? -27.102 -20.811 -9.011  1.00 0.00 ? 90  PRO A HG2  5  
ATOM 10774 H HG3  . PRO A 1 90  ? -28.773 -20.555 -8.550  1.00 0.00 ? 90  PRO A HG3  5  
ATOM 10775 H HD2  . PRO A 1 90  ? -26.977 -18.606 -9.647  1.00 0.00 ? 90  PRO A HD2  5  
ATOM 10776 H HD3  . PRO A 1 90  ? -28.609 -18.323 -9.078  1.00 0.00 ? 90  PRO A HD3  5  
ATOM 10777 N N    . ILE A 1 91  ? -24.551 -18.010 -6.086  1.00 0.00 ? 91  ILE A N    5  
ATOM 10778 C CA   . ILE A 1 91  ? -23.102 -17.968 -5.976  1.00 0.00 ? 91  ILE A CA   5  
ATOM 10779 C C    . ILE A 1 91  ? -22.688 -18.406 -4.571  1.00 0.00 ? 91  ILE A C    5  
ATOM 10780 O O    . ILE A 1 91  ? -23.302 -18.003 -3.584  1.00 0.00 ? 91  ILE A O    5  
ATOM 10781 C CB   . ILE A 1 91  ? -22.577 -16.586 -6.370  1.00 0.00 ? 91  ILE A CB   5  
ATOM 10782 C CG1  . ILE A 1 91  ? -21.199 -16.690 -7.028  1.00 0.00 ? 91  ILE A CG1  5  
ATOM 10783 C CG2  . ILE A 1 91  ? -22.567 -15.640 -5.167  1.00 0.00 ? 91  ILE A CG2  5  
ATOM 10784 C CD1  . ILE A 1 91  ? -20.616 -15.302 -7.303  1.00 0.00 ? 91  ILE A CD1  5  
ATOM 10785 H H    . ILE A 1 91  ? -25.020 -17.168 -5.821  1.00 0.00 ? 91  ILE A H    5  
ATOM 10786 H HA   . ILE A 1 91  ? -22.700 -18.681 -6.695  1.00 0.00 ? 91  ILE A HA   5  
ATOM 10787 H HB   . ILE A 1 91  ? -23.255 -16.159 -7.108  1.00 0.00 ? 91  ILE A HB   5  
ATOM 10788 H HG12 . ILE A 1 91  ? -20.524 -17.250 -6.380  1.00 0.00 ? 91  ILE A HG12 5  
ATOM 10789 H HG13 . ILE A 1 91  ? -21.280 -17.246 -7.962  1.00 0.00 ? 91  ILE A HG13 5  
ATOM 10790 H HG21 . ILE A 1 91  ? -23.471 -15.792 -4.578  1.00 0.00 ? 91  ILE A HG21 5  
ATOM 10791 H HG22 . ILE A 1 91  ? -21.693 -15.847 -4.549  1.00 0.00 ? 91  ILE A HG22 5  
ATOM 10792 H HG23 . ILE A 1 91  ? -22.529 -14.608 -5.516  1.00 0.00 ? 91  ILE A HG23 5  
ATOM 10793 H HD11 . ILE A 1 91  ? -21.396 -14.653 -7.700  1.00 0.00 ? 91  ILE A HD11 5  
ATOM 10794 H HD12 . ILE A 1 91  ? -20.229 -14.881 -6.375  1.00 0.00 ? 91  ILE A HD12 5  
ATOM 10795 H HD13 . ILE A 1 91  ? -19.808 -15.386 -8.030  1.00 0.00 ? 91  ILE A HD13 5  
ATOM 10796 N N    . ALA A 1 92  ? -21.649 -19.226 -4.524  1.00 0.00 ? 92  ALA A N    5  
ATOM 10797 C CA   . ALA A 1 92  ? -21.145 -19.724 -3.254  1.00 0.00 ? 92  ALA A CA   5  
ATOM 10798 C C    . ALA A 1 92  ? -20.698 -18.544 -2.390  1.00 0.00 ? 92  ALA A C    5  
ATOM 10799 O O    . ALA A 1 92  ? -20.326 -17.493 -2.911  1.00 0.00 ? 92  ALA A O    5  
ATOM 10800 C CB   . ALA A 1 92  ? -20.013 -20.720 -3.510  1.00 0.00 ? 92  ALA A CB   5  
ATOM 10801 H H    . ALA A 1 92  ? -21.155 -19.549 -5.331  1.00 0.00 ? 92  ALA A H    5  
ATOM 10802 H HA   . ALA A 1 92  ? -21.962 -20.243 -2.754  1.00 0.00 ? 92  ALA A HA   5  
ATOM 10803 H HB1  . ALA A 1 92  ? -20.026 -21.025 -4.557  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 10804 H HB2  . ALA A 1 92  ? -19.056 -20.250 -3.281  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 10805 H HB3  . ALA A 1 92  ? -20.148 -21.596 -2.875  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 10806 N N    . PRO A 1 93  ? -20.752 -18.761 -1.048  1.00 0.00 ? 93  PRO A N    5  
ATOM 10807 C CA   . PRO A 1 93  ? -20.358 -17.728 -0.106  1.00 0.00 ? 93  PRO A CA   5  
ATOM 10808 C C    . PRO A 1 93  ? -18.835 -17.583 -0.057  1.00 0.00 ? 93  PRO A C    5  
ATOM 10809 O O    . PRO A 1 93  ? -18.178 -18.187 0.790   1.00 0.00 ? 93  PRO A O    5  
ATOM 10810 C CB   . PRO A 1 93  ? -20.958 -18.158 1.223   1.00 0.00 ? 93  PRO A CB   5  
ATOM 10811 C CG   . PRO A 1 93  ? -21.267 -19.639 1.081   1.00 0.00 ? 93  PRO A CG   5  
ATOM 10812 C CD   . PRO A 1 93  ? -21.188 -19.992 -0.396  1.00 0.00 ? 93  PRO A CD   5  
ATOM 10813 H HA   . PRO A 1 93  ? -20.708 -16.838 -0.400  1.00 0.00 ? 93  PRO A HA   5  
ATOM 10814 H HB2  . PRO A 1 93  ? -20.259 -17.982 2.041   1.00 0.00 ? 93  PRO A HB2  5  
ATOM 10815 H HB3  . PRO A 1 93  ? -21.860 -17.589 1.446   1.00 0.00 ? 93  PRO A HB3  5  
ATOM 10816 H HG2  . PRO A 1 93  ? -20.556 -20.235 1.654   1.00 0.00 ? 93  PRO A HG2  5  
ATOM 10817 H HG3  . PRO A 1 93  ? -22.258 -19.861 1.474   1.00 0.00 ? 93  PRO A HG3  5  
ATOM 10818 H HD2  . PRO A 1 93  ? -20.483 -20.804 -0.572  1.00 0.00 ? 93  PRO A HD2  5  
ATOM 10819 H HD3  . PRO A 1 93  ? -22.155 -20.321 -0.776  1.00 0.00 ? 93  PRO A HD3  5  
ATOM 10820 N N    . GLY A 1 94  ? -18.320 -16.777 -0.974  1.00 0.00 ? 94  GLY A N    5  
ATOM 10821 C CA   . GLY A 1 94  ? -16.887 -16.545 -1.045  1.00 0.00 ? 94  GLY A CA   5  
ATOM 10822 C C    . GLY A 1 94  ? -16.367 -16.765 -2.467  1.00 0.00 ? 94  GLY A C    5  
ATOM 10823 O O    . GLY A 1 94  ? -15.175 -16.606 -2.727  1.00 0.00 ? 94  GLY A O    5  
ATOM 10824 H H    . GLY A 1 94  ? -18.862 -16.289 -1.658  1.00 0.00 ? 94  GLY A H    5  
ATOM 10825 H HA2  . GLY A 1 94  ? -16.664 -15.528 -0.725  1.00 0.00 ? 94  GLY A HA2  5  
ATOM 10826 H HA3  . GLY A 1 94  ? -16.372 -17.216 -0.357  1.00 0.00 ? 94  GLY A HA3  5  
ATOM 10827 N N    . GLN A 1 95  ? -17.285 -17.127 -3.350  1.00 0.00 ? 95  GLN A N    5  
ATOM 10828 C CA   . GLN A 1 95  ? -16.934 -17.369 -4.739  1.00 0.00 ? 95  GLN A CA   5  
ATOM 10829 C C    . GLN A 1 95  ? -16.720 -16.044 -5.472  1.00 0.00 ? 95  GLN A C    5  
ATOM 10830 O O    . GLN A 1 95  ? -17.355 -15.785 -6.494  1.00 0.00 ? 95  GLN A O    5  
ATOM 10831 C CB   . GLN A 1 95  ? -18.003 -18.215 -5.435  1.00 0.00 ? 95  GLN A CB   5  
ATOM 10832 C CG   . GLN A 1 95  ? -17.533 -19.661 -5.603  1.00 0.00 ? 95  GLN A CG   5  
ATOM 10833 C CD   . GLN A 1 95  ? -17.444 -20.041 -7.082  1.00 0.00 ? 95  GLN A CD   5  
ATOM 10834 O OE1  . GLN A 1 95  ? -17.324 -19.200 -7.959  1.00 0.00 ? 95  GLN A OE1  5  
ATOM 10835 N NE2  . GLN A 1 95  ? -17.508 -21.349 -7.310  1.00 0.00 ? 95  GLN A NE2  5  
ATOM 10836 H H    . GLN A 1 95  ? -18.253 -17.253 -3.131  1.00 0.00 ? 95  GLN A H    5  
ATOM 10837 H HA   . GLN A 1 95  ? -15.999 -17.930 -4.707  1.00 0.00 ? 95  GLN A HA   5  
ATOM 10838 H HB2  . GLN A 1 95  ? -18.925 -18.192 -4.855  1.00 0.00 ? 95  GLN A HB2  5  
ATOM 10839 H HB3  . GLN A 1 95  ? -18.231 -17.787 -6.411  1.00 0.00 ? 95  GLN A HB3  5  
ATOM 10840 H HG2  . GLN A 1 95  ? -16.559 -19.789 -5.131  1.00 0.00 ? 95  GLN A HG2  5  
ATOM 10841 H HG3  . GLN A 1 95  ? -18.224 -20.333 -5.093  1.00 0.00 ? 95  GLN A HG3  5  
ATOM 10842 H HE21 . GLN A 1 95  ? -17.606 -21.986 -6.545  1.00 0.00 ? 95  GLN A HE21 5  
ATOM 10843 H HE22 . GLN A 1 95  ? -17.458 -21.696 -8.246  1.00 0.00 ? 95  GLN A HE22 5  
ATOM 10844 N N    . MET A 1 96  ? -15.824 -15.237 -4.921  1.00 0.00 ? 96  MET A N    5  
ATOM 10845 C CA   . MET A 1 96  ? -15.520 -13.944 -5.510  1.00 0.00 ? 96  MET A CA   5  
ATOM 10846 C C    . MET A 1 96  ? -16.774 -13.304 -6.109  1.00 0.00 ? 96  MET A C    5  
ATOM 10847 O O    . MET A 1 96  ? -17.005 -13.392 -7.314  1.00 0.00 ? 96  MET A O    5  
ATOM 10848 C CB   . MET A 1 96  ? -14.463 -14.118 -6.603  1.00 0.00 ? 96  MET A CB   5  
ATOM 10849 C CG   . MET A 1 96  ? -13.948 -12.761 -7.088  1.00 0.00 ? 96  MET A CG   5  
ATOM 10850 S SD   . MET A 1 96  ? -12.167 -12.709 -6.978  1.00 0.00 ? 96  MET A SD   5  
ATOM 10851 C CE   . MET A 1 96  ? -11.925 -10.966 -6.677  1.00 0.00 ? 96  MET A CE   5  
ATOM 10852 H H    . MET A 1 96  ? -15.313 -15.454 -4.090  1.00 0.00 ? 96  MET A H    5  
ATOM 10853 H HA   . MET A 1 96  ? -15.146 -13.330 -4.690  1.00 0.00 ? 96  MET A HA   5  
ATOM 10854 H HB2  . MET A 1 96  ? -13.632 -14.710 -6.220  1.00 0.00 ? 96  MET A HB2  5  
ATOM 10855 H HB3  . MET A 1 96  ? -14.889 -14.669 -7.441  1.00 0.00 ? 96  MET A HB3  5  
ATOM 10856 H HG2  . MET A 1 96  ? -14.262 -12.589 -8.117  1.00 0.00 ? 96  MET A HG2  5  
ATOM 10857 H HG3  . MET A 1 96  ? -14.381 -11.961 -6.485  1.00 0.00 ? 96  MET A HG3  5  
ATOM 10858 H HE1  . MET A 1 96  ? -12.444 -10.390 -7.443  1.00 0.00 ? 96  MET A HE1  5  
ATOM 10859 H HE2  . MET A 1 96  ? -12.323 -10.709 -5.696  1.00 0.00 ? 96  MET A HE2  5  
ATOM 10860 H HE3  . MET A 1 96  ? -10.860 -10.737 -6.709  1.00 0.00 ? 96  MET A HE3  5  
ATOM 10861 N N    . ARG A 1 97  ? -17.551 -12.674 -5.239  1.00 0.00 ? 97  ARG A N    5  
ATOM 10862 C CA   . ARG A 1 97  ? -18.775 -12.020 -5.667  1.00 0.00 ? 97  ARG A CA   5  
ATOM 10863 C C    . ARG A 1 97  ? -18.583 -10.502 -5.700  1.00 0.00 ? 97  ARG A C    5  
ATOM 10864 O O    . ARG A 1 97  ? -17.803 -9.955  -4.921  1.00 0.00 ? 97  ARG A O    5  
ATOM 10865 C CB   . ARG A 1 97  ? -19.937 -12.361 -4.732  1.00 0.00 ? 97  ARG A CB   5  
ATOM 10866 C CG   . ARG A 1 97  ? -21.262 -11.838 -5.292  1.00 0.00 ? 97  ARG A CG   5  
ATOM 10867 C CD   . ARG A 1 97  ? -22.440 -12.299 -4.430  1.00 0.00 ? 97  ARG A CD   5  
ATOM 10868 N NE   . ARG A 1 97  ? -22.679 -11.327 -3.339  1.00 0.00 ? 97  ARG A NE   5  
ATOM 10869 C CZ   . ARG A 1 97  ? -22.046 -11.353 -2.159  1.00 0.00 ? 97  ARG A CZ   5  
ATOM 10870 N NH1  . ARG A 1 97  ? -21.132 -12.301 -1.909  1.00 0.00 ? 97  ARG A NH1  5  
ATOM 10871 N NH2  . ARG A 1 97  ? -22.327 -10.432 -1.227  1.00 0.00 ? 97  ARG A NH2  5  
ATOM 10872 H H    . ARG A 1 97  ? -17.355 -12.607 -4.261  1.00 0.00 ? 97  ARG A H    5  
ATOM 10873 H HA   . ARG A 1 97  ? -18.966 -12.412 -6.666  1.00 0.00 ? 97  ARG A HA   5  
ATOM 10874 H HB2  . ARG A 1 97  ? -19.996 -13.440 -4.597  1.00 0.00 ? 97  ARG A HB2  5  
ATOM 10875 H HB3  . ARG A 1 97  ? -19.757 -11.925 -3.749  1.00 0.00 ? 97  ARG A HB3  5  
ATOM 10876 H HG2  . ARG A 1 97  ? -21.240 -10.749 -5.332  1.00 0.00 ? 97  ARG A HG2  5  
ATOM 10877 H HG3  . ARG A 1 97  ? -21.395 -12.192 -6.314  1.00 0.00 ? 97  ARG A HG3  5  
ATOM 10878 H HD2  . ARG A 1 97  ? -23.335 -12.394 -5.045  1.00 0.00 ? 97  ARG A HD2  5  
ATOM 10879 H HD3  . ARG A 1 97  ? -22.233 -13.284 -4.013  1.00 0.00 ? 97  ARG A HD3  5  
ATOM 10880 H HE   . ARG A 1 97  ? -23.355 -10.607 -3.493  1.00 0.00 ? 97  ARG A HE   5  
ATOM 10881 H HH11 . ARG A 1 97  ? -20.922 -12.989 -2.604  1.00 0.00 ? 97  ARG A HH11 5  
ATOM 10882 H HH12 . ARG A 1 97  ? -20.659 -12.321 -1.028  1.00 0.00 ? 97  ARG A HH12 5  
ATOM 10883 H HH21 . ARG A 1 97  ? -23.009 -9.725  -1.413  1.00 0.00 ? 97  ARG A HH21 5  
ATOM 10884 H HH22 . ARG A 1 97  ? -21.854 -10.452 -0.346  1.00 0.00 ? 97  ARG A HH22 5  
ATOM 10885 N N    . GLU A 1 98  ? -19.307 -9.865  -6.608  1.00 0.00 ? 98  GLU A N    5  
ATOM 10886 C CA   . GLU A 1 98  ? -19.226 -8.422  -6.751  1.00 0.00 ? 98  GLU A CA   5  
ATOM 10887 C C    . GLU A 1 98  ? -19.590 -7.736  -5.434  1.00 0.00 ? 98  GLU A C    5  
ATOM 10888 O O    . GLU A 1 98  ? -20.731 -7.821  -4.980  1.00 0.00 ? 98  GLU A O    5  
ATOM 10889 C CB   . GLU A 1 98  ? -20.123 -7.932  -7.890  1.00 0.00 ? 98  GLU A CB   5  
ATOM 10890 C CG   . GLU A 1 98  ? -19.638 -8.467  -9.240  1.00 0.00 ? 98  GLU A CG   5  
ATOM 10891 C CD   . GLU A 1 98  ? -18.671 -7.485  -9.902  1.00 0.00 ? 98  GLU A CD   5  
ATOM 10892 O OE1  . GLU A 1 98  ? -19.173 -6.570  -10.590 1.00 0.00 ? 98  GLU A OE1  5  
ATOM 10893 O OE2  . GLU A 1 98  ? -17.450 -7.670  -9.706  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 10894 H H    . GLU A 1 98  ? -19.938 -10.318 -7.238  1.00 0.00 ? 98  GLU A H    5  
ATOM 10895 H HA   . GLU A 1 98  ? -18.186 -8.213  -7.003  1.00 0.00 ? 98  GLU A HA   5  
ATOM 10896 H HB2  . GLU A 1 98  ? -21.149 -8.257  -7.714  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 10897 H HB3  . GLU A 1 98  ? -20.133 -6.843  -7.909  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 10898 H HG2  . GLU A 1 98  ? -19.145 -9.429  -9.098  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 10899 H HG3  . GLU A 1 98  ? -20.491 -8.640  -9.894  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 10900 N N    . PRO A 1 99  ? -18.574 -7.054  -4.840  1.00 0.00 ? 99  PRO A N    5  
ATOM 10901 C CA   . PRO A 1 99  ? -18.776 -6.354  -3.583  1.00 0.00 ? 99  PRO A CA   5  
ATOM 10902 C C    . PRO A 1 99  ? -19.564 -5.060  -3.796  1.00 0.00 ? 99  PRO A C    5  
ATOM 10903 O O    . PRO A 1 99  ? -19.497 -4.458  -4.866  1.00 0.00 ? 99  PRO A O    5  
ATOM 10904 C CB   . PRO A 1 99  ? -17.377 -6.113  -3.038  1.00 0.00 ? 99  PRO A CB   5  
ATOM 10905 C CG   . PRO A 1 99  ? -16.435 -6.270  -4.221  1.00 0.00 ? 99  PRO A CG   5  
ATOM 10906 C CD   . PRO A 1 99  ? -17.210 -6.932  -5.349  1.00 0.00 ? 99  PRO A CD   5  
ATOM 10907 H HA   . PRO A 1 99  ? -19.326 -6.910  -2.960  1.00 0.00 ? 99  PRO A HA   5  
ATOM 10908 H HB2  . PRO A 1 99  ? -17.294 -5.119  -2.601  1.00 0.00 ? 99  PRO A HB2  5  
ATOM 10909 H HB3  . PRO A 1 99  ? -17.137 -6.828  -2.250  1.00 0.00 ? 99  PRO A HB3  5  
ATOM 10910 H HG2  . PRO A 1 99  ? -16.055 -5.299  -4.538  1.00 0.00 ? 99  PRO A HG2  5  
ATOM 10911 H HG3  . PRO A 1 99  ? -15.572 -6.875  -3.945  1.00 0.00 ? 99  PRO A HG3  5  
ATOM 10912 H HD2  . PRO A 1 99  ? -17.179 -6.331  -6.257  1.00 0.00 ? 99  PRO A HD2  5  
ATOM 10913 H HD3  . PRO A 1 99  ? -16.792 -7.908  -5.598  1.00 0.00 ? 99  PRO A HD3  5  
ATOM 10914 N N    . ARG A 1 100 ? -20.293 -4.673  -2.760  1.00 0.00 ? 100 ARG A N    5  
ATOM 10915 C CA   . ARG A 1 100 ? -21.094 -3.462  -2.821  1.00 0.00 ? 100 ARG A CA   5  
ATOM 10916 C C    . ARG A 1 100 ? -20.399 -2.327  -2.067  1.00 0.00 ? 100 ARG A C    5  
ATOM 10917 O O    . ARG A 1 100 ? -21.058 -1.470  -1.480  1.00 0.00 ? 100 ARG A O    5  
ATOM 10918 C CB   . ARG A 1 100 ? -22.483 -3.689  -2.218  1.00 0.00 ? 100 ARG A CB   5  
ATOM 10919 C CG   . ARG A 1 100 ? -23.283 -4.692  -3.050  1.00 0.00 ? 100 ARG A CG   5  
ATOM 10920 C CD   . ARG A 1 100 ? -24.615 -5.027  -2.373  1.00 0.00 ? 100 ARG A CD   5  
ATOM 10921 N NE   . ARG A 1 100 ? -24.412 -6.076  -1.349  1.00 0.00 ? 100 ARG A NE   5  
ATOM 10922 C CZ   . ARG A 1 100 ? -25.297 -6.364  -0.384  1.00 0.00 ? 100 ARG A CZ   5  
ATOM 10923 N NH1  . ARG A 1 100 ? -26.449 -5.684  -0.307  1.00 0.00 ? 100 ARG A NH1  5  
ATOM 10924 N NH2  . ARG A 1 100 ? -25.028 -7.332  0.503   1.00 0.00 ? 100 ARG A NH2  5  
ATOM 10925 H H    . ARG A 1 100 ? -20.342 -5.169  -1.894  1.00 0.00 ? 100 ARG A H    5  
ATOM 10926 H HA   . ARG A 1 100 ? -21.176 -3.234  -3.883  1.00 0.00 ? 100 ARG A HA   5  
ATOM 10927 H HB2  . ARG A 1 100 ? -22.384 -4.055  -1.196  1.00 0.00 ? 100 ARG A HB2  5  
ATOM 10928 H HB3  . ARG A 1 100 ? -23.020 -2.743  -2.167  1.00 0.00 ? 100 ARG A HB3  5  
ATOM 10929 H HG2  . ARG A 1 100 ? -23.469 -4.282  -4.042  1.00 0.00 ? 100 ARG A HG2  5  
ATOM 10930 H HG3  . ARG A 1 100 ? -22.701 -5.604  -3.186  1.00 0.00 ? 100 ARG A HG3  5  
ATOM 10931 H HD2  . ARG A 1 100 ? -25.033 -4.132  -1.913  1.00 0.00 ? 100 ARG A HD2  5  
ATOM 10932 H HD3  . ARG A 1 100 ? -25.334 -5.368  -3.117  1.00 0.00 ? 100 ARG A HD3  5  
ATOM 10933 H HE   . ARG A 1 100 ? -23.562 -6.601  -1.378  1.00 0.00 ? 100 ARG A HE   5  
ATOM 10934 H HH11 . ARG A 1 100 ? -26.648 -4.962  -0.969  1.00 0.00 ? 100 ARG A HH11 5  
ATOM 10935 H HH12 . ARG A 1 100 ? -27.109 -5.899  0.414   1.00 0.00 ? 100 ARG A HH12 5  
ATOM 10936 H HH21 . ARG A 1 100 ? -24.169 -7.839  0.445   1.00 0.00 ? 100 ARG A HH21 5  
ATOM 10937 H HH22 . ARG A 1 100 ? -25.688 -7.546  1.223   1.00 0.00 ? 100 ARG A HH22 5  
ATOM 10938 N N    . GLY A 1 101 ? -19.074 -2.357  -2.107  1.00 0.00 ? 101 GLY A N    5  
ATOM 10939 C CA   . GLY A 1 101 ? -18.282 -1.341  -1.435  1.00 0.00 ? 101 GLY A CA   5  
ATOM 10940 C C    . GLY A 1 101 ? -17.966 -1.756  0.003   1.00 0.00 ? 101 GLY A C    5  
ATOM 10941 O O    . GLY A 1 101 ? -16.805 -1.762  0.411   1.00 0.00 ? 101 GLY A O    5  
ATOM 10942 H H    . GLY A 1 101 ? -18.545 -3.058  -2.587  1.00 0.00 ? 101 GLY A H    5  
ATOM 10943 H HA2  . GLY A 1 101 ? -17.354 -1.177  -1.982  1.00 0.00 ? 101 GLY A HA2  5  
ATOM 10944 H HA3  . GLY A 1 101 ? -18.822 -0.395  -1.434  1.00 0.00 ? 101 GLY A HA3  5  
ATOM 10945 N N    . SER A 1 102 ? -19.019 -2.093  0.733   1.00 0.00 ? 102 SER A N    5  
ATOM 10946 C CA   . SER A 1 102 ? -18.867 -2.508  2.118   1.00 0.00 ? 102 SER A CA   5  
ATOM 10947 C C    . SER A 1 102 ? -17.718 -3.510  2.241   1.00 0.00 ? 102 SER A C    5  
ATOM 10948 O O    . SER A 1 102 ? -16.946 -3.460  3.198   1.00 0.00 ? 102 SER A O    5  
ATOM 10949 C CB   . SER A 1 102 ? -20.163 -3.117  2.656   1.00 0.00 ? 102 SER A CB   5  
ATOM 10950 O OG   . SER A 1 102 ? -20.555 -4.273  1.919   1.00 0.00 ? 102 SER A OG   5  
ATOM 10951 H H    . SER A 1 102 ? -19.959 -2.085  0.395   1.00 0.00 ? 102 SER A H    5  
ATOM 10952 H HA   . SER A 1 102 ? -18.639 -1.595  2.669   1.00 0.00 ? 102 SER A HA   5  
ATOM 10953 H HB2  . SER A 1 102 ? -20.032 -3.382  3.705   1.00 0.00 ? 102 SER A HB2  5  
ATOM 10954 H HB3  . SER A 1 102 ? -20.959 -2.374  2.611   1.00 0.00 ? 102 SER A HB3  5  
ATOM 10955 H HG   . SER A 1 102 ? -21.338 -4.059  1.336   1.00 0.00 ? 102 SER A HG   5  
ATOM 10956 N N    . ASP A 1 103 ? -17.641 -4.397  1.260   1.00 0.00 ? 103 ASP A N    5  
ATOM 10957 C CA   . ASP A 1 103 ? -16.599 -5.410  1.247   1.00 0.00 ? 103 ASP A CA   5  
ATOM 10958 C C    . ASP A 1 103 ? -15.237 -4.732  1.091   1.00 0.00 ? 103 ASP A C    5  
ATOM 10959 O O    . ASP A 1 103 ? -14.254 -5.159  1.694   1.00 0.00 ? 103 ASP A O    5  
ATOM 10960 C CB   . ASP A 1 103 ? -16.784 -6.374  0.074   1.00 0.00 ? 103 ASP A CB   5  
ATOM 10961 C CG   . ASP A 1 103 ? -16.908 -7.848  0.463   1.00 0.00 ? 103 ASP A CG   5  
ATOM 10962 O OD1  . ASP A 1 103 ? -16.393 -8.195  1.547   1.00 0.00 ? 103 ASP A OD1  5  
ATOM 10963 O OD2  . ASP A 1 103 ? -17.516 -8.596  -0.334  1.00 0.00 ? 103 ASP A OD2  5  
ATOM 10964 H H    . ASP A 1 103 ? -18.273 -4.430  0.486   1.00 0.00 ? 103 ASP A H    5  
ATOM 10965 H HA   . ASP A 1 103 ? -16.698 -5.935  2.197   1.00 0.00 ? 103 ASP A HA   5  
ATOM 10966 H HB2  . ASP A 1 103 ? -17.677 -6.083  -0.480  1.00 0.00 ? 103 ASP A HB2  5  
ATOM 10967 H HB3  . ASP A 1 103 ? -15.938 -6.264  -0.605  1.00 0.00 ? 103 ASP A HB3  5  
ATOM 10968 N N    . ILE A 1 104 ? -15.221 -3.685  0.278   1.00 0.00 ? 104 ILE A N    5  
ATOM 10969 C CA   . ILE A 1 104 ? -13.995 -2.943  0.036   1.00 0.00 ? 104 ILE A CA   5  
ATOM 10970 C C    . ILE A 1 104 ? -13.448 -2.424  1.366   1.00 0.00 ? 104 ILE A C    5  
ATOM 10971 O O    . ILE A 1 104 ? -12.253 -2.156  1.486   1.00 0.00 ? 104 ILE A O    5  
ATOM 10972 C CB   . ILE A 1 104 ? -14.230 -1.846  -1.004  1.00 0.00 ? 104 ILE A CB   5  
ATOM 10973 C CG1  . ILE A 1 104 ? -14.826 -2.425  -2.289  1.00 0.00 ? 104 ILE A CG1  5  
ATOM 10974 C CG2  . ILE A 1 104 ? -12.945 -1.060  -1.271  1.00 0.00 ? 104 ILE A CG2  5  
ATOM 10975 C CD1  . ILE A 1 104 ? -15.033 -1.333  -3.339  1.00 0.00 ? 104 ILE A CD1  5  
ATOM 10976 H H    . ILE A 1 104 ? -16.025 -3.344  -0.209  1.00 0.00 ? 104 ILE A H    5  
ATOM 10977 H HA   . ILE A 1 104 ? -13.271 -3.639  -0.388  1.00 0.00 ? 104 ILE A HA   5  
ATOM 10978 H HB   . ILE A 1 104 ? -14.959 -1.143  -0.600  1.00 0.00 ? 104 ILE A HB   5  
ATOM 10979 H HG12 . ILE A 1 104 ? -14.165 -3.195  -2.685  1.00 0.00 ? 104 ILE A HG12 5  
ATOM 10980 H HG13 . ILE A 1 104 ? -15.779 -2.907  -2.067  1.00 0.00 ? 104 ILE A HG13 5  
ATOM 10981 H HG21 . ILE A 1 104 ? -12.197 -1.322  -0.523  1.00 0.00 ? 104 ILE A HG21 5  
ATOM 10982 H HG22 . ILE A 1 104 ? -12.568 -1.308  -2.264  1.00 0.00 ? 104 ILE A HG22 5  
ATOM 10983 H HG23 . ILE A 1 104 ? -13.155 0.008   -1.219  1.00 0.00 ? 104 ILE A HG23 5  
ATOM 10984 H HD11 . ILE A 1 104 ? -14.074 -0.870  -3.575  1.00 0.00 ? 104 ILE A HD11 5  
ATOM 10985 H HD12 . ILE A 1 104 ? -15.457 -1.772  -4.242  1.00 0.00 ? 104 ILE A HD12 5  
ATOM 10986 H HD13 . ILE A 1 104 ? -15.714 -0.577  -2.948  1.00 0.00 ? 104 ILE A HD13 5  
ATOM 10987 N N    . ALA A 1 105 ? -14.346 -2.298  2.331   1.00 0.00 ? 105 ALA A N    5  
ATOM 10988 C CA   . ALA A 1 105 ? -13.967 -1.815  3.648   1.00 0.00 ? 105 ALA A CA   5  
ATOM 10989 C C    . ALA A 1 105 ? -13.186 -2.906  4.381   1.00 0.00 ? 105 ALA A C    5  
ATOM 10990 O O    . ALA A 1 105 ? -12.417 -2.615  5.297   1.00 0.00 ? 105 ALA A O    5  
ATOM 10991 C CB   . ALA A 1 105 ? -15.220 -1.381  4.413   1.00 0.00 ? 105 ALA A CB   5  
ATOM 10992 H H    . ALA A 1 105 ? -15.316 -2.518  2.224   1.00 0.00 ? 105 ALA A H    5  
ATOM 10993 H HA   . ALA A 1 105 ? -13.323 -0.948  3.510   1.00 0.00 ? 105 ALA A HA   5  
ATOM 10994 H HB1  . ALA A 1 105 ? -14.973 -0.548  5.070   1.00 0.00 ? 105 ALA A HB1  5  
ATOM 10995 H HB2  . ALA A 1 105 ? -15.988 -1.071  3.704   1.00 0.00 ? 105 ALA A HB2  5  
ATOM 10996 H HB3  . ALA A 1 105 ? -15.589 -2.216  5.007   1.00 0.00 ? 105 ALA A HB3  5  
ATOM 10997 N N    . GLY A 1 106 ? -13.409 -4.139  3.951   1.00 0.00 ? 106 GLY A N    5  
ATOM 10998 C CA   . GLY A 1 106 ? -12.734 -5.276  4.556   1.00 0.00 ? 106 GLY A CA   5  
ATOM 10999 C C    . GLY A 1 106 ? -13.522 -5.807  5.756   1.00 0.00 ? 106 GLY A C    5  
ATOM 11000 O O    . GLY A 1 106 ? -13.038 -6.667  6.490   1.00 0.00 ? 106 GLY A O    5  
ATOM 11001 H H    . GLY A 1 106 ? -14.036 -4.367  3.207   1.00 0.00 ? 106 GLY A H    5  
ATOM 11002 H HA2  . GLY A 1 106 ? -12.615 -6.068  3.816   1.00 0.00 ? 106 GLY A HA2  5  
ATOM 11003 H HA3  . GLY A 1 106 ? -11.734 -4.983  4.874   1.00 0.00 ? 106 GLY A HA3  5  
ATOM 11004 N N    . THR A 1 107 ? -14.723 -5.271  5.918   1.00 0.00 ? 107 THR A N    5  
ATOM 11005 C CA   . THR A 1 107 ? -15.582 -5.680  7.016   1.00 0.00 ? 107 THR A CA   5  
ATOM 11006 C C    . THR A 1 107 ? -15.998 -7.143  6.852   1.00 0.00 ? 107 THR A C    5  
ATOM 11007 O O    . THR A 1 107 ? -16.084 -7.880  7.833   1.00 0.00 ? 107 THR A O    5  
ATOM 11008 C CB   . THR A 1 107 ? -16.768 -4.714  7.073   1.00 0.00 ? 107 THR A CB   5  
ATOM 11009 O OG1  . THR A 1 107 ? -16.204 -3.501  7.562   1.00 0.00 ? 107 THR A OG1  5  
ATOM 11010 C CG2  . THR A 1 107 ? -17.792 -5.107  8.140   1.00 0.00 ? 107 THR A CG2  5  
ATOM 11011 H H    . THR A 1 107 ? -15.109 -4.571  5.317   1.00 0.00 ? 107 THR A H    5  
ATOM 11012 H HA   . THR A 1 107 ? -15.012 -5.610  7.942   1.00 0.00 ? 107 THR A HA   5  
ATOM 11013 H HB   . THR A 1 107 ? -17.241 -4.621  6.095   1.00 0.00 ? 107 THR A HB   5  
ATOM 11014 H HG1  . THR A 1 107 ? -16.152 -2.827  6.825   1.00 0.00 ? 107 THR A HG1  5  
ATOM 11015 H HG21 . THR A 1 107 ? -17.274 -5.359  9.065   1.00 0.00 ? 107 THR A HG21 5  
ATOM 11016 H HG22 . THR A 1 107 ? -18.469 -4.272  8.319   1.00 0.00 ? 107 THR A HG22 5  
ATOM 11017 H HG23 . THR A 1 107 ? -18.362 -5.970  7.796   1.00 0.00 ? 107 THR A HG23 5  
ATOM 11018 N N    . THR A 1 108 ? -16.242 -7.520  5.606   1.00 0.00 ? 108 THR A N    5  
ATOM 11019 C CA   . THR A 1 108 ? -16.645 -8.882  5.301   1.00 0.00 ? 108 THR A CA   5  
ATOM 11020 C C    . THR A 1 108 ? -15.518 -9.624  4.579   1.00 0.00 ? 108 THR A C    5  
ATOM 11021 O O    . THR A 1 108 ? -15.479 -10.853 4.582   1.00 0.00 ? 108 THR A O    5  
ATOM 11022 C CB   . THR A 1 108 ? -17.946 -8.821  4.497   1.00 0.00 ? 108 THR A CB   5  
ATOM 11023 O OG1  . THR A 1 108 ? -18.926 -8.421  5.451   1.00 0.00 ? 108 THR A OG1  5  
ATOM 11024 C CG2  . THR A 1 108 ? -18.416 -10.203 4.038   1.00 0.00 ? 108 THR A CG2  5  
ATOM 11025 H H    . THR A 1 108 ? -16.169 -6.914  4.814   1.00 0.00 ? 108 THR A H    5  
ATOM 11026 H HA   . THR A 1 108 ? -16.823 -9.406  6.241   1.00 0.00 ? 108 THR A HA   5  
ATOM 11027 H HB   . THR A 1 108 ? -17.849 -8.141  3.650   1.00 0.00 ? 108 THR A HB   5  
ATOM 11028 H HG1  . THR A 1 108 ? -18.864 -7.436  5.612   1.00 0.00 ? 108 THR A HG1  5  
ATOM 11029 H HG21 . THR A 1 108 ? -18.005 -10.964 4.701   1.00 0.00 ? 108 THR A HG21 5  
ATOM 11030 H HG22 . THR A 1 108 ? -19.504 -10.245 4.066   1.00 0.00 ? 108 THR A HG22 5  
ATOM 11031 H HG23 . THR A 1 108 ? -18.071 -10.383 3.020   1.00 0.00 ? 108 THR A HG23 5  
ATOM 11032 N N    . SER A 1 109 ? -14.631 -8.844  3.979   1.00 0.00 ? 109 SER A N    5  
ATOM 11033 C CA   . SER A 1 109 ? -13.506 -9.412  3.254   1.00 0.00 ? 109 SER A CA   5  
ATOM 11034 C C    . SER A 1 109 ? -12.193 -9.012  3.931   1.00 0.00 ? 109 SER A C    5  
ATOM 11035 O O    . SER A 1 109 ? -12.152 -8.048  4.693   1.00 0.00 ? 109 SER A O    5  
ATOM 11036 C CB   . SER A 1 109 ? -13.509 -8.961  1.793   1.00 0.00 ? 109 SER A CB   5  
ATOM 11037 O OG   . SER A 1 109 ? -13.344 -7.552  1.668   1.00 0.00 ? 109 SER A OG   5  
ATOM 11038 H H    . SER A 1 109 ? -14.671 -7.845  3.981   1.00 0.00 ? 109 SER A H    5  
ATOM 11039 H HA   . SER A 1 109 ? -13.648 -10.492 3.301   1.00 0.00 ? 109 SER A HA   5  
ATOM 11040 H HB2  . SER A 1 109 ? -12.709 -9.470  1.255   1.00 0.00 ? 109 SER A HB2  5  
ATOM 11041 H HB3  . SER A 1 109 ? -14.447 -9.260  1.324   1.00 0.00 ? 109 SER A HB3  5  
ATOM 11042 H HG   . SER A 1 109 ? -14.057 -7.077  2.182   1.00 0.00 ? 109 SER A HG   5  
ATOM 11043 N N    . THR A 1 110 ? -11.153 -9.774  3.627   1.00 0.00 ? 110 THR A N    5  
ATOM 11044 C CA   . THR A 1 110 ? -9.841  -9.511  4.195   1.00 0.00 ? 110 THR A CA   5  
ATOM 11045 C C    . THR A 1 110 ? -8.889  -8.987  3.120   1.00 0.00 ? 110 THR A C    5  
ATOM 11046 O O    . THR A 1 110 ? -9.293  -8.775  1.977   1.00 0.00 ? 110 THR A O    5  
ATOM 11047 C CB   . THR A 1 110 ? -9.351  -10.796 4.867   1.00 0.00 ? 110 THR A CB   5  
ATOM 11048 O OG1  . THR A 1 110 ? -9.228  -11.724 3.792   1.00 0.00 ? 110 THR A OG1  5  
ATOM 11049 C CG2  . THR A 1 110 ? -10.409 -11.421 5.779   1.00 0.00 ? 110 THR A CG2  5  
ATOM 11050 H H    . THR A 1 110 ? -11.195 -10.557 3.006   1.00 0.00 ? 110 THR A H    5  
ATOM 11051 H HA   . THR A 1 110 ? -9.943  -8.725  4.943   1.00 0.00 ? 110 THR A HA   5  
ATOM 11052 H HB   . THR A 1 110 ? -8.423  -10.622 5.410   1.00 0.00 ? 110 THR A HB   5  
ATOM 11053 H HG1  . THR A 1 110 ? -8.378  -11.557 3.293   1.00 0.00 ? 110 THR A HG1  5  
ATOM 11054 H HG21 . THR A 1 110 ? -11.383 -11.373 5.291   1.00 0.00 ? 110 THR A HG21 5  
ATOM 11055 H HG22 . THR A 1 110 ? -10.151 -12.462 5.974   1.00 0.00 ? 110 THR A HG22 5  
ATOM 11056 H HG23 . THR A 1 110 ? -10.448 -10.873 6.719   1.00 0.00 ? 110 THR A HG23 5  
ATOM 11057 N N    . LEU A 1 111 ? -7.642  -8.790  3.523   1.00 0.00 ? 111 LEU A N    5  
ATOM 11058 C CA   . LEU A 1 111 ? -6.629  -8.294  2.607   1.00 0.00 ? 111 LEU A CA   5  
ATOM 11059 C C    . LEU A 1 111 ? -6.567  -9.205  1.380   1.00 0.00 ? 111 LEU A C    5  
ATOM 11060 O O    . LEU A 1 111 ? -6.721  -8.742  0.251   1.00 0.00 ? 111 LEU A O    5  
ATOM 11061 C CB   . LEU A 1 111 ? -5.287  -8.138  3.326   1.00 0.00 ? 111 LEU A CB   5  
ATOM 11062 C CG   . LEU A 1 111 ? -4.043  -8.149  2.436   1.00 0.00 ? 111 LEU A CG   5  
ATOM 11063 C CD1  . LEU A 1 111 ? -3.849  -6.795  1.750   1.00 0.00 ? 111 LEU A CD1  5  
ATOM 11064 C CD2  . LEU A 1 111 ? -2.806  -8.573  3.227   1.00 0.00 ? 111 LEU A CD2  5  
ATOM 11065 H H    . LEU A 1 111 ? -7.322  -8.965  4.454   1.00 0.00 ? 111 LEU A H    5  
ATOM 11066 H HA   . LEU A 1 111 ? -6.939  -7.300  2.285   1.00 0.00 ? 111 LEU A HA   5  
ATOM 11067 H HB2  . LEU A 1 111 ? -5.303  -7.202  3.884   1.00 0.00 ? 111 LEU A HB2  5  
ATOM 11068 H HB3  . LEU A 1 111 ? -5.194  -8.942  4.057   1.00 0.00 ? 111 LEU A HB3  5  
ATOM 11069 H HG   . LEU A 1 111 ? -4.192  -8.889  1.650   1.00 0.00 ? 111 LEU A HG   5  
ATOM 11070 H HD11 . LEU A 1 111 ? -3.798  -6.009  2.504   1.00 0.00 ? 111 LEU A HD11 5  
ATOM 11071 H HD12 . LEU A 1 111 ? -2.922  -6.808  1.176   1.00 0.00 ? 111 LEU A HD12 5  
ATOM 11072 H HD13 . LEU A 1 111 ? -4.688  -6.603  1.081   1.00 0.00 ? 111 LEU A HD13 5  
ATOM 11073 H HD21 . LEU A 1 111 ? -3.018  -8.515  4.295   1.00 0.00 ? 111 LEU A HD21 5  
ATOM 11074 H HD22 . LEU A 1 111 ? -2.540  -9.598  2.965   1.00 0.00 ? 111 LEU A HD22 5  
ATOM 11075 H HD23 . LEU A 1 111 ? -1.975  -7.910  2.986   1.00 0.00 ? 111 LEU A HD23 5  
ATOM 11076 N N    . GLN A 1 112 ? -6.340  -10.483 1.642   1.00 0.00 ? 112 GLN A N    5  
ATOM 11077 C CA   . GLN A 1 112 ? -6.255  -11.464 0.573   1.00 0.00 ? 112 GLN A CA   5  
ATOM 11078 C C    . GLN A 1 112 ? -7.393  -11.256 -0.429  1.00 0.00 ? 112 GLN A C    5  
ATOM 11079 O O    . GLN A 1 112 ? -7.171  -11.271 -1.639  1.00 0.00 ? 112 GLN A O    5  
ATOM 11080 C CB   . GLN A 1 112 ? -6.268  -12.887 1.132   1.00 0.00 ? 112 GLN A CB   5  
ATOM 11081 C CG   . GLN A 1 112 ? -4.869  -13.317 1.573   1.00 0.00 ? 112 GLN A CG   5  
ATOM 11082 C CD   . GLN A 1 112 ? -4.911  -14.665 2.297   1.00 0.00 ? 112 GLN A CD   5  
ATOM 11083 O OE1  . GLN A 1 112 ? -5.962  -15.184 2.634   1.00 0.00 ? 112 GLN A OE1  5  
ATOM 11084 N NE2  . GLN A 1 112 ? -3.713  -15.198 2.517   1.00 0.00 ? 112 GLN A NE2  5  
ATOM 11085 H H    . GLN A 1 112 ? -6.215  -10.852 2.564   1.00 0.00 ? 112 GLN A H    5  
ATOM 11086 H HA   . GLN A 1 112 ? -5.297  -11.279 0.087   1.00 0.00 ? 112 GLN A HA   5  
ATOM 11087 H HB2  . GLN A 1 112 ? -6.954  -12.943 1.977   1.00 0.00 ? 112 GLN A HB2  5  
ATOM 11088 H HB3  . GLN A 1 112 ? -6.642  -13.576 0.373   1.00 0.00 ? 112 GLN A HB3  5  
ATOM 11089 H HG2  . GLN A 1 112 ? -4.215  -13.388 0.704   1.00 0.00 ? 112 GLN A HG2  5  
ATOM 11090 H HG3  . GLN A 1 112 ? -4.443  -12.560 2.231   1.00 0.00 ? 112 GLN A HG3  5  
ATOM 11091 H HE21 . GLN A 1 112 ? -2.889  -14.719 2.215   1.00 0.00 ? 112 GLN A HE21 5  
ATOM 11092 H HE22 . GLN A 1 112 ? -3.636  -16.079 2.985   1.00 0.00 ? 112 GLN A HE22 5  
ATOM 11093 N N    . GLU A 1 113 ? -8.588  -11.067 0.113   1.00 0.00 ? 113 GLU A N    5  
ATOM 11094 C CA   . GLU A 1 113 ? -9.760  -10.856 -0.718  1.00 0.00 ? 113 GLU A CA   5  
ATOM 11095 C C    . GLU A 1 113 ? -9.585  -9.602  -1.577  1.00 0.00 ? 113 GLU A C    5  
ATOM 11096 O O    . GLU A 1 113 ? -9.922  -9.604  -2.760  1.00 0.00 ? 113 GLU A O    5  
ATOM 11097 C CB   . GLU A 1 113 ? -11.027 -10.764 0.136   1.00 0.00 ? 113 GLU A CB   5  
ATOM 11098 C CG   . GLU A 1 113 ? -11.609 -12.153 0.405   1.00 0.00 ? 113 GLU A CG   5  
ATOM 11099 C CD   . GLU A 1 113 ? -12.838 -12.066 1.313   1.00 0.00 ? 113 GLU A CD   5  
ATOM 11100 O OE1  . GLU A 1 113 ? -13.924 -11.767 0.771   1.00 0.00 ? 113 GLU A OE1  5  
ATOM 11101 O OE2  . GLU A 1 113 ? -12.663 -12.301 2.528   1.00 0.00 ? 113 GLU A OE2  5  
ATOM 11102 H H    . GLU A 1 113 ? -8.759  -11.056 1.097   1.00 0.00 ? 113 GLU A H    5  
ATOM 11103 H HA   . GLU A 1 113 ? -9.824  -11.737 -1.358  1.00 0.00 ? 113 GLU A HA   5  
ATOM 11104 H HB2  . GLU A 1 113 ? -10.799 -10.272 1.081   1.00 0.00 ? 113 GLU A HB2  5  
ATOM 11105 H HB3  . GLU A 1 113 ? -11.769 -10.147 -0.374  1.00 0.00 ? 113 GLU A HB3  5  
ATOM 11106 H HG2  . GLU A 1 113 ? -11.883 -12.627 -0.538  1.00 0.00 ? 113 GLU A HG2  5  
ATOM 11107 H HG3  . GLU A 1 113 ? -10.852 -12.784 0.871   1.00 0.00 ? 113 GLU A HG3  5  
ATOM 11108 N N    . GLN A 1 114 ? -9.058  -8.562  -0.948  1.00 0.00 ? 114 GLN A N    5  
ATOM 11109 C CA   . GLN A 1 114 ? -8.834  -7.304  -1.639  1.00 0.00 ? 114 GLN A CA   5  
ATOM 11110 C C    . GLN A 1 114 ? -7.757  -7.473  -2.714  1.00 0.00 ? 114 GLN A C    5  
ATOM 11111 O O    . GLN A 1 114 ? -7.805  -6.818  -3.753  1.00 0.00 ? 114 GLN A O    5  
ATOM 11112 C CB   . GLN A 1 114 ? -8.456  -6.197  -0.654  1.00 0.00 ? 114 GLN A CB   5  
ATOM 11113 C CG   . GLN A 1 114 ? -9.704  -5.527  -0.076  1.00 0.00 ? 114 GLN A CG   5  
ATOM 11114 C CD   . GLN A 1 114 ? -10.293 -6.358  1.066   1.00 0.00 ? 114 GLN A CD   5  
ATOM 11115 O OE1  . GLN A 1 114 ? -10.905 -7.393  0.863   1.00 0.00 ? 114 GLN A OE1  5  
ATOM 11116 N NE2  . GLN A 1 114 ? -10.074 -5.849  2.275   1.00 0.00 ? 114 GLN A NE2  5  
ATOM 11117 H H    . GLN A 1 114 ? -8.786  -8.569  0.014   1.00 0.00 ? 114 GLN A H    5  
ATOM 11118 H HA   . GLN A 1 114 ? -9.787  -7.057  -2.107  1.00 0.00 ? 114 GLN A HA   5  
ATOM 11119 H HB2  . GLN A 1 114 ? -7.856  -6.613  0.155   1.00 0.00 ? 114 GLN A HB2  5  
ATOM 11120 H HB3  . GLN A 1 114 ? -7.839  -5.452  -1.158  1.00 0.00 ? 114 GLN A HB3  5  
ATOM 11121 H HG2  . GLN A 1 114 ? -9.452  -4.531  0.287   1.00 0.00 ? 114 GLN A HG2  5  
ATOM 11122 H HG3  . GLN A 1 114 ? -10.450 -5.402  -0.861  1.00 0.00 ? 114 GLN A HG3  5  
ATOM 11123 H HE21 . GLN A 1 114 ? -9.562  -4.994  2.372   1.00 0.00 ? 114 GLN A HE21 5  
ATOM 11124 H HE22 . GLN A 1 114 ? -10.419 -6.319  3.087   1.00 0.00 ? 114 GLN A HE22 5  
ATOM 11125 N N    . ILE A 1 115 ? -6.812  -8.356  -2.425  1.00 0.00 ? 115 ILE A N    5  
ATOM 11126 C CA   . ILE A 1 115 ? -5.725  -8.620  -3.353  1.00 0.00 ? 115 ILE A CA   5  
ATOM 11127 C C    . ILE A 1 115 ? -6.292  -9.241  -4.631  1.00 0.00 ? 115 ILE A C    5  
ATOM 11128 O O    . ILE A 1 115 ? -5.930  -8.838  -5.735  1.00 0.00 ? 115 ILE A O    5  
ATOM 11129 C CB   . ILE A 1 115 ? -4.644  -9.468  -2.683  1.00 0.00 ? 115 ILE A CB   5  
ATOM 11130 C CG1  . ILE A 1 115 ? -4.124  -8.792  -1.413  1.00 0.00 ? 115 ILE A CG1  5  
ATOM 11131 C CG2  . ILE A 1 115 ? -3.514  -9.790  -3.664  1.00 0.00 ? 115 ILE A CG2  5  
ATOM 11132 C CD1  . ILE A 1 115 ? -4.149  -7.269  -1.553  1.00 0.00 ? 115 ILE A CD1  5  
ATOM 11133 H H    . ILE A 1 115 ? -6.781  -8.885  -1.577  1.00 0.00 ? 115 ILE A H    5  
ATOM 11134 H HA   . ILE A 1 115 ? -5.273  -7.661  -3.606  1.00 0.00 ? 115 ILE A HA   5  
ATOM 11135 H HB   . ILE A 1 115 ? -5.090  -10.416 -2.384  1.00 0.00 ? 115 ILE A HB   5  
ATOM 11136 H HG12 . ILE A 1 115 ? -4.734  -9.093  -0.561  1.00 0.00 ? 115 ILE A HG12 5  
ATOM 11137 H HG13 . ILE A 1 115 ? -3.106  -9.126  -1.210  1.00 0.00 ? 115 ILE A HG13 5  
ATOM 11138 H HG21 . ILE A 1 115 ? -3.936  -10.209 -4.579  1.00 0.00 ? 115 ILE A HG21 5  
ATOM 11139 H HG22 . ILE A 1 115 ? -2.967  -8.878  -3.901  1.00 0.00 ? 115 ILE A HG22 5  
ATOM 11140 H HG23 . ILE A 1 115 ? -2.836  -10.515 -3.213  1.00 0.00 ? 115 ILE A HG23 5  
ATOM 11141 H HD11 . ILE A 1 115 ? -3.576  -6.976  -2.433  1.00 0.00 ? 115 ILE A HD11 5  
ATOM 11142 H HD12 . ILE A 1 115 ? -5.180  -6.932  -1.661  1.00 0.00 ? 115 ILE A HD12 5  
ATOM 11143 H HD13 . ILE A 1 115 ? -3.709  -6.815  -0.665  1.00 0.00 ? 115 ILE A HD13 5  
ATOM 11144 N N    . GLY A 1 116 ? -7.173  -10.212 -4.439  1.00 0.00 ? 116 GLY A N    5  
ATOM 11145 C CA   . GLY A 1 116 ? -7.792  -10.894 -5.562  1.00 0.00 ? 116 GLY A CA   5  
ATOM 11146 C C    . GLY A 1 116 ? -8.626  -9.922  -6.399  1.00 0.00 ? 116 GLY A C    5  
ATOM 11147 O O    . GLY A 1 116 ? -8.473  -9.858  -7.618  1.00 0.00 ? 116 GLY A O    5  
ATOM 11148 H H    . GLY A 1 116 ? -7.462  -10.534 -3.537  1.00 0.00 ? 116 GLY A H    5  
ATOM 11149 H HA2  . GLY A 1 116 ? -7.024  -11.350 -6.185  1.00 0.00 ? 116 GLY A HA2  5  
ATOM 11150 H HA3  . GLY A 1 116 ? -8.427  -11.702 -5.197  1.00 0.00 ? 116 GLY A HA3  5  
ATOM 11151 N N    . TRP A 1 117 ? -9.493  -9.191  -5.713  1.00 0.00 ? 117 TRP A N    5  
ATOM 11152 C CA   . TRP A 1 117 ? -10.350 -8.226  -6.378  1.00 0.00 ? 117 TRP A CA   5  
ATOM 11153 C C    . TRP A 1 117 ? -9.464  -7.305  -7.218  1.00 0.00 ? 117 TRP A C    5  
ATOM 11154 O O    . TRP A 1 117 ? -9.784  -7.008  -8.368  1.00 0.00 ? 117 TRP A O    5  
ATOM 11155 C CB   . TRP A 1 117 ? -11.211 -7.468  -5.367  1.00 0.00 ? 117 TRP A CB   5  
ATOM 11156 C CG   . TRP A 1 117 ? -12.565 -8.123  -5.086  1.00 0.00 ? 117 TRP A CG   5  
ATOM 11157 C CD1  . TRP A 1 117 ? -13.442 -8.617  -5.972  1.00 0.00 ? 117 TRP A CD1  5  
ATOM 11158 C CD2  . TRP A 1 117 ? -13.166 -8.337  -3.791  1.00 0.00 ? 117 TRP A CD2  5  
ATOM 11159 N NE1  . TRP A 1 117 ? -14.558 -9.131  -5.345  1.00 0.00 ? 117 TRP A NE1  5  
ATOM 11160 C CE2  . TRP A 1 117 ? -14.385 -8.955  -3.977  1.00 0.00 ? 117 TRP A CE2  5  
ATOM 11161 C CE3  . TRP A 1 117 ? -12.694 -8.018  -2.506  1.00 0.00 ? 117 TRP A CE3  5  
ATOM 11162 C CZ2  . TRP A 1 117 ? -15.234 -9.309  -2.922  1.00 0.00 ? 117 TRP A CZ2  5  
ATOM 11163 C CZ3  . TRP A 1 117 ? -13.555 -8.378  -1.462  1.00 0.00 ? 117 TRP A CZ3  5  
ATOM 11164 C CH2  . TRP A 1 117 ? -14.785 -9.000  -1.632  1.00 0.00 ? 117 TRP A CH2  5  
ATOM 11165 H H    . TRP A 1 117 ? -9.611  -9.250  -4.721  1.00 0.00 ? 117 TRP A H    5  
ATOM 11166 H HA   . TRP A 1 117 ? -11.033 -8.778  -7.025  1.00 0.00 ? 117 TRP A HA   5  
ATOM 11167 H HB2  . TRP A 1 117 ? -10.661 -7.382  -4.430  1.00 0.00 ? 117 TRP A HB2  5  
ATOM 11168 H HB3  . TRP A 1 117 ? -11.378 -6.456  -5.732  1.00 0.00 ? 117 TRP A HB3  5  
ATOM 11169 H HD1  . TRP A 1 117 ? -13.291 -8.612  -7.052  1.00 0.00 ? 117 TRP A HD1  5  
ATOM 11170 H HE1  . TRP A 1 117 ? -15.418 -9.590  -5.833  1.00 0.00 ? 117 TRP A HE1  5  
ATOM 11171 H HE3  . TRP A 1 117 ? -11.735 -7.530  -2.333  1.00 0.00 ? 117 TRP A HE3  5  
ATOM 11172 H HZ2  . TRP A 1 117 ? -16.194 -9.796  -3.095  1.00 0.00 ? 117 TRP A HZ2  5  
ATOM 11173 H HZ3  . TRP A 1 117 ? -13.237 -8.153  -0.443  1.00 0.00 ? 117 TRP A HZ3  5  
ATOM 11174 H HH2  . TRP A 1 117 ? -15.398 -9.248  -0.765  1.00 0.00 ? 117 TRP A HH2  5  
ATOM 11175 N N    . MET A 1 118 ? -8.367  -6.878  -6.611  1.00 0.00 ? 118 MET A N    5  
ATOM 11176 C CA   . MET A 1 118 ? -7.431  -5.997  -7.289  1.00 0.00 ? 118 MET A CA   5  
ATOM 11177 C C    . MET A 1 118 ? -6.814  -6.684  -8.508  1.00 0.00 ? 118 MET A C    5  
ATOM 11178 O O    . MET A 1 118 ? -6.426  -6.021  -9.469  1.00 0.00 ? 118 MET A O    5  
ATOM 11179 C CB   . MET A 1 118 ? -6.322  -5.586  -6.318  1.00 0.00 ? 118 MET A CB   5  
ATOM 11180 C CG   . MET A 1 118 ? -6.666  -4.269  -5.618  1.00 0.00 ? 118 MET A CG   5  
ATOM 11181 S SD   . MET A 1 118 ? -5.212  -3.239  -5.506  1.00 0.00 ? 118 MET A SD   5  
ATOM 11182 C CE   . MET A 1 118 ? -5.331  -2.719  -3.803  1.00 0.00 ? 118 MET A CE   5  
ATOM 11183 H H    . MET A 1 118 ? -8.113  -7.124  -5.676  1.00 0.00 ? 118 MET A H    5  
ATOM 11184 H HA   . MET A 1 118 ? -8.019  -5.135  -7.607  1.00 0.00 ? 118 MET A HA   5  
ATOM 11185 H HB2  . MET A 1 118 ? -6.175  -6.369  -5.575  1.00 0.00 ? 118 MET A HB2  5  
ATOM 11186 H HB3  . MET A 1 118 ? -5.381  -5.478  -6.859  1.00 0.00 ? 118 MET A HB3  5  
ATOM 11187 H HG2  . MET A 1 118 ? -7.449  -3.749  -6.168  1.00 0.00 ? 118 MET A HG2  5  
ATOM 11188 H HG3  . MET A 1 118 ? -7.057  -4.470  -4.620  1.00 0.00 ? 118 MET A HG3  5  
ATOM 11189 H HE1  . MET A 1 118 ? -5.442  -3.594  -3.162  1.00 0.00 ? 118 MET A HE1  5  
ATOM 11190 H HE2  . MET A 1 118 ? -4.428  -2.177  -3.525  1.00 0.00 ? 118 MET A HE2  5  
ATOM 11191 H HE3  . MET A 1 118 ? -6.198  -2.068  -3.682  1.00 0.00 ? 118 MET A HE3  5  
ATOM 11192 N N    . THR A 1 119 ? -6.742  -8.005  -8.429  1.00 0.00 ? 119 THR A N    5  
ATOM 11193 C CA   . THR A 1 119 ? -6.178  -8.789  -9.515  1.00 0.00 ? 119 THR A CA   5  
ATOM 11194 C C    . THR A 1 119 ? -7.269  -9.623  -10.191 1.00 0.00 ? 119 THR A C    5  
ATOM 11195 O O    . THR A 1 119 ? -6.975  -10.627 -10.838 1.00 0.00 ? 119 THR A O    5  
ATOM 11196 C CB   . THR A 1 119 ? -5.036  -9.632  -8.945  1.00 0.00 ? 119 THR A CB   5  
ATOM 11197 O OG1  . THR A 1 119 ? -4.142  -8.674  -8.386  1.00 0.00 ? 119 THR A OG1  5  
ATOM 11198 C CG2  . THR A 1 119 ? -4.211  -10.316 -10.037 1.00 0.00 ? 119 THR A CG2  5  
ATOM 11199 H H    . THR A 1 119 ? -7.059  -8.536  -7.644  1.00 0.00 ? 119 THR A H    5  
ATOM 11200 H HA   . THR A 1 119 ? -5.786  -8.105  -10.266 1.00 0.00 ? 119 THR A HA   5  
ATOM 11201 H HB   . THR A 1 119 ? -5.410  -10.361 -8.226  1.00 0.00 ? 119 THR A HB   5  
ATOM 11202 H HG1  . THR A 1 119 ? -4.429  -8.441  -7.456  1.00 0.00 ? 119 THR A HG1  5  
ATOM 11203 H HG21 . THR A 1 119 ? -4.792  -10.356 -10.959 1.00 0.00 ? 119 THR A HG21 5  
ATOM 11204 H HG22 . THR A 1 119 ? -3.295  -9.751  -10.209 1.00 0.00 ? 119 THR A HG22 5  
ATOM 11205 H HG23 . THR A 1 119 ? -3.960  -11.328 -9.722  1.00 0.00 ? 119 THR A HG23 5  
ATOM 11206 N N    . HIS A 1 120 ? -8.504  -9.174  -10.021 1.00 0.00 ? 120 HIS A N    5  
ATOM 11207 C CA   . HIS A 1 120 ? -9.639  -9.866  -10.607 1.00 0.00 ? 120 HIS A CA   5  
ATOM 11208 C C    . HIS A 1 120 ? -9.835  -9.397  -12.050 1.00 0.00 ? 120 HIS A C    5  
ATOM 11209 O O    . HIS A 1 120 ? -9.149  -8.485  -12.509 1.00 0.00 ? 120 HIS A O    5  
ATOM 11210 C CB   . HIS A 1 120 ? -10.891 -9.680  -9.748  1.00 0.00 ? 120 HIS A CB   5  
ATOM 11211 C CG   . HIS A 1 120 ? -11.995 -10.664 -10.053 1.00 0.00 ? 120 HIS A CG   5  
ATOM 11212 N ND1  . HIS A 1 120 ? -11.751 -11.959 -10.476 1.00 0.00 ? 120 HIS A ND1  5  
ATOM 11213 C CD2  . HIS A 1 120 ? -13.352 -10.528 -9.990  1.00 0.00 ? 120 HIS A CD2  5  
ATOM 11214 C CE1  . HIS A 1 120 ? -12.915 -12.565 -10.658 1.00 0.00 ? 120 HIS A CE1  5  
ATOM 11215 N NE2  . HIS A 1 120 ? -13.906 -11.677 -10.358 1.00 0.00 ? 120 HIS A NE2  5  
ATOM 11216 H H    . HIS A 1 120 ? -8.733  -8.356  -9.494  1.00 0.00 ? 120 HIS A H    5  
ATOM 11217 H HA   . HIS A 1 120 ? -9.391  -10.927 -10.609 1.00 0.00 ? 120 HIS A HA   5  
ATOM 11218 H HB2  . HIS A 1 120 ? -10.615 -9.774  -8.697  1.00 0.00 ? 120 HIS A HB2  5  
ATOM 11219 H HB3  . HIS A 1 120 ? -11.270 -8.669  -9.890  1.00 0.00 ? 120 HIS A HB3  5  
ATOM 11220 H HD1  . HIS A 1 120 ? -10.850 -12.367 -10.620 1.00 0.00 ? 120 HIS A HD1  5  
ATOM 11221 H HD2  . HIS A 1 120 ? -13.889 -9.628  -9.691  1.00 0.00 ? 120 HIS A HD2  5  
ATOM 11222 H HE1  . HIS A 1 120 ? -13.056 -13.595 -10.990 1.00 0.00 ? 120 HIS A HE1  5  
ATOM 11223 H HE2  . HIS A 1 120 ? -14.885 -11.879 -10.350 1.00 0.00 ? 120 HIS A HE2  5  
ATOM 11224 N N    . ASN A 1 121 ? -10.774 -10.043 -12.726 1.00 0.00 ? 121 ASN A N    5  
ATOM 11225 C CA   . ASN A 1 121 ? -11.070 -9.704  -14.107 1.00 0.00 ? 121 ASN A CA   5  
ATOM 11226 C C    . ASN A 1 121 ? -12.571 -9.448  -14.256 1.00 0.00 ? 121 ASN A C    5  
ATOM 11227 O O    . ASN A 1 121 ? -13.364 -10.389 -14.286 1.00 0.00 ? 121 ASN A O    5  
ATOM 11228 C CB   . ASN A 1 121 ? -10.689 -10.848 -15.049 1.00 0.00 ? 121 ASN A CB   5  
ATOM 11229 C CG   . ASN A 1 121 ? -10.672 -10.378 -16.505 1.00 0.00 ? 121 ASN A CG   5  
ATOM 11230 O OD1  . ASN A 1 121 ? -10.959 -9.234  -16.818 1.00 0.00 ? 121 ASN A OD1  5  
ATOM 11231 N ND2  . ASN A 1 121 ? -10.319 -11.321 -17.374 1.00 0.00 ? 121 ASN A ND2  5  
ATOM 11232 H H    . ASN A 1 121 ? -11.327 -10.783 -12.345 1.00 0.00 ? 121 ASN A H    5  
ATOM 11233 H HA   . ASN A 1 121 ? -10.473 -8.816  -14.318 1.00 0.00 ? 121 ASN A HA   5  
ATOM 11234 H HB2  . ASN A 1 121 ? -9.708  -11.237 -14.777 1.00 0.00 ? 121 ASN A HB2  5  
ATOM 11235 H HB3  . ASN A 1 121 ? -11.400 -11.668 -14.936 1.00 0.00 ? 121 ASN A HB3  5  
ATOM 11236 H HD21 . ASN A 1 121 ? -10.096 -12.240 -17.051 1.00 0.00 ? 121 ASN A HD21 5  
ATOM 11237 H HD22 . ASN A 1 121 ? -10.278 -11.110 -18.351 1.00 0.00 ? 121 ASN A HD22 5  
ATOM 11238 N N    . PRO A 1 122 ? -12.926 -8.138  -14.346 1.00 0.00 ? 122 PRO A N    5  
ATOM 11239 C CA   . PRO A 1 122 ? -11.924 -7.087  -14.302 1.00 0.00 ? 122 PRO A CA   5  
ATOM 11240 C C    . PRO A 1 122 ? -11.405 -6.884  -12.877 1.00 0.00 ? 122 PRO A C    5  
ATOM 11241 O O    . PRO A 1 122 ? -12.054 -7.287  -11.912 1.00 0.00 ? 122 PRO A O    5  
ATOM 11242 C CB   . PRO A 1 122 ? -12.619 -5.857  -14.862 1.00 0.00 ? 122 PRO A CB   5  
ATOM 11243 C CG   . PRO A 1 122 ? -14.109 -6.141  -14.765 1.00 0.00 ? 122 PRO A CG   5  
ATOM 11244 C CD   . PRO A 1 122 ? -14.285 -7.626  -14.493 1.00 0.00 ? 122 PRO A CD   5  
ATOM 11245 H HA   . PRO A 1 122 ? -11.126 -7.344  -14.849 1.00 0.00 ? 122 PRO A HA   5  
ATOM 11246 H HB2  . PRO A 1 122 ? -12.353 -4.966  -14.294 1.00 0.00 ? 122 PRO A HB2  5  
ATOM 11247 H HB3  . PRO A 1 122 ? -12.321 -5.677  -15.894 1.00 0.00 ? 122 PRO A HB3  5  
ATOM 11248 H HG2  . PRO A 1 122 ? -14.559 -5.551  -13.967 1.00 0.00 ? 122 PRO A HG2  5  
ATOM 11249 H HG3  . PRO A 1 122 ? -14.611 -5.860  -15.691 1.00 0.00 ? 122 PRO A HG3  5  
ATOM 11250 H HD2  . PRO A 1 122 ? -14.872 -7.796  -13.591 1.00 0.00 ? 122 PRO A HD2  5  
ATOM 11251 H HD3  . PRO A 1 122 ? -14.808 -8.119  -15.312 1.00 0.00 ? 122 PRO A HD3  5  
ATOM 11252 N N    . PRO A 1 123 ? -10.210 -6.244  -12.786 1.00 0.00 ? 123 PRO A N    5  
ATOM 11253 C CA   . PRO A 1 123 ? -9.596  -5.982  -11.495 1.00 0.00 ? 123 PRO A CA   5  
ATOM 11254 C C    . PRO A 1 123 ? -10.305 -4.834  -10.773 1.00 0.00 ? 123 PRO A C    5  
ATOM 11255 O O    . PRO A 1 123 ? -10.327 -3.706  -11.265 1.00 0.00 ? 123 PRO A O    5  
ATOM 11256 C CB   . PRO A 1 123 ? -8.139  -5.679  -11.805 1.00 0.00 ? 123 PRO A CB   5  
ATOM 11257 C CG   . PRO A 1 123 ? -8.093  -5.326  -13.283 1.00 0.00 ? 123 PRO A CG   5  
ATOM 11258 C CD   . PRO A 1 123 ? -9.412  -5.753  -13.906 1.00 0.00 ? 123 PRO A CD   5  
ATOM 11259 H HA   . PRO A 1 123 ? -9.690  -6.779  -10.898 1.00 0.00 ? 123 PRO A HA   5  
ATOM 11260 H HB2  . PRO A 1 123 ? -7.774  -4.853  -11.194 1.00 0.00 ? 123 PRO A HB2  5  
ATOM 11261 H HB3  . PRO A 1 123 ? -7.507  -6.539  -11.589 1.00 0.00 ? 123 PRO A HB3  5  
ATOM 11262 H HG2  . PRO A 1 123 ? -7.937  -4.255  -13.414 1.00 0.00 ? 123 PRO A HG2  5  
ATOM 11263 H HG3  . PRO A 1 123 ? -7.260  -5.831  -13.770 1.00 0.00 ? 123 PRO A HG3  5  
ATOM 11264 H HD2  . PRO A 1 123 ? -9.903  -4.917  -14.405 1.00 0.00 ? 123 PRO A HD2  5  
ATOM 11265 H HD3  . PRO A 1 123 ? -9.263  -6.529  -14.656 1.00 0.00 ? 123 PRO A HD3  5  
ATOM 11266 N N    . ILE A 1 124 ? -10.867 -5.161  -9.619  1.00 0.00 ? 124 ILE A N    5  
ATOM 11267 C CA   . ILE A 1 124 ? -11.576 -4.171  -8.825  1.00 0.00 ? 124 ILE A CA   5  
ATOM 11268 C C    . ILE A 1 124 ? -10.562 -3.293  -8.090  1.00 0.00 ? 124 ILE A C    5  
ATOM 11269 O O    . ILE A 1 124 ? -9.730  -3.795  -7.337  1.00 0.00 ? 124 ILE A O    5  
ATOM 11270 C CB   . ILE A 1 124 ? -12.585 -4.851  -7.898  1.00 0.00 ? 124 ILE A CB   5  
ATOM 11271 C CG1  . ILE A 1 124 ? -13.767 -5.412  -8.691  1.00 0.00 ? 124 ILE A CG1  5  
ATOM 11272 C CG2  . ILE A 1 124 ? -13.040 -3.898  -6.791  1.00 0.00 ? 124 ILE A CG2  5  
ATOM 11273 C CD1  . ILE A 1 124 ? -13.719 -6.941  -8.737  1.00 0.00 ? 124 ILE A CD1  5  
ATOM 11274 H H    . ILE A 1 124 ? -10.845 -6.081  -9.226  1.00 0.00 ? 124 ILE A H    5  
ATOM 11275 H HA   . ILE A 1 124 ? -12.141 -3.544  -9.514  1.00 0.00 ? 124 ILE A HA   5  
ATOM 11276 H HB   . ILE A 1 124 ? -12.092 -5.694  -7.415  1.00 0.00 ? 124 ILE A HB   5  
ATOM 11277 H HG12 . ILE A 1 124 ? -14.702 -5.088  -8.237  1.00 0.00 ? 124 ILE A HG12 5  
ATOM 11278 H HG13 . ILE A 1 124 ? -13.750 -5.015  -9.706  1.00 0.00 ? 124 ILE A HG13 5  
ATOM 11279 H HG21 . ILE A 1 124 ? -12.652 -2.899  -6.988  1.00 0.00 ? 124 ILE A HG21 5  
ATOM 11280 H HG22 . ILE A 1 124 ? -14.130 -3.866  -6.764  1.00 0.00 ? 124 ILE A HG22 5  
ATOM 11281 H HG23 . ILE A 1 124 ? -12.664 -4.251  -5.830  1.00 0.00 ? 124 ILE A HG23 5  
ATOM 11282 H HD11 . ILE A 1 124 ? -12.730 -7.283  -8.432  1.00 0.00 ? 124 ILE A HD11 5  
ATOM 11283 H HD12 . ILE A 1 124 ? -14.468 -7.348  -8.059  1.00 0.00 ? 124 ILE A HD12 5  
ATOM 11284 H HD13 . ILE A 1 124 ? -13.924 -7.282  -9.753  1.00 0.00 ? 124 ILE A HD13 5  
ATOM 11285 N N    . PRO A 1 125 ? -10.665 -1.960  -8.343  1.00 0.00 ? 125 PRO A N    5  
ATOM 11286 C CA   . PRO A 1 125 ? -9.767  -1.006  -7.715  1.00 0.00 ? 125 PRO A CA   5  
ATOM 11287 C C    . PRO A 1 125 ? -10.137 -0.791  -6.245  1.00 0.00 ? 125 PRO A C    5  
ATOM 11288 O O    . PRO A 1 125 ? -10.257 0.345   -5.792  1.00 0.00 ? 125 PRO A O    5  
ATOM 11289 C CB   . PRO A 1 125 ? -9.890  0.258   -8.548  1.00 0.00 ? 125 PRO A CB   5  
ATOM 11290 C CG   . PRO A 1 125 ? -11.188 0.121   -9.327  1.00 0.00 ? 125 PRO A CG   5  
ATOM 11291 C CD   . PRO A 1 125 ? -11.637 -1.329  -9.231  1.00 0.00 ? 125 PRO A CD   5  
ATOM 11292 H HA   . PRO A 1 125 ? -8.832  -1.360  -7.713  1.00 0.00 ? 125 PRO A HA   5  
ATOM 11293 H HB2  . PRO A 1 125 ? -9.907  1.144   -7.914  1.00 0.00 ? 125 PRO A HB2  5  
ATOM 11294 H HB3  . PRO A 1 125 ? -9.040  0.365   -9.223  1.00 0.00 ? 125 PRO A HB3  5  
ATOM 11295 H HG2  . PRO A 1 125 ? -11.951 0.784   -8.918  1.00 0.00 ? 125 PRO A HG2  5  
ATOM 11296 H HG3  . PRO A 1 125 ? -11.042 0.406   -10.368 1.00 0.00 ? 125 PRO A HG3  5  
ATOM 11297 H HD2  . PRO A 1 125 ? -12.648 -1.404  -8.829  1.00 0.00 ? 125 PRO A HD2  5  
ATOM 11298 H HD3  . PRO A 1 125 ? -11.648 -1.805  -10.211 1.00 0.00 ? 125 PRO A HD3  5  
ATOM 11299 N N    . VAL A 1 126 ? -10.305 -1.902  -5.542  1.00 0.00 ? 126 VAL A N    5  
ATOM 11300 C CA   . VAL A 1 126 ? -10.658 -1.849  -4.134  1.00 0.00 ? 126 VAL A CA   5  
ATOM 11301 C C    . VAL A 1 126 ? -9.754  -0.841  -3.423  1.00 0.00 ? 126 VAL A C    5  
ATOM 11302 O O    . VAL A 1 126 ? -10.172 -0.196  -2.463  1.00 0.00 ? 126 VAL A O    5  
ATOM 11303 C CB   . VAL A 1 126 ? -10.586 -3.251  -3.524  1.00 0.00 ? 126 VAL A CB   5  
ATOM 11304 C CG1  . VAL A 1 126 ? -9.300  -3.966  -3.943  1.00 0.00 ? 126 VAL A CG1  5  
ATOM 11305 C CG2  . VAL A 1 126 ? -10.710 -3.192  -2.000  1.00 0.00 ? 126 VAL A CG2  5  
ATOM 11306 H H    . VAL A 1 126 ? -10.206 -2.823  -5.919  1.00 0.00 ? 126 VAL A H    5  
ATOM 11307 H HA   . VAL A 1 126 ? -11.690 -1.504  -4.066  1.00 0.00 ? 126 VAL A HA   5  
ATOM 11308 H HB   . VAL A 1 126 ? -11.429 -3.826  -3.906  1.00 0.00 ? 126 VAL A HB   5  
ATOM 11309 H HG11 . VAL A 1 126 ? -8.787  -3.375  -4.703  1.00 0.00 ? 126 VAL A HG11 5  
ATOM 11310 H HG12 . VAL A 1 126 ? -8.651  -4.084  -3.076  1.00 0.00 ? 126 VAL A HG12 5  
ATOM 11311 H HG13 . VAL A 1 126 ? -9.545  -4.947  -4.351  1.00 0.00 ? 126 VAL A HG13 5  
ATOM 11312 H HG21 . VAL A 1 126 ? -10.798 -2.154  -1.682  1.00 0.00 ? 126 VAL A HG21 5  
ATOM 11313 H HG22 . VAL A 1 126 ? -11.595 -3.745  -1.686  1.00 0.00 ? 126 VAL A HG22 5  
ATOM 11314 H HG23 . VAL A 1 126 ? -9.823  -3.637  -1.547  1.00 0.00 ? 126 VAL A HG23 5  
ATOM 11315 N N    . GLY A 1 127 ? -8.531  -0.736  -3.923  1.00 0.00 ? 127 GLY A N    5  
ATOM 11316 C CA   . GLY A 1 127 ? -7.564  0.183   -3.347  1.00 0.00 ? 127 GLY A CA   5  
ATOM 11317 C C    . GLY A 1 127 ? -7.947  1.635   -3.640  1.00 0.00 ? 127 GLY A C    5  
ATOM 11318 O O    . GLY A 1 127 ? -8.170  2.420   -2.720  1.00 0.00 ? 127 GLY A O    5  
ATOM 11319 H H    . GLY A 1 127 ? -8.199  -1.264  -4.703  1.00 0.00 ? 127 GLY A H    5  
ATOM 11320 H HA2  . GLY A 1 127 ? -7.506  0.029   -2.270  1.00 0.00 ? 127 GLY A HA2  5  
ATOM 11321 H HA3  . GLY A 1 127 ? -6.574  -0.025  -3.752  1.00 0.00 ? 127 GLY A HA3  5  
ATOM 11322 N N    . GLU A 1 128 ? -8.011  1.949   -4.925  1.00 0.00 ? 128 GLU A N    5  
ATOM 11323 C CA   . GLU A 1 128 ? -8.362  3.293   -5.352  1.00 0.00 ? 128 GLU A CA   5  
ATOM 11324 C C    . GLU A 1 128 ? -9.677  3.729   -4.702  1.00 0.00 ? 128 GLU A C    5  
ATOM 11325 O O    . GLU A 1 128 ? -9.816  4.876   -4.281  1.00 0.00 ? 128 GLU A O    5  
ATOM 11326 C CB   . GLU A 1 128 ? -8.449  3.380   -6.877  1.00 0.00 ? 128 GLU A CB   5  
ATOM 11327 C CG   . GLU A 1 128 ? -7.633  4.560   -7.406  1.00 0.00 ? 128 GLU A CG   5  
ATOM 11328 C CD   . GLU A 1 128 ? -7.808  4.713   -8.919  1.00 0.00 ? 128 GLU A CD   5  
ATOM 11329 O OE1  . GLU A 1 128 ? -7.200  3.896   -9.645  1.00 0.00 ? 128 GLU A OE1  5  
ATOM 11330 O OE2  . GLU A 1 128 ? -8.543  5.643   -9.314  1.00 0.00 ? 128 GLU A OE2  5  
ATOM 11331 H H    . GLU A 1 128 ? -7.829  1.304   -5.668  1.00 0.00 ? 128 GLU A H    5  
ATOM 11332 H HA   . GLU A 1 128 ? -7.549  3.929   -5.003  1.00 0.00 ? 128 GLU A HA   5  
ATOM 11333 H HB2  . GLU A 1 128 ? -8.084  2.453   -7.318  1.00 0.00 ? 128 GLU A HB2  5  
ATOM 11334 H HB3  . GLU A 1 128 ? -9.491  3.488   -7.180  1.00 0.00 ? 128 GLU A HB3  5  
ATOM 11335 H HG2  . GLU A 1 128 ? -7.947  5.477   -6.906  1.00 0.00 ? 128 GLU A HG2  5  
ATOM 11336 H HG3  . GLU A 1 128 ? -6.580  4.413   -7.171  1.00 0.00 ? 128 GLU A HG3  5  
ATOM 11337 N N    . ILE A 1 129 ? -10.610 2.789   -4.639  1.00 0.00 ? 129 ILE A N    5  
ATOM 11338 C CA   . ILE A 1 129 ? -11.908 3.062   -4.048  1.00 0.00 ? 129 ILE A CA   5  
ATOM 11339 C C    . ILE A 1 129 ? -11.722 3.475   -2.586  1.00 0.00 ? 129 ILE A C    5  
ATOM 11340 O O    . ILE A 1 129 ? -12.091 4.583   -2.199  1.00 0.00 ? 129 ILE A O    5  
ATOM 11341 C CB   . ILE A 1 129 ? -12.843 1.865   -4.233  1.00 0.00 ? 129 ILE A CB   5  
ATOM 11342 C CG1  . ILE A 1 129 ? -13.205 1.675   -5.707  1.00 0.00 ? 129 ILE A CG1  5  
ATOM 11343 C CG2  . ILE A 1 129 ? -14.086 1.998   -3.350  1.00 0.00 ? 129 ILE A CG2  5  
ATOM 11344 C CD1  . ILE A 1 129 ? -13.017 0.218   -6.135  1.00 0.00 ? 129 ILE A CD1  5  
ATOM 11345 H H    . ILE A 1 129 ? -10.488 1.858   -4.983  1.00 0.00 ? 129 ILE A H    5  
ATOM 11346 H HA   . ILE A 1 129 ? -12.345 3.899   -4.591  1.00 0.00 ? 129 ILE A HA   5  
ATOM 11347 H HB   . ILE A 1 129 ? -12.316 0.966   -3.912  1.00 0.00 ? 129 ILE A HB   5  
ATOM 11348 H HG12 . ILE A 1 129 ? -14.240 1.977   -5.873  1.00 0.00 ? 129 ILE A HG12 5  
ATOM 11349 H HG13 . ILE A 1 129 ? -12.582 2.322   -6.325  1.00 0.00 ? 129 ILE A HG13 5  
ATOM 11350 H HG21 . ILE A 1 129 ? -13.786 2.275   -2.340  1.00 0.00 ? 129 ILE A HG21 5  
ATOM 11351 H HG22 . ILE A 1 129 ? -14.741 2.768   -3.759  1.00 0.00 ? 129 ILE A HG22 5  
ATOM 11352 H HG23 . ILE A 1 129 ? -14.617 1.046   -3.324  1.00 0.00 ? 129 ILE A HG23 5  
ATOM 11353 H HD11 . ILE A 1 129 ? -12.330 -0.277  -5.448  1.00 0.00 ? 129 ILE A HD11 5  
ATOM 11354 H HD12 . ILE A 1 129 ? -13.979 -0.293  -6.117  1.00 0.00 ? 129 ILE A HD12 5  
ATOM 11355 H HD13 . ILE A 1 129 ? -12.607 0.186   -7.145  1.00 0.00 ? 129 ILE A HD13 5  
ATOM 11356 N N    . TYR A 1 130 ? -11.148 2.563   -1.814  1.00 0.00 ? 130 TYR A N    5  
ATOM 11357 C CA   . TYR A 1 130 ? -10.908 2.820   -0.405  1.00 0.00 ? 130 TYR A CA   5  
ATOM 11358 C C    . TYR A 1 130 ? -10.123 4.118   -0.209  1.00 0.00 ? 130 TYR A C    5  
ATOM 11359 O O    . TYR A 1 130 ? -10.377 4.866   0.733   1.00 0.00 ? 130 TYR A O    5  
ATOM 11360 C CB   . TYR A 1 130 ? -10.065 1.646   0.099   1.00 0.00 ? 130 TYR A CB   5  
ATOM 11361 C CG   . TYR A 1 130 ? -10.281 1.316   1.577   1.00 0.00 ? 130 TYR A CG   5  
ATOM 11362 C CD1  . TYR A 1 130 ? -11.559 1.270   2.095   1.00 0.00 ? 130 TYR A CD1  5  
ATOM 11363 C CD2  . TYR A 1 130 ? -9.197  1.062   2.393   1.00 0.00 ? 130 TYR A CD2  5  
ATOM 11364 C CE1  . TYR A 1 130 ? -11.762 0.958   3.486   1.00 0.00 ? 130 TYR A CE1  5  
ATOM 11365 C CE2  . TYR A 1 130 ? -9.398  0.750   3.784   1.00 0.00 ? 130 TYR A CE2  5  
ATOM 11366 C CZ   . TYR A 1 130 ? -10.672 0.714   4.262   1.00 0.00 ? 130 TYR A CZ   5  
ATOM 11367 O OH   . TYR A 1 130 ? -10.863 0.419   5.576   1.00 0.00 ? 130 TYR A OH   5  
ATOM 11368 H H    . TYR A 1 130 ? -10.851 1.665   -2.137  1.00 0.00 ? 130 TYR A H    5  
ATOM 11369 H HA   . TYR A 1 130 ? -11.875 2.911   0.090   1.00 0.00 ? 130 TYR A HA   5  
ATOM 11370 H HB2  . TYR A 1 130 ? -10.295 0.764   -0.498  1.00 0.00 ? 130 TYR A HB2  5  
ATOM 11371 H HB3  . TYR A 1 130 ? -9.011  1.874   -0.061  1.00 0.00 ? 130 TYR A HB3  5  
ATOM 11372 H HD1  . TYR A 1 130 ? -12.415 1.470   1.451   1.00 0.00 ? 130 TYR A HD1  5  
ATOM 11373 H HD2  . TYR A 1 130 ? -8.186  1.099   1.984   1.00 0.00 ? 130 TYR A HD2  5  
ATOM 11374 H HE1  . TYR A 1 130 ? -12.766 0.919   3.908   1.00 0.00 ? 130 TYR A HE1  5  
ATOM 11375 H HE2  . TYR A 1 130 ? -8.551  0.549   4.439   1.00 0.00 ? 130 TYR A HE2  5  
ATOM 11376 H HH   . TYR A 1 130 ? -10.437 -0.458  5.795   1.00 0.00 ? 130 TYR A HH   5  
ATOM 11377 N N    . LYS A 1 131 ? -9.183  4.346   -1.116  1.00 0.00 ? 131 LYS A N    5  
ATOM 11378 C CA   . LYS A 1 131 ? -8.359  5.541   -1.055  1.00 0.00 ? 131 LYS A CA   5  
ATOM 11379 C C    . LYS A 1 131 ? -9.257  6.779   -1.117  1.00 0.00 ? 131 LYS A C    5  
ATOM 11380 O O    . LYS A 1 131 ? -9.078  7.719   -0.345  1.00 0.00 ? 131 LYS A O    5  
ATOM 11381 C CB   . LYS A 1 131 ? -7.284  5.507   -2.144  1.00 0.00 ? 131 LYS A CB   5  
ATOM 11382 C CG   . LYS A 1 131 ? -6.905  6.921   -2.583  1.00 0.00 ? 131 LYS A CG   5  
ATOM 11383 C CD   . LYS A 1 131 ? -7.650  7.317   -3.860  1.00 0.00 ? 131 LYS A CD   5  
ATOM 11384 C CE   . LYS A 1 131 ? -7.390  8.784   -4.214  1.00 0.00 ? 131 LYS A CE   5  
ATOM 11385 N NZ   . LYS A 1 131 ? -8.669  9.506   -4.397  1.00 0.00 ? 131 LYS A NZ   5  
ATOM 11386 H H    . LYS A 1 131 ? -8.982  3.733   -1.880  1.00 0.00 ? 131 LYS A H    5  
ATOM 11387 H HA   . LYS A 1 131 ? -7.846  5.534   -0.095  1.00 0.00 ? 131 LYS A HA   5  
ATOM 11388 H HB2  . LYS A 1 131 ? -6.402  4.988   -1.771  1.00 0.00 ? 131 LYS A HB2  5  
ATOM 11389 H HB3  . LYS A 1 131 ? -7.648  4.941   -3.002  1.00 0.00 ? 131 LYS A HB3  5  
ATOM 11390 H HG2  . LYS A 1 131 ? -7.138  7.629   -1.788  1.00 0.00 ? 131 LYS A HG2  5  
ATOM 11391 H HG3  . LYS A 1 131 ? -5.829  6.977   -2.754  1.00 0.00 ? 131 LYS A HG3  5  
ATOM 11392 H HD2  . LYS A 1 131 ? -7.331  6.679   -4.685  1.00 0.00 ? 131 LYS A HD2  5  
ATOM 11393 H HD3  . LYS A 1 131 ? -8.719  7.155   -3.727  1.00 0.00 ? 131 LYS A HD3  5  
ATOM 11394 H HE2  . LYS A 1 131 ? -6.808  9.257   -3.423  1.00 0.00 ? 131 LYS A HE2  5  
ATOM 11395 H HE3  . LYS A 1 131 ? -6.797  8.844   -5.127  1.00 0.00 ? 131 LYS A HE3  5  
ATOM 11396 H HZ1  . LYS A 1 131 ? -9.204  9.457   -3.554  1.00 0.00 ? 131 LYS A HZ1  5  
ATOM 11397 H HZ2  . LYS A 1 131 ? -8.481  10.464  -4.618  1.00 0.00 ? 131 LYS A HZ2  5  
ATOM 11398 H HZ3  . LYS A 1 131 ? -9.184  9.087   -5.145  1.00 0.00 ? 131 LYS A HZ3  5  
ATOM 11399 N N    . ARG A 1 132 ? -10.204 6.737   -2.044  1.00 0.00 ? 132 ARG A N    5  
ATOM 11400 C CA   . ARG A 1 132 ? -11.130 7.844   -2.217  1.00 0.00 ? 132 ARG A CA   5  
ATOM 11401 C C    . ARG A 1 132 ? -12.076 7.936   -1.017  1.00 0.00 ? 132 ARG A C    5  
ATOM 11402 O O    . ARG A 1 132 ? -12.471 9.030   -0.616  1.00 0.00 ? 132 ARG A O    5  
ATOM 11403 C CB   . ARG A 1 132 ? -11.953 7.679   -3.495  1.00 0.00 ? 132 ARG A CB   5  
ATOM 11404 C CG   . ARG A 1 132 ? -12.132 9.019   -4.210  1.00 0.00 ? 132 ARG A CG   5  
ATOM 11405 C CD   . ARG A 1 132 ? -13.436 9.698   -3.783  1.00 0.00 ? 132 ARG A CD   5  
ATOM 11406 N NE   . ARG A 1 132 ? -13.670 10.906  -4.605  1.00 0.00 ? 132 ARG A NE   5  
ATOM 11407 C CZ   . ARG A 1 132 ? -14.132 10.880  -5.862  1.00 0.00 ? 132 ARG A CZ   5  
ATOM 11408 N NH1  . ARG A 1 132 ? -14.413 9.708   -6.450  1.00 0.00 ? 132 ARG A NH1  5  
ATOM 11409 N NH2  . ARG A 1 132 ? -14.314 12.025  -6.533  1.00 0.00 ? 132 ARG A NH2  5  
ATOM 11410 H H    . ARG A 1 132 ? -10.343 5.969   -2.667  1.00 0.00 ? 132 ARG A H    5  
ATOM 11411 H HA   . ARG A 1 132 ? -10.498 8.728   -2.285  1.00 0.00 ? 132 ARG A HA   5  
ATOM 11412 H HB2  . ARG A 1 132 ? -11.459 6.971   -4.161  1.00 0.00 ? 132 ARG A HB2  5  
ATOM 11413 H HB3  . ARG A 1 132 ? -12.930 7.259   -3.252  1.00 0.00 ? 132 ARG A HB3  5  
ATOM 11414 H HG2  . ARG A 1 132 ? -11.288 9.671   -3.983  1.00 0.00 ? 132 ARG A HG2  5  
ATOM 11415 H HG3  . ARG A 1 132 ? -12.136 8.863   -5.288  1.00 0.00 ? 132 ARG A HG3  5  
ATOM 11416 H HD2  . ARG A 1 132 ? -14.269 9.005   -3.894  1.00 0.00 ? 132 ARG A HD2  5  
ATOM 11417 H HD3  . ARG A 1 132 ? -13.386 9.970   -2.729  1.00 0.00 ? 132 ARG A HD3  5  
ATOM 11418 H HE   . ARG A 1 132 ? -13.471 11.797  -4.197  1.00 0.00 ? 132 ARG A HE   5  
ATOM 11419 H HH11 . ARG A 1 132 ? -14.277 8.854   -5.949  1.00 0.00 ? 132 ARG A HH11 5  
ATOM 11420 H HH12 . ARG A 1 132 ? -14.758 9.689   -7.388  1.00 0.00 ? 132 ARG A HH12 5  
ATOM 11421 H HH21 . ARG A 1 132 ? -14.106 12.901  -6.095  1.00 0.00 ? 132 ARG A HH21 5  
ATOM 11422 H HH22 . ARG A 1 132 ? -14.660 12.006  -7.472  1.00 0.00 ? 132 ARG A HH22 5  
ATOM 11423 N N    . TRP A 1 133 ? -12.412 6.773   -0.479  1.00 0.00 ? 133 TRP A N    5  
ATOM 11424 C CA   . TRP A 1 133 ? -13.304 6.709   0.666   1.00 0.00 ? 133 TRP A CA   5  
ATOM 11425 C C    . TRP A 1 133 ? -12.627 7.427   1.835   1.00 0.00 ? 133 TRP A C    5  
ATOM 11426 O O    . TRP A 1 133 ? -13.092 8.476   2.277   1.00 0.00 ? 133 TRP A O    5  
ATOM 11427 C CB   . TRP A 1 133 ? -13.677 5.261   0.990   1.00 0.00 ? 133 TRP A CB   5  
ATOM 11428 C CG   . TRP A 1 133 ? -14.658 4.634   -0.003  1.00 0.00 ? 133 TRP A CG   5  
ATOM 11429 C CD1  . TRP A 1 133 ? -14.893 4.997   -1.271  1.00 0.00 ? 133 TRP A CD1  5  
ATOM 11430 C CD2  . TRP A 1 133 ? -15.530 3.510   0.243   1.00 0.00 ? 133 TRP A CD2  5  
ATOM 11431 N NE1  . TRP A 1 133 ? -15.851 4.195   -1.857  1.00 0.00 ? 133 TRP A NE1  5  
ATOM 11432 C CE2  . TRP A 1 133 ? -16.250 3.262   -0.907  1.00 0.00 ? 133 TRP A CE2  5  
ATOM 11433 C CE3  . TRP A 1 133 ? -15.705 2.731   1.400   1.00 0.00 ? 133 TRP A CE3  5  
ATOM 11434 C CZ2  . TRP A 1 133 ? -17.193 2.233   -1.014  1.00 0.00 ? 133 TRP A CZ2  5  
ATOM 11435 C CZ3  . TRP A 1 133 ? -16.652 1.707   1.278   1.00 0.00 ? 133 TRP A CZ3  5  
ATOM 11436 C CH2  . TRP A 1 133 ? -17.385 1.443   0.126   1.00 0.00 ? 133 TRP A CH2  5  
ATOM 11437 H H    . TRP A 1 133 ? -12.087 5.888   -0.810  1.00 0.00 ? 133 TRP A H    5  
ATOM 11438 H HA   . TRP A 1 133 ? -14.227 7.222   0.399   1.00 0.00 ? 133 TRP A HA   5  
ATOM 11439 H HB2  . TRP A 1 133 ? -12.768 4.660   1.017   1.00 0.00 ? 133 TRP A HB2  5  
ATOM 11440 H HB3  . TRP A 1 133 ? -14.113 5.223   1.988   1.00 0.00 ? 133 TRP A HB3  5  
ATOM 11441 H HD1  . TRP A 1 133 ? -14.393 5.824   -1.774  1.00 0.00 ? 133 TRP A HD1  5  
ATOM 11442 H HE1  . TRP A 1 133 ? -16.225 4.277   -2.878  1.00 0.00 ? 133 TRP A HE1  5  
ATOM 11443 H HE3  . TRP A 1 133 ? -15.150 2.908   2.321   1.00 0.00 ? 133 TRP A HE3  5  
ATOM 11444 H HZ2  . TRP A 1 133 ? -17.749 2.057   -1.935  1.00 0.00 ? 133 TRP A HZ2  5  
ATOM 11445 H HZ3  . TRP A 1 133 ? -16.827 1.072   2.146   1.00 0.00 ? 133 TRP A HZ3  5  
ATOM 11446 H HH2  . TRP A 1 133 ? -18.105 0.625   0.111   1.00 0.00 ? 133 TRP A HH2  5  
ATOM 11447 N N    . ILE A 1 134 ? -11.538 6.833   2.302   1.00 0.00 ? 134 ILE A N    5  
ATOM 11448 C CA   . ILE A 1 134 ? -10.792 7.404   3.411   1.00 0.00 ? 134 ILE A CA   5  
ATOM 11449 C C    . ILE A 1 134 ? -10.635 8.910   3.194   1.00 0.00 ? 134 ILE A C    5  
ATOM 11450 O O    . ILE A 1 134 ? -10.935 9.703   4.084   1.00 0.00 ? 134 ILE A O    5  
ATOM 11451 C CB   . ILE A 1 134 ? -9.463  6.668   3.597   1.00 0.00 ? 134 ILE A CB   5  
ATOM 11452 C CG1  . ILE A 1 134 ? -9.686  5.275   4.187   1.00 0.00 ? 134 ILE A CG1  5  
ATOM 11453 C CG2  . ILE A 1 134 ? -8.489  7.498   4.436   1.00 0.00 ? 134 ILE A CG2  5  
ATOM 11454 C CD1  . ILE A 1 134 ? -8.366  4.510   4.302   1.00 0.00 ? 134 ILE A CD1  5  
ATOM 11455 H H    . ILE A 1 134 ? -11.167 5.981   1.937   1.00 0.00 ? 134 ILE A H    5  
ATOM 11456 H HA   . ILE A 1 134 ? -11.378 7.244   4.315   1.00 0.00 ? 134 ILE A HA   5  
ATOM 11457 H HB   . ILE A 1 134 ? -9.007  6.533   2.616   1.00 0.00 ? 134 ILE A HB   5  
ATOM 11458 H HG12 . ILE A 1 134 ? -10.146 5.363   5.172   1.00 0.00 ? 134 ILE A HG12 5  
ATOM 11459 H HG13 . ILE A 1 134 ? -10.381 4.716   3.560   1.00 0.00 ? 134 ILE A HG13 5  
ATOM 11460 H HG21 . ILE A 1 134 ? -8.996  8.392   4.802   1.00 0.00 ? 134 ILE A HG21 5  
ATOM 11461 H HG22 . ILE A 1 134 ? -8.143  6.905   5.283   1.00 0.00 ? 134 ILE A HG22 5  
ATOM 11462 H HG23 . ILE A 1 134 ? -7.637  7.788   3.822   1.00 0.00 ? 134 ILE A HG23 5  
ATOM 11463 H HD11 . ILE A 1 134 ? -7.554  5.212   4.492   1.00 0.00 ? 134 ILE A HD11 5  
ATOM 11464 H HD12 . ILE A 1 134 ? -8.428  3.798   5.125   1.00 0.00 ? 134 ILE A HD12 5  
ATOM 11465 H HD13 . ILE A 1 134 ? -8.174  3.974   3.372   1.00 0.00 ? 134 ILE A HD13 5  
ATOM 11466 N N    . ILE A 1 135 ? -10.166 9.258   2.004   1.00 0.00 ? 135 ILE A N    5  
ATOM 11467 C CA   . ILE A 1 135 ? -9.966  10.656  1.659   1.00 0.00 ? 135 ILE A CA   5  
ATOM 11468 C C    . ILE A 1 135 ? -11.293 11.405  1.797   1.00 0.00 ? 135 ILE A C    5  
ATOM 11469 O O    . ILE A 1 135 ? -11.314 12.568  2.200   1.00 0.00 ? 135 ILE A O    5  
ATOM 11470 C CB   . ILE A 1 135 ? -9.333  10.780  0.272   1.00 0.00 ? 135 ILE A CB   5  
ATOM 11471 C CG1  . ILE A 1 135 ? -7.806  10.827  0.369   1.00 0.00 ? 135 ILE A CG1  5  
ATOM 11472 C CG2  . ILE A 1 135 ? -9.897  11.984  -0.484  1.00 0.00 ? 135 ILE A CG2  5  
ATOM 11473 C CD1  . ILE A 1 135 ? -7.280  9.714   1.276   1.00 0.00 ? 135 ILE A CD1  5  
ATOM 11474 H H    . ILE A 1 135 ? -9.925  8.607   1.285   1.00 0.00 ? 135 ILE A H    5  
ATOM 11475 H HA   . ILE A 1 135 ? -9.258  11.072  2.376   1.00 0.00 ? 135 ILE A HA   5  
ATOM 11476 H HB   . ILE A 1 135 ? -9.591  9.890   -0.302  1.00 0.00 ? 135 ILE A HB   5  
ATOM 11477 H HG12 . ILE A 1 135 ? -7.372  10.727  -0.625  1.00 0.00 ? 135 ILE A HG12 5  
ATOM 11478 H HG13 . ILE A 1 135 ? -7.493  11.796  0.758   1.00 0.00 ? 135 ILE A HG13 5  
ATOM 11479 H HG21 . ILE A 1 135 ? -10.090 12.795  0.218   1.00 0.00 ? 135 ILE A HG21 5  
ATOM 11480 H HG22 . ILE A 1 135 ? -9.175  12.316  -1.230  1.00 0.00 ? 135 ILE A HG22 5  
ATOM 11481 H HG23 . ILE A 1 135 ? -10.825 11.701  -0.977  1.00 0.00 ? 135 ILE A HG23 5  
ATOM 11482 H HD11 . ILE A 1 135 ? -7.706  9.824   2.274   1.00 0.00 ? 135 ILE A HD11 5  
ATOM 11483 H HD12 . ILE A 1 135 ? -7.565  8.744   0.866   1.00 0.00 ? 135 ILE A HD12 5  
ATOM 11484 H HD13 . ILE A 1 135 ? -6.193  9.776   1.336   1.00 0.00 ? 135 ILE A HD13 5  
ATOM 11485 N N    . LEU A 1 136 ? -12.367 10.710  1.456   1.00 0.00 ? 136 LEU A N    5  
ATOM 11486 C CA   . LEU A 1 136 ? -13.695 11.295  1.538   1.00 0.00 ? 136 LEU A CA   5  
ATOM 11487 C C    . LEU A 1 136 ? -13.963 11.744  2.975   1.00 0.00 ? 136 LEU A C    5  
ATOM 11488 O O    . LEU A 1 136 ? -14.421 12.862  3.206   1.00 0.00 ? 136 LEU A O    5  
ATOM 11489 C CB   . LEU A 1 136 ? -14.744 10.324  0.991   1.00 0.00 ? 136 LEU A CB   5  
ATOM 11490 C CG   . LEU A 1 136 ? -15.696 10.889  -0.065  1.00 0.00 ? 136 LEU A CG   5  
ATOM 11491 C CD1  . LEU A 1 136 ? -16.053 9.827   -1.106  1.00 0.00 ? 136 LEU A CD1  5  
ATOM 11492 C CD2  . LEU A 1 136 ? -16.941 11.494  0.588   1.00 0.00 ? 136 LEU A CD2  5  
ATOM 11493 H H    . LEU A 1 136 ? -12.342 9.765   1.130   1.00 0.00 ? 136 LEU A H    5  
ATOM 11494 H HA   . LEU A 1 136 ? -13.705 12.175  0.894   1.00 0.00 ? 136 LEU A HA   5  
ATOM 11495 H HB2  . LEU A 1 136 ? -14.226 9.466   0.562   1.00 0.00 ? 136 LEU A HB2  5  
ATOM 11496 H HB3  . LEU A 1 136 ? -15.338 9.954   1.826   1.00 0.00 ? 136 LEU A HB3  5  
ATOM 11497 H HG   . LEU A 1 136 ? -15.185 11.696  -0.590  1.00 0.00 ? 136 LEU A HG   5  
ATOM 11498 H HD11 . LEU A 1 136 ? -16.147 8.857   -0.618  1.00 0.00 ? 136 LEU A HD11 5  
ATOM 11499 H HD12 . LEU A 1 136 ? -16.999 10.087  -1.581  1.00 0.00 ? 136 LEU A HD12 5  
ATOM 11500 H HD13 . LEU A 1 136 ? -15.268 9.780   -1.861  1.00 0.00 ? 136 LEU A HD13 5  
ATOM 11501 H HD21 . LEU A 1 136 ? -16.639 12.207  1.355   1.00 0.00 ? 136 LEU A HD21 5  
ATOM 11502 H HD22 . LEU A 1 136 ? -17.536 12.004  -0.169  1.00 0.00 ? 136 LEU A HD22 5  
ATOM 11503 H HD23 . LEU A 1 136 ? -17.535 10.700  1.042   1.00 0.00 ? 136 LEU A HD23 5  
ATOM 11504 N N    . GLY A 1 137 ? -13.666 10.848  3.906   1.00 0.00 ? 137 GLY A N    5  
ATOM 11505 C CA   . GLY A 1 137 ? -13.869 11.139  5.315   1.00 0.00 ? 137 GLY A CA   5  
ATOM 11506 C C    . GLY A 1 137 ? -12.960 12.280  5.777   1.00 0.00 ? 137 GLY A C    5  
ATOM 11507 O O    . GLY A 1 137 ? -13.425 13.240  6.388   1.00 0.00 ? 137 GLY A O    5  
ATOM 11508 H H    . GLY A 1 137 ? -13.293 9.941   3.710   1.00 0.00 ? 137 GLY A H    5  
ATOM 11509 H HA2  . GLY A 1 137 ? -14.911 11.405  5.488   1.00 0.00 ? 137 GLY A HA2  5  
ATOM 11510 H HA3  . GLY A 1 137 ? -13.665 10.246  5.906   1.00 0.00 ? 137 GLY A HA3  5  
ATOM 11511 N N    . LEU A 1 138 ? -11.680 12.138  5.465   1.00 0.00 ? 138 LEU A N    5  
ATOM 11512 C CA   . LEU A 1 138 ? -10.702 13.146  5.840   1.00 0.00 ? 138 LEU A CA   5  
ATOM 11513 C C    . LEU A 1 138 ? -11.216 14.527  5.428   1.00 0.00 ? 138 LEU A C    5  
ATOM 11514 O O    . LEU A 1 138 ? -11.175 15.468  6.218   1.00 0.00 ? 138 LEU A O    5  
ATOM 11515 C CB   . LEU A 1 138 ? -9.329  12.801  5.259   1.00 0.00 ? 138 LEU A CB   5  
ATOM 11516 C CG   . LEU A 1 138 ? -8.443  11.900  6.122   1.00 0.00 ? 138 LEU A CG   5  
ATOM 11517 C CD1  . LEU A 1 138 ? -7.209  11.438  5.345   1.00 0.00 ? 138 LEU A CD1  5  
ATOM 11518 C CD2  . LEU A 1 138 ? -8.069  12.592  7.434   1.00 0.00 ? 138 LEU A CD2  5  
ATOM 11519 H H    . LEU A 1 138 ? -11.310 11.355  4.967   1.00 0.00 ? 138 LEU A H    5  
ATOM 11520 H HA   . LEU A 1 138 ? -10.609 13.122  6.926   1.00 0.00 ? 138 LEU A HA   5  
ATOM 11521 H HB2  . LEU A 1 138 ? -9.475  12.317  4.295   1.00 0.00 ? 138 LEU A HB2  5  
ATOM 11522 H HB3  . LEU A 1 138 ? -8.793  13.732  5.072   1.00 0.00 ? 138 LEU A HB3  5  
ATOM 11523 H HG   . LEU A 1 138 ? -9.013  11.007  6.380   1.00 0.00 ? 138 LEU A HG   5  
ATOM 11524 H HD11 . LEU A 1 138 ? -