data_1GZH
# 
_entry.id   1GZH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GZH         
PDBE  EBI-9811     
WWPDB D_1290009811 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A1U unspecified 'SOLUTION STRUCTURE DETERMINATION OF A P53 MUTANT DIMERIZATION DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE' 
PDB 1AIE unspecified 'P53 TETRAMERIZATION DOMAIN CRYSTAL STRUCTURE' 
PDB 1DT7 unspecified 
'SOLUTION STRUCTURE OF THE C-TERMINAL NEGATIVE REGULATORY DOMAIN OF P53 IN A COMPLEX WITH CA2+-BOUND S100B(BB)'          
PDB 1HS5 unspecified 'NMR SOLUTION STRUCTURE OF DESIGNED P53 DIMER' 
PDB 1KZY unspecified 'CRYSTAL STRUCTURE OF THE 53BP1 BRCT REGION COMPLEXED TOTUMOR SUPPRESSOR P53' 
PDB 1OLG unspecified 'P53 (OLIGOMERIZATION DOMAIN) (NMR, MINIMIZED AVERAGE STRUCTURE)' 
PDB 1OLH unspecified 'P53 (OLIGOMERIZATION DOMAIN) (NMR, 35 STRUCTURES)' 
PDB 1PES unspecified 'TUMOR ANTIGEN P53 (TETRAMERIZATION DOMAIN) (P53TET) (NMR, MINIMIZED AVERAGE STRUCTURE)' 
PDB 1PET unspecified 'TUMOR ANTIGEN P53 (TETRAMERIZATION DOMAIN) (P53TET) (NMR, 19 STRUCTURES)' 
PDB 1SAE unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAC STRUCTURES)' 
PDB 1SAF unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAD STRUCTURES)' 
PDB 1SAG unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAC STRUCTURES)' 
PDB 1SAH unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAD STRUCTURES)' 
PDB 1SAI unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAC STRUCTURES)' 
PDB 1SAJ unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAD STRUCTURES)' 
PDB 1SAK unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAC STRUCTURES)' 
PDB 1SAL unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAD STRUCTURES)' 
PDB 1TSR unspecified 'P53 CORE DOMAIN IN COMPLEX WITH DEOXYRIBONUCLEIC ACID' 
PDB 1TUP unspecified 'TUMOR SUPPRESSOR P53 COMPLEXED WITH DEOXYRIBONUCLEIC ACID' 
PDB 1YCQ unspecified 'XENOPUS LAEVIS MDM2 BOUND TO THE TRANSACTIVATION DOMAIN OF HUMAN P53' 
PDB 1YCS unspecified 'P53-53BP2 COMPLEX' 
PDB 3SAK unspecified 
'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI- DIMENSIONAL NMR (SAC STRUCTURES)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GZH 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Derbyshire, D.J.' 1 
'Doherty, A.J.'    2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Structure of Human 53BP1 Brct Domains Bound to P53 Tumour Suppressor' 'Embo J.'                  21 3863 ? 2002 
EMJODG UK 0261-4189 0897 ? 12110597 10.1093/EMBOJ/CDF383      
1       
'Purification, Crystallization and Preliminary X-Ray Analysis of the Brct Domains of Human 53BP1 Bound to the P53 Tumour Suppressor.' 
'Acta Crystallogr.,Sect.D' 58 1826 ? 2002 ABCRE6 DK 0907-4449 0766 ? 12351827 10.1107/S0907444902010910 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Derbyshire, D.J.' 1  
primary 'Basu, B.P.'       2  
primary 'Serpell, L.'      3  
primary 'Joo, W.'          4  
primary 'Date, T.'         5  
primary 'Iwabuchi, K.'     6  
primary 'Doherty, A.J.'    7  
1       'Derbyshire, D.J.' 8  
1       'Basu, B.P.'       9  
1       'Date, T.'         10 
1       'Iwabuchi, K.'     11 
1       'Doherty, A.J.'    12 
# 
_cell.entry_id           1GZH 
_cell.length_a           71.520 
_cell.length_b           94.570 
_cell.length_c           136.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GZH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CELLULAR TUMOR ANTIGEN P53'             22375.479 1   ? ? 'DNA BINDING REGION, RESIDUES 95-292'    ? 
2 polymer     man 'TUMOR SUPPRESSOR P53-BINDING PROTEIN 1' 28175.900 2   ? ? 'BRCT TANDEM REPEAT, RESIDUES 1724-1972' ? 
3 polymer     man 'CELLULAR TUMOR ANTIGEN P53'             22361.453 1   ? ? 'DNA BINDING REGION, RESIDUES 95-292'    ? 
4 non-polymer syn 'ZINC ION'                               65.409    2   ? ? ?                                        ? 
5 non-polymer syn 'SULFATE ION'                            96.063    2   ? ? ?                                        ? 
6 water       nat water                                    18.015    110 ? ? ?                                        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TUMOR SUPPRESSOR P53, PHOSPHOPROTEIN P53, ANTIGEN NY-CO-13' 
2 'P53-BINDING PROTEIN 1,53BP1'                                
3 'TUMOR SUPPRESSOR P53, PHOSPHOPROTEIN P53, ANTIGEN NY-CO-13' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR
RCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSECTTIHYNYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
;
;SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR
RCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSECTTIHYNYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
;
A   ? 
2 'polypeptide(L)' no no 
;LNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCL
LIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQN
FLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHP
KYKHDYVSH
;
;LNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCL
LIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQN
FLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHP
KYKHDYVSH
;
B,D ? 
3 'polypeptide(L)' no no 
;SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR
RCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
;
;SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR
RCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI
ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
;
C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   VAL n 
1 4   PRO n 
1 5   SER n 
1 6   GLN n 
1 7   LYS n 
1 8   THR n 
1 9   TYR n 
1 10  GLN n 
1 11  GLY n 
1 12  SER n 
1 13  TYR n 
1 14  GLY n 
1 15  PHE n 
1 16  ARG n 
1 17  LEU n 
1 18  GLY n 
1 19  PHE n 
1 20  LEU n 
1 21  HIS n 
1 22  SER n 
1 23  GLY n 
1 24  THR n 
1 25  ALA n 
1 26  LYS n 
1 27  SER n 
1 28  VAL n 
1 29  THR n 
1 30  CYS n 
1 31  THR n 
1 32  TYR n 
1 33  SER n 
1 34  PRO n 
1 35  ALA n 
1 36  LEU n 
1 37  ASN n 
1 38  LYS n 
1 39  MET n 
1 40  PHE n 
1 41  CYS n 
1 42  GLN n 
1 43  LEU n 
1 44  ALA n 
1 45  LYS n 
1 46  THR n 
1 47  CYS n 
1 48  PRO n 
1 49  VAL n 
1 50  GLN n 
1 51  LEU n 
1 52  TRP n 
1 53  VAL n 
1 54  ASP n 
1 55  SER n 
1 56  THR n 
1 57  PRO n 
1 58  PRO n 
1 59  PRO n 
1 60  GLY n 
1 61  THR n 
1 62  ARG n 
1 63  VAL n 
1 64  ARG n 
1 65  ALA n 
1 66  MET n 
1 67  ALA n 
1 68  ILE n 
1 69  TYR n 
1 70  LYS n 
1 71  GLN n 
1 72  SER n 
1 73  GLN n 
1 74  HIS n 
1 75  MET n 
1 76  THR n 
1 77  GLU n 
1 78  VAL n 
1 79  VAL n 
1 80  ARG n 
1 81  ARG n 
1 82  CYS n 
1 83  PRO n 
1 84  HIS n 
1 85  HIS n 
1 86  GLU n 
1 87  ARG n 
1 88  CYS n 
1 89  SER n 
1 90  ASP n 
1 91  SER n 
1 92  ASP n 
1 93  GLY n 
1 94  LEU n 
1 95  ALA n 
1 96  PRO n 
1 97  PRO n 
1 98  GLN n 
1 99  HIS n 
1 100 LEU n 
1 101 ILE n 
1 102 ARG n 
1 103 VAL n 
1 104 GLU n 
1 105 GLY n 
1 106 ASN n 
1 107 LEU n 
1 108 ARG n 
1 109 VAL n 
1 110 GLU n 
1 111 TYR n 
1 112 LEU n 
1 113 ASP n 
1 114 ASP n 
1 115 ARG n 
1 116 ASN n 
1 117 THR n 
1 118 PHE n 
1 119 ARG n 
1 120 HIS n 
1 121 SER n 
1 122 VAL n 
1 123 VAL n 
1 124 VAL n 
1 125 PRO n 
1 126 TYR n 
1 127 GLU n 
1 128 PRO n 
1 129 PRO n 
1 130 GLU n 
1 131 VAL n 
1 132 GLY n 
1 133 SER n 
1 134 GLU n 
1 135 CYS n 
1 136 THR n 
1 137 THR n 
1 138 ILE n 
1 139 HIS n 
1 140 TYR n 
1 141 ASN n 
1 142 TYR n 
1 143 MET n 
1 144 CYS n 
1 145 ASN n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 MET n 
1 150 GLY n 
1 151 GLY n 
1 152 MET n 
1 153 ASN n 
1 154 ARG n 
1 155 ARG n 
1 156 PRO n 
1 157 ILE n 
1 158 LEU n 
1 159 THR n 
1 160 ILE n 
1 161 ILE n 
1 162 THR n 
1 163 LEU n 
1 164 GLU n 
1 165 ASP n 
1 166 SER n 
1 167 SER n 
1 168 GLY n 
1 169 ASN n 
1 170 LEU n 
1 171 LEU n 
1 172 GLY n 
1 173 ARG n 
1 174 ASN n 
1 175 SER n 
1 176 PHE n 
1 177 GLU n 
1 178 VAL n 
1 179 ARG n 
1 180 VAL n 
1 181 CYS n 
1 182 ALA n 
1 183 CYS n 
1 184 PRO n 
1 185 GLY n 
1 186 ARG n 
1 187 ASP n 
1 188 ARG n 
1 189 ARG n 
1 190 THR n 
1 191 GLU n 
1 192 GLU n 
1 193 GLU n 
1 194 ASN n 
1 195 LEU n 
1 196 ARG n 
1 197 LYS n 
1 198 LYS n 
2 1   LEU n 
2 2   ASN n 
2 3   LYS n 
2 4   THR n 
2 5   LEU n 
2 6   PHE n 
2 7   LEU n 
2 8   GLY n 
2 9   TYR n 
2 10  ALA n 
2 11  PHE n 
2 12  LEU n 
2 13  LEU n 
2 14  THR n 
2 15  MET n 
2 16  ALA n 
2 17  THR n 
2 18  THR n 
2 19  SER n 
2 20  ASP n 
2 21  LYS n 
2 22  LEU n 
2 23  ALA n 
2 24  SER n 
2 25  ARG n 
2 26  SER n 
2 27  LYS n 
2 28  LEU n 
2 29  PRO n 
2 30  ASP n 
2 31  GLY n 
2 32  PRO n 
2 33  THR n 
2 34  GLY n 
2 35  SER n 
2 36  SER n 
2 37  GLU n 
2 38  GLU n 
2 39  GLU n 
2 40  GLU n 
2 41  GLU n 
2 42  PHE n 
2 43  LEU n 
2 44  GLU n 
2 45  ILE n 
2 46  PRO n 
2 47  PRO n 
2 48  PHE n 
2 49  ASN n 
2 50  LYS n 
2 51  GLN n 
2 52  TYR n 
2 53  THR n 
2 54  GLU n 
2 55  SER n 
2 56  GLN n 
2 57  LEU n 
2 58  ARG n 
2 59  ALA n 
2 60  GLY n 
2 61  ALA n 
2 62  GLY n 
2 63  TYR n 
2 64  ILE n 
2 65  LEU n 
2 66  GLU n 
2 67  ASP n 
2 68  PHE n 
2 69  ASN n 
2 70  GLU n 
2 71  ALA n 
2 72  GLN n 
2 73  CYS n 
2 74  ASN n 
2 75  THR n 
2 76  ALA n 
2 77  TYR n 
2 78  GLN n 
2 79  CYS n 
2 80  LEU n 
2 81  LEU n 
2 82  ILE n 
2 83  ALA n 
2 84  ASP n 
2 85  GLN n 
2 86  HIS n 
2 87  CYS n 
2 88  ARG n 
2 89  THR n 
2 90  ARG n 
2 91  LYS n 
2 92  TYR n 
2 93  PHE n 
2 94  LEU n 
2 95  CYS n 
2 96  LEU n 
2 97  ALA n 
2 98  SER n 
2 99  GLY n 
2 100 ILE n 
2 101 PRO n 
2 102 CYS n 
2 103 VAL n 
2 104 SER n 
2 105 HIS n 
2 106 VAL n 
2 107 TRP n 
2 108 VAL n 
2 109 HIS n 
2 110 ASP n 
2 111 SER n 
2 112 CYS n 
2 113 HIS n 
2 114 ALA n 
2 115 ASN n 
2 116 GLN n 
2 117 LEU n 
2 118 GLN n 
2 119 ASN n 
2 120 TYR n 
2 121 ARG n 
2 122 ASN n 
2 123 TYR n 
2 124 LEU n 
2 125 LEU n 
2 126 PRO n 
2 127 ALA n 
2 128 GLY n 
2 129 TYR n 
2 130 SER n 
2 131 LEU n 
2 132 GLU n 
2 133 GLU n 
2 134 GLN n 
2 135 ARG n 
2 136 ILE n 
2 137 LEU n 
2 138 ASP n 
2 139 TRP n 
2 140 GLN n 
2 141 PRO n 
2 142 ARG n 
2 143 GLU n 
2 144 ASN n 
2 145 PRO n 
2 146 PHE n 
2 147 GLN n 
2 148 ASN n 
2 149 LEU n 
2 150 LYS n 
2 151 VAL n 
2 152 LEU n 
2 153 LEU n 
2 154 VAL n 
2 155 SER n 
2 156 ASP n 
2 157 GLN n 
2 158 GLN n 
2 159 GLN n 
2 160 ASN n 
2 161 PHE n 
2 162 LEU n 
2 163 GLU n 
2 164 LEU n 
2 165 TRP n 
2 166 SER n 
2 167 GLU n 
2 168 ILE n 
2 169 LEU n 
2 170 MET n 
2 171 THR n 
2 172 GLY n 
2 173 GLY n 
2 174 ALA n 
2 175 ALA n 
2 176 SER n 
2 177 VAL n 
2 178 LYS n 
2 179 GLN n 
2 180 HIS n 
2 181 HIS n 
2 182 SER n 
2 183 SER n 
2 184 ALA n 
2 185 HIS n 
2 186 ASN n 
2 187 LYS n 
2 188 ASP n 
2 189 ILE n 
2 190 ALA n 
2 191 LEU n 
2 192 GLY n 
2 193 VAL n 
2 194 PHE n 
2 195 ASP n 
2 196 VAL n 
2 197 VAL n 
2 198 VAL n 
2 199 THR n 
2 200 ASP n 
2 201 PRO n 
2 202 SER n 
2 203 CYS n 
2 204 PRO n 
2 205 ALA n 
2 206 SER n 
2 207 VAL n 
2 208 LEU n 
2 209 LYS n 
2 210 CYS n 
2 211 ALA n 
2 212 GLU n 
2 213 ALA n 
2 214 LEU n 
2 215 GLN n 
2 216 LEU n 
2 217 PRO n 
2 218 VAL n 
2 219 VAL n 
2 220 SER n 
2 221 GLN n 
2 222 GLU n 
2 223 TRP n 
2 224 VAL n 
2 225 ILE n 
2 226 GLN n 
2 227 CYS n 
2 228 LEU n 
2 229 ILE n 
2 230 VAL n 
2 231 GLY n 
2 232 GLU n 
2 233 ARG n 
2 234 ILE n 
2 235 GLY n 
2 236 PHE n 
2 237 LYS n 
2 238 GLN n 
2 239 HIS n 
2 240 PRO n 
2 241 LYS n 
2 242 TYR n 
2 243 LYS n 
2 244 HIS n 
2 245 ASP n 
2 246 TYR n 
2 247 VAL n 
2 248 SER n 
2 249 HIS n 
3 1   SER n 
3 2   SER n 
3 3   VAL n 
3 4   PRO n 
3 5   SER n 
3 6   GLN n 
3 7   LYS n 
3 8   THR n 
3 9   TYR n 
3 10  GLN n 
3 11  GLY n 
3 12  SER n 
3 13  TYR n 
3 14  GLY n 
3 15  PHE n 
3 16  ARG n 
3 17  LEU n 
3 18  GLY n 
3 19  PHE n 
3 20  LEU n 
3 21  HIS n 
3 22  SER n 
3 23  GLY n 
3 24  THR n 
3 25  ALA n 
3 26  LYS n 
3 27  SER n 
3 28  VAL n 
3 29  THR n 
3 30  CYS n 
3 31  THR n 
3 32  TYR n 
3 33  SER n 
3 34  PRO n 
3 35  ALA n 
3 36  LEU n 
3 37  ASN n 
3 38  LYS n 
3 39  MET n 
3 40  PHE n 
3 41  CYS n 
3 42  GLN n 
3 43  LEU n 
3 44  ALA n 
3 45  LYS n 
3 46  THR n 
3 47  CYS n 
3 48  PRO n 
3 49  VAL n 
3 50  GLN n 
3 51  LEU n 
3 52  TRP n 
3 53  VAL n 
3 54  ASP n 
3 55  SER n 
3 56  THR n 
3 57  PRO n 
3 58  PRO n 
3 59  PRO n 
3 60  GLY n 
3 61  THR n 
3 62  ARG n 
3 63  VAL n 
3 64  ARG n 
3 65  ALA n 
3 66  MET n 
3 67  ALA n 
3 68  ILE n 
3 69  TYR n 
3 70  LYS n 
3 71  GLN n 
3 72  SER n 
3 73  GLN n 
3 74  HIS n 
3 75  MET n 
3 76  THR n 
3 77  GLU n 
3 78  VAL n 
3 79  VAL n 
3 80  ARG n 
3 81  ARG n 
3 82  CYS n 
3 83  PRO n 
3 84  HIS n 
3 85  HIS n 
3 86  GLU n 
3 87  ARG n 
3 88  CYS n 
3 89  SER n 
3 90  ASP n 
3 91  SER n 
3 92  ASP n 
3 93  GLY n 
3 94  LEU n 
3 95  ALA n 
3 96  PRO n 
3 97  PRO n 
3 98  GLN n 
3 99  HIS n 
3 100 LEU n 
3 101 ILE n 
3 102 ARG n 
3 103 VAL n 
3 104 GLU n 
3 105 GLY n 
3 106 ASN n 
3 107 LEU n 
3 108 ARG n 
3 109 VAL n 
3 110 GLU n 
3 111 TYR n 
3 112 LEU n 
3 113 ASP n 
3 114 ASP n 
3 115 ARG n 
3 116 ASN n 
3 117 THR n 
3 118 PHE n 
3 119 ARG n 
3 120 HIS n 
3 121 SER n 
3 122 VAL n 
3 123 VAL n 
3 124 VAL n 
3 125 PRO n 
3 126 TYR n 
3 127 GLU n 
3 128 PRO n 
3 129 PRO n 
3 130 GLU n 
3 131 VAL n 
3 132 GLY n 
3 133 SER n 
3 134 ASP n 
3 135 CYS n 
3 136 THR n 
3 137 THR n 
3 138 ILE n 
3 139 HIS n 
3 140 TYR n 
3 141 ASN n 
3 142 TYR n 
3 143 MET n 
3 144 CYS n 
3 145 ASN n 
3 146 SER n 
3 147 SER n 
3 148 CYS n 
3 149 MET n 
3 150 GLY n 
3 151 GLY n 
3 152 MET n 
3 153 ASN n 
3 154 ARG n 
3 155 ARG n 
3 156 PRO n 
3 157 ILE n 
3 158 LEU n 
3 159 THR n 
3 160 ILE n 
3 161 ILE n 
3 162 THR n 
3 163 LEU n 
3 164 GLU n 
3 165 ASP n 
3 166 SER n 
3 167 SER n 
3 168 GLY n 
3 169 ASN n 
3 170 LEU n 
3 171 LEU n 
3 172 GLY n 
3 173 ARG n 
3 174 ASN n 
3 175 SER n 
3 176 PHE n 
3 177 GLU n 
3 178 VAL n 
3 179 ARG n 
3 180 VAL n 
3 181 CYS n 
3 182 ALA n 
3 183 CYS n 
3 184 PRO n 
3 185 GLY n 
3 186 ARG n 
3 187 ASP n 
3 188 ARG n 
3 189 ARG n 
3 190 THR n 
3 191 GLU n 
3 192 GLU n 
3 193 GLU n 
3 194 ASN n 
3 195 LEU n 
3 196 ARG n 
3 197 LYS n 
3 198 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'B834(DE3)PLYSS' ? ? 
? ? ? ? ? ? ? ? ? PRSET-B ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'B834(DE3)PLYSS' ? ? 
? ? ? ? ? ? ? ? ? PRSET-A ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'B834(DE3)PLYSS' ? ? 
? ? ? ? ? ? ? ? ? PRSET-B ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP P53_HUMAN  1 ? ? P04637 ? 
2 UNP P531_HUMAN 2 ? ? Q12888 ? 
3 UNP P53_HUMAN  3 ? ? P04637 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1GZH A 1 ? 198 ? P04637 95   ? 292  ? 95   292  
2 2 1GZH B 1 ? 249 ? Q12888 1724 ? 1972 ? 1724 1972 
3 3 1GZH C 1 ? 198 ? P04637 95   ? 292  ? 95   292  
4 2 1GZH D 1 ? 249 ? Q12888 1724 ? 1972 ? 1724 1972 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1GZH 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      134 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04637 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          228 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            228 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1GZH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   41.76 
_exptl_crystal.description           
'STRUCTURE DETERMINATION COMPLETED BY MOLECULAR REPLACEMENT WITH PDB ENTRY 1KZY (VIA PERSONAL COMMUNICATION)' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.40 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50 MM TRIS PH 7.4, 250 MM AMMONIUM SULFATE, 25% POLYETHYLENE GLYCOL 4000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2000-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GZH 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.840 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   54119 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.10400 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.2000 
_reflns.B_iso_Wilson_estimate        35.1 
_reflns.pdbx_redundancy              7.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           0.35800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.400 
_reflns_shell.pdbx_redundancy        3.70 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GZH 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     54119 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1861614.03 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.84 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    98.5 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.238 
_refine.ls_R_factor_R_free                       0.288 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  2835 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.4 
_refine.aniso_B[1][1]                            9.17 
_refine.aniso_B[2][2]                            -14.42 
_refine.aniso_B[3][3]                            5.24 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .340415 
_refine.solvent_model_param_bsol                 18.1016 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;CHAIN A HAS BREAKS BETWEEN RESIDUES 183-188 AND 224-227. DISORDER IS ALSO EVIDENT FOR RESIDUE 200. CHAIN B IS UNINTREPRETABLE BETWEEN RESIDUES 1750-1768. CHAIN C HAS NO BREAKS BUT ONLY EXTENDS FROM 95-289. CHAIN D HAS A BREAK BETWEEN 1740-1768 AND 1794-1796, AND ONLY EXTENDS FROM 1725-1969.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1TSR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GZH 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             0.54 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.61 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6508 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             110 
_refine_hist.number_atoms_total               6630 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        38.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                .008  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.91  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.786 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.931 3.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.446 2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.638 3.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   ? 
_refine_ls_restr_ncs.rms_dev_position    1.99 
_refine_ls_restr_ncs.weight_position     300 
_refine_ls_restr_ncs.rms_dev_B_iso       15.00 
_refine_ls_restr_ncs.weight_B_iso        2 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.62 
_refine_ls_shell.number_reflns_R_work             1023 
_refine_ls_shell.R_factor_R_work                  0.348 
_refine_ls_shell.percent_reflns_obs               95.8 
_refine_ls_shell.R_factor_R_free                  0.340 
_refine_ls_shell.R_factor_R_free_error            0.046 
_refine_ls_shell.percent_reflns_R_free            5.4 
_refine_ls_shell.number_reflns_R_free             58 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 DNA-RNA_REP.PARAM DNA-RNA.TOP 
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 4 ION.PARAM         ION.PARAM   
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.850000 0.009000  -0.527000 -0.017000 1.000000 -0.010000 0.527000 0.017000 0.850000 44.52079 -7.08252 -32.72585 
2 given ? 0.800000 -0.052000 -0.598000 0.035000  0.999000 -0.040000 0.599000 0.011000 0.801000 49.60453 -6.92727 -32.73009 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1GZH 
_struct.title                     'Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor' 
_struct.pdbx_descriptor           'CELLULAR TUMOR ANTIGEN P53, TUMOR SUPPRESSOR P53-BINDING PROTEIN 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GZH 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
;GENE REGULATION, ANTI-ONCOGENE, DNA-BINDING, TRANSCRIPTION REGULATION, BCRT DOMAIN, APOPTOSIS, DISEASE MUTATION, ACTIVATOR, DNA- REPAIR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 71  ? THR A 76  ? GLN A 165  THR A 170  1 ? 6  
HELX_P HELX_P2  2  CYS A 82  ? ARG A 87  ? CYS A 176  ARG A 181  1 ? 6  
HELX_P HELX_P3  3  CYS A 183 ? LYS A 197 ? CYS A 277  LYS A 291  1 ? 15 
HELX_P HELX_P4  4  THR B 17  ? ALA B 23  ? THR B 1740 ALA B 1746 1 ? 7  
HELX_P HELX_P5  5  ASN B 49  ? GLY B 60  ? ASN B 1772 GLY B 1783 1 ? 12 
HELX_P HELX_P6  6  THR B 89  ? GLY B 99  ? THR B 1812 GLY B 1822 1 ? 11 
HELX_P HELX_P7  7  HIS B 105 ? ASN B 115 ? HIS B 1828 ASN B 1838 1 ? 11 
HELX_P HELX_P8  8  ASN B 119 ? TYR B 123 ? ASN B 1842 TYR B 1846 5 ? 5  
HELX_P HELX_P9  9  PHE B 161 ? GLY B 172 ? PHE B 1884 GLY B 1895 1 ? 12 
HELX_P HELX_P10 10 ALA B 190 ? PHE B 194 ? ALA B 1913 PHE B 1917 5 ? 5  
HELX_P HELX_P11 11 PRO B 204 ? GLN B 215 ? PRO B 1927 GLN B 1938 1 ? 12 
HELX_P HELX_P12 12 SER B 220 ? GLY B 231 ? SER B 1943 GLY B 1954 1 ? 12 
HELX_P HELX_P13 13 HIS B 239 ? LYS B 243 ? HIS B 1962 LYS B 1966 5 ? 5  
HELX_P HELX_P14 14 GLN C 71  ? THR C 76  ? GLN C 165  THR C 170  1 ? 6  
HELX_P HELX_P15 15 CYS C 82  ? ARG C 87  ? CYS C 176  ARG C 181  1 ? 6  
HELX_P HELX_P16 16 CYS C 183 ? LEU C 195 ? CYS C 277  LEU C 289  1 ? 13 
HELX_P HELX_P17 17 ASN D 49  ? GLY D 60  ? ASN D 1772 GLY D 1783 1 ? 12 
HELX_P HELX_P18 18 THR D 89  ? GLY D 99  ? THR D 1812 GLY D 1822 1 ? 11 
HELX_P HELX_P19 19 HIS D 105 ? ASN D 115 ? HIS D 1828 ASN D 1838 1 ? 11 
HELX_P HELX_P20 20 ASN D 119 ? TYR D 123 ? ASN D 1842 TYR D 1846 5 ? 5  
HELX_P HELX_P21 21 PHE D 161 ? GLY D 172 ? PHE D 1884 GLY D 1895 1 ? 12 
HELX_P HELX_P22 22 ALA D 190 ? PHE D 194 ? ALA D 1913 PHE D 1917 5 ? 5  
HELX_P HELX_P23 23 PRO D 204 ? GLN D 215 ? PRO D 1927 GLN D 1938 1 ? 12 
HELX_P HELX_P24 24 SER D 220 ? GLY D 231 ? SER D 1943 GLY D 1954 1 ? 12 
HELX_P HELX_P25 25 HIS D 239 ? LYS D 243 ? HIS D 1962 LYS D 1966 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 144 SG  ? ? A ZN 1293 A CYS 238 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc2 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 148 SG  ? ? A ZN 1293 A CYS 242 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc3 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 85  ND1 ? ? A ZN 1293 A HIS 179 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc4 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 82  SG  ? ? A ZN 1293 A CYS 176 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc5 metalc ? ? G ZN . ZN ? ? ? 1_555 C CYS 148 SG  ? ? C ZN 1290 C CYS 242 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc6 metalc ? ? G ZN . ZN ? ? ? 1_555 C CYS 144 SG  ? ? C ZN 1290 C CYS 238 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc7 metalc ? ? G ZN . ZN ? ? ? 1_555 C CYS 82  SG  ? ? C ZN 1290 C CYS 176 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc8 metalc ? ? G ZN . ZN ? ? ? 1_555 C HIS 85  ND1 ? ? C ZN 1290 C HIS 179 1_555 ? ? ? ? ? ? ? 2.305 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 7 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 4 ? 
CA ? 4 ? 
CB ? 7 ? 
DA ? 4 ? 
DB ? 2 ? 
DC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BB 1 2 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? parallel      
BC 3 4 ? parallel      
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? parallel      
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CB 5 6 ? anti-parallel 
CB 6 7 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? parallel      
DA 3 4 ? parallel      
DB 1 2 ? anti-parallel 
DC 1 2 ? parallel      
DC 2 3 ? parallel      
DC 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 16  ? GLY A 18  ? ARG A 110  GLY A 112  
AA 2 CYS A 47  ? TRP A 52  ? CYS A 141  TRP A 146  
AA 3 THR A 136 ? TYR A 142 ? THR A 230  TYR A 236  
AA 4 ILE A 101 ? VAL A 103 ? ILE A 195  VAL A 197  
AB 1 CYS A 30  ? SER A 33  ? CYS A 124  SER A 127  
AB 2 LYS A 38  ? CYS A 41  ? LYS A 132  CYS A 135  
AB 3 LEU A 170 ? VAL A 180 ? LEU A 264  VAL A 274  
AB 4 ILE A 157 ? GLU A 164 ? ILE A 251  GLU A 258  
AB 5 ARG A 62  ? TYR A 69  ? ARG A 156  TYR A 163  
AB 6 HIS A 120 ? PRO A 125 ? HIS A 214  PRO A 219  
AB 7 GLU A 110 ? ASP A 113 ? GLU A 204  ASP A 207  
BA 1 TYR B 63  ? ILE B 64  ? TYR B 1786 ILE B 1787 
BA 2 TYR B 9   ? LEU B 13  ? TYR B 1732 LEU B 1736 
BA 3 GLN B 78  ? ALA B 83  ? GLN B 1801 ALA B 1806 
BA 4 CYS B 102 ? SER B 104 ? CYS B 1825 SER B 1827 
BB 1 GLY B 128 ? SER B 130 ? GLY B 1851 SER B 1853 
BB 2 ARG B 135 ? LEU B 137 ? ARG B 1858 LEU B 1860 
BC 1 SER B 176 ? HIS B 181 ? SER B 1899 HIS B 1904 
BC 2 LYS B 150 ? SER B 155 ? LYS B 1873 SER B 1878 
BC 3 VAL B 196 ? THR B 199 ? VAL B 1919 THR B 1922 
BC 4 VAL B 218 ? VAL B 219 ? VAL B 1941 VAL B 1942 
CA 1 ARG C 16  ? GLY C 18  ? ARG C 110  GLY C 112  
CA 2 CYS C 47  ? TRP C 52  ? CYS C 141  TRP C 146  
CA 3 THR C 136 ? TYR C 142 ? THR C 230  TYR C 236  
CA 4 ILE C 101 ? GLU C 104 ? ILE C 195  GLU C 198  
CB 1 CYS C 30  ? SER C 33  ? CYS C 124  SER C 127  
CB 2 LYS C 38  ? CYS C 41  ? LYS C 132  CYS C 135  
CB 3 LEU C 170 ? VAL C 180 ? LEU C 264  VAL C 274  
CB 4 ILE C 157 ? GLU C 164 ? ILE C 251  GLU C 258  
CB 5 ARG C 62  ? TYR C 69  ? ARG C 156  TYR C 163  
CB 6 HIS C 120 ? PRO C 125 ? HIS C 214  PRO C 219  
CB 7 GLU C 110 ? ASP C 113 ? GLU C 204  ASP C 207  
DA 1 TYR D 63  ? ILE D 64  ? TYR D 1786 ILE D 1787 
DA 2 TYR D 9   ? LEU D 13  ? TYR D 1732 LEU D 1736 
DA 3 GLN D 78  ? ALA D 83  ? GLN D 1801 ALA D 1806 
DA 4 CYS D 102 ? SER D 104 ? CYS D 1825 SER D 1827 
DB 1 GLY D 128 ? SER D 130 ? GLY D 1851 SER D 1853 
DB 2 ARG D 135 ? LEU D 137 ? ARG D 1858 LEU D 1860 
DC 1 SER D 176 ? HIS D 181 ? SER D 1899 HIS D 1904 
DC 2 LYS D 150 ? SER D 155 ? LYS D 1873 SER D 1878 
DC 3 VAL D 196 ? THR D 199 ? VAL D 1919 THR D 1922 
DC 4 VAL D 218 ? VAL D 219 ? VAL D 1941 VAL D 1942 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 18  ? N GLY A 112  O GLN A 50  ? O GLN A 144  
AA 2 3 N LEU A 51  ? N LEU A 145  O THR A 136 ? O THR A 230  
AA 3 4 N ASN A 141 ? N ASN A 235  O ARG A 102 ? O ARG A 196  
AB 1 2 N SER A 33  ? N SER A 127  O LYS A 38  ? O LYS A 132  
AB 2 3 N MET A 39  ? N MET A 133  O GLU A 177 ? O GLU A 271  
AB 3 4 N VAL A 178 ? N VAL A 272  O ILE A 157 ? O ILE A 251  
AB 4 5 N GLU A 164 ? N GLU A 258  O ARG A 62  ? O ARG A 156  
AB 5 6 N ALA A 65  ? N ALA A 159  O VAL A 122 ? O VAL A 216  
AB 6 7 N VAL A 123 ? N VAL A 217  O GLU A 110 ? O GLU A 204  
BA 1 2 N TYR B 63  ? N TYR B 1786 O TYR B 9   ? O TYR B 1732 
BA 2 3 N ALA B 10  ? N ALA B 1733 O GLN B 78  ? O GLN B 1801 
BA 3 4 N ALA B 83  ? N ALA B 1806 O VAL B 103 ? O VAL B 1826 
BB 1 2 N SER B 130 ? N SER B 1853 O ARG B 135 ? O ARG B 1858 
BC 1 2 N LYS B 178 ? N LYS B 1901 O VAL B 151 ? O VAL B 1874 
BC 2 3 N LEU B 152 ? N LEU B 1875 O VAL B 196 ? O VAL B 1919 
BC 3 4 N THR B 199 ? N THR B 1922 O VAL B 219 ? O VAL B 1942 
CA 1 2 N GLY C 18  ? N GLY C 112  O GLN C 50  ? O GLN C 144  
CA 2 3 N LEU C 51  ? N LEU C 145  O THR C 136 ? O THR C 230  
CA 3 4 N ASN C 141 ? N ASN C 235  O ARG C 102 ? O ARG C 196  
CB 1 2 N SER C 33  ? N SER C 127  O LYS C 38  ? O LYS C 132  
CB 2 3 N MET C 39  ? N MET C 133  O GLU C 177 ? O GLU C 271  
CB 3 4 N VAL C 178 ? N VAL C 272  O ILE C 157 ? O ILE C 251  
CB 4 5 N GLU C 164 ? N GLU C 258  O ARG C 62  ? O ARG C 156  
CB 5 6 N ALA C 65  ? N ALA C 159  O VAL C 122 ? O VAL C 216  
CB 6 7 N VAL C 123 ? N VAL C 217  O GLU C 110 ? O GLU C 204  
DA 1 2 N TYR D 63  ? N TYR D 1786 O TYR D 9   ? O TYR D 1732 
DA 2 3 N ALA D 10  ? N ALA D 1733 O GLN D 78  ? O GLN D 1801 
DA 3 4 N ALA D 83  ? N ALA D 1806 O VAL D 103 ? O VAL D 1826 
DB 1 2 N SER D 130 ? N SER D 1853 O ARG D 135 ? O ARG D 1858 
DC 1 2 N LYS D 178 ? N LYS D 1901 O VAL D 151 ? O VAL D 1874 
DC 2 3 N LEU D 152 ? N LEU D 1875 O VAL D 196 ? O VAL D 1919 
DC 3 4 N THR D 199 ? N THR D 1922 O VAL D 219 ? O VAL D 1942 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1293'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 2972' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1290'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 2970' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 82  ? CYS A 176  . ? 1_555 ? 
2  AC1 4 HIS A 85  ? HIS A 179  . ? 1_555 ? 
3  AC1 4 CYS A 144 ? CYS A 238  . ? 1_555 ? 
4  AC1 4 CYS A 148 ? CYS A 242  . ? 1_555 ? 
5  AC2 6 THR B 14  ? THR B 1737 . ? 1_555 ? 
6  AC2 6 MET B 15  ? MET B 1738 . ? 1_555 ? 
7  AC2 6 LYS B 50  ? LYS B 1773 . ? 1_555 ? 
8  AC2 6 LYS B 91  ? LYS B 1814 . ? 1_555 ? 
9  AC2 6 HOH J .   ? HOH B 2043 . ? 1_555 ? 
10 AC2 6 SER C 89  ? SER C 183  . ? 3_655 ? 
11 AC3 4 CYS C 82  ? CYS C 176  . ? 1_555 ? 
12 AC3 4 HIS C 85  ? HIS C 179  . ? 1_555 ? 
13 AC3 4 CYS C 144 ? CYS C 238  . ? 1_555 ? 
14 AC3 4 CYS C 148 ? CYS C 242  . ? 1_555 ? 
15 AC4 6 THR B 75  ? THR B 1798 . ? 1_555 ? 
16 AC4 6 LEU D 13  ? LEU D 1736 . ? 1_555 ? 
17 AC4 6 THR D 14  ? THR D 1737 . ? 1_555 ? 
18 AC4 6 MET D 15  ? MET D 1738 . ? 1_555 ? 
19 AC4 6 LYS D 50  ? LYS D 1773 . ? 1_555 ? 
20 AC4 6 LYS D 91  ? LYS D 1814 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GZH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GZH 
_atom_sites.fract_transf_matrix[1][1]   0.013982 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010574 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007342 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 26.666 21.088  12.685  1.00 67.00 ? 95   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 28.135 21.112  12.956  1.00 66.41 ? 95   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 28.490 20.398  14.261  1.00 66.71 ? 95   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 29.367 19.523  14.290  1.00 66.30 ? 95   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 28.634 22.561  13.025  1.00 65.83 ? 95   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 29.988 22.624  13.448  1.00 63.22 ? 95   SER A OG  1 
ATOM   7    N  N   . SER A 1 2   ? 27.801 20.772  15.336  1.00 64.91 ? 96   SER A N   1 
ATOM   8    C  CA  . SER A 1 2   ? 28.070 20.192  16.646  1.00 62.50 ? 96   SER A CA  1 
ATOM   9    C  C   . SER A 1 2   ? 26.829 20.014  17.504  1.00 60.44 ? 96   SER A C   1 
ATOM   10   O  O   . SER A 1 2   ? 26.685 18.993  18.176  1.00 62.39 ? 96   SER A O   1 
ATOM   11   C  CB  . SER A 1 2   ? 29.083 21.057  17.404  1.00 62.37 ? 96   SER A CB  1 
ATOM   12   O  OG  . SER A 1 2   ? 29.195 20.642  18.752  1.00 61.81 ? 96   SER A OG  1 
ATOM   13   N  N   . VAL A 1 3   ? 25.937 21.000  17.501  1.00 55.23 ? 97   VAL A N   1 
ATOM   14   C  CA  . VAL A 1 3   ? 24.737 20.880  18.310  1.00 50.39 ? 97   VAL A CA  1 
ATOM   15   C  C   . VAL A 1 3   ? 23.987 19.608  17.916  1.00 47.74 ? 97   VAL A C   1 
ATOM   16   O  O   . VAL A 1 3   ? 23.698 19.393  16.742  1.00 46.45 ? 97   VAL A O   1 
ATOM   17   C  CB  . VAL A 1 3   ? 23.813 22.107  18.121  1.00 50.39 ? 97   VAL A CB  1 
ATOM   18   C  CG1 . VAL A 1 3   ? 23.481 22.287  16.649  1.00 50.63 ? 97   VAL A CG1 1 
ATOM   19   C  CG2 . VAL A 1 3   ? 22.536 21.939  18.940  1.00 49.23 ? 97   VAL A CG2 1 
ATOM   20   N  N   . PRO A 1 4   ? 23.671 18.742  18.897  1.00 46.55 ? 98   PRO A N   1 
ATOM   21   C  CA  . PRO A 1 4   ? 22.950 17.490  18.635  1.00 44.47 ? 98   PRO A CA  1 
ATOM   22   C  C   . PRO A 1 4   ? 21.570 17.769  18.064  1.00 43.20 ? 98   PRO A C   1 
ATOM   23   O  O   . PRO A 1 4   ? 20.958 18.794  18.370  1.00 44.42 ? 98   PRO A O   1 
ATOM   24   C  CB  . PRO A 1 4   ? 22.846 16.843  20.018  1.00 42.96 ? 98   PRO A CB  1 
ATOM   25   C  CG  . PRO A 1 4   ? 23.984 17.441  20.779  1.00 45.77 ? 98   PRO A CG  1 
ATOM   26   C  CD  . PRO A 1 4   ? 23.958 18.880  20.335  1.00 46.60 ? 98   PRO A CD  1 
ATOM   27   N  N   . SER A 1 5   ? 21.075 16.851  17.245  1.00 41.85 ? 99   SER A N   1 
ATOM   28   C  CA  . SER A 1 5   ? 19.754 16.995  16.648  1.00 39.55 ? 99   SER A CA  1 
ATOM   29   C  C   . SER A 1 5   ? 18.664 16.821  17.699  1.00 38.57 ? 99   SER A C   1 
ATOM   30   O  O   . SER A 1 5   ? 18.811 16.030  18.629  1.00 39.70 ? 99   SER A O   1 
ATOM   31   C  CB  . SER A 1 5   ? 19.552 15.947  15.548  1.00 37.51 ? 99   SER A CB  1 
ATOM   32   O  OG  . SER A 1 5   ? 18.249 16.037  14.990  1.00 36.07 ? 99   SER A OG  1 
ATOM   33   N  N   . GLN A 1 6   ? 17.571 17.558  17.537  1.00 37.48 ? 100  GLN A N   1 
ATOM   34   C  CA  . GLN A 1 6   ? 16.440 17.472  18.448  1.00 35.92 ? 100  GLN A CA  1 
ATOM   35   C  C   . GLN A 1 6   ? 15.213 17.072  17.624  1.00 36.31 ? 100  GLN A C   1 
ATOM   36   O  O   . GLN A 1 6   ? 14.089 17.004  18.133  1.00 35.62 ? 100  GLN A O   1 
ATOM   37   C  CB  . GLN A 1 6   ? 16.205 18.825  19.122  1.00 34.86 ? 100  GLN A CB  1 
ATOM   38   C  CG  . GLN A 1 6   ? 15.697 19.901  18.188  1.00 33.80 ? 100  GLN A CG  1 
ATOM   39   C  CD  . GLN A 1 6   ? 15.463 21.233  18.893  1.00 34.84 ? 100  GLN A CD  1 
ATOM   40   O  OE1 . GLN A 1 6   ? 16.376 22.056  19.015  1.00 33.96 ? 100  GLN A OE1 1 
ATOM   41   N  NE2 . GLN A 1 6   ? 14.232 21.445  19.371  1.00 34.86 ? 100  GLN A NE2 1 
ATOM   42   N  N   . LYS A 1 7   ? 15.450 16.799  16.344  1.00 36.54 ? 101  LYS A N   1 
ATOM   43   C  CA  . LYS A 1 7   ? 14.392 16.410  15.411  1.00 37.65 ? 101  LYS A CA  1 
ATOM   44   C  C   . LYS A 1 7   ? 13.618 15.153  15.816  1.00 36.17 ? 101  LYS A C   1 
ATOM   45   O  O   . LYS A 1 7   ? 14.194 14.059  15.965  1.00 32.67 ? 101  LYS A O   1 
ATOM   46   C  CB  . LYS A 1 7   ? 14.973 16.191  14.001  1.00 41.67 ? 101  LYS A CB  1 
ATOM   47   C  CG  . LYS A 1 7   ? 15.523 17.450  13.312  1.00 48.43 ? 101  LYS A CG  1 
ATOM   48   C  CD  . LYS A 1 7   ? 16.128 17.133  11.928  1.00 50.53 ? 101  LYS A CD  1 
ATOM   49   C  CE  . LYS A 1 7   ? 16.514 18.401  11.133  1.00 50.47 ? 101  LYS A CE  1 
ATOM   50   N  NZ  . LYS A 1 7   ? 17.617 19.218  11.740  1.00 47.67 ? 101  LYS A NZ  1 
ATOM   51   N  N   . THR A 1 8   ? 12.306 15.301  15.986  1.00 34.20 ? 102  THR A N   1 
ATOM   52   C  CA  . THR A 1 8   ? 11.487 14.149  16.335  1.00 31.00 ? 102  THR A CA  1 
ATOM   53   C  C   . THR A 1 8   ? 11.681 13.097  15.249  1.00 31.50 ? 102  THR A C   1 
ATOM   54   O  O   . THR A 1 8   ? 11.633 13.413  14.059  1.00 33.33 ? 102  THR A O   1 
ATOM   55   C  CB  . THR A 1 8   ? 9.999  14.504  16.403  1.00 28.24 ? 102  THR A CB  1 
ATOM   56   O  OG1 . THR A 1 8   ? 9.743  15.302  17.568  1.00 22.52 ? 102  THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 8   ? 9.161  13.220  16.454  1.00 26.13 ? 102  THR A CG2 1 
ATOM   58   N  N   . TYR A 1 9   ? 11.908 11.855  15.665  1.00 32.28 ? 103  TYR A N   1 
ATOM   59   C  CA  . TYR A 1 9   ? 12.116 10.722  14.747  1.00 31.55 ? 103  TYR A CA  1 
ATOM   60   C  C   . TYR A 1 9   ? 11.540 9.474   15.398  1.00 29.81 ? 103  TYR A C   1 
ATOM   61   O  O   . TYR A 1 9   ? 12.227 8.820   16.191  1.00 27.91 ? 103  TYR A O   1 
ATOM   62   C  CB  . TYR A 1 9   ? 13.616 10.509  14.495  1.00 35.11 ? 103  TYR A CB  1 
ATOM   63   C  CG  . TYR A 1 9   ? 13.989 9.339   13.589  1.00 40.10 ? 103  TYR A CG  1 
ATOM   64   C  CD1 . TYR A 1 9   ? 13.254 9.051   12.430  1.00 41.61 ? 103  TYR A CD1 1 
ATOM   65   C  CD2 . TYR A 1 9   ? 15.150 8.590   13.830  1.00 41.44 ? 103  TYR A CD2 1 
ATOM   66   C  CE1 . TYR A 1 9   ? 13.671 8.057   11.530  1.00 39.27 ? 103  TYR A CE1 1 
ATOM   67   C  CE2 . TYR A 1 9   ? 15.577 7.597   12.936  1.00 39.88 ? 103  TYR A CE2 1 
ATOM   68   C  CZ  . TYR A 1 9   ? 14.835 7.341   11.787  1.00 40.18 ? 103  TYR A CZ  1 
ATOM   69   O  OH  . TYR A 1 9   ? 15.277 6.405   10.874  1.00 38.87 ? 103  TYR A OH  1 
ATOM   70   N  N   . GLN A 1 10  ? 10.288 9.149   15.078  1.00 26.34 ? 104  GLN A N   1 
ATOM   71   C  CA  . GLN A 1 10  ? 9.655  7.978   15.666  1.00 28.63 ? 104  GLN A CA  1 
ATOM   72   C  C   . GLN A 1 10  ? 10.306 6.678   15.226  1.00 29.64 ? 104  GLN A C   1 
ATOM   73   O  O   . GLN A 1 10  ? 10.311 5.693   15.972  1.00 31.06 ? 104  GLN A O   1 
ATOM   74   C  CB  . GLN A 1 10  ? 8.164  7.974   15.355  1.00 28.66 ? 104  GLN A CB  1 
ATOM   75   C  CG  . GLN A 1 10  ? 7.425  9.014   16.173  1.00 31.27 ? 104  GLN A CG  1 
ATOM   76   C  CD  . GLN A 1 10  ? 6.003  9.205   15.720  1.00 35.54 ? 104  GLN A CD  1 
ATOM   77   O  OE1 . GLN A 1 10  ? 5.178  8.298   15.836  1.00 38.60 ? 104  GLN A OE1 1 
ATOM   78   N  NE2 . GLN A 1 10  ? 5.703  10.393  15.188  1.00 36.24 ? 104  GLN A NE2 1 
ATOM   79   N  N   . GLY A 1 11  ? 10.860 6.678   14.020  1.00 29.31 ? 105  GLY A N   1 
ATOM   80   C  CA  . GLY A 1 11  ? 11.546 5.499   13.530  1.00 30.17 ? 105  GLY A CA  1 
ATOM   81   C  C   . GLY A 1 11  ? 10.697 4.287   13.228  1.00 30.22 ? 105  GLY A C   1 
ATOM   82   O  O   . GLY A 1 11  ? 9.467  4.336   13.254  1.00 31.02 ? 105  GLY A O   1 
ATOM   83   N  N   . SER A 1 12  ? 11.377 3.183   12.946  1.00 31.47 ? 106  SER A N   1 
ATOM   84   C  CA  . SER A 1 12  ? 10.716 1.937   12.600  1.00 33.02 ? 106  SER A CA  1 
ATOM   85   C  C   . SER A 1 12  ? 9.930  1.311   13.740  1.00 33.03 ? 106  SER A C   1 
ATOM   86   O  O   . SER A 1 12  ? 8.988  0.552   13.512  1.00 35.58 ? 106  SER A O   1 
ATOM   87   C  CB  . SER A 1 12  ? 11.750 0.937   12.064  1.00 33.87 ? 106  SER A CB  1 
ATOM   88   O  OG  . SER A 1 12  ? 12.910 0.890   12.883  1.00 33.95 ? 106  SER A OG  1 
ATOM   89   N  N   . TYR A 1 13  ? 10.294 1.635   14.971  1.00 32.63 ? 107  TYR A N   1 
ATOM   90   C  CA  . TYR A 1 13  ? 9.593  1.050   16.106  1.00 31.57 ? 107  TYR A CA  1 
ATOM   91   C  C   . TYR A 1 13  ? 8.458  1.911   16.656  1.00 31.42 ? 107  TYR A C   1 
ATOM   92   O  O   . TYR A 1 13  ? 7.874  1.581   17.695  1.00 32.16 ? 107  TYR A O   1 
ATOM   93   C  CB  . TYR A 1 13  ? 10.600 0.723   17.204  1.00 30.89 ? 107  TYR A CB  1 
ATOM   94   C  CG  . TYR A 1 13  ? 11.690 -0.195  16.718  1.00 29.92 ? 107  TYR A CG  1 
ATOM   95   C  CD1 . TYR A 1 13  ? 11.450 -1.559  16.537  1.00 32.94 ? 107  TYR A CD1 1 
ATOM   96   C  CD2 . TYR A 1 13  ? 12.944 0.300   16.394  1.00 30.43 ? 107  TYR A CD2 1 
ATOM   97   C  CE1 . TYR A 1 13  ? 12.444 -2.413  16.040  1.00 33.50 ? 107  TYR A CE1 1 
ATOM   98   C  CE2 . TYR A 1 13  ? 13.951 -0.543  15.891  1.00 33.65 ? 107  TYR A CE2 1 
ATOM   99   C  CZ  . TYR A 1 13  ? 13.691 -1.896  15.717  1.00 34.29 ? 107  TYR A CZ  1 
ATOM   100  O  OH  . TYR A 1 13  ? 14.669 -2.727  15.209  1.00 38.22 ? 107  TYR A OH  1 
ATOM   101  N  N   . GLY A 1 14  ? 8.138  2.997   15.953  1.00 29.33 ? 108  GLY A N   1 
ATOM   102  C  CA  . GLY A 1 14  ? 7.068  3.884   16.389  1.00 30.07 ? 108  GLY A CA  1 
ATOM   103  C  C   . GLY A 1 14  ? 7.304  4.420   17.792  1.00 32.58 ? 108  GLY A C   1 
ATOM   104  O  O   . GLY A 1 14  ? 6.430  4.333   18.668  1.00 31.35 ? 108  GLY A O   1 
ATOM   105  N  N   . PHE A 1 15  ? 8.488  4.991   18.003  1.00 33.91 ? 109  PHE A N   1 
ATOM   106  C  CA  . PHE A 1 15  ? 8.881  5.518   19.313  1.00 34.38 ? 109  PHE A CA  1 
ATOM   107  C  C   . PHE A 1 15  ? 8.260  6.867   19.696  1.00 34.69 ? 109  PHE A C   1 
ATOM   108  O  O   . PHE A 1 15  ? 8.464  7.883   19.023  1.00 36.71 ? 109  PHE A O   1 
ATOM   109  C  CB  . PHE A 1 15  ? 10.418 5.597   19.376  1.00 34.15 ? 109  PHE A CB  1 
ATOM   110  C  CG  . PHE A 1 15  ? 10.962 6.118   20.685  1.00 32.21 ? 109  PHE A CG  1 
ATOM   111  C  CD1 . PHE A 1 15  ? 10.521 5.597   21.898  1.00 30.65 ? 109  PHE A CD1 1 
ATOM   112  C  CD2 . PHE A 1 15  ? 11.934 7.115   20.696  1.00 30.01 ? 109  PHE A CD2 1 
ATOM   113  C  CE1 . PHE A 1 15  ? 11.039 6.062   23.098  1.00 29.51 ? 109  PHE A CE1 1 
ATOM   114  C  CE2 . PHE A 1 15  ? 12.457 7.586   21.885  1.00 28.55 ? 109  PHE A CE2 1 
ATOM   115  C  CZ  . PHE A 1 15  ? 12.010 7.059   23.091  1.00 32.00 ? 109  PHE A CZ  1 
ATOM   116  N  N   . ARG A 1 16  ? 7.508  6.862   20.791  1.00 33.03 ? 110  ARG A N   1 
ATOM   117  C  CA  . ARG A 1 16  ? 6.855  8.066   21.297  1.00 33.39 ? 110  ARG A CA  1 
ATOM   118  C  C   . ARG A 1 16  ? 7.115  8.131   22.806  1.00 32.79 ? 110  ARG A C   1 
ATOM   119  O  O   . ARG A 1 16  ? 7.464  7.120   23.418  1.00 31.86 ? 110  ARG A O   1 
ATOM   120  C  CB  . ARG A 1 16  ? 5.342  7.984   21.037  1.00 33.94 ? 110  ARG A CB  1 
ATOM   121  C  CG  . ARG A 1 16  ? 5.002  7.388   19.678  1.00 39.52 ? 110  ARG A CG  1 
ATOM   122  C  CD  . ARG A 1 16  ? 3.507  7.402   19.349  1.00 42.31 ? 110  ARG A CD  1 
ATOM   123  N  NE  . ARG A 1 16  ? 2.694  6.493   20.166  1.00 48.13 ? 110  ARG A NE  1 
ATOM   124  C  CZ  . ARG A 1 16  ? 2.870  5.173   20.266  1.00 48.01 ? 110  ARG A CZ  1 
ATOM   125  N  NH1 . ARG A 1 16  ? 3.851  4.555   19.609  1.00 44.94 ? 110  ARG A NH1 1 
ATOM   126  N  NH2 . ARG A 1 16  ? 2.031  4.462   21.008  1.00 48.22 ? 110  ARG A NH2 1 
ATOM   127  N  N   . LEU A 1 17  ? 6.943  9.315   23.393  1.00 31.44 ? 111  LEU A N   1 
ATOM   128  C  CA  . LEU A 1 17  ? 7.142  9.524   24.823  1.00 27.01 ? 111  LEU A CA  1 
ATOM   129  C  C   . LEU A 1 17  ? 5.803  9.750   25.494  1.00 29.09 ? 111  LEU A C   1 
ATOM   130  O  O   . LEU A 1 17  ? 4.834  10.145  24.841  1.00 27.47 ? 111  LEU A O   1 
ATOM   131  C  CB  . LEU A 1 17  ? 8.019  10.749  25.072  1.00 23.14 ? 111  LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 17  ? 9.498  10.673  24.691  1.00 22.45 ? 111  LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 17  ? 10.184 12.030  24.970  1.00 17.25 ? 111  LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 17  ? 10.153 9.549   25.494  1.00 19.88 ? 111  LEU A CD2 1 
ATOM   135  N  N   . GLY A 1 18  ? 5.765  9.507   26.806  1.00 32.88 ? 112  GLY A N   1 
ATOM   136  C  CA  . GLY A 1 18  ? 4.553  9.690   27.595  1.00 30.21 ? 112  GLY A CA  1 
ATOM   137  C  C   . GLY A 1 18  ? 4.921  10.250  28.959  1.00 31.84 ? 112  GLY A C   1 
ATOM   138  O  O   . GLY A 1 18  ? 6.079  10.170  29.374  1.00 31.33 ? 112  GLY A O   1 
ATOM   139  N  N   . PHE A 1 19  ? 3.948  10.820  29.662  1.00 32.68 ? 113  PHE A N   1 
ATOM   140  C  CA  . PHE A 1 19  ? 4.200  11.405  30.977  1.00 33.16 ? 113  PHE A CA  1 
ATOM   141  C  C   . PHE A 1 19  ? 3.002  11.203  31.918  1.00 33.38 ? 113  PHE A C   1 
ATOM   142  O  O   . PHE A 1 19  ? 1.852  11.256  31.488  1.00 30.73 ? 113  PHE A O   1 
ATOM   143  C  CB  . PHE A 1 19  ? 4.481  12.901  30.812  1.00 33.32 ? 113  PHE A CB  1 
ATOM   144  C  CG  . PHE A 1 19  ? 5.625  13.215  29.870  1.00 34.88 ? 113  PHE A CG  1 
ATOM   145  C  CD1 . PHE A 1 19  ? 6.914  13.440  30.358  1.00 35.57 ? 113  PHE A CD1 1 
ATOM   146  C  CD2 . PHE A 1 19  ? 5.416  13.291  28.491  1.00 32.60 ? 113  PHE A CD2 1 
ATOM   147  C  CE1 . PHE A 1 19  ? 7.983  13.739  29.478  1.00 31.01 ? 113  PHE A CE1 1 
ATOM   148  C  CE2 . PHE A 1 19  ? 6.476  13.587  27.614  1.00 29.77 ? 113  PHE A CE2 1 
ATOM   149  C  CZ  . PHE A 1 19  ? 7.758  13.810  28.115  1.00 28.64 ? 113  PHE A CZ  1 
ATOM   150  N  N   . LEU A 1 20  ? 3.265  10.966  33.201  1.00 36.02 ? 114  LEU A N   1 
ATOM   151  C  CA  . LEU A 1 20  ? 2.175  10.780  34.157  1.00 37.20 ? 114  LEU A CA  1 
ATOM   152  C  C   . LEU A 1 20  ? 1.406  12.084  34.310  1.00 39.54 ? 114  LEU A C   1 
ATOM   153  O  O   . LEU A 1 20  ? 1.962  13.166  34.094  1.00 40.51 ? 114  LEU A O   1 
ATOM   154  C  CB  . LEU A 1 20  ? 2.710  10.377  35.527  1.00 37.41 ? 114  LEU A CB  1 
ATOM   155  C  CG  . LEU A 1 20  ? 3.466  9.054   35.675  1.00 38.96 ? 114  LEU A CG  1 
ATOM   156  C  CD1 . LEU A 1 20  ? 3.937  8.911   37.130  1.00 36.38 ? 114  LEU A CD1 1 
ATOM   157  C  CD2 . LEU A 1 20  ? 2.579  7.891   35.273  1.00 37.50 ? 114  LEU A CD2 1 
ATOM   158  N  N   . HIS A 1 21  ? 0.128  11.980  34.672  1.00 41.07 ? 115  HIS A N   1 
ATOM   159  C  CA  . HIS A 1 21  ? -0.704 13.160  34.875  1.00 41.18 ? 115  HIS A CA  1 
ATOM   160  C  C   . HIS A 1 21  ? -0.602 13.596  36.325  1.00 42.47 ? 115  HIS A C   1 
ATOM   161  O  O   . HIS A 1 21  ? -0.687 12.774  37.239  1.00 43.24 ? 115  HIS A O   1 
ATOM   162  C  CB  . HIS A 1 21  ? -2.175 12.881  34.585  1.00 41.53 ? 115  HIS A CB  1 
ATOM   163  C  CG  . HIS A 1 21  ? -3.089 13.953  35.099  1.00 41.63 ? 115  HIS A CG  1 
ATOM   164  N  ND1 . HIS A 1 21  ? -3.437 15.060  34.354  1.00 40.60 ? 115  HIS A ND1 1 
ATOM   165  C  CD2 . HIS A 1 21  ? -3.667 14.123  36.314  1.00 41.75 ? 115  HIS A CD2 1 
ATOM   166  C  CE1 . HIS A 1 21  ? -4.189 15.864  35.086  1.00 40.07 ? 115  HIS A CE1 1 
ATOM   167  N  NE2 . HIS A 1 21  ? -4.343 15.319  36.279  1.00 40.12 ? 115  HIS A NE2 1 
ATOM   168  N  N   . SER A 1 22  ? -0.447 14.896  36.528  1.00 42.43 ? 116  SER A N   1 
ATOM   169  C  CA  . SER A 1 22  ? -0.340 15.441  37.868  1.00 43.27 ? 116  SER A CA  1 
ATOM   170  C  C   . SER A 1 22  ? -0.995 16.821  37.896  1.00 45.16 ? 116  SER A C   1 
ATOM   171  O  O   . SER A 1 22  ? -1.231 17.441  36.846  1.00 44.90 ? 116  SER A O   1 
ATOM   172  C  CB  . SER A 1 22  ? 1.132  15.527  38.259  1.00 43.33 ? 116  SER A CB  1 
ATOM   173  O  OG  . SER A 1 22  ? 1.796  14.331  37.883  1.00 39.86 ? 116  SER A OG  1 
ATOM   174  N  N   . GLY A 1 23  ? -1.302 17.301  39.093  1.00 44.46 ? 117  GLY A N   1 
ATOM   175  C  CA  . GLY A 1 23  ? -1.946 18.593  39.192  1.00 46.44 ? 117  GLY A CA  1 
ATOM   176  C  C   . GLY A 1 23  ? -1.026 19.757  38.890  1.00 47.36 ? 117  GLY A C   1 
ATOM   177  O  O   . GLY A 1 23  ? 0.034  19.601  38.268  1.00 47.14 ? 117  GLY A O   1 
ATOM   178  N  N   . THR A 1 24  ? -1.461 20.935  39.320  1.00 46.75 ? 118  THR A N   1 
ATOM   179  C  CA  . THR A 1 24  ? -0.697 22.159  39.159  1.00 46.31 ? 118  THR A CA  1 
ATOM   180  C  C   . THR A 1 24  ? -0.611 22.721  40.568  1.00 46.71 ? 118  THR A C   1 
ATOM   181  O  O   . THR A 1 24  ? -0.238 23.876  40.780  1.00 46.35 ? 118  THR A O   1 
ATOM   182  C  CB  . THR A 1 24  ? -1.411 23.172  38.241  1.00 45.63 ? 118  THR A CB  1 
ATOM   183  O  OG1 . THR A 1 24  ? -2.716 23.465  38.760  1.00 45.61 ? 118  THR A OG1 1 
ATOM   184  C  CG2 . THR A 1 24  ? -1.520 22.618  36.825  1.00 44.17 ? 118  THR A CG2 1 
ATOM   185  N  N   . ALA A 1 25  ? -0.971 21.873  41.528  1.00 47.30 ? 119  ALA A N   1 
ATOM   186  C  CA  . ALA A 1 25  ? -0.956 22.231  42.939  1.00 48.75 ? 119  ALA A CA  1 
ATOM   187  C  C   . ALA A 1 25  ? 0.421  22.718  43.368  1.00 50.15 ? 119  ALA A C   1 
ATOM   188  O  O   . ALA A 1 25  ? 1.448  22.152  42.986  1.00 48.47 ? 119  ALA A O   1 
ATOM   189  C  CB  . ALA A 1 25  ? -1.374 21.028  43.792  1.00 47.82 ? 119  ALA A CB  1 
ATOM   190  N  N   . LYS A 1 26  ? 0.426  23.773  44.172  1.00 51.95 ? 120  LYS A N   1 
ATOM   191  C  CA  . LYS A 1 26  ? 1.658  24.354  44.679  1.00 53.70 ? 120  LYS A CA  1 
ATOM   192  C  C   . LYS A 1 26  ? 2.498  23.281  45.400  1.00 56.90 ? 120  LYS A C   1 
ATOM   193  O  O   . LYS A 1 26  ? 3.670  23.509  45.729  1.00 58.23 ? 120  LYS A O   1 
ATOM   194  C  CB  . LYS A 1 26  ? 1.299  25.525  45.606  1.00 51.99 ? 120  LYS A CB  1 
ATOM   195  C  CG  . LYS A 1 26  ? 0.492  26.642  44.876  1.00 49.14 ? 120  LYS A CG  1 
ATOM   196  C  CD  . LYS A 1 26  ? -0.660 27.227  45.716  1.00 40.33 ? 120  LYS A CD  1 
ATOM   197  C  CE  . LYS A 1 26  ? -1.478 28.248  44.925  1.00 34.38 ? 120  LYS A CE  1 
ATOM   198  N  NZ  . LYS A 1 26  ? -0.681 29.415  44.434  1.00 22.84 ? 120  LYS A NZ  1 
ATOM   199  N  N   . SER A 1 27  ? 1.898  22.108  45.622  1.00 56.78 ? 121  SER A N   1 
ATOM   200  C  CA  . SER A 1 27  ? 2.578  20.990  46.278  1.00 57.88 ? 121  SER A CA  1 
ATOM   201  C  C   . SER A 1 27  ? 2.689  19.760  45.368  1.00 58.91 ? 121  SER A C   1 
ATOM   202  O  O   . SER A 1 27  ? 2.073  18.715  45.634  1.00 59.00 ? 121  SER A O   1 
ATOM   203  C  CB  . SER A 1 27  ? 1.857  20.594  47.573  1.00 59.00 ? 121  SER A CB  1 
ATOM   204  O  OG  . SER A 1 27  ? 2.280  21.392  48.669  1.00 62.46 ? 121  SER A OG  1 
ATOM   205  N  N   . VAL A 1 28  ? 3.479  19.895  44.301  1.00 56.08 ? 122  VAL A N   1 
ATOM   206  C  CA  . VAL A 1 28  ? 3.698  18.814  43.344  1.00 51.51 ? 122  VAL A CA  1 
ATOM   207  C  C   . VAL A 1 28  ? 5.187  18.767  42.997  1.00 49.33 ? 122  VAL A C   1 
ATOM   208  O  O   . VAL A 1 28  ? 5.774  19.796  42.650  1.00 47.81 ? 122  VAL A O   1 
ATOM   209  C  CB  . VAL A 1 28  ? 2.854  19.031  42.058  1.00 49.66 ? 122  VAL A CB  1 
ATOM   210  C  CG1 . VAL A 1 28  ? 3.222  20.344  41.400  1.00 48.15 ? 122  VAL A CG1 1 
ATOM   211  C  CG2 . VAL A 1 28  ? 3.064  17.873  41.099  1.00 49.80 ? 122  VAL A CG2 1 
ATOM   212  N  N   . THR A 1 29  ? 5.792  17.579  43.099  1.00 46.62 ? 123  THR A N   1 
ATOM   213  C  CA  . THR A 1 29  ? 7.225  17.404  42.825  1.00 44.13 ? 123  THR A CA  1 
ATOM   214  C  C   . THR A 1 29  ? 7.582  17.405  41.330  1.00 44.10 ? 123  THR A C   1 
ATOM   215  O  O   . THR A 1 29  ? 8.624  17.926  40.926  1.00 45.42 ? 123  THR A O   1 
ATOM   216  C  CB  . THR A 1 29  ? 7.790  16.086  43.470  1.00 43.40 ? 123  THR A CB  1 
ATOM   217  O  OG1 . THR A 1 29  ? 7.168  14.939  42.874  1.00 40.83 ? 123  THR A OG1 1 
ATOM   218  C  CG2 . THR A 1 29  ? 7.547  16.068  44.982  1.00 40.52 ? 123  THR A CG2 1 
ATOM   219  N  N   . CYS A 1 30  ? 6.722  16.814  40.513  1.00 41.29 ? 124  CYS A N   1 
ATOM   220  C  CA  . CYS A 1 30  ? 6.954  16.758  39.078  1.00 39.18 ? 124  CYS A CA  1 
ATOM   221  C  C   . CYS A 1 30  ? 5.644  16.732  38.313  1.00 37.94 ? 124  CYS A C   1 
ATOM   222  O  O   . CYS A 1 30  ? 4.830  15.821  38.480  1.00 39.67 ? 124  CYS A O   1 
ATOM   223  C  CB  . CYS A 1 30  ? 7.755  15.520  38.701  1.00 39.40 ? 124  CYS A CB  1 
ATOM   224  S  SG  . CYS A 1 30  ? 7.902  15.353  36.916  1.00 38.72 ? 124  CYS A SG  1 
ATOM   225  N  N   . THR A 1 31  ? 5.444  17.730  37.466  1.00 35.52 ? 125  THR A N   1 
ATOM   226  C  CA  . THR A 1 31  ? 4.228  17.814  36.682  1.00 33.70 ? 125  THR A CA  1 
ATOM   227  C  C   . THR A 1 31  ? 4.565  18.092  35.225  1.00 32.52 ? 125  THR A C   1 
ATOM   228  O  O   . THR A 1 31  ? 5.513  18.816  34.922  1.00 32.97 ? 125  THR A O   1 
ATOM   229  C  CB  . THR A 1 31  ? 3.313  18.917  37.222  1.00 35.18 ? 125  THR A CB  1 
ATOM   230  O  OG1 . THR A 1 31  ? 2.096  18.942  36.462  1.00 36.37 ? 125  THR A OG1 1 
ATOM   231  C  CG2 . THR A 1 31  ? 4.017  20.274  37.156  1.00 33.81 ? 125  THR A CG2 1 
ATOM   232  N  N   . TYR A 1 32  ? 3.784  17.515  34.321  1.00 32.97 ? 126  TYR A N   1 
ATOM   233  C  CA  . TYR A 1 32  ? 4.021  17.688  32.889  1.00 34.07 ? 126  TYR A CA  1 
ATOM   234  C  C   . TYR A 1 32  ? 2.959  18.536  32.209  1.00 32.88 ? 126  TYR A C   1 
ATOM   235  O  O   . TYR A 1 32  ? 1.771  18.367  32.466  1.00 34.30 ? 126  TYR A O   1 
ATOM   236  C  CB  . TYR A 1 32  ? 4.070  16.323  32.199  1.00 34.19 ? 126  TYR A CB  1 
ATOM   237  C  CG  . TYR A 1 32  ? 4.174  16.416  30.694  1.00 35.71 ? 126  TYR A CG  1 
ATOM   238  C  CD1 . TYR A 1 32  ? 3.211  15.830  29.871  1.00 34.52 ? 126  TYR A CD1 1 
ATOM   239  C  CD2 . TYR A 1 32  ? 5.233  17.098  30.087  1.00 32.94 ? 126  TYR A CD2 1 
ATOM   240  C  CE1 . TYR A 1 32  ? 3.297  15.921  28.471  1.00 34.32 ? 126  TYR A CE1 1 
ATOM   241  C  CE2 . TYR A 1 32  ? 5.329  17.192  28.696  1.00 30.89 ? 126  TYR A CE2 1 
ATOM   242  C  CZ  . TYR A 1 32  ? 4.358  16.601  27.892  1.00 31.88 ? 126  TYR A CZ  1 
ATOM   243  O  OH  . TYR A 1 32  ? 4.453  16.686  26.516  1.00 29.38 ? 126  TYR A OH  1 
ATOM   244  N  N   . SER A 1 33  ? 3.391  19.436  31.327  1.00 32.81 ? 127  SER A N   1 
ATOM   245  C  CA  . SER A 1 33  ? 2.475  20.311  30.590  1.00 31.69 ? 127  SER A CA  1 
ATOM   246  C  C   . SER A 1 33  ? 2.365  19.908  29.126  1.00 32.81 ? 127  SER A C   1 
ATOM   247  O  O   . SER A 1 33  ? 3.234  20.250  28.320  1.00 31.80 ? 127  SER A O   1 
ATOM   248  C  CB  . SER A 1 33  ? 2.956  21.759  30.647  1.00 31.23 ? 127  SER A CB  1 
ATOM   249  O  OG  . SER A 1 33  ? 2.489  22.508  29.525  1.00 28.93 ? 127  SER A OG  1 
ATOM   250  N  N   . PRO A 1 34  ? 1.293  19.188  28.757  1.00 33.32 ? 128  PRO A N   1 
ATOM   251  C  CA  . PRO A 1 34  ? 1.120  18.767  27.362  1.00 32.48 ? 128  PRO A CA  1 
ATOM   252  C  C   . PRO A 1 34  ? 1.009  19.962  26.434  1.00 32.48 ? 128  PRO A C   1 
ATOM   253  O  O   . PRO A 1 34  ? 1.507  19.933  25.310  1.00 35.10 ? 128  PRO A O   1 
ATOM   254  C  CB  . PRO A 1 34  ? -0.151 17.921  27.404  1.00 33.03 ? 128  PRO A CB  1 
ATOM   255  C  CG  . PRO A 1 34  ? -0.922 18.503  28.575  1.00 36.04 ? 128  PRO A CG  1 
ATOM   256  C  CD  . PRO A 1 34  ? 0.167  18.739  29.599  1.00 34.77 ? 128  PRO A CD  1 
ATOM   257  N  N   . ALA A 1 35  ? 0.376  21.027  26.913  1.00 34.10 ? 129  ALA A N   1 
ATOM   258  C  CA  . ALA A 1 35  ? 0.215  22.237  26.107  1.00 33.52 ? 129  ALA A CA  1 
ATOM   259  C  C   . ALA A 1 35  ? 1.573  22.745  25.607  1.00 35.50 ? 129  ALA A C   1 
ATOM   260  O  O   . ALA A 1 35  ? 1.779  22.926  24.406  1.00 38.31 ? 129  ALA A O   1 
ATOM   261  C  CB  . ALA A 1 35  ? -0.475 23.314  26.924  1.00 31.95 ? 129  ALA A CB  1 
ATOM   262  N  N   . LEU A 1 36  ? 2.503  22.953  26.534  1.00 34.93 ? 130  LEU A N   1 
ATOM   263  C  CA  . LEU A 1 36  ? 3.836  23.448  26.196  1.00 33.92 ? 130  LEU A CA  1 
ATOM   264  C  C   . LEU A 1 36  ? 4.845  22.324  25.937  1.00 34.34 ? 130  LEU A C   1 
ATOM   265  O  O   . LEU A 1 36  ? 5.992  22.593  25.563  1.00 35.03 ? 130  LEU A O   1 
ATOM   266  C  CB  . LEU A 1 36  ? 4.361  24.330  27.339  1.00 32.81 ? 130  LEU A CB  1 
ATOM   267  C  CG  . LEU A 1 36  ? 3.604  25.615  27.712  1.00 29.45 ? 130  LEU A CG  1 
ATOM   268  C  CD1 . LEU A 1 36  ? 3.593  25.783  29.215  1.00 25.97 ? 130  LEU A CD1 1 
ATOM   269  C  CD2 . LEU A 1 36  ? 4.255  26.816  27.044  1.00 28.62 ? 130  LEU A CD2 1 
ATOM   270  N  N   . ASN A 1 37  ? 4.419  21.073  26.124  1.00 33.36 ? 131  ASN A N   1 
ATOM   271  C  CA  . ASN A 1 37  ? 5.310  19.913  25.967  1.00 32.09 ? 131  ASN A CA  1 
ATOM   272  C  C   . ASN A 1 37  ? 6.536  20.175  26.827  1.00 30.90 ? 131  ASN A C   1 
ATOM   273  O  O   . ASN A 1 37  ? 7.679  20.052  26.372  1.00 28.03 ? 131  ASN A O   1 
ATOM   274  C  CB  . ASN A 1 37  ? 5.760  19.716  24.520  1.00 31.36 ? 131  ASN A CB  1 
ATOM   275  C  CG  . ASN A 1 37  ? 6.609  18.471  24.362  1.00 33.21 ? 131  ASN A CG  1 
ATOM   276  O  OD1 . ASN A 1 37  ? 6.335  17.447  25.004  1.00 31.15 ? 131  ASN A OD1 1 
ATOM   277  N  ND2 . ASN A 1 37  ? 7.644  18.542  23.517  1.00 30.75 ? 131  ASN A ND2 1 
ATOM   278  N  N   . LYS A 1 38  ? 6.278  20.544  28.078  1.00 30.16 ? 132  LYS A N   1 
ATOM   279  C  CA  . LYS A 1 38  ? 7.334  20.889  29.007  1.00 29.46 ? 132  LYS A CA  1 
ATOM   280  C  C   . LYS A 1 38  ? 7.096  20.279  30.362  1.00 29.98 ? 132  LYS A C   1 
ATOM   281  O  O   . LYS A 1 38  ? 5.964  20.203  30.834  1.00 31.87 ? 132  LYS A O   1 
ATOM   282  C  CB  . LYS A 1 38  ? 7.403  22.410  29.134  1.00 29.14 ? 132  LYS A CB  1 
ATOM   283  C  CG  . LYS A 1 38  ? 8.499  22.968  30.049  1.00 27.29 ? 132  LYS A CG  1 
ATOM   284  C  CD  . LYS A 1 38  ? 8.593  24.477  29.828  1.00 23.31 ? 132  LYS A CD  1 
ATOM   285  C  CE  . LYS A 1 38  ? 9.652  25.131  30.671  1.00 23.03 ? 132  LYS A CE  1 
ATOM   286  N  NZ  . LYS A 1 38  ? 9.758  26.588  30.306  1.00 23.29 ? 132  LYS A NZ  1 
ATOM   287  N  N   . MET A 1 39  ? 8.181  19.849  30.986  1.00 31.05 ? 133  MET A N   1 
ATOM   288  C  CA  . MET A 1 39  ? 8.121  19.245  32.303  1.00 31.75 ? 133  MET A CA  1 
ATOM   289  C  C   . MET A 1 39  ? 8.667  20.201  33.354  1.00 30.36 ? 133  MET A C   1 
ATOM   290  O  O   . MET A 1 39  ? 9.694  20.855  33.143  1.00 32.38 ? 133  MET A O   1 
ATOM   291  C  CB  . MET A 1 39  ? 8.939  17.954  32.324  1.00 34.46 ? 133  MET A CB  1 
ATOM   292  C  CG  . MET A 1 39  ? 9.500  17.642  33.681  1.00 39.65 ? 133  MET A CG  1 
ATOM   293  S  SD  . MET A 1 39  ? 10.235 16.026  33.735  1.00 50.07 ? 133  MET A SD  1 
ATOM   294  C  CE  . MET A 1 39  ? 8.710  15.011  33.614  1.00 46.90 ? 133  MET A CE  1 
ATOM   295  N  N   . PHE A 1 40  ? 7.972  20.285  34.483  1.00 28.24 ? 134  PHE A N   1 
ATOM   296  C  CA  . PHE A 1 40  ? 8.405  21.140  35.584  1.00 27.06 ? 134  PHE A CA  1 
ATOM   297  C  C   . PHE A 1 40  ? 8.662  20.182  36.736  1.00 27.60 ? 134  PHE A C   1 
ATOM   298  O  O   . PHE A 1 40  ? 7.818  19.340  37.026  1.00 24.37 ? 134  PHE A O   1 
ATOM   299  C  CB  . PHE A 1 40  ? 7.314  22.148  35.979  1.00 24.69 ? 134  PHE A CB  1 
ATOM   300  C  CG  . PHE A 1 40  ? 6.921  23.097  34.872  1.00 22.88 ? 134  PHE A CG  1 
ATOM   301  C  CD1 . PHE A 1 40  ? 6.041  22.695  33.868  1.00 24.38 ? 134  PHE A CD1 1 
ATOM   302  C  CD2 . PHE A 1 40  ? 7.456  24.383  34.817  1.00 23.73 ? 134  PHE A CD2 1 
ATOM   303  C  CE1 . PHE A 1 40  ? 5.695  23.554  32.818  1.00 21.93 ? 134  PHE A CE1 1 
ATOM   304  C  CE2 . PHE A 1 40  ? 7.124  25.254  33.776  1.00 24.93 ? 134  PHE A CE2 1 
ATOM   305  C  CZ  . PHE A 1 40  ? 6.236  24.832  32.768  1.00 25.02 ? 134  PHE A CZ  1 
ATOM   306  N  N   . CYS A 1 41  ? 9.823  20.301  37.381  1.00 30.36 ? 135  CYS A N   1 
ATOM   307  C  CA  . CYS A 1 41  ? 10.175 19.416  38.486  1.00 32.30 ? 135  CYS A CA  1 
ATOM   308  C  C   . CYS A 1 41  ? 11.154 20.061  39.474  1.00 34.00 ? 135  CYS A C   1 
ATOM   309  O  O   . CYS A 1 41  ? 11.820 21.046  39.145  1.00 35.87 ? 135  CYS A O   1 
ATOM   310  C  CB  . CYS A 1 41  ? 10.799 18.146  37.920  1.00 33.25 ? 135  CYS A CB  1 
ATOM   311  S  SG  . CYS A 1 41  ? 12.337 18.493  37.036  1.00 35.88 ? 135  CYS A SG  1 
ATOM   312  N  N   . GLN A 1 42  ? 11.250 19.495  40.677  1.00 34.65 ? 136  GLN A N   1 
ATOM   313  C  CA  . GLN A 1 42  ? 12.161 20.021  41.691  1.00 35.96 ? 136  GLN A CA  1 
ATOM   314  C  C   . GLN A 1 42  ? 13.518 19.337  41.578  1.00 34.62 ? 136  GLN A C   1 
ATOM   315  O  O   . GLN A 1 42  ? 13.621 18.220  41.072  1.00 33.13 ? 136  GLN A O   1 
ATOM   316  C  CB  . GLN A 1 42  ? 11.603 19.792  43.092  1.00 38.30 ? 136  GLN A CB  1 
ATOM   317  C  CG  . GLN A 1 42  ? 10.200 20.296  43.281  1.00 39.83 ? 136  GLN A CG  1 
ATOM   318  C  CD  . GLN A 1 42  ? 9.756  20.186  44.717  1.00 40.60 ? 136  GLN A CD  1 
ATOM   319  O  OE1 . GLN A 1 42  ? 9.782  19.102  45.306  1.00 41.16 ? 136  GLN A OE1 1 
ATOM   320  N  NE2 . GLN A 1 42  ? 9.344  21.311  45.296  1.00 39.88 ? 136  GLN A NE2 1 
ATOM   321  N  N   . LEU A 1 43  ? 14.554 20.007  42.067  1.00 34.27 ? 137  LEU A N   1 
ATOM   322  C  CA  . LEU A 1 43  ? 15.909 19.466  42.009  1.00 33.83 ? 137  LEU A CA  1 
ATOM   323  C  C   . LEU A 1 43  ? 15.971 18.078  42.645  1.00 33.19 ? 137  LEU A C   1 
ATOM   324  O  O   . LEU A 1 43  ? 15.465 17.869  43.748  1.00 32.85 ? 137  LEU A O   1 
ATOM   325  C  CB  . LEU A 1 43  ? 16.892 20.413  42.724  1.00 33.24 ? 137  LEU A CB  1 
ATOM   326  C  CG  . LEU A 1 43  ? 18.366 20.424  42.276  1.00 32.62 ? 137  LEU A CG  1 
ATOM   327  C  CD1 . LEU A 1 43  ? 19.102 21.518  43.021  1.00 33.46 ? 137  LEU A CD1 1 
ATOM   328  C  CD2 . LEU A 1 43  ? 19.036 19.078  42.532  1.00 33.21 ? 137  LEU A CD2 1 
ATOM   329  N  N   . ALA A 1 44  ? 16.580 17.134  41.932  1.00 32.37 ? 138  ALA A N   1 
ATOM   330  C  CA  . ALA A 1 44  ? 16.737 15.775  42.421  1.00 33.96 ? 138  ALA A CA  1 
ATOM   331  C  C   . ALA A 1 44  ? 15.432 15.196  42.932  1.00 36.58 ? 138  ALA A C   1 
ATOM   332  O  O   . ALA A 1 44  ? 15.255 15.006  44.128  1.00 43.37 ? 138  ALA A O   1 
ATOM   333  C  CB  . ALA A 1 44  ? 17.773 15.749  43.526  1.00 32.55 ? 138  ALA A CB  1 
ATOM   334  N  N   . LYS A 1 45  ? 14.513 14.924  42.022  1.00 36.76 ? 139  LYS A N   1 
ATOM   335  C  CA  . LYS A 1 45  ? 13.221 14.356  42.373  1.00 36.40 ? 139  LYS A CA  1 
ATOM   336  C  C   . LYS A 1 45  ? 12.757 13.540  41.174  1.00 37.39 ? 139  LYS A C   1 
ATOM   337  O  O   . LYS A 1 45  ? 12.935 13.952  40.028  1.00 35.68 ? 139  LYS A O   1 
ATOM   338  C  CB  . LYS A 1 45  ? 12.200 15.459  42.649  1.00 34.96 ? 139  LYS A CB  1 
ATOM   339  C  CG  . LYS A 1 45  ? 12.510 16.329  43.841  1.00 38.77 ? 139  LYS A CG  1 
ATOM   340  C  CD  . LYS A 1 45  ? 11.953 15.763  45.140  1.00 40.37 ? 139  LYS A CD  1 
ATOM   341  C  CE  . LYS A 1 45  ? 12.435 16.596  46.334  1.00 43.51 ? 139  LYS A CE  1 
ATOM   342  N  NZ  . LYS A 1 45  ? 11.804 16.198  47.628  1.00 44.72 ? 139  LYS A NZ  1 
ATOM   343  N  N   . THR A 1 46  ? 12.168 12.384  41.452  1.00 38.20 ? 140  THR A N   1 
ATOM   344  C  CA  . THR A 1 46  ? 11.667 11.479  40.429  1.00 36.78 ? 140  THR A CA  1 
ATOM   345  C  C   . THR A 1 46  ? 10.960 12.166  39.264  1.00 35.12 ? 140  THR A C   1 
ATOM   346  O  O   . THR A 1 46  ? 9.970  12.865  39.459  1.00 36.32 ? 140  THR A O   1 
ATOM   347  C  CB  . THR A 1 46  ? 10.674 10.480  41.043  1.00 36.41 ? 140  THR A CB  1 
ATOM   348  O  OG1 . THR A 1 46  ? 11.327 9.723   42.070  1.00 34.75 ? 140  THR A OG1 1 
ATOM   349  C  CG2 . THR A 1 46  ? 10.130 9.549   39.975  1.00 37.71 ? 140  THR A CG2 1 
ATOM   350  N  N   . CYS A 1 47  ? 11.477 11.974  38.056  1.00 35.63 ? 141  CYS A N   1 
ATOM   351  C  CA  . CYS A 1 47  ? 10.849 12.525  36.861  1.00 34.41 ? 141  CYS A CA  1 
ATOM   352  C  C   . CYS A 1 47  ? 10.575 11.333  35.969  1.00 33.67 ? 141  CYS A C   1 
ATOM   353  O  O   . CYS A 1 47  ? 11.458 10.839  35.265  1.00 33.03 ? 141  CYS A O   1 
ATOM   354  C  CB  . CYS A 1 47  ? 11.761 13.511  36.154  1.00 36.10 ? 141  CYS A CB  1 
ATOM   355  S  SG  . CYS A 1 47  ? 11.998 15.022  37.082  1.00 46.70 ? 141  CYS A SG  1 
ATOM   356  N  N   . PRO A 1 48  ? 9.344  10.821  36.021  1.00 33.05 ? 142  PRO A N   1 
ATOM   357  C  CA  . PRO A 1 48  ? 9.025  9.671   35.186  1.00 32.33 ? 142  PRO A CA  1 
ATOM   358  C  C   . PRO A 1 48  ? 8.764  10.082  33.751  1.00 29.03 ? 142  PRO A C   1 
ATOM   359  O  O   . PRO A 1 48  ? 7.982  10.992  33.490  1.00 27.79 ? 142  PRO A O   1 
ATOM   360  C  CB  . PRO A 1 48  ? 7.787  9.092   35.869  1.00 32.92 ? 142  PRO A CB  1 
ATOM   361  C  CG  . PRO A 1 48  ? 7.094  10.338  36.339  1.00 34.07 ? 142  PRO A CG  1 
ATOM   362  C  CD  . PRO A 1 48  ? 8.234  11.133  36.937  1.00 32.86 ? 142  PRO A CD  1 
ATOM   363  N  N   . VAL A 1 49  ? 9.457  9.422   32.833  1.00 27.86 ? 143  VAL A N   1 
ATOM   364  C  CA  . VAL A 1 49  ? 9.294  9.652   31.405  1.00 26.77 ? 143  VAL A CA  1 
ATOM   365  C  C   . VAL A 1 49  ? 8.979  8.272   30.856  1.00 28.79 ? 143  VAL A C   1 
ATOM   366  O  O   . VAL A 1 49  ? 9.683  7.301   31.161  1.00 28.19 ? 143  VAL A O   1 
ATOM   367  C  CB  . VAL A 1 49  ? 10.578 10.169  30.743  1.00 24.94 ? 143  VAL A CB  1 
ATOM   368  C  CG1 . VAL A 1 49  ? 10.402 10.207  29.249  1.00 23.09 ? 143  VAL A CG1 1 
ATOM   369  C  CG2 . VAL A 1 49  ? 10.896 11.567  31.248  1.00 27.75 ? 143  VAL A CG2 1 
ATOM   370  N  N   . GLN A 1 50  ? 7.906  8.184   30.074  1.00 30.94 ? 144  GLN A N   1 
ATOM   371  C  CA  . GLN A 1 50  ? 7.464  6.919   29.493  1.00 31.04 ? 144  GLN A CA  1 
ATOM   372  C  C   . GLN A 1 50  ? 7.940  6.675   28.064  1.00 30.54 ? 144  GLN A C   1 
ATOM   373  O  O   . GLN A 1 50  ? 7.903  7.569   27.215  1.00 29.56 ? 144  GLN A O   1 
ATOM   374  C  CB  . GLN A 1 50  ? 5.933  6.837   29.494  1.00 31.62 ? 144  GLN A CB  1 
ATOM   375  C  CG  . GLN A 1 50  ? 5.280  6.935   30.864  1.00 37.19 ? 144  GLN A CG  1 
ATOM   376  C  CD  . GLN A 1 50  ? 3.774  6.649   30.827  1.00 39.72 ? 144  GLN A CD  1 
ATOM   377  O  OE1 . GLN A 1 50  ? 3.034  7.190   29.991  1.00 41.48 ? 144  GLN A OE1 1 
ATOM   378  N  NE2 . GLN A 1 50  ? 3.316  5.802   31.745  1.00 40.26 ? 144  GLN A NE2 1 
ATOM   379  N  N   . LEU A 1 51  ? 8.374  5.448   27.806  1.00 29.42 ? 145  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 51  ? 8.815  5.055   26.479  1.00 28.25 ? 145  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 51  ? 7.702  4.196   25.895  1.00 29.23 ? 145  LEU A C   1 
ATOM   382  O  O   . LEU A 1 51  ? 7.311  3.192   26.495  1.00 31.51 ? 145  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 51  ? 10.105 4.234   26.564  1.00 24.40 ? 145  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 51  ? 11.259 4.848   27.363  1.00 25.15 ? 145  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 51  ? 12.514 4.004   27.173  1.00 24.36 ? 145  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 51  ? 11.510 6.270   26.891  1.00 23.81 ? 145  LEU A CD2 1 
ATOM   387  N  N   . TRP A 1 52  ? 7.173  4.598   24.746  1.00 29.70 ? 146  TRP A N   1 
ATOM   388  C  CA  . TRP A 1 52  ? 6.119  3.835   24.087  1.00 31.74 ? 146  TRP A CA  1 
ATOM   389  C  C   . TRP A 1 52  ? 6.593  3.443   22.692  1.00 33.31 ? 146  TRP A C   1 
ATOM   390  O  O   . TRP A 1 52  ? 7.155  4.273   21.981  1.00 38.78 ? 146  TRP A O   1 
ATOM   391  C  CB  . TRP A 1 52  ? 4.834  4.662   23.960  1.00 32.05 ? 146  TRP A CB  1 
ATOM   392  C  CG  . TRP A 1 52  ? 4.146  4.958   25.266  1.00 35.52 ? 146  TRP A CG  1 
ATOM   393  C  CD1 . TRP A 1 52  ? 4.568  5.810   26.241  1.00 34.74 ? 146  TRP A CD1 1 
ATOM   394  C  CD2 . TRP A 1 52  ? 2.928  4.374   25.744  1.00 37.49 ? 146  TRP A CD2 1 
ATOM   395  N  NE1 . TRP A 1 52  ? 3.692  5.795   27.298  1.00 35.92 ? 146  TRP A NE1 1 
ATOM   396  C  CE2 . TRP A 1 52  ? 2.675  4.921   27.019  1.00 38.37 ? 146  TRP A CE2 1 
ATOM   397  C  CE3 . TRP A 1 52  ? 2.027  3.436   25.217  1.00 39.53 ? 146  TRP A CE3 1 
ATOM   398  C  CZ2 . TRP A 1 52  ? 1.553  4.563   27.781  1.00 40.66 ? 146  TRP A CZ2 1 
ATOM   399  C  CZ3 . TRP A 1 52  ? 0.910  3.077   25.975  1.00 39.01 ? 146  TRP A CZ3 1 
ATOM   400  C  CH2 . TRP A 1 52  ? 0.686  3.642   27.243  1.00 40.59 ? 146  TRP A CH2 1 
ATOM   401  N  N   . VAL A 1 53  ? 6.384  2.188   22.303  1.00 31.90 ? 147  VAL A N   1 
ATOM   402  C  CA  . VAL A 1 53  ? 6.769  1.742   20.969  1.00 33.10 ? 147  VAL A CA  1 
ATOM   403  C  C   . VAL A 1 53  ? 5.694  0.840   20.372  1.00 35.10 ? 147  VAL A C   1 
ATOM   404  O  O   . VAL A 1 53  ? 4.996  0.136   21.110  1.00 34.90 ? 147  VAL A O   1 
ATOM   405  C  CB  . VAL A 1 53  ? 8.133  0.978   20.971  1.00 35.53 ? 147  VAL A CB  1 
ATOM   406  C  CG1 . VAL A 1 53  ? 9.245  1.903   21.441  1.00 35.93 ? 147  VAL A CG1 1 
ATOM   407  C  CG2 . VAL A 1 53  ? 8.060  -0.273  21.841  1.00 32.99 ? 147  VAL A CG2 1 
ATOM   408  N  N   . ASP A 1 54  ? 5.556  0.880   19.042  1.00 35.08 ? 148  ASP A N   1 
ATOM   409  C  CA  . ASP A 1 54  ? 4.577  0.059   18.320  1.00 34.01 ? 148  ASP A CA  1 
ATOM   410  C  C   . ASP A 1 54  ? 5.131  -1.344  18.164  1.00 34.95 ? 148  ASP A C   1 
ATOM   411  O  O   . ASP A 1 54  ? 4.380  -2.321  18.147  1.00 37.56 ? 148  ASP A O   1 
ATOM   412  C  CB  . ASP A 1 54  ? 4.325  0.609   16.917  1.00 36.14 ? 148  ASP A CB  1 
ATOM   413  C  CG  . ASP A 1 54  ? 3.510  1.875   16.918  1.00 37.55 ? 148  ASP A CG  1 
ATOM   414  O  OD1 . ASP A 1 54  ? 3.523  2.574   15.880  1.00 36.14 ? 148  ASP A OD1 1 
ATOM   415  O  OD2 . ASP A 1 54  ? 2.852  2.169   17.942  1.00 42.24 ? 148  ASP A OD2 1 
ATOM   416  N  N   . SER A 1 55  ? 6.451  -1.431  18.015  1.00 35.21 ? 149  SER A N   1 
ATOM   417  C  CA  . SER A 1 55  ? 7.137  -2.714  17.855  1.00 36.26 ? 149  SER A CA  1 
ATOM   418  C  C   . SER A 1 55  ? 8.328  -2.766  18.806  1.00 38.31 ? 149  SER A C   1 
ATOM   419  O  O   . SER A 1 55  ? 9.127  -1.828  18.876  1.00 38.61 ? 149  SER A O   1 
ATOM   420  C  CB  . SER A 1 55  ? 7.638  -2.893  16.413  1.00 34.34 ? 149  SER A CB  1 
ATOM   421  O  OG  . SER A 1 55  ? 6.571  -2.887  15.475  1.00 33.50 ? 149  SER A OG  1 
ATOM   422  N  N   . THR A 1 56  ? 8.444  -3.868  19.535  1.00 38.86 ? 150  THR A N   1 
ATOM   423  C  CA  . THR A 1 56  ? 9.532  -4.036  20.480  1.00 39.46 ? 150  THR A CA  1 
ATOM   424  C  C   . THR A 1 56  ? 10.906 -4.006  19.811  1.00 38.56 ? 150  THR A C   1 
ATOM   425  O  O   . THR A 1 56  ? 11.183 -4.793  18.908  1.00 35.44 ? 150  THR A O   1 
ATOM   426  C  CB  . THR A 1 56  ? 9.365  -5.367  21.266  1.00 41.15 ? 150  THR A CB  1 
ATOM   427  O  OG1 . THR A 1 56  ? 8.509  -5.144  22.396  1.00 42.51 ? 150  THR A OG1 1 
ATOM   428  C  CG2 . THR A 1 56  ? 10.712 -5.896  21.747  1.00 40.27 ? 150  THR A CG2 1 
ATOM   429  N  N   . PRO A 1 57  ? 11.784 -3.082  20.245  1.00 40.25 ? 151  PRO A N   1 
ATOM   430  C  CA  . PRO A 1 57  ? 13.133 -2.982  19.674  1.00 40.22 ? 151  PRO A CA  1 
ATOM   431  C  C   . PRO A 1 57  ? 13.892 -4.228  20.112  1.00 41.95 ? 151  PRO A C   1 
ATOM   432  O  O   . PRO A 1 57  ? 13.613 -4.791  21.173  1.00 43.28 ? 151  PRO A O   1 
ATOM   433  C  CB  . PRO A 1 57  ? 13.717 -1.741  20.346  1.00 40.34 ? 151  PRO A CB  1 
ATOM   434  C  CG  . PRO A 1 57  ? 12.517 -0.971  20.821  1.00 41.55 ? 151  PRO A CG  1 
ATOM   435  C  CD  . PRO A 1 57  ? 11.571 -2.042  21.269  1.00 41.61 ? 151  PRO A CD  1 
ATOM   436  N  N   . PRO A 1 58  ? 14.872 -4.667  19.316  1.00 42.73 ? 152  PRO A N   1 
ATOM   437  C  CA  . PRO A 1 58  ? 15.657 -5.859  19.656  1.00 44.52 ? 152  PRO A CA  1 
ATOM   438  C  C   . PRO A 1 58  ? 16.495 -5.670  20.923  1.00 47.12 ? 152  PRO A C   1 
ATOM   439  O  O   . PRO A 1 58  ? 17.023 -4.583  21.166  1.00 46.54 ? 152  PRO A O   1 
ATOM   440  C  CB  . PRO A 1 58  ? 16.522 -6.062  18.414  1.00 43.86 ? 152  PRO A CB  1 
ATOM   441  C  CG  . PRO A 1 58  ? 16.760 -4.648  17.942  1.00 42.94 ? 152  PRO A CG  1 
ATOM   442  C  CD  . PRO A 1 58  ? 15.390 -4.015  18.096  1.00 43.78 ? 152  PRO A CD  1 
ATOM   443  N  N   . PRO A 1 59  ? 16.654 -6.740  21.729  1.00 49.97 ? 153  PRO A N   1 
ATOM   444  C  CA  . PRO A 1 59  ? 17.439 -6.666  22.972  1.00 49.39 ? 153  PRO A CA  1 
ATOM   445  C  C   . PRO A 1 59  ? 18.806 -6.102  22.607  1.00 46.81 ? 153  PRO A C   1 
ATOM   446  O  O   . PRO A 1 59  ? 19.341 -6.435  21.551  1.00 47.85 ? 153  PRO A O   1 
ATOM   447  C  CB  . PRO A 1 59  ? 17.541 -8.126  23.388  1.00 51.86 ? 153  PRO A CB  1 
ATOM   448  C  CG  . PRO A 1 59  ? 17.698 -8.813  22.039  1.00 49.77 ? 153  PRO A CG  1 
ATOM   449  C  CD  . PRO A 1 59  ? 16.589 -8.136  21.246  1.00 50.24 ? 153  PRO A CD  1 
ATOM   450  N  N   . GLY A 1 60  ? 19.375 -5.264  23.467  1.00 43.27 ? 154  GLY A N   1 
ATOM   451  C  CA  . GLY A 1 60  ? 20.665 -4.672  23.159  1.00 36.79 ? 154  GLY A CA  1 
ATOM   452  C  C   . GLY A 1 60  ? 20.470 -3.206  22.806  1.00 35.51 ? 154  GLY A C   1 
ATOM   453  O  O   . GLY A 1 60  ? 21.435 -2.458  22.629  1.00 31.69 ? 154  GLY A O   1 
ATOM   454  N  N   . THR A 1 61  ? 19.204 -2.804  22.692  1.00 35.49 ? 155  THR A N   1 
ATOM   455  C  CA  . THR A 1 61  ? 18.848 -1.425  22.384  1.00 35.30 ? 155  THR A CA  1 
ATOM   456  C  C   . THR A 1 61  ? 19.006 -0.589  23.659  1.00 36.04 ? 155  THR A C   1 
ATOM   457  O  O   . THR A 1 61  ? 18.731 -1.058  24.765  1.00 34.94 ? 155  THR A O   1 
ATOM   458  C  CB  . THR A 1 61  ? 17.389 -1.320  21.901  1.00 34.63 ? 155  THR A CB  1 
ATOM   459  O  OG1 . THR A 1 61  ? 17.237 -2.052  20.679  1.00 35.86 ? 155  THR A OG1 1 
ATOM   460  C  CG2 . THR A 1 61  ? 17.007 0.136   21.667  1.00 31.88 ? 155  THR A CG2 1 
ATOM   461  N  N   . ARG A 1 62  ? 19.444 0.655   23.505  1.00 35.06 ? 156  ARG A N   1 
ATOM   462  C  CA  . ARG A 1 62  ? 19.649 1.511   24.662  1.00 32.23 ? 156  ARG A CA  1 
ATOM   463  C  C   . ARG A 1 62  ? 18.872 2.817   24.563  1.00 30.66 ? 156  ARG A C   1 
ATOM   464  O  O   . ARG A 1 62  ? 18.489 3.251   23.470  1.00 30.89 ? 156  ARG A O   1 
ATOM   465  C  CB  . ARG A 1 62  ? 21.148 1.801   24.845  1.00 30.30 ? 156  ARG A CB  1 
ATOM   466  C  CG  . ARG A 1 62  ? 22.042 0.551   24.780  1.00 29.71 ? 156  ARG A CG  1 
ATOM   467  C  CD  . ARG A 1 62  ? 23.344 0.722   25.582  1.00 29.27 ? 156  ARG A CD  1 
ATOM   468  N  NE  . ARG A 1 62  ? 24.356 1.536   24.913  1.00 28.31 ? 156  ARG A NE  1 
ATOM   469  C  CZ  . ARG A 1 62  ? 25.396 2.092   25.534  1.00 28.71 ? 156  ARG A CZ  1 
ATOM   470  N  NH1 . ARG A 1 62  ? 25.556 1.929   26.842  1.00 30.59 ? 156  ARG A NH1 1 
ATOM   471  N  NH2 . ARG A 1 62  ? 26.295 2.792   24.851  1.00 27.92 ? 156  ARG A NH2 1 
ATOM   472  N  N   . VAL A 1 63  ? 18.635 3.428   25.724  1.00 28.61 ? 157  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 63  ? 17.917 4.690   25.812  1.00 24.91 ? 157  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 63  ? 18.862 5.743   26.350  1.00 24.03 ? 157  VAL A C   1 
ATOM   475  O  O   . VAL A 1 63  ? 19.293 5.674   27.498  1.00 22.16 ? 157  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 63  ? 16.716 4.589   26.766  1.00 24.95 ? 157  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 63  ? 15.932 5.890   26.747  1.00 24.17 ? 157  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 63  ? 15.819 3.415   26.362  1.00 25.16 ? 157  VAL A CG2 1 
ATOM   479  N  N   . ARG A 1 64  ? 19.195 6.721   25.515  1.00 26.57 ? 158  ARG A N   1 
ATOM   480  C  CA  . ARG A 1 64  ? 20.095 7.794   25.926  1.00 24.75 ? 158  ARG A CA  1 
ATOM   481  C  C   . ARG A 1 64  ? 19.306 9.062   26.243  1.00 26.50 ? 158  ARG A C   1 
ATOM   482  O  O   . ARG A 1 64  ? 18.252 9.316   25.636  1.00 27.58 ? 158  ARG A O   1 
ATOM   483  C  CB  . ARG A 1 64  ? 21.107 8.080   24.816  1.00 24.68 ? 158  ARG A CB  1 
ATOM   484  C  CG  . ARG A 1 64  ? 22.146 9.135   25.183  1.00 27.45 ? 158  ARG A CG  1 
ATOM   485  C  CD  . ARG A 1 64  ? 23.209 9.279   24.097  1.00 25.07 ? 158  ARG A CD  1 
ATOM   486  N  NE  . ARG A 1 64  ? 23.923 8.028   23.872  1.00 28.17 ? 158  ARG A NE  1 
ATOM   487  C  CZ  . ARG A 1 64  ? 24.878 7.558   24.670  1.00 31.11 ? 158  ARG A CZ  1 
ATOM   488  N  NH1 . ARG A 1 64  ? 25.246 8.238   25.746  1.00 33.78 ? 158  ARG A NH1 1 
ATOM   489  N  NH2 . ARG A 1 64  ? 25.453 6.394   24.405  1.00 34.50 ? 158  ARG A NH2 1 
ATOM   490  N  N   . ALA A 1 65  ? 19.802 9.847   27.200  1.00 23.27 ? 159  ALA A N   1 
ATOM   491  C  CA  . ALA A 1 65  ? 19.147 11.098  27.573  1.00 20.98 ? 159  ALA A CA  1 
ATOM   492  C  C   . ALA A 1 65  ? 20.222 12.162  27.608  1.00 24.31 ? 159  ALA A C   1 
ATOM   493  O  O   . ALA A 1 65  ? 21.271 11.970  28.216  1.00 24.75 ? 159  ALA A O   1 
ATOM   494  C  CB  . ALA A 1 65  ? 18.476 10.986  28.926  1.00 18.03 ? 159  ALA A CB  1 
ATOM   495  N  N   . MET A 1 66  ? 19.952 13.282  26.945  1.00 26.63 ? 160  MET A N   1 
ATOM   496  C  CA  . MET A 1 66  ? 20.901 14.379  26.865  1.00 28.65 ? 160  MET A CA  1 
ATOM   497  C  C   . MET A 1 66  ? 20.176 15.725  26.844  1.00 29.73 ? 160  MET A C   1 
ATOM   498  O  O   . MET A 1 66  ? 19.126 15.878  26.204  1.00 28.77 ? 160  MET A O   1 
ATOM   499  C  CB  . MET A 1 66  ? 21.756 14.221  25.594  1.00 27.99 ? 160  MET A CB  1 
ATOM   500  C  CG  . MET A 1 66  ? 22.716 15.366  25.303  1.00 26.90 ? 160  MET A CG  1 
ATOM   501  S  SD  . MET A 1 66  ? 23.759 15.016  23.845  1.00 32.01 ? 160  MET A SD  1 
ATOM   502  C  CE  . MET A 1 66  ? 24.987 13.914  24.571  1.00 26.14 ? 160  MET A CE  1 
ATOM   503  N  N   . ALA A 1 67  ? 20.747 16.702  27.544  1.00 29.27 ? 161  ALA A N   1 
ATOM   504  C  CA  . ALA A 1 67  ? 20.179 18.042  27.600  1.00 28.75 ? 161  ALA A CA  1 
ATOM   505  C  C   . ALA A 1 67  ? 20.944 18.991  26.680  1.00 29.70 ? 161  ALA A C   1 
ATOM   506  O  O   . ALA A 1 67  ? 22.154 18.855  26.482  1.00 31.68 ? 161  ALA A O   1 
ATOM   507  C  CB  . ALA A 1 67  ? 20.224 18.574  29.036  1.00 24.32 ? 161  ALA A CB  1 
ATOM   508  N  N   . ILE A 1 68  ? 20.223 19.951  26.118  1.00 29.13 ? 162  ILE A N   1 
ATOM   509  C  CA  . ILE A 1 68  ? 20.809 20.958  25.252  1.00 28.18 ? 162  ILE A CA  1 
ATOM   510  C  C   . ILE A 1 68  ? 20.032 22.220  25.569  1.00 27.55 ? 162  ILE A C   1 
ATOM   511  O  O   . ILE A 1 68  ? 18.906 22.149  26.066  1.00 24.68 ? 162  ILE A O   1 
ATOM   512  C  CB  . ILE A 1 68  ? 20.611 20.608  23.765  1.00 29.40 ? 162  ILE A CB  1 
ATOM   513  C  CG1 . ILE A 1 68  ? 19.122 20.433  23.459  1.00 28.36 ? 162  ILE A CG1 1 
ATOM   514  C  CG2 . ILE A 1 68  ? 21.346 19.323  23.436  1.00 29.60 ? 162  ILE A CG2 1 
ATOM   515  C  CD1 . ILE A 1 68  ? 18.804 20.346  21.968  1.00 28.71 ? 162  ILE A CD1 1 
ATOM   516  N  N   . TYR A 1 69  ? 20.618 23.378  25.312  1.00 28.96 ? 163  TYR A N   1 
ATOM   517  C  CA  . TYR A 1 69  ? 19.889 24.605  25.583  1.00 29.04 ? 163  TYR A CA  1 
ATOM   518  C  C   . TYR A 1 69  ? 18.879 24.835  24.475  1.00 29.22 ? 163  TYR A C   1 
ATOM   519  O  O   . TYR A 1 69  ? 19.144 24.553  23.310  1.00 30.16 ? 163  TYR A O   1 
ATOM   520  C  CB  . TYR A 1 69  ? 20.860 25.776  25.738  1.00 26.49 ? 163  TYR A CB  1 
ATOM   521  C  CG  . TYR A 1 69  ? 21.510 25.737  27.102  1.00 23.50 ? 163  TYR A CG  1 
ATOM   522  C  CD1 . TYR A 1 69  ? 22.875 25.482  27.246  1.00 19.31 ? 163  TYR A CD1 1 
ATOM   523  C  CD2 . TYR A 1 69  ? 20.724 25.838  28.263  1.00 22.06 ? 163  TYR A CD2 1 
ATOM   524  C  CE1 . TYR A 1 69  ? 23.443 25.315  28.517  1.00 19.82 ? 163  TYR A CE1 1 
ATOM   525  C  CE2 . TYR A 1 69  ? 21.277 25.670  29.528  1.00 20.19 ? 163  TYR A CE2 1 
ATOM   526  C  CZ  . TYR A 1 69  ? 22.637 25.406  29.644  1.00 19.42 ? 163  TYR A CZ  1 
ATOM   527  O  OH  . TYR A 1 69  ? 23.175 25.221  30.888  1.00 21.15 ? 163  TYR A OH  1 
ATOM   528  N  N   . LYS A 1 70  ? 17.704 25.324  24.839  1.00 30.45 ? 164  LYS A N   1 
ATOM   529  C  CA  . LYS A 1 70  ? 16.668 25.540  23.850  1.00 30.77 ? 164  LYS A CA  1 
ATOM   530  C  C   . LYS A 1 70  ? 16.916 26.728  22.927  1.00 32.14 ? 164  LYS A C   1 
ATOM   531  O  O   . LYS A 1 70  ? 16.542 26.691  21.759  1.00 33.22 ? 164  LYS A O   1 
ATOM   532  C  CB  . LYS A 1 70  ? 15.314 25.693  24.542  1.00 30.36 ? 164  LYS A CB  1 
ATOM   533  C  CG  . LYS A 1 70  ? 14.151 25.761  23.578  1.00 29.36 ? 164  LYS A CG  1 
ATOM   534  C  CD  . LYS A 1 70  ? 12.850 25.985  24.303  1.00 31.03 ? 164  LYS A CD  1 
ATOM   535  C  CE  . LYS A 1 70  ? 11.776 26.421  23.333  1.00 33.51 ? 164  LYS A CE  1 
ATOM   536  N  NZ  . LYS A 1 70  ? 10.448 26.550  24.007  1.00 39.88 ? 164  LYS A NZ  1 
ATOM   537  N  N   . GLN A 1 71  ? 17.545 27.779  23.438  1.00 35.40 ? 165  GLN A N   1 
ATOM   538  C  CA  . GLN A 1 71  ? 17.806 28.969  22.627  1.00 38.21 ? 165  GLN A CA  1 
ATOM   539  C  C   . GLN A 1 71  ? 19.045 28.879  21.728  1.00 41.17 ? 165  GLN A C   1 
ATOM   540  O  O   . GLN A 1 71  ? 20.099 28.358  22.122  1.00 43.85 ? 165  GLN A O   1 
ATOM   541  C  CB  . GLN A 1 71  ? 17.894 30.193  23.534  1.00 36.77 ? 165  GLN A CB  1 
ATOM   542  C  CG  . GLN A 1 71  ? 16.591 30.470  24.266  1.00 39.12 ? 165  GLN A CG  1 
ATOM   543  C  CD  . GLN A 1 71  ? 16.781 31.335  25.505  1.00 42.99 ? 165  GLN A CD  1 
ATOM   544  O  OE1 . GLN A 1 71  ? 17.599 31.019  26.378  1.00 45.19 ? 165  GLN A OE1 1 
ATOM   545  N  NE2 . GLN A 1 71  ? 16.022 32.428  25.592  1.00 41.94 ? 165  GLN A NE2 1 
ATOM   546  N  N   . SER A 1 72  ? 18.898 29.401  20.512  1.00 41.29 ? 166  SER A N   1 
ATOM   547  C  CA  . SER A 1 72  ? 19.956 29.400  19.505  1.00 41.05 ? 166  SER A CA  1 
ATOM   548  C  C   . SER A 1 72  ? 21.307 29.910  19.974  1.00 41.88 ? 166  SER A C   1 
ATOM   549  O  O   . SER A 1 72  ? 22.323 29.241  19.780  1.00 42.11 ? 166  SER A O   1 
ATOM   550  C  CB  . SER A 1 72  ? 19.533 30.238  18.307  1.00 40.40 ? 166  SER A CB  1 
ATOM   551  O  OG  . SER A 1 72  ? 18.268 29.836  17.839  1.00 43.79 ? 166  SER A OG  1 
ATOM   552  N  N   . GLN A 1 73  ? 21.322 31.104  20.563  1.00 41.77 ? 167  GLN A N   1 
ATOM   553  C  CA  . GLN A 1 73  ? 22.568 31.704  21.031  1.00 42.66 ? 167  GLN A CA  1 
ATOM   554  C  C   . GLN A 1 73  ? 23.284 30.813  22.035  1.00 42.01 ? 167  GLN A C   1 
ATOM   555  O  O   . GLN A 1 73  ? 24.492 30.955  22.261  1.00 42.51 ? 167  GLN A O   1 
ATOM   556  C  CB  . GLN A 1 73  ? 22.316 33.089  21.665  1.00 45.08 ? 167  GLN A CB  1 
ATOM   557  C  CG  . GLN A 1 73  ? 21.387 33.104  22.888  1.00 46.74 ? 167  GLN A CG  1 
ATOM   558  C  CD  . GLN A 1 73  ? 19.929 33.398  22.530  1.00 49.02 ? 167  GLN A CD  1 
ATOM   559  O  OE1 . GLN A 1 73  ? 19.425 32.953  21.489  1.00 47.47 ? 167  GLN A OE1 1 
ATOM   560  N  NE2 . GLN A 1 73  ? 19.240 34.139  23.402  1.00 49.08 ? 167  GLN A NE2 1 
ATOM   561  N  N   . HIS A 1 74  ? 22.543 29.880  22.623  1.00 39.04 ? 168  HIS A N   1 
ATOM   562  C  CA  . HIS A 1 74  ? 23.132 29.001  23.614  1.00 39.09 ? 168  HIS A CA  1 
ATOM   563  C  C   . HIS A 1 74  ? 23.304 27.532  23.219  1.00 40.44 ? 168  HIS A C   1 
ATOM   564  O  O   . HIS A 1 74  ? 24.076 26.813  23.851  1.00 41.33 ? 168  HIS A O   1 
ATOM   565  C  CB  . HIS A 1 74  ? 22.341 29.120  24.920  1.00 34.99 ? 168  HIS A CB  1 
ATOM   566  C  CG  . HIS A 1 74  ? 22.478 30.460  25.580  1.00 32.25 ? 168  HIS A CG  1 
ATOM   567  N  ND1 . HIS A 1 74  ? 21.403 31.290  25.818  1.00 27.69 ? 168  HIS A ND1 1 
ATOM   568  C  CD2 . HIS A 1 74  ? 23.571 31.121  26.037  1.00 32.96 ? 168  HIS A CD2 1 
ATOM   569  C  CE1 . HIS A 1 74  ? 21.827 32.403  26.391  1.00 31.23 ? 168  HIS A CE1 1 
ATOM   570  N  NE2 . HIS A 1 74  ? 23.139 32.327  26.535  1.00 31.82 ? 168  HIS A NE2 1 
ATOM   571  N  N   . MET A 1 75  ? 22.628 27.089  22.164  1.00 40.76 ? 169  MET A N   1 
ATOM   572  C  CA  . MET A 1 75  ? 22.727 25.689  21.750  1.00 40.44 ? 169  MET A CA  1 
ATOM   573  C  C   . MET A 1 75  ? 24.111 25.055  21.658  1.00 40.33 ? 169  MET A C   1 
ATOM   574  O  O   . MET A 1 75  ? 24.273 23.903  22.063  1.00 41.92 ? 169  MET A O   1 
ATOM   575  C  CB  . MET A 1 75  ? 22.014 25.464  20.425  1.00 42.81 ? 169  MET A CB  1 
ATOM   576  C  CG  . MET A 1 75  ? 20.511 25.651  20.482  1.00 43.55 ? 169  MET A CG  1 
ATOM   577  S  SD  . MET A 1 75  ? 19.759 25.114  18.934  1.00 46.62 ? 169  MET A SD  1 
ATOM   578  C  CE  . MET A 1 75  ? 20.957 25.812  17.686  1.00 43.81 ? 169  MET A CE  1 
ATOM   579  N  N   . THR A 1 76  ? 25.109 25.761  21.130  1.00 38.17 ? 170  THR A N   1 
ATOM   580  C  CA  . THR A 1 76  ? 26.432 25.137  21.037  1.00 34.68 ? 170  THR A CA  1 
ATOM   581  C  C   . THR A 1 76  ? 27.092 25.015  22.397  1.00 34.32 ? 170  THR A C   1 
ATOM   582  O  O   . THR A 1 76  ? 28.184 24.455  22.500  1.00 37.00 ? 170  THR A O   1 
ATOM   583  C  CB  . THR A 1 76  ? 27.402 25.893  20.104  1.00 32.26 ? 170  THR A CB  1 
ATOM   584  O  OG1 . THR A 1 76  ? 27.639 27.207  20.621  1.00 38.00 ? 170  THR A OG1 1 
ATOM   585  C  CG2 . THR A 1 76  ? 26.835 25.982  18.693  1.00 28.95 ? 170  THR A CG2 1 
ATOM   586  N  N   . GLU A 1 77  ? 26.433 25.530  23.436  1.00 30.84 ? 171  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 77  ? 26.965 25.456  24.797  1.00 30.42 ? 171  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 77  ? 26.594 24.135  25.470  1.00 31.11 ? 171  GLU A C   1 
ATOM   589  O  O   . GLU A 1 77  ? 25.450 23.676  25.380  1.00 32.42 ? 171  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 77  ? 26.433 26.619  25.625  1.00 31.93 ? 171  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 77  ? 26.967 27.954  25.185  1.00 32.56 ? 171  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 77  ? 28.413 28.132  25.577  1.00 33.47 ? 171  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 77  ? 29.160 28.737  24.776  1.00 36.15 ? 171  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 77  ? 28.791 27.673  26.687  1.00 31.42 ? 171  GLU A OE2 1 
ATOM   595  N  N   . VAL A 1 78  ? 27.564 23.526  26.143  1.00 28.74 ? 172  VAL A N   1 
ATOM   596  C  CA  . VAL A 1 78  ? 27.347 22.256  26.815  1.00 26.34 ? 172  VAL A CA  1 
ATOM   597  C  C   . VAL A 1 78  ? 26.580 22.446  28.114  1.00 25.56 ? 172  VAL A C   1 
ATOM   598  O  O   . VAL A 1 78  ? 26.983 23.237  28.963  1.00 27.82 ? 172  VAL A O   1 
ATOM   599  C  CB  . VAL A 1 78  ? 28.703 21.564  27.109  1.00 26.58 ? 172  VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 78  ? 28.503 20.355  28.009  1.00 26.53 ? 172  VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 78  ? 29.356 21.121  25.794  1.00 27.61 ? 172  VAL A CG2 1 
ATOM   602  N  N   . VAL A 1 79  ? 25.478 21.724  28.274  1.00 23.00 ? 173  VAL A N   1 
ATOM   603  C  CA  . VAL A 1 79  ? 24.695 21.848  29.497  1.00 25.32 ? 173  VAL A CA  1 
ATOM   604  C  C   . VAL A 1 79  ? 25.343 21.057  30.631  1.00 26.13 ? 173  VAL A C   1 
ATOM   605  O  O   . VAL A 1 79  ? 25.580 19.854  30.492  1.00 27.02 ? 173  VAL A O   1 
ATOM   606  C  CB  . VAL A 1 79  ? 23.259 21.324  29.307  1.00 22.48 ? 173  VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 79  ? 22.501 21.416  30.627  1.00 20.46 ? 173  VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 79  ? 22.554 22.121  28.236  1.00 19.86 ? 173  VAL A CG2 1 
ATOM   609  N  N   . ARG A 1 80  ? 25.624 21.721  31.749  1.00 28.41 ? 174  ARG A N   1 
ATOM   610  C  CA  . ARG A 1 80  ? 26.231 21.031  32.890  1.00 34.38 ? 174  ARG A CA  1 
ATOM   611  C  C   . ARG A 1 80  ? 25.859 21.652  34.242  1.00 34.20 ? 174  ARG A C   1 
ATOM   612  O  O   . ARG A 1 80  ? 25.279 22.737  34.291  1.00 35.28 ? 174  ARG A O   1 
ATOM   613  C  CB  . ARG A 1 80  ? 27.758 20.992  32.723  1.00 38.76 ? 174  ARG A CB  1 
ATOM   614  C  CG  . ARG A 1 80  ? 28.493 22.242  33.169  1.00 41.79 ? 174  ARG A CG  1 
ATOM   615  C  CD  . ARG A 1 80  ? 29.530 22.703  32.134  1.00 47.62 ? 174  ARG A CD  1 
ATOM   616  N  NE  . ARG A 1 80  ? 30.222 21.629  31.397  1.00 49.38 ? 174  ARG A NE  1 
ATOM   617  C  CZ  . ARG A 1 80  ? 31.004 20.689  31.934  1.00 46.69 ? 174  ARG A CZ  1 
ATOM   618  N  NH1 . ARG A 1 80  ? 31.574 19.784  31.144  1.00 46.31 ? 174  ARG A NH1 1 
ATOM   619  N  NH2 . ARG A 1 80  ? 31.205 20.631  33.249  1.00 43.81 ? 174  ARG A NH2 1 
ATOM   620  N  N   . ARG A 1 81  ? 26.184 20.959  35.336  1.00 34.15 ? 175  ARG A N   1 
ATOM   621  C  CA  . ARG A 1 81  ? 25.873 21.452  36.689  1.00 32.36 ? 175  ARG A CA  1 
ATOM   622  C  C   . ARG A 1 81  ? 26.734 22.664  37.028  1.00 30.06 ? 175  ARG A C   1 
ATOM   623  O  O   . ARG A 1 81  ? 27.848 22.799  36.518  1.00 30.97 ? 175  ARG A O   1 
ATOM   624  C  CB  . ARG A 1 81  ? 26.125 20.356  37.742  1.00 32.29 ? 175  ARG A CB  1 
ATOM   625  C  CG  . ARG A 1 81  ? 25.196 19.150  37.639  1.00 37.69 ? 175  ARG A CG  1 
ATOM   626  C  CD  . ARG A 1 81  ? 24.523 18.821  38.991  1.00 39.22 ? 175  ARG A CD  1 
ATOM   627  N  NE  . ARG A 1 81  ? 25.356 18.004  39.868  1.00 38.35 ? 175  ARG A NE  1 
ATOM   628  C  CZ  . ARG A 1 81  ? 25.144 17.869  41.171  1.00 37.51 ? 175  ARG A CZ  1 
ATOM   629  N  NH1 . ARG A 1 81  ? 24.126 18.503  41.739  1.00 34.27 ? 175  ARG A NH1 1 
ATOM   630  N  NH2 . ARG A 1 81  ? 25.945 17.099  41.904  1.00 39.22 ? 175  ARG A NH2 1 
ATOM   631  N  N   . CYS A 1 82  ? 26.229 23.542  37.889  1.00 26.98 ? 176  CYS A N   1 
ATOM   632  C  CA  . CYS A 1 82  ? 27.005 24.712  38.277  1.00 24.17 ? 176  CYS A CA  1 
ATOM   633  C  C   . CYS A 1 82  ? 28.134 24.249  39.173  1.00 23.41 ? 176  CYS A C   1 
ATOM   634  O  O   . CYS A 1 82  ? 28.043 23.195  39.803  1.00 22.32 ? 176  CYS A O   1 
ATOM   635  C  CB  . CYS A 1 82  ? 26.131 25.719  39.026  1.00 25.45 ? 176  CYS A CB  1 
ATOM   636  S  SG  . CYS A 1 82  ? 25.464 25.171  40.627  1.00 24.23 ? 176  CYS A SG  1 
ATOM   637  N  N   . PRO A 1 83  ? 29.235 25.001  39.219  1.00 25.08 ? 177  PRO A N   1 
ATOM   638  C  CA  . PRO A 1 83  ? 30.294 24.512  40.108  1.00 26.51 ? 177  PRO A CA  1 
ATOM   639  C  C   . PRO A 1 83  ? 29.805 24.355  41.543  1.00 27.24 ? 177  PRO A C   1 
ATOM   640  O  O   . PRO A 1 83  ? 30.305 23.508  42.269  1.00 28.15 ? 177  PRO A O   1 
ATOM   641  C  CB  . PRO A 1 83  ? 31.382 25.570  39.960  1.00 24.85 ? 177  PRO A CB  1 
ATOM   642  C  CG  . PRO A 1 83  ? 31.285 25.895  38.491  1.00 23.43 ? 177  PRO A CG  1 
ATOM   643  C  CD  . PRO A 1 83  ? 29.762 26.012  38.283  1.00 26.58 ? 177  PRO A CD  1 
ATOM   644  N  N   . HIS A 1 84  ? 28.817 25.150  41.947  1.00 30.22 ? 178  HIS A N   1 
ATOM   645  C  CA  . HIS A 1 84  ? 28.300 25.057  43.309  1.00 35.07 ? 178  HIS A CA  1 
ATOM   646  C  C   . HIS A 1 84  ? 27.849 23.637  43.639  1.00 36.64 ? 178  HIS A C   1 
ATOM   647  O  O   . HIS A 1 84  ? 28.346 23.021  44.584  1.00 36.65 ? 178  HIS A O   1 
ATOM   648  C  CB  . HIS A 1 84  ? 27.126 26.024  43.520  1.00 38.76 ? 178  HIS A CB  1 
ATOM   649  C  CG  . HIS A 1 84  ? 26.441 25.862  44.847  1.00 42.95 ? 178  HIS A CG  1 
ATOM   650  N  ND1 . HIS A 1 84  ? 27.092 26.042  46.050  1.00 44.16 ? 178  HIS A ND1 1 
ATOM   651  C  CD2 . HIS A 1 84  ? 25.170 25.506  45.159  1.00 45.29 ? 178  HIS A CD2 1 
ATOM   652  C  CE1 . HIS A 1 84  ? 26.253 25.801  47.044  1.00 43.88 ? 178  HIS A CE1 1 
ATOM   653  N  NE2 . HIS A 1 84  ? 25.080 25.473  46.531  1.00 43.96 ? 178  HIS A NE2 1 
ATOM   654  N  N   . HIS A 1 85  ? 26.909 23.120  42.857  1.00 37.31 ? 179  HIS A N   1 
ATOM   655  C  CA  . HIS A 1 85  ? 26.392 21.779  43.086  1.00 37.31 ? 179  HIS A CA  1 
ATOM   656  C  C   . HIS A 1 85  ? 27.326 20.639  42.694  1.00 38.82 ? 179  HIS A C   1 
ATOM   657  O  O   . HIS A 1 85  ? 27.109 19.498  43.099  1.00 40.42 ? 179  HIS A O   1 
ATOM   658  C  CB  . HIS A 1 85  ? 25.048 21.622  42.392  1.00 34.17 ? 179  HIS A CB  1 
ATOM   659  C  CG  . HIS A 1 85  ? 23.926 22.299  43.110  1.00 33.71 ? 179  HIS A CG  1 
ATOM   660  N  ND1 . HIS A 1 85  ? 23.041 23.148  42.479  1.00 34.65 ? 179  HIS A ND1 1 
ATOM   661  C  CD2 . HIS A 1 85  ? 23.518 22.220  44.399  1.00 34.44 ? 179  HIS A CD2 1 
ATOM   662  C  CE1 . HIS A 1 85  ? 22.136 23.561  43.349  1.00 35.06 ? 179  HIS A CE1 1 
ATOM   663  N  NE2 . HIS A 1 85  ? 22.402 23.012  44.521  1.00 36.60 ? 179  HIS A NE2 1 
ATOM   664  N  N   . GLU A 1 86  ? 28.366 20.937  41.922  1.00 41.84 ? 180  GLU A N   1 
ATOM   665  C  CA  . GLU A 1 86  ? 29.321 19.901  41.522  1.00 45.23 ? 180  GLU A CA  1 
ATOM   666  C  C   . GLU A 1 86  ? 30.173 19.559  42.741  1.00 46.83 ? 180  GLU A C   1 
ATOM   667  O  O   . GLU A 1 86  ? 30.589 18.412  42.929  1.00 46.02 ? 180  GLU A O   1 
ATOM   668  C  CB  . GLU A 1 86  ? 30.209 20.398  40.378  1.00 46.71 ? 180  GLU A CB  1 
ATOM   669  C  CG  . GLU A 1 86  ? 31.080 19.340  39.737  1.00 52.46 ? 180  GLU A CG  1 
ATOM   670  C  CD  . GLU A 1 86  ? 31.758 19.838  38.462  1.00 59.65 ? 180  GLU A CD  1 
ATOM   671  O  OE1 . GLU A 1 86  ? 31.035 20.211  37.505  1.00 62.54 ? 180  GLU A OE1 1 
ATOM   672  O  OE2 . GLU A 1 86  ? 33.010 19.857  38.413  1.00 60.86 ? 180  GLU A OE2 1 
ATOM   673  N  N   . ARG A 1 87  ? 30.403 20.564  43.581  1.00 49.39 ? 181  ARG A N   1 
ATOM   674  C  CA  . ARG A 1 87  ? 31.198 20.406  44.796  1.00 52.42 ? 181  ARG A CA  1 
ATOM   675  C  C   . ARG A 1 87  ? 30.452 19.652  45.902  1.00 55.62 ? 181  ARG A C   1 
ATOM   676  O  O   . ARG A 1 87  ? 30.797 19.789  47.078  1.00 56.36 ? 181  ARG A O   1 
ATOM   677  C  CB  . ARG A 1 87  ? 31.630 21.779  45.341  1.00 50.37 ? 181  ARG A CB  1 
ATOM   678  C  CG  . ARG A 1 87  ? 32.538 22.586  44.421  1.00 50.52 ? 181  ARG A CG  1 
ATOM   679  C  CD  . ARG A 1 87  ? 33.191 23.750  45.166  1.00 50.77 ? 181  ARG A CD  1 
ATOM   680  N  NE  . ARG A 1 87  ? 32.238 24.783  45.573  1.00 49.61 ? 181  ARG A NE  1 
ATOM   681  C  CZ  . ARG A 1 87  ? 31.957 25.873  44.861  1.00 47.71 ? 181  ARG A CZ  1 
ATOM   682  N  NH1 . ARG A 1 87  ? 32.559 26.089  43.696  1.00 45.81 ? 181  ARG A NH1 1 
ATOM   683  N  NH2 . ARG A 1 87  ? 31.070 26.751  45.315  1.00 47.47 ? 181  ARG A NH2 1 
ATOM   684  N  N   . CYS A 1 88  ? 29.459 18.837  45.532  1.00 57.87 ? 182  CYS A N   1 
ATOM   685  C  CA  . CYS A 1 88  ? 28.686 18.072  46.518  1.00 57.33 ? 182  CYS A CA  1 
ATOM   686  C  C   . CYS A 1 88  ? 28.225 16.707  45.983  1.00 58.54 ? 182  CYS A C   1 
ATOM   687  O  O   . CYS A 1 88  ? 27.825 16.568  44.818  1.00 58.93 ? 182  CYS A O   1 
ATOM   688  C  CB  . CYS A 1 88  ? 27.468 18.885  46.964  1.00 56.95 ? 182  CYS A CB  1 
ATOM   689  S  SG  . CYS A 1 88  ? 27.824 20.640  47.298  1.00 59.16 ? 182  CYS A SG  1 
ATOM   690  N  N   . ALA A 1 95  ? 27.208 8.030   40.112  1.00 43.67 ? 189  ALA A N   1 
ATOM   691  C  CA  . ALA A 1 95  ? 27.186 8.995   39.008  1.00 43.75 ? 189  ALA A CA  1 
ATOM   692  C  C   . ALA A 1 95  ? 28.179 10.160  39.161  1.00 42.73 ? 189  ALA A C   1 
ATOM   693  O  O   . ALA A 1 95  ? 28.379 10.691  40.264  1.00 40.87 ? 189  ALA A O   1 
ATOM   694  C  CB  . ALA A 1 95  ? 25.771 9.559   38.836  1.00 41.10 ? 189  ALA A CB  1 
ATOM   695  N  N   . PRO A 1 96  ? 28.817 10.574  38.047  1.00 41.95 ? 190  PRO A N   1 
ATOM   696  C  CA  . PRO A 1 96  ? 29.774 11.683  38.104  1.00 41.50 ? 190  PRO A CA  1 
ATOM   697  C  C   . PRO A 1 96  ? 29.072 12.994  38.491  1.00 42.22 ? 190  PRO A C   1 
ATOM   698  O  O   . PRO A 1 96  ? 28.015 13.331  37.942  1.00 39.71 ? 190  PRO A O   1 
ATOM   699  C  CB  . PRO A 1 96  ? 30.342 11.712  36.691  1.00 41.62 ? 190  PRO A CB  1 
ATOM   700  C  CG  . PRO A 1 96  ? 30.305 10.262  36.303  1.00 41.44 ? 190  PRO A CG  1 
ATOM   701  C  CD  . PRO A 1 96  ? 28.933 9.852   36.766  1.00 40.44 ? 190  PRO A CD  1 
ATOM   702  N  N   . PRO A 1 97  ? 29.662 13.751  39.441  1.00 42.71 ? 191  PRO A N   1 
ATOM   703  C  CA  . PRO A 1 97  ? 29.149 15.028  39.958  1.00 41.41 ? 191  PRO A CA  1 
ATOM   704  C  C   . PRO A 1 97  ? 28.869 16.159  38.964  1.00 40.20 ? 191  PRO A C   1 
ATOM   705  O  O   . PRO A 1 97  ? 28.173 17.121  39.308  1.00 39.33 ? 191  PRO A O   1 
ATOM   706  C  CB  . PRO A 1 97  ? 30.199 15.419  40.998  1.00 39.87 ? 191  PRO A CB  1 
ATOM   707  C  CG  . PRO A 1 97  ? 31.449 14.831  40.449  1.00 38.71 ? 191  PRO A CG  1 
ATOM   708  C  CD  . PRO A 1 97  ? 30.982 13.460  40.031  1.00 41.05 ? 191  PRO A CD  1 
ATOM   709  N  N   . GLN A 1 98  ? 29.387 16.047  37.743  1.00 38.85 ? 192  GLN A N   1 
ATOM   710  C  CA  . GLN A 1 98  ? 29.176 17.094  36.747  1.00 37.04 ? 192  GLN A CA  1 
ATOM   711  C  C   . GLN A 1 98  ? 27.975 16.862  35.827  1.00 36.94 ? 192  GLN A C   1 
ATOM   712  O  O   . GLN A 1 98  ? 27.612 17.751  35.056  1.00 40.94 ? 192  GLN A O   1 
ATOM   713  C  CB  . GLN A 1 98  ? 30.438 17.297  35.899  1.00 35.14 ? 192  GLN A CB  1 
ATOM   714  C  CG  . GLN A 1 98  ? 30.732 16.161  34.943  1.00 37.20 ? 192  GLN A CG  1 
ATOM   715  C  CD  . GLN A 1 98  ? 31.397 14.963  35.610  1.00 40.26 ? 192  GLN A CD  1 
ATOM   716  O  OE1 . GLN A 1 98  ? 31.157 14.663  36.789  1.00 40.20 ? 192  GLN A OE1 1 
ATOM   717  N  NE2 . GLN A 1 98  ? 32.226 14.256  34.846  1.00 43.04 ? 192  GLN A NE2 1 
ATOM   718  N  N   . HIS A 1 99  ? 27.354 15.686  35.898  1.00 34.94 ? 193  HIS A N   1 
ATOM   719  C  CA  . HIS A 1 99  ? 26.183 15.400  35.058  1.00 32.91 ? 193  HIS A CA  1 
ATOM   720  C  C   . HIS A 1 99  ? 24.921 16.006  35.666  1.00 30.99 ? 193  HIS A C   1 
ATOM   721  O  O   . HIS A 1 99  ? 24.682 15.892  36.876  1.00 31.18 ? 193  HIS A O   1 
ATOM   722  C  CB  . HIS A 1 99  ? 25.974 13.886  34.897  1.00 31.46 ? 193  HIS A CB  1 
ATOM   723  C  CG  . HIS A 1 99  ? 26.896 13.244  33.903  1.00 30.78 ? 193  HIS A CG  1 
ATOM   724  N  ND1 . HIS A 1 99  ? 26.616 13.184  32.555  1.00 31.73 ? 193  HIS A ND1 1 
ATOM   725  C  CD2 . HIS A 1 99  ? 28.091 12.628  34.064  1.00 28.88 ? 193  HIS A CD2 1 
ATOM   726  C  CE1 . HIS A 1 99  ? 27.595 12.556  31.929  1.00 27.92 ? 193  HIS A CE1 1 
ATOM   727  N  NE2 . HIS A 1 99  ? 28.502 12.209  32.822  1.00 27.87 ? 193  HIS A NE2 1 
ATOM   728  N  N   . LEU A 1 100 ? 24.120 16.654  34.827  1.00 28.65 ? 194  LEU A N   1 
ATOM   729  C  CA  . LEU A 1 100 ? 22.870 17.266  35.281  1.00 28.45 ? 194  LEU A CA  1 
ATOM   730  C  C   . LEU A 1 100 ? 21.751 16.230  35.396  1.00 25.15 ? 194  LEU A C   1 
ATOM   731  O  O   . LEU A 1 100 ? 20.970 16.247  36.354  1.00 23.80 ? 194  LEU A O   1 
ATOM   732  C  CB  . LEU A 1 100 ? 22.426 18.360  34.311  1.00 28.34 ? 194  LEU A CB  1 
ATOM   733  C  CG  . LEU A 1 100 ? 21.041 18.948  34.553  1.00 27.78 ? 194  LEU A CG  1 
ATOM   734  C  CD1 . LEU A 1 100 ? 21.056 19.802  35.788  1.00 29.69 ? 194  LEU A CD1 1 
ATOM   735  C  CD2 . LEU A 1 100 ? 20.637 19.786  33.352  1.00 32.32 ? 194  LEU A CD2 1 
ATOM   736  N  N   . ILE A 1 101 ? 21.680 15.337  34.415  1.00 23.08 ? 195  ILE A N   1 
ATOM   737  C  CA  . ILE A 1 101 ? 20.651 14.302  34.388  1.00 22.96 ? 195  ILE A CA  1 
ATOM   738  C  C   . ILE A 1 101 ? 21.134 12.939  34.855  1.00 26.05 ? 195  ILE A C   1 
ATOM   739  O  O   . ILE A 1 101 ? 22.073 12.366  34.292  1.00 28.69 ? 195  ILE A O   1 
ATOM   740  C  CB  . ILE A 1 101 ? 20.071 14.102  32.984  1.00 18.99 ? 195  ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 101 ? 19.477 15.415  32.466  1.00 17.69 ? 195  ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 101 ? 19.010 13.007  33.034  1.00 14.53 ? 195  ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 101 ? 19.091 15.358  30.995  1.00 16.78 ? 195  ILE A CD1 1 
ATOM   744  N  N   . ARG A 1 102 ? 20.463 12.417  35.872  1.00 27.01 ? 196  ARG A N   1 
ATOM   745  C  CA  . ARG A 1 102 ? 20.781 11.116  36.427  1.00 29.11 ? 196  ARG A CA  1 
ATOM   746  C  C   . ARG A 1 102 ? 19.585 10.190  36.233  1.00 31.25 ? 196  ARG A C   1 
ATOM   747  O  O   . ARG A 1 102 ? 18.502 10.622  35.803  1.00 31.36 ? 196  ARG A O   1 
ATOM   748  C  CB  . ARG A 1 102 ? 21.060 11.231  37.928  1.00 28.76 ? 196  ARG A CB  1 
ATOM   749  C  CG  . ARG A 1 102 ? 22.275 12.054  38.291  1.00 30.62 ? 196  ARG A CG  1 
ATOM   750  C  CD  . ARG A 1 102 ? 22.548 11.982  39.782  1.00 29.49 ? 196  ARG A CD  1 
ATOM   751  N  NE  . ARG A 1 102 ? 23.663 12.845  40.163  1.00 34.64 ? 196  ARG A NE  1 
ATOM   752  C  CZ  . ARG A 1 102 ? 24.097 12.997  41.412  1.00 36.70 ? 196  ARG A CZ  1 
ATOM   753  N  NH1 . ARG A 1 102 ? 25.120 13.806  41.674  1.00 36.31 ? 196  ARG A NH1 1 
ATOM   754  N  NH2 . ARG A 1 102 ? 23.508 12.337  42.403  1.00 38.20 ? 196  ARG A NH2 1 
ATOM   755  N  N   . VAL A 1 103 ? 19.781 8.917   36.566  1.00 30.67 ? 197  VAL A N   1 
ATOM   756  C  CA  . VAL A 1 103 ? 18.709 7.940   36.471  1.00 30.69 ? 197  VAL A CA  1 
ATOM   757  C  C   . VAL A 1 103 ? 18.716 7.136   37.759  1.00 32.68 ? 197  VAL A C   1 
ATOM   758  O  O   . VAL A 1 103 ? 19.761 6.626   38.180  1.00 34.58 ? 197  VAL A O   1 
ATOM   759  C  CB  . VAL A 1 103 ? 18.905 6.988   35.266  1.00 28.79 ? 197  VAL A CB  1 
ATOM   760  C  CG1 . VAL A 1 103 ? 17.845 5.892   35.289  1.00 28.08 ? 197  VAL A CG1 1 
ATOM   761  C  CG2 . VAL A 1 103 ? 18.825 7.771   33.975  1.00 24.90 ? 197  VAL A CG2 1 
ATOM   762  N  N   . GLU A 1 104 ? 17.558 7.046   38.401  1.00 34.55 ? 198  GLU A N   1 
ATOM   763  C  CA  . GLU A 1 104 ? 17.453 6.283   39.632  1.00 40.37 ? 198  GLU A CA  1 
ATOM   764  C  C   . GLU A 1 104 ? 16.815 4.939   39.335  1.00 42.34 ? 198  GLU A C   1 
ATOM   765  O  O   . GLU A 1 104 ? 15.888 4.847   38.525  1.00 41.41 ? 198  GLU A O   1 
ATOM   766  C  CB  . GLU A 1 104 ? 16.631 7.041   40.676  1.00 43.14 ? 198  GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 104 ? 15.229 7.435   40.250  1.00 46.88 ? 198  GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 104 ? 14.484 8.150   41.375  1.00 49.88 ? 198  GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 104 ? 14.456 7.599   42.501  1.00 51.99 ? 198  GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 104 ? 13.934 9.252   41.141  1.00 48.59 ? 198  GLU A OE2 1 
ATOM   771  N  N   . GLY A 1 105 ? 17.352 3.899   39.972  1.00 43.86 ? 199  GLY A N   1 
ATOM   772  C  CA  . GLY A 1 105 ? 16.860 2.548   39.781  1.00 44.97 ? 199  GLY A CA  1 
ATOM   773  C  C   . GLY A 1 105 ? 18.014 1.579   39.962  1.00 47.88 ? 199  GLY A C   1 
ATOM   774  O  O   . GLY A 1 105 ? 17.847 0.358   39.892  1.00 51.31 ? 199  GLY A O   1 
ATOM   775  N  N   . LEU A 1 107 ? 19.956 0.874   38.066  1.00 40.41 ? 201  LEU A N   1 
ATOM   776  C  CA  . LEU A 1 107 ? 20.162 -0.109  37.009  1.00 41.50 ? 201  LEU A CA  1 
ATOM   777  C  C   . LEU A 1 107 ? 21.627 -0.128  36.587  1.00 42.43 ? 201  LEU A C   1 
ATOM   778  O  O   . LEU A 1 107 ? 22.532 0.246   37.346  1.00 43.19 ? 201  LEU A O   1 
ATOM   779  C  CB  . LEU A 1 107 ? 19.329 0.250   35.773  1.00 41.19 ? 201  LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 107 ? 17.842 0.555   35.925  1.00 40.50 ? 201  LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 107 ? 17.639 1.732   36.841  1.00 40.38 ? 201  LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 107 ? 17.260 0.864   34.564  1.00 41.42 ? 201  LEU A CD2 1 
ATOM   783  N  N   . ARG A 1 108 ? 21.837 -0.582  35.358  1.00 40.61 ? 202  ARG A N   1 
ATOM   784  C  CA  . ARG A 1 108 ? 23.150 -0.624  34.739  1.00 41.28 ? 202  ARG A CA  1 
ATOM   785  C  C   . ARG A 1 108 ? 23.348 0.702   34.000  1.00 40.87 ? 202  ARG A C   1 
ATOM   786  O  O   . ARG A 1 108 ? 23.815 0.742   32.856  1.00 43.62 ? 202  ARG A O   1 
ATOM   787  C  CB  . ARG A 1 108 ? 23.272 -1.808  33.771  1.00 38.77 ? 202  ARG A CB  1 
ATOM   788  C  CG  . ARG A 1 108 ? 23.847 -3.059  34.419  1.00 34.49 ? 202  ARG A CG  1 
ATOM   789  C  CD  . ARG A 1 108 ? 22.908 -4.237  34.262  1.00 35.75 ? 202  ARG A CD  1 
ATOM   790  N  NE  . ARG A 1 108 ? 22.596 -4.479  32.858  1.00 32.68 ? 202  ARG A NE  1 
ATOM   791  C  CZ  . ARG A 1 108 ? 21.633 -5.292  32.441  1.00 33.73 ? 202  ARG A CZ  1 
ATOM   792  N  NH1 . ARG A 1 108 ? 21.423 -5.446  31.135  1.00 33.71 ? 202  ARG A NH1 1 
ATOM   793  N  NH2 . ARG A 1 108 ? 20.880 -5.948  33.327  1.00 31.01 ? 202  ARG A NH2 1 
ATOM   794  N  N   . VAL A 1 109 ? 22.982 1.784   34.682  1.00 37.05 ? 203  VAL A N   1 
ATOM   795  C  CA  . VAL A 1 109 ? 23.091 3.139   34.157  1.00 34.96 ? 203  VAL A CA  1 
ATOM   796  C  C   . VAL A 1 109 ? 24.527 3.487   33.818  1.00 36.09 ? 203  VAL A C   1 
ATOM   797  O  O   . VAL A 1 109 ? 25.406 3.378   34.661  1.00 36.22 ? 203  VAL A O   1 
ATOM   798  C  CB  . VAL A 1 109 ? 22.608 4.171   35.198  1.00 33.53 ? 203  VAL A CB  1 
ATOM   799  C  CG1 . VAL A 1 109 ? 22.507 5.549   34.576  1.00 30.55 ? 203  VAL A CG1 1 
ATOM   800  C  CG2 . VAL A 1 109 ? 21.287 3.736   35.776  1.00 33.74 ? 203  VAL A CG2 1 
ATOM   801  N  N   . GLU A 1 110 ? 24.763 3.925   32.588  1.00 36.17 ? 204  GLU A N   1 
ATOM   802  C  CA  . GLU A 1 110 ? 26.106 4.310   32.170  1.00 36.54 ? 204  GLU A CA  1 
ATOM   803  C  C   . GLU A 1 110 ? 26.166 5.819   31.896  1.00 36.59 ? 204  GLU A C   1 
ATOM   804  O  O   . GLU A 1 110 ? 25.305 6.376   31.217  1.00 38.12 ? 204  GLU A O   1 
ATOM   805  C  CB  . GLU A 1 110 ? 26.523 3.539   30.911  1.00 36.31 ? 204  GLU A CB  1 
ATOM   806  C  CG  . GLU A 1 110 ? 26.667 2.032   31.104  1.00 39.39 ? 204  GLU A CG  1 
ATOM   807  C  CD  . GLU A 1 110 ? 27.094 1.299   29.827  1.00 42.49 ? 204  GLU A CD  1 
ATOM   808  O  OE1 . GLU A 1 110 ? 27.057 0.044   29.822  1.00 43.57 ? 204  GLU A OE1 1 
ATOM   809  O  OE2 . GLU A 1 110 ? 27.468 1.969   28.832  1.00 40.59 ? 204  GLU A OE2 1 
ATOM   810  N  N   . TYR A 1 111 ? 27.180 6.482   32.436  1.00 36.75 ? 205  TYR A N   1 
ATOM   811  C  CA  . TYR A 1 111 ? 27.341 7.909   32.228  1.00 35.04 ? 205  TYR A CA  1 
ATOM   812  C  C   . TYR A 1 111 ? 28.443 8.157   31.209  1.00 37.68 ? 205  TYR A C   1 
ATOM   813  O  O   . TYR A 1 111 ? 29.507 7.530   31.267  1.00 39.16 ? 205  TYR A O   1 
ATOM   814  C  CB  . TYR A 1 111 ? 27.656 8.600   33.550  1.00 32.34 ? 205  TYR A CB  1 
ATOM   815  C  CG  . TYR A 1 111 ? 26.462 8.620   34.484  1.00 33.66 ? 205  TYR A CG  1 
ATOM   816  C  CD1 . TYR A 1 111 ? 26.151 7.517   35.285  1.00 31.11 ? 205  TYR A CD1 1 
ATOM   817  C  CD2 . TYR A 1 111 ? 25.603 9.720   34.520  1.00 32.94 ? 205  TYR A CD2 1 
ATOM   818  C  CE1 . TYR A 1 111 ? 25.010 7.504   36.096  1.00 29.62 ? 205  TYR A CE1 1 
ATOM   819  C  CE2 . TYR A 1 111 ? 24.455 9.716   35.332  1.00 33.65 ? 205  TYR A CE2 1 
ATOM   820  C  CZ  . TYR A 1 111 ? 24.164 8.606   36.113  1.00 31.75 ? 205  TYR A CZ  1 
ATOM   821  O  OH  . TYR A 1 111 ? 23.020 8.601   36.891  1.00 29.59 ? 205  TYR A OH  1 
ATOM   822  N  N   . LEU A 1 112 ? 28.181 9.057   30.263  1.00 36.38 ? 206  LEU A N   1 
ATOM   823  C  CA  . LEU A 1 112 ? 29.159 9.352   29.236  1.00 37.40 ? 206  LEU A CA  1 
ATOM   824  C  C   . LEU A 1 112 ? 29.545 10.819  29.098  1.00 38.59 ? 206  LEU A C   1 
ATOM   825  O  O   . LEU A 1 112 ? 28.716 11.725  29.223  1.00 35.99 ? 206  LEU A O   1 
ATOM   826  C  CB  . LEU A 1 112 ? 28.670 8.843   27.878  1.00 39.20 ? 206  LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 112 ? 29.554 9.223   26.677  1.00 40.21 ? 206  LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 112 ? 30.957 8.594   26.817  1.00 40.92 ? 206  LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 112 ? 28.883 8.756   25.395  1.00 39.68 ? 206  LEU A CD2 1 
ATOM   830  N  N   . ASP A 1 113 ? 30.832 11.030  28.849  1.00 40.05 ? 207  ASP A N   1 
ATOM   831  C  CA  . ASP A 1 113 ? 31.384 12.354  28.625  1.00 42.50 ? 207  ASP A CA  1 
ATOM   832  C  C   . ASP A 1 113 ? 32.056 12.248  27.268  1.00 44.42 ? 207  ASP A C   1 
ATOM   833  O  O   . ASP A 1 113 ? 33.240 11.911  27.160  1.00 45.17 ? 207  ASP A O   1 
ATOM   834  C  CB  . ASP A 1 113 ? 32.423 12.730  29.679  1.00 43.51 ? 207  ASP A CB  1 
ATOM   835  C  CG  . ASP A 1 113 ? 31.810 12.985  31.037  1.00 47.31 ? 207  ASP A CG  1 
ATOM   836  O  OD1 . ASP A 1 113 ? 32.107 14.057  31.629  1.00 47.09 ? 207  ASP A OD1 1 
ATOM   837  O  OD2 . ASP A 1 113 ? 31.042 12.110  31.509  1.00 47.24 ? 207  ASP A OD2 1 
ATOM   838  N  N   . ASP A 1 114 ? 31.282 12.499  26.226  1.00 45.26 ? 208  ASP A N   1 
ATOM   839  C  CA  . ASP A 1 114 ? 31.809 12.431  24.882  1.00 48.25 ? 208  ASP A CA  1 
ATOM   840  C  C   . ASP A 1 114 ? 33.132 13.185  24.847  1.00 51.01 ? 208  ASP A C   1 
ATOM   841  O  O   . ASP A 1 114 ? 33.185 14.372  25.174  1.00 51.06 ? 208  ASP A O   1 
ATOM   842  C  CB  . ASP A 1 114 ? 30.825 13.072  23.918  1.00 47.50 ? 208  ASP A CB  1 
ATOM   843  C  CG  . ASP A 1 114 ? 31.134 12.738  22.496  1.00 47.07 ? 208  ASP A CG  1 
ATOM   844  O  OD1 . ASP A 1 114 ? 32.289 12.988  22.080  1.00 45.59 ? 208  ASP A OD1 1 
ATOM   845  O  OD2 . ASP A 1 114 ? 30.227 12.222  21.804  1.00 46.90 ? 208  ASP A OD2 1 
ATOM   846  N  N   . ARG A 1 115 ? 34.201 12.501  24.452  1.00 54.47 ? 209  ARG A N   1 
ATOM   847  C  CA  . ARG A 1 115 ? 35.516 13.131  24.405  1.00 57.31 ? 209  ARG A CA  1 
ATOM   848  C  C   . ARG A 1 115 ? 35.728 14.114  23.257  1.00 56.03 ? 209  ARG A C   1 
ATOM   849  O  O   . ARG A 1 115 ? 36.833 14.621  23.085  1.00 55.72 ? 209  ARG A O   1 
ATOM   850  C  CB  . ARG A 1 115 ? 36.617 12.059  24.389  1.00 60.52 ? 209  ARG A CB  1 
ATOM   851  C  CG  . ARG A 1 115 ? 36.327 10.857  23.490  1.00 66.15 ? 209  ARG A CG  1 
ATOM   852  C  CD  . ARG A 1 115 ? 35.989 9.588   24.302  1.00 69.31 ? 209  ARG A CD  1 
ATOM   853  N  NE  . ARG A 1 115 ? 37.118 9.076   25.088  1.00 70.93 ? 209  ARG A NE  1 
ATOM   854  C  CZ  . ARG A 1 115 ? 38.278 8.660   24.576  1.00 71.98 ? 209  ARG A CZ  1 
ATOM   855  N  NH1 . ARG A 1 115 ? 39.234 8.212   25.383  1.00 70.56 ? 209  ARG A NH1 1 
ATOM   856  N  NH2 . ARG A 1 115 ? 38.489 8.694   23.262  1.00 71.93 ? 209  ARG A NH2 1 
ATOM   857  N  N   . ASN A 1 116 ? 34.696 14.378  22.456  1.00 56.19 ? 210  ASN A N   1 
ATOM   858  C  CA  . ASN A 1 116 ? 34.870 15.358  21.391  1.00 56.33 ? 210  ASN A CA  1 
ATOM   859  C  C   . ASN A 1 116 ? 33.796 16.449  21.390  1.00 53.88 ? 210  ASN A C   1 
ATOM   860  O  O   . ASN A 1 116 ? 34.084 17.589  21.039  1.00 55.77 ? 210  ASN A O   1 
ATOM   861  C  CB  . ASN A 1 116 ? 35.066 14.694  20.000  1.00 58.03 ? 210  ASN A CB  1 
ATOM   862  C  CG  . ASN A 1 116 ? 33.796 14.133  19.400  1.00 60.60 ? 210  ASN A CG  1 
ATOM   863  O  OD1 . ASN A 1 116 ? 33.846 13.452  18.372  1.00 61.79 ? 210  ASN A OD1 1 
ATOM   864  N  ND2 . ASN A 1 116 ? 32.655 14.418  20.015  1.00 62.73 ? 210  ASN A ND2 1 
ATOM   865  N  N   . THR A 1 117 ? 32.574 16.132  21.807  1.00 51.21 ? 211  THR A N   1 
ATOM   866  C  CA  . THR A 1 117 ? 31.538 17.165  21.878  1.00 48.50 ? 211  THR A CA  1 
ATOM   867  C  C   . THR A 1 117 ? 31.537 17.688  23.310  1.00 47.06 ? 211  THR A C   1 
ATOM   868  O  O   . THR A 1 117 ? 31.019 18.768  23.590  1.00 46.22 ? 211  THR A O   1 
ATOM   869  C  CB  . THR A 1 117 ? 30.130 16.625  21.578  1.00 47.60 ? 211  THR A CB  1 
ATOM   870  O  OG1 . THR A 1 117 ? 29.761 15.670  22.583  1.00 48.43 ? 211  THR A OG1 1 
ATOM   871  C  CG2 . THR A 1 117 ? 30.088 15.981  20.199  1.00 46.67 ? 211  THR A CG2 1 
ATOM   872  N  N   . PHE A 1 118 ? 32.130 16.909  24.212  1.00 46.38 ? 212  PHE A N   1 
ATOM   873  C  CA  . PHE A 1 118 ? 32.202 17.276  25.621  1.00 44.72 ? 212  PHE A CA  1 
ATOM   874  C  C   . PHE A 1 118 ? 30.818 17.172  26.271  1.00 43.68 ? 212  PHE A C   1 
ATOM   875  O  O   . PHE A 1 118 ? 30.659 17.466  27.457  1.00 44.76 ? 212  PHE A O   1 
ATOM   876  C  CB  . PHE A 1 118 ? 32.711 18.714  25.768  1.00 46.22 ? 212  PHE A CB  1 
ATOM   877  C  CG  . PHE A 1 118 ? 34.128 18.918  25.305  1.00 47.78 ? 212  PHE A CG  1 
ATOM   878  C  CD1 . PHE A 1 118 ? 35.198 18.431  26.055  1.00 49.37 ? 212  PHE A CD1 1 
ATOM   879  C  CD2 . PHE A 1 118 ? 34.393 19.622  24.126  1.00 49.73 ? 212  PHE A CD2 1 
ATOM   880  C  CE1 . PHE A 1 118 ? 36.517 18.638  25.646  1.00 49.87 ? 212  PHE A CE1 1 
ATOM   881  C  CE2 . PHE A 1 118 ? 35.704 19.840  23.698  1.00 49.53 ? 212  PHE A CE2 1 
ATOM   882  C  CZ  . PHE A 1 118 ? 36.772 19.346  24.463  1.00 52.22 ? 212  PHE A CZ  1 
ATOM   883  N  N   . ARG A 1 119 ? 29.825 16.758  25.487  1.00 41.96 ? 213  ARG A N   1 
ATOM   884  C  CA  . ARG A 1 119 ? 28.437 16.619  25.950  1.00 40.23 ? 213  ARG A CA  1 
ATOM   885  C  C   . ARG A 1 119 ? 28.237 15.503  26.969  1.00 39.04 ? 213  ARG A C   1 
ATOM   886  O  O   . ARG A 1 119 ? 28.824 14.428  26.845  1.00 39.76 ? 213  ARG A O   1 
ATOM   887  C  CB  . ARG A 1 119 ? 27.508 16.307  24.769  1.00 37.49 ? 213  ARG A CB  1 
ATOM   888  C  CG  . ARG A 1 119 ? 27.444 17.350  23.678  1.00 36.76 ? 213  ARG A CG  1 
ATOM   889  C  CD  . ARG A 1 119 ? 26.534 18.496  24.062  1.00 35.86 ? 213  ARG A CD  1 
ATOM   890  N  NE  . ARG A 1 119 ? 26.432 19.491  22.996  1.00 36.11 ? 213  ARG A NE  1 
ATOM   891  C  CZ  . ARG A 1 119 ? 25.669 20.580  23.066  1.00 36.83 ? 213  ARG A CZ  1 
ATOM   892  N  NH1 . ARG A 1 119 ? 24.934 20.806  24.151  1.00 38.07 ? 213  ARG A NH1 1 
ATOM   893  N  NH2 . ARG A 1 119 ? 25.665 21.459  22.069  1.00 32.44 ? 213  ARG A NH2 1 
ATOM   894  N  N   . HIS A 1 120 ? 27.383 15.750  27.956  1.00 38.52 ? 214  HIS A N   1 
ATOM   895  C  CA  . HIS A 1 120 ? 27.066 14.736  28.959  1.00 37.28 ? 214  HIS A CA  1 
ATOM   896  C  C   . HIS A 1 120 ? 25.798 14.007  28.497  1.00 35.64 ? 214  HIS A C   1 
ATOM   897  O  O   . HIS A 1 120 ? 24.928 14.598  27.842  1.00 33.08 ? 214  HIS A O   1 
ATOM   898  C  CB  . HIS A 1 120 ? 26.792 15.369  30.332  1.00 35.87 ? 214  HIS A CB  1 
ATOM   899  C  CG  . HIS A 1 120 ? 27.931 16.177  30.877  1.00 38.74 ? 214  HIS A CG  1 
ATOM   900  N  ND1 . HIS A 1 120 ? 27.781 17.048  31.938  1.00 39.91 ? 214  HIS A ND1 1 
ATOM   901  C  CD2 . HIS A 1 120 ? 29.234 16.247  30.514  1.00 38.53 ? 214  HIS A CD2 1 
ATOM   902  C  CE1 . HIS A 1 120 ? 28.943 17.619  32.204  1.00 38.78 ? 214  HIS A CE1 1 
ATOM   903  N  NE2 . HIS A 1 120 ? 29.841 17.150  31.355  1.00 39.49 ? 214  HIS A NE2 1 
ATOM   904  N  N   . SER A 1 121 ? 25.714 12.720  28.826  1.00 33.57 ? 215  SER A N   1 
ATOM   905  C  CA  . SER A 1 121 ? 24.549 11.914  28.497  1.00 29.42 ? 215  SER A CA  1 
ATOM   906  C  C   . SER A 1 121 ? 24.509 10.698  29.412  1.00 29.87 ? 215  SER A C   1 
ATOM   907  O  O   . SER A 1 121 ? 25.548 10.235  29.903  1.00 29.68 ? 215  SER A O   1 
ATOM   908  C  CB  . SER A 1 121 ? 24.569 11.478  27.037  1.00 25.75 ? 215  SER A CB  1 
ATOM   909  O  OG  . SER A 1 121 ? 25.606 10.560  26.795  1.00 26.26 ? 215  SER A OG  1 
ATOM   910  N  N   . VAL A 1 122 ? 23.302 10.204  29.670  1.00 29.15 ? 216  VAL A N   1 
ATOM   911  C  CA  . VAL A 1 122 ? 23.122 9.034   30.520  1.00 27.44 ? 216  VAL A CA  1 
ATOM   912  C  C   . VAL A 1 122 ? 22.284 8.016   29.754  1.00 29.08 ? 216  VAL A C   1 
ATOM   913  O  O   . VAL A 1 122 ? 21.209 8.334   29.224  1.00 27.72 ? 216  VAL A O   1 
ATOM   914  C  CB  . VAL A 1 122 ? 22.462 9.418   31.854  1.00 23.84 ? 216  VAL A CB  1 
ATOM   915  C  CG1 . VAL A 1 122 ? 21.391 10.448  31.617  1.00 26.51 ? 216  VAL A CG1 1 
ATOM   916  C  CG2 . VAL A 1 122 ? 21.895 8.187   32.526  1.00 24.46 ? 216  VAL A CG2 1 
ATOM   917  N  N   . VAL A 1 123 ? 22.797 6.789   29.690  1.00 29.32 ? 217  VAL A N   1 
ATOM   918  C  CA  . VAL A 1 123 ? 22.144 5.723   28.947  1.00 30.13 ? 217  VAL A CA  1 
ATOM   919  C  C   . VAL A 1 123 ? 21.931 4.455   29.777  1.00 31.67 ? 217  VAL A C   1 
ATOM   920  O  O   . VAL A 1 123 ? 22.710 4.147   30.685  1.00 31.71 ? 217  VAL A O   1 
ATOM   921  C  CB  . VAL A 1 123 ? 22.962 5.413   27.658  1.00 28.65 ? 217  VAL A CB  1 
ATOM   922  C  CG1 . VAL A 1 123 ? 24.426 5.158   28.011  1.00 28.57 ? 217  VAL A CG1 1 
ATOM   923  C  CG2 . VAL A 1 123 ? 22.374 4.231   26.927  1.00 27.73 ? 217  VAL A CG2 1 
ATOM   924  N  N   . VAL A 1 124 ? 20.846 3.746   29.474  1.00 31.40 ? 218  VAL A N   1 
ATOM   925  C  CA  . VAL A 1 124 ? 20.504 2.517   30.169  1.00 31.57 ? 218  VAL A CA  1 
ATOM   926  C  C   . VAL A 1 124 ? 19.930 1.509   29.183  1.00 34.20 ? 218  VAL A C   1 
ATOM   927  O  O   . VAL A 1 124 ? 19.420 1.878   28.125  1.00 35.33 ? 218  VAL A O   1 
ATOM   928  C  CB  . VAL A 1 124 ? 19.468 2.775   31.272  1.00 30.33 ? 218  VAL A CB  1 
ATOM   929  C  CG1 . VAL A 1 124 ? 20.108 3.556   32.402  1.00 27.34 ? 218  VAL A CG1 1 
ATOM   930  C  CG2 . VAL A 1 124 ? 18.264 3.520   30.690  1.00 25.84 ? 218  VAL A CG2 1 
ATOM   931  N  N   . PRO A 1 125 ? 20.023 0.214   29.509  1.00 35.67 ? 219  PRO A N   1 
ATOM   932  C  CA  . PRO A 1 125 ? 19.492 -0.821  28.617  1.00 36.61 ? 219  PRO A CA  1 
ATOM   933  C  C   . PRO A 1 125 ? 17.983 -0.650  28.409  1.00 35.72 ? 219  PRO A C   1 
ATOM   934  O  O   . PRO A 1 125 ? 17.249 -0.419  29.369  1.00 36.30 ? 219  PRO A O   1 
ATOM   935  C  CB  . PRO A 1 125 ? 19.809 -2.117  29.368  1.00 35.59 ? 219  PRO A CB  1 
ATOM   936  C  CG  . PRO A 1 125 ? 21.030 -1.765  30.168  1.00 34.99 ? 219  PRO A CG  1 
ATOM   937  C  CD  . PRO A 1 125 ? 20.718 -0.384  30.666  1.00 33.87 ? 219  PRO A CD  1 
ATOM   938  N  N   . TYR A 1 126 ? 17.517 -0.743  27.167  1.00 34.87 ? 220  TYR A N   1 
ATOM   939  C  CA  . TYR A 1 126 ? 16.082 -0.634  26.936  1.00 32.96 ? 220  TYR A CA  1 
ATOM   940  C  C   . TYR A 1 126 ? 15.449 -1.962  27.311  1.00 34.00 ? 220  TYR A C   1 
ATOM   941  O  O   . TYR A 1 126 ? 15.937 -3.021  26.916  1.00 31.77 ? 220  TYR A O   1 
ATOM   942  C  CB  . TYR A 1 126 ? 15.739 -0.334  25.470  1.00 29.62 ? 220  TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 126 ? 14.260 -0.558  25.167  1.00 28.12 ? 220  TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 126 ? 13.783 -1.823  24.799  1.00 25.42 ? 220  TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 126 ? 13.322 0.470   25.343  1.00 28.24 ? 220  TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 126 ? 12.409 -2.065  24.621  1.00 24.69 ? 220  TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 126 ? 11.946 0.238   25.171  1.00 27.41 ? 220  TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 126 ? 11.500 -1.036  24.816  1.00 27.86 ? 220  TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 126 ? 10.145 -1.291  24.705  1.00 29.32 ? 220  TYR A OH  1 
ATOM   950  N  N   . GLU A 1 127 ? 14.364 -1.898  28.074  1.00 36.18 ? 221  GLU A N   1 
ATOM   951  C  CA  . GLU A 1 127 ? 13.642 -3.095  28.479  1.00 38.08 ? 221  GLU A CA  1 
ATOM   952  C  C   . GLU A 1 127 ? 12.182 -2.899  28.075  1.00 36.51 ? 221  GLU A C   1 
ATOM   953  O  O   . GLU A 1 127 ? 11.651 -1.799  28.180  1.00 38.09 ? 221  GLU A O   1 
ATOM   954  C  CB  . GLU A 1 127 ? 13.763 -3.310  29.991  1.00 42.12 ? 221  GLU A CB  1 
ATOM   955  C  CG  . GLU A 1 127 ? 14.546 -4.579  30.396  1.00 50.76 ? 221  GLU A CG  1 
ATOM   956  C  CD  . GLU A 1 127 ? 16.059 -4.366  30.565  1.00 55.99 ? 221  GLU A CD  1 
ATOM   957  O  OE1 . GLU A 1 127 ? 16.454 -3.560  31.442  1.00 59.57 ? 221  GLU A OE1 1 
ATOM   958  O  OE2 . GLU A 1 127 ? 16.856 -5.010  29.834  1.00 56.15 ? 221  GLU A OE2 1 
ATOM   959  N  N   . PRO A 1 128 ? 11.522 -3.959  27.580  1.00 37.97 ? 222  PRO A N   1 
ATOM   960  C  CA  . PRO A 1 128 ? 10.114 -3.871  27.162  1.00 36.87 ? 222  PRO A CA  1 
ATOM   961  C  C   . PRO A 1 128 ? 9.221  -3.596  28.355  1.00 36.90 ? 222  PRO A C   1 
ATOM   962  O  O   . PRO A 1 128 ? 9.622  -3.831  29.496  1.00 38.70 ? 222  PRO A O   1 
ATOM   963  C  CB  . PRO A 1 128 ? 9.849  -5.244  26.555  1.00 36.67 ? 222  PRO A CB  1 
ATOM   964  C  CG  . PRO A 1 128 ? 10.717 -6.131  27.378  1.00 36.44 ? 222  PRO A CG  1 
ATOM   965  C  CD  . PRO A 1 128 ? 12.016 -5.341  27.443  1.00 37.47 ? 222  PRO A CD  1 
ATOM   966  N  N   . PRO A 1 129 ? 7.995  -3.105  28.114  1.00 35.86 ? 223  PRO A N   1 
ATOM   967  C  CA  . PRO A 1 129 ? 7.069  -2.805  29.211  1.00 35.54 ? 223  PRO A CA  1 
ATOM   968  C  C   . PRO A 1 129 ? 6.695  -4.005  30.075  1.00 35.47 ? 223  PRO A C   1 
ATOM   969  O  O   . PRO A 1 129 ? 7.015  -5.146  29.745  1.00 35.13 ? 223  PRO A O   1 
ATOM   970  C  CB  . PRO A 1 129 ? 5.874  -2.183  28.491  1.00 35.77 ? 223  PRO A CB  1 
ATOM   971  C  CG  . PRO A 1 129 ? 5.919  -2.817  27.140  1.00 35.65 ? 223  PRO A CG  1 
ATOM   972  C  CD  . PRO A 1 129 ? 7.383  -2.799  26.812  1.00 36.13 ? 223  PRO A CD  1 
ATOM   973  N  N   . GLU A 1 134 ? 0.801  -0.515  27.031  1.00 42.59 ? 228  GLU A N   1 
ATOM   974  C  CA  . GLU A 1 134 ? 1.879  -0.871  27.948  1.00 41.29 ? 228  GLU A CA  1 
ATOM   975  C  C   . GLU A 1 134 ? 3.160  -0.134  27.532  1.00 40.60 ? 228  GLU A C   1 
ATOM   976  O  O   . GLU A 1 134 ? 3.576  -0.198  26.368  1.00 42.62 ? 228  GLU A O   1 
ATOM   977  C  CB  . GLU A 1 134 ? 2.084  -2.390  27.921  1.00 41.56 ? 228  GLU A CB  1 
ATOM   978  C  CG  . GLU A 1 134 ? 2.683  -2.960  29.178  1.00 41.30 ? 228  GLU A CG  1 
ATOM   979  C  CD  . GLU A 1 134 ? 1.951  -2.490  30.411  1.00 46.82 ? 228  GLU A CD  1 
ATOM   980  O  OE1 . GLU A 1 134 ? 1.908  -1.254  30.639  1.00 48.69 ? 228  GLU A OE1 1 
ATOM   981  O  OE2 . GLU A 1 134 ? 1.413  -3.351  31.153  1.00 48.93 ? 228  GLU A OE2 1 
ATOM   982  N  N   . CYS A 1 135 ? 3.769  0.577   28.480  1.00 37.31 ? 229  CYS A N   1 
ATOM   983  C  CA  . CYS A 1 135 ? 4.984  1.355   28.228  1.00 36.67 ? 229  CYS A CA  1 
ATOM   984  C  C   . CYS A 1 135 ? 6.060  1.052   29.259  1.00 36.46 ? 229  CYS A C   1 
ATOM   985  O  O   . CYS A 1 135 ? 5.778  0.469   30.311  1.00 38.94 ? 229  CYS A O   1 
ATOM   986  C  CB  . CYS A 1 135 ? 4.663  2.847   28.290  1.00 37.42 ? 229  CYS A CB  1 
ATOM   987  S  SG  . CYS A 1 135 ? 4.038  3.407   29.920  1.00 35.53 ? 229  CYS A SG  1 
ATOM   988  N  N   . THR A 1 136 ? 7.296  1.440   28.962  1.00 32.71 ? 230  THR A N   1 
ATOM   989  C  CA  . THR A 1 136 ? 8.383  1.212   29.904  1.00 30.93 ? 230  THR A CA  1 
ATOM   990  C  C   . THR A 1 136 ? 8.748  2.579   30.488  1.00 31.08 ? 230  THR A C   1 
ATOM   991  O  O   . THR A 1 136 ? 8.881  3.572   29.764  1.00 32.92 ? 230  THR A O   1 
ATOM   992  C  CB  . THR A 1 136 ? 9.587  0.463   29.227  1.00 30.50 ? 230  THR A CB  1 
ATOM   993  O  OG1 . THR A 1 136 ? 10.832 1.011   29.679  1.00 33.08 ? 230  THR A OG1 1 
ATOM   994  C  CG2 . THR A 1 136 ? 9.500  0.542   27.704  1.00 32.52 ? 230  THR A CG2 1 
ATOM   995  N  N   . THR A 1 137 ? 8.853  2.640   31.811  1.00 30.48 ? 231  THR A N   1 
ATOM   996  C  CA  . THR A 1 137 ? 9.140  3.905   32.470  1.00 31.62 ? 231  THR A CA  1 
ATOM   997  C  C   . THR A 1 137 ? 10.568 4.047   32.979  1.00 31.70 ? 231  THR A C   1 
ATOM   998  O  O   . THR A 1 137 ? 11.138 3.106   33.534  1.00 31.61 ? 231  THR A O   1 
ATOM   999  C  CB  . THR A 1 137 ? 8.168  4.136   33.645  1.00 29.77 ? 231  THR A CB  1 
ATOM   1000 O  OG1 . THR A 1 137 ? 6.820  4.085   33.166  1.00 30.57 ? 231  THR A OG1 1 
ATOM   1001 C  CG2 . THR A 1 137 ? 8.408  5.500   34.276  1.00 28.29 ? 231  THR A CG2 1 
ATOM   1002 N  N   . ILE A 1 138 ? 11.139 5.233   32.768  1.00 31.48 ? 232  ILE A N   1 
ATOM   1003 C  CA  . ILE A 1 138 ? 12.489 5.536   33.220  1.00 32.16 ? 232  ILE A CA  1 
ATOM   1004 C  C   . ILE A 1 138 ? 12.391 6.708   34.173  1.00 34.65 ? 232  ILE A C   1 
ATOM   1005 O  O   . ILE A 1 138 ? 11.731 7.699   33.877  1.00 37.13 ? 232  ILE A O   1 
ATOM   1006 C  CB  . ILE A 1 138 ? 13.397 5.970   32.083  1.00 30.27 ? 232  ILE A CB  1 
ATOM   1007 C  CG1 . ILE A 1 138 ? 13.492 4.862   31.039  1.00 34.59 ? 232  ILE A CG1 1 
ATOM   1008 C  CG2 . ILE A 1 138 ? 14.771 6.291   32.629  1.00 25.09 ? 232  ILE A CG2 1 
ATOM   1009 C  CD1 . ILE A 1 138 ? 14.390 5.215   29.864  1.00 36.25 ? 232  ILE A CD1 1 
ATOM   1010 N  N   . HIS A 1 139 ? 13.047 6.599   35.317  1.00 35.55 ? 233  HIS A N   1 
ATOM   1011 C  CA  . HIS A 1 139 ? 13.017 7.667   36.301  1.00 34.98 ? 233  HIS A CA  1 
ATOM   1012 C  C   . HIS A 1 139 ? 14.252 8.546   36.201  1.00 32.80 ? 233  HIS A C   1 
ATOM   1013 O  O   . HIS A 1 139 ? 15.367 8.093   36.468  1.00 33.28 ? 233  HIS A O   1 
ATOM   1014 C  CB  . HIS A 1 139 ? 12.924 7.075   37.703  1.00 38.04 ? 233  HIS A CB  1 
ATOM   1015 C  CG  . HIS A 1 139 ? 11.544 6.643   38.089  1.00 41.51 ? 233  HIS A CG  1 
ATOM   1016 N  ND1 . HIS A 1 139 ? 11.273 5.996   39.277  1.00 44.40 ? 233  HIS A ND1 1 
ATOM   1017 C  CD2 . HIS A 1 139 ? 10.349 6.827   37.480  1.00 42.30 ? 233  HIS A CD2 1 
ATOM   1018 C  CE1 . HIS A 1 139 ? 9.970  5.807   39.386  1.00 45.05 ? 233  HIS A CE1 1 
ATOM   1019 N  NE2 . HIS A 1 139 ? 9.386  6.302   38.309  1.00 44.92 ? 233  HIS A NE2 1 
ATOM   1020 N  N   . TYR A 1 140 ? 14.053 9.802   35.811  1.00 31.69 ? 234  TYR A N   1 
ATOM   1021 C  CA  . TYR A 1 140 ? 15.169 10.744  35.693  1.00 29.57 ? 234  TYR A CA  1 
ATOM   1022 C  C   . TYR A 1 140 ? 15.228 11.720  36.867  1.00 29.05 ? 234  TYR A C   1 
ATOM   1023 O  O   . TYR A 1 140 ? 14.248 11.905  37.601  1.00 28.44 ? 234  TYR A O   1 
ATOM   1024 C  CB  . TYR A 1 140 ? 15.073 11.544  34.388  1.00 25.50 ? 234  TYR A CB  1 
ATOM   1025 C  CG  . TYR A 1 140 ? 15.335 10.737  33.137  1.00 23.69 ? 234  TYR A CG  1 
ATOM   1026 C  CD1 . TYR A 1 140 ? 14.310 10.472  32.226  1.00 22.12 ? 234  TYR A CD1 1 
ATOM   1027 C  CD2 . TYR A 1 140 ? 16.607 10.234  32.865  1.00 21.29 ? 234  TYR A CD2 1 
ATOM   1028 C  CE1 . TYR A 1 140 ? 14.543 9.729   31.077  1.00 22.22 ? 234  TYR A CE1 1 
ATOM   1029 C  CE2 . TYR A 1 140 ? 16.852 9.484   31.719  1.00 25.18 ? 234  TYR A CE2 1 
ATOM   1030 C  CZ  . TYR A 1 140 ? 15.815 9.234   30.832  1.00 24.91 ? 234  TYR A CZ  1 
ATOM   1031 O  OH  . TYR A 1 140 ? 16.041 8.451   29.727  1.00 27.29 ? 234  TYR A OH  1 
ATOM   1032 N  N   . ASN A 1 141 ? 16.390 12.340  37.037  1.00 28.94 ? 235  ASN A N   1 
ATOM   1033 C  CA  . ASN A 1 141 ? 16.601 13.323  38.099  1.00 26.90 ? 235  ASN A CA  1 
ATOM   1034 C  C   . ASN A 1 141 ? 17.413 14.458  37.516  1.00 24.98 ? 235  ASN A C   1 
ATOM   1035 O  O   . ASN A 1 141 ? 18.421 14.225  36.847  1.00 25.17 ? 235  ASN A O   1 
ATOM   1036 C  CB  . ASN A 1 141 ? 17.385 12.719  39.270  1.00 24.63 ? 235  ASN A CB  1 
ATOM   1037 C  CG  . ASN A 1 141 ? 16.565 11.753  40.082  1.00 24.97 ? 235  ASN A CG  1 
ATOM   1038 O  OD1 . ASN A 1 141 ? 17.115 10.904  40.768  1.00 26.89 ? 235  ASN A OD1 1 
ATOM   1039 N  ND2 . ASN A 1 141 ? 15.233 11.891  40.028  1.00 25.18 ? 235  ASN A ND2 1 
ATOM   1040 N  N   . TYR A 1 142 ? 16.975 15.686  37.753  1.00 22.85 ? 236  TYR A N   1 
ATOM   1041 C  CA  . TYR A 1 142 ? 17.715 16.834  37.272  1.00 23.11 ? 236  TYR A CA  1 
ATOM   1042 C  C   . TYR A 1 142 ? 18.392 17.389  38.527  1.00 24.41 ? 236  TYR A C   1 
ATOM   1043 O  O   . TYR A 1 142 ? 17.706 17.782  39.473  1.00 24.74 ? 236  TYR A O   1 
ATOM   1044 C  CB  . TYR A 1 142 ? 16.751 17.829  36.634  1.00 20.66 ? 236  TYR A CB  1 
ATOM   1045 C  CG  . TYR A 1 142 ? 16.172 17.310  35.347  1.00 19.61 ? 236  TYR A CG  1 
ATOM   1046 C  CD1 . TYR A 1 142 ? 16.737 17.655  34.119  1.00 19.92 ? 236  TYR A CD1 1 
ATOM   1047 C  CD2 . TYR A 1 142 ? 15.079 16.423  35.355  1.00 20.17 ? 236  TYR A CD2 1 
ATOM   1048 C  CE1 . TYR A 1 142 ? 16.232 17.126  32.915  1.00 21.12 ? 236  TYR A CE1 1 
ATOM   1049 C  CE2 . TYR A 1 142 ? 14.561 15.891  34.163  1.00 17.89 ? 236  TYR A CE2 1 
ATOM   1050 C  CZ  . TYR A 1 142 ? 15.146 16.251  32.949  1.00 22.33 ? 236  TYR A CZ  1 
ATOM   1051 O  OH  . TYR A 1 142 ? 14.637 15.754  31.771  1.00 23.83 ? 236  TYR A OH  1 
ATOM   1052 N  N   . MET A 1 143 ? 19.729 17.403  38.533  1.00 23.90 ? 237  MET A N   1 
ATOM   1053 C  CA  . MET A 1 143 ? 20.491 17.836  39.700  1.00 26.16 ? 237  MET A CA  1 
ATOM   1054 C  C   . MET A 1 143 ? 20.874 19.312  39.853  1.00 26.62 ? 237  MET A C   1 
ATOM   1055 O  O   . MET A 1 143 ? 21.807 19.633  40.596  1.00 27.50 ? 237  MET A O   1 
ATOM   1056 C  CB  . MET A 1 143 ? 21.758 16.974  39.821  1.00 26.63 ? 237  MET A CB  1 
ATOM   1057 C  CG  . MET A 1 143 ? 21.493 15.475  39.861  1.00 28.34 ? 237  MET A CG  1 
ATOM   1058 S  SD  . MET A 1 143 ? 20.291 14.983  41.131  1.00 29.58 ? 237  MET A SD  1 
ATOM   1059 C  CE  . MET A 1 143 ? 21.244 15.123  42.661  1.00 27.13 ? 237  MET A CE  1 
ATOM   1060 N  N   . CYS A 1 144 ? 20.164 20.204  39.169  1.00 28.07 ? 238  CYS A N   1 
ATOM   1061 C  CA  . CYS A 1 144 ? 20.431 21.652  39.249  1.00 27.84 ? 238  CYS A CA  1 
ATOM   1062 C  C   . CYS A 1 144 ? 19.144 22.369  38.863  1.00 27.07 ? 238  CYS A C   1 
ATOM   1063 O  O   . CYS A 1 144 ? 18.390 21.870  38.020  1.00 28.73 ? 238  CYS A O   1 
ATOM   1064 C  CB  . CYS A 1 144 ? 21.540 22.071  38.263  1.00 27.86 ? 238  CYS A CB  1 
ATOM   1065 S  SG  . CYS A 1 144 ? 23.243 22.285  38.922  1.00 25.82 ? 238  CYS A SG  1 
ATOM   1066 N  N   . ASN A 1 145 ? 18.881 23.516  39.484  1.00 25.53 ? 239  ASN A N   1 
ATOM   1067 C  CA  . ASN A 1 145 ? 17.691 24.300  39.149  1.00 24.42 ? 239  ASN A CA  1 
ATOM   1068 C  C   . ASN A 1 145 ? 17.989 25.072  37.870  1.00 25.47 ? 239  ASN A C   1 
ATOM   1069 O  O   . ASN A 1 145 ? 19.145 25.426  37.615  1.00 25.40 ? 239  ASN A O   1 
ATOM   1070 C  CB  . ASN A 1 145 ? 17.373 25.311  40.244  1.00 20.52 ? 239  ASN A CB  1 
ATOM   1071 C  CG  . ASN A 1 145 ? 16.679 24.687  41.423  1.00 24.09 ? 239  ASN A CG  1 
ATOM   1072 O  OD1 . ASN A 1 145 ? 15.665 24.007  41.264  1.00 24.09 ? 239  ASN A OD1 1 
ATOM   1073 N  ND2 . ASN A 1 145 ? 17.215 24.913  42.626  1.00 24.74 ? 239  ASN A ND2 1 
ATOM   1074 N  N   . SER A 1 146 ? 16.957 25.352  37.075  1.00 25.51 ? 240  SER A N   1 
ATOM   1075 C  CA  . SER A 1 146 ? 17.154 26.111  35.836  1.00 25.44 ? 240  SER A CA  1 
ATOM   1076 C  C   . SER A 1 146 ? 17.829 27.468  36.080  1.00 25.38 ? 240  SER A C   1 
ATOM   1077 O  O   . SER A 1 146 ? 18.473 28.015  35.180  1.00 22.97 ? 240  SER A O   1 
ATOM   1078 C  CB  . SER A 1 146 ? 15.813 26.346  35.123  1.00 23.08 ? 240  SER A CB  1 
ATOM   1079 O  OG  . SER A 1 146 ? 15.301 25.146  34.559  1.00 24.27 ? 240  SER A OG  1 
ATOM   1080 N  N   . SER A 1 147 ? 17.697 28.002  37.294  1.00 25.17 ? 241  SER A N   1 
ATOM   1081 C  CA  . SER A 1 147 ? 18.268 29.311  37.614  1.00 26.20 ? 241  SER A CA  1 
ATOM   1082 C  C   . SER A 1 147 ? 19.661 29.290  38.231  1.00 28.24 ? 241  SER A C   1 
ATOM   1083 O  O   . SER A 1 147 ? 20.193 30.353  38.581  1.00 25.97 ? 241  SER A O   1 
ATOM   1084 C  CB  . SER A 1 147 ? 17.352 30.056  38.572  1.00 22.54 ? 241  SER A CB  1 
ATOM   1085 O  OG  . SER A 1 147 ? 17.412 29.438  39.843  1.00 26.03 ? 241  SER A OG  1 
ATOM   1086 N  N   . CYS A 1 148 ? 20.241 28.099  38.383  1.00 30.70 ? 242  CYS A N   1 
ATOM   1087 C  CA  . CYS A 1 148 ? 21.573 27.968  38.979  1.00 30.03 ? 242  CYS A CA  1 
ATOM   1088 C  C   . CYS A 1 148 ? 22.599 28.874  38.311  1.00 29.47 ? 242  CYS A C   1 
ATOM   1089 O  O   . CYS A 1 148 ? 22.899 28.724  37.119  1.00 26.15 ? 242  CYS A O   1 
ATOM   1090 C  CB  . CYS A 1 148 ? 22.069 26.511  38.905  1.00 32.95 ? 242  CYS A CB  1 
ATOM   1091 S  SG  . CYS A 1 148 ? 21.470 25.392  40.213  1.00 32.57 ? 242  CYS A SG  1 
ATOM   1092 N  N   . MET A 1 149 ? 23.130 29.816  39.091  1.00 31.53 ? 243  MET A N   1 
ATOM   1093 C  CA  . MET A 1 149 ? 24.140 30.747  38.595  1.00 30.69 ? 243  MET A CA  1 
ATOM   1094 C  C   . MET A 1 149 ? 25.388 29.926  38.357  1.00 32.20 ? 243  MET A C   1 
ATOM   1095 O  O   . MET A 1 149 ? 25.857 29.217  39.247  1.00 31.07 ? 243  MET A O   1 
ATOM   1096 C  CB  . MET A 1 149 ? 24.439 31.839  39.624  1.00 32.40 ? 243  MET A CB  1 
ATOM   1097 C  CG  . MET A 1 149 ? 25.647 32.714  39.287  1.00 31.27 ? 243  MET A CG  1 
ATOM   1098 S  SD  . MET A 1 149 ? 25.617 33.363  37.596  1.00 30.78 ? 243  MET A SD  1 
ATOM   1099 C  CE  . MET A 1 149 ? 24.297 34.568  37.742  1.00 29.80 ? 243  MET A CE  1 
ATOM   1100 N  N   . GLY A 1 150 ? 25.920 30.005  37.146  1.00 33.02 ? 244  GLY A N   1 
ATOM   1101 C  CA  . GLY A 1 150 ? 27.109 29.244  36.841  1.00 29.99 ? 244  GLY A CA  1 
ATOM   1102 C  C   . GLY A 1 150 ? 26.772 28.014  36.033  1.00 29.75 ? 244  GLY A C   1 
ATOM   1103 O  O   . GLY A 1 150 ? 27.633 27.446  35.369  1.00 30.90 ? 244  GLY A O   1 
ATOM   1104 N  N   . GLY A 1 151 ? 25.514 27.595  36.091  1.00 29.97 ? 245  GLY A N   1 
ATOM   1105 C  CA  . GLY A 1 151 ? 25.091 26.429  35.338  1.00 26.23 ? 245  GLY A CA  1 
ATOM   1106 C  C   . GLY A 1 151 ? 24.134 26.870  34.255  1.00 29.56 ? 245  GLY A C   1 
ATOM   1107 O  O   . GLY A 1 151 ? 24.464 27.760  33.465  1.00 30.39 ? 245  GLY A O   1 
ATOM   1108 N  N   . MET A 1 152 ? 22.945 26.270  34.217  1.00 30.89 ? 246  MET A N   1 
ATOM   1109 C  CA  . MET A 1 152 ? 21.941 26.630  33.215  1.00 30.18 ? 246  MET A CA  1 
ATOM   1110 C  C   . MET A 1 152 ? 21.713 28.142  33.224  1.00 30.10 ? 246  MET A C   1 
ATOM   1111 O  O   . MET A 1 152 ? 21.502 28.762  32.171  1.00 31.41 ? 246  MET A O   1 
ATOM   1112 C  CB  . MET A 1 152 ? 20.652 25.850  33.477  1.00 29.63 ? 246  MET A CB  1 
ATOM   1113 C  CG  . MET A 1 152 ? 20.909 24.340  33.443  1.00 32.01 ? 246  MET A CG  1 
ATOM   1114 S  SD  . MET A 1 152 ? 19.484 23.286  33.096  1.00 33.40 ? 246  MET A SD  1 
ATOM   1115 C  CE  . MET A 1 152 ? 18.752 23.128  34.726  1.00 31.14 ? 246  MET A CE  1 
ATOM   1116 N  N   . ASN A 1 153 ? 21.755 28.728  34.418  1.00 29.23 ? 247  ASN A N   1 
ATOM   1117 C  CA  . ASN A 1 153 ? 21.647 30.170  34.557  1.00 28.42 ? 247  ASN A CA  1 
ATOM   1118 C  C   . ASN A 1 153 ? 20.412 30.773  33.899  1.00 28.19 ? 247  ASN A C   1 
ATOM   1119 O  O   . ASN A 1 153 ? 20.523 31.720  33.131  1.00 27.85 ? 247  ASN A O   1 
ATOM   1120 C  CB  . ASN A 1 153 ? 22.926 30.779  33.958  1.00 29.23 ? 247  ASN A CB  1 
ATOM   1121 C  CG  . ASN A 1 153 ? 23.187 32.204  34.411  1.00 27.57 ? 247  ASN A CG  1 
ATOM   1122 O  OD1 . ASN A 1 153 ? 22.901 32.578  35.557  1.00 24.92 ? 247  ASN A OD1 1 
ATOM   1123 N  ND2 . ASN A 1 153 ? 23.770 33.002  33.514  1.00 26.89 ? 247  ASN A ND2 1 
ATOM   1124 N  N   . ARG A 1 154 ? 19.241 30.222  34.203  1.00 30.88 ? 248  ARG A N   1 
ATOM   1125 C  CA  . ARG A 1 154 ? 17.973 30.712  33.653  1.00 30.56 ? 248  ARG A CA  1 
ATOM   1126 C  C   . ARG A 1 154 ? 17.708 30.296  32.204  1.00 28.67 ? 248  ARG A C   1 
ATOM   1127 O  O   . ARG A 1 154 ? 16.642 30.599  31.661  1.00 28.95 ? 248  ARG A O   1 
ATOM   1128 C  CB  . ARG A 1 154 ? 17.900 32.244  33.744  1.00 29.47 ? 248  ARG A CB  1 
ATOM   1129 C  CG  . ARG A 1 154 ? 18.245 32.802  35.108  1.00 33.12 ? 248  ARG A CG  1 
ATOM   1130 C  CD  . ARG A 1 154 ? 17.957 34.298  35.175  1.00 37.09 ? 248  ARG A CD  1 
ATOM   1131 N  NE  . ARG A 1 154 ? 18.656 35.055  34.138  1.00 41.72 ? 248  ARG A NE  1 
ATOM   1132 C  CZ  . ARG A 1 154 ? 19.969 35.289  34.121  1.00 47.19 ? 248  ARG A CZ  1 
ATOM   1133 N  NH1 . ARG A 1 154 ? 20.509 35.993  33.121  1.00 47.74 ? 248  ARG A NH1 1 
ATOM   1134 N  NH2 . ARG A 1 154 ? 20.747 34.832  35.102  1.00 45.36 ? 248  ARG A NH2 1 
ATOM   1135 N  N   . ARG A 1 155 ? 18.663 29.614  31.575  1.00 27.81 ? 249  ARG A N   1 
ATOM   1136 C  CA  . ARG A 1 155 ? 18.497 29.179  30.185  1.00 26.55 ? 249  ARG A CA  1 
ATOM   1137 C  C   . ARG A 1 155 ? 17.672 27.897  30.094  1.00 28.80 ? 249  ARG A C   1 
ATOM   1138 O  O   . ARG A 1 155 ? 18.086 26.854  30.610  1.00 27.51 ? 249  ARG A O   1 
ATOM   1139 C  CB  . ARG A 1 155 ? 19.866 28.941  29.542  1.00 26.00 ? 249  ARG A CB  1 
ATOM   1140 C  CG  . ARG A 1 155 ? 20.634 30.207  29.196  1.00 25.02 ? 249  ARG A CG  1 
ATOM   1141 C  CD  . ARG A 1 155 ? 22.073 29.906  28.793  1.00 20.17 ? 249  ARG A CD  1 
ATOM   1142 N  NE  . ARG A 1 155 ? 22.755 29.185  29.861  1.00 21.85 ? 249  ARG A NE  1 
ATOM   1143 C  CZ  . ARG A 1 155 ? 24.047 28.869  29.861  1.00 24.46 ? 249  ARG A CZ  1 
ATOM   1144 N  NH1 . ARG A 1 155 ? 24.831 29.215  28.840  1.00 23.41 ? 249  ARG A NH1 1 
ATOM   1145 N  NH2 . ARG A 1 155 ? 24.557 28.194  30.887  1.00 25.16 ? 249  ARG A NH2 1 
ATOM   1146 N  N   . PRO A 1 156 ? 16.492 27.946  29.433  1.00 30.28 ? 250  PRO A N   1 
ATOM   1147 C  CA  . PRO A 1 156 ? 15.683 26.724  29.331  1.00 30.17 ? 250  PRO A CA  1 
ATOM   1148 C  C   . PRO A 1 156 ? 16.434 25.640  28.564  1.00 30.95 ? 250  PRO A C   1 
ATOM   1149 O  O   . PRO A 1 156 ? 17.249 25.936  27.677  1.00 28.78 ? 250  PRO A O   1 
ATOM   1150 C  CB  . PRO A 1 156 ? 14.435 27.190  28.581  1.00 27.61 ? 250  PRO A CB  1 
ATOM   1151 C  CG  . PRO A 1 156 ? 14.317 28.608  28.983  1.00 29.58 ? 250  PRO A CG  1 
ATOM   1152 C  CD  . PRO A 1 156 ? 15.754 29.088  28.872  1.00 30.33 ? 250  PRO A CD  1 
ATOM   1153 N  N   . ILE A 1 157 ? 16.169 24.385  28.912  1.00 32.31 ? 251  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 157 ? 16.822 23.268  28.229  1.00 32.25 ? 251  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 157 ? 15.800 22.346  27.605  1.00 30.19 ? 251  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 157 ? 14.596 22.476  27.831  1.00 32.84 ? 251  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 157 ? 17.663 22.376  29.185  1.00 30.82 ? 251  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 157 ? 16.782 21.882  30.335  1.00 32.35 ? 251  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 157 ? 18.867 23.136  29.701  1.00 31.07 ? 251  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 157 ? 17.399 20.748  31.167  1.00 32.90 ? 251  ILE A CD1 1 
ATOM   1161 N  N   . LEU A 1 158 ? 16.312 21.411  26.815  1.00 30.69 ? 252  LEU A N   1 
ATOM   1162 C  CA  . LEU A 1 158 ? 15.521 20.383  26.156  1.00 26.75 ? 252  LEU A CA  1 
ATOM   1163 C  C   . LEU A 1 158 ? 16.181 19.069  26.545  1.00 26.35 ? 252  LEU A C   1 
ATOM   1164 O  O   . LEU A 1 158 ? 17.416 18.964  26.566  1.00 25.33 ? 252  LEU A O   1 
ATOM   1165 C  CB  . LEU A 1 158 ? 15.592 20.501  24.631  1.00 23.95 ? 252  LEU A CB  1 
ATOM   1166 C  CG  . LEU A 1 158 ? 14.803 21.605  23.927  1.00 30.61 ? 252  LEU A CG  1 
ATOM   1167 C  CD1 . LEU A 1 158 ? 15.071 21.581  22.411  1.00 28.12 ? 252  LEU A CD1 1 
ATOM   1168 C  CD2 . LEU A 1 158 ? 13.325 21.407  24.208  1.00 30.01 ? 252  LEU A CD2 1 
ATOM   1169 N  N   . THR A 1 159 ? 15.373 18.077  26.892  1.00 24.47 ? 253  THR A N   1 
ATOM   1170 C  CA  . THR A 1 159 ? 15.923 16.771  27.189  1.00 21.60 ? 253  THR A CA  1 
ATOM   1171 C  C   . THR A 1 159 ? 15.628 16.006  25.904  1.00 22.02 ? 253  THR A C   1 
ATOM   1172 O  O   . THR A 1 159 ? 14.468 15.948  25.472  1.00 21.15 ? 253  THR A O   1 
ATOM   1173 C  CB  . THR A 1 159 ? 15.209 16.086  28.377  1.00 19.19 ? 253  THR A CB  1 
ATOM   1174 O  OG1 . THR A 1 159 ? 15.479 16.819  29.580  1.00 19.51 ? 253  THR A OG1 1 
ATOM   1175 C  CG2 . THR A 1 159 ? 15.715 14.647  28.554  1.00 16.28 ? 253  THR A CG2 1 
ATOM   1176 N  N   . ILE A 1 160 ? 16.669 15.477  25.260  1.00 22.25 ? 254  ILE A N   1 
ATOM   1177 C  CA  . ILE A 1 160 ? 16.473 14.693  24.039  1.00 24.18 ? 254  ILE A CA  1 
ATOM   1178 C  C   . ILE A 1 160 ? 16.660 13.231  24.379  1.00 24.78 ? 254  ILE A C   1 
ATOM   1179 O  O   . ILE A 1 160 ? 17.732 12.823  24.834  1.00 29.89 ? 254  ILE A O   1 
ATOM   1180 C  CB  . ILE A 1 160 ? 17.486 15.018  22.897  1.00 24.98 ? 254  ILE A CB  1 
ATOM   1181 C  CG1 . ILE A 1 160 ? 17.312 16.453  22.420  1.00 23.65 ? 254  ILE A CG1 1 
ATOM   1182 C  CG2 . ILE A 1 160 ? 17.290 14.050  21.728  1.00 17.72 ? 254  ILE A CG2 1 
ATOM   1183 C  CD1 . ILE A 1 160 ? 17.952 17.438  23.342  1.00 28.62 ? 254  ILE A CD1 1 
ATOM   1184 N  N   . ILE A 1 161 ? 15.611 12.446  24.165  1.00 25.01 ? 255  ILE A N   1 
ATOM   1185 C  CA  . ILE A 1 161 ? 15.653 11.021  24.434  1.00 22.77 ? 255  ILE A CA  1 
ATOM   1186 C  C   . ILE A 1 161 ? 15.861 10.293  23.113  1.00 24.69 ? 255  ILE A C   1 
ATOM   1187 O  O   . ILE A 1 161 ? 15.108 10.493  22.157  1.00 24.74 ? 255  ILE A O   1 
ATOM   1188 C  CB  . ILE A 1 161 ? 14.343 10.525  25.035  1.00 21.03 ? 255  ILE A CB  1 
ATOM   1189 C  CG1 . ILE A 1 161 ? 14.016 11.290  26.317  1.00 18.89 ? 255  ILE A CG1 1 
ATOM   1190 C  CG2 . ILE A 1 161 ? 14.445 9.036   25.284  1.00 22.80 ? 255  ILE A CG2 1 
ATOM   1191 C  CD1 . ILE A 1 161 ? 15.039 11.148  27.399  1.00 21.17 ? 255  ILE A CD1 1 
ATOM   1192 N  N   . THR A 1 162 ? 16.876 9.443   23.052  1.00 26.96 ? 256  THR A N   1 
ATOM   1193 C  CA  . THR A 1 162 ? 17.140 8.713   21.821  1.00 28.52 ? 256  THR A CA  1 
ATOM   1194 C  C   . THR A 1 162 ? 17.172 7.221   22.054  1.00 29.86 ? 256  THR A C   1 
ATOM   1195 O  O   . THR A 1 162 ? 17.653 6.740   23.084  1.00 33.52 ? 256  THR A O   1 
ATOM   1196 C  CB  . THR A 1 162 ? 18.490 9.135   21.165  1.00 27.84 ? 256  THR A CB  1 
ATOM   1197 O  OG1 . THR A 1 162 ? 19.517 9.212   22.163  1.00 25.96 ? 256  THR A OG1 1 
ATOM   1198 C  CG2 . THR A 1 162 ? 18.355 10.485  20.482  1.00 29.59 ? 256  THR A CG2 1 
ATOM   1199 N  N   . LEU A 1 163 ? 16.630 6.492   21.091  1.00 30.80 ? 257  LEU A N   1 
ATOM   1200 C  CA  . LEU A 1 163 ? 16.614 5.040   21.134  1.00 32.86 ? 257  LEU A CA  1 
ATOM   1201 C  C   . LEU A 1 163 ? 17.715 4.628   20.151  1.00 35.36 ? 257  LEU A C   1 
ATOM   1202 O  O   . LEU A 1 163 ? 17.644 4.961   18.955  1.00 34.45 ? 257  LEU A O   1 
ATOM   1203 C  CB  . LEU A 1 163 ? 15.269 4.516   20.646  1.00 29.83 ? 257  LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1 163 ? 14.720 3.291   21.363  1.00 32.06 ? 257  LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1 163 ? 14.286 3.675   22.783  1.00 31.88 ? 257  LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1 163 ? 13.541 2.745   20.571  1.00 32.90 ? 257  LEU A CD2 1 
ATOM   1207 N  N   . GLU A 1 164 ? 18.736 3.934   20.649  1.00 35.25 ? 258  GLU A N   1 
ATOM   1208 C  CA  . GLU A 1 164 ? 19.835 3.497   19.796  1.00 39.16 ? 258  GLU A CA  1 
ATOM   1209 C  C   . GLU A 1 164 ? 20.129 1.997   19.906  1.00 40.41 ? 258  GLU A C   1 
ATOM   1210 O  O   . GLU A 1 164 ? 19.750 1.353   20.884  1.00 41.15 ? 258  GLU A O   1 
ATOM   1211 C  CB  . GLU A 1 164 ? 21.102 4.317   20.103  1.00 41.61 ? 258  GLU A CB  1 
ATOM   1212 C  CG  . GLU A 1 164 ? 21.250 4.783   21.548  1.00 45.35 ? 258  GLU A CG  1 
ATOM   1213 C  CD  . GLU A 1 164 ? 22.521 5.604   21.791  1.00 45.28 ? 258  GLU A CD  1 
ATOM   1214 O  OE1 . GLU A 1 164 ? 23.610 4.996   21.884  1.00 44.85 ? 258  GLU A OE1 1 
ATOM   1215 O  OE2 . GLU A 1 164 ? 22.425 6.855   21.886  1.00 44.53 ? 258  GLU A OE2 1 
ATOM   1216 N  N   . ASP A 1 165 ? 20.786 1.437   18.890  1.00 40.55 ? 259  ASP A N   1 
ATOM   1217 C  CA  . ASP A 1 165 ? 21.110 0.023   18.905  1.00 39.61 ? 259  ASP A CA  1 
ATOM   1218 C  C   . ASP A 1 165 ? 22.355 -0.256  19.743  1.00 41.04 ? 259  ASP A C   1 
ATOM   1219 O  O   . ASP A 1 165 ? 22.959 0.666   20.300  1.00 40.45 ? 259  ASP A O   1 
ATOM   1220 C  CB  . ASP A 1 165 ? 21.266 -0.513  17.474  1.00 38.50 ? 259  ASP A CB  1 
ATOM   1221 C  CG  . ASP A 1 165 ? 22.512 0.007   16.755  1.00 37.44 ? 259  ASP A CG  1 
ATOM   1222 O  OD1 . ASP A 1 165 ? 22.704 -0.389  15.585  1.00 37.70 ? 259  ASP A OD1 1 
ATOM   1223 O  OD2 . ASP A 1 165 ? 23.298 0.790   17.328  1.00 37.99 ? 259  ASP A OD2 1 
ATOM   1224 N  N   . SER A 1 166 ? 22.723 -1.532  19.842  1.00 42.76 ? 260  SER A N   1 
ATOM   1225 C  CA  . SER A 1 166 ? 23.872 -1.949  20.633  1.00 44.36 ? 260  SER A CA  1 
ATOM   1226 C  C   . SER A 1 166 ? 25.129 -1.173  20.290  1.00 45.44 ? 260  SER A C   1 
ATOM   1227 O  O   . SER A 1 166 ? 26.011 -0.995  21.135  1.00 47.01 ? 260  SER A O   1 
ATOM   1228 C  CB  . SER A 1 166 ? 24.126 -3.447  20.443  1.00 45.09 ? 260  SER A CB  1 
ATOM   1229 O  OG  . SER A 1 166 ? 24.417 -3.758  19.093  1.00 47.69 ? 260  SER A OG  1 
ATOM   1230 N  N   . SER A 1 167 ? 25.197 -0.696  19.054  1.00 46.38 ? 261  SER A N   1 
ATOM   1231 C  CA  . SER A 1 167 ? 26.355 0.044   18.569  1.00 49.15 ? 261  SER A CA  1 
ATOM   1232 C  C   . SER A 1 167 ? 26.260 1.581   18.651  1.00 51.75 ? 261  SER A C   1 
ATOM   1233 O  O   . SER A 1 167 ? 27.261 2.283   18.465  1.00 53.28 ? 261  SER A O   1 
ATOM   1234 C  CB  . SER A 1 167 ? 26.628 -0.377  17.129  1.00 47.52 ? 261  SER A CB  1 
ATOM   1235 O  OG  . SER A 1 167 ? 27.738 0.320   16.610  1.00 50.97 ? 261  SER A OG  1 
ATOM   1236 N  N   . GLY A 1 168 ? 25.064 2.104   18.911  1.00 51.30 ? 262  GLY A N   1 
ATOM   1237 C  CA  . GLY A 1 168 ? 24.910 3.543   19.016  1.00 49.51 ? 262  GLY A CA  1 
ATOM   1238 C  C   . GLY A 1 168 ? 24.243 4.228   17.836  1.00 49.03 ? 262  GLY A C   1 
ATOM   1239 O  O   . GLY A 1 168 ? 24.248 5.464   17.756  1.00 49.73 ? 262  GLY A O   1 
ATOM   1240 N  N   . ASN A 1 169 ? 23.674 3.445   16.921  1.00 46.69 ? 263  ASN A N   1 
ATOM   1241 C  CA  . ASN A 1 169 ? 22.990 4.011   15.755  1.00 45.34 ? 263  ASN A CA  1 
ATOM   1242 C  C   . ASN A 1 169 ? 21.583 4.455   16.134  1.00 43.37 ? 263  ASN A C   1 
ATOM   1243 O  O   . ASN A 1 169 ? 20.929 3.825   16.965  1.00 41.16 ? 263  ASN A O   1 
ATOM   1244 C  CB  . ASN A 1 169 ? 22.892 2.984   14.631  1.00 46.77 ? 263  ASN A CB  1 
ATOM   1245 C  CG  . ASN A 1 169 ? 24.229 2.669   14.025  1.00 49.82 ? 263  ASN A CG  1 
ATOM   1246 O  OD1 . ASN A 1 169 ? 25.165 2.308   14.729  1.00 54.22 ? 263  ASN A OD1 1 
ATOM   1247 N  ND2 . ASN A 1 169 ? 24.330 2.800   12.708  1.00 54.47 ? 263  ASN A ND2 1 
ATOM   1248 N  N   . LEU A 1 170 ? 21.118 5.533   15.507  1.00 42.07 ? 264  LEU A N   1 
ATOM   1249 C  CA  . LEU A 1 170 ? 19.790 6.075   15.774  1.00 38.81 ? 264  LEU A CA  1 
ATOM   1250 C  C   . LEU A 1 170 ? 18.659 5.160   15.312  1.00 38.49 ? 264  LEU A C   1 
ATOM   1251 O  O   . LEU A 1 170 ? 18.625 4.715   14.162  1.00 37.11 ? 264  LEU A O   1 
ATOM   1252 C  CB  . LEU A 1 170 ? 19.631 7.439   15.102  1.00 39.98 ? 264  LEU A CB  1 
ATOM   1253 C  CG  . LEU A 1 170 ? 18.321 8.190   15.378  1.00 41.60 ? 264  LEU A CG  1 
ATOM   1254 C  CD1 . LEU A 1 170 ? 18.240 8.600   16.850  1.00 38.86 ? 264  LEU A CD1 1 
ATOM   1255 C  CD2 . LEU A 1 170 ? 18.258 9.412   14.482  1.00 40.89 ? 264  LEU A CD2 1 
ATOM   1256 N  N   . LEU A 1 171 ? 17.734 4.895   16.229  1.00 38.70 ? 265  LEU A N   1 
ATOM   1257 C  CA  . LEU A 1 171 ? 16.572 4.053   15.973  1.00 36.69 ? 265  LEU A CA  1 
ATOM   1258 C  C   . LEU A 1 171 ? 15.339 4.908   16.217  1.00 34.36 ? 265  LEU A C   1 
ATOM   1259 O  O   . LEU A 1 171 ? 14.290 4.688   15.612  1.00 30.36 ? 265  LEU A O   1 
ATOM   1260 C  CB  . LEU A 1 171 ? 16.559 2.864   16.935  1.00 41.14 ? 265  LEU A CB  1 
ATOM   1261 C  CG  . LEU A 1 171 ? 17.740 1.889   16.852  1.00 45.54 ? 265  LEU A CG  1 
ATOM   1262 C  CD1 . LEU A 1 171 ? 17.733 0.955   18.068  1.00 44.47 ? 265  LEU A CD1 1 
ATOM   1263 C  CD2 . LEU A 1 171 ? 17.652 1.088   15.540  1.00 45.41 ? 265  LEU A CD2 1 
ATOM   1264 N  N   . GLY A 1 172 ? 15.480 5.886   17.114  1.00 33.50 ? 266  GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 172 ? 14.376 6.774   17.436  1.00 32.29 ? 266  GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 172 ? 14.815 7.971   18.253  1.00 32.38 ? 266  GLY A C   1 
ATOM   1267 O  O   . GLY A 1 172 ? 15.856 7.926   18.904  1.00 33.03 ? 266  GLY A O   1 
ATOM   1268 N  N   . ARG A 1 173 ? 14.026 9.046   18.227  1.00 34.33 ? 267  ARG A N   1 
ATOM   1269 C  CA  . ARG A 1 173 ? 14.356 10.266  18.973  1.00 30.43 ? 267  ARG A CA  1 
ATOM   1270 C  C   . ARG A 1 173 ? 13.118 11.086  19.307  1.00 27.80 ? 267  ARG A C   1 
ATOM   1271 O  O   . ARG A 1 173 ? 12.188 11.174  18.512  1.00 26.56 ? 267  ARG A O   1 
ATOM   1272 C  CB  . ARG A 1 173 ? 15.350 11.121  18.166  1.00 31.24 ? 267  ARG A CB  1 
ATOM   1273 C  CG  . ARG A 1 173 ? 15.620 12.531  18.708  1.00 30.90 ? 267  ARG A CG  1 
ATOM   1274 C  CD  . ARG A 1 173 ? 16.893 13.122  18.096  1.00 29.02 ? 267  ARG A CD  1 
ATOM   1275 N  NE  . ARG A 1 173 ? 16.891 13.062  16.637  1.00 31.75 ? 267  ARG A NE  1 
ATOM   1276 C  CZ  . ARG A 1 173 ? 17.956 12.735  15.900  1.00 34.65 ? 267  ARG A CZ  1 
ATOM   1277 N  NH1 . ARG A 1 173 ? 19.112 12.437  16.488  1.00 34.86 ? 267  ARG A NH1 1 
ATOM   1278 N  NH2 . ARG A 1 173 ? 17.871 12.700  14.572  1.00 33.25 ? 267  ARG A NH2 1 
ATOM   1279 N  N   . ASN A 1 174 ? 13.116 11.672  20.501  1.00 27.40 ? 268  ASN A N   1 
ATOM   1280 C  CA  . ASN A 1 174 ? 12.013 12.509  20.979  1.00 27.84 ? 268  ASN A CA  1 
ATOM   1281 C  C   . ASN A 1 174 ? 12.561 13.502  21.984  1.00 28.22 ? 268  ASN A C   1 
ATOM   1282 O  O   . ASN A 1 174 ? 13.674 13.337  22.486  1.00 25.66 ? 268  ASN A O   1 
ATOM   1283 C  CB  . ASN A 1 174 ? 10.936 11.675  21.676  1.00 28.22 ? 268  ASN A CB  1 
ATOM   1284 C  CG  . ASN A 1 174 ? 9.990  11.038  20.710  1.00 30.66 ? 268  ASN A CG  1 
ATOM   1285 O  OD1 . ASN A 1 174 ? 9.349  11.727  19.907  1.00 30.90 ? 268  ASN A OD1 1 
ATOM   1286 N  ND2 . ASN A 1 174 ? 9.888  9.709   20.768  1.00 32.42 ? 268  ASN A ND2 1 
ATOM   1287 N  N   . SER A 1 175 ? 11.770 14.518  22.310  1.00 28.86 ? 269  SER A N   1 
ATOM   1288 C  CA  . SER A 1 175 ? 12.238 15.506  23.259  1.00 28.36 ? 269  SER A CA  1 
ATOM   1289 C  C   . SER A 1 175 ? 11.120 16.271  23.942  1.00 27.24 ? 269  SER A C   1 
ATOM   1290 O  O   . SER A 1 175 ? 9.977  16.286  23.495  1.00 29.67 ? 269  SER A O   1 
ATOM   1291 C  CB  . SER A 1 175 ? 13.133 16.494  22.534  1.00 28.18 ? 269  SER A CB  1 
ATOM   1292 O  OG  . SER A 1 175 ? 12.373 17.129  21.523  1.00 27.54 ? 269  SER A OG  1 
ATOM   1293 N  N   . PHE A 1 176 ? 11.474 16.919  25.037  1.00 26.42 ? 270  PHE A N   1 
ATOM   1294 C  CA  . PHE A 1 176 ? 10.531 17.734  25.779  1.00 26.92 ? 270  PHE A CA  1 
ATOM   1295 C  C   . PHE A 1 176 ? 11.342 18.814  26.502  1.00 27.50 ? 270  PHE A C   1 
ATOM   1296 O  O   . PHE A 1 176 ? 12.513 18.612  26.831  1.00 29.96 ? 270  PHE A O   1 
ATOM   1297 C  CB  . PHE A 1 176 ? 9.729  16.868  26.765  1.00 23.94 ? 270  PHE A CB  1 
ATOM   1298 C  CG  . PHE A 1 176 ? 10.581 16.032  27.679  1.00 22.43 ? 270  PHE A CG  1 
ATOM   1299 C  CD1 . PHE A 1 176 ? 11.071 14.806  27.263  1.00 20.24 ? 270  PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A 1 176 ? 10.924 16.495  28.944  1.00 23.34 ? 270  PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A 1 176 ? 11.889 14.052  28.085  1.00 21.58 ? 270  PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A 1 176 ? 11.747 15.744  29.779  1.00 22.34 ? 270  PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A 1 176 ? 12.230 14.519  29.344  1.00 23.87 ? 270  PHE A CZ  1 
ATOM   1304 N  N   . GLU A 1 177 ? 10.735 19.968  26.726  1.00 27.95 ? 271  GLU A N   1 
ATOM   1305 C  CA  . GLU A 1 177 ? 11.428 21.065  27.398  1.00 29.49 ? 271  GLU A CA  1 
ATOM   1306 C  C   . GLU A 1 177 ? 11.372 20.861  28.908  1.00 29.03 ? 271  GLU A C   1 
ATOM   1307 O  O   . GLU A 1 177 ? 10.416 20.277  29.432  1.00 28.53 ? 271  GLU A O   1 
ATOM   1308 C  CB  . GLU A 1 177 ? 10.775 22.394  27.014  1.00 30.63 ? 271  GLU A CB  1 
ATOM   1309 C  CG  . GLU A 1 177 ? 11.400 23.618  27.627  1.00 32.38 ? 271  GLU A CG  1 
ATOM   1310 C  CD  . GLU A 1 177 ? 10.815 24.883  27.042  1.00 37.42 ? 271  GLU A CD  1 
ATOM   1311 O  OE1 . GLU A 1 177 ? 10.970 25.954  27.674  1.00 39.20 ? 271  GLU A OE1 1 
ATOM   1312 O  OE2 . GLU A 1 177 ? 10.205 24.800  25.943  1.00 37.07 ? 271  GLU A OE2 1 
ATOM   1313 N  N   . VAL A 1 178 ? 12.387 21.342  29.613  1.00 25.98 ? 272  VAL A N   1 
ATOM   1314 C  CA  . VAL A 1 178 ? 12.397 21.168  31.052  1.00 27.78 ? 272  VAL A CA  1 
ATOM   1315 C  C   . VAL A 1 178 ? 12.689 22.429  31.842  1.00 27.44 ? 272  VAL A C   1 
ATOM   1316 O  O   . VAL A 1 178 ? 13.445 23.290  31.408  1.00 27.91 ? 272  VAL A O   1 
ATOM   1317 C  CB  . VAL A 1 178 ? 13.441 20.129  31.483  1.00 25.39 ? 272  VAL A CB  1 
ATOM   1318 C  CG1 . VAL A 1 178 ? 13.426 19.971  32.998  1.00 21.86 ? 272  VAL A CG1 1 
ATOM   1319 C  CG2 . VAL A 1 178 ? 13.165 18.826  30.812  1.00 23.40 ? 272  VAL A CG2 1 
ATOM   1320 N  N   . ARG A 1 179 ? 12.064 22.528  33.007  1.00 27.49 ? 273  ARG A N   1 
ATOM   1321 C  CA  . ARG A 1 179 ? 12.322 23.630  33.911  1.00 29.22 ? 273  ARG A CA  1 
ATOM   1322 C  C   . ARG A 1 179 ? 12.472 22.999  35.289  1.00 31.57 ? 273  ARG A C   1 
ATOM   1323 O  O   . ARG A 1 179 ? 11.511 22.423  35.838  1.00 30.84 ? 273  ARG A O   1 
ATOM   1324 C  CB  . ARG A 1 179 ? 11.179 24.649  33.950  1.00 31.01 ? 273  ARG A CB  1 
ATOM   1325 C  CG  . ARG A 1 179 ? 11.446 25.777  34.957  1.00 30.49 ? 273  ARG A CG  1 
ATOM   1326 C  CD  . ARG A 1 179 ? 10.293 26.768  35.113  1.00 31.82 ? 273  ARG A CD  1 
ATOM   1327 N  NE  . ARG A 1 179 ? 10.457 27.591  36.317  1.00 31.15 ? 273  ARG A NE  1 
ATOM   1328 C  CZ  . ARG A 1 179 ? 11.286 28.625  36.420  1.00 30.88 ? 273  ARG A CZ  1 
ATOM   1329 N  NH1 . ARG A 1 179 ? 12.036 28.993  35.388  1.00 31.67 ? 273  ARG A NH1 1 
ATOM   1330 N  NH2 . ARG A 1 179 ? 11.381 29.281  37.567  1.00 30.20 ? 273  ARG A NH2 1 
ATOM   1331 N  N   . VAL A 1 180 ? 13.685 23.061  35.832  1.00 30.21 ? 274  VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 180 ? 13.917 22.529  37.169  1.00 30.67 ? 274  VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 180 ? 13.756 23.739  38.077  1.00 31.66 ? 274  VAL A C   1 
ATOM   1334 O  O   . VAL A 1 180 ? 14.501 24.720  37.949  1.00 32.89 ? 274  VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 180 ? 15.327 21.968  37.319  1.00 29.11 ? 274  VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 180 ? 15.441 21.240  38.639  1.00 28.80 ? 274  VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 180 ? 15.637 21.042  36.167  1.00 25.15 ? 274  VAL A CG2 1 
ATOM   1338 N  N   . CYS A 1 181 ? 12.783 23.681  38.981  1.00 31.38 ? 275  CYS A N   1 
ATOM   1339 C  CA  . CYS A 1 181 ? 12.510 24.813  39.861  1.00 33.45 ? 275  CYS A CA  1 
ATOM   1340 C  C   . CYS A 1 181 ? 11.963 24.436  41.235  1.00 36.12 ? 275  CYS A C   1 
ATOM   1341 O  O   . CYS A 1 181 ? 11.706 23.260  41.524  1.00 39.43 ? 275  CYS A O   1 
ATOM   1342 C  CB  . CYS A 1 181 ? 11.519 25.757  39.163  1.00 35.71 ? 275  CYS A CB  1 
ATOM   1343 S  SG  . CYS A 1 181 ? 9.936  24.989  38.597  1.00 32.62 ? 275  CYS A SG  1 
ATOM   1344 N  N   . ALA A 1 182 ? 11.774 25.445  42.079  1.00 35.98 ? 276  ALA A N   1 
ATOM   1345 C  CA  . ALA A 1 182 ? 11.260 25.223  43.425  1.00 37.64 ? 276  ALA A CA  1 
ATOM   1346 C  C   . ALA A 1 182 ? 9.780  24.834  43.393  1.00 39.91 ? 276  ALA A C   1 
ATOM   1347 O  O   . ALA A 1 182 ? 9.367  23.884  44.074  1.00 38.02 ? 276  ALA A O   1 
ATOM   1348 C  CB  . ALA A 1 182 ? 11.453 26.482  44.273  1.00 38.26 ? 276  ALA A CB  1 
ATOM   1349 N  N   . CYS A 1 183 ? 8.984  25.554  42.602  1.00 39.73 ? 277  CYS A N   1 
ATOM   1350 C  CA  . CYS A 1 183 ? 7.569  25.239  42.535  1.00 42.76 ? 277  CYS A CA  1 
ATOM   1351 C  C   . CYS A 1 183 ? 7.049  24.857  41.150  1.00 42.22 ? 277  CYS A C   1 
ATOM   1352 O  O   . CYS A 1 183 ? 6.479  25.686  40.429  1.00 40.37 ? 277  CYS A O   1 
ATOM   1353 C  CB  . CYS A 1 183 ? 6.755  26.393  43.095  1.00 44.49 ? 277  CYS A CB  1 
ATOM   1354 S  SG  . CYS A 1 183 ? 5.312  25.782  43.966  1.00 55.76 ? 277  CYS A SG  1 
ATOM   1355 N  N   . PRO A 1 184 ? 7.226  23.578  40.769  1.00 41.62 ? 278  PRO A N   1 
ATOM   1356 C  CA  . PRO A 1 184 ? 6.783  23.058  39.471  1.00 40.04 ? 278  PRO A CA  1 
ATOM   1357 C  C   . PRO A 1 184 ? 5.344  23.445  39.194  1.00 39.85 ? 278  PRO A C   1 
ATOM   1358 O  O   . PRO A 1 184 ? 5.052  24.104  38.197  1.00 38.10 ? 278  PRO A O   1 
ATOM   1359 C  CB  . PRO A 1 184 ? 6.947  21.557  39.631  1.00 40.26 ? 278  PRO A CB  1 
ATOM   1360 C  CG  . PRO A 1 184 ? 8.147  21.463  40.531  1.00 42.66 ? 278  PRO A CG  1 
ATOM   1361 C  CD  . PRO A 1 184 ? 7.838  22.510  41.577  1.00 41.46 ? 278  PRO A CD  1 
ATOM   1362 N  N   . GLY A 1 185 ? 4.452  23.040  40.094  1.00 40.71 ? 279  GLY A N   1 
ATOM   1363 C  CA  . GLY A 1 185 ? 3.040  23.348  39.943  1.00 40.39 ? 279  GLY A CA  1 
ATOM   1364 C  C   . GLY A 1 185 ? 2.797  24.817  39.679  1.00 40.65 ? 279  GLY A C   1 
ATOM   1365 O  O   . GLY A 1 185 ? 2.172  25.183  38.687  1.00 42.40 ? 279  GLY A O   1 
ATOM   1366 N  N   . ARG A 1 186 ? 3.291  25.663  40.572  1.00 42.20 ? 280  ARG A N   1 
ATOM   1367 C  CA  . ARG A 1 186 ? 3.138  27.113  40.440  1.00 45.05 ? 280  ARG A CA  1 
ATOM   1368 C  C   . ARG A 1 186 ? 3.611  27.626  39.065  1.00 42.75 ? 280  ARG A C   1 
ATOM   1369 O  O   . ARG A 1 186 ? 2.900  28.378  38.392  1.00 41.50 ? 280  ARG A O   1 
ATOM   1370 C  CB  . ARG A 1 186 ? 3.941  27.793  41.559  1.00 50.16 ? 280  ARG A CB  1 
ATOM   1371 C  CG  . ARG A 1 186 ? 3.919  29.323  41.598  1.00 56.92 ? 280  ARG A CG  1 
ATOM   1372 C  CD  . ARG A 1 186 ? 5.037  29.859  42.540  1.00 62.61 ? 280  ARG A CD  1 
ATOM   1373 N  NE  . ARG A 1 186 ? 6.387  29.693  41.977  1.00 63.93 ? 280  ARG A NE  1 
ATOM   1374 C  CZ  . ARG A 1 186 ? 7.514  29.625  42.689  1.00 64.09 ? 280  ARG A CZ  1 
ATOM   1375 N  NH1 . ARG A 1 186 ? 7.480  29.704  44.015  1.00 64.04 ? 280  ARG A NH1 1 
ATOM   1376 N  NH2 . ARG A 1 186 ? 8.681  29.468  42.071  1.00 63.78 ? 280  ARG A NH2 1 
ATOM   1377 N  N   . ASP A 1 187 ? 4.805  27.207  38.651  1.00 41.05 ? 281  ASP A N   1 
ATOM   1378 C  CA  . ASP A 1 187 ? 5.374  27.651  37.380  1.00 39.61 ? 281  ASP A CA  1 
ATOM   1379 C  C   . ASP A 1 187 ? 4.688  27.084  36.139  1.00 39.56 ? 281  ASP A C   1 
ATOM   1380 O  O   . ASP A 1 187 ? 4.623  27.752  35.098  1.00 40.34 ? 281  ASP A O   1 
ATOM   1381 C  CB  . ASP A 1 187 ? 6.866  27.327  37.342  1.00 39.20 ? 281  ASP A CB  1 
ATOM   1382 C  CG  . ASP A 1 187 ? 7.675  28.200  38.279  1.00 39.53 ? 281  ASP A CG  1 
ATOM   1383 O  OD1 . ASP A 1 187 ? 8.886  27.919  38.436  1.00 41.89 ? 281  ASP A OD1 1 
ATOM   1384 O  OD2 . ASP A 1 187 ? 7.110  29.167  38.847  1.00 36.34 ? 281  ASP A OD2 1 
ATOM   1385 N  N   . ARG A 1 188 ? 4.191  25.855  36.231  1.00 36.50 ? 282  ARG A N   1 
ATOM   1386 C  CA  . ARG A 1 188 ? 3.510  25.272  35.095  1.00 35.36 ? 282  ARG A CA  1 
ATOM   1387 C  C   . ARG A 1 188 ? 2.309  26.162  34.782  1.00 37.50 ? 282  ARG A C   1 
ATOM   1388 O  O   . ARG A 1 188 ? 2.142  26.618  33.650  1.00 38.08 ? 282  ARG A O   1 
ATOM   1389 C  CB  . ARG A 1 188 ? 3.019  23.858  35.409  1.00 37.06 ? 282  ARG A CB  1 
ATOM   1390 C  CG  . ARG A 1 188 ? 2.272  23.223  34.242  1.00 35.30 ? 282  ARG A CG  1 
ATOM   1391 C  CD  . ARG A 1 188 ? 1.544  21.962  34.635  1.00 35.02 ? 282  ARG A CD  1 
ATOM   1392 N  NE  . ARG A 1 188 ? 0.555  21.609  33.618  1.00 35.56 ? 282  ARG A NE  1 
ATOM   1393 C  CZ  . ARG A 1 188 ? -0.275 20.578  33.713  1.00 30.58 ? 282  ARG A CZ  1 
ATOM   1394 N  NH1 . ARG A 1 188 ? -1.143 20.329  32.747  1.00 29.75 ? 282  ARG A NH1 1 
ATOM   1395 N  NH2 . ARG A 1 188 ? -0.233 19.795  34.777  1.00 31.99 ? 282  ARG A NH2 1 
ATOM   1396 N  N   . ARG A 1 189 ? 1.483  26.409  35.800  1.00 38.69 ? 283  ARG A N   1 
ATOM   1397 C  CA  . ARG A 1 189 ? 0.283  27.241  35.665  1.00 40.21 ? 283  ARG A CA  1 
ATOM   1398 C  C   . ARG A 1 189 ? 0.590  28.616  35.091  1.00 39.22 ? 283  ARG A C   1 
ATOM   1399 O  O   . ARG A 1 189 ? -0.102 29.106  34.194  1.00 41.11 ? 283  ARG A O   1 
ATOM   1400 C  CB  . ARG A 1 189 ? -0.413 27.421  37.030  1.00 42.08 ? 283  ARG A CB  1 
ATOM   1401 C  CG  . ARG A 1 189 ? -1.513 26.392  37.308  1.00 45.69 ? 283  ARG A CG  1 
ATOM   1402 C  CD  . ARG A 1 189 ? -2.260 26.622  38.631  1.00 48.98 ? 283  ARG A CD  1 
ATOM   1403 N  NE  . ARG A 1 189 ? -1.500 26.263  39.835  1.00 49.47 ? 283  ARG A NE  1 
ATOM   1404 C  CZ  . ARG A 1 189 ? -0.995 27.149  40.694  1.00 52.27 ? 283  ARG A CZ  1 
ATOM   1405 N  NH1 . ARG A 1 189 ? -0.322 26.740  41.766  1.00 52.09 ? 283  ARG A NH1 1 
ATOM   1406 N  NH2 . ARG A 1 189 ? -1.157 28.452  40.482  1.00 52.29 ? 283  ARG A NH2 1 
ATOM   1407 N  N   . THR A 1 190 ? 1.623  29.243  35.630  1.00 37.16 ? 284  THR A N   1 
ATOM   1408 C  CA  . THR A 1 190 ? 2.038  30.561  35.182  1.00 36.00 ? 284  THR A CA  1 
ATOM   1409 C  C   . THR A 1 190 ? 2.408  30.555  33.695  1.00 38.42 ? 284  THR A C   1 
ATOM   1410 O  O   . THR A 1 190 ? 1.856  31.325  32.895  1.00 38.17 ? 284  THR A O   1 
ATOM   1411 C  CB  . THR A 1 190 ? 3.224  31.041  36.042  1.00 33.62 ? 284  THR A CB  1 
ATOM   1412 O  OG1 . THR A 1 190 ? 2.766  31.210  37.391  1.00 33.25 ? 284  THR A OG1 1 
ATOM   1413 C  CG2 . THR A 1 190 ? 3.804  32.351  35.526  1.00 28.39 ? 284  THR A CG2 1 
ATOM   1414 N  N   . GLU A 1 191 ? 3.330  29.680  33.314  1.00 39.79 ? 285  GLU A N   1 
ATOM   1415 C  CA  . GLU A 1 191 ? 3.733  29.616  31.918  1.00 41.63 ? 285  GLU A CA  1 
ATOM   1416 C  C   . GLU A 1 191 ? 2.578  29.203  31.002  1.00 43.40 ? 285  GLU A C   1 
ATOM   1417 O  O   . GLU A 1 191 ? 2.552  29.583  29.831  1.00 43.24 ? 285  GLU A O   1 
ATOM   1418 C  CB  . GLU A 1 191 ? 4.931  28.680  31.759  1.00 40.21 ? 285  GLU A CB  1 
ATOM   1419 C  CG  . GLU A 1 191 ? 6.195  29.252  32.383  1.00 39.13 ? 285  GLU A CG  1 
ATOM   1420 C  CD  . GLU A 1 191 ? 7.445  28.471  32.030  1.00 37.86 ? 285  GLU A CD  1 
ATOM   1421 O  OE1 . GLU A 1 191 ? 8.551  28.942  32.372  1.00 34.50 ? 285  GLU A OE1 1 
ATOM   1422 O  OE2 . GLU A 1 191 ? 7.321  27.391  31.413  1.00 41.38 ? 285  GLU A OE2 1 
ATOM   1423 N  N   . GLU A 1 192 ? 1.615  28.446  31.530  1.00 45.12 ? 286  GLU A N   1 
ATOM   1424 C  CA  . GLU A 1 192 ? 0.464  28.035  30.722  1.00 47.92 ? 286  GLU A CA  1 
ATOM   1425 C  C   . GLU A 1 192 ? -0.475 29.228  30.520  1.00 50.20 ? 286  GLU A C   1 
ATOM   1426 O  O   . GLU A 1 192 ? -1.121 29.350  29.479  1.00 50.38 ? 286  GLU A O   1 
ATOM   1427 C  CB  . GLU A 1 192 ? -0.281 26.858  31.371  1.00 46.43 ? 286  GLU A CB  1 
ATOM   1428 C  CG  . GLU A 1 192 ? 0.590  25.613  31.556  1.00 47.03 ? 286  GLU A CG  1 
ATOM   1429 C  CD  . GLU A 1 192 ? -0.204 24.318  31.606  1.00 47.75 ? 286  GLU A CD  1 
ATOM   1430 O  OE1 . GLU A 1 192 ? -1.282 24.298  32.248  1.00 48.61 ? 286  GLU A OE1 1 
ATOM   1431 O  OE2 . GLU A 1 192 ? 0.260  23.317  31.011  1.00 44.83 ? 286  GLU A OE2 1 
ATOM   1432 N  N   . GLU A 1 193 ? -0.527 30.117  31.510  1.00 52.22 ? 287  GLU A N   1 
ATOM   1433 C  CA  . GLU A 1 193 ? -1.351 31.321  31.423  1.00 53.90 ? 287  GLU A CA  1 
ATOM   1434 C  C   . GLU A 1 193 ? -0.611 32.248  30.474  1.00 55.22 ? 287  GLU A C   1 
ATOM   1435 O  O   . GLU A 1 193 ? -1.196 32.864  29.586  1.00 54.91 ? 287  GLU A O   1 
ATOM   1436 C  CB  . GLU A 1 193 ? -1.473 31.986  32.795  1.00 53.51 ? 287  GLU A CB  1 
ATOM   1437 C  CG  . GLU A 1 193 ? -2.831 31.827  33.473  1.00 55.21 ? 287  GLU A CG  1 
ATOM   1438 C  CD  . GLU A 1 193 ? -3.894 32.757  32.902  1.00 55.46 ? 287  GLU A CD  1 
ATOM   1439 O  OE1 . GLU A 1 193 ? -3.536 33.877  32.471  1.00 56.69 ? 287  GLU A OE1 1 
ATOM   1440 O  OE2 . GLU A 1 193 ? -5.088 32.381  32.905  1.00 53.26 ? 287  GLU A OE2 1 
ATOM   1441 N  N   . ASN A 1 194 ? 0.697  32.332  30.678  1.00 58.20 ? 288  ASN A N   1 
ATOM   1442 C  CA  . ASN A 1 194 ? 1.567  33.161  29.855  1.00 60.61 ? 288  ASN A CA  1 
ATOM   1443 C  C   . ASN A 1 194 ? 1.196  32.933  28.386  1.00 60.74 ? 288  ASN A C   1 
ATOM   1444 O  O   . ASN A 1 194 ? 1.213  33.856  27.571  1.00 59.81 ? 288  ASN A O   1 
ATOM   1445 C  CB  . ASN A 1 194 ? 3.027  32.758  30.114  1.00 63.16 ? 288  ASN A CB  1 
ATOM   1446 C  CG  . ASN A 1 194 ? 4.026  33.600  29.337  1.00 64.80 ? 288  ASN A CG  1 
ATOM   1447 O  OD1 . ASN A 1 194 ? 3.670  34.272  28.367  1.00 65.42 ? 288  ASN A OD1 1 
ATOM   1448 N  ND2 . ASN A 1 194 ? 5.297  33.550  29.753  1.00 63.59 ? 288  ASN A ND2 1 
ATOM   1449 N  N   . LEU A 1 195 ? 0.838  31.692  28.072  1.00 62.40 ? 289  LEU A N   1 
ATOM   1450 C  CA  . LEU A 1 195 ? 0.474  31.300  26.717  1.00 62.87 ? 289  LEU A CA  1 
ATOM   1451 C  C   . LEU A 1 195 ? -0.790 32.018  26.270  1.00 63.23 ? 289  LEU A C   1 
ATOM   1452 O  O   . LEU A 1 195 ? -0.783 32.751  25.287  1.00 63.16 ? 289  LEU A O   1 
ATOM   1453 C  CB  . LEU A 1 195 ? 0.251  29.784  26.658  1.00 62.70 ? 289  LEU A CB  1 
ATOM   1454 C  CG  . LEU A 1 195 ? 0.652  29.016  25.390  1.00 63.72 ? 289  LEU A CG  1 
ATOM   1455 C  CD1 . LEU A 1 195 ? 0.005  29.639  24.166  1.00 63.92 ? 289  LEU A CD1 1 
ATOM   1456 C  CD2 . LEU A 1 195 ? 2.163  29.028  25.245  1.00 64.26 ? 289  LEU A CD2 1 
ATOM   1457 N  N   . ARG A 1 196 ? -1.867 31.799  27.014  1.00 65.21 ? 290  ARG A N   1 
ATOM   1458 C  CA  . ARG A 1 196 ? -3.176 32.382  26.730  1.00 68.07 ? 290  ARG A CA  1 
ATOM   1459 C  C   . ARG A 1 196 ? -3.204 33.680  25.922  1.00 70.57 ? 290  ARG A C   1 
ATOM   1460 O  O   . ARG A 1 196 ? -4.002 33.816  24.992  1.00 70.82 ? 290  ARG A O   1 
ATOM   1461 C  CB  . ARG A 1 196 ? -3.942 32.577  28.039  1.00 67.51 ? 290  ARG A CB  1 
ATOM   1462 C  CG  . ARG A 1 196 ? -4.238 31.270  28.773  1.00 67.50 ? 290  ARG A CG  1 
ATOM   1463 C  CD  . ARG A 1 196 ? -5.681 31.242  29.202  1.00 65.89 ? 290  ARG A CD  1 
ATOM   1464 N  NE  . ARG A 1 196 ? -6.052 32.508  29.818  1.00 65.07 ? 290  ARG A NE  1 
ATOM   1465 C  CZ  . ARG A 1 196 ? -7.301 32.878  30.061  1.00 66.10 ? 290  ARG A CZ  1 
ATOM   1466 N  NH1 . ARG A 1 196 ? -7.546 34.054  30.628  1.00 67.40 ? 290  ARG A NH1 1 
ATOM   1467 N  NH2 . ARG A 1 196 ? -8.305 32.075  29.731  1.00 66.55 ? 290  ARG A NH2 1 
ATOM   1468 N  N   . LYS A 1 197 ? -2.353 34.636  26.278  1.00 73.76 ? 291  LYS A N   1 
ATOM   1469 C  CA  . LYS A 1 197 ? -2.299 35.900  25.552  1.00 76.88 ? 291  LYS A CA  1 
ATOM   1470 C  C   . LYS A 1 197 ? -0.879 36.447  25.512  1.00 79.64 ? 291  LYS A C   1 
ATOM   1471 O  O   . LYS A 1 197 ? -0.014 36.024  26.286  1.00 79.06 ? 291  LYS A O   1 
ATOM   1472 C  CB  . LYS A 1 197 ? -3.226 36.938  26.196  1.00 76.28 ? 291  LYS A CB  1 
ATOM   1473 C  CG  . LYS A 1 197 ? -3.174 38.310  25.518  1.00 77.09 ? 291  LYS A CG  1 
ATOM   1474 C  CD  . LYS A 1 197 ? -4.123 39.310  26.168  1.00 78.81 ? 291  LYS A CD  1 
ATOM   1475 C  CE  . LYS A 1 197 ? -4.018 40.690  25.522  1.00 78.15 ? 291  LYS A CE  1 
ATOM   1476 N  NZ  . LYS A 1 197 ? -5.029 41.651  26.062  1.00 76.42 ? 291  LYS A NZ  1 
ATOM   1477 N  N   . LYS A 1 198 ? -0.646 37.386  24.598  1.00 82.19 ? 292  LYS A N   1 
ATOM   1478 C  CA  . LYS A 1 198 ? 0.663  38.011  24.450  1.00 83.74 ? 292  LYS A CA  1 
ATOM   1479 C  C   . LYS A 1 198 ? 0.961  38.904  25.654  1.00 84.04 ? 292  LYS A C   1 
ATOM   1480 O  O   . LYS A 1 198 ? 1.232  40.108  25.453  1.00 84.34 ? 292  LYS A O   1 
ATOM   1481 C  CB  . LYS A 1 198 ? 0.723  38.834  23.148  1.00 84.52 ? 292  LYS A CB  1 
ATOM   1482 C  CG  . LYS A 1 198 ? -0.355 39.916  22.992  1.00 84.49 ? 292  LYS A CG  1 
ATOM   1483 C  CD  . LYS A 1 198 ? -1.745 39.330  22.760  1.00 83.75 ? 292  LYS A CD  1 
ATOM   1484 C  CE  . LYS A 1 198 ? -2.789 40.425  22.587  1.00 82.58 ? 292  LYS A CE  1 
ATOM   1485 N  NZ  . LYS A 1 198 ? -4.169 39.875  22.467  1.00 80.67 ? 292  LYS A NZ  1 
ATOM   1486 O  OXT . LYS A 1 198 ? 0.924  38.381  26.791  1.00 83.78 ? 292  LYS A OXT 1 
ATOM   1487 N  N   . LEU B 2 1   ? 46.191 30.367  45.037  1.00 24.65 ? 1724 LEU B N   1 
ATOM   1488 C  CA  . LEU B 2 1   ? 45.648 31.085  43.842  1.00 27.57 ? 1724 LEU B CA  1 
ATOM   1489 C  C   . LEU B 2 1   ? 46.702 31.381  42.781  1.00 27.50 ? 1724 LEU B C   1 
ATOM   1490 O  O   . LEU B 2 1   ? 47.708 32.025  43.045  1.00 29.74 ? 1724 LEU B O   1 
ATOM   1491 C  CB  . LEU B 2 1   ? 44.987 32.412  44.242  1.00 27.06 ? 1724 LEU B CB  1 
ATOM   1492 C  CG  . LEU B 2 1   ? 44.443 33.237  43.052  1.00 26.42 ? 1724 LEU B CG  1 
ATOM   1493 C  CD1 . LEU B 2 1   ? 43.439 32.405  42.264  1.00 28.18 ? 1724 LEU B CD1 1 
ATOM   1494 C  CD2 . LEU B 2 1   ? 43.773 34.505  43.533  1.00 20.84 ? 1724 LEU B CD2 1 
ATOM   1495 N  N   . ASN B 2 2   ? 46.446 30.918  41.568  1.00 28.76 ? 1725 ASN B N   1 
ATOM   1496 C  CA  . ASN B 2 2   ? 47.354 31.129  40.452  1.00 30.59 ? 1725 ASN B CA  1 
ATOM   1497 C  C   . ASN B 2 2   ? 47.489 32.628  40.204  1.00 34.85 ? 1725 ASN B C   1 
ATOM   1498 O  O   . ASN B 2 2   ? 46.479 33.309  40.003  1.00 37.22 ? 1725 ASN B O   1 
ATOM   1499 C  CB  . ASN B 2 2   ? 46.780 30.440  39.219  1.00 30.49 ? 1725 ASN B CB  1 
ATOM   1500 C  CG  . ASN B 2 2   ? 47.672 30.561  38.024  1.00 30.14 ? 1725 ASN B CG  1 
ATOM   1501 O  OD1 . ASN B 2 2   ? 48.608 31.369  38.010  1.00 32.17 ? 1725 ASN B OD1 1 
ATOM   1502 N  ND2 . ASN B 2 2   ? 47.391 29.768  36.999  1.00 27.55 ? 1725 ASN B ND2 1 
ATOM   1503 N  N   . LYS B 2 3   ? 48.728 33.134  40.205  1.00 38.37 ? 1726 LYS B N   1 
ATOM   1504 C  CA  . LYS B 2 3   ? 49.022 34.565  40.002  1.00 39.57 ? 1726 LYS B CA  1 
ATOM   1505 C  C   . LYS B 2 3   ? 48.710 35.110  38.611  1.00 39.37 ? 1726 LYS B C   1 
ATOM   1506 O  O   . LYS B 2 3   ? 48.709 36.327  38.399  1.00 41.01 ? 1726 LYS B O   1 
ATOM   1507 C  CB  . LYS B 2 3   ? 50.502 34.834  40.284  1.00 42.19 ? 1726 LYS B CB  1 
ATOM   1508 C  CG  . LYS B 2 3   ? 50.926 34.556  41.707  1.00 48.01 ? 1726 LYS B CG  1 
ATOM   1509 C  CD  . LYS B 2 3   ? 52.218 35.285  42.035  1.00 52.19 ? 1726 LYS B CD  1 
ATOM   1510 C  CE  . LYS B 2 3   ? 52.348 35.487  43.534  1.00 52.65 ? 1726 LYS B CE  1 
ATOM   1511 N  NZ  . LYS B 2 3   ? 51.086 36.040  44.121  1.00 54.67 ? 1726 LYS B NZ  1 
ATOM   1512 N  N   . THR B 2 4   ? 48.463 34.211  37.666  1.00 37.13 ? 1727 THR B N   1 
ATOM   1513 C  CA  . THR B 2 4   ? 48.190 34.598  36.289  1.00 35.77 ? 1727 THR B CA  1 
ATOM   1514 C  C   . THR B 2 4   ? 46.815 34.098  35.854  1.00 32.28 ? 1727 THR B C   1 
ATOM   1515 O  O   . THR B 2 4   ? 46.536 33.970  34.661  1.00 32.06 ? 1727 THR B O   1 
ATOM   1516 C  CB  . THR B 2 4   ? 49.288 34.004  35.348  1.00 37.96 ? 1727 THR B CB  1 
ATOM   1517 O  OG1 . THR B 2 4   ? 49.056 34.426  34.000  1.00 42.89 ? 1727 THR B OG1 1 
ATOM   1518 C  CG2 . THR B 2 4   ? 49.266 32.474  35.381  1.00 39.45 ? 1727 THR B CG2 1 
ATOM   1519 N  N   . LEU B 2 5   ? 45.949 33.822  36.822  1.00 28.48 ? 1728 LEU B N   1 
ATOM   1520 C  CA  . LEU B 2 5   ? 44.629 33.312  36.492  1.00 26.81 ? 1728 LEU B CA  1 
ATOM   1521 C  C   . LEU B 2 5   ? 43.835 34.212  35.547  1.00 25.29 ? 1728 LEU B C   1 
ATOM   1522 O  O   . LEU B 2 5   ? 43.293 33.723  34.552  1.00 21.21 ? 1728 LEU B O   1 
ATOM   1523 C  CB  . LEU B 2 5   ? 43.828 33.060  37.771  1.00 26.33 ? 1728 LEU B CB  1 
ATOM   1524 C  CG  . LEU B 2 5   ? 42.494 32.347  37.565  1.00 24.78 ? 1728 LEU B CG  1 
ATOM   1525 C  CD1 . LEU B 2 5   ? 42.730 31.013  36.888  1.00 27.88 ? 1728 LEU B CD1 1 
ATOM   1526 C  CD2 . LEU B 2 5   ? 41.809 32.150  38.900  1.00 28.32 ? 1728 LEU B CD2 1 
ATOM   1527 N  N   . PHE B 2 6   ? 43.788 35.517  35.837  1.00 23.19 ? 1729 PHE B N   1 
ATOM   1528 C  CA  . PHE B 2 6   ? 43.018 36.445  35.011  1.00 25.26 ? 1729 PHE B CA  1 
ATOM   1529 C  C   . PHE B 2 6   ? 43.820 37.281  34.014  1.00 26.00 ? 1729 PHE B C   1 
ATOM   1530 O  O   . PHE B 2 6   ? 43.272 38.210  33.405  1.00 25.08 ? 1729 PHE B O   1 
ATOM   1531 C  CB  . PHE B 2 6   ? 42.200 37.385  35.907  1.00 24.83 ? 1729 PHE B CB  1 
ATOM   1532 C  CG  . PHE B 2 6   ? 41.343 36.669  36.931  1.00 23.59 ? 1729 PHE B CG  1 
ATOM   1533 C  CD1 . PHE B 2 6   ? 41.804 36.471  38.238  1.00 22.97 ? 1729 PHE B CD1 1 
ATOM   1534 C  CD2 . PHE B 2 6   ? 40.087 36.178  36.585  1.00 19.13 ? 1729 PHE B CD2 1 
ATOM   1535 C  CE1 . PHE B 2 6   ? 41.023 35.796  39.176  1.00 17.72 ? 1729 PHE B CE1 1 
ATOM   1536 C  CE2 . PHE B 2 6   ? 39.304 35.503  37.515  1.00 16.71 ? 1729 PHE B CE2 1 
ATOM   1537 C  CZ  . PHE B 2 6   ? 39.773 35.312  38.814  1.00 17.61 ? 1729 PHE B CZ  1 
ATOM   1538 N  N   . LEU B 2 7   ? 45.106 36.959  33.848  1.00 24.76 ? 1730 LEU B N   1 
ATOM   1539 C  CA  . LEU B 2 7   ? 45.960 37.700  32.922  1.00 21.95 ? 1730 LEU B CA  1 
ATOM   1540 C  C   . LEU B 2 7   ? 45.302 37.726  31.539  1.00 23.98 ? 1730 LEU B C   1 
ATOM   1541 O  O   . LEU B 2 7   ? 44.754 36.714  31.087  1.00 23.78 ? 1730 LEU B O   1 
ATOM   1542 C  CB  . LEU B 2 7   ? 47.352 37.053  32.841  1.00 18.12 ? 1730 LEU B CB  1 
ATOM   1543 C  CG  . LEU B 2 7   ? 48.362 37.736  31.900  1.00 16.95 ? 1730 LEU B CG  1 
ATOM   1544 C  CD1 . LEU B 2 7   ? 48.834 39.027  32.516  1.00 13.52 ? 1730 LEU B CD1 1 
ATOM   1545 C  CD2 . LEU B 2 7   ? 49.546 36.811  31.631  1.00 15.19 ? 1730 LEU B CD2 1 
ATOM   1546 N  N   . GLY B 2 8   ? 45.346 38.884  30.884  1.00 23.58 ? 1731 GLY B N   1 
ATOM   1547 C  CA  . GLY B 2 8   ? 44.747 39.013  29.569  1.00 25.84 ? 1731 GLY B CA  1 
ATOM   1548 C  C   . GLY B 2 8   ? 43.341 39.593  29.625  1.00 29.25 ? 1731 GLY B C   1 
ATOM   1549 O  O   . GLY B 2 8   ? 42.798 40.032  28.596  1.00 32.18 ? 1731 GLY B O   1 
ATOM   1550 N  N   . TYR B 2 9   ? 42.743 39.591  30.817  1.00 28.11 ? 1732 TYR B N   1 
ATOM   1551 C  CA  . TYR B 2 9   ? 41.394 40.134  31.014  1.00 27.48 ? 1732 TYR B CA  1 
ATOM   1552 C  C   . TYR B 2 9   ? 41.420 41.510  31.647  1.00 24.94 ? 1732 TYR B C   1 
ATOM   1553 O  O   . TYR B 2 9   ? 42.286 41.793  32.468  1.00 25.06 ? 1732 TYR B O   1 
ATOM   1554 C  CB  . TYR B 2 9   ? 40.571 39.242  31.943  1.00 28.22 ? 1732 TYR B CB  1 
ATOM   1555 C  CG  . TYR B 2 9   ? 40.180 37.928  31.347  1.00 30.98 ? 1732 TYR B CG  1 
ATOM   1556 C  CD1 . TYR B 2 9   ? 41.146 37.002  30.968  1.00 35.86 ? 1732 TYR B CD1 1 
ATOM   1557 C  CD2 . TYR B 2 9   ? 38.844 37.608  31.147  1.00 33.80 ? 1732 TYR B CD2 1 
ATOM   1558 C  CE1 . TYR B 2 9   ? 40.787 35.781  30.398  1.00 37.04 ? 1732 TYR B CE1 1 
ATOM   1559 C  CE2 . TYR B 2 9   ? 38.474 36.390  30.577  1.00 35.32 ? 1732 TYR B CE2 1 
ATOM   1560 C  CZ  . TYR B 2 9   ? 39.449 35.487  30.207  1.00 35.67 ? 1732 TYR B CZ  1 
ATOM   1561 O  OH  . TYR B 2 9   ? 39.098 34.288  29.635  1.00 42.00 ? 1732 TYR B OH  1 
ATOM   1562 N  N   . ALA B 2 10  ? 40.463 42.354  31.270  1.00 24.51 ? 1733 ALA B N   1 
ATOM   1563 C  CA  . ALA B 2 10  ? 40.324 43.698  31.841  1.00 19.55 ? 1733 ALA B CA  1 
ATOM   1564 C  C   . ALA B 2 10  ? 38.925 43.682  32.465  1.00 22.52 ? 1733 ALA B C   1 
ATOM   1565 O  O   . ALA B 2 10  ? 38.028 42.979  31.972  1.00 19.44 ? 1733 ALA B O   1 
ATOM   1566 C  CB  . ALA B 2 10  ? 40.405 44.746  30.754  1.00 21.22 ? 1733 ALA B CB  1 
ATOM   1567 N  N   . PHE B 2 11  ? 38.715 44.451  33.530  1.00 24.45 ? 1734 PHE B N   1 
ATOM   1568 C  CA  . PHE B 2 11  ? 37.413 44.434  34.203  1.00 24.35 ? 1734 PHE B CA  1 
ATOM   1569 C  C   . PHE B 2 11  ? 36.816 45.785  34.582  1.00 26.84 ? 1734 PHE B C   1 
ATOM   1570 O  O   . PHE B 2 11  ? 37.530 46.751  34.880  1.00 30.89 ? 1734 PHE B O   1 
ATOM   1571 C  CB  . PHE B 2 11  ? 37.493 43.601  35.500  1.00 18.66 ? 1734 PHE B CB  1 
ATOM   1572 C  CG  . PHE B 2 11  ? 37.907 42.172  35.298  1.00 14.60 ? 1734 PHE B CG  1 
ATOM   1573 C  CD1 . PHE B 2 11  ? 36.955 41.178  35.056  1.00 14.40 ? 1734 PHE B CD1 1 
ATOM   1574 C  CD2 . PHE B 2 11  ? 39.252 41.806  35.385  1.00 13.12 ? 1734 PHE B CD2 1 
ATOM   1575 C  CE1 . PHE B 2 11  ? 37.335 39.823  34.906  1.00 6.73  ? 1734 PHE B CE1 1 
ATOM   1576 C  CE2 . PHE B 2 11  ? 39.651 40.461  35.238  1.00 8.61  ? 1734 PHE B CE2 1 
ATOM   1577 C  CZ  . PHE B 2 11  ? 38.684 39.469  34.999  1.00 8.17  ? 1734 PHE B CZ  1 
ATOM   1578 N  N   . LEU B 2 12  ? 35.489 45.817  34.590  1.00 26.13 ? 1735 LEU B N   1 
ATOM   1579 C  CA  . LEU B 2 12  ? 34.719 46.982  34.987  1.00 25.41 ? 1735 LEU B CA  1 
ATOM   1580 C  C   . LEU B 2 12  ? 33.844 46.401  36.087  1.00 26.31 ? 1735 LEU B C   1 
ATOM   1581 O  O   . LEU B 2 12  ? 33.308 45.302  35.930  1.00 29.84 ? 1735 LEU B O   1 
ATOM   1582 C  CB  . LEU B 2 12  ? 33.857 47.468  33.827  1.00 24.05 ? 1735 LEU B CB  1 
ATOM   1583 C  CG  . LEU B 2 12  ? 34.459 48.438  32.818  1.00 22.17 ? 1735 LEU B CG  1 
ATOM   1584 C  CD1 . LEU B 2 12  ? 33.911 48.155  31.425  1.00 23.67 ? 1735 LEU B CD1 1 
ATOM   1585 C  CD2 . LEU B 2 12  ? 34.114 49.849  33.243  1.00 18.70 ? 1735 LEU B CD2 1 
ATOM   1586 N  N   . LEU B 2 13  ? 33.718 47.108  37.199  1.00 24.31 ? 1736 LEU B N   1 
ATOM   1587 C  CA  . LEU B 2 13  ? 32.912 46.633  38.313  1.00 25.04 ? 1736 LEU B CA  1 
ATOM   1588 C  C   . LEU B 2 13  ? 31.783 47.626  38.518  1.00 26.02 ? 1736 LEU B C   1 
ATOM   1589 O  O   . LEU B 2 13  ? 31.977 48.820  38.300  1.00 28.28 ? 1736 LEU B O   1 
ATOM   1590 C  CB  . LEU B 2 13  ? 33.764 46.587  39.585  1.00 23.85 ? 1736 LEU B CB  1 
ATOM   1591 C  CG  . LEU B 2 13  ? 34.904 45.578  39.703  1.00 21.44 ? 1736 LEU B CG  1 
ATOM   1592 C  CD1 . LEU B 2 13  ? 34.335 44.199  39.899  1.00 18.94 ? 1736 LEU B CD1 1 
ATOM   1593 C  CD2 . LEU B 2 13  ? 35.799 45.640  38.490  1.00 21.26 ? 1736 LEU B CD2 1 
ATOM   1594 N  N   . THR B 2 14  ? 30.619 47.153  38.951  1.00 27.13 ? 1737 THR B N   1 
ATOM   1595 C  CA  . THR B 2 14  ? 29.503 48.054  39.189  1.00 27.68 ? 1737 THR B CA  1 
ATOM   1596 C  C   . THR B 2 14  ? 28.539 47.544  40.256  1.00 30.29 ? 1737 THR B C   1 
ATOM   1597 O  O   . THR B 2 14  ? 28.240 46.354  40.314  1.00 30.10 ? 1737 THR B O   1 
ATOM   1598 C  CB  . THR B 2 14  ? 28.720 48.286  37.910  1.00 26.61 ? 1737 THR B CB  1 
ATOM   1599 O  OG1 . THR B 2 14  ? 27.817 49.380  38.111  1.00 28.01 ? 1737 THR B OG1 1 
ATOM   1600 C  CG2 . THR B 2 14  ? 27.921 47.028  37.538  1.00 27.96 ? 1737 THR B CG2 1 
ATOM   1601 N  N   . MET B 2 15  ? 28.061 48.454  41.099  1.00 35.22 ? 1738 MET B N   1 
ATOM   1602 C  CA  . MET B 2 15  ? 27.115 48.112  42.165  1.00 40.66 ? 1738 MET B CA  1 
ATOM   1603 C  C   . MET B 2 15  ? 25.698 48.537  41.772  1.00 42.30 ? 1738 MET B C   1 
ATOM   1604 O  O   . MET B 2 15  ? 25.482 49.670  41.334  1.00 43.19 ? 1738 MET B O   1 
ATOM   1605 C  CB  . MET B 2 15  ? 27.476 48.837  43.469  1.00 41.30 ? 1738 MET B CB  1 
ATOM   1606 C  CG  . MET B 2 15  ? 28.685 48.308  44.199  1.00 42.36 ? 1738 MET B CG  1 
ATOM   1607 S  SD  . MET B 2 15  ? 28.303 46.744  44.981  1.00 46.63 ? 1738 MET B SD  1 
ATOM   1608 C  CE  . MET B 2 15  ? 27.222 47.284  46.282  1.00 47.44 ? 1738 MET B CE  1 
ATOM   1609 N  N   . ALA B 2 16  ? 24.735 47.636  41.932  1.00 41.76 ? 1739 ALA B N   1 
ATOM   1610 C  CA  . ALA B 2 16  ? 23.357 47.968  41.618  1.00 42.86 ? 1739 ALA B CA  1 
ATOM   1611 C  C   . ALA B 2 16  ? 22.971 49.159  42.491  1.00 45.14 ? 1739 ALA B C   1 
ATOM   1612 O  O   . ALA B 2 16  ? 23.147 49.123  43.713  1.00 46.53 ? 1739 ALA B O   1 
ATOM   1613 C  CB  . ALA B 2 16  ? 22.449 46.783  41.923  1.00 40.80 ? 1739 ALA B CB  1 
ATOM   1614 N  N   . THR B 2 17  ? 22.468 50.223  41.866  1.00 46.48 ? 1740 THR B N   1 
ATOM   1615 C  CA  . THR B 2 17  ? 22.045 51.400  42.617  1.00 46.33 ? 1740 THR B CA  1 
ATOM   1616 C  C   . THR B 2 17  ? 20.996 50.948  43.628  1.00 47.16 ? 1740 THR B C   1 
ATOM   1617 O  O   . THR B 2 17  ? 20.516 49.811  43.580  1.00 45.92 ? 1740 THR B O   1 
ATOM   1618 C  CB  . THR B 2 17  ? 21.412 52.478  41.710  1.00 45.70 ? 1740 THR B CB  1 
ATOM   1619 O  OG1 . THR B 2 17  ? 20.167 51.995  41.187  1.00 43.86 ? 1740 THR B OG1 1 
ATOM   1620 C  CG2 . THR B 2 17  ? 22.358 52.837  40.563  1.00 43.99 ? 1740 THR B CG2 1 
ATOM   1621 N  N   . THR B 2 18  ? 20.628 51.838  44.540  1.00 49.15 ? 1741 THR B N   1 
ATOM   1622 C  CA  . THR B 2 18  ? 19.656 51.471  45.553  1.00 50.21 ? 1741 THR B CA  1 
ATOM   1623 C  C   . THR B 2 18  ? 18.251 51.271  44.970  1.00 51.23 ? 1741 THR B C   1 
ATOM   1624 O  O   . THR B 2 18  ? 17.451 50.503  45.512  1.00 51.04 ? 1741 THR B O   1 
ATOM   1625 C  CB  . THR B 2 18  ? 19.635 52.511  46.695  1.00 47.57 ? 1741 THR B CB  1 
ATOM   1626 O  OG1 . THR B 2 18  ? 18.750 52.063  47.730  1.00 47.55 ? 1741 THR B OG1 1 
ATOM   1627 C  CG2 . THR B 2 18  ? 19.198 53.863  46.184  1.00 44.07 ? 1741 THR B CG2 1 
ATOM   1628 N  N   . SER B 2 19  ? 17.952 51.939  43.862  1.00 52.04 ? 1742 SER B N   1 
ATOM   1629 C  CA  . SER B 2 19  ? 16.638 51.779  43.252  1.00 53.57 ? 1742 SER B CA  1 
ATOM   1630 C  C   . SER B 2 19  ? 16.625 50.450  42.513  1.00 54.02 ? 1742 SER B C   1 
ATOM   1631 O  O   . SER B 2 19  ? 15.574 49.825  42.358  1.00 53.23 ? 1742 SER B O   1 
ATOM   1632 C  CB  . SER B 2 19  ? 16.335 52.921  42.275  1.00 55.51 ? 1742 SER B CB  1 
ATOM   1633 O  OG  . SER B 2 19  ? 16.800 52.630  40.970  1.00 56.89 ? 1742 SER B OG  1 
ATOM   1634 N  N   . ASP B 2 20  ? 17.798 50.017  42.054  1.00 55.12 ? 1743 ASP B N   1 
ATOM   1635 C  CA  . ASP B 2 20  ? 17.891 48.741  41.353  1.00 57.13 ? 1743 ASP B CA  1 
ATOM   1636 C  C   . ASP B 2 20  ? 17.588 47.617  42.336  1.00 58.89 ? 1743 ASP B C   1 
ATOM   1637 O  O   . ASP B 2 20  ? 16.836 46.693  42.030  1.00 59.91 ? 1743 ASP B O   1 
ATOM   1638 C  CB  . ASP B 2 20  ? 19.290 48.537  40.754  1.00 56.53 ? 1743 ASP B CB  1 
ATOM   1639 C  CG  . ASP B 2 20  ? 19.480 49.271  39.435  1.00 57.06 ? 1743 ASP B CG  1 
ATOM   1640 O  OD1 . ASP B 2 20  ? 18.613 49.122  38.544  1.00 56.57 ? 1743 ASP B OD1 1 
ATOM   1641 O  OD2 . ASP B 2 20  ? 20.498 49.986  39.285  1.00 57.44 ? 1743 ASP B OD2 1 
ATOM   1642 N  N   . LYS B 2 21  ? 18.174 47.709  43.525  1.00 61.76 ? 1744 LYS B N   1 
ATOM   1643 C  CA  . LYS B 2 21  ? 17.968 46.701  44.555  1.00 64.17 ? 1744 LYS B CA  1 
ATOM   1644 C  C   . LYS B 2 21  ? 16.554 46.834  45.112  1.00 65.98 ? 1744 LYS B C   1 
ATOM   1645 O  O   . LYS B 2 21  ? 15.911 45.837  45.448  1.00 67.09 ? 1744 LYS B O   1 
ATOM   1646 C  CB  . LYS B 2 21  ? 18.994 46.874  45.681  1.00 64.56 ? 1744 LYS B CB  1 
ATOM   1647 C  CG  . LYS B 2 21  ? 20.438 47.010  45.194  1.00 64.62 ? 1744 LYS B CG  1 
ATOM   1648 C  CD  . LYS B 2 21  ? 21.443 46.761  46.307  1.00 63.17 ? 1744 LYS B CD  1 
ATOM   1649 C  CE  . LYS B 2 21  ? 21.307 45.342  46.852  1.00 64.48 ? 1744 LYS B CE  1 
ATOM   1650 N  NZ  . LYS B 2 21  ? 21.502 44.306  45.800  1.00 62.10 ? 1744 LYS B NZ  1 
ATOM   1651 N  N   . LEU B 2 22  ? 16.073 48.072  45.190  1.00 67.28 ? 1745 LEU B N   1 
ATOM   1652 C  CA  . LEU B 2 22  ? 14.737 48.354  45.708  1.00 69.35 ? 1745 LEU B CA  1 
ATOM   1653 C  C   . LEU B 2 22  ? 13.679 47.487  45.024  1.00 71.31 ? 1745 LEU B C   1 
ATOM   1654 O  O   . LEU B 2 22  ? 12.915 46.791  45.694  1.00 72.21 ? 1745 LEU B O   1 
ATOM   1655 C  CB  . LEU B 2 22  ? 14.400 49.837  45.517  1.00 68.00 ? 1745 LEU B CB  1 
ATOM   1656 C  CG  . LEU B 2 22  ? 13.268 50.409  46.381  1.00 67.72 ? 1745 LEU B CG  1 
ATOM   1657 C  CD1 . LEU B 2 22  ? 11.927 49.775  46.021  1.00 66.93 ? 1745 LEU B CD1 1 
ATOM   1658 C  CD2 . LEU B 2 22  ? 13.607 50.168  47.849  1.00 67.83 ? 1745 LEU B CD2 1 
ATOM   1659 N  N   . ALA B 2 23  ? 13.634 47.540  43.694  1.00 73.14 ? 1746 ALA B N   1 
ATOM   1660 C  CA  . ALA B 2 23  ? 12.679 46.747  42.925  1.00 74.74 ? 1746 ALA B CA  1 
ATOM   1661 C  C   . ALA B 2 23  ? 12.998 45.265  43.108  1.00 76.67 ? 1746 ALA B C   1 
ATOM   1662 O  O   . ALA B 2 23  ? 13.532 44.621  42.206  1.00 75.54 ? 1746 ALA B O   1 
ATOM   1663 C  CB  . ALA B 2 23  ? 12.751 47.123  41.449  1.00 73.00 ? 1746 ALA B CB  1 
ATOM   1664 N  N   . SER B 2 24  ? 12.662 44.743  44.289  1.00 80.28 ? 1747 SER B N   1 
ATOM   1665 C  CA  . SER B 2 24  ? 12.898 43.344  44.654  1.00 82.83 ? 1747 SER B CA  1 
ATOM   1666 C  C   . SER B 2 24  ? 11.826 42.434  44.044  1.00 85.27 ? 1747 SER B C   1 
ATOM   1667 O  O   . SER B 2 24  ? 12.148 41.428  43.405  1.00 85.87 ? 1747 SER B O   1 
ATOM   1668 C  CB  . SER B 2 24  ? 12.912 43.205  46.189  1.00 81.85 ? 1747 SER B CB  1 
ATOM   1669 O  OG  . SER B 2 24  ? 13.391 41.936  46.615  1.00 79.73 ? 1747 SER B OG  1 
ATOM   1670 N  N   . ARG B 2 25  ? 10.557 42.791  44.246  1.00 88.13 ? 1748 ARG B N   1 
ATOM   1671 C  CA  . ARG B 2 25  ? 9.431  42.023  43.704  1.00 90.06 ? 1748 ARG B CA  1 
ATOM   1672 C  C   . ARG B 2 25  ? 8.870  42.688  42.441  1.00 91.28 ? 1748 ARG B C   1 
ATOM   1673 O  O   . ARG B 2 25  ? 8.289  42.016  41.580  1.00 91.98 ? 1748 ARG B O   1 
ATOM   1674 C  CB  . ARG B 2 25  ? 8.318  41.889  44.755  1.00 89.95 ? 1748 ARG B CB  1 
ATOM   1675 C  CG  . ARG B 2 25  ? 6.939  41.566  44.173  1.00 90.10 ? 1748 ARG B CG  1 
ATOM   1676 C  CD  . ARG B 2 25  ? 5.906  41.328  45.269  1.00 90.67 ? 1748 ARG B CD  1 
ATOM   1677 N  NE  . ARG B 2 25  ? 4.528  41.419  44.782  1.00 90.55 ? 1748 ARG B NE  1 
ATOM   1678 C  CZ  . ARG B 2 25  ? 3.895  42.561  44.520  1.00 90.25 ? 1748 ARG B CZ  1 
ATOM   1679 N  NH1 . ARG B 2 25  ? 2.643  42.542  44.081  1.00 89.90 ? 1748 ARG B NH1 1 
ATOM   1680 N  NH2 . ARG B 2 25  ? 4.504  43.726  44.705  1.00 90.10 ? 1748 ARG B NH2 1 
ATOM   1681 N  N   . SER B 2 26  ? 9.058  44.004  42.345  1.00 91.12 ? 1749 SER B N   1 
ATOM   1682 C  CA  . SER B 2 26  ? 8.584  44.800  41.213  1.00 91.00 ? 1749 SER B CA  1 
ATOM   1683 C  C   . SER B 2 26  ? 7.102  44.562  40.927  1.00 90.85 ? 1749 SER B C   1 
ATOM   1684 O  O   . SER B 2 26  ? 6.233  45.245  41.473  1.00 90.22 ? 1749 SER B O   1 
ATOM   1685 C  CB  . SER B 2 26  ? 9.419  44.498  39.956  1.00 91.10 ? 1749 SER B CB  1 
ATOM   1686 O  OG  . SER B 2 26  ? 9.300  43.143  39.554  1.00 92.00 ? 1749 SER B OG  1 
ATOM   1687 N  N   . PRO B 2 46  ? 29.184 34.590  49.631  1.00 46.04 ? 1769 PRO B N   1 
ATOM   1688 C  CA  . PRO B 2 46  ? 29.368 35.925  50.220  1.00 47.79 ? 1769 PRO B CA  1 
ATOM   1689 C  C   . PRO B 2 46  ? 28.827 37.070  49.347  1.00 48.36 ? 1769 PRO B C   1 
ATOM   1690 O  O   . PRO B 2 46  ? 29.055 37.104  48.136  1.00 48.16 ? 1769 PRO B O   1 
ATOM   1691 C  CB  . PRO B 2 46  ? 30.886 36.009  50.428  1.00 47.48 ? 1769 PRO B CB  1 
ATOM   1692 C  CG  . PRO B 2 46  ? 31.430 35.123  49.325  1.00 47.84 ? 1769 PRO B CG  1 
ATOM   1693 C  CD  . PRO B 2 46  ? 30.481 33.938  49.375  1.00 45.93 ? 1769 PRO B CD  1 
ATOM   1694 N  N   . PRO B 2 47  ? 28.105 38.028  49.957  1.00 47.86 ? 1770 PRO B N   1 
ATOM   1695 C  CA  . PRO B 2 47  ? 27.571 39.137  49.162  1.00 44.81 ? 1770 PRO B CA  1 
ATOM   1696 C  C   . PRO B 2 47  ? 28.685 39.789  48.357  1.00 42.16 ? 1770 PRO B C   1 
ATOM   1697 O  O   . PRO B 2 47  ? 29.854 39.761  48.746  1.00 41.07 ? 1770 PRO B O   1 
ATOM   1698 C  CB  . PRO B 2 47  ? 26.990 40.078  50.218  1.00 45.67 ? 1770 PRO B CB  1 
ATOM   1699 C  CG  . PRO B 2 47  ? 26.613 39.152  51.335  1.00 47.39 ? 1770 PRO B CG  1 
ATOM   1700 C  CD  . PRO B 2 47  ? 27.805 38.219  51.389  1.00 48.60 ? 1770 PRO B CD  1 
ATOM   1701 N  N   . PHE B 2 48  ? 28.308 40.384  47.236  1.00 39.66 ? 1771 PHE B N   1 
ATOM   1702 C  CA  . PHE B 2 48  ? 29.251 41.036  46.340  1.00 38.23 ? 1771 PHE B CA  1 
ATOM   1703 C  C   . PHE B 2 48  ? 29.931 42.274  46.933  1.00 38.07 ? 1771 PHE B C   1 
ATOM   1704 O  O   . PHE B 2 48  ? 29.277 43.182  47.432  1.00 39.08 ? 1771 PHE B O   1 
ATOM   1705 C  CB  . PHE B 2 48  ? 28.525 41.390  45.030  1.00 37.05 ? 1771 PHE B CB  1 
ATOM   1706 C  CG  . PHE B 2 48  ? 29.388 42.104  44.014  1.00 35.41 ? 1771 PHE B CG  1 
ATOM   1707 C  CD1 . PHE B 2 48  ? 30.619 41.577  43.626  1.00 33.48 ? 1771 PHE B CD1 1 
ATOM   1708 C  CD2 . PHE B 2 48  ? 28.975 43.317  43.464  1.00 32.52 ? 1771 PHE B CD2 1 
ATOM   1709 C  CE1 . PHE B 2 48  ? 31.427 42.249  42.709  1.00 33.70 ? 1771 PHE B CE1 1 
ATOM   1710 C  CE2 . PHE B 2 48  ? 29.774 43.995  42.549  1.00 33.66 ? 1771 PHE B CE2 1 
ATOM   1711 C  CZ  . PHE B 2 48  ? 31.005 43.463  42.168  1.00 32.54 ? 1771 PHE B CZ  1 
ATOM   1712 N  N   . ASN B 2 49  ? 31.257 42.297  46.893  1.00 38.69 ? 1772 ASN B N   1 
ATOM   1713 C  CA  . ASN B 2 49  ? 32.002 43.448  47.388  1.00 38.60 ? 1772 ASN B CA  1 
ATOM   1714 C  C   . ASN B 2 49  ? 33.065 43.867  46.377  1.00 38.60 ? 1772 ASN B C   1 
ATOM   1715 O  O   . ASN B 2 49  ? 34.082 43.192  46.169  1.00 39.98 ? 1772 ASN B O   1 
ATOM   1716 C  CB  . ASN B 2 49  ? 32.643 43.171  48.741  1.00 41.29 ? 1772 ASN B CB  1 
ATOM   1717 C  CG  . ASN B 2 49  ? 33.419 44.370  49.268  1.00 41.72 ? 1772 ASN B CG  1 
ATOM   1718 O  OD1 . ASN B 2 49  ? 34.546 44.634  48.838  1.00 42.09 ? 1772 ASN B OD1 1 
ATOM   1719 N  ND2 . ASN B 2 49  ? 32.811 45.111  50.194  1.00 40.80 ? 1772 ASN B ND2 1 
ATOM   1720 N  N   . LYS B 2 50  ? 32.792 44.997  45.745  1.00 37.49 ? 1773 LYS B N   1 
ATOM   1721 C  CA  . LYS B 2 50  ? 33.640 45.587  44.721  1.00 37.66 ? 1773 LYS B CA  1 
ATOM   1722 C  C   . LYS B 2 50  ? 35.128 45.514  45.061  1.00 38.29 ? 1773 LYS B C   1 
ATOM   1723 O  O   . LYS B 2 50  ? 35.926 45.001  44.283  1.00 38.91 ? 1773 LYS B O   1 
ATOM   1724 C  CB  . LYS B 2 50  ? 33.215 47.051  44.526  1.00 38.52 ? 1773 LYS B CB  1 
ATOM   1725 C  CG  . LYS B 2 50  ? 33.167 47.569  43.091  1.00 40.88 ? 1773 LYS B CG  1 
ATOM   1726 C  CD  . LYS B 2 50  ? 32.491 48.945  43.063  1.00 44.22 ? 1773 LYS B CD  1 
ATOM   1727 C  CE  . LYS B 2 50  ? 32.462 49.557  41.673  1.00 47.05 ? 1773 LYS B CE  1 
ATOM   1728 N  NZ  . LYS B 2 50  ? 33.827 49.809  41.114  1.00 50.34 ? 1773 LYS B NZ  1 
ATOM   1729 N  N   . GLN B 2 51  ? 35.499 46.029  46.228  1.00 38.52 ? 1774 GLN B N   1 
ATOM   1730 C  CA  . GLN B 2 51  ? 36.901 46.040  46.647  1.00 38.67 ? 1774 GLN B CA  1 
ATOM   1731 C  C   . GLN B 2 51  ? 37.496 44.650  46.790  1.00 36.19 ? 1774 GLN B C   1 
ATOM   1732 O  O   . GLN B 2 51  ? 38.653 44.418  46.439  1.00 34.96 ? 1774 GLN B O   1 
ATOM   1733 C  CB  . GLN B 2 51  ? 37.064 46.780  47.981  1.00 39.52 ? 1774 GLN B CB  1 
ATOM   1734 C  CG  . GLN B 2 51  ? 36.735 48.268  47.939  1.00 44.23 ? 1774 GLN B CG  1 
ATOM   1735 C  CD  . GLN B 2 51  ? 35.300 48.563  47.474  1.00 45.30 ? 1774 GLN B CD  1 
ATOM   1736 O  OE1 . GLN B 2 51  ? 35.050 48.789  46.284  1.00 44.40 ? 1774 GLN B OE1 1 
ATOM   1737 N  NE2 . GLN B 2 51  ? 34.358 48.553  48.416  1.00 44.22 ? 1774 GLN B NE2 1 
ATOM   1738 N  N   . TYR B 2 52  ? 36.713 43.728  47.329  1.00 35.21 ? 1775 TYR B N   1 
ATOM   1739 C  CA  . TYR B 2 52  ? 37.198 42.375  47.513  1.00 34.58 ? 1775 TYR B CA  1 
ATOM   1740 C  C   . TYR B 2 52  ? 37.448 41.732  46.156  1.00 32.66 ? 1775 TYR B C   1 
ATOM   1741 O  O   . TYR B 2 52  ? 38.555 41.276  45.878  1.00 34.10 ? 1775 TYR B O   1 
ATOM   1742 C  CB  . TYR B 2 52  ? 36.183 41.557  48.305  1.00 36.09 ? 1775 TYR B CB  1 
ATOM   1743 C  CG  . TYR B 2 52  ? 36.691 40.181  48.630  1.00 41.53 ? 1775 TYR B CG  1 
ATOM   1744 C  CD1 . TYR B 2 52  ? 37.804 40.010  49.458  1.00 42.94 ? 1775 TYR B CD1 1 
ATOM   1745 C  CD2 . TYR B 2 52  ? 36.078 39.044  48.103  1.00 43.33 ? 1775 TYR B CD2 1 
ATOM   1746 C  CE1 . TYR B 2 52  ? 38.296 38.741  49.759  1.00 44.46 ? 1775 TYR B CE1 1 
ATOM   1747 C  CE2 . TYR B 2 52  ? 36.561 37.764  48.397  1.00 46.60 ? 1775 TYR B CE2 1 
ATOM   1748 C  CZ  . TYR B 2 52  ? 37.669 37.621  49.228  1.00 47.00 ? 1775 TYR B CZ  1 
ATOM   1749 O  OH  . TYR B 2 52  ? 38.136 36.363  49.546  1.00 49.14 ? 1775 TYR B OH  1 
ATOM   1750 N  N   . THR B 2 53  ? 36.425 41.709  45.306  1.00 30.07 ? 1776 THR B N   1 
ATOM   1751 C  CA  . THR B 2 53  ? 36.568 41.118  43.979  1.00 30.33 ? 1776 THR B CA  1 
ATOM   1752 C  C   . THR B 2 53  ? 37.763 41.713  43.220  1.00 29.67 ? 1776 THR B C   1 
ATOM   1753 O  O   . THR B 2 53  ? 38.529 40.986  42.569  1.00 28.90 ? 1776 THR B O   1 
ATOM   1754 C  CB  . THR B 2 53  ? 35.262 41.279  43.164  1.00 29.75 ? 1776 THR B CB  1 
ATOM   1755 O  OG1 . THR B 2 53  ? 34.237 40.459  43.753  1.00 29.54 ? 1776 THR B OG1 1 
ATOM   1756 C  CG2 . THR B 2 53  ? 35.471 40.854  41.708  1.00 28.47 ? 1776 THR B CG2 1 
ATOM   1757 N  N   . GLU B 2 54  ? 37.928 43.029  43.312  1.00 30.41 ? 1777 GLU B N   1 
ATOM   1758 C  CA  . GLU B 2 54  ? 39.048 43.693  42.658  1.00 31.94 ? 1777 GLU B CA  1 
ATOM   1759 C  C   . GLU B 2 54  ? 40.341 43.062  43.169  1.00 32.62 ? 1777 GLU B C   1 
ATOM   1760 O  O   . GLU B 2 54  ? 41.257 42.776  42.385  1.00 31.53 ? 1777 GLU B O   1 
ATOM   1761 C  CB  . GLU B 2 54  ? 39.058 45.198  42.971  1.00 31.59 ? 1777 GLU B CB  1 
ATOM   1762 C  CG  . GLU B 2 54  ? 37.969 46.020  42.274  1.00 33.85 ? 1777 GLU B CG  1 
ATOM   1763 C  CD  . GLU B 2 54  ? 38.066 47.495  42.613  1.00 33.42 ? 1777 GLU B CD  1 
ATOM   1764 O  OE1 . GLU B 2 54  ? 39.179 48.043  42.516  1.00 35.96 ? 1777 GLU B OE1 1 
ATOM   1765 O  OE2 . GLU B 2 54  ? 37.043 48.114  42.979  1.00 37.47 ? 1777 GLU B OE2 1 
ATOM   1766 N  N   . SER B 2 55  ? 40.414 42.835  44.480  1.00 33.99 ? 1778 SER B N   1 
ATOM   1767 C  CA  . SER B 2 55  ? 41.620 42.248  45.064  1.00 36.73 ? 1778 SER B CA  1 
ATOM   1768 C  C   . SER B 2 55  ? 41.871 40.853  44.489  1.00 34.04 ? 1778 SER B C   1 
ATOM   1769 O  O   . SER B 2 55  ? 43.007 40.522  44.138  1.00 33.72 ? 1778 SER B O   1 
ATOM   1770 C  CB  . SER B 2 55  ? 41.530 42.197  46.600  1.00 38.85 ? 1778 SER B CB  1 
ATOM   1771 O  OG  . SER B 2 55  ? 40.628 41.197  47.053  1.00 44.93 ? 1778 SER B OG  1 
ATOM   1772 N  N   . GLN B 2 56  ? 40.822 40.042  44.382  1.00 32.28 ? 1779 GLN B N   1 
ATOM   1773 C  CA  . GLN B 2 56  ? 40.973 38.708  43.804  1.00 34.37 ? 1779 GLN B CA  1 
ATOM   1774 C  C   . GLN B 2 56  ? 41.440 38.830  42.342  1.00 32.65 ? 1779 GLN B C   1 
ATOM   1775 O  O   . GLN B 2 56  ? 42.306 38.073  41.886  1.00 30.65 ? 1779 GLN B O   1 
ATOM   1776 C  CB  . GLN B 2 56  ? 39.644 37.937  43.832  1.00 35.38 ? 1779 GLN B CB  1 
ATOM   1777 C  CG  . GLN B 2 56  ? 38.999 37.826  45.193  1.00 41.00 ? 1779 GLN B CG  1 
ATOM   1778 C  CD  . GLN B 2 56  ? 38.081 36.618  45.303  1.00 45.25 ? 1779 GLN B CD  1 
ATOM   1779 O  OE1 . GLN B 2 56  ? 38.545 35.489  45.484  1.00 47.00 ? 1779 GLN B OE1 1 
ATOM   1780 N  NE2 . GLN B 2 56  ? 36.773 36.847  45.182  1.00 49.20 ? 1779 GLN B NE2 1 
ATOM   1781 N  N   . LEU B 2 57  ? 40.862 39.787  41.617  1.00 28.92 ? 1780 LEU B N   1 
ATOM   1782 C  CA  . LEU B 2 57  ? 41.205 39.981  40.221  1.00 26.46 ? 1780 LEU B CA  1 
ATOM   1783 C  C   . LEU B 2 57  ? 42.657 40.391  40.034  1.00 27.60 ? 1780 LEU B C   1 
ATOM   1784 O  O   . LEU B 2 57  ? 43.363 39.815  39.207  1.00 27.08 ? 1780 LEU B O   1 
ATOM   1785 C  CB  . LEU B 2 57  ? 40.250 41.001  39.601  1.00 22.84 ? 1780 LEU B CB  1 
ATOM   1786 C  CG  . LEU B 2 57  ? 38.846 40.398  39.523  1.00 21.50 ? 1780 LEU B CG  1 
ATOM   1787 C  CD1 . LEU B 2 57  ? 37.818 41.465  39.195  1.00 14.63 ? 1780 LEU B CD1 1 
ATOM   1788 C  CD2 . LEU B 2 57  ? 38.856 39.265  38.478  1.00 19.15 ? 1780 LEU B CD2 1 
ATOM   1789 N  N   . ARG B 2 58  ? 43.106 41.377  40.806  1.00 29.08 ? 1781 ARG B N   1 
ATOM   1790 C  CA  . ARG B 2 58  ? 44.487 41.842  40.719  1.00 29.53 ? 1781 ARG B CA  1 
ATOM   1791 C  C   . ARG B 2 58  ? 45.456 40.707  41.060  1.00 29.81 ? 1781 ARG B C   1 
ATOM   1792 O  O   . ARG B 2 58  ? 46.503 40.533  40.422  1.00 28.64 ? 1781 ARG B O   1 
ATOM   1793 C  CB  . ARG B 2 58  ? 44.717 42.992  41.699  1.00 27.75 ? 1781 ARG B CB  1 
ATOM   1794 C  CG  . ARG B 2 58  ? 43.961 44.256  41.363  1.00 30.71 ? 1781 ARG B CG  1 
ATOM   1795 C  CD  . ARG B 2 58  ? 44.909 45.411  41.015  1.00 28.47 ? 1781 ARG B CD  1 
ATOM   1796 N  NE  . ARG B 2 58  ? 44.160 46.648  40.822  1.00 27.38 ? 1781 ARG B NE  1 
ATOM   1797 C  CZ  . ARG B 2 58  ? 43.317 47.146  41.724  1.00 28.12 ? 1781 ARG B CZ  1 
ATOM   1798 N  NH1 . ARG B 2 58  ? 42.660 48.278  41.474  1.00 28.52 ? 1781 ARG B NH1 1 
ATOM   1799 N  NH2 . ARG B 2 58  ? 43.135 46.514  42.881  1.00 22.74 ? 1781 ARG B NH2 1 
ATOM   1800 N  N   . ALA B 2 59  ? 45.103 39.938  42.082  1.00 29.39 ? 1782 ALA B N   1 
ATOM   1801 C  CA  . ALA B 2 59  ? 45.949 38.834  42.516  1.00 29.54 ? 1782 ALA B CA  1 
ATOM   1802 C  C   . ALA B 2 59  ? 46.217 37.858  41.374  1.00 29.70 ? 1782 ALA B C   1 
ATOM   1803 O  O   . ALA B 2 59  ? 47.187 37.096  41.412  1.00 32.38 ? 1782 ALA B O   1 
ATOM   1804 C  CB  . ALA B 2 59  ? 45.300 38.110  43.684  1.00 23.97 ? 1782 ALA B CB  1 
ATOM   1805 N  N   . GLY B 2 60  ? 45.357 37.884  40.360  1.00 28.94 ? 1783 GLY B N   1 
ATOM   1806 C  CA  . GLY B 2 60  ? 45.528 36.999  39.219  1.00 25.72 ? 1783 GLY B CA  1 
ATOM   1807 C  C   . GLY B 2 60  ? 45.931 37.745  37.957  1.00 25.61 ? 1783 GLY B C   1 
ATOM   1808 O  O   . GLY B 2 60  ? 45.626 37.308  36.842  1.00 25.85 ? 1783 GLY B O   1 
ATOM   1809 N  N   . ALA B 2 61  ? 46.609 38.876  38.140  1.00 23.80 ? 1784 ALA B N   1 
ATOM   1810 C  CA  . ALA B 2 61  ? 47.077 39.712  37.041  1.00 23.99 ? 1784 ALA B CA  1 
ATOM   1811 C  C   . ALA B 2 61  ? 45.939 40.320  36.230  1.00 27.02 ? 1784 ALA B C   1 
ATOM   1812 O  O   . ALA B 2 61  ? 46.135 40.726  35.074  1.00 30.20 ? 1784 ALA B O   1 
ATOM   1813 C  CB  . ALA B 2 61  ? 48.006 38.921  36.133  1.00 21.41 ? 1784 ALA B CB  1 
ATOM   1814 N  N   . GLY B 2 62  ? 44.751 40.383  36.828  1.00 25.59 ? 1785 GLY B N   1 
ATOM   1815 C  CA  . GLY B 2 62  ? 43.624 40.985  36.140  1.00 26.45 ? 1785 GLY B CA  1 
ATOM   1816 C  C   . GLY B 2 62  ? 43.823 42.493  36.091  1.00 28.04 ? 1785 GLY B C   1 
ATOM   1817 O  O   . GLY B 2 62  ? 44.315 43.099  37.044  1.00 27.22 ? 1785 GLY B O   1 
ATOM   1818 N  N   . TYR B 2 63  ? 43.452 43.101  34.975  1.00 28.32 ? 1786 TYR B N   1 
ATOM   1819 C  CA  . TYR B 2 63  ? 43.592 44.538  34.793  1.00 29.62 ? 1786 TYR B CA  1 
ATOM   1820 C  C   . TYR B 2 63  ? 42.283 45.211  35.225  1.00 28.25 ? 1786 TYR B C   1 
ATOM   1821 O  O   . TYR B 2 63  ? 41.208 44.873  34.726  1.00 28.68 ? 1786 TYR B O   1 
ATOM   1822 C  CB  . TYR B 2 63  ? 43.895 44.784  33.312  1.00 33.29 ? 1786 TYR B CB  1 
ATOM   1823 C  CG  . TYR B 2 63  ? 44.174 46.204  32.897  1.00 36.30 ? 1786 TYR B CG  1 
ATOM   1824 C  CD1 . TYR B 2 63  ? 44.084 47.255  33.800  1.00 38.22 ? 1786 TYR B CD1 1 
ATOM   1825 C  CD2 . TYR B 2 63  ? 44.511 46.495  31.571  1.00 41.53 ? 1786 TYR B CD2 1 
ATOM   1826 C  CE1 . TYR B 2 63  ? 44.316 48.569  33.396  1.00 40.92 ? 1786 TYR B CE1 1 
ATOM   1827 C  CE2 . TYR B 2 63  ? 44.750 47.803  31.152  1.00 42.52 ? 1786 TYR B CE2 1 
ATOM   1828 C  CZ  . TYR B 2 63  ? 44.647 48.838  32.070  1.00 42.78 ? 1786 TYR B CZ  1 
ATOM   1829 O  OH  . TYR B 2 63  ? 44.851 50.141  31.660  1.00 43.25 ? 1786 TYR B OH  1 
ATOM   1830 N  N   . ILE B 2 64  ? 42.361 46.155  36.155  1.00 27.26 ? 1787 ILE B N   1 
ATOM   1831 C  CA  . ILE B 2 64  ? 41.151 46.843  36.619  1.00 25.72 ? 1787 ILE B CA  1 
ATOM   1832 C  C   . ILE B 2 64  ? 40.927 48.167  35.890  1.00 28.20 ? 1787 ILE B C   1 
ATOM   1833 O  O   . ILE B 2 64  ? 41.772 49.053  35.944  1.00 30.94 ? 1787 ILE B O   1 
ATOM   1834 C  CB  . ILE B 2 64  ? 41.211 47.170  38.142  1.00 22.56 ? 1787 ILE B CB  1 
ATOM   1835 C  CG1 . ILE B 2 64  ? 41.295 45.884  38.976  1.00 19.04 ? 1787 ILE B CG1 1 
ATOM   1836 C  CG2 . ILE B 2 64  ? 40.019 48.014  38.539  1.00 20.42 ? 1787 ILE B CG2 1 
ATOM   1837 C  CD1 . ILE B 2 64  ? 40.129 44.940  38.822  1.00 15.67 ? 1787 ILE B CD1 1 
ATOM   1838 N  N   . LEU B 2 65  ? 39.791 48.305  35.213  1.00 29.21 ? 1788 LEU B N   1 
ATOM   1839 C  CA  . LEU B 2 65  ? 39.477 49.550  34.519  1.00 30.92 ? 1788 LEU B CA  1 
ATOM   1840 C  C   . LEU B 2 65  ? 38.647 50.414  35.475  1.00 33.96 ? 1788 LEU B C   1 
ATOM   1841 O  O   . LEU B 2 65  ? 37.596 49.985  35.921  1.00 34.57 ? 1788 LEU B O   1 
ATOM   1842 C  CB  . LEU B 2 65  ? 38.670 49.261  33.255  1.00 28.22 ? 1788 LEU B CB  1 
ATOM   1843 C  CG  . LEU B 2 65  ? 39.396 48.446  32.182  1.00 27.73 ? 1788 LEU B CG  1 
ATOM   1844 C  CD1 . LEU B 2 65  ? 38.489 48.283  30.974  1.00 24.13 ? 1788 LEU B CD1 1 
ATOM   1845 C  CD2 . LEU B 2 65  ? 40.709 49.151  31.789  1.00 29.88 ? 1788 LEU B CD2 1 
ATOM   1846 N  N   . GLU B 2 66  ? 39.083 51.612  35.838  1.00 36.80 ? 1789 GLU B N   1 
ATOM   1847 C  CA  . GLU B 2 66  ? 38.247 52.391  36.757  1.00 40.43 ? 1789 GLU B CA  1 
ATOM   1848 C  C   . GLU B 2 66  ? 37.042 52.955  36.022  1.00 40.92 ? 1789 GLU B C   1 
ATOM   1849 O  O   . GLU B 2 66  ? 36.000 53.202  36.621  1.00 42.46 ? 1789 GLU B O   1 
ATOM   1850 C  CB  . GLU B 2 66  ? 39.032 53.538  37.412  1.00 45.82 ? 1789 GLU B CB  1 
ATOM   1851 C  CG  . GLU B 2 66  ? 40.143 53.105  38.387  1.00 50.75 ? 1789 GLU B CG  1 
ATOM   1852 C  CD  . GLU B 2 66  ? 39.653 52.166  39.489  1.00 53.10 ? 1789 GLU B CD  1 
ATOM   1853 O  OE1 . GLU B 2 66  ? 38.554 52.401  40.049  1.00 55.14 ? 1789 GLU B OE1 1 
ATOM   1854 O  OE2 . GLU B 2 66  ? 40.381 51.199  39.802  1.00 52.02 ? 1789 GLU B OE2 1 
ATOM   1855 N  N   . ASP B 2 67  ? 37.189 53.152  34.717  1.00 42.30 ? 1790 ASP B N   1 
ATOM   1856 C  CA  . ASP B 2 67  ? 36.107 53.676  33.898  1.00 41.99 ? 1790 ASP B CA  1 
ATOM   1857 C  C   . ASP B 2 67  ? 36.157 53.058  32.509  1.00 42.00 ? 1790 ASP B C   1 
ATOM   1858 O  O   . ASP B 2 67  ? 37.162 52.461  32.119  1.00 42.62 ? 1790 ASP B O   1 
ATOM   1859 C  CB  . ASP B 2 67  ? 36.221 55.189  33.782  1.00 46.46 ? 1790 ASP B CB  1 
ATOM   1860 C  CG  . ASP B 2 67  ? 34.933 55.831  33.306  1.00 49.58 ? 1790 ASP B CG  1 
ATOM   1861 O  OD1 . ASP B 2 67  ? 33.942 55.806  34.071  1.00 49.08 ? 1790 ASP B OD1 1 
ATOM   1862 O  OD2 . ASP B 2 67  ? 34.909 56.355  32.169  1.00 52.23 ? 1790 ASP B OD2 1 
ATOM   1863 N  N   . PHE B 2 68  ? 35.074 53.219  31.758  1.00 41.38 ? 1791 PHE B N   1 
ATOM   1864 C  CA  . PHE B 2 68  ? 34.967 52.662  30.409  1.00 40.35 ? 1791 PHE B CA  1 
ATOM   1865 C  C   . PHE B 2 68  ? 35.898 53.308  29.371  1.00 41.83 ? 1791 PHE B C   1 
ATOM   1866 O  O   . PHE B 2 68  ? 36.134 54.519  29.410  1.00 38.50 ? 1791 PHE B O   1 
ATOM   1867 C  CB  . PHE B 2 68  ? 33.508 52.770  29.943  1.00 36.08 ? 1791 PHE B CB  1 
ATOM   1868 C  CG  . PHE B 2 68  ? 33.245 52.123  28.617  1.00 35.27 ? 1791 PHE B CG  1 
ATOM   1869 C  CD1 . PHE B 2 68  ? 33.553 52.780  27.430  1.00 33.80 ? 1791 PHE B CD1 1 
ATOM   1870 C  CD2 . PHE B 2 68  ? 32.744 50.825  28.554  1.00 34.23 ? 1791 PHE B CD2 1 
ATOM   1871 C  CE1 . PHE B 2 68  ? 33.371 52.150  26.195  1.00 33.92 ? 1791 PHE B CE1 1 
ATOM   1872 C  CE2 . PHE B 2 68  ? 32.558 50.186  27.325  1.00 32.12 ? 1791 PHE B CE2 1 
ATOM   1873 C  CZ  . PHE B 2 68  ? 32.873 50.848  26.145  1.00 33.23 ? 1791 PHE B CZ  1 
ATOM   1874 N  N   . ASN B 2 69  ? 36.427 52.502  28.444  1.00 46.09 ? 1792 ASN B N   1 
ATOM   1875 C  CA  . ASN B 2 69  ? 37.290 53.046  27.387  1.00 50.64 ? 1792 ASN B CA  1 
ATOM   1876 C  C   . ASN B 2 69  ? 36.510 53.233  26.085  1.00 50.94 ? 1792 ASN B C   1 
ATOM   1877 O  O   . ASN B 2 69  ? 37.039 53.042  24.987  1.00 52.90 ? 1792 ASN B O   1 
ATOM   1878 C  CB  . ASN B 2 69  ? 38.526 52.159  27.131  1.00 53.55 ? 1792 ASN B CB  1 
ATOM   1879 C  CG  . ASN B 2 69  ? 38.221 50.888  26.332  1.00 57.58 ? 1792 ASN B CG  1 
ATOM   1880 O  OD1 . ASN B 2 69  ? 37.274 50.822  25.540  1.00 56.78 ? 1792 ASN B OD1 1 
ATOM   1881 N  ND2 . ASN B 2 69  ? 39.065 49.872  26.522  1.00 60.31 ? 1792 ASN B ND2 1 
ATOM   1882 N  N   . THR B 2 75  ? 41.520 46.715  22.941  1.00 55.64 ? 1798 THR B N   1 
ATOM   1883 C  CA  . THR B 2 75  ? 42.169 45.988  21.852  1.00 55.95 ? 1798 THR B CA  1 
ATOM   1884 C  C   . THR B 2 75  ? 43.177 44.962  22.357  1.00 54.82 ? 1798 THR B C   1 
ATOM   1885 O  O   . THR B 2 75  ? 43.406 43.932  21.712  1.00 54.60 ? 1798 THR B O   1 
ATOM   1886 C  CB  . THR B 2 75  ? 42.913 46.955  20.891  1.00 57.24 ? 1798 THR B CB  1 
ATOM   1887 O  OG1 . THR B 2 75  ? 41.967 47.596  20.023  1.00 58.15 ? 1798 THR B OG1 1 
ATOM   1888 C  CG2 . THR B 2 75  ? 43.951 46.203  20.058  1.00 56.01 ? 1798 THR B CG2 1 
ATOM   1889 N  N   . ALA B 2 76  ? 43.778 45.244  23.507  1.00 52.05 ? 1799 ALA B N   1 
ATOM   1890 C  CA  . ALA B 2 76  ? 44.776 44.343  24.062  1.00 50.41 ? 1799 ALA B CA  1 
ATOM   1891 C  C   . ALA B 2 76  ? 44.236 43.439  25.146  1.00 49.80 ? 1799 ALA B C   1 
ATOM   1892 O  O   . ALA B 2 76  ? 44.970 42.605  25.665  1.00 50.43 ? 1799 ALA B O   1 
ATOM   1893 C  CB  . ALA B 2 76  ? 45.951 45.139  24.613  1.00 52.34 ? 1799 ALA B CB  1 
ATOM   1894 N  N   . TYR B 2 77  ? 42.964 43.596  25.495  1.00 49.38 ? 1800 TYR B N   1 
ATOM   1895 C  CA  . TYR B 2 77  ? 42.374 42.779  26.552  1.00 47.21 ? 1800 TYR B CA  1 
ATOM   1896 C  C   . TYR B 2 77  ? 40.947 42.345  26.275  1.00 45.43 ? 1800 TYR B C   1 
ATOM   1897 O  O   . TYR B 2 77  ? 40.223 43.009  25.533  1.00 47.24 ? 1800 TYR B O   1 
ATOM   1898 C  CB  . TYR B 2 77  ? 42.345 43.549  27.878  1.00 51.02 ? 1800 TYR B CB  1 
ATOM   1899 C  CG  . TYR B 2 77  ? 43.660 43.700  28.603  1.00 54.79 ? 1800 TYR B CG  1 
ATOM   1900 C  CD1 . TYR B 2 77  ? 44.630 44.608  28.166  1.00 57.34 ? 1800 TYR B CD1 1 
ATOM   1901 C  CD2 . TYR B 2 77  ? 43.924 42.954  29.753  1.00 55.17 ? 1800 TYR B CD2 1 
ATOM   1902 C  CE1 . TYR B 2 77  ? 45.830 44.771  28.860  1.00 57.91 ? 1800 TYR B CE1 1 
ATOM   1903 C  CE2 . TYR B 2 77  ? 45.118 43.108  30.452  1.00 57.91 ? 1800 TYR B CE2 1 
ATOM   1904 C  CZ  . TYR B 2 77  ? 46.063 44.016  30.000  1.00 59.07 ? 1800 TYR B CZ  1 
ATOM   1905 O  OH  . TYR B 2 77  ? 47.239 44.165  30.695  1.00 63.65 ? 1800 TYR B OH  1 
ATOM   1906 N  N   . GLN B 2 78  ? 40.544 41.230  26.888  1.00 42.49 ? 1801 GLN B N   1 
ATOM   1907 C  CA  . GLN B 2 78  ? 39.168 40.744  26.784  1.00 37.79 ? 1801 GLN B CA  1 
ATOM   1908 C  C   . GLN B 2 78  ? 38.490 41.407  27.987  1.00 35.93 ? 1801 GLN B C   1 
ATOM   1909 O  O   . GLN B 2 78  ? 38.831 41.116  29.138  1.00 34.33 ? 1801 GLN B O   1 
ATOM   1910 C  CB  . GLN B 2 78  ? 39.116 39.216  26.912  1.00 38.96 ? 1801 GLN B CB  1 
ATOM   1911 C  CG  . GLN B 2 78  ? 37.804 38.641  27.494  1.00 42.36 ? 1801 GLN B CG  1 
ATOM   1912 C  CD  . GLN B 2 78  ? 36.567 38.861  26.606  1.00 43.57 ? 1801 GLN B CD  1 
ATOM   1913 O  OE1 . GLN B 2 78  ? 36.214 39.998  26.281  1.00 42.97 ? 1801 GLN B OE1 1 
ATOM   1914 N  NE2 . GLN B 2 78  ? 35.900 37.763  26.225  1.00 42.40 ? 1801 GLN B NE2 1 
ATOM   1915 N  N   . CYS B 2 79  ? 37.565 42.329  27.730  1.00 33.46 ? 1802 CYS B N   1 
ATOM   1916 C  CA  . CYS B 2 79  ? 36.886 43.019  28.824  1.00 31.21 ? 1802 CYS B CA  1 
ATOM   1917 C  C   . CYS B 2 79  ? 35.655 42.293  29.320  1.00 26.19 ? 1802 CYS B C   1 
ATOM   1918 O  O   . CYS B 2 79  ? 34.974 41.588  28.572  1.00 25.28 ? 1802 CYS B O   1 
ATOM   1919 C  CB  . CYS B 2 79  ? 36.470 44.431  28.414  1.00 33.56 ? 1802 CYS B CB  1 
ATOM   1920 S  SG  . CYS B 2 79  ? 37.817 45.520  27.957  1.00 42.87 ? 1802 CYS B SG  1 
ATOM   1921 N  N   . LEU B 2 80  ? 35.370 42.498  30.595  1.00 22.93 ? 1803 LEU B N   1 
ATOM   1922 C  CA  . LEU B 2 80  ? 34.215 41.900  31.228  1.00 23.06 ? 1803 LEU B CA  1 
ATOM   1923 C  C   . LEU B 2 80  ? 33.697 42.829  32.316  1.00 23.82 ? 1803 LEU B C   1 
ATOM   1924 O  O   . LEU B 2 80  ? 34.476 43.464  33.032  1.00 23.44 ? 1803 LEU B O   1 
ATOM   1925 C  CB  . LEU B 2 80  ? 34.582 40.555  31.851  1.00 20.37 ? 1803 LEU B CB  1 
ATOM   1926 C  CG  . LEU B 2 80  ? 34.888 39.386  30.916  1.00 23.01 ? 1803 LEU B CG  1 
ATOM   1927 C  CD1 . LEU B 2 80  ? 35.194 38.136  31.748  1.00 22.77 ? 1803 LEU B CD1 1 
ATOM   1928 C  CD2 . LEU B 2 80  ? 33.705 39.142  29.989  1.00 21.94 ? 1803 LEU B CD2 1 
ATOM   1929 N  N   . LEU B 2 81  ? 32.380 42.925  32.432  1.00 24.24 ? 1804 LEU B N   1 
ATOM   1930 C  CA  . LEU B 2 81  ? 31.802 43.752  33.476  1.00 24.35 ? 1804 LEU B CA  1 
ATOM   1931 C  C   . LEU B 2 81  ? 31.442 42.795  34.606  1.00 23.80 ? 1804 LEU B C   1 
ATOM   1932 O  O   . LEU B 2 81  ? 30.982 41.684  34.353  1.00 23.51 ? 1804 LEU B O   1 
ATOM   1933 C  CB  . LEU B 2 81  ? 30.554 44.491  32.967  1.00 21.51 ? 1804 LEU B CB  1 
ATOM   1934 C  CG  . LEU B 2 81  ? 29.660 45.163  34.027  1.00 23.74 ? 1804 LEU B CG  1 
ATOM   1935 C  CD1 . LEU B 2 81  ? 29.312 46.580  33.627  1.00 19.82 ? 1804 LEU B CD1 1 
ATOM   1936 C  CD2 . LEU B 2 81  ? 28.387 44.352  34.195  1.00 22.01 ? 1804 LEU B CD2 1 
ATOM   1937 N  N   . ILE B 2 82  ? 31.682 43.204  35.846  1.00 24.77 ? 1805 ILE B N   1 
ATOM   1938 C  CA  . ILE B 2 82  ? 31.358 42.358  36.988  1.00 22.36 ? 1805 ILE B CA  1 
ATOM   1939 C  C   . ILE B 2 82  ? 30.351 43.067  37.872  1.00 24.95 ? 1805 ILE B C   1 
ATOM   1940 O  O   . ILE B 2 82  ? 30.531 44.234  38.231  1.00 25.61 ? 1805 ILE B O   1 
ATOM   1941 C  CB  . ILE B 2 82  ? 32.602 42.004  37.827  1.00 20.60 ? 1805 ILE B CB  1 
ATOM   1942 C  CG1 . ILE B 2 82  ? 33.506 41.051  37.035  1.00 18.17 ? 1805 ILE B CG1 1 
ATOM   1943 C  CG2 . ILE B 2 82  ? 32.178 41.377  39.163  1.00 19.99 ? 1805 ILE B CG2 1 
ATOM   1944 C  CD1 . ILE B 2 82  ? 32.784 39.870  36.421  1.00 16.45 ? 1805 ILE B CD1 1 
ATOM   1945 N  N   . ALA B 2 83  ? 29.284 42.348  38.209  1.00 24.37 ? 1806 ALA B N   1 
ATOM   1946 C  CA  . ALA B 2 83  ? 28.214 42.882  39.033  1.00 26.02 ? 1806 ALA B CA  1 
ATOM   1947 C  C   . ALA B 2 83  ? 27.488 41.740  39.738  1.00 28.18 ? 1806 ALA B C   1 
ATOM   1948 O  O   . ALA B 2 83  ? 27.656 40.578  39.378  1.00 30.10 ? 1806 ALA B O   1 
ATOM   1949 C  CB  . ALA B 2 83  ? 27.239 43.659  38.164  1.00 25.34 ? 1806 ALA B CB  1 
ATOM   1950 N  N   . ASP B 2 84  ? 26.680 42.052  40.742  1.00 29.09 ? 1807 ASP B N   1 
ATOM   1951 C  CA  . ASP B 2 84  ? 25.991 40.975  41.421  1.00 29.82 ? 1807 ASP B CA  1 
ATOM   1952 C  C   . ASP B 2 84  ? 24.575 40.804  40.884  1.00 30.61 ? 1807 ASP B C   1 
ATOM   1953 O  O   . ASP B 2 84  ? 23.853 39.894  41.286  1.00 29.77 ? 1807 ASP B O   1 
ATOM   1954 C  CB  . ASP B 2 84  ? 26.009 41.190  42.935  1.00 31.67 ? 1807 ASP B CB  1 
ATOM   1955 C  CG  . ASP B 2 84  ? 24.959 42.139  43.402  1.00 35.00 ? 1807 ASP B CG  1 
ATOM   1956 O  OD1 . ASP B 2 84  ? 24.914 43.291  42.918  1.00 36.92 ? 1807 ASP B OD1 1 
ATOM   1957 O  OD2 . ASP B 2 84  ? 24.176 41.720  44.277  1.00 43.07 ? 1807 ASP B OD2 1 
ATOM   1958 N  N   . GLN B 2 85  ? 24.195 41.661  39.940  1.00 30.07 ? 1808 GLN B N   1 
ATOM   1959 C  CA  . GLN B 2 85  ? 22.871 41.582  39.334  1.00 31.53 ? 1808 GLN B CA  1 
ATOM   1960 C  C   . GLN B 2 85  ? 22.775 42.617  38.229  1.00 34.14 ? 1808 GLN B C   1 
ATOM   1961 O  O   . GLN B 2 85  ? 23.651 43.479  38.091  1.00 39.75 ? 1808 GLN B O   1 
ATOM   1962 C  CB  . GLN B 2 85  ? 21.785 41.864  40.370  1.00 32.34 ? 1808 GLN B CB  1 
ATOM   1963 C  CG  . GLN B 2 85  ? 21.535 43.347  40.617  1.00 35.87 ? 1808 GLN B CG  1 
ATOM   1964 C  CD  . GLN B 2 85  ? 20.642 43.606  41.821  1.00 37.90 ? 1808 GLN B CD  1 
ATOM   1965 O  OE1 . GLN B 2 85  ? 21.061 43.437  42.970  1.00 39.00 ? 1808 GLN B OE1 1 
ATOM   1966 N  NE2 . GLN B 2 85  ? 19.403 44.015  41.564  1.00 38.46 ? 1808 GLN B NE2 1 
ATOM   1967 N  N   . HIS B 2 86  ? 21.718 42.541  37.436  1.00 30.97 ? 1809 HIS B N   1 
ATOM   1968 C  CA  . HIS B 2 86  ? 21.539 43.515  36.371  1.00 31.81 ? 1809 HIS B CA  1 
ATOM   1969 C  C   . HIS B 2 86  ? 21.219 44.835  37.059  1.00 32.48 ? 1809 HIS B C   1 
ATOM   1970 O  O   . HIS B 2 86  ? 20.450 44.858  38.034  1.00 31.81 ? 1809 HIS B O   1 
ATOM   1971 C  CB  . HIS B 2 86  ? 20.364 43.110  35.473  1.00 31.89 ? 1809 HIS B CB  1 
ATOM   1972 C  CG  . HIS B 2 86  ? 19.068 42.959  36.212  1.00 31.52 ? 1809 HIS B CG  1 
ATOM   1973 N  ND1 . HIS B 2 86  ? 18.100 43.944  36.234  1.00 32.19 ? 1809 HIS B ND1 1 
ATOM   1974 C  CD2 . HIS B 2 86  ? 18.595 41.950  36.983  1.00 27.64 ? 1809 HIS B CD2 1 
ATOM   1975 C  CE1 . HIS B 2 86  ? 17.087 43.548  36.983  1.00 28.40 ? 1809 HIS B CE1 1 
ATOM   1976 N  NE2 . HIS B 2 86  ? 17.363 42.342  37.450  1.00 31.31 ? 1809 HIS B NE2 1 
ATOM   1977 N  N   . CYS B 2 87  ? 21.819 45.924  36.576  1.00 32.29 ? 1810 CYS B N   1 
ATOM   1978 C  CA  . CYS B 2 87  ? 21.547 47.240  37.149  1.00 32.50 ? 1810 CYS B CA  1 
ATOM   1979 C  C   . CYS B 2 87  ? 21.503 48.355  36.112  1.00 30.19 ? 1810 CYS B C   1 
ATOM   1980 O  O   . CYS B 2 87  ? 21.899 48.169  34.961  1.00 30.48 ? 1810 CYS B O   1 
ATOM   1981 C  CB  . CYS B 2 87  ? 22.561 47.587  38.260  1.00 36.18 ? 1810 CYS B CB  1 
ATOM   1982 S  SG  . CYS B 2 87  ? 24.200 46.813  38.186  1.00 32.26 ? 1810 CYS B SG  1 
ATOM   1983 N  N   . ARG B 2 88  ? 20.989 49.510  36.524  1.00 28.36 ? 1811 ARG B N   1 
ATOM   1984 C  CA  . ARG B 2 88  ? 20.889 50.651  35.635  1.00 26.32 ? 1811 ARG B CA  1 
ATOM   1985 C  C   . ARG B 2 88  ? 21.890 51.727  36.021  1.00 26.42 ? 1811 ARG B C   1 
ATOM   1986 O  O   . ARG B 2 88  ? 21.530 52.763  36.580  1.00 28.76 ? 1811 ARG B O   1 
ATOM   1987 C  CB  . ARG B 2 88  ? 19.471 51.191  35.656  1.00 22.21 ? 1811 ARG B CB  1 
ATOM   1988 C  CG  . ARG B 2 88  ? 18.482 50.246  34.999  1.00 21.85 ? 1811 ARG B CG  1 
ATOM   1989 C  CD  . ARG B 2 88  ? 17.105 50.445  35.594  1.00 21.17 ? 1811 ARG B CD  1 
ATOM   1990 N  NE  . ARG B 2 88  ? 16.688 51.841  35.491  1.00 24.11 ? 1811 ARG B NE  1 
ATOM   1991 C  CZ  . ARG B 2 88  ? 15.927 52.319  34.508  1.00 28.80 ? 1811 ARG B CZ  1 
ATOM   1992 N  NH1 . ARG B 2 88  ? 15.493 51.507  33.543  1.00 25.54 ? 1811 ARG B NH1 1 
ATOM   1993 N  NH2 . ARG B 2 88  ? 15.597 53.609  34.492  1.00 27.64 ? 1811 ARG B NH2 1 
ATOM   1994 N  N   . THR B 2 89  ? 23.159 51.450  35.730  1.00 25.03 ? 1812 THR B N   1 
ATOM   1995 C  CA  . THR B 2 89  ? 24.248 52.382  36.013  1.00 23.98 ? 1812 THR B CA  1 
ATOM   1996 C  C   . THR B 2 89  ? 24.942 52.742  34.708  1.00 25.33 ? 1812 THR B C   1 
ATOM   1997 O  O   . THR B 2 89  ? 24.869 51.999  33.726  1.00 26.41 ? 1812 THR B O   1 
ATOM   1998 C  CB  . THR B 2 89  ? 25.332 51.755  36.871  1.00 18.35 ? 1812 THR B CB  1 
ATOM   1999 O  OG1 . THR B 2 89  ? 25.906 50.663  36.142  1.00 18.25 ? 1812 THR B OG1 1 
ATOM   2000 C  CG2 . THR B 2 89  ? 24.772 51.257  38.181  1.00 18.73 ? 1812 THR B CG2 1 
ATOM   2001 N  N   . ARG B 2 90  ? 25.641 53.870  34.714  1.00 26.58 ? 1813 ARG B N   1 
ATOM   2002 C  CA  . ARG B 2 90  ? 26.380 54.318  33.537  1.00 26.36 ? 1813 ARG B CA  1 
ATOM   2003 C  C   . ARG B 2 90  ? 27.234 53.162  32.996  1.00 26.63 ? 1813 ARG B C   1 
ATOM   2004 O  O   . ARG B 2 90  ? 27.216 52.862  31.798  1.00 24.83 ? 1813 ARG B O   1 
ATOM   2005 C  CB  . ARG B 2 90  ? 27.286 55.500  33.908  1.00 26.84 ? 1813 ARG B CB  1 
ATOM   2006 C  CG  . ARG B 2 90  ? 27.826 56.279  32.719  1.00 31.44 ? 1813 ARG B CG  1 
ATOM   2007 C  CD  . ARG B 2 90  ? 28.646 57.467  33.170  1.00 35.22 ? 1813 ARG B CD  1 
ATOM   2008 N  NE  . ARG B 2 90  ? 30.037 57.087  33.356  1.00 39.68 ? 1813 ARG B NE  1 
ATOM   2009 C  CZ  . ARG B 2 90  ? 30.914 56.995  32.362  1.00 43.09 ? 1813 ARG B CZ  1 
ATOM   2010 N  NH1 . ARG B 2 90  ? 30.536 57.269  31.120  1.00 46.10 ? 1813 ARG B NH1 1 
ATOM   2011 N  NH2 . ARG B 2 90  ? 32.162 56.612  32.600  1.00 42.16 ? 1813 ARG B NH2 1 
ATOM   2012 N  N   . LYS B 2 91  ? 27.976 52.507  33.884  1.00 26.65 ? 1814 LYS B N   1 
ATOM   2013 C  CA  . LYS B 2 91  ? 28.825 51.407  33.471  1.00 27.42 ? 1814 LYS B CA  1 
ATOM   2014 C  C   . LYS B 2 91  ? 28.042 50.250  32.858  1.00 27.48 ? 1814 LYS B C   1 
ATOM   2015 O  O   . LYS B 2 91  ? 28.504 49.619  31.892  1.00 26.50 ? 1814 LYS B O   1 
ATOM   2016 C  CB  . LYS B 2 91  ? 29.643 50.891  34.654  1.00 32.06 ? 1814 LYS B CB  1 
ATOM   2017 C  CG  . LYS B 2 91  ? 30.848 51.755  35.025  1.00 32.95 ? 1814 LYS B CG  1 
ATOM   2018 C  CD  . LYS B 2 91  ? 31.609 51.139  36.200  1.00 32.83 ? 1814 LYS B CD  1 
ATOM   2019 C  CE  . LYS B 2 91  ? 32.769 52.017  36.634  1.00 36.25 ? 1814 LYS B CE  1 
ATOM   2020 N  NZ  . LYS B 2 91  ? 33.549 51.394  37.743  1.00 37.53 ? 1814 LYS B NZ  1 
ATOM   2021 N  N   . TYR B 2 92  ? 26.862 49.955  33.395  1.00 25.58 ? 1815 TYR B N   1 
ATOM   2022 C  CA  . TYR B 2 92  ? 26.111 48.840  32.831  1.00 24.56 ? 1815 TYR B CA  1 
ATOM   2023 C  C   . TYR B 2 92  ? 25.627 49.192  31.431  1.00 25.75 ? 1815 TYR B C   1 
ATOM   2024 O  O   . TYR B 2 92  ? 25.816 48.426  30.484  1.00 25.87 ? 1815 TYR B O   1 
ATOM   2025 C  CB  . TYR B 2 92  ? 24.921 48.467  33.702  1.00 24.41 ? 1815 TYR B CB  1 
ATOM   2026 C  CG  . TYR B 2 92  ? 24.560 46.994  33.633  1.00 24.57 ? 1815 TYR B CG  1 
ATOM   2027 C  CD1 . TYR B 2 92  ? 25.282 46.044  34.358  1.00 25.50 ? 1815 TYR B CD1 1 
ATOM   2028 C  CD2 . TYR B 2 92  ? 23.494 46.550  32.853  1.00 27.64 ? 1815 TYR B CD2 1 
ATOM   2029 C  CE1 . TYR B 2 92  ? 24.958 44.692  34.315  1.00 22.54 ? 1815 TYR B CE1 1 
ATOM   2030 C  CE2 . TYR B 2 92  ? 23.157 45.194  32.801  1.00 28.25 ? 1815 TYR B CE2 1 
ATOM   2031 C  CZ  . TYR B 2 92  ? 23.896 44.273  33.537  1.00 25.91 ? 1815 TYR B CZ  1 
ATOM   2032 O  OH  . TYR B 2 92  ? 23.558 42.939  33.503  1.00 26.89 ? 1815 TYR B OH  1 
ATOM   2033 N  N   . PHE B 2 93  ? 25.014 50.359  31.292  1.00 24.99 ? 1816 PHE B N   1 
ATOM   2034 C  CA  . PHE B 2 93  ? 24.510 50.784  29.994  1.00 27.97 ? 1816 PHE B CA  1 
ATOM   2035 C  C   . PHE B 2 93  ? 25.628 50.862  28.952  1.00 29.62 ? 1816 PHE B C   1 
ATOM   2036 O  O   . PHE B 2 93  ? 25.423 50.548  27.769  1.00 27.61 ? 1816 PHE B O   1 
ATOM   2037 C  CB  . PHE B 2 93  ? 23.847 52.147  30.126  1.00 27.07 ? 1816 PHE B CB  1 
ATOM   2038 C  CG  . PHE B 2 93  ? 22.671 52.153  31.037  1.00 28.65 ? 1816 PHE B CG  1 
ATOM   2039 C  CD1 . PHE B 2 93  ? 22.230 53.339  31.609  1.00 30.57 ? 1816 PHE B CD1 1 
ATOM   2040 C  CD2 . PHE B 2 93  ? 21.960 50.983  31.284  1.00 28.79 ? 1816 PHE B CD2 1 
ATOM   2041 C  CE1 . PHE B 2 93  ? 21.084 53.358  32.415  1.00 31.32 ? 1816 PHE B CE1 1 
ATOM   2042 C  CE2 . PHE B 2 93  ? 20.819 50.992  32.085  1.00 28.83 ? 1816 PHE B CE2 1 
ATOM   2043 C  CZ  . PHE B 2 93  ? 20.380 52.183  32.650  1.00 29.44 ? 1816 PHE B CZ  1 
ATOM   2044 N  N   . LEU B 2 94  ? 26.814 51.275  29.382  1.00 29.95 ? 1817 LEU B N   1 
ATOM   2045 C  CA  . LEU B 2 94  ? 27.921 51.383  28.440  1.00 31.48 ? 1817 LEU B CA  1 
ATOM   2046 C  C   . LEU B 2 94  ? 28.332 50.022  27.942  1.00 32.46 ? 1817 LEU B C   1 
ATOM   2047 O  O   . LEU B 2 94  ? 28.673 49.863  26.762  1.00 34.46 ? 1817 LEU B O   1 
ATOM   2048 C  CB  . LEU B 2 94  ? 29.126 52.086  29.066  1.00 32.46 ? 1817 LEU B CB  1 
ATOM   2049 C  CG  . LEU B 2 94  ? 29.019 53.610  29.020  1.00 33.50 ? 1817 LEU B CG  1 
ATOM   2050 C  CD1 . LEU B 2 94  ? 30.094 54.208  29.893  1.00 35.37 ? 1817 LEU B CD1 1 
ATOM   2051 C  CD2 . LEU B 2 94  ? 29.131 54.106  27.574  1.00 31.96 ? 1817 LEU B CD2 1 
ATOM   2052 N  N   . CYS B 2 95  ? 28.301 49.028  28.824  1.00 29.61 ? 1818 CYS B N   1 
ATOM   2053 C  CA  . CYS B 2 95  ? 28.684 47.695  28.389  1.00 26.68 ? 1818 CYS B CA  1 
ATOM   2054 C  C   . CYS B 2 95  ? 27.613 47.067  27.495  1.00 26.62 ? 1818 CYS B C   1 
ATOM   2055 O  O   . CYS B 2 95  ? 27.945 46.335  26.556  1.00 27.43 ? 1818 CYS B O   1 
ATOM   2056 C  CB  . CYS B 2 95  ? 28.999 46.815  29.595  1.00 22.81 ? 1818 CYS B CB  1 
ATOM   2057 S  SG  . CYS B 2 95  ? 30.510 47.371  30.420  1.00 22.22 ? 1818 CYS B SG  1 
ATOM   2058 N  N   . LEU B 2 96  ? 26.339 47.353  27.770  1.00 24.63 ? 1819 LEU B N   1 
ATOM   2059 C  CA  . LEU B 2 96  ? 25.264 46.818  26.940  1.00 24.38 ? 1819 LEU B CA  1 
ATOM   2060 C  C   . LEU B 2 96  ? 25.425 47.422  25.564  1.00 26.05 ? 1819 LEU B C   1 
ATOM   2061 O  O   . LEU B 2 96  ? 25.250 46.761  24.542  1.00 27.06 ? 1819 LEU B O   1 
ATOM   2062 C  CB  . LEU B 2 96  ? 23.894 47.227  27.461  1.00 21.14 ? 1819 LEU B CB  1 
ATOM   2063 C  CG  . LEU B 2 96  ? 23.370 46.539  28.709  1.00 19.92 ? 1819 LEU B CG  1 
ATOM   2064 C  CD1 . LEU B 2 96  ? 22.044 47.184  29.080  1.00 25.22 ? 1819 LEU B CD1 1 
ATOM   2065 C  CD2 . LEU B 2 96  ? 23.197 45.070  28.458  1.00 16.37 ? 1819 LEU B CD2 1 
ATOM   2066 N  N   . ALA B 2 97  ? 25.765 48.701  25.549  1.00 27.76 ? 1820 ALA B N   1 
ATOM   2067 C  CA  . ALA B 2 97  ? 25.932 49.416  24.299  1.00 27.83 ? 1820 ALA B CA  1 
ATOM   2068 C  C   . ALA B 2 97  ? 27.155 48.965  23.509  1.00 29.27 ? 1820 ALA B C   1 
ATOM   2069 O  O   . ALA B 2 97  ? 27.140 48.993  22.274  1.00 29.88 ? 1820 ALA B O   1 
ATOM   2070 C  CB  . ALA B 2 97  ? 26.012 50.918  24.573  1.00 23.12 ? 1820 ALA B CB  1 
ATOM   2071 N  N   . SER B 2 98  ? 28.209 48.535  24.203  1.00 30.83 ? 1821 SER B N   1 
ATOM   2072 C  CA  . SER B 2 98  ? 29.433 48.133  23.511  1.00 31.36 ? 1821 SER B CA  1 
ATOM   2073 C  C   . SER B 2 98  ? 29.721 46.648  23.364  1.00 32.69 ? 1821 SER B C   1 
ATOM   2074 O  O   . SER B 2 98  ? 30.732 46.274  22.774  1.00 34.91 ? 1821 SER B O   1 
ATOM   2075 C  CB  . SER B 2 98  ? 30.641 48.802  24.156  1.00 33.33 ? 1821 SER B CB  1 
ATOM   2076 O  OG  . SER B 2 98  ? 30.623 48.609  25.557  1.00 41.73 ? 1821 SER B OG  1 
ATOM   2077 N  N   . GLY B 2 99  ? 28.861 45.786  23.887  1.00 31.90 ? 1822 GLY B N   1 
ATOM   2078 C  CA  . GLY B 2 99  ? 29.128 44.366  23.729  1.00 29.03 ? 1822 GLY B CA  1 
ATOM   2079 C  C   . GLY B 2 99  ? 30.050 43.771  24.775  1.00 30.15 ? 1822 GLY B C   1 
ATOM   2080 O  O   . GLY B 2 99  ? 30.439 42.610  24.654  1.00 31.37 ? 1822 GLY B O   1 
ATOM   2081 N  N   . ILE B 2 100 ? 30.426 44.542  25.795  1.00 28.35 ? 1823 ILE B N   1 
ATOM   2082 C  CA  . ILE B 2 100 ? 31.266 43.975  26.841  1.00 26.18 ? 1823 ILE B CA  1 
ATOM   2083 C  C   . ILE B 2 100 ? 30.297 43.176  27.712  1.00 25.39 ? 1823 ILE B C   1 
ATOM   2084 O  O   . ILE B 2 100 ? 29.363 43.721  28.296  1.00 25.20 ? 1823 ILE B O   1 
ATOM   2085 C  CB  . ILE B 2 100 ? 31.998 45.070  27.650  1.00 26.41 ? 1823 ILE B CB  1 
ATOM   2086 C  CG1 . ILE B 2 100 ? 33.028 45.760  26.746  1.00 25.28 ? 1823 ILE B CG1 1 
ATOM   2087 C  CG2 . ILE B 2 100 ? 32.686 44.459  28.857  1.00 22.31 ? 1823 ILE B CG2 1 
ATOM   2088 C  CD1 . ILE B 2 100 ? 33.731 46.930  27.383  1.00 28.22 ? 1823 ILE B CD1 1 
ATOM   2089 N  N   . PRO B 2 101 ? 30.494 41.854  27.779  1.00 25.56 ? 1824 PRO B N   1 
ATOM   2090 C  CA  . PRO B 2 101 ? 29.637 40.954  28.564  1.00 24.41 ? 1824 PRO B CA  1 
ATOM   2091 C  C   . PRO B 2 101 ? 29.492 41.330  30.028  1.00 22.85 ? 1824 PRO B C   1 
ATOM   2092 O  O   . PRO B 2 101 ? 30.475 41.690  30.673  1.00 24.23 ? 1824 PRO B O   1 
ATOM   2093 C  CB  . PRO B 2 101 ? 30.312 39.593  28.388  1.00 24.22 ? 1824 PRO B CB  1 
ATOM   2094 C  CG  . PRO B 2 101 ? 30.994 39.721  27.028  1.00 24.99 ? 1824 PRO B CG  1 
ATOM   2095 C  CD  . PRO B 2 101 ? 31.568 41.108  27.095  1.00 23.93 ? 1824 PRO B CD  1 
ATOM   2096 N  N   . CYS B 2 102 ? 28.269 41.229  30.546  1.00 22.05 ? 1825 CYS B N   1 
ATOM   2097 C  CA  . CYS B 2 102 ? 27.996 41.539  31.944  1.00 21.54 ? 1825 CYS B CA  1 
ATOM   2098 C  C   . CYS B 2 102 ? 27.980 40.231  32.677  1.00 22.73 ? 1825 CYS B C   1 
ATOM   2099 O  O   . CYS B 2 102 ? 27.035 39.446  32.565  1.00 23.37 ? 1825 CYS B O   1 
ATOM   2100 C  CB  . CYS B 2 102 ? 26.656 42.237  32.091  1.00 21.69 ? 1825 CYS B CB  1 
ATOM   2101 S  SG  . CYS B 2 102 ? 26.628 43.779  31.177  1.00 30.27 ? 1825 CYS B SG  1 
ATOM   2102 N  N   . VAL B 2 103 ? 29.043 39.996  33.431  1.00 24.38 ? 1826 VAL B N   1 
ATOM   2103 C  CA  . VAL B 2 103 ? 29.181 38.752  34.163  1.00 24.27 ? 1826 VAL B CA  1 
ATOM   2104 C  C   . VAL B 2 103 ? 29.017 38.880  35.664  1.00 24.95 ? 1826 VAL B C   1 
ATOM   2105 O  O   . VAL B 2 103 ? 29.395 39.895  36.265  1.00 23.97 ? 1826 VAL B O   1 
ATOM   2106 C  CB  . VAL B 2 103 ? 30.534 38.113  33.843  1.00 24.56 ? 1826 VAL B CB  1 
ATOM   2107 C  CG1 . VAL B 2 103 ? 30.771 36.877  34.720  1.00 23.23 ? 1826 VAL B CG1 1 
ATOM   2108 C  CG2 . VAL B 2 103 ? 30.563 37.754  32.365  1.00 20.25 ? 1826 VAL B CG2 1 
ATOM   2109 N  N   . SER B 2 104 ? 28.440 37.836  36.257  1.00 26.98 ? 1827 SER B N   1 
ATOM   2110 C  CA  . SER B 2 104 ? 28.200 37.778  37.695  1.00 27.10 ? 1827 SER B CA  1 
ATOM   2111 C  C   . SER B 2 104 ? 29.501 37.578  38.452  1.00 28.06 ? 1827 SER B C   1 
ATOM   2112 O  O   . SER B 2 104 ? 30.374 36.824  38.015  1.00 30.71 ? 1827 SER B O   1 
ATOM   2113 C  CB  . SER B 2 104 ? 27.261 36.625  38.018  1.00 25.75 ? 1827 SER B CB  1 
ATOM   2114 O  OG  . SER B 2 104 ? 27.543 36.130  39.314  1.00 29.21 ? 1827 SER B OG  1 
ATOM   2115 N  N   . HIS B 2 105 ? 29.626 38.234  39.599  1.00 28.00 ? 1828 HIS B N   1 
ATOM   2116 C  CA  . HIS B 2 105 ? 30.835 38.113  40.400  1.00 26.73 ? 1828 HIS B CA  1 
ATOM   2117 C  C   . HIS B 2 105 ? 31.147 36.662  40.735  1.00 24.46 ? 1828 HIS B C   1 
ATOM   2118 O  O   . HIS B 2 105 ? 32.304 36.307  40.943  1.00 27.97 ? 1828 HIS B O   1 
ATOM   2119 C  CB  . HIS B 2 105 ? 30.702 38.921  41.691  1.00 26.10 ? 1828 HIS B CB  1 
ATOM   2120 C  CG  . HIS B 2 105 ? 29.591 38.469  42.583  1.00 26.36 ? 1828 HIS B CG  1 
ATOM   2121 N  ND1 . HIS B 2 105 ? 29.776 38.209  43.926  1.00 26.83 ? 1828 HIS B ND1 1 
ATOM   2122 C  CD2 . HIS B 2 105 ? 28.272 38.274  42.339  1.00 26.93 ? 1828 HIS B CD2 1 
ATOM   2123 C  CE1 . HIS B 2 105 ? 28.619 37.876  44.471  1.00 28.43 ? 1828 HIS B CE1 1 
ATOM   2124 N  NE2 . HIS B 2 105 ? 27.690 37.909  43.530  1.00 30.19 ? 1828 HIS B NE2 1 
ATOM   2125 N  N   . VAL B 2 106 ? 30.115 35.825  40.780  1.00 24.46 ? 1829 VAL B N   1 
ATOM   2126 C  CA  . VAL B 2 106 ? 30.290 34.410  41.102  1.00 23.70 ? 1829 VAL B CA  1 
ATOM   2127 C  C   . VAL B 2 106 ? 31.274 33.745  40.135  1.00 24.52 ? 1829 VAL B C   1 
ATOM   2128 O  O   . VAL B 2 106 ? 31.880 32.733  40.467  1.00 28.65 ? 1829 VAL B O   1 
ATOM   2129 C  CB  . VAL B 2 106 ? 28.927 33.660  41.075  1.00 23.71 ? 1829 VAL B CB  1 
ATOM   2130 C  CG1 . VAL B 2 106 ? 29.109 32.199  41.494  1.00 21.10 ? 1829 VAL B CG1 1 
ATOM   2131 C  CG2 . VAL B 2 106 ? 27.929 34.360  42.016  1.00 22.01 ? 1829 VAL B CG2 1 
ATOM   2132 N  N   . TRP B 2 107 ? 31.439 34.306  38.942  1.00 21.87 ? 1830 TRP B N   1 
ATOM   2133 C  CA  . TRP B 2 107 ? 32.388 33.746  37.986  1.00 20.92 ? 1830 TRP B CA  1 
ATOM   2134 C  C   . TRP B 2 107 ? 33.795 33.953  38.551  1.00 22.48 ? 1830 TRP B C   1 
ATOM   2135 O  O   . TRP B 2 107 ? 34.693 33.153  38.300  1.00 24.24 ? 1830 TRP B O   1 
ATOM   2136 C  CB  . TRP B 2 107 ? 32.253 34.444  36.630  1.00 21.32 ? 1830 TRP B CB  1 
ATOM   2137 C  CG  . TRP B 2 107 ? 33.346 34.118  35.647  1.00 19.14 ? 1830 TRP B CG  1 
ATOM   2138 C  CD1 . TRP B 2 107 ? 33.391 33.060  34.780  1.00 18.38 ? 1830 TRP B CD1 1 
ATOM   2139 C  CD2 . TRP B 2 107 ? 34.550 34.869  35.430  1.00 18.67 ? 1830 TRP B CD2 1 
ATOM   2140 N  NE1 . TRP B 2 107 ? 34.552 33.109  34.034  1.00 20.08 ? 1830 TRP B NE1 1 
ATOM   2141 C  CE2 . TRP B 2 107 ? 35.279 34.208  34.415  1.00 18.82 ? 1830 TRP B CE2 1 
ATOM   2142 C  CE3 . TRP B 2 107 ? 35.081 36.042  35.994  1.00 18.71 ? 1830 TRP B CE3 1 
ATOM   2143 C  CZ2 . TRP B 2 107 ? 36.516 34.675  33.954  1.00 20.26 ? 1830 TRP B CZ2 1 
ATOM   2144 C  CZ3 . TRP B 2 107 ? 36.313 36.510  35.532  1.00 19.51 ? 1830 TRP B CZ3 1 
ATOM   2145 C  CH2 . TRP B 2 107 ? 37.016 35.824  34.523  1.00 19.25 ? 1830 TRP B CH2 1 
ATOM   2146 N  N   . VAL B 2 108 ? 33.987 35.035  39.304  1.00 21.26 ? 1831 VAL B N   1 
ATOM   2147 C  CA  . VAL B 2 108 ? 35.282 35.305  39.913  1.00 23.12 ? 1831 VAL B CA  1 
ATOM   2148 C  C   . VAL B 2 108 ? 35.462 34.282  41.041  1.00 27.26 ? 1831 VAL B C   1 
ATOM   2149 O  O   . VAL B 2 108 ? 36.513 33.642  41.163  1.00 30.17 ? 1831 VAL B O   1 
ATOM   2150 C  CB  . VAL B 2 108 ? 35.346 36.730  40.524  1.00 21.92 ? 1831 VAL B CB  1 
ATOM   2151 C  CG1 . VAL B 2 108 ? 36.708 36.944  41.168  1.00 18.55 ? 1831 VAL B CG1 1 
ATOM   2152 C  CG2 . VAL B 2 108 ? 35.085 37.798  39.447  1.00 16.57 ? 1831 VAL B CG2 1 
ATOM   2153 N  N   . HIS B 2 109 ? 34.420 34.136  41.857  1.00 27.94 ? 1832 HIS B N   1 
ATOM   2154 C  CA  . HIS B 2 109 ? 34.395 33.203  42.994  1.00 30.37 ? 1832 HIS B CA  1 
ATOM   2155 C  C   . HIS B 2 109 ? 34.803 31.798  42.545  1.00 28.88 ? 1832 HIS B C   1 
ATOM   2156 O  O   . HIS B 2 109 ? 35.843 31.274  42.937  1.00 31.06 ? 1832 HIS B O   1 
ATOM   2157 C  CB  . HIS B 2 109 ? 32.966 33.156  43.576  1.00 33.09 ? 1832 HIS B CB  1 
ATOM   2158 C  CG  . HIS B 2 109 ? 32.849 32.437  44.889  1.00 35.94 ? 1832 HIS B CG  1 
ATOM   2159 N  ND1 . HIS B 2 109 ? 33.158 33.031  46.096  1.00 37.33 ? 1832 HIS B ND1 1 
ATOM   2160 C  CD2 . HIS B 2 109 ? 32.448 31.176  45.184  1.00 36.43 ? 1832 HIS B CD2 1 
ATOM   2161 C  CE1 . HIS B 2 109 ? 32.953 32.167  47.077  1.00 36.06 ? 1832 HIS B CE1 1 
ATOM   2162 N  NE2 . HIS B 2 109 ? 32.522 31.034  46.551  1.00 37.10 ? 1832 HIS B NE2 1 
ATOM   2163 N  N   . ASP B 2 110 ? 33.959 31.197  41.718  1.00 28.45 ? 1833 ASP B N   1 
ATOM   2164 C  CA  . ASP B 2 110 ? 34.185 29.863  41.187  1.00 27.73 ? 1833 ASP B CA  1 
ATOM   2165 C  C   . ASP B 2 110 ? 35.553 29.709  40.528  1.00 28.10 ? 1833 ASP B C   1 
ATOM   2166 O  O   . ASP B 2 110 ? 36.157 28.639  40.598  1.00 30.24 ? 1833 ASP B O   1 
ATOM   2167 C  CB  . ASP B 2 110 ? 33.109 29.516  40.149  1.00 28.86 ? 1833 ASP B CB  1 
ATOM   2168 C  CG  . ASP B 2 110 ? 31.777 29.106  40.770  1.00 30.61 ? 1833 ASP B CG  1 
ATOM   2169 O  OD1 . ASP B 2 110 ? 31.635 29.086  42.018  1.00 31.50 ? 1833 ASP B OD1 1 
ATOM   2170 O  OD2 . ASP B 2 110 ? 30.860 28.786  39.981  1.00 32.29 ? 1833 ASP B OD2 1 
ATOM   2171 N  N   . SER B 2 111 ? 36.039 30.759  39.875  1.00 27.55 ? 1834 SER B N   1 
ATOM   2172 C  CA  . SER B 2 111 ? 37.331 30.669  39.205  1.00 28.84 ? 1834 SER B CA  1 
ATOM   2173 C  C   . SER B 2 111 ? 38.494 30.625  40.185  1.00 31.10 ? 1834 SER B C   1 
ATOM   2174 O  O   . SER B 2 111 ? 39.453 29.865  39.994  1.00 30.65 ? 1834 SER B O   1 
ATOM   2175 C  CB  . SER B 2 111 ? 37.514 31.831  38.229  1.00 27.96 ? 1834 SER B CB  1 
ATOM   2176 O  OG  . SER B 2 111 ? 36.685 31.665  37.088  1.00 28.31 ? 1834 SER B OG  1 
ATOM   2177 N  N   . CYS B 2 112 ? 38.419 31.431  41.236  1.00 30.94 ? 1835 CYS B N   1 
ATOM   2178 C  CA  . CYS B 2 112 ? 39.488 31.439  42.216  1.00 35.14 ? 1835 CYS B CA  1 
ATOM   2179 C  C   . CYS B 2 112 ? 39.468 30.097  42.924  1.00 37.36 ? 1835 CYS B C   1 
ATOM   2180 O  O   . CYS B 2 112 ? 40.467 29.377  42.957  1.00 38.33 ? 1835 CYS B O   1 
ATOM   2181 C  CB  . CYS B 2 112 ? 39.273 32.579  43.204  1.00 32.71 ? 1835 CYS B CB  1 
ATOM   2182 S  SG  . CYS B 2 112 ? 39.290 34.188  42.388  1.00 34.25 ? 1835 CYS B SG  1 
ATOM   2183 N  N   . HIS B 2 113 ? 38.306 29.768  43.476  1.00 38.88 ? 1836 HIS B N   1 
ATOM   2184 C  CA  . HIS B 2 113 ? 38.084 28.510  44.182  1.00 40.57 ? 1836 HIS B CA  1 
ATOM   2185 C  C   . HIS B 2 113 ? 38.701 27.322  43.442  1.00 40.05 ? 1836 HIS B C   1 
ATOM   2186 O  O   . HIS B 2 113 ? 39.441 26.527  44.012  1.00 40.79 ? 1836 HIS B O   1 
ATOM   2187 C  CB  . HIS B 2 113 ? 36.578 28.271  44.321  1.00 44.49 ? 1836 HIS B CB  1 
ATOM   2188 C  CG  . HIS B 2 113 ? 36.227 27.098  45.181  1.00 49.83 ? 1836 HIS B CG  1 
ATOM   2189 N  ND1 . HIS B 2 113 ? 35.906 27.224  46.517  1.00 49.74 ? 1836 HIS B ND1 1 
ATOM   2190 C  CD2 . HIS B 2 113 ? 36.184 25.771  44.906  1.00 50.36 ? 1836 HIS B CD2 1 
ATOM   2191 C  CE1 . HIS B 2 113 ? 35.681 26.026  47.027  1.00 50.23 ? 1836 HIS B CE1 1 
ATOM   2192 N  NE2 . HIS B 2 113 ? 35.844 25.127  46.071  1.00 50.86 ? 1836 HIS B NE2 1 
ATOM   2193 N  N   . ALA B 2 114 ? 38.373 27.199  42.164  1.00 39.28 ? 1837 ALA B N   1 
ATOM   2194 C  CA  . ALA B 2 114 ? 38.884 26.109  41.349  1.00 37.21 ? 1837 ALA B CA  1 
ATOM   2195 C  C   . ALA B 2 114 ? 40.273 26.422  40.821  1.00 38.11 ? 1837 ALA B C   1 
ATOM   2196 O  O   . ALA B 2 114 ? 40.972 25.534  40.321  1.00 37.70 ? 1837 ALA B O   1 
ATOM   2197 C  CB  . ALA B 2 114 ? 37.941 25.851  40.186  1.00 34.97 ? 1837 ALA B CB  1 
ATOM   2198 N  N   . ASN B 2 115 ? 40.668 27.689  40.918  1.00 38.96 ? 1838 ASN B N   1 
ATOM   2199 C  CA  . ASN B 2 115 ? 41.978 28.107  40.429  1.00 37.21 ? 1838 ASN B CA  1 
ATOM   2200 C  C   . ASN B 2 115 ? 42.066 27.684  38.966  1.00 36.27 ? 1838 ASN B C   1 
ATOM   2201 O  O   . ASN B 2 115 ? 43.038 27.071  38.543  1.00 37.78 ? 1838 ASN B O   1 
ATOM   2202 C  CB  . ASN B 2 115 ? 43.076 27.424  41.255  1.00 33.16 ? 1838 ASN B CB  1 
ATOM   2203 C  CG  . ASN B 2 115 ? 44.421 28.080  41.087  1.00 31.95 ? 1838 ASN B CG  1 
ATOM   2204 O  OD1 . ASN B 2 115 ? 44.517 29.300  40.951  1.00 33.35 ? 1838 ASN B OD1 1 
ATOM   2205 N  ND2 . ASN B 2 115 ? 45.476 27.279  41.111  1.00 35.10 ? 1838 ASN B ND2 1 
ATOM   2206 N  N   . GLN B 2 116 ? 41.027 28.016  38.208  1.00 34.97 ? 1839 GLN B N   1 
ATOM   2207 C  CA  . GLN B 2 116 ? 40.932 27.677  36.793  1.00 33.27 ? 1839 GLN B CA  1 
ATOM   2208 C  C   . GLN B 2 116 ? 39.782 28.492  36.173  1.00 31.02 ? 1839 GLN B C   1 
ATOM   2209 O  O   . GLN B 2 116 ? 38.650 28.468  36.674  1.00 30.94 ? 1839 GLN B O   1 
ATOM   2210 C  CB  . GLN B 2 116 ? 40.660 26.178  36.670  1.00 34.54 ? 1839 GLN B CB  1 
ATOM   2211 C  CG  . GLN B 2 116 ? 40.476 25.670  35.251  1.00 36.60 ? 1839 GLN B CG  1 
ATOM   2212 C  CD  . GLN B 2 116 ? 41.065 24.279  35.074  1.00 37.58 ? 1839 GLN B CD  1 
ATOM   2213 O  OE1 . GLN B 2 116 ? 40.658 23.324  35.747  1.00 34.21 ? 1839 GLN B OE1 1 
ATOM   2214 N  NE2 . GLN B 2 116 ? 42.039 24.161  34.173  1.00 37.46 ? 1839 GLN B NE2 1 
ATOM   2215 N  N   . LEU B 2 117 ? 40.061 29.221  35.100  1.00 26.78 ? 1840 LEU B N   1 
ATOM   2216 C  CA  . LEU B 2 117 ? 39.024 30.038  34.477  1.00 27.63 ? 1840 LEU B CA  1 
ATOM   2217 C  C   . LEU B 2 117 ? 37.775 29.268  34.052  1.00 29.51 ? 1840 LEU B C   1 
ATOM   2218 O  O   . LEU B 2 117 ? 37.848 28.284  33.309  1.00 29.29 ? 1840 LEU B O   1 
ATOM   2219 C  CB  . LEU B 2 117 ? 39.570 30.773  33.248  1.00 26.48 ? 1840 LEU B CB  1 
ATOM   2220 C  CG  . LEU B 2 117 ? 40.477 31.988  33.426  1.00 25.24 ? 1840 LEU B CG  1 
ATOM   2221 C  CD1 . LEU B 2 117 ? 40.453 32.781  32.127  1.00 25.63 ? 1840 LEU B CD1 1 
ATOM   2222 C  CD2 . LEU B 2 117 ? 39.992 32.864  34.567  1.00 22.18 ? 1840 LEU B CD2 1 
ATOM   2223 N  N   . GLN B 2 118 ? 36.620 29.724  34.516  1.00 30.10 ? 1841 GLN B N   1 
ATOM   2224 C  CA  . GLN B 2 118 ? 35.370 29.083  34.135  1.00 29.16 ? 1841 GLN B CA  1 
ATOM   2225 C  C   . GLN B 2 118 ? 34.881 29.782  32.866  1.00 28.20 ? 1841 GLN B C   1 
ATOM   2226 O  O   . GLN B 2 118 ? 35.388 30.842  32.486  1.00 25.00 ? 1841 GLN B O   1 
ATOM   2227 C  CB  . GLN B 2 118 ? 34.314 29.242  35.235  1.00 28.78 ? 1841 GLN B CB  1 
ATOM   2228 C  CG  . GLN B 2 118 ? 34.769 28.813  36.626  1.00 32.37 ? 1841 GLN B CG  1 
ATOM   2229 C  CD  . GLN B 2 118 ? 35.055 27.323  36.725  1.00 33.00 ? 1841 GLN B CD  1 
ATOM   2230 O  OE1 . GLN B 2 118 ? 34.135 26.500  36.704  1.00 33.06 ? 1841 GLN B OE1 1 
ATOM   2231 N  NE2 . GLN B 2 118 ? 36.338 26.967  36.825  1.00 29.99 ? 1841 GLN B NE2 1 
ATOM   2232 N  N   . ASN B 2 119 ? 33.903 29.177  32.205  1.00 28.11 ? 1842 ASN B N   1 
ATOM   2233 C  CA  . ASN B 2 119 ? 33.327 29.768  31.004  1.00 29.06 ? 1842 ASN B CA  1 
ATOM   2234 C  C   . ASN B 2 119 ? 32.340 30.846  31.469  1.00 29.73 ? 1842 ASN B C   1 
ATOM   2235 O  O   . ASN B 2 119 ? 31.292 30.530  32.044  1.00 29.65 ? 1842 ASN B O   1 
ATOM   2236 C  CB  . ASN B 2 119 ? 32.610 28.690  30.196  1.00 27.86 ? 1842 ASN B CB  1 
ATOM   2237 C  CG  . ASN B 2 119 ? 31.915 29.242  28.984  1.00 28.45 ? 1842 ASN B CG  1 
ATOM   2238 O  OD1 . ASN B 2 119 ? 32.153 30.381  28.580  1.00 31.29 ? 1842 ASN B OD1 1 
ATOM   2239 N  ND2 . ASN B 2 119 ? 31.047 28.433  28.384  1.00 31.26 ? 1842 ASN B ND2 1 
ATOM   2240 N  N   . TYR B 2 120 ? 32.676 32.113  31.235  1.00 30.48 ? 1843 TYR B N   1 
ATOM   2241 C  CA  . TYR B 2 120 ? 31.816 33.208  31.670  1.00 31.48 ? 1843 TYR B CA  1 
ATOM   2242 C  C   . TYR B 2 120 ? 30.422 33.158  31.067  1.00 30.54 ? 1843 TYR B C   1 
ATOM   2243 O  O   . TYR B 2 120 ? 29.473 33.697  31.640  1.00 27.14 ? 1843 TYR B O   1 
ATOM   2244 C  CB  . TYR B 2 120 ? 32.462 34.574  31.368  1.00 34.89 ? 1843 TYR B CB  1 
ATOM   2245 C  CG  . TYR B 2 120 ? 32.601 34.943  29.899  1.00 38.44 ? 1843 TYR B CG  1 
ATOM   2246 C  CD1 . TYR B 2 120 ? 31.481 35.142  29.092  1.00 39.22 ? 1843 TYR B CD1 1 
ATOM   2247 C  CD2 . TYR B 2 120 ? 33.861 35.132  29.325  1.00 41.75 ? 1843 TYR B CD2 1 
ATOM   2248 C  CE1 . TYR B 2 120 ? 31.607 35.524  27.750  1.00 40.14 ? 1843 TYR B CE1 1 
ATOM   2249 C  CE2 . TYR B 2 120 ? 33.998 35.514  27.986  1.00 42.44 ? 1843 TYR B CE2 1 
ATOM   2250 C  CZ  . TYR B 2 120 ? 32.864 35.709  27.211  1.00 42.20 ? 1843 TYR B CZ  1 
ATOM   2251 O  OH  . TYR B 2 120 ? 32.990 36.115  25.904  1.00 45.49 ? 1843 TYR B OH  1 
ATOM   2252 N  N   . ARG B 2 121 ? 30.292 32.508  29.917  1.00 30.78 ? 1844 ARG B N   1 
ATOM   2253 C  CA  . ARG B 2 121 ? 28.993 32.423  29.268  1.00 32.09 ? 1844 ARG B CA  1 
ATOM   2254 C  C   . ARG B 2 121 ? 27.961 31.681  30.129  1.00 33.91 ? 1844 ARG B C   1 
ATOM   2255 O  O   . ARG B 2 121 ? 26.761 31.694  29.817  1.00 32.79 ? 1844 ARG B O   1 
ATOM   2256 C  CB  . ARG B 2 121 ? 29.115 31.740  27.905  1.00 32.80 ? 1844 ARG B CB  1 
ATOM   2257 C  CG  . ARG B 2 121 ? 30.034 32.473  26.956  1.00 34.79 ? 1844 ARG B CG  1 
ATOM   2258 C  CD  . ARG B 2 121 ? 29.916 32.000  25.514  1.00 35.78 ? 1844 ARG B CD  1 
ATOM   2259 N  NE  . ARG B 2 121 ? 30.712 32.871  24.650  1.00 41.86 ? 1844 ARG B NE  1 
ATOM   2260 C  CZ  . ARG B 2 121 ? 32.044 32.967  24.711  1.00 44.55 ? 1844 ARG B CZ  1 
ATOM   2261 N  NH1 . ARG B 2 121 ? 32.695 33.793  23.896  1.00 43.64 ? 1844 ARG B NH1 1 
ATOM   2262 N  NH2 . ARG B 2 121 ? 32.732 32.222  25.576  1.00 44.24 ? 1844 ARG B NH2 1 
ATOM   2263 N  N   . ASN B 2 122 ? 28.417 31.027  31.199  1.00 31.47 ? 1845 ASN B N   1 
ATOM   2264 C  CA  . ASN B 2 122 ? 27.497 30.312  32.092  1.00 31.33 ? 1845 ASN B CA  1 
ATOM   2265 C  C   . ASN B 2 122 ? 27.178 31.200  33.287  1.00 31.36 ? 1845 ASN B C   1 
ATOM   2266 O  O   . ASN B 2 122 ? 26.491 30.778  34.231  1.00 29.42 ? 1845 ASN B O   1 
ATOM   2267 C  CB  . ASN B 2 122 ? 28.099 29.006  32.646  1.00 32.76 ? 1845 ASN B CB  1 
ATOM   2268 C  CG  . ASN B 2 122 ? 28.169 27.890  31.621  1.00 33.67 ? 1845 ASN B CG  1 
ATOM   2269 O  OD1 . ASN B 2 122 ? 27.247 27.689  30.824  1.00 37.81 ? 1845 ASN B OD1 1 
ATOM   2270 N  ND2 . ASN B 2 122 ? 29.260 27.134  31.658  1.00 33.42 ? 1845 ASN B ND2 1 
ATOM   2271 N  N   . TYR B 2 123 ? 27.700 32.421  33.258  1.00 30.73 ? 1846 TYR B N   1 
ATOM   2272 C  CA  . TYR B 2 123 ? 27.473 33.360  34.342  1.00 27.59 ? 1846 TYR B CA  1 
ATOM   2273 C  C   . TYR B 2 123 ? 26.983 34.718  33.861  1.00 27.20 ? 1846 TYR B C   1 
ATOM   2274 O  O   . TYR B 2 123 ? 27.069 35.702  34.605  1.00 27.16 ? 1846 TYR B O   1 
ATOM   2275 C  CB  . TYR B 2 123 ? 28.757 33.555  35.126  1.00 28.03 ? 1846 TYR B CB  1 
ATOM   2276 C  CG  . TYR B 2 123 ? 29.290 32.300  35.768  1.00 27.72 ? 1846 TYR B CG  1 
ATOM   2277 C  CD1 . TYR B 2 123 ? 30.022 31.371  35.025  1.00 27.54 ? 1846 TYR B CD1 1 
ATOM   2278 C  CD2 . TYR B 2 123 ? 29.108 32.064  37.138  1.00 25.05 ? 1846 TYR B CD2 1 
ATOM   2279 C  CE1 . TYR B 2 123 ? 30.577 30.240  35.632  1.00 27.74 ? 1846 TYR B CE1 1 
ATOM   2280 C  CE2 . TYR B 2 123 ? 29.650 30.940  37.753  1.00 24.77 ? 1846 TYR B CE2 1 
ATOM   2281 C  CZ  . TYR B 2 123 ? 30.386 30.035  36.997  1.00 26.89 ? 1846 TYR B CZ  1 
ATOM   2282 O  OH  . TYR B 2 123 ? 30.940 28.931  37.600  1.00 30.16 ? 1846 TYR B OH  1 
ATOM   2283 N  N   . LEU B 2 124 ? 26.472 34.785  32.630  1.00 26.03 ? 1847 LEU B N   1 
ATOM   2284 C  CA  . LEU B 2 124 ? 25.989 36.056  32.099  1.00 23.77 ? 1847 LEU B CA  1 
ATOM   2285 C  C   . LEU B 2 124 ? 24.840 36.558  32.945  1.00 22.21 ? 1847 LEU B C   1 
ATOM   2286 O  O   . LEU B 2 124 ? 24.020 35.771  33.416  1.00 20.87 ? 1847 LEU B O   1 
ATOM   2287 C  CB  . LEU B 2 124 ? 25.524 35.908  30.656  1.00 24.40 ? 1847 LEU B CB  1 
ATOM   2288 C  CG  . LEU B 2 124 ? 26.625 35.626  29.637  1.00 29.07 ? 1847 LEU B CG  1 
ATOM   2289 C  CD1 . LEU B 2 124 ? 26.016 35.087  28.339  1.00 32.45 ? 1847 LEU B CD1 1 
ATOM   2290 C  CD2 . LEU B 2 124 ? 27.408 36.887  29.381  1.00 27.41 ? 1847 LEU B CD2 1 
ATOM   2291 N  N   . LEU B 2 125 ? 24.805 37.871  33.152  1.00 22.03 ? 1848 LEU B N   1 
ATOM   2292 C  CA  . LEU B 2 125 ? 23.756 38.520  33.926  1.00 22.33 ? 1848 LEU B CA  1 
ATOM   2293 C  C   . LEU B 2 125 ? 22.623 38.921  32.978  1.00 24.54 ? 1848 LEU B C   1 
ATOM   2294 O  O   . LEU B 2 125 ? 22.834 39.081  31.768  1.00 23.93 ? 1848 LEU B O   1 
ATOM   2295 C  CB  . LEU B 2 125 ? 24.313 39.783  34.588  1.00 22.00 ? 1848 LEU B CB  1 
ATOM   2296 C  CG  . LEU B 2 125 ? 25.261 39.621  35.781  1.00 21.14 ? 1848 LEU B CG  1 
ATOM   2297 C  CD1 . LEU B 2 125 ? 25.815 40.971  36.196  1.00 18.73 ? 1848 LEU B CD1 1 
ATOM   2298 C  CD2 . LEU B 2 125 ? 24.502 38.984  36.935  1.00 18.00 ? 1848 LEU B CD2 1 
ATOM   2299 N  N   . PRO B 2 126 ? 21.400 39.085  33.506  1.00 25.20 ? 1849 PRO B N   1 
ATOM   2300 C  CA  . PRO B 2 126 ? 20.307 39.481  32.607  1.00 25.80 ? 1849 PRO B CA  1 
ATOM   2301 C  C   . PRO B 2 126 ? 20.567 40.890  32.063  1.00 27.11 ? 1849 PRO B C   1 
ATOM   2302 O  O   . PRO B 2 126 ? 21.382 41.635  32.620  1.00 29.52 ? 1849 PRO B O   1 
ATOM   2303 C  CB  . PRO B 2 126 ? 19.070 39.405  33.503  1.00 21.51 ? 1849 PRO B CB  1 
ATOM   2304 C  CG  . PRO B 2 126 ? 19.622 39.621  34.879  1.00 25.64 ? 1849 PRO B CG  1 
ATOM   2305 C  CD  . PRO B 2 126 ? 20.922 38.868  34.880  1.00 24.07 ? 1849 PRO B CD  1 
ATOM   2306 N  N   . ALA B 2 127 ? 19.899 41.264  30.975  1.00 26.60 ? 1850 ALA B N   1 
ATOM   2307 C  CA  . ALA B 2 127 ? 20.113 42.602  30.425  1.00 27.91 ? 1850 ALA B CA  1 
ATOM   2308 C  C   . ALA B 2 127 ? 19.449 43.649  31.319  1.00 28.04 ? 1850 ALA B C   1 
ATOM   2309 O  O   . ALA B 2 127 ? 20.049 44.672  31.632  1.00 28.15 ? 1850 ALA B O   1 
ATOM   2310 C  CB  . ALA B 2 127 ? 19.570 42.704  28.989  1.00 22.60 ? 1850 ALA B CB  1 
ATOM   2311 N  N   . GLY B 2 128 ? 18.211 43.385  31.726  1.00 27.68 ? 1851 GLY B N   1 
ATOM   2312 C  CA  . GLY B 2 128 ? 17.496 44.314  32.576  1.00 28.79 ? 1851 GLY B CA  1 
ATOM   2313 C  C   . GLY B 2 128 ? 16.001 44.053  32.550  1.00 32.02 ? 1851 GLY B C   1 
ATOM   2314 O  O   . GLY B 2 128 ? 15.539 43.078  31.937  1.00 32.97 ? 1851 GLY B O   1 
ATOM   2315 N  N   . TYR B 2 129 ? 15.245 44.913  33.229  1.00 34.05 ? 1852 TYR B N   1 
ATOM   2316 C  CA  . TYR B 2 129 ? 13.791 44.797  33.275  1.00 34.93 ? 1852 TYR B CA  1 
ATOM   2317 C  C   . TYR B 2 129 ? 13.200 45.467  32.032  1.00 35.99 ? 1852 TYR B C   1 
ATOM   2318 O  O   . TYR B 2 129 ? 13.471 46.635  31.768  1.00 36.01 ? 1852 TYR B O   1 
ATOM   2319 C  CB  . TYR B 2 129 ? 13.245 45.481  34.527  1.00 35.86 ? 1852 TYR B CB  1 
ATOM   2320 C  CG  . TYR B 2 129 ? 11.742 45.432  34.600  1.00 39.25 ? 1852 TYR B CG  1 
ATOM   2321 C  CD1 . TYR B 2 129 ? 11.088 44.287  35.052  1.00 40.73 ? 1852 TYR B CD1 1 
ATOM   2322 C  CD2 . TYR B 2 129 ? 10.964 46.500  34.139  1.00 38.59 ? 1852 TYR B CD2 1 
ATOM   2323 C  CE1 . TYR B 2 129 ? 9.693  44.200  35.036  1.00 42.12 ? 1852 TYR B CE1 1 
ATOM   2324 C  CE2 . TYR B 2 129 ? 9.573  46.423  34.116  1.00 40.27 ? 1852 TYR B CE2 1 
ATOM   2325 C  CZ  . TYR B 2 129 ? 8.945  45.267  34.562  1.00 41.70 ? 1852 TYR B CZ  1 
ATOM   2326 O  OH  . TYR B 2 129 ? 7.580  45.149  34.492  1.00 42.17 ? 1852 TYR B OH  1 
ATOM   2327 N  N   . SER B 2 130 ? 12.400 44.728  31.265  1.00 37.55 ? 1853 SER B N   1 
ATOM   2328 C  CA  . SER B 2 130 ? 11.789 45.275  30.054  1.00 38.89 ? 1853 SER B CA  1 
ATOM   2329 C  C   . SER B 2 130 ? 10.400 45.841  30.301  1.00 40.64 ? 1853 SER B C   1 
ATOM   2330 O  O   . SER B 2 130 ? 9.526  45.157  30.826  1.00 44.40 ? 1853 SER B O   1 
ATOM   2331 C  CB  . SER B 2 130 ? 11.692 44.209  28.961  1.00 37.99 ? 1853 SER B CB  1 
ATOM   2332 O  OG  . SER B 2 130 ? 10.804 44.636  27.939  1.00 36.28 ? 1853 SER B OG  1 
ATOM   2333 N  N   . LEU B 2 131 ? 10.194 47.090  29.909  1.00 40.85 ? 1854 LEU B N   1 
ATOM   2334 C  CA  . LEU B 2 131 ? 8.896  47.728  30.093  1.00 41.51 ? 1854 LEU B CA  1 
ATOM   2335 C  C   . LEU B 2 131 ? 7.842  47.014  29.260  1.00 43.61 ? 1854 LEU B C   1 
ATOM   2336 O  O   . LEU B 2 131 ? 6.747  46.713  29.739  1.00 44.53 ? 1854 LEU B O   1 
ATOM   2337 C  CB  . LEU B 2 131 ? 8.981  49.188  29.677  1.00 37.48 ? 1854 LEU B CB  1 
ATOM   2338 C  CG  . LEU B 2 131 ? 9.804  50.041  30.633  1.00 34.33 ? 1854 LEU B CG  1 
ATOM   2339 C  CD1 . LEU B 2 131 ? 9.855  51.461  30.120  1.00 33.73 ? 1854 LEU B CD1 1 
ATOM   2340 C  CD2 . LEU B 2 131 ? 9.174  49.983  32.019  1.00 31.08 ? 1854 LEU B CD2 1 
ATOM   2341 N  N   . GLU B 2 132 ? 8.198  46.741  28.012  1.00 44.80 ? 1855 GLU B N   1 
ATOM   2342 C  CA  . GLU B 2 132 ? 7.330  46.060  27.065  1.00 46.15 ? 1855 GLU B CA  1 
ATOM   2343 C  C   . GLU B 2 132 ? 6.920  44.645  27.510  1.00 47.18 ? 1855 GLU B C   1 
ATOM   2344 O  O   . GLU B 2 132 ? 5.728  44.342  27.624  1.00 45.25 ? 1855 GLU B O   1 
ATOM   2345 C  CB  . GLU B 2 132 ? 8.041  45.988  25.704  1.00 48.65 ? 1855 GLU B CB  1 
ATOM   2346 C  CG  . GLU B 2 132 ? 7.345  45.127  24.659  1.00 48.82 ? 1855 GLU B CG  1 
ATOM   2347 C  CD  . GLU B 2 132 ? 5.953  45.622  24.343  1.00 50.56 ? 1855 GLU B CD  1 
ATOM   2348 O  OE1 . GLU B 2 132 ? 5.823  46.757  23.823  1.00 50.90 ? 1855 GLU B OE1 1 
ATOM   2349 O  OE2 . GLU B 2 132 ? 4.988  44.877  24.625  1.00 51.20 ? 1855 GLU B OE2 1 
ATOM   2350 N  N   . GLU B 2 133 ? 7.910  43.783  27.748  1.00 46.97 ? 1856 GLU B N   1 
ATOM   2351 C  CA  . GLU B 2 133 ? 7.655  42.403  28.155  1.00 47.45 ? 1856 GLU B CA  1 
ATOM   2352 C  C   . GLU B 2 133 ? 7.211  42.283  29.613  1.00 47.96 ? 1856 GLU B C   1 
ATOM   2353 O  O   . GLU B 2 133 ? 6.695  41.247  30.033  1.00 47.28 ? 1856 GLU B O   1 
ATOM   2354 C  CB  . GLU B 2 133 ? 8.910  41.562  27.947  1.00 50.18 ? 1856 GLU B CB  1 
ATOM   2355 C  CG  . GLU B 2 133 ? 9.450  41.566  26.531  1.00 53.36 ? 1856 GLU B CG  1 
ATOM   2356 C  CD  . GLU B 2 133 ? 8.656  40.671  25.613  1.00 56.13 ? 1856 GLU B CD  1 
ATOM   2357 O  OE1 . GLU B 2 133 ? 8.524  39.466  25.928  1.00 59.12 ? 1856 GLU B OE1 1 
ATOM   2358 O  OE2 . GLU B 2 133 ? 8.169  41.168  24.577  1.00 56.55 ? 1856 GLU B OE2 1 
ATOM   2359 N  N   . GLN B 2 134 ? 7.426  43.336  30.391  1.00 49.63 ? 1857 GLN B N   1 
ATOM   2360 C  CA  . GLN B 2 134 ? 7.023  43.324  31.796  1.00 50.74 ? 1857 GLN B CA  1 
ATOM   2361 C  C   . GLN B 2 134 ? 7.729  42.248  32.629  1.00 48.94 ? 1857 GLN B C   1 
ATOM   2362 O  O   . GLN B 2 134 ? 7.120  41.632  33.508  1.00 50.32 ? 1857 GLN B O   1 
ATOM   2363 C  CB  . GLN B 2 134 ? 5.507  43.129  31.884  1.00 53.42 ? 1857 GLN B CB  1 
ATOM   2364 C  CG  . GLN B 2 134 ? 4.699  44.376  31.565  1.00 57.30 ? 1857 GLN B CG  1 
ATOM   2365 C  CD  . GLN B 2 134 ? 4.640  45.330  32.744  1.00 60.48 ? 1857 GLN B CD  1 
ATOM   2366 O  OE1 . GLN B 2 134 ? 4.024  45.018  33.770  1.00 61.39 ? 1857 GLN B OE1 1 
ATOM   2367 N  NE2 . GLN B 2 134 ? 5.288  46.494  32.613  1.00 59.92 ? 1857 GLN B NE2 1 
ATOM   2368 N  N   . ARG B 2 135 ? 9.010  42.025  32.354  1.00 43.78 ? 1858 ARG B N   1 
ATOM   2369 C  CA  . ARG B 2 135 ? 9.784  41.034  33.091  1.00 39.63 ? 1858 ARG B CA  1 
ATOM   2370 C  C   . ARG B 2 135 ? 11.267 41.267  32.854  1.00 37.19 ? 1858 ARG B C   1 
ATOM   2371 O  O   . ARG B 2 135 ? 11.654 42.089  32.031  1.00 36.75 ? 1858 ARG B O   1 
ATOM   2372 C  CB  . ARG B 2 135 ? 9.410  39.622  32.637  1.00 40.72 ? 1858 ARG B CB  1 
ATOM   2373 C  CG  . ARG B 2 135 ? 9.828  39.303  31.212  1.00 42.12 ? 1858 ARG B CG  1 
ATOM   2374 C  CD  . ARG B 2 135 ? 9.060  38.119  30.657  1.00 44.39 ? 1858 ARG B CD  1 
ATOM   2375 N  NE  . ARG B 2 135 ? 9.419  37.852  29.267  1.00 46.28 ? 1858 ARG B NE  1 
ATOM   2376 C  CZ  . ARG B 2 135 ? 10.530 37.232  28.887  1.00 46.65 ? 1858 ARG B CZ  1 
ATOM   2377 N  NH1 . ARG B 2 135 ? 11.398 36.804  29.799  1.00 46.29 ? 1858 ARG B NH1 1 
ATOM   2378 N  NH2 . ARG B 2 135 ? 10.774 37.044  27.595  1.00 47.01 ? 1858 ARG B NH2 1 
ATOM   2379 N  N   . ILE B 2 136 ? 12.098 40.544  33.588  1.00 35.94 ? 1859 ILE B N   1 
ATOM   2380 C  CA  . ILE B 2 136 ? 13.542 40.661  33.436  1.00 30.87 ? 1859 ILE B CA  1 
ATOM   2381 C  C   . ILE B 2 136 ? 13.965 39.883  32.205  1.00 30.43 ? 1859 ILE B C   1 
ATOM   2382 O  O   . ILE B 2 136 ? 13.734 38.678  32.126  1.00 31.39 ? 1859 ILE B O   1 
ATOM   2383 C  CB  . ILE B 2 136 ? 14.267 40.082  34.650  1.00 28.38 ? 1859 ILE B CB  1 
ATOM   2384 C  CG1 . ILE B 2 136 ? 14.103 41.032  35.845  1.00 26.67 ? 1859 ILE B CG1 1 
ATOM   2385 C  CG2 . ILE B 2 136 ? 15.716 39.819  34.303  1.00 30.84 ? 1859 ILE B CG2 1 
ATOM   2386 C  CD1 . ILE B 2 136 ? 14.664 40.498  37.145  1.00 23.55 ? 1859 ILE B CD1 1 
ATOM   2387 N  N   . LEU B 2 137 ? 14.574 40.566  31.242  1.00 28.39 ? 1860 LEU B N   1 
ATOM   2388 C  CA  . LEU B 2 137 ? 15.025 39.892  30.028  1.00 29.47 ? 1860 LEU B CA  1 
ATOM   2389 C  C   . LEU B 2 137 ? 16.474 39.436  30.086  1.00 28.76 ? 1860 LEU B C   1 
ATOM   2390 O  O   . LEU B 2 137 ? 17.344 40.120  30.624  1.00 27.28 ? 1860 LEU B O   1 
ATOM   2391 C  CB  . LEU B 2 137 ? 14.866 40.798  28.807  1.00 32.43 ? 1860 LEU B CB  1 
ATOM   2392 C  CG  . LEU B 2 137 ? 13.479 40.903  28.174  1.00 33.96 ? 1860 LEU B CG  1 
ATOM   2393 C  CD1 . LEU B 2 137 ? 13.556 41.847  26.986  1.00 32.94 ? 1860 LEU B CD1 1 
ATOM   2394 C  CD2 . LEU B 2 137 ? 12.996 39.517  27.737  1.00 35.28 ? 1860 LEU B CD2 1 
ATOM   2395 N  N   . ASP B 2 138 ? 16.722 38.268  29.513  1.00 30.38 ? 1861 ASP B N   1 
ATOM   2396 C  CA  . ASP B 2 138 ? 18.061 37.707  29.457  1.00 30.75 ? 1861 ASP B CA  1 
ATOM   2397 C  C   . ASP B 2 138 ? 18.824 38.444  28.365  1.00 30.99 ? 1861 ASP B C   1 
ATOM   2398 O  O   . ASP B 2 138 ? 18.217 39.139  27.539  1.00 29.91 ? 1861 ASP B O   1 
ATOM   2399 C  CB  . ASP B 2 138 ? 17.977 36.222  29.114  1.00 32.26 ? 1861 ASP B CB  1 
ATOM   2400 C  CG  . ASP B 2 138 ? 17.704 35.354  30.339  1.00 36.78 ? 1861 ASP B CG  1 
ATOM   2401 O  OD1 . ASP B 2 138 ? 17.232 35.902  31.379  1.00 33.98 ? 1861 ASP B OD1 1 
ATOM   2402 O  OD2 . ASP B 2 138 ? 17.962 34.122  30.248  1.00 35.88 ? 1861 ASP B OD2 1 
ATOM   2403 N  N   . TRP B 2 139 ? 20.147 38.297  28.354  1.00 29.36 ? 1862 TRP B N   1 
ATOM   2404 C  CA  . TRP B 2 139 ? 20.977 38.954  27.349  1.00 29.43 ? 1862 TRP B CA  1 
ATOM   2405 C  C   . TRP B 2 139 ? 21.274 38.021  26.191  1.00 29.80 ? 1862 TRP B C   1 
ATOM   2406 O  O   . TRP B 2 139 ? 21.586 36.847  26.393  1.00 32.24 ? 1862 TRP B O   1 
ATOM   2407 C  CB  . TRP B 2 139 ? 22.322 39.383  27.937  1.00 31.80 ? 1862 TRP B CB  1 
ATOM   2408 C  CG  . TRP B 2 139 ? 23.183 40.117  26.943  1.00 34.53 ? 1862 TRP B CG  1 
ATOM   2409 C  CD1 . TRP B 2 139 ? 23.148 41.452  26.665  1.00 38.35 ? 1862 TRP B CD1 1 
ATOM   2410 C  CD2 . TRP B 2 139 ? 24.122 39.546  26.020  1.00 37.79 ? 1862 TRP B CD2 1 
ATOM   2411 N  NE1 . TRP B 2 139 ? 24.000 41.752  25.624  1.00 37.81 ? 1862 TRP B NE1 1 
ATOM   2412 C  CE2 . TRP B 2 139 ? 24.609 40.599  25.209  1.00 38.49 ? 1862 TRP B CE2 1 
ATOM   2413 C  CE3 . TRP B 2 139 ? 24.597 38.248  25.795  1.00 38.70 ? 1862 TRP B CE3 1 
ATOM   2414 C  CZ2 . TRP B 2 139 ? 25.549 40.394  24.191  1.00 39.51 ? 1862 TRP B CZ2 1 
ATOM   2415 C  CZ3 . TRP B 2 139 ? 25.535 38.047  24.779  1.00 40.75 ? 1862 TRP B CZ3 1 
ATOM   2416 C  CH2 . TRP B 2 139 ? 25.998 39.115  23.992  1.00 39.69 ? 1862 TRP B CH2 1 
ATOM   2417 N  N   . GLN B 2 140 ? 21.196 38.545  24.977  1.00 30.80 ? 1863 GLN B N   1 
ATOM   2418 C  CA  . GLN B 2 140 ? 21.507 37.752  23.802  1.00 35.01 ? 1863 GLN B CA  1 
ATOM   2419 C  C   . GLN B 2 140 ? 22.260 38.620  22.784  1.00 37.48 ? 1863 GLN B C   1 
ATOM   2420 O  O   . GLN B 2 140 ? 22.114 39.847  22.769  1.00 34.15 ? 1863 GLN B O   1 
ATOM   2421 C  CB  . GLN B 2 140 ? 20.230 37.177  23.191  1.00 39.27 ? 1863 GLN B CB  1 
ATOM   2422 C  CG  . GLN B 2 140 ? 19.294 38.188  22.565  1.00 48.14 ? 1863 GLN B CG  1 
ATOM   2423 C  CD  . GLN B 2 140 ? 18.150 37.513  21.818  1.00 53.14 ? 1863 GLN B CD  1 
ATOM   2424 O  OE1 . GLN B 2 140 ? 18.375 36.619  20.991  1.00 55.50 ? 1863 GLN B OE1 1 
ATOM   2425 N  NE2 . GLN B 2 140 ? 16.915 37.941  22.099  1.00 54.23 ? 1863 GLN B NE2 1 
ATOM   2426 N  N   . PRO B 2 141 ? 23.091 37.996  21.927  1.00 40.12 ? 1864 PRO B N   1 
ATOM   2427 C  CA  . PRO B 2 141 ? 23.825 38.808  20.949  1.00 40.94 ? 1864 PRO B CA  1 
ATOM   2428 C  C   . PRO B 2 141 ? 22.879 39.740  20.191  1.00 39.68 ? 1864 PRO B C   1 
ATOM   2429 O  O   . PRO B 2 141 ? 21.755 39.357  19.850  1.00 40.20 ? 1864 PRO B O   1 
ATOM   2430 C  CB  . PRO B 2 141 ? 24.477 37.760  20.046  1.00 41.60 ? 1864 PRO B CB  1 
ATOM   2431 C  CG  . PRO B 2 141 ? 23.494 36.619  20.101  1.00 42.55 ? 1864 PRO B CG  1 
ATOM   2432 C  CD  . PRO B 2 141 ? 23.172 36.565  21.578  1.00 40.60 ? 1864 PRO B CD  1 
ATOM   2433 N  N   . ARG B 2 142 ? 23.332 40.966  19.948  1.00 37.53 ? 1865 ARG B N   1 
ATOM   2434 C  CA  . ARG B 2 142 ? 22.514 41.948  19.240  1.00 37.09 ? 1865 ARG B CA  1 
ATOM   2435 C  C   . ARG B 2 142 ? 23.367 42.812  18.316  1.00 37.53 ? 1865 ARG B C   1 
ATOM   2436 O  O   . ARG B 2 142 ? 24.598 42.766  18.350  1.00 34.16 ? 1865 ARG B O   1 
ATOM   2437 C  CB  . ARG B 2 142 ? 21.808 42.885  20.224  1.00 34.82 ? 1865 ARG B CB  1 
ATOM   2438 C  CG  . ARG B 2 142 ? 22.754 43.883  20.928  1.00 32.71 ? 1865 ARG B CG  1 
ATOM   2439 C  CD  . ARG B 2 142 ? 23.355 43.291  22.200  1.00 29.20 ? 1865 ARG B CD  1 
ATOM   2440 N  NE  . ARG B 2 142 ? 22.309 42.991  23.182  1.00 31.11 ? 1865 ARG B NE  1 
ATOM   2441 C  CZ  . ARG B 2 142 ? 21.590 43.913  23.823  1.00 31.49 ? 1865 ARG B CZ  1 
ATOM   2442 N  NH1 . ARG B 2 142 ? 20.653 43.548  24.698  1.00 31.05 ? 1865 ARG B NH1 1 
ATOM   2443 N  NH2 . ARG B 2 142 ? 21.815 45.204  23.604  1.00 31.37 ? 1865 ARG B NH2 1 
ATOM   2444 N  N   . GLU B 2 143 ? 22.696 43.604  17.490  1.00 40.03 ? 1866 GLU B N   1 
ATOM   2445 C  CA  . GLU B 2 143 ? 23.377 44.512  16.582  1.00 42.43 ? 1866 GLU B CA  1 
ATOM   2446 C  C   . GLU B 2 143 ? 23.235 45.903  17.174  1.00 41.58 ? 1866 GLU B C   1 
ATOM   2447 O  O   . GLU B 2 143 ? 22.158 46.247  17.673  1.00 42.13 ? 1866 GLU B O   1 
ATOM   2448 C  CB  . GLU B 2 143 ? 22.726 44.499  15.193  1.00 46.61 ? 1866 GLU B CB  1 
ATOM   2449 C  CG  . GLU B 2 143 ? 23.028 43.273  14.331  1.00 53.00 ? 1866 GLU B CG  1 
ATOM   2450 C  CD  . GLU B 2 143 ? 22.525 43.432  12.895  1.00 56.43 ? 1866 GLU B CD  1 
ATOM   2451 O  OE1 . GLU B 2 143 ? 21.287 43.496  12.697  1.00 59.48 ? 1866 GLU B OE1 1 
ATOM   2452 O  OE2 . GLU B 2 143 ? 23.366 43.499  11.965  1.00 55.72 ? 1866 GLU B OE2 1 
ATOM   2453 N  N   . ASN B 2 144 ? 24.313 46.689  17.126  1.00 39.93 ? 1867 ASN B N   1 
ATOM   2454 C  CA  . ASN B 2 144 ? 24.307 48.066  17.638  1.00 40.45 ? 1867 ASN B CA  1 
ATOM   2455 C  C   . ASN B 2 144 ? 22.916 48.681  17.457  1.00 40.86 ? 1867 ASN B C   1 
ATOM   2456 O  O   . ASN B 2 144 ? 22.518 49.041  16.346  1.00 42.77 ? 1867 ASN B O   1 
ATOM   2457 C  CB  . ASN B 2 144 ? 25.325 48.909  16.877  1.00 39.56 ? 1867 ASN B CB  1 
ATOM   2458 C  CG  . ASN B 2 144 ? 26.756 48.552  17.217  1.00 40.83 ? 1867 ASN B CG  1 
ATOM   2459 O  OD1 . ASN B 2 144 ? 27.670 48.824  16.439  1.00 39.70 ? 1867 ASN B OD1 1 
ATOM   2460 N  ND2 . ASN B 2 144 ? 26.964 47.960  18.391  1.00 41.76 ? 1867 ASN B ND2 1 
ATOM   2461 N  N   . PRO B 2 145 ? 22.161 48.817  18.554  1.00 39.72 ? 1868 PRO B N   1 
ATOM   2462 C  CA  . PRO B 2 145 ? 20.802 49.375  18.545  1.00 38.59 ? 1868 PRO B CA  1 
ATOM   2463 C  C   . PRO B 2 145 ? 20.623 50.822  18.074  1.00 37.81 ? 1868 PRO B C   1 
ATOM   2464 O  O   . PRO B 2 145 ? 19.487 51.282  17.865  1.00 40.36 ? 1868 PRO B O   1 
ATOM   2465 C  CB  . PRO B 2 145 ? 20.345 49.165  19.990  1.00 37.00 ? 1868 PRO B CB  1 
ATOM   2466 C  CG  . PRO B 2 145 ? 21.629 49.293  20.761  1.00 37.93 ? 1868 PRO B CG  1 
ATOM   2467 C  CD  . PRO B 2 145 ? 22.611 48.523  19.927  1.00 36.56 ? 1868 PRO B CD  1 
ATOM   2468 N  N   . PHE B 2 146 ? 21.722 51.544  17.897  1.00 34.70 ? 1869 PHE B N   1 
ATOM   2469 C  CA  . PHE B 2 146 ? 21.616 52.937  17.460  1.00 34.63 ? 1869 PHE B CA  1 
ATOM   2470 C  C   . PHE B 2 146 ? 22.322 53.180  16.124  1.00 35.59 ? 1869 PHE B C   1 
ATOM   2471 O  O   . PHE B 2 146 ? 22.584 54.319  15.745  1.00 34.67 ? 1869 PHE B O   1 
ATOM   2472 C  CB  . PHE B 2 146 ? 22.179 53.859  18.548  1.00 28.02 ? 1869 PHE B CB  1 
ATOM   2473 C  CG  . PHE B 2 146 ? 21.603 53.596  19.913  1.00 24.38 ? 1869 PHE B CG  1 
ATOM   2474 C  CD1 . PHE B 2 146 ? 22.434 53.373  21.004  1.00 23.37 ? 1869 PHE B CD1 1 
ATOM   2475 C  CD2 . PHE B 2 146 ? 20.224 53.556  20.105  1.00 22.88 ? 1869 PHE B CD2 1 
ATOM   2476 C  CE1 . PHE B 2 146 ? 21.898 53.112  22.269  1.00 23.96 ? 1869 PHE B CE1 1 
ATOM   2477 C  CE2 . PHE B 2 146 ? 19.679 53.298  21.364  1.00 19.77 ? 1869 PHE B CE2 1 
ATOM   2478 C  CZ  . PHE B 2 146 ? 20.518 53.075  22.447  1.00 22.07 ? 1869 PHE B CZ  1 
ATOM   2479 N  N   . GLN B 2 147 ? 22.610 52.094  15.409  1.00 38.28 ? 1870 GLN B N   1 
ATOM   2480 C  CA  . GLN B 2 147 ? 23.279 52.162  14.112  1.00 38.32 ? 1870 GLN B CA  1 
ATOM   2481 C  C   . GLN B 2 147 ? 22.761 53.288  13.226  1.00 36.02 ? 1870 GLN B C   1 
ATOM   2482 O  O   . GLN B 2 147 ? 21.555 53.426  13.026  1.00 32.46 ? 1870 GLN B O   1 
ATOM   2483 C  CB  . GLN B 2 147 ? 23.123 50.839  13.353  1.00 41.27 ? 1870 GLN B CB  1 
ATOM   2484 C  CG  . GLN B 2 147 ? 24.202 49.810  13.648  1.00 46.22 ? 1870 GLN B CG  1 
ATOM   2485 C  CD  . GLN B 2 147 ? 25.606 50.394  13.542  1.00 46.40 ? 1870 GLN B CD  1 
ATOM   2486 O  OE1 . GLN B 2 147 ? 25.912 51.147  12.610  1.00 43.23 ? 1870 GLN B OE1 1 
ATOM   2487 N  NE2 . GLN B 2 147 ? 26.470 50.039  14.495  1.00 44.57 ? 1870 GLN B NE2 1 
ATOM   2488 N  N   . ASN B 2 148 ? 23.686 54.082  12.698  1.00 35.15 ? 1871 ASN B N   1 
ATOM   2489 C  CA  . ASN B 2 148 ? 23.358 55.195  11.810  1.00 39.62 ? 1871 ASN B CA  1 
ATOM   2490 C  C   . ASN B 2 148 ? 22.254 56.130  12.281  1.00 38.23 ? 1871 ASN B C   1 
ATOM   2491 O  O   . ASN B 2 148 ? 21.622 56.825  11.480  1.00 38.64 ? 1871 ASN B O   1 
ATOM   2492 C  CB  . ASN B 2 148 ? 23.028 54.669  10.410  1.00 42.18 ? 1871 ASN B CB  1 
ATOM   2493 C  CG  . ASN B 2 148 ? 24.255 54.634  9.511   1.00 47.21 ? 1871 ASN B CG  1 
ATOM   2494 O  OD1 . ASN B 2 148 ? 24.836 55.684  9.193   1.00 47.34 ? 1871 ASN B OD1 1 
ATOM   2495 N  ND2 . ASN B 2 148 ? 24.669 53.434  9.112   1.00 44.53 ? 1871 ASN B ND2 1 
ATOM   2496 N  N   . LEU B 2 149 ? 22.029 56.156  13.584  1.00 36.87 ? 1872 LEU B N   1 
ATOM   2497 C  CA  . LEU B 2 149 ? 21.004 57.013  14.140  1.00 34.61 ? 1872 LEU B CA  1 
ATOM   2498 C  C   . LEU B 2 149 ? 21.645 58.372  14.383  1.00 35.08 ? 1872 LEU B C   1 
ATOM   2499 O  O   . LEU B 2 149 ? 22.761 58.454  14.908  1.00 37.03 ? 1872 LEU B O   1 
ATOM   2500 C  CB  . LEU B 2 149 ? 20.489 56.412  15.451  1.00 33.18 ? 1872 LEU B CB  1 
ATOM   2501 C  CG  . LEU B 2 149 ? 19.175 56.929  16.048  1.00 32.86 ? 1872 LEU B CG  1 
ATOM   2502 C  CD1 . LEU B 2 149 ? 18.002 56.452  15.207  1.00 28.97 ? 1872 LEU B CD1 1 
ATOM   2503 C  CD2 . LEU B 2 149 ? 19.027 56.420  17.484  1.00 31.17 ? 1872 LEU B CD2 1 
ATOM   2504 N  N   . LYS B 2 150 ? 20.959 59.433  13.969  1.00 33.52 ? 1873 LYS B N   1 
ATOM   2505 C  CA  . LYS B 2 150 ? 21.453 60.793  14.170  1.00 32.84 ? 1873 LYS B CA  1 
ATOM   2506 C  C   . LYS B 2 150 ? 20.524 61.395  15.222  1.00 31.10 ? 1873 LYS B C   1 
ATOM   2507 O  O   . LYS B 2 150 ? 19.332 61.599  14.960  1.00 25.94 ? 1873 LYS B O   1 
ATOM   2508 C  CB  . LYS B 2 150 ? 21.377 61.578  12.860  1.00 34.77 ? 1873 LYS B CB  1 
ATOM   2509 C  CG  . LYS B 2 150 ? 22.186 60.944  11.718  1.00 41.48 ? 1873 LYS B CG  1 
ATOM   2510 C  CD  . LYS B 2 150 ? 22.063 61.727  10.403  1.00 42.21 ? 1873 LYS B CD  1 
ATOM   2511 C  CE  . LYS B 2 150 ? 20.629 61.720  9.880   1.00 43.69 ? 1873 LYS B CE  1 
ATOM   2512 N  NZ  . LYS B 2 150 ? 20.511 62.515  8.626   1.00 47.53 ? 1873 LYS B NZ  1 
ATOM   2513 N  N   . VAL B 2 151 ? 21.052 61.668  16.413  1.00 30.02 ? 1874 VAL B N   1 
ATOM   2514 C  CA  . VAL B 2 151 ? 20.192 62.195  17.461  1.00 30.58 ? 1874 VAL B CA  1 
ATOM   2515 C  C   . VAL B 2 151 ? 20.589 63.539  18.050  1.00 31.96 ? 1874 VAL B C   1 
ATOM   2516 O  O   . VAL B 2 151 ? 21.763 63.934  18.035  1.00 34.11 ? 1874 VAL B O   1 
ATOM   2517 C  CB  . VAL B 2 151 ? 20.027 61.143  18.608  1.00 30.92 ? 1874 VAL B CB  1 
ATOM   2518 C  CG1 . VAL B 2 151 ? 20.759 59.857  18.234  1.00 28.37 ? 1874 VAL B CG1 1 
ATOM   2519 C  CG2 . VAL B 2 151 ? 20.541 61.689  19.933  1.00 30.06 ? 1874 VAL B CG2 1 
ATOM   2520 N  N   . LEU B 2 152 ? 19.578 64.240  18.554  1.00 30.49 ? 1875 LEU B N   1 
ATOM   2521 C  CA  . LEU B 2 152 ? 19.758 65.531  19.191  1.00 31.80 ? 1875 LEU B CA  1 
ATOM   2522 C  C   . LEU B 2 152 ? 19.466 65.348  20.681  1.00 33.03 ? 1875 LEU B C   1 
ATOM   2523 O  O   . LEU B 2 152 ? 18.390 64.878  21.062  1.00 34.07 ? 1875 LEU B O   1 
ATOM   2524 C  CB  . LEU B 2 152 ? 18.788 66.555  18.596  1.00 32.67 ? 1875 LEU B CB  1 
ATOM   2525 C  CG  . LEU B 2 152 ? 18.746 67.960  19.219  1.00 32.32 ? 1875 LEU B CG  1 
ATOM   2526 C  CD1 . LEU B 2 152 ? 20.038 68.713  18.907  1.00 32.35 ? 1875 LEU B CD1 1 
ATOM   2527 C  CD2 . LEU B 2 152 ? 17.557 68.734  18.662  1.00 30.98 ? 1875 LEU B CD2 1 
ATOM   2528 N  N   . LEU B 2 153 ? 20.439 65.694  21.517  1.00 32.91 ? 1876 LEU B N   1 
ATOM   2529 C  CA  . LEU B 2 153 ? 20.287 65.586  22.962  1.00 30.64 ? 1876 LEU B CA  1 
ATOM   2530 C  C   . LEU B 2 153 ? 19.979 66.957  23.504  1.00 28.43 ? 1876 LEU B C   1 
ATOM   2531 O  O   . LEU B 2 153 ? 20.766 67.885  23.321  1.00 32.22 ? 1876 LEU B O   1 
ATOM   2532 C  CB  . LEU B 2 153 ? 21.584 65.093  23.605  1.00 31.47 ? 1876 LEU B CB  1 
ATOM   2533 C  CG  . LEU B 2 153 ? 21.745 63.591  23.773  1.00 31.63 ? 1876 LEU B CG  1 
ATOM   2534 C  CD1 . LEU B 2 153 ? 23.098 63.284  24.383  1.00 32.78 ? 1876 LEU B CD1 1 
ATOM   2535 C  CD2 . LEU B 2 153 ? 20.631 63.086  24.656  1.00 30.08 ? 1876 LEU B CD2 1 
ATOM   2536 N  N   . VAL B 2 154 ? 18.846 67.102  24.168  1.00 24.77 ? 1877 VAL B N   1 
ATOM   2537 C  CA  . VAL B 2 154 ? 18.509 68.391  24.737  1.00 25.54 ? 1877 VAL B CA  1 
ATOM   2538 C  C   . VAL B 2 154 ? 18.279 68.269  26.236  1.00 29.10 ? 1877 VAL B C   1 
ATOM   2539 O  O   . VAL B 2 154 ? 17.440 67.483  26.689  1.00 29.70 ? 1877 VAL B O   1 
ATOM   2540 C  CB  . VAL B 2 154 ? 17.284 68.967  24.071  1.00 23.96 ? 1877 VAL B CB  1 
ATOM   2541 C  CG1 . VAL B 2 154 ? 16.879 70.252  24.773  1.00 22.93 ? 1877 VAL B CG1 1 
ATOM   2542 C  CG2 . VAL B 2 154 ? 17.590 69.217  22.597  1.00 21.53 ? 1877 VAL B CG2 1 
ATOM   2543 N  N   . SER B 2 155 ? 19.045 69.036  27.009  1.00 31.42 ? 1878 SER B N   1 
ATOM   2544 C  CA  . SER B 2 155 ? 18.926 69.000  28.464  1.00 32.31 ? 1878 SER B CA  1 
ATOM   2545 C  C   . SER B 2 155 ? 19.756 70.066  29.149  1.00 34.44 ? 1878 SER B C   1 
ATOM   2546 O  O   . SER B 2 155 ? 20.699 70.609  28.574  1.00 30.72 ? 1878 SER B O   1 
ATOM   2547 C  CB  . SER B 2 155 ? 19.361 67.644  29.004  1.00 31.27 ? 1878 SER B CB  1 
ATOM   2548 O  OG  . SER B 2 155 ? 19.381 67.662  30.420  1.00 30.97 ? 1878 SER B OG  1 
ATOM   2549 N  N   . ASP B 2 156 ? 19.393 70.354  30.393  1.00 40.09 ? 1879 ASP B N   1 
ATOM   2550 C  CA  . ASP B 2 156 ? 20.097 71.352  31.187  1.00 43.89 ? 1879 ASP B CA  1 
ATOM   2551 C  C   . ASP B 2 156 ? 21.108 70.688  32.130  1.00 45.32 ? 1879 ASP B C   1 
ATOM   2552 O  O   . ASP B 2 156 ? 21.766 71.365  32.925  1.00 47.41 ? 1879 ASP B O   1 
ATOM   2553 C  CB  . ASP B 2 156 ? 19.087 72.214  31.969  1.00 42.75 ? 1879 ASP B CB  1 
ATOM   2554 C  CG  . ASP B 2 156 ? 18.298 71.421  32.998  1.00 44.23 ? 1879 ASP B CG  1 
ATOM   2555 O  OD1 . ASP B 2 156 ? 18.195 70.179  32.878  1.00 45.12 ? 1879 ASP B OD1 1 
ATOM   2556 O  OD2 . ASP B 2 156 ? 17.762 72.052  33.932  1.00 45.90 ? 1879 ASP B OD2 1 
ATOM   2557 N  N   . GLN B 2 157 ? 21.225 69.363  32.033  1.00 45.43 ? 1880 GLN B N   1 
ATOM   2558 C  CA  . GLN B 2 157 ? 22.175 68.605  32.846  1.00 46.01 ? 1880 GLN B CA  1 
ATOM   2559 C  C   . GLN B 2 157 ? 23.387 68.294  31.968  1.00 45.45 ? 1880 GLN B C   1 
ATOM   2560 O  O   . GLN B 2 157 ? 23.504 67.206  31.399  1.00 44.41 ? 1880 GLN B O   1 
ATOM   2561 C  CB  . GLN B 2 157 ? 21.534 67.310  33.354  1.00 47.23 ? 1880 GLN B CB  1 
ATOM   2562 C  CG  . GLN B 2 157 ? 20.413 67.537  34.350  1.00 49.38 ? 1880 GLN B CG  1 
ATOM   2563 C  CD  . GLN B 2 157 ? 20.850 68.437  35.485  1.00 53.95 ? 1880 GLN B CD  1 
ATOM   2564 O  OE1 . GLN B 2 157 ? 21.732 68.079  36.271  1.00 55.17 ? 1880 GLN B OE1 1 
ATOM   2565 N  NE2 . GLN B 2 157 ? 20.246 69.626  35.572  1.00 55.02 ? 1880 GLN B NE2 1 
ATOM   2566 N  N   . GLN B 2 158 ? 24.283 69.271  31.857  1.00 46.59 ? 1881 GLN B N   1 
ATOM   2567 C  CA  . GLN B 2 158 ? 25.480 69.144  31.026  1.00 46.47 ? 1881 GLN B CA  1 
ATOM   2568 C  C   . GLN B 2 158 ? 26.395 67.990  31.417  1.00 47.56 ? 1881 GLN B C   1 
ATOM   2569 O  O   . GLN B 2 158 ? 27.402 67.766  30.765  1.00 50.19 ? 1881 GLN B O   1 
ATOM   2570 C  CB  . GLN B 2 158 ? 26.277 70.460  31.034  1.00 42.50 ? 1881 GLN B CB  1 
ATOM   2571 C  CG  . GLN B 2 158 ? 27.463 70.514  30.069  1.00 39.32 ? 1881 GLN B CG  1 
ATOM   2572 C  CD  . GLN B 2 158 ? 27.068 70.802  28.616  1.00 40.11 ? 1881 GLN B CD  1 
ATOM   2573 O  OE1 . GLN B 2 158 ? 27.383 70.020  27.703  1.00 38.57 ? 1881 GLN B OE1 1 
ATOM   2574 N  NE2 . GLN B 2 158 ? 26.387 71.932  28.393  1.00 33.42 ? 1881 GLN B NE2 1 
ATOM   2575 N  N   . GLN B 2 159 ? 26.045 67.241  32.457  1.00 49.17 ? 1882 GLN B N   1 
ATOM   2576 C  CA  . GLN B 2 159 ? 26.893 66.133  32.878  1.00 50.11 ? 1882 GLN B CA  1 
ATOM   2577 C  C   . GLN B 2 159 ? 26.171 64.796  32.995  1.00 49.81 ? 1882 GLN B C   1 
ATOM   2578 O  O   . GLN B 2 159 ? 26.589 63.801  32.401  1.00 49.31 ? 1882 GLN B O   1 
ATOM   2579 C  CB  . GLN B 2 159 ? 27.546 66.474  34.220  1.00 53.85 ? 1882 GLN B CB  1 
ATOM   2580 C  CG  . GLN B 2 159 ? 29.064 66.333  34.247  1.00 57.58 ? 1882 GLN B CG  1 
ATOM   2581 C  CD  . GLN B 2 159 ? 29.525 64.883  34.303  1.00 61.65 ? 1882 GLN B CD  1 
ATOM   2582 O  OE1 . GLN B 2 159 ? 29.144 64.061  33.460  1.00 62.76 ? 1882 GLN B OE1 1 
ATOM   2583 N  NE2 . GLN B 2 159 ? 30.357 64.562  35.298  1.00 61.38 ? 1882 GLN B NE2 1 
ATOM   2584 N  N   . ASN B 2 160 ? 25.089 64.777  33.763  1.00 48.68 ? 1883 ASN B N   1 
ATOM   2585 C  CA  . ASN B 2 160 ? 24.335 63.553  33.977  1.00 47.21 ? 1883 ASN B CA  1 
ATOM   2586 C  C   . ASN B 2 160 ? 23.369 63.241  32.859  1.00 43.64 ? 1883 ASN B C   1 
ATOM   2587 O  O   . ASN B 2 160 ? 22.599 62.286  32.962  1.00 44.06 ? 1883 ASN B O   1 
ATOM   2588 C  CB  . ASN B 2 160 ? 23.586 63.647  35.299  1.00 52.40 ? 1883 ASN B CB  1 
ATOM   2589 C  CG  . ASN B 2 160 ? 24.505 64.000  36.445  1.00 56.27 ? 1883 ASN B CG  1 
ATOM   2590 O  OD1 . ASN B 2 160 ? 25.167 63.126  37.016  1.00 58.78 ? 1883 ASN B OD1 1 
ATOM   2591 N  ND2 . ASN B 2 160 ? 24.581 65.293  36.769  1.00 54.67 ? 1883 ASN B ND2 1 
ATOM   2592 N  N   . PHE B 2 161 ? 23.392 64.049  31.799  1.00 39.04 ? 1884 PHE B N   1 
ATOM   2593 C  CA  . PHE B 2 161 ? 22.518 63.800  30.655  1.00 34.71 ? 1884 PHE B CA  1 
ATOM   2594 C  C   . PHE B 2 161 ? 23.261 63.970  29.331  1.00 34.51 ? 1884 PHE B C   1 
ATOM   2595 O  O   . PHE B 2 161 ? 23.576 62.993  28.657  1.00 36.00 ? 1884 PHE B O   1 
ATOM   2596 C  CB  . PHE B 2 161 ? 21.283 64.721  30.673  1.00 27.28 ? 1884 PHE B CB  1 
ATOM   2597 C  CG  . PHE B 2 161 ? 20.178 64.266  29.745  1.00 20.53 ? 1884 PHE B CG  1 
ATOM   2598 C  CD1 . PHE B 2 161 ? 19.081 63.565  30.235  1.00 16.36 ? 1884 PHE B CD1 1 
ATOM   2599 C  CD2 . PHE B 2 161 ? 20.261 64.492  28.370  1.00 19.78 ? 1884 PHE B CD2 1 
ATOM   2600 C  CE1 . PHE B 2 161 ? 18.084 63.090  29.377  1.00 14.50 ? 1884 PHE B CE1 1 
ATOM   2601 C  CE2 . PHE B 2 161 ? 19.264 64.021  27.499  1.00 16.36 ? 1884 PHE B CE2 1 
ATOM   2602 C  CZ  . PHE B 2 161 ? 18.176 63.319  28.003  1.00 14.23 ? 1884 PHE B CZ  1 
ATOM   2603 N  N   . LEU B 2 162 ? 23.540 65.212  28.958  1.00 36.63 ? 1885 LEU B N   1 
ATOM   2604 C  CA  . LEU B 2 162 ? 24.235 65.494  27.701  1.00 38.32 ? 1885 LEU B CA  1 
ATOM   2605 C  C   . LEU B 2 162 ? 25.501 64.682  27.522  1.00 39.36 ? 1885 LEU B C   1 
ATOM   2606 O  O   . LEU B 2 162 ? 25.719 64.060  26.485  1.00 41.10 ? 1885 LEU B O   1 
ATOM   2607 C  CB  . LEU B 2 162 ? 24.609 66.972  27.616  1.00 35.41 ? 1885 LEU B CB  1 
ATOM   2608 C  CG  . LEU B 2 162 ? 23.452 67.931  27.391  1.00 34.59 ? 1885 LEU B CG  1 
ATOM   2609 C  CD1 . LEU B 2 162 ? 23.960 69.347  27.577  1.00 35.65 ? 1885 LEU B CD1 1 
ATOM   2610 C  CD2 . LEU B 2 162 ? 22.865 67.733  25.993  1.00 29.98 ? 1885 LEU B CD2 1 
ATOM   2611 N  N   . GLU B 2 163 ? 26.349 64.705  28.535  1.00 40.86 ? 1886 GLU B N   1 
ATOM   2612 C  CA  . GLU B 2 163 ? 27.599 63.983  28.463  1.00 42.07 ? 1886 GLU B CA  1 
ATOM   2613 C  C   . GLU B 2 163 ? 27.361 62.472  28.588  1.00 41.73 ? 1886 GLU B C   1 
ATOM   2614 O  O   . GLU B 2 163 ? 27.937 61.685  27.830  1.00 42.03 ? 1886 GLU B O   1 
ATOM   2615 C  CB  . GLU B 2 163 ? 28.533 64.488  29.566  1.00 45.29 ? 1886 GLU B CB  1 
ATOM   2616 C  CG  . GLU B 2 163 ? 30.015 64.395  29.229  1.00 51.12 ? 1886 GLU B CG  1 
ATOM   2617 C  CD  . GLU B 2 163 ? 30.920 64.848  30.378  1.00 54.46 ? 1886 GLU B CD  1 
ATOM   2618 O  OE1 . GLU B 2 163 ? 30.750 65.996  30.865  1.00 54.82 ? 1886 GLU B OE1 1 
ATOM   2619 O  OE2 . GLU B 2 163 ? 31.805 64.057  30.788  1.00 54.02 ? 1886 GLU B OE2 1 
ATOM   2620 N  N   . LEU B 2 164 ? 26.493 62.071  29.517  1.00 39.29 ? 1887 LEU B N   1 
ATOM   2621 C  CA  . LEU B 2 164 ? 26.220 60.653  29.735  1.00 37.32 ? 1887 LEU B CA  1 
ATOM   2622 C  C   . LEU B 2 164 ? 25.568 59.894  28.577  1.00 37.05 ? 1887 LEU B C   1 
ATOM   2623 O  O   . LEU B 2 164 ? 26.048 58.820  28.196  1.00 38.39 ? 1887 LEU B O   1 
ATOM   2624 C  CB  . LEU B 2 164 ? 25.388 60.462  31.006  1.00 35.07 ? 1887 LEU B CB  1 
ATOM   2625 C  CG  . LEU B 2 164 ? 25.121 58.992  31.379  1.00 37.30 ? 1887 LEU B CG  1 
ATOM   2626 C  CD1 . LEU B 2 164 ? 25.089 58.829  32.893  1.00 36.94 ? 1887 LEU B CD1 1 
ATOM   2627 C  CD2 . LEU B 2 164 ? 23.810 58.532  30.761  1.00 34.91 ? 1887 LEU B CD2 1 
ATOM   2628 N  N   . TRP B 2 165 ? 24.482 60.424  28.022  1.00 33.57 ? 1888 TRP B N   1 
ATOM   2629 C  CA  . TRP B 2 165 ? 23.814 59.727  26.927  1.00 33.17 ? 1888 TRP B CA  1 
ATOM   2630 C  C   . TRP B 2 165 ? 24.559 59.885  25.608  1.00 32.33 ? 1888 TRP B C   1 
ATOM   2631 O  O   . TRP B 2 165 ? 24.435 59.050  24.714  1.00 31.66 ? 1888 TRP B O   1 
ATOM   2632 C  CB  . TRP B 2 165 ? 22.358 60.201  26.794  1.00 29.84 ? 1888 TRP B CB  1 
ATOM   2633 C  CG  . TRP B 2 165 ? 21.569 59.912  28.035  1.00 26.15 ? 1888 TRP B CG  1 
ATOM   2634 C  CD1 . TRP B 2 165 ? 21.101 60.823  28.958  1.00 25.52 ? 1888 TRP B CD1 1 
ATOM   2635 C  CD2 . TRP B 2 165 ? 21.281 58.619  28.571  1.00 22.33 ? 1888 TRP B CD2 1 
ATOM   2636 N  NE1 . TRP B 2 165 ? 20.551 60.164  30.038  1.00 21.50 ? 1888 TRP B NE1 1 
ATOM   2637 C  CE2 . TRP B 2 165 ? 20.650 58.813  29.825  1.00 22.76 ? 1888 TRP B CE2 1 
ATOM   2638 C  CE3 . TRP B 2 165 ? 21.502 57.314  28.120  1.00 21.85 ? 1888 TRP B CE3 1 
ATOM   2639 C  CZ2 . TRP B 2 165 ? 20.243 57.746  30.628  1.00 20.04 ? 1888 TRP B CZ2 1 
ATOM   2640 C  CZ3 . TRP B 2 165 ? 21.099 56.256  28.917  1.00 20.85 ? 1888 TRP B CZ3 1 
ATOM   2641 C  CH2 . TRP B 2 165 ? 20.476 56.480  30.160  1.00 19.81 ? 1888 TRP B CH2 1 
ATOM   2642 N  N   . SER B 2 166 ? 25.344 60.948  25.490  1.00 33.24 ? 1889 SER B N   1 
ATOM   2643 C  CA  . SER B 2 166 ? 26.098 61.164  24.261  1.00 34.64 ? 1889 SER B CA  1 
ATOM   2644 C  C   . SER B 2 166 ? 27.047 59.995  24.058  1.00 33.54 ? 1889 SER B C   1 
ATOM   2645 O  O   . SER B 2 166 ? 26.995 59.309  23.035  1.00 33.36 ? 1889 SER B O   1 
ATOM   2646 C  CB  . SER B 2 166 ? 26.901 62.465  24.322  1.00 35.53 ? 1889 SER B CB  1 
ATOM   2647 O  OG  . SER B 2 166 ? 27.465 62.745  23.047  1.00 39.32 ? 1889 SER B OG  1 
ATOM   2648 N  N   . GLU B 2 167 ? 27.908 59.770  25.045  1.00 31.49 ? 1890 GLU B N   1 
ATOM   2649 C  CA  . GLU B 2 167 ? 28.861 58.675  24.988  1.00 28.61 ? 1890 GLU B CA  1 
ATOM   2650 C  C   . GLU B 2 167 ? 28.149 57.327  24.825  1.00 29.47 ? 1890 GLU B C   1 
ATOM   2651 O  O   . GLU B 2 167 ? 28.571 56.489  24.020  1.00 31.78 ? 1890 GLU B O   1 
ATOM   2652 C  CB  . GLU B 2 167 ? 29.722 58.675  26.249  1.00 26.36 ? 1890 GLU B CB  1 
ATOM   2653 C  CG  . GLU B 2 167 ? 30.556 57.435  26.423  1.00 31.77 ? 1890 GLU B CG  1 
ATOM   2654 C  CD  . GLU B 2 167 ? 31.520 57.518  27.601  1.00 35.54 ? 1890 GLU B CD  1 
ATOM   2655 O  OE1 . GLU B 2 167 ? 31.097 57.921  28.712  1.00 36.35 ? 1890 GLU B OE1 1 
ATOM   2656 O  OE2 . GLU B 2 167 ? 32.705 57.160  27.406  1.00 36.59 ? 1890 GLU B OE2 1 
ATOM   2657 N  N   . ILE B 2 168 ? 27.061 57.119  25.563  1.00 25.53 ? 1891 ILE B N   1 
ATOM   2658 C  CA  . ILE B 2 168 ? 26.348 55.852  25.467  1.00 26.65 ? 1891 ILE B CA  1 
ATOM   2659 C  C   . ILE B 2 168 ? 25.753 55.625  24.080  1.00 28.43 ? 1891 ILE B C   1 
ATOM   2660 O  O   . ILE B 2 168 ? 25.885 54.534  23.514  1.00 30.49 ? 1891 ILE B O   1 
ATOM   2661 C  CB  . ILE B 2 168 ? 25.245 55.765  26.535  1.00 27.39 ? 1891 ILE B CB  1 
ATOM   2662 C  CG1 . ILE B 2 168 ? 25.896 55.675  27.915  1.00 26.04 ? 1891 ILE B CG1 1 
ATOM   2663 C  CG2 . ILE B 2 168 ? 24.334 54.560  26.272  1.00 25.19 ? 1891 ILE B CG2 1 
ATOM   2664 C  CD1 . ILE B 2 168 ? 24.993 56.063  29.056  1.00 26.02 ? 1891 ILE B CD1 1 
ATOM   2665 N  N   . LEU B 2 169 ? 25.111 56.652  23.528  1.00 26.55 ? 1892 LEU B N   1 
ATOM   2666 C  CA  . LEU B 2 169 ? 24.503 56.553  22.209  1.00 26.25 ? 1892 LEU B CA  1 
ATOM   2667 C  C   . LEU B 2 169 ? 25.536 56.244  21.136  1.00 28.19 ? 1892 LEU B C   1 
ATOM   2668 O  O   . LEU B 2 169 ? 25.302 55.412  20.253  1.00 27.92 ? 1892 LEU B O   1 
ATOM   2669 C  CB  . LEU B 2 169 ? 23.802 57.860  21.856  1.00 27.15 ? 1892 LEU B CB  1 
ATOM   2670 C  CG  . LEU B 2 169 ? 22.367 58.078  22.338  1.00 24.89 ? 1892 LEU B CG  1 
ATOM   2671 C  CD1 . LEU B 2 169 ? 21.969 59.532  22.096  1.00 18.82 ? 1892 LEU B CD1 1 
ATOM   2672 C  CD2 . LEU B 2 169 ? 21.423 57.117  21.591  1.00 22.95 ? 1892 LEU B CD2 1 
ATOM   2673 N  N   . MET B 2 170 ? 26.684 56.915  21.213  1.00 30.70 ? 1893 MET B N   1 
ATOM   2674 C  CA  . MET B 2 170 ? 27.757 56.717  20.230  1.00 29.72 ? 1893 MET B CA  1 
ATOM   2675 C  C   . MET B 2 170 ? 28.388 55.326  20.279  1.00 30.40 ? 1893 MET B C   1 
ATOM   2676 O  O   . MET B 2 170 ? 28.471 54.639  19.247  1.00 29.18 ? 1893 MET B O   1 
ATOM   2677 C  CB  . MET B 2 170 ? 28.847 57.779  20.398  1.00 29.54 ? 1893 MET B CB  1 
ATOM   2678 C  CG  . MET B 2 170 ? 28.393 59.202  20.096  1.00 30.79 ? 1893 MET B CG  1 
ATOM   2679 S  SD  . MET B 2 170 ? 27.837 59.449  18.387  1.00 37.20 ? 1893 MET B SD  1 
ATOM   2680 C  CE  . MET B 2 170 ? 29.431 59.385  17.530  1.00 31.45 ? 1893 MET B CE  1 
ATOM   2681 N  N   . THR B 2 171 ? 28.830 54.890  21.457  1.00 31.10 ? 1894 THR B N   1 
ATOM   2682 C  CA  . THR B 2 171 ? 29.429 53.563  21.522  1.00 33.20 ? 1894 THR B CA  1 
ATOM   2683 C  C   . THR B 2 171 ? 28.354 52.537  21.183  1.00 32.47 ? 1894 THR B C   1 
ATOM   2684 O  O   . THR B 2 171 ? 28.655 51.377  20.947  1.00 37.26 ? 1894 THR B O   1 
ATOM   2685 C  CB  . THR B 2 171 ? 30.040 53.262  22.903  1.00 35.28 ? 1894 THR B CB  1 
ATOM   2686 O  OG1 . THR B 2 171 ? 29.080 52.590  23.725  1.00 38.45 ? 1894 THR B OG1 1 
ATOM   2687 C  CG2 . THR B 2 171 ? 30.472 54.560  23.581  1.00 34.26 ? 1894 THR B CG2 1 
ATOM   2688 N  N   . GLY B 2 172 ? 27.099 52.980  21.156  1.00 30.83 ? 1895 GLY B N   1 
ATOM   2689 C  CA  . GLY B 2 172 ? 26.003 52.098  20.805  1.00 28.45 ? 1895 GLY B CA  1 
ATOM   2690 C  C   . GLY B 2 172 ? 25.755 52.173  19.302  1.00 31.27 ? 1895 GLY B C   1 
ATOM   2691 O  O   . GLY B 2 172 ? 24.706 51.746  18.800  1.00 32.31 ? 1895 GLY B O   1 
ATOM   2692 N  N   . GLY B 2 173 ? 26.713 52.744  18.575  1.00 30.69 ? 1896 GLY B N   1 
ATOM   2693 C  CA  . GLY B 2 173 ? 26.595 52.826  17.124  1.00 32.60 ? 1896 GLY B CA  1 
ATOM   2694 C  C   . GLY B 2 173 ? 25.958 54.045  16.461  1.00 32.28 ? 1896 GLY B C   1 
ATOM   2695 O  O   . GLY B 2 173 ? 25.815 54.071  15.236  1.00 32.95 ? 1896 GLY B O   1 
ATOM   2696 N  N   . ALA B 2 174 ? 25.578 55.057  17.234  1.00 30.36 ? 1897 ALA B N   1 
ATOM   2697 C  CA  . ALA B 2 174 ? 24.954 56.233  16.638  1.00 29.12 ? 1897 ALA B CA  1 
ATOM   2698 C  C   . ALA B 2 174 ? 25.854 56.854  15.571  1.00 31.08 ? 1897 ALA B C   1 
ATOM   2699 O  O   . ALA B 2 174 ? 27.080 56.783  15.659  1.00 31.94 ? 1897 ALA B O   1 
ATOM   2700 C  CB  . ALA B 2 174 ? 24.630 57.257  17.714  1.00 24.87 ? 1897 ALA B CB  1 
ATOM   2701 N  N   . ALA B 2 175 ? 25.242 57.450  14.551  1.00 31.41 ? 1898 ALA B N   1 
ATOM   2702 C  CA  . ALA B 2 175 ? 26.007 58.090  13.493  1.00 31.79 ? 1898 ALA B CA  1 
ATOM   2703 C  C   . ALA B 2 175 ? 26.559 59.390  14.054  1.00 33.55 ? 1898 ALA B C   1 
ATOM   2704 O  O   . ALA B 2 175 ? 27.659 59.807  13.704  1.00 37.29 ? 1898 ALA B O   1 
ATOM   2705 C  CB  . ALA B 2 175 ? 25.121 58.365  12.289  1.00 33.19 ? 1898 ALA B CB  1 
ATOM   2706 N  N   . SER B 2 176 ? 25.802 60.021  14.945  1.00 35.00 ? 1899 SER B N   1 
ATOM   2707 C  CA  . SER B 2 176 ? 26.232 61.272  15.566  1.00 33.21 ? 1899 SER B CA  1 
ATOM   2708 C  C   . SER B 2 176 ? 25.234 61.744  16.630  1.00 32.27 ? 1899 SER B C   1 
ATOM   2709 O  O   . SER B 2 176 ? 24.040 61.389  16.585  1.00 30.30 ? 1899 SER B O   1 
ATOM   2710 C  CB  . SER B 2 176 ? 26.378 62.339  14.490  1.00 31.17 ? 1899 SER B CB  1 
ATOM   2711 O  OG  . SER B 2 176 ? 25.176 62.422  13.744  1.00 34.06 ? 1899 SER B OG  1 
ATOM   2712 N  N   . VAL B 2 177 ? 25.726 62.542  17.579  1.00 29.51 ? 1900 VAL B N   1 
ATOM   2713 C  CA  . VAL B 2 177 ? 24.886 63.068  18.648  1.00 29.00 ? 1900 VAL B CA  1 
ATOM   2714 C  C   . VAL B 2 177 ? 25.190 64.540  18.869  1.00 31.62 ? 1900 VAL B C   1 
ATOM   2715 O  O   . VAL B 2 177 ? 26.295 64.909  19.264  1.00 32.82 ? 1900 VAL B O   1 
ATOM   2716 C  CB  . VAL B 2 177 ? 25.116 62.319  19.976  1.00 26.99 ? 1900 VAL B CB  1 
ATOM   2717 C  CG1 . VAL B 2 177 ? 24.220 62.891  21.057  1.00 26.21 ? 1900 VAL B CG1 1 
ATOM   2718 C  CG2 . VAL B 2 177 ? 24.837 60.845  19.797  1.00 25.37 ? 1900 VAL B CG2 1 
ATOM   2719 N  N   . LYS B 2 178 ? 24.200 65.382  18.608  1.00 33.91 ? 1901 LYS B N   1 
ATOM   2720 C  CA  . LYS B 2 178 ? 24.354 66.819  18.785  1.00 36.23 ? 1901 LYS B CA  1 
ATOM   2721 C  C   . LYS B 2 178 ? 23.842 67.204  20.171  1.00 36.37 ? 1901 LYS B C   1 
ATOM   2722 O  O   . LYS B 2 178 ? 22.645 67.094  20.455  1.00 35.52 ? 1901 LYS B O   1 
ATOM   2723 C  CB  . LYS B 2 178 ? 23.572 67.564  17.689  1.00 36.66 ? 1901 LYS B CB  1 
ATOM   2724 C  CG  . LYS B 2 178 ? 23.544 69.094  17.805  1.00 37.80 ? 1901 LYS B CG  1 
ATOM   2725 C  CD  . LYS B 2 178 ? 24.851 69.768  17.389  1.00 38.79 ? 1901 LYS B CD  1 
ATOM   2726 C  CE  . LYS B 2 178 ? 24.672 71.301  17.318  1.00 43.27 ? 1901 LYS B CE  1 
ATOM   2727 N  NZ  . LYS B 2 178 ? 25.911 72.082  16.942  1.00 39.44 ? 1901 LYS B NZ  1 
ATOM   2728 N  N   . GLN B 2 179 ? 24.760 67.629  21.034  1.00 36.63 ? 1902 GLN B N   1 
ATOM   2729 C  CA  . GLN B 2 179 ? 24.419 68.040  22.395  1.00 38.07 ? 1902 GLN B CA  1 
ATOM   2730 C  C   . GLN B 2 179 ? 23.952 69.489  22.387  1.00 38.80 ? 1902 GLN B C   1 
ATOM   2731 O  O   . GLN B 2 179 ? 24.631 70.361  21.855  1.00 41.15 ? 1902 GLN B O   1 
ATOM   2732 C  CB  . GLN B 2 179 ? 25.633 67.928  23.310  1.00 38.95 ? 1902 GLN B CB  1 
ATOM   2733 C  CG  . GLN B 2 179 ? 26.062 66.521  23.594  1.00 42.06 ? 1902 GLN B CG  1 
ATOM   2734 C  CD  . GLN B 2 179 ? 27.411 66.479  24.246  1.00 43.42 ? 1902 GLN B CD  1 
ATOM   2735 O  OE1 . GLN B 2 179 ? 27.707 67.291  25.115  1.00 48.52 ? 1902 GLN B OE1 1 
ATOM   2736 N  NE2 . GLN B 2 179 ? 28.242 65.529  23.838  1.00 43.86 ? 1902 GLN B NE2 1 
ATOM   2737 N  N   . HIS B 2 180 ? 22.800 69.742  22.993  1.00 38.41 ? 1903 HIS B N   1 
ATOM   2738 C  CA  . HIS B 2 180 ? 22.232 71.085  23.050  1.00 37.08 ? 1903 HIS B CA  1 
ATOM   2739 C  C   . HIS B 2 180 ? 21.688 71.350  24.452  1.00 39.69 ? 1903 HIS B C   1 
ATOM   2740 O  O   . HIS B 2 180 ? 20.859 70.589  24.970  1.00 40.14 ? 1903 HIS B O   1 
ATOM   2741 C  CB  . HIS B 2 180 ? 21.103 71.212  22.008  1.00 35.19 ? 1903 HIS B CB  1 
ATOM   2742 C  CG  . HIS B 2 180 ? 20.419 72.552  21.987  1.00 34.81 ? 1903 HIS B CG  1 
ATOM   2743 N  ND1 . HIS B 2 180 ? 21.066 73.721  21.641  1.00 37.23 ? 1903 HIS B ND1 1 
ATOM   2744 C  CD2 . HIS B 2 180 ? 19.133 72.901  22.240  1.00 32.56 ? 1903 HIS B CD2 1 
ATOM   2745 C  CE1 . HIS B 2 180 ? 20.210 74.729  21.682  1.00 32.74 ? 1903 HIS B CE1 1 
ATOM   2746 N  NE2 . HIS B 2 180 ? 19.030 74.257  22.042  1.00 29.63 ? 1903 HIS B NE2 1 
ATOM   2747 N  N   . HIS B 2 181 ? 22.158 72.436  25.057  1.00 41.35 ? 1904 HIS B N   1 
ATOM   2748 C  CA  . HIS B 2 181 ? 21.740 72.823  26.397  1.00 43.69 ? 1904 HIS B CA  1 
ATOM   2749 C  C   . HIS B 2 181 ? 20.351 73.478  26.363  1.00 44.89 ? 1904 HIS B C   1 
ATOM   2750 O  O   . HIS B 2 181 ? 20.122 74.413  25.596  1.00 44.89 ? 1904 HIS B O   1 
ATOM   2751 C  CB  . HIS B 2 181 ? 22.777 73.787  26.973  1.00 42.97 ? 1904 HIS B CB  1 
ATOM   2752 C  CG  . HIS B 2 181 ? 22.666 73.971  28.449  1.00 43.59 ? 1904 HIS B CG  1 
ATOM   2753 N  ND1 . HIS B 2 181 ? 21.748 74.822  29.026  1.00 44.81 ? 1904 HIS B ND1 1 
ATOM   2754 C  CD2 . HIS B 2 181 ? 23.323 73.375  29.471  1.00 43.30 ? 1904 HIS B CD2 1 
ATOM   2755 C  CE1 . HIS B 2 181 ? 21.844 74.742  30.341  1.00 44.66 ? 1904 HIS B CE1 1 
ATOM   2756 N  NE2 . HIS B 2 181 ? 22.791 73.869  30.638  1.00 44.78 ? 1904 HIS B NE2 1 
ATOM   2757 N  N   . SER B 2 182 ? 19.432 72.988  27.196  1.00 46.11 ? 1905 SER B N   1 
ATOM   2758 C  CA  . SER B 2 182 ? 18.063 73.519  27.242  1.00 45.99 ? 1905 SER B CA  1 
ATOM   2759 C  C   . SER B 2 182 ? 18.014 75.035  27.387  1.00 47.76 ? 1905 SER B C   1 
ATOM   2760 O  O   . SER B 2 182 ? 17.199 75.697  26.743  1.00 48.91 ? 1905 SER B O   1 
ATOM   2761 C  CB  . SER B 2 182 ? 17.274 72.891  28.400  1.00 44.40 ? 1905 SER B CB  1 
ATOM   2762 O  OG  . SER B 2 182 ? 17.196 71.476  28.301  1.00 44.84 ? 1905 SER B OG  1 
ATOM   2763 N  N   . SER B 2 183 ? 18.885 75.577  28.235  1.00 48.81 ? 1906 SER B N   1 
ATOM   2764 C  CA  . SER B 2 183 ? 18.937 77.014  28.490  1.00 49.92 ? 1906 SER B CA  1 
ATOM   2765 C  C   . SER B 2 183 ? 19.783 77.754  27.459  1.00 50.74 ? 1906 SER B C   1 
ATOM   2766 O  O   . SER B 2 183 ? 20.033 78.944  27.615  1.00 51.90 ? 1906 SER B O   1 
ATOM   2767 C  CB  . SER B 2 183 ? 19.515 77.284  29.887  1.00 50.54 ? 1906 SER B CB  1 
ATOM   2768 O  OG  . SER B 2 183 ? 18.928 76.451  30.881  1.00 50.73 ? 1906 SER B OG  1 
ATOM   2769 N  N   . ALA B 2 184 ? 20.231 77.053  26.415  1.00 52.42 ? 1907 ALA B N   1 
ATOM   2770 C  CA  . ALA B 2 184 ? 21.043 77.672  25.361  1.00 52.66 ? 1907 ALA B CA  1 
ATOM   2771 C  C   . ALA B 2 184 ? 20.113 78.213  24.291  1.00 54.70 ? 1907 ALA B C   1 
ATOM   2772 O  O   . ALA B 2 184 ? 18.899 78.228  24.483  1.00 54.73 ? 1907 ALA B O   1 
ATOM   2773 C  CB  . ALA B 2 184 ? 21.992 76.657  24.759  1.00 51.89 ? 1907 ALA B CB  1 
ATOM   2774 N  N   . HIS B 2 185 ? 20.655 78.652  23.160  1.00 57.94 ? 1908 HIS B N   1 
ATOM   2775 C  CA  . HIS B 2 185 ? 19.776 79.181  22.126  1.00 62.50 ? 1908 HIS B CA  1 
ATOM   2776 C  C   . HIS B 2 185 ? 19.866 78.530  20.753  1.00 63.52 ? 1908 HIS B C   1 
ATOM   2777 O  O   . HIS B 2 185 ? 20.942 78.145  20.285  1.00 62.90 ? 1908 HIS B O   1 
ATOM   2778 C  CB  . HIS B 2 185 ? 19.959 80.691  21.982  1.00 66.90 ? 1908 HIS B CB  1 
ATOM   2779 C  CG  . HIS B 2 185 ? 18.670 81.434  21.801  1.00 69.96 ? 1908 HIS B CG  1 
ATOM   2780 N  ND1 . HIS B 2 185 ? 17.622 81.329  22.693  1.00 70.83 ? 1908 HIS B ND1 1 
ATOM   2781 C  CD2 . HIS B 2 185 ? 18.268 82.311  20.851  1.00 71.50 ? 1908 HIS B CD2 1 
ATOM   2782 C  CE1 . HIS B 2 185 ? 16.632 82.111  22.302  1.00 71.36 ? 1908 HIS B CE1 1 
ATOM   2783 N  NE2 . HIS B 2 185 ? 16.998 82.718  21.188  1.00 72.97 ? 1908 HIS B NE2 1 
ATOM   2784 N  N   . ASN B 2 186 ? 18.695 78.447  20.124  1.00 64.67 ? 1909 ASN B N   1 
ATOM   2785 C  CA  . ASN B 2 186 ? 18.467 77.852  18.808  1.00 66.50 ? 1909 ASN B CA  1 
ATOM   2786 C  C   . ASN B 2 186 ? 18.956 78.666  17.616  1.00 66.35 ? 1909 ASN B C   1 
ATOM   2787 O  O   . ASN B 2 186 ? 18.138 79.202  16.870  1.00 65.89 ? 1909 ASN B O   1 
ATOM   2788 C  CB  . ASN B 2 186 ? 16.968 77.640  18.625  1.00 69.63 ? 1909 ASN B CB  1 
ATOM   2789 C  CG  . ASN B 2 186 ? 16.182 78.951  18.740  1.00 72.51 ? 1909 ASN B CG  1 
ATOM   2790 O  OD1 . ASN B 2 186 ? 16.029 79.508  19.833  1.00 74.20 ? 1909 ASN B OD1 1 
ATOM   2791 N  ND2 . ASN B 2 186 ? 15.704 79.456  17.608  1.00 72.02 ? 1909 ASN B ND2 1 
ATOM   2792 N  N   . LYS B 2 187 ? 20.262 78.765  17.405  1.00 66.20 ? 1910 LYS B N   1 
ATOM   2793 C  CA  . LYS B 2 187 ? 20.721 79.535  16.260  1.00 66.86 ? 1910 LYS B CA  1 
ATOM   2794 C  C   . LYS B 2 187 ? 21.572 78.717  15.309  1.00 66.23 ? 1910 LYS B C   1 
ATOM   2795 O  O   . LYS B 2 187 ? 22.344 79.266  14.527  1.00 69.54 ? 1910 LYS B O   1 
ATOM   2796 C  CB  . LYS B 2 187 ? 21.467 80.808  16.708  1.00 68.81 ? 1910 LYS B CB  1 
ATOM   2797 C  CG  . LYS B 2 187 ? 22.658 80.605  17.638  1.00 72.36 ? 1910 LYS B CG  1 
ATOM   2798 C  CD  . LYS B 2 187 ? 23.309 81.946  18.028  1.00 73.38 ? 1910 LYS B CD  1 
ATOM   2799 C  CE  . LYS B 2 187 ? 23.864 82.689  16.805  1.00 74.12 ? 1910 LYS B CE  1 
ATOM   2800 N  NZ  . LYS B 2 187 ? 24.544 83.974  17.148  1.00 73.60 ? 1910 LYS B NZ  1 
ATOM   2801 N  N   . ASP B 2 188 ? 21.408 77.400  15.367  1.00 64.03 ? 1911 ASP B N   1 
ATOM   2802 C  CA  . ASP B 2 188 ? 22.149 76.488  14.498  1.00 62.02 ? 1911 ASP B CA  1 
ATOM   2803 C  C   . ASP B 2 188 ? 21.456 75.138  14.398  1.00 58.17 ? 1911 ASP B C   1 
ATOM   2804 O  O   . ASP B 2 188 ? 21.722 74.361  13.481  1.00 57.67 ? 1911 ASP B O   1 
ATOM   2805 C  CB  . ASP B 2 188 ? 23.569 76.257  15.027  1.00 66.27 ? 1911 ASP B CB  1 
ATOM   2806 C  CG  . ASP B 2 188 ? 24.502 77.409  14.727  1.00 69.85 ? 1911 ASP B CG  1 
ATOM   2807 O  OD1 . ASP B 2 188 ? 24.495 77.875  13.563  1.00 72.10 ? 1911 ASP B OD1 1 
ATOM   2808 O  OD2 . ASP B 2 188 ? 25.244 77.837  15.645  1.00 70.80 ? 1911 ASP B OD2 1 
ATOM   2809 N  N   . ILE B 2 189 ? 20.574 74.856  15.349  1.00 53.35 ? 1912 ILE B N   1 
ATOM   2810 C  CA  . ILE B 2 189 ? 19.882 73.582  15.366  1.00 49.87 ? 1912 ILE B CA  1 
ATOM   2811 C  C   . ILE B 2 189 ? 18.867 73.402  14.251  1.00 47.53 ? 1912 ILE B C   1 
ATOM   2812 O  O   . ILE B 2 189 ? 17.745 73.899  14.317  1.00 44.59 ? 1912 ILE B O   1 
ATOM   2813 C  CB  . ILE B 2 189 ? 19.208 73.332  16.733  1.00 47.73 ? 1912 ILE B CB  1 
ATOM   2814 C  CG1 . ILE B 2 189 ? 18.593 74.629  17.260  1.00 51.39 ? 1912 ILE B CG1 1 
ATOM   2815 C  CG2 . ILE B 2 189 ? 20.232 72.801  17.723  1.00 45.44 ? 1912 ILE B CG2 1 
ATOM   2816 C  CD1 . ILE B 2 189 ? 18.084 74.520  18.695  1.00 52.06 ? 1912 ILE B CD1 1 
ATOM   2817 N  N   . ALA B 2 190 ? 19.291 72.686  13.214  1.00 45.73 ? 1913 ALA B N   1 
ATOM   2818 C  CA  . ALA B 2 190 ? 18.427 72.394  12.082  1.00 42.26 ? 1913 ALA B CA  1 
ATOM   2819 C  C   . ALA B 2 190 ? 17.786 71.035  12.377  1.00 42.54 ? 1913 ALA B C   1 
ATOM   2820 O  O   . ALA B 2 190 ? 18.271 69.995  11.931  1.00 42.57 ? 1913 ALA B O   1 
ATOM   2821 C  CB  . ALA B 2 190 ? 19.237 72.336  10.805  1.00 36.63 ? 1913 ALA B CB  1 
ATOM   2822 N  N   . LEU B 2 191 ? 16.696 71.058  13.141  1.00 42.76 ? 1914 LEU B N   1 
ATOM   2823 C  CA  . LEU B 2 191 ? 15.983 69.844  13.545  1.00 42.78 ? 1914 LEU B CA  1 
ATOM   2824 C  C   . LEU B 2 191 ? 15.743 68.798  12.469  1.00 43.41 ? 1914 LEU B C   1 
ATOM   2825 O  O   . LEU B 2 191 ? 15.685 67.603  12.766  1.00 45.85 ? 1914 LEU B O   1 
ATOM   2826 C  CB  . LEU B 2 191 ? 14.621 70.187  14.170  1.00 39.99 ? 1914 LEU B CB  1 
ATOM   2827 C  CG  . LEU B 2 191 ? 14.576 70.919  15.515  1.00 38.59 ? 1914 LEU B CG  1 
ATOM   2828 C  CD1 . LEU B 2 191 ? 13.222 70.671  16.154  1.00 37.30 ? 1914 LEU B CD1 1 
ATOM   2829 C  CD2 . LEU B 2 191 ? 15.683 70.426  16.438  1.00 36.81 ? 1914 LEU B CD2 1 
ATOM   2830 N  N   . GLY B 2 192 ? 15.592 69.234  11.226  1.00 42.80 ? 1915 GLY B N   1 
ATOM   2831 C  CA  . GLY B 2 192 ? 15.323 68.291  10.152  1.00 40.63 ? 1915 GLY B CA  1 
ATOM   2832 C  C   . GLY B 2 192 ? 16.422 67.311  9.789   1.00 39.03 ? 1915 GLY B C   1 
ATOM   2833 O  O   . GLY B 2 192 ? 16.214 66.440  8.959   1.00 39.76 ? 1915 GLY B O   1 
ATOM   2834 N  N   . VAL B 2 193 ? 17.591 67.433  10.399  1.00 38.70 ? 1916 VAL B N   1 
ATOM   2835 C  CA  . VAL B 2 193 ? 18.682 66.534  10.071  1.00 37.11 ? 1916 VAL B CA  1 
ATOM   2836 C  C   . VAL B 2 193 ? 18.729 65.368  11.071  1.00 37.03 ? 1916 VAL B C   1 
ATOM   2837 O  O   . VAL B 2 193 ? 19.507 64.423  10.907  1.00 37.79 ? 1916 VAL B O   1 
ATOM   2838 C  CB  . VAL B 2 193 ? 20.023 67.315  10.077  1.00 35.76 ? 1916 VAL B CB  1 
ATOM   2839 C  CG1 . VAL B 2 193 ? 20.552 67.435  11.501  1.00 35.27 ? 1916 VAL B CG1 1 
ATOM   2840 C  CG2 . VAL B 2 193 ? 21.028 66.647  9.161   1.00 36.02 ? 1916 VAL B CG2 1 
ATOM   2841 N  N   . PHE B 2 194 ? 17.869 65.424  12.089  1.00 34.60 ? 1917 PHE B N   1 
ATOM   2842 C  CA  . PHE B 2 194 ? 17.843 64.396  13.131  1.00 32.73 ? 1917 PHE B CA  1 
ATOM   2843 C  C   . PHE B 2 194 ? 16.780 63.318  12.953  1.00 31.93 ? 1917 PHE B C   1 
ATOM   2844 O  O   . PHE B 2 194 ? 15.746 63.545  12.322  1.00 31.26 ? 1917 PHE B O   1 
ATOM   2845 C  CB  . PHE B 2 194 ? 17.639 65.046  14.499  1.00 31.67 ? 1917 PHE B CB  1 
ATOM   2846 C  CG  . PHE B 2 194 ? 18.626 66.126  14.810  1.00 34.45 ? 1917 PHE B CG  1 
ATOM   2847 C  CD1 . PHE B 2 194 ? 18.191 67.421  15.088  1.00 34.78 ? 1917 PHE B CD1 1 
ATOM   2848 C  CD2 . PHE B 2 194 ? 19.990 65.853  14.838  1.00 34.97 ? 1917 PHE B CD2 1 
ATOM   2849 C  CE1 . PHE B 2 194 ? 19.099 68.435  15.390  1.00 36.68 ? 1917 PHE B CE1 1 
ATOM   2850 C  CE2 . PHE B 2 194 ? 20.910 66.862  15.141  1.00 38.06 ? 1917 PHE B CE2 1 
ATOM   2851 C  CZ  . PHE B 2 194 ? 20.462 68.155  15.418  1.00 36.15 ? 1917 PHE B CZ  1 
ATOM   2852 N  N   . ASP B 2 195 ? 17.036 62.147  13.536  1.00 30.98 ? 1918 ASP B N   1 
ATOM   2853 C  CA  . ASP B 2 195 ? 16.102 61.029  13.463  1.00 27.74 ? 1918 ASP B CA  1 
ATOM   2854 C  C   . ASP B 2 195 ? 15.248 61.035  14.719  1.00 25.12 ? 1918 ASP B C   1 
ATOM   2855 O  O   . ASP B 2 195 ? 14.090 60.599  14.700  1.00 25.89 ? 1918 ASP B O   1 
ATOM   2856 C  CB  . ASP B 2 195 ? 16.846 59.690  13.368  1.00 29.21 ? 1918 ASP B CB  1 
ATOM   2857 C  CG  . ASP B 2 195 ? 17.648 59.548  12.083  1.00 32.71 ? 1918 ASP B CG  1 
ATOM   2858 O  OD1 . ASP B 2 195 ? 18.845 59.190  12.168  1.00 35.46 ? 1918 ASP B OD1 1 
ATOM   2859 O  OD2 . ASP B 2 195 ? 17.089 59.785  10.989  1.00 37.91 ? 1918 ASP B OD2 1 
ATOM   2860 N  N   . VAL B 2 196 ? 15.814 61.536  15.811  1.00 22.30 ? 1919 VAL B N   1 
ATOM   2861 C  CA  . VAL B 2 196 ? 15.086 61.577  17.080  1.00 21.13 ? 1919 VAL B CA  1 
ATOM   2862 C  C   . VAL B 2 196 ? 15.692 62.564  18.069  1.00 20.48 ? 1919 VAL B C   1 
ATOM   2863 O  O   . VAL B 2 196 ? 16.896 62.838  18.052  1.00 20.22 ? 1919 VAL B O   1 
ATOM   2864 C  CB  . VAL B 2 196 ? 15.042 60.169  17.750  1.00 18.26 ? 1919 VAL B CB  1 
ATOM   2865 C  CG1 . VAL B 2 196 ? 16.462 59.637  17.945  1.00 14.36 ? 1919 VAL B CG1 1 
ATOM   2866 C  CG2 . VAL B 2 196 ? 14.315 60.242  19.095  1.00 15.74 ? 1919 VAL B CG2 1 
ATOM   2867 N  N   . VAL B 2 197 ? 14.838 63.095  18.933  1.00 23.61 ? 1920 VAL B N   1 
ATOM   2868 C  CA  . VAL B 2 197 ? 15.249 64.037  19.967  1.00 24.24 ? 1920 VAL B CA  1 
ATOM   2869 C  C   . VAL B 2 197 ? 15.159 63.314  21.310  1.00 22.83 ? 1920 VAL B C   1 
ATOM   2870 O  O   . VAL B 2 197 ? 14.070 62.908  21.726  1.00 22.31 ? 1920 VAL B O   1 
ATOM   2871 C  CB  . VAL B 2 197 ? 14.290 65.256  20.013  1.00 25.95 ? 1920 VAL B CB  1 
ATOM   2872 C  CG1 . VAL B 2 197 ? 14.640 66.153  21.184  1.00 27.31 ? 1920 VAL B CG1 1 
ATOM   2873 C  CG2 . VAL B 2 197 ? 14.355 66.035  18.695  1.00 24.54 ? 1920 VAL B CG2 1 
ATOM   2874 N  N   . VAL B 2 198 ? 16.291 63.117  21.971  1.00 23.68 ? 1921 VAL B N   1 
ATOM   2875 C  CA  . VAL B 2 198 ? 16.277 62.478  23.288  1.00 25.48 ? 1921 VAL B CA  1 
ATOM   2876 C  C   . VAL B 2 198 ? 16.426 63.600  24.301  1.00 27.43 ? 1921 VAL B C   1 
ATOM   2877 O  O   . VAL B 2 198 ? 17.444 64.301  24.314  1.00 27.64 ? 1921 VAL B O   1 
ATOM   2878 C  CB  . VAL B 2 198 ? 17.442 61.505  23.472  1.00 23.87 ? 1921 VAL B CB  1 
ATOM   2879 C  CG1 . VAL B 2 198 ? 17.365 60.873  24.839  1.00 23.21 ? 1921 VAL B CG1 1 
ATOM   2880 C  CG2 . VAL B 2 198 ? 17.398 60.439  22.399  1.00 26.04 ? 1921 VAL B CG2 1 
ATOM   2881 N  N   . THR B 2 199 ? 15.420 63.782  25.147  1.00 28.89 ? 1922 THR B N   1 
ATOM   2882 C  CA  . THR B 2 199 ? 15.478 64.867  26.122  1.00 30.42 ? 1922 THR B CA  1 
ATOM   2883 C  C   . THR B 2 199 ? 14.811 64.540  27.464  1.00 31.53 ? 1922 THR B C   1 
ATOM   2884 O  O   . THR B 2 199 ? 14.506 63.379  27.766  1.00 30.07 ? 1922 THR B O   1 
ATOM   2885 C  CB  . THR B 2 199 ? 14.820 66.122  25.531  1.00 27.75 ? 1922 THR B CB  1 
ATOM   2886 O  OG1 . THR B 2 199 ? 14.942 67.220  26.443  1.00 26.80 ? 1922 THR B OG1 1 
ATOM   2887 C  CG2 . THR B 2 199 ? 13.352 65.855  25.266  1.00 28.77 ? 1922 THR B CG2 1 
ATOM   2888 N  N   . ASP B 2 200 ? 14.602 65.573  28.272  1.00 32.15 ? 1923 ASP B N   1 
ATOM   2889 C  CA  . ASP B 2 200 ? 13.957 65.417  29.570  1.00 33.78 ? 1923 ASP B CA  1 
ATOM   2890 C  C   . ASP B 2 200 ? 12.985 66.586  29.768  1.00 33.42 ? 1923 ASP B C   1 
ATOM   2891 O  O   . ASP B 2 200 ? 12.779 67.393  28.853  1.00 32.93 ? 1923 ASP B O   1 
ATOM   2892 C  CB  . ASP B 2 200 ? 15.013 65.336  30.702  1.00 34.26 ? 1923 ASP B CB  1 
ATOM   2893 C  CG  . ASP B 2 200 ? 15.969 66.538  30.733  1.00 36.43 ? 1923 ASP B CG  1 
ATOM   2894 O  OD1 . ASP B 2 200 ? 17.007 66.444  31.438  1.00 31.85 ? 1923 ASP B OD1 1 
ATOM   2895 O  OD2 . ASP B 2 200 ? 15.688 67.571  30.070  1.00 35.79 ? 1923 ASP B OD2 1 
ATOM   2896 N  N   . PRO B 2 201 ? 12.361 66.687  30.950  1.00 32.80 ? 1924 PRO B N   1 
ATOM   2897 C  CA  . PRO B 2 201 ? 11.411 67.787  31.186  1.00 32.30 ? 1924 PRO B CA  1 
ATOM   2898 C  C   . PRO B 2 201 ? 11.909 69.229  31.017  1.00 32.01 ? 1924 PRO B C   1 
ATOM   2899 O  O   . PRO B 2 201 ? 11.106 70.164  30.953  1.00 33.06 ? 1924 PRO B O   1 
ATOM   2900 C  CB  . PRO B 2 201 ? 10.897 67.507  32.606  1.00 32.59 ? 1924 PRO B CB  1 
ATOM   2901 C  CG  . PRO B 2 201 ? 11.981 66.629  33.229  1.00 30.28 ? 1924 PRO B CG  1 
ATOM   2902 C  CD  . PRO B 2 201 ? 12.381 65.746  32.086  1.00 29.52 ? 1924 PRO B CD  1 
ATOM   2903 N  N   . SER B 2 202 ? 13.220 69.424  30.929  1.00 30.20 ? 1925 SER B N   1 
ATOM   2904 C  CA  . SER B 2 202 ? 13.747 70.779  30.788  1.00 27.54 ? 1925 SER B CA  1 
ATOM   2905 C  C   . SER B 2 202 ? 13.799 71.227  29.338  1.00 28.43 ? 1925 SER B C   1 
ATOM   2906 O  O   . SER B 2 202 ? 14.353 72.287  29.031  1.00 26.80 ? 1925 SER B O   1 
ATOM   2907 C  CB  . SER B 2 202 ? 15.152 70.879  31.386  1.00 26.63 ? 1925 SER B CB  1 
ATOM   2908 O  OG  . SER B 2 202 ? 16.128 70.348  30.498  1.00 30.81 ? 1925 SER B OG  1 
ATOM   2909 N  N   . CYS B 2 203 ? 13.228 70.421  28.446  1.00 29.24 ? 1926 CYS B N   1 
ATOM   2910 C  CA  . CYS B 2 203 ? 13.236 70.748  27.029  1.00 29.50 ? 1926 CYS B CA  1 
ATOM   2911 C  C   . CYS B 2 203 ? 12.460 72.041  26.749  1.00 32.02 ? 1926 CYS B C   1 
ATOM   2912 O  O   . CYS B 2 203 ? 11.291 72.182  27.143  1.00 30.48 ? 1926 CYS B O   1 
ATOM   2913 C  CB  . CYS B 2 203 ? 12.636 69.592  26.220  1.00 28.71 ? 1926 CYS B CB  1 
ATOM   2914 S  SG  . CYS B 2 203 ? 12.897 69.690  24.409  1.00 28.06 ? 1926 CYS B SG  1 
ATOM   2915 N  N   . PRO B 2 204 ? 13.106 73.012  26.073  1.00 31.99 ? 1927 PRO B N   1 
ATOM   2916 C  CA  . PRO B 2 204 ? 12.443 74.282  25.752  1.00 30.68 ? 1927 PRO B CA  1 
ATOM   2917 C  C   . PRO B 2 204 ? 11.182 73.972  24.966  1.00 31.32 ? 1927 PRO B C   1 
ATOM   2918 O  O   . PRO B 2 204 ? 11.183 73.065  24.131  1.00 32.35 ? 1927 PRO B O   1 
ATOM   2919 C  CB  . PRO B 2 204 ? 13.473 75.003  24.883  1.00 28.89 ? 1927 PRO B CB  1 
ATOM   2920 C  CG  . PRO B 2 204 ? 14.777 74.495  25.407  1.00 30.99 ? 1927 PRO B CG  1 
ATOM   2921 C  CD  . PRO B 2 204 ? 14.495 73.008  25.577  1.00 31.41 ? 1927 PRO B CD  1 
ATOM   2922 N  N   . ALA B 2 205 ? 10.115 74.719  25.218  1.00 31.98 ? 1928 ALA B N   1 
ATOM   2923 C  CA  . ALA B 2 205 ? 8.862  74.502  24.502  1.00 33.19 ? 1928 ALA B CA  1 
ATOM   2924 C  C   . ALA B 2 205 ? 8.960  74.825  23.010  1.00 34.79 ? 1928 ALA B C   1 
ATOM   2925 O  O   . ALA B 2 205 ? 8.151  74.334  22.218  1.00 35.98 ? 1928 ALA B O   1 
ATOM   2926 C  CB  . ALA B 2 205 ? 7.756  75.317  25.130  1.00 31.81 ? 1928 ALA B CB  1 
ATOM   2927 N  N   . SER B 2 206 ? 9.935  75.641  22.610  1.00 34.37 ? 1929 SER B N   1 
ATOM   2928 C  CA  . SER B 2 206 ? 10.046 75.971  21.192  1.00 33.00 ? 1929 SER B CA  1 
ATOM   2929 C  C   . SER B 2 206 ? 10.557 74.765  20.415  1.00 32.61 ? 1929 SER B C   1 
ATOM   2930 O  O   . SER B 2 206 ? 10.228 74.592  19.235  1.00 30.64 ? 1929 SER B O   1 
ATOM   2931 C  CB  . SER B 2 206 ? 10.946 77.210  20.957  1.00 32.03 ? 1929 SER B CB  1 
ATOM   2932 O  OG  . SER B 2 206 ? 12.319 76.991  21.241  1.00 32.58 ? 1929 SER B OG  1 
ATOM   2933 N  N   . VAL B 2 207 ? 11.342 73.918  21.082  1.00 30.99 ? 1930 VAL B N   1 
ATOM   2934 C  CA  . VAL B 2 207 ? 11.875 72.731  20.429  1.00 30.76 ? 1930 VAL B CA  1 
ATOM   2935 C  C   . VAL B 2 207 ? 10.807 71.655  20.300  1.00 31.69 ? 1930 VAL B C   1 
ATOM   2936 O  O   . VAL B 2 207 ? 10.804 70.889  19.335  1.00 32.68 ? 1930 VAL B O   1 
ATOM   2937 C  CB  . VAL B 2 207 ? 13.074 72.150  21.197  1.00 29.11 ? 1930 VAL B CB  1 
ATOM   2938 C  CG1 . VAL B 2 207 ? 13.456 70.785  20.617  1.00 24.51 ? 1930 VAL B CG1 1 
ATOM   2939 C  CG2 . VAL B 2 207 ? 14.245 73.114  21.112  1.00 25.64 ? 1930 VAL B CG2 1 
ATOM   2940 N  N   . LEU B 2 208 ? 9.905  71.586  21.273  1.00 30.16 ? 1931 LEU B N   1 
ATOM   2941 C  CA  . LEU B 2 208 ? 8.842  70.600  21.212  1.00 30.25 ? 1931 LEU B CA  1 
ATOM   2942 C  C   . LEU B 2 208 ? 7.898  70.991  20.078  1.00 33.10 ? 1931 LEU B C   1 
ATOM   2943 O  O   . LEU B 2 208 ? 7.501  70.146  19.273  1.00 36.14 ? 1931 LEU B O   1 
ATOM   2944 C  CB  . LEU B 2 208 ? 8.073  70.534  22.532  1.00 29.03 ? 1931 LEU B CB  1 
ATOM   2945 C  CG  . LEU B 2 208 ? 8.815  70.073  23.783  1.00 28.59 ? 1931 LEU B CG  1 
ATOM   2946 C  CD1 . LEU B 2 208 ? 7.857  70.086  24.978  1.00 31.13 ? 1931 LEU B CD1 1 
ATOM   2947 C  CD2 . LEU B 2 208 ? 9.362  68.684  23.569  1.00 30.42 ? 1931 LEU B CD2 1 
ATOM   2948 N  N   . LYS B 2 209 ? 7.543  72.270  19.999  1.00 33.99 ? 1932 LYS B N   1 
ATOM   2949 C  CA  . LYS B 2 209 ? 6.652  72.708  18.936  1.00 35.52 ? 1932 LYS B CA  1 
ATOM   2950 C  C   . LYS B 2 209 ? 7.267  72.479  17.550  1.00 35.05 ? 1932 LYS B C   1 
ATOM   2951 O  O   . LYS B 2 209 ? 6.585  71.987  16.649  1.00 39.31 ? 1932 LYS B O   1 
ATOM   2952 C  CB  . LYS B 2 209 ? 6.232  74.171  19.150  1.00 35.78 ? 1932 LYS B CB  1 
ATOM   2953 C  CG  . LYS B 2 209 ? 5.116  74.315  20.189  1.00 36.29 ? 1932 LYS B CG  1 
ATOM   2954 C  CD  . LYS B 2 209 ? 4.658  75.765  20.380  1.00 40.93 ? 1932 LYS B CD  1 
ATOM   2955 C  CE  . LYS B 2 209 ? 5.611  76.577  21.259  1.00 44.23 ? 1932 LYS B CE  1 
ATOM   2956 N  NZ  . LYS B 2 209 ? 5.230  78.032  21.346  1.00 45.09 ? 1932 LYS B NZ  1 
ATOM   2957 N  N   . CYS B 2 210 ? 8.543  72.796  17.373  1.00 31.36 ? 1933 CYS B N   1 
ATOM   2958 C  CA  . CYS B 2 210 ? 9.171  72.575  16.080  1.00 32.54 ? 1933 CYS B CA  1 
ATOM   2959 C  C   . CYS B 2 210 ? 9.209  71.082  15.743  1.00 31.81 ? 1933 CYS B C   1 
ATOM   2960 O  O   . CYS B 2 210 ? 8.867  70.675  14.629  1.00 32.14 ? 1933 CYS B O   1 
ATOM   2961 C  CB  . CYS B 2 210 ? 10.584 73.162  16.073  1.00 35.38 ? 1933 CYS B CB  1 
ATOM   2962 S  SG  . CYS B 2 210 ? 10.616 74.984  16.137  1.00 37.02 ? 1933 CYS B SG  1 
ATOM   2963 N  N   . ALA B 2 211 ? 9.611  70.264  16.708  1.00 30.68 ? 1934 ALA B N   1 
ATOM   2964 C  CA  . ALA B 2 211 ? 9.681  68.826  16.482  1.00 29.99 ? 1934 ALA B CA  1 
ATOM   2965 C  C   . ALA B 2 211 ? 8.340  68.325  15.965  1.00 29.57 ? 1934 ALA B C   1 
ATOM   2966 O  O   . ALA B 2 211 ? 8.273  67.554  15.011  1.00 27.90 ? 1934 ALA B O   1 
ATOM   2967 C  CB  . ALA B 2 211 ? 10.052 68.102  17.767  1.00 27.15 ? 1934 ALA B CB  1 
ATOM   2968 N  N   . GLU B 2 212 ? 7.262  68.778  16.582  1.00 32.44 ? 1935 GLU B N   1 
ATOM   2969 C  CA  . GLU B 2 212 ? 5.949  68.332  16.151  1.00 36.89 ? 1935 GLU B CA  1 
ATOM   2970 C  C   . GLU B 2 212 ? 5.715  68.708  14.687  1.00 38.16 ? 1935 GLU B C   1 
ATOM   2971 O  O   . GLU B 2 212 ? 5.389  67.846  13.878  1.00 40.58 ? 1935 GLU B O   1 
ATOM   2972 C  CB  . GLU B 2 212 ? 4.859  68.908  17.067  1.00 38.79 ? 1935 GLU B CB  1 
ATOM   2973 C  CG  . GLU B 2 212 ? 3.557  68.117  17.023  1.00 47.72 ? 1935 GLU B CG  1 
ATOM   2974 C  CD  . GLU B 2 212 ? 2.703  68.274  18.287  1.00 53.67 ? 1935 GLU B CD  1 
ATOM   2975 O  OE1 . GLU B 2 212 ? 3.224  68.006  19.396  1.00 54.85 ? 1935 GLU B OE1 1 
ATOM   2976 O  OE2 . GLU B 2 212 ? 1.509  68.650  18.169  1.00 55.58 ? 1935 GLU B OE2 1 
ATOM   2977 N  N   . ALA B 2 213 ? 5.914  69.977  14.335  1.00 37.51 ? 1936 ALA B N   1 
ATOM   2978 C  CA  . ALA B 2 213 ? 5.726  70.411  12.955  1.00 36.88 ? 1936 ALA B CA  1 
ATOM   2979 C  C   . ALA B 2 213 ? 6.560  69.578  11.978  1.00 37.61 ? 1936 ALA B C   1 
ATOM   2980 O  O   . ALA B 2 213 ? 6.075  69.231  10.901  1.00 40.59 ? 1936 ALA B O   1 
ATOM   2981 C  CB  . ALA B 2 213 ? 6.073  71.891  12.816  1.00 38.98 ? 1936 ALA B CB  1 
ATOM   2982 N  N   . LEU B 2 214 ? 7.804  69.260  12.341  1.00 35.46 ? 1937 LEU B N   1 
ATOM   2983 C  CA  . LEU B 2 214 ? 8.660  68.462  11.469  1.00 36.97 ? 1937 LEU B CA  1 
ATOM   2984 C  C   . LEU B 2 214 ? 8.433  66.958  11.663  1.00 37.86 ? 1937 LEU B C   1 
ATOM   2985 O  O   . LEU B 2 214 ? 9.051  66.121  10.992  1.00 36.34 ? 1937 LEU B O   1 
ATOM   2986 C  CB  . LEU B 2 214 ? 10.129 68.812  11.716  1.00 38.37 ? 1937 LEU B CB  1 
ATOM   2987 C  CG  . LEU B 2 214 ? 10.598 70.098  11.029  1.00 39.69 ? 1937 LEU B CG  1 
ATOM   2988 C  CD1 . LEU B 2 214 ? 9.714  71.242  11.456  1.00 40.72 ? 1937 LEU B CD1 1 
ATOM   2989 C  CD2 . LEU B 2 214 ? 12.052 70.391  11.382  1.00 42.08 ? 1937 LEU B CD2 1 
ATOM   2990 N  N   . GLN B 2 215 ? 7.523  66.621  12.571  1.00 39.53 ? 1938 GLN B N   1 
ATOM   2991 C  CA  . GLN B 2 215 ? 7.234  65.224  12.881  1.00 41.19 ? 1938 GLN B CA  1 
ATOM   2992 C  C   . GLN B 2 215 ? 8.517  64.476  13.250  1.00 39.79 ? 1938 GLN B C   1 
ATOM   2993 O  O   . GLN B 2 215 ? 8.831  63.411  12.715  1.00 41.32 ? 1938 GLN B O   1 
ATOM   2994 C  CB  . GLN B 2 215 ? 6.522  64.548  11.712  1.00 43.20 ? 1938 GLN B CB  1 
ATOM   2995 C  CG  . GLN B 2 215 ? 5.074  64.965  11.605  1.00 46.77 ? 1938 GLN B CG  1 
ATOM   2996 C  CD  . GLN B 2 215 ? 4.318  64.150  10.594  1.00 50.70 ? 1938 GLN B CD  1 
ATOM   2997 O  OE1 . GLN B 2 215 ? 4.600  64.216  9.397   1.00 51.39 ? 1938 GLN B OE1 1 
ATOM   2998 N  NE2 . GLN B 2 215 ? 3.352  63.362  11.068  1.00 52.10 ? 1938 GLN B NE2 1 
ATOM   2999 N  N   . LEU B 2 216 ? 9.258  65.076  14.171  1.00 36.96 ? 1939 LEU B N   1 
ATOM   3000 C  CA  . LEU B 2 216 ? 10.494 64.516  14.671  1.00 34.81 ? 1939 LEU B CA  1 
ATOM   3001 C  C   . LEU B 2 216 ? 10.189 63.961  16.052  1.00 32.68 ? 1939 LEU B C   1 
ATOM   3002 O  O   . LEU B 2 216 ? 9.934  64.718  16.993  1.00 32.78 ? 1939 LEU B O   1 
ATOM   3003 C  CB  . LEU B 2 216 ? 11.564 65.602  14.760  1.00 36.96 ? 1939 LEU B CB  1 
ATOM   3004 C  CG  . LEU B 2 216 ? 12.740 65.371  15.711  1.00 40.84 ? 1939 LEU B CG  1 
ATOM   3005 C  CD1 . LEU B 2 216 ? 13.173 63.927  15.685  1.00 41.62 ? 1939 LEU B CD1 1 
ATOM   3006 C  CD2 . LEU B 2 216 ? 13.893 66.291  15.307  1.00 43.58 ? 1939 LEU B CD2 1 
ATOM   3007 N  N   . PRO B 2 217 ? 10.216 62.626  16.195  1.00 28.78 ? 1940 PRO B N   1 
ATOM   3008 C  CA  . PRO B 2 217 ? 9.932  62.002  17.487  1.00 26.42 ? 1940 PRO B CA  1 
ATOM   3009 C  C   . PRO B 2 217 ? 10.789 62.587  18.604  1.00 26.61 ? 1940 PRO B C   1 
ATOM   3010 O  O   . PRO B 2 217 ? 11.977 62.870  18.407  1.00 26.45 ? 1940 PRO B O   1 
ATOM   3011 C  CB  . PRO B 2 217 ? 10.275 60.537  17.251  1.00 23.57 ? 1940 PRO B CB  1 
ATOM   3012 C  CG  . PRO B 2 217 ? 10.110 60.365  15.790  1.00 25.36 ? 1940 PRO B CG  1 
ATOM   3013 C  CD  . PRO B 2 217 ? 10.706 61.622  15.238  1.00 24.55 ? 1940 PRO B CD  1 
ATOM   3014 N  N   . VAL B 2 218 ? 10.175 62.766  19.770  1.00 25.85 ? 1941 VAL B N   1 
ATOM   3015 C  CA  . VAL B 2 218 ? 10.864 63.271  20.953  1.00 22.86 ? 1941 VAL B CA  1 
ATOM   3016 C  C   . VAL B 2 218 ? 10.630 62.261  22.071  1.00 23.43 ? 1941 VAL B C   1 
ATOM   3017 O  O   . VAL B 2 218 ? 9.489  61.908  22.371  1.00 20.99 ? 1941 VAL B O   1 
ATOM   3018 C  CB  . VAL B 2 218 ? 10.319 64.623  21.398  1.00 18.96 ? 1941 VAL B CB  1 
ATOM   3019 C  CG1 . VAL B 2 218 ? 11.097 65.098  22.627  1.00 17.86 ? 1941 VAL B CG1 1 
ATOM   3020 C  CG2 . VAL B 2 218 ? 10.438 65.643  20.253  1.00 15.96 ? 1941 VAL B CG2 1 
ATOM   3021 N  N   . VAL B 2 219 ? 11.703 61.793  22.699  1.00 25.36 ? 1942 VAL B N   1 
ATOM   3022 C  CA  . VAL B 2 219 ? 11.549 60.795  23.756  1.00 23.56 ? 1942 VAL B CA  1 
ATOM   3023 C  C   . VAL B 2 219 ? 12.415 61.046  24.975  1.00 24.37 ? 1942 VAL B C   1 
ATOM   3024 O  O   . VAL B 2 219 ? 13.284 61.925  24.969  1.00 27.56 ? 1942 VAL B O   1 
ATOM   3025 C  CB  . VAL B 2 219 ? 11.883 59.394  23.223  1.00 19.73 ? 1942 VAL B CB  1 
ATOM   3026 C  CG1 . VAL B 2 219 ? 11.171 59.181  21.911  1.00 17.88 ? 1942 VAL B CG1 1 
ATOM   3027 C  CG2 . VAL B 2 219 ? 13.407 59.237  23.040  1.00 17.00 ? 1942 VAL B CG2 1 
ATOM   3028 N  N   . SER B 2 220 ? 12.177 60.258  26.018  1.00 22.57 ? 1943 SER B N   1 
ATOM   3029 C  CA  . SER B 2 220 ? 12.948 60.366  27.246  1.00 23.37 ? 1943 SER B CA  1 
ATOM   3030 C  C   . SER B 2 220 ? 14.113 59.370  27.206  1.00 26.78 ? 1943 SER B C   1 
ATOM   3031 O  O   . SER B 2 220 ? 14.200 58.517  26.314  1.00 28.40 ? 1943 SER B O   1 
ATOM   3032 C  CB  . SER B 2 220 ? 12.078 60.056  28.447  1.00 19.25 ? 1943 SER B CB  1 
ATOM   3033 O  OG  . SER B 2 220 ? 11.714 58.693  28.418  1.00 20.71 ? 1943 SER B OG  1 
ATOM   3034 N  N   . GLN B 2 221 ? 15.003 59.473  28.186  1.00 26.93 ? 1944 GLN B N   1 
ATOM   3035 C  CA  . GLN B 2 221 ? 16.161 58.597  28.254  1.00 25.18 ? 1944 GLN B CA  1 
ATOM   3036 C  C   . GLN B 2 221 ? 15.780 57.138  28.428  1.00 27.14 ? 1944 GLN B C   1 
ATOM   3037 O  O   . GLN B 2 221 ? 16.603 56.244  28.184  1.00 27.22 ? 1944 GLN B O   1 
ATOM   3038 C  CB  . GLN B 2 221 ? 17.054 58.996  29.423  1.00 26.00 ? 1944 GLN B CB  1 
ATOM   3039 C  CG  . GLN B 2 221 ? 16.432 58.751  30.778  1.00 23.60 ? 1944 GLN B CG  1 
ATOM   3040 C  CD  . GLN B 2 221 ? 17.355 59.158  31.922  1.00 23.47 ? 1944 GLN B CD  1 
ATOM   3041 O  OE1 . GLN B 2 221 ? 17.965 60.229  31.890  1.00 22.90 ? 1944 GLN B OE1 1 
ATOM   3042 N  NE2 . GLN B 2 221 ? 17.449 58.309  32.944  1.00 22.99 ? 1944 GLN B NE2 1 
ATOM   3043 N  N   . GLU B 2 222 ? 14.545 56.884  28.859  1.00 26.94 ? 1945 GLU B N   1 
ATOM   3044 C  CA  . GLU B 2 222 ? 14.110 55.502  29.065  1.00 25.80 ? 1945 GLU B CA  1 
ATOM   3045 C  C   . GLU B 2 222 ? 13.984 54.764  27.737  1.00 24.96 ? 1945 GLU B C   1 
ATOM   3046 O  O   . GLU B 2 222 ? 14.029 53.530  27.685  1.00 20.99 ? 1945 GLU B O   1 
ATOM   3047 C  CB  . GLU B 2 222 ? 12.775 55.459  29.797  1.00 26.38 ? 1945 GLU B CB  1 
ATOM   3048 C  CG  . GLU B 2 222 ? 12.466 54.083  30.328  1.00 27.45 ? 1945 GLU B CG  1 
ATOM   3049 C  CD  . GLU B 2 222 ? 13.492 53.613  31.346  1.00 27.79 ? 1945 GLU B CD  1 
ATOM   3050 O  OE1 . GLU B 2 222 ? 13.784 52.399  31.377  1.00 27.71 ? 1945 GLU B OE1 1 
ATOM   3051 O  OE2 . GLU B 2 222 ? 13.996 54.453  32.122  1.00 29.61 ? 1945 GLU B OE2 1 
ATOM   3052 N  N   . TRP B 2 223 ? 13.792 55.521  26.664  1.00 24.44 ? 1946 TRP B N   1 
ATOM   3053 C  CA  . TRP B 2 223 ? 13.700 54.914  25.351  1.00 23.62 ? 1946 TRP B CA  1 
ATOM   3054 C  C   . TRP B 2 223 ? 15.099 54.361  25.033  1.00 23.68 ? 1946 TRP B C   1 
ATOM   3055 O  O   . TRP B 2 223 ? 15.240 53.233  24.557  1.00 25.16 ? 1946 TRP B O   1 
ATOM   3056 C  CB  . TRP B 2 223 ? 13.303 55.959  24.310  1.00 25.26 ? 1946 TRP B CB  1 
ATOM   3057 C  CG  . TRP B 2 223 ? 13.210 55.394  22.931  1.00 21.74 ? 1946 TRP B CG  1 
ATOM   3058 C  CD1 . TRP B 2 223 ? 12.229 54.584  22.446  1.00 20.18 ? 1946 TRP B CD1 1 
ATOM   3059 C  CD2 . TRP B 2 223 ? 14.182 55.522  21.891  1.00 21.00 ? 1946 TRP B CD2 1 
ATOM   3060 N  NE1 . TRP B 2 223 ? 12.531 54.193  21.165  1.00 23.45 ? 1946 TRP B NE1 1 
ATOM   3061 C  CE2 . TRP B 2 223 ? 13.728 54.752  20.800  1.00 23.07 ? 1946 TRP B CE2 1 
ATOM   3062 C  CE3 . TRP B 2 223 ? 15.397 56.210  21.776  1.00 20.94 ? 1946 TRP B CE3 1 
ATOM   3063 C  CZ2 . TRP B 2 223 ? 14.448 54.644  19.603  1.00 22.43 ? 1946 TRP B CZ2 1 
ATOM   3064 C  CZ3 . TRP B 2 223 ? 16.117 56.107  20.583  1.00 22.35 ? 1946 TRP B CZ3 1 
ATOM   3065 C  CH2 . TRP B 2 223 ? 15.635 55.327  19.512  1.00 21.89 ? 1946 TRP B CH2 1 
ATOM   3066 N  N   . VAL B 2 224 ? 16.132 55.159  25.304  1.00 19.76 ? 1947 VAL B N   1 
ATOM   3067 C  CA  . VAL B 2 224 ? 17.502 54.732  25.066  1.00 20.00 ? 1947 VAL B CA  1 
ATOM   3068 C  C   . VAL B 2 224 ? 17.772 53.472  25.904  1.00 24.57 ? 1947 VAL B C   1 
ATOM   3069 O  O   . VAL B 2 224 ? 18.199 52.433  25.390  1.00 27.40 ? 1947 VAL B O   1 
ATOM   3070 C  CB  . VAL B 2 224 ? 18.510 55.835  25.489  1.00 19.56 ? 1947 VAL B CB  1 
ATOM   3071 C  CG1 . VAL B 2 224 ? 19.960 55.387  25.197  1.00 15.77 ? 1947 VAL B CG1 1 
ATOM   3072 C  CG2 . VAL B 2 224 ? 18.201 57.124  24.757  1.00 16.11 ? 1947 VAL B CG2 1 
ATOM   3073 N  N   . ILE B 2 225 ? 17.507 53.567  27.200  1.00 24.27 ? 1948 ILE B N   1 
ATOM   3074 C  CA  . ILE B 2 225 ? 17.732 52.446  28.092  1.00 24.84 ? 1948 ILE B CA  1 
ATOM   3075 C  C   . ILE B 2 225 ? 17.008 51.179  27.647  1.00 28.36 ? 1948 ILE B C   1 
ATOM   3076 O  O   . ILE B 2 225 ? 17.632 50.110  27.579  1.00 32.23 ? 1948 ILE B O   1 
ATOM   3077 C  CB  . ILE B 2 225 ? 17.312 52.796  29.531  1.00 23.32 ? 1948 ILE B CB  1 
ATOM   3078 C  CG1 . ILE B 2 225 ? 18.120 54.006  30.014  1.00 20.45 ? 1948 ILE B CG1 1 
ATOM   3079 C  CG2 . ILE B 2 225 ? 17.512 51.579  30.444  1.00 20.39 ? 1948 ILE B CG2 1 
ATOM   3080 C  CD1 . ILE B 2 225 ? 17.757 54.500  31.414  1.00 18.90 ? 1948 ILE B CD1 1 
ATOM   3081 N  N   . GLN B 2 226 ? 15.712 51.283  27.342  1.00 26.56 ? 1949 GLN B N   1 
ATOM   3082 C  CA  . GLN B 2 226 ? 14.955 50.116  26.902  1.00 25.91 ? 1949 GLN B CA  1 
ATOM   3083 C  C   . GLN B 2 226 ? 15.569 49.542  25.639  1.00 25.95 ? 1949 GLN B C   1 
ATOM   3084 O  O   . GLN B 2 226 ? 15.584 48.324  25.453  1.00 26.79 ? 1949 GLN B O   1 
ATOM   3085 C  CB  . GLN B 2 226 ? 13.490 50.474  26.655  1.00 29.90 ? 1949 GLN B CB  1 
ATOM   3086 C  CG  . GLN B 2 226 ? 12.681 50.657  27.944  1.00 32.09 ? 1949 GLN B CG  1 
ATOM   3087 C  CD  . GLN B 2 226 ? 12.807 49.458  28.866  1.00 30.36 ? 1949 GLN B CD  1 
ATOM   3088 O  OE1 . GLN B 2 226 ? 12.682 48.320  28.421  1.00 31.77 ? 1949 GLN B OE1 1 
ATOM   3089 N  NE2 . GLN B 2 226 ? 13.055 49.706  30.157  1.00 28.48 ? 1949 GLN B NE2 1 
ATOM   3090 N  N   . CYS B 2 227 ? 16.083 50.406  24.770  1.00 24.29 ? 1950 CYS B N   1 
ATOM   3091 C  CA  . CYS B 2 227 ? 16.705 49.911  23.547  1.00 25.72 ? 1950 CYS B CA  1 
ATOM   3092 C  C   . CYS B 2 227 ? 17.889 49.025  23.895  1.00 25.96 ? 1950 CYS B C   1 
ATOM   3093 O  O   . CYS B 2 227 ? 18.121 48.001  23.248  1.00 26.42 ? 1950 CYS B O   1 
ATOM   3094 C  CB  . CYS B 2 227 ? 17.182 51.062  22.663  1.00 26.21 ? 1950 CYS B CB  1 
ATOM   3095 S  SG  . CYS B 2 227 ? 15.881 51.835  21.675  1.00 27.77 ? 1950 CYS B SG  1 
ATOM   3096 N  N   . LEU B 2 228 ? 18.638 49.418  24.918  1.00 23.02 ? 1951 LEU B N   1 
ATOM   3097 C  CA  . LEU B 2 228 ? 19.794 48.637  25.331  1.00 22.56 ? 1951 LEU B CA  1 
ATOM   3098 C  C   . LEU B 2 228 ? 19.383 47.327  26.012  1.00 25.41 ? 1951 LEU B C   1 
ATOM   3099 O  O   . LEU B 2 228 ? 19.981 46.270  25.772  1.00 25.29 ? 1951 LEU B O   1 
ATOM   3100 C  CB  . LEU B 2 228 ? 20.673 49.469  26.258  1.00 18.90 ? 1951 LEU B CB  1 
ATOM   3101 C  CG  . LEU B 2 228 ? 21.359 50.616  25.517  1.00 15.32 ? 1951 LEU B CG  1 
ATOM   3102 C  CD1 . LEU B 2 228 ? 21.910 51.642  26.515  1.00 11.00 ? 1951 LEU B CD1 1 
ATOM   3103 C  CD2 . LEU B 2 228 ? 22.462 50.035  24.630  1.00 15.44 ? 1951 LEU B CD2 1 
ATOM   3104 N  N   . ILE B 2 229 ? 18.367 47.390  26.864  1.00 26.48 ? 1952 ILE B N   1 
ATOM   3105 C  CA  . ILE B 2 229 ? 17.897 46.193  27.542  1.00 26.57 ? 1952 ILE B CA  1 
ATOM   3106 C  C   . ILE B 2 229 ? 17.353 45.206  26.500  1.00 27.90 ? 1952 ILE B C   1 
ATOM   3107 O  O   . ILE B 2 229 ? 17.846 44.085  26.377  1.00 29.33 ? 1952 ILE B O   1 
ATOM   3108 C  CB  . ILE B 2 229 ? 16.778 46.525  28.557  1.00 25.00 ? 1952 ILE B CB  1 
ATOM   3109 C  CG1 . ILE B 2 229 ? 17.376 47.009  29.875  1.00 28.09 ? 1952 ILE B CG1 1 
ATOM   3110 C  CG2 . ILE B 2 229 ? 15.943 45.294  28.831  1.00 26.86 ? 1952 ILE B CG2 1 
ATOM   3111 C  CD1 . ILE B 2 229 ? 18.186 48.255  29.773  1.00 33.12 ? 1952 ILE B CD1 1 
ATOM   3112 N  N   . VAL B 2 230 ? 16.344 45.635  25.748  1.00 26.61 ? 1953 VAL B N   1 
ATOM   3113 C  CA  . VAL B 2 230 ? 15.723 44.787  24.744  1.00 28.55 ? 1953 VAL B CA  1 
ATOM   3114 C  C   . VAL B 2 230 ? 16.713 44.296  23.706  1.00 29.85 ? 1953 VAL B C   1 
ATOM   3115 O  O   . VAL B 2 230 ? 16.552 43.214  23.155  1.00 32.15 ? 1953 VAL B O   1 
ATOM   3116 C  CB  . VAL B 2 230 ? 14.577 45.534  24.030  1.00 31.01 ? 1953 VAL B CB  1 
ATOM   3117 C  CG1 . VAL B 2 230 ? 14.016 44.683  22.907  1.00 30.68 ? 1953 VAL B CG1 1 
ATOM   3118 C  CG2 . VAL B 2 230 ? 13.484 45.891  25.038  1.00 30.08 ? 1953 VAL B CG2 1 
ATOM   3119 N  N   . GLY B 2 231 ? 17.733 45.094  23.426  1.00 32.64 ? 1954 GLY B N   1 
ATOM   3120 C  CA  . GLY B 2 231 ? 18.733 44.688  22.451  1.00 33.83 ? 1954 GLY B CA  1 
ATOM   3121 C  C   . GLY B 2 231 ? 18.455 45.090  21.010  1.00 37.85 ? 1954 GLY B C   1 
ATOM   3122 O  O   . GLY B 2 231 ? 19.090 44.592  20.080  1.00 37.81 ? 1954 GLY B O   1 
ATOM   3123 N  N   . GLU B 2 232 ? 17.504 45.990  20.805  1.00 41.27 ? 1955 GLU B N   1 
ATOM   3124 C  CA  . GLU B 2 232 ? 17.184 46.442  19.453  1.00 40.66 ? 1955 GLU B CA  1 
ATOM   3125 C  C   . GLU B 2 232 ? 16.393 47.745  19.544  1.00 40.22 ? 1955 GLU B C   1 
ATOM   3126 O  O   . GLU B 2 232 ? 15.848 48.077  20.598  1.00 41.77 ? 1955 GLU B O   1 
ATOM   3127 C  CB  . GLU B 2 232 ? 16.365 45.378  18.718  1.00 40.78 ? 1955 GLU B CB  1 
ATOM   3128 C  CG  . GLU B 2 232 ? 14.982 45.155  19.312  1.00 44.71 ? 1955 GLU B CG  1 
ATOM   3129 C  CD  . GLU B 2 232 ? 14.220 44.043  18.619  1.00 47.60 ? 1955 GLU B CD  1 
ATOM   3130 O  OE1 . GLU B 2 232 ? 13.001 43.904  18.885  1.00 50.19 ? 1955 GLU B OE1 1 
ATOM   3131 O  OE2 . GLU B 2 232 ? 14.840 43.306  17.816  1.00 46.63 ? 1955 GLU B OE2 1 
ATOM   3132 N  N   . ARG B 2 233 ? 16.327 48.487  18.446  1.00 38.41 ? 1956 ARG B N   1 
ATOM   3133 C  CA  . ARG B 2 233 ? 15.600 49.750  18.452  1.00 35.80 ? 1956 ARG B CA  1 
ATOM   3134 C  C   . ARG B 2 233 ? 14.106 49.449  18.594  1.00 35.61 ? 1956 ARG B C   1 
ATOM   3135 O  O   . ARG B 2 233 ? 13.547 48.712  17.777  1.00 37.27 ? 1956 ARG B O   1 
ATOM   3136 C  CB  . ARG B 2 233 ? 15.882 50.493  17.150  1.00 34.28 ? 1956 ARG B CB  1 
ATOM   3137 C  CG  . ARG B 2 233 ? 15.658 51.986  17.178  1.00 35.89 ? 1956 ARG B CG  1 
ATOM   3138 C  CD  . ARG B 2 233 ? 16.260 52.604  15.915  1.00 38.19 ? 1956 ARG B CD  1 
ATOM   3139 N  NE  . ARG B 2 233 ? 17.685 52.274  15.799  1.00 37.85 ? 1956 ARG B NE  1 
ATOM   3140 C  CZ  . ARG B 2 233 ? 18.411 52.407  14.689  1.00 35.96 ? 1956 ARG B CZ  1 
ATOM   3141 N  NH1 . ARG B 2 233 ? 17.864 52.862  13.569  1.00 35.16 ? 1956 ARG B NH1 1 
ATOM   3142 N  NH2 . ARG B 2 233 ? 19.697 52.093  14.704  1.00 37.00 ? 1956 ARG B NH2 1 
ATOM   3143 N  N   . ILE B 2 234 ? 13.466 49.986  19.637  1.00 31.19 ? 1957 ILE B N   1 
ATOM   3144 C  CA  . ILE B 2 234 ? 12.032 49.763  19.835  1.00 27.95 ? 1957 ILE B CA  1 
ATOM   3145 C  C   . ILE B 2 234 ? 11.159 51.017  19.654  1.00 27.29 ? 1957 ILE B C   1 
ATOM   3146 O  O   . ILE B 2 234 ? 11.666 52.130  19.475  1.00 25.74 ? 1957 ILE B O   1 
ATOM   3147 C  CB  . ILE B 2 234 ? 11.725 49.103  21.223  1.00 28.62 ? 1957 ILE B CB  1 
ATOM   3148 C  CG1 . ILE B 2 234 ? 12.456 49.832  22.357  1.00 28.02 ? 1957 ILE B CG1 1 
ATOM   3149 C  CG2 . ILE B 2 234 ? 12.119 47.635  21.197  1.00 29.07 ? 1957 ILE B CG2 1 
ATOM   3150 C  CD1 . ILE B 2 234 ? 11.832 51.148  22.742  1.00 27.23 ? 1957 ILE B CD1 1 
ATOM   3151 N  N   . GLY B 2 235 ? 9.842  50.814  19.713  1.00 26.93 ? 1958 GLY B N   1 
ATOM   3152 C  CA  . GLY B 2 235 ? 8.875  51.882  19.510  1.00 26.76 ? 1958 GLY B CA  1 
ATOM   3153 C  C   . GLY B 2 235 ? 9.073  53.200  20.230  1.00 27.87 ? 1958 GLY B C   1 
ATOM   3154 O  O   . GLY B 2 235 ? 9.166  53.238  21.451  1.00 29.59 ? 1958 GLY B O   1 
ATOM   3155 N  N   . PHE B 2 236 ? 9.126  54.290  19.471  1.00 26.73 ? 1959 PHE B N   1 
ATOM   3156 C  CA  . PHE B 2 236 ? 9.294  55.620  20.046  1.00 28.34 ? 1959 PHE B CA  1 
ATOM   3157 C  C   . PHE B 2 236 ? 8.176  55.916  21.041  1.00 31.31 ? 1959 PHE B C   1 
ATOM   3158 O  O   . PHE B 2 236 ? 8.385  56.618  22.031  1.00 29.71 ? 1959 PHE B O   1 
ATOM   3159 C  CB  . PHE B 2 236 ? 9.251  56.688  18.943  1.00 26.37 ? 1959 PHE B CB  1 
ATOM   3160 C  CG  . PHE B 2 236 ? 10.513 56.788  18.125  1.00 25.30 ? 1959 PHE B CG  1 
ATOM   3161 C  CD1 . PHE B 2 236 ? 10.445 56.951  16.742  1.00 26.33 ? 1959 PHE B CD1 1 
ATOM   3162 C  CD2 . PHE B 2 236 ? 11.762 56.790  18.735  1.00 22.98 ? 1959 PHE B CD2 1 
ATOM   3163 C  CE1 . PHE B 2 236 ? 11.611 57.123  15.974  1.00 25.77 ? 1959 PHE B CE1 1 
ATOM   3164 C  CE2 . PHE B 2 236 ? 12.926 56.960  17.985  1.00 25.02 ? 1959 PHE B CE2 1 
ATOM   3165 C  CZ  . PHE B 2 236 ? 12.851 57.129  16.597  1.00 24.83 ? 1959 PHE B CZ  1 
ATOM   3166 N  N   . LYS B 2 237 ? 6.985  55.386  20.769  1.00 36.81 ? 1960 LYS B N   1 
ATOM   3167 C  CA  . LYS B 2 237 ? 5.825  55.629  21.627  1.00 39.46 ? 1960 LYS B CA  1 
ATOM   3168 C  C   . LYS B 2 237 ? 5.237  54.336  22.168  1.00 40.65 ? 1960 LYS B C   1 
ATOM   3169 O  O   . LYS B 2 237 ? 4.098  54.316  22.645  1.00 41.75 ? 1960 LYS B O   1 
ATOM   3170 C  CB  . LYS B 2 237 ? 4.746  56.379  20.839  1.00 40.91 ? 1960 LYS B CB  1 
ATOM   3171 C  CG  . LYS B 2 237 ? 5.279  57.562  20.057  1.00 44.40 ? 1960 LYS B CG  1 
ATOM   3172 C  CD  . LYS B 2 237 ? 4.417  57.904  18.843  1.00 48.23 ? 1960 LYS B CD  1 
ATOM   3173 C  CE  . LYS B 2 237 ? 3.184  58.717  19.210  1.00 52.08 ? 1960 LYS B CE  1 
ATOM   3174 N  NZ  . LYS B 2 237 ? 2.625  59.420  18.005  1.00 53.56 ? 1960 LYS B NZ  1 
ATOM   3175 N  N   . GLN B 2 238 ? 6.017  53.260  22.114  1.00 40.20 ? 1961 GLN B N   1 
ATOM   3176 C  CA  . GLN B 2 238 ? 5.544  51.956  22.580  1.00 38.81 ? 1961 GLN B CA  1 
ATOM   3177 C  C   . GLN B 2 238 ? 5.216  51.919  24.072  1.00 35.92 ? 1961 GLN B C   1 
ATOM   3178 O  O   . GLN B 2 238 ? 4.662  50.941  24.557  1.00 31.87 ? 1961 GLN B O   1 
ATOM   3179 C  CB  . GLN B 2 238 ? 6.581  50.882  22.258  1.00 41.40 ? 1961 GLN B CB  1 
ATOM   3180 C  CG  . GLN B 2 238 ? 6.061  49.456  22.281  1.00 44.21 ? 1961 GLN B CG  1 
ATOM   3181 C  CD  . GLN B 2 238 ? 7.123  48.466  21.816  1.00 46.64 ? 1961 GLN B CD  1 
ATOM   3182 O  OE1 . GLN B 2 238 ? 8.196  48.373  22.409  1.00 48.97 ? 1961 GLN B OE1 1 
ATOM   3183 N  NE2 . GLN B 2 238 ? 6.830  47.732  20.746  1.00 47.79 ? 1961 GLN B NE2 1 
ATOM   3184 N  N   . HIS B 2 239 ? 5.539  52.990  24.793  1.00 36.19 ? 1962 HIS B N   1 
ATOM   3185 C  CA  . HIS B 2 239 ? 5.292  53.043  26.238  1.00 36.33 ? 1962 HIS B CA  1 
ATOM   3186 C  C   . HIS B 2 239 ? 5.267  54.489  26.745  1.00 36.87 ? 1962 HIS B C   1 
ATOM   3187 O  O   . HIS B 2 239 ? 6.067  55.321  26.323  1.00 37.66 ? 1962 HIS B O   1 
ATOM   3188 C  CB  . HIS B 2 239 ? 6.395  52.258  26.957  1.00 36.90 ? 1962 HIS B CB  1 
ATOM   3189 C  CG  . HIS B 2 239 ? 6.148  52.041  28.420  1.00 38.47 ? 1962 HIS B CG  1 
ATOM   3190 N  ND1 . HIS B 2 239 ? 6.401  53.004  29.374  1.00 39.49 ? 1962 HIS B ND1 1 
ATOM   3191 C  CD2 . HIS B 2 239 ? 5.682  50.960  29.093  1.00 38.61 ? 1962 HIS B CD2 1 
ATOM   3192 C  CE1 . HIS B 2 239 ? 6.106  52.526  30.570  1.00 37.54 ? 1962 HIS B CE1 1 
ATOM   3193 N  NE2 . HIS B 2 239 ? 5.667  51.287  30.428  1.00 36.45 ? 1962 HIS B NE2 1 
ATOM   3194 N  N   . PRO B 2 240 ? 4.357  54.803  27.676  1.00 37.83 ? 1963 PRO B N   1 
ATOM   3195 C  CA  . PRO B 2 240 ? 4.254  56.166  28.214  1.00 37.77 ? 1963 PRO B CA  1 
ATOM   3196 C  C   . PRO B 2 240 ? 5.531  56.753  28.810  1.00 35.68 ? 1963 PRO B C   1 
ATOM   3197 O  O   . PRO B 2 240 ? 5.769  57.958  28.713  1.00 35.35 ? 1963 PRO B O   1 
ATOM   3198 C  CB  . PRO B 2 240 ? 3.135  56.047  29.256  1.00 36.70 ? 1963 PRO B CB  1 
ATOM   3199 C  CG  . PRO B 2 240 ? 3.281  54.653  29.737  1.00 38.16 ? 1963 PRO B CG  1 
ATOM   3200 C  CD  . PRO B 2 240 ? 3.500  53.881  28.443  1.00 39.07 ? 1963 PRO B CD  1 
ATOM   3201 N  N   . LYS B 2 241 ? 6.347  55.911  29.434  1.00 35.37 ? 1964 LYS B N   1 
ATOM   3202 C  CA  . LYS B 2 241 ? 7.585  56.392  30.047  1.00 34.86 ? 1964 LYS B CA  1 
ATOM   3203 C  C   . LYS B 2 241 ? 8.598  56.919  29.029  1.00 34.26 ? 1964 LYS B C   1 
ATOM   3204 O  O   . LYS B 2 241 ? 9.668  57.430  29.403  1.00 30.34 ? 1964 LYS B O   1 
ATOM   3205 C  CB  . LYS B 2 241 ? 8.235  55.290  30.897  1.00 32.38 ? 1964 LYS B CB  1 
ATOM   3206 C  CG  . LYS B 2 241 ? 7.615  55.163  32.267  1.00 36.73 ? 1964 LYS B CG  1 
ATOM   3207 C  CD  . LYS B 2 241 ? 8.231  54.051  33.113  1.00 41.30 ? 1964 LYS B CD  1 
ATOM   3208 C  CE  . LYS B 2 241 ? 7.484  53.907  34.448  1.00 42.42 ? 1964 LYS B CE  1 
ATOM   3209 N  NZ  . LYS B 2 241 ? 7.785  52.621  35.146  1.00 44.61 ? 1964 LYS B NZ  1 
ATOM   3210 N  N   . TYR B 2 242 ? 8.267  56.792  27.749  1.00 32.44 ? 1965 TYR B N   1 
ATOM   3211 C  CA  . TYR B 2 242 ? 9.159  57.273  26.708  1.00 34.34 ? 1965 TYR B CA  1 
ATOM   3212 C  C   . TYR B 2 242 ? 8.913  58.762  26.424  1.00 35.14 ? 1965 TYR B C   1 
ATOM   3213 O  O   . TYR B 2 242 ? 9.792  59.446  25.896  1.00 36.85 ? 1965 TYR B O   1 
ATOM   3214 C  CB  . TYR B 2 242 ? 8.995  56.425  25.435  1.00 33.37 ? 1965 TYR B CB  1 
ATOM   3215 C  CG  . TYR B 2 242 ? 9.364  54.950  25.602  1.00 34.91 ? 1965 TYR B CG  1 
ATOM   3216 C  CD1 . TYR B 2 242 ? 9.119  54.032  24.579  1.00 35.61 ? 1965 TYR B CD1 1 
ATOM   3217 C  CD2 . TYR B 2 242 ? 9.945  54.471  26.782  1.00 36.62 ? 1965 TYR B CD2 1 
ATOM   3218 C  CE1 . TYR B 2 242 ? 9.434  52.675  24.716  1.00 35.12 ? 1965 TYR B CE1 1 
ATOM   3219 C  CE2 . TYR B 2 242 ? 10.267 53.109  26.934  1.00 36.52 ? 1965 TYR B CE2 1 
ATOM   3220 C  CZ  . TYR B 2 242 ? 10.005 52.216  25.893  1.00 36.86 ? 1965 TYR B CZ  1 
ATOM   3221 O  OH  . TYR B 2 242 ? 10.294 50.867  26.029  1.00 34.25 ? 1965 TYR B OH  1 
ATOM   3222 N  N   . LYS B 2 243 ? 7.728  59.263  26.784  1.00 37.56 ? 1966 LYS B N   1 
ATOM   3223 C  CA  . LYS B 2 243 ? 7.391  60.680  26.584  1.00 39.82 ? 1966 LYS B CA  1 
ATOM   3224 C  C   . LYS B 2 243 ? 8.405  61.490  27.384  1.00 39.30 ? 1966 LYS B C   1 
ATOM   3225 O  O   . LYS B 2 243 ? 8.634  61.210  28.558  1.00 39.63 ? 1966 LYS B O   1 
ATOM   3226 C  CB  . LYS B 2 243 ? 5.989  60.993  27.112  1.00 39.82 ? 1966 LYS B CB  1 
ATOM   3227 C  CG  . LYS B 2 243 ? 4.889  60.156  26.505  1.00 43.58 ? 1966 LYS B CG  1 
ATOM   3228 C  CD  . LYS B 2 243 ? 3.542  60.483  27.147  1.00 46.84 ? 1966 LYS B CD  1 
ATOM   3229 C  CE  . LYS B 2 243 ? 2.459  59.496  26.709  1.00 48.07 ? 1966 LYS B CE  1 
ATOM   3230 N  NZ  . LYS B 2 243 ? 1.172  59.692  27.437  1.00 47.24 ? 1966 LYS B NZ  1 
ATOM   3231 N  N   . HIS B 2 244 ? 8.995  62.496  26.752  1.00 39.27 ? 1967 HIS B N   1 
ATOM   3232 C  CA  . HIS B 2 244 ? 10.019 63.330  27.380  1.00 38.68 ? 1967 HIS B CA  1 
ATOM   3233 C  C   . HIS B 2 244 ? 9.659  63.912  28.740  1.00 38.92 ? 1967 HIS B C   1 
ATOM   3234 O  O   . HIS B 2 244 ? 10.518 64.043  29.609  1.00 36.23 ? 1967 HIS B O   1 
ATOM   3235 C  CB  . HIS B 2 244 ? 10.382 64.480  26.441  1.00 37.38 ? 1967 HIS B CB  1 
ATOM   3236 C  CG  . HIS B 2 244 ? 9.456  65.648  26.547  1.00 38.05 ? 1967 HIS B CG  1 
ATOM   3237 N  ND1 . HIS B 2 244 ? 9.654  66.670  27.451  1.00 36.72 ? 1967 HIS B ND1 1 
ATOM   3238 C  CD2 . HIS B 2 244 ? 8.287  65.919  25.920  1.00 36.89 ? 1967 HIS B CD2 1 
ATOM   3239 C  CE1 . HIS B 2 244 ? 8.645  67.519  27.379  1.00 35.13 ? 1967 HIS B CE1 1 
ATOM   3240 N  NE2 . HIS B 2 244 ? 7.802  67.086  26.458  1.00 36.25 ? 1967 HIS B NE2 1 
ATOM   3241 N  N   . ASP B 2 245 ? 8.394  64.265  28.929  1.00 42.62 ? 1968 ASP B N   1 
ATOM   3242 C  CA  . ASP B 2 245 ? 7.990  64.878  30.184  1.00 43.68 ? 1968 ASP B CA  1 
ATOM   3243 C  C   . ASP B 2 245 ? 7.471  63.945  31.264  1.00 45.91 ? 1968 ASP B C   1 
ATOM   3244 O  O   . ASP B 2 245 ? 6.919  64.414  32.262  1.00 48.18 ? 1968 ASP B O   1 
ATOM   3245 C  CB  . ASP B 2 245 ? 6.964  65.978  29.922  1.00 41.77 ? 1968 ASP B CB  1 
ATOM   3246 C  CG  . ASP B 2 245 ? 5.652  65.441  29.412  1.00 41.70 ? 1968 ASP B CG  1 
ATOM   3247 O  OD1 . ASP B 2 245 ? 5.559  64.220  29.159  1.00 42.48 ? 1968 ASP B OD1 1 
ATOM   3248 O  OD2 . ASP B 2 245 ? 4.709  66.249  29.262  1.00 43.94 ? 1968 ASP B OD2 1 
ATOM   3249 N  N   . TYR B 2 246 ? 7.678  62.639  31.107  1.00 45.95 ? 1969 TYR B N   1 
ATOM   3250 C  CA  . TYR B 2 246 ? 7.207  61.691  32.118  1.00 48.68 ? 1969 TYR B CA  1 
ATOM   3251 C  C   . TYR B 2 246 ? 7.825  62.039  33.472  1.00 53.44 ? 1969 TYR B C   1 
ATOM   3252 O  O   . TYR B 2 246 ? 9.049  62.004  33.629  1.00 55.56 ? 1969 TYR B O   1 
ATOM   3253 C  CB  . TYR B 2 246 ? 7.598  60.268  31.748  1.00 45.26 ? 1969 TYR B CB  1 
ATOM   3254 C  CG  . TYR B 2 246 ? 6.982  59.218  32.645  1.00 44.18 ? 1969 TYR B CG  1 
ATOM   3255 C  CD1 . TYR B 2 246 ? 5.760  58.619  32.317  1.00 43.69 ? 1969 TYR B CD1 1 
ATOM   3256 C  CD2 . TYR B 2 246 ? 7.623  58.812  33.820  1.00 43.88 ? 1969 TYR B CD2 1 
ATOM   3257 C  CE1 . TYR B 2 246 ? 5.195  57.635  33.138  1.00 42.31 ? 1969 TYR B CE1 1 
ATOM   3258 C  CE2 . TYR B 2 246 ? 7.071  57.830  34.649  1.00 41.92 ? 1969 TYR B CE2 1 
ATOM   3259 C  CZ  . TYR B 2 246 ? 5.859  57.243  34.302  1.00 42.61 ? 1969 TYR B CZ  1 
ATOM   3260 O  OH  . TYR B 2 246 ? 5.326  56.250  35.097  1.00 39.74 ? 1969 TYR B OH  1 
ATOM   3261 N  N   . VAL B 2 247 ? 6.980  62.356  34.452  1.00 56.88 ? 1970 VAL B N   1 
ATOM   3262 C  CA  . VAL B 2 247 ? 7.469  62.737  35.772  1.00 59.42 ? 1970 VAL B CA  1 
ATOM   3263 C  C   . VAL B 2 247 ? 7.482  61.622  36.814  1.00 63.64 ? 1970 VAL B C   1 
ATOM   3264 O  O   . VAL B 2 247 ? 8.468  60.890  36.922  1.00 66.54 ? 1970 VAL B O   1 
ATOM   3265 C  CB  . VAL B 2 247 ? 6.677  63.954  36.324  1.00 58.02 ? 1970 VAL B CB  1 
ATOM   3266 C  CG1 . VAL B 2 247 ? 7.155  64.316  37.726  1.00 57.15 ? 1970 VAL B CG1 1 
ATOM   3267 C  CG2 . VAL B 2 247 ? 6.864  65.147  35.395  1.00 57.20 ? 1970 VAL B CG2 1 
ATOM   3268 N  N   . SER B 2 248 ? 6.400  61.484  37.578  1.00 66.59 ? 1971 SER B N   1 
ATOM   3269 C  CA  . SER B 2 248 ? 6.349  60.466  38.632  1.00 68.88 ? 1971 SER B CA  1 
ATOM   3270 C  C   . SER B 2 248 ? 4.933  60.196  39.166  1.00 70.48 ? 1971 SER B C   1 
ATOM   3271 O  O   . SER B 2 248 ? 4.391  59.102  38.874  1.00 71.13 ? 1971 SER B O   1 
ATOM   3272 C  CB  . SER B 2 248 ? 7.270  60.900  39.788  1.00 68.78 ? 1971 SER B CB  1 
ATOM   3273 O  OG  . SER B 2 248 ? 7.226  59.997  40.880  1.00 70.49 ? 1971 SER B OG  1 
ATOM   3274 N  N   . HIS B 2 249 ? 4.378  61.075  39.871  1.00 70.99 ? 1972 HIS B N   1 
ATOM   3275 N  N   . SER C 3 1   ? 63.145 13.154  -1.004  1.00 70.65 ? 95   SER C N   1 
ATOM   3276 C  CA  . SER C 3 1   ? 61.807 12.755  -0.468  1.00 71.21 ? 95   SER C CA  1 
ATOM   3277 C  C   . SER C 3 1   ? 60.678 13.112  -1.446  1.00 69.87 ? 95   SER C C   1 
ATOM   3278 O  O   . SER C 3 1   ? 59.658 13.701  -1.065  1.00 68.74 ? 95   SER C O   1 
ATOM   3279 C  CB  . SER C 3 1   ? 61.574 13.427  0.893   1.00 72.45 ? 95   SER C CB  1 
ATOM   3280 O  OG  . SER C 3 1   ? 61.860 14.817  0.838   1.00 72.95 ? 95   SER C OG  1 
ATOM   3281 N  N   . SER C 3 2   ? 60.872 12.736  -2.707  1.00 67.86 ? 96   SER C N   1 
ATOM   3282 C  CA  . SER C 3 2   ? 59.903 13.009  -3.760  1.00 65.89 ? 96   SER C CA  1 
ATOM   3283 C  C   . SER C 3 2   ? 58.477 12.592  -3.400  1.00 64.67 ? 96   SER C C   1 
ATOM   3284 O  O   . SER C 3 2   ? 58.252 11.630  -2.655  1.00 63.76 ? 96   SER C O   1 
ATOM   3285 C  CB  . SER C 3 2   ? 60.324 12.309  -5.061  1.00 64.96 ? 96   SER C CB  1 
ATOM   3286 O  OG  . SER C 3 2   ? 59.407 12.590  -6.104  1.00 60.86 ? 96   SER C OG  1 
ATOM   3287 N  N   . VAL C 3 3   ? 57.524 13.344  -3.942  1.00 61.78 ? 97   VAL C N   1 
ATOM   3288 C  CA  . VAL C 3 3   ? 56.099 13.114  -3.742  1.00 58.96 ? 97   VAL C CA  1 
ATOM   3289 C  C   . VAL C 3 3   ? 55.643 11.883  -4.514  1.00 55.76 ? 97   VAL C C   1 
ATOM   3290 O  O   . VAL C 3 3   ? 55.974 11.717  -5.689  1.00 54.92 ? 97   VAL C O   1 
ATOM   3291 C  CB  . VAL C 3 3   ? 55.280 14.313  -4.229  1.00 58.80 ? 97   VAL C CB  1 
ATOM   3292 C  CG1 . VAL C 3 3   ? 55.840 14.807  -5.549  1.00 60.46 ? 97   VAL C CG1 1 
ATOM   3293 C  CG2 . VAL C 3 3   ? 53.822 13.907  -4.407  1.00 59.43 ? 97   VAL C CG2 1 
ATOM   3294 N  N   . PRO C 3 4   ? 54.871 11.003  -3.859  1.00 53.36 ? 98   PRO C N   1 
ATOM   3295 C  CA  . PRO C 3 4   ? 54.378 9.785   -4.512  1.00 49.56 ? 98   PRO C CA  1 
ATOM   3296 C  C   . PRO C 3 4   ? 53.475 10.098  -5.693  1.00 49.09 ? 98   PRO C C   1 
ATOM   3297 O  O   . PRO C 3 4   ? 52.797 11.129  -5.705  1.00 52.02 ? 98   PRO C O   1 
ATOM   3298 C  CB  . PRO C 3 4   ? 53.647 9.059   -3.387  1.00 48.84 ? 98   PRO C CB  1 
ATOM   3299 C  CG  . PRO C 3 4   ? 53.216 10.173  -2.477  1.00 50.75 ? 98   PRO C CG  1 
ATOM   3300 C  CD  . PRO C 3 4   ? 54.415 11.078  -2.458  1.00 51.17 ? 98   PRO C CD  1 
ATOM   3301 N  N   . SER C 3 5   ? 53.478 9.217   -6.689  1.00 46.10 ? 99   SER C N   1 
ATOM   3302 C  CA  . SER C 3 5   ? 52.655 9.405   -7.878  1.00 44.67 ? 99   SER C CA  1 
ATOM   3303 C  C   . SER C 3 5   ? 51.166 9.215   -7.566  1.00 43.98 ? 99   SER C C   1 
ATOM   3304 O  O   . SER C 3 5   ? 50.797 8.390   -6.726  1.00 43.76 ? 99   SER C O   1 
ATOM   3305 C  CB  . SER C 3 5   ? 53.076 8.417   -8.981  1.00 45.42 ? 99   SER C CB  1 
ATOM   3306 O  OG  . SER C 3 5   ? 52.285 8.575   -10.156 1.00 44.06 ? 99   SER C OG  1 
ATOM   3307 N  N   . GLN C 3 6   ? 50.319 9.983   -8.245  1.00 40.93 ? 100  GLN C N   1 
ATOM   3308 C  CA  . GLN C 3 6   ? 48.882 9.878   -8.056  1.00 40.36 ? 100  GLN C CA  1 
ATOM   3309 C  C   . GLN C 3 6   ? 48.279 9.520   -9.421  1.00 42.56 ? 100  GLN C C   1 
ATOM   3310 O  O   . GLN C 3 6   ? 47.048 9.474   -9.590  1.00 41.96 ? 100  GLN C O   1 
ATOM   3311 C  CB  . GLN C 3 6   ? 48.308 11.213  -7.556  1.00 39.68 ? 100  GLN C CB  1 
ATOM   3312 C  CG  . GLN C 3 6   ? 48.259 12.314  -8.620  1.00 40.57 ? 100  GLN C CG  1 
ATOM   3313 C  CD  . GLN C 3 6   ? 48.099 13.717  -8.036  1.00 39.31 ? 100  GLN C CD  1 
ATOM   3314 O  OE1 . GLN C 3 6   ? 49.010 14.238  -7.377  1.00 38.15 ? 100  GLN C OE1 1 
ATOM   3315 N  NE2 . GLN C 3 6   ? 46.945 14.336  -8.280  1.00 36.09 ? 100  GLN C NE2 1 
ATOM   3316 N  N   . LYS C 3 7   ? 49.162 9.257   -10.386 1.00 40.75 ? 101  LYS C N   1 
ATOM   3317 C  CA  . LYS C 3 7   ? 48.761 8.926   -11.755 1.00 39.83 ? 101  LYS C CA  1 
ATOM   3318 C  C   . LYS C 3 7   ? 47.865 7.678   -11.869 1.00 36.39 ? 101  LYS C C   1 
ATOM   3319 O  O   . LYS C 3 7   ? 48.260 6.573   -11.475 1.00 35.33 ? 101  LYS C O   1 
ATOM   3320 C  CB  . LYS C 3 7   ? 50.020 8.740   -12.610 1.00 39.38 ? 101  LYS C CB  1 
ATOM   3321 C  CG  . LYS C 3 7   ? 49.994 9.447   -13.955 1.00 41.73 ? 101  LYS C CG  1 
ATOM   3322 C  CD  . LYS C 3 7   ? 51.288 9.189   -14.750 1.00 45.81 ? 101  LYS C CD  1 
ATOM   3323 C  CE  . LYS C 3 7   ? 52.581 9.522   -13.953 1.00 50.27 ? 101  LYS C CE  1 
ATOM   3324 N  NZ  . LYS C 3 7   ? 52.844 10.981  -13.686 1.00 49.26 ? 101  LYS C NZ  1 
ATOM   3325 N  N   . THR C 3 8   ? 46.658 7.858   -12.397 1.00 31.92 ? 102  THR C N   1 
ATOM   3326 C  CA  . THR C 3 8   ? 45.752 6.729   -12.590 1.00 32.39 ? 102  THR C CA  1 
ATOM   3327 C  C   . THR C 3 8   ? 46.510 5.677   -13.386 1.00 33.04 ? 102  THR C C   1 
ATOM   3328 O  O   . THR C 3 8   ? 47.169 6.006   -14.364 1.00 37.10 ? 102  THR C O   1 
ATOM   3329 C  CB  . THR C 3 8   ? 44.528 7.121   -13.414 1.00 29.87 ? 102  THR C CB  1 
ATOM   3330 O  OG1 . THR C 3 8   ? 43.756 8.084   -12.690 1.00 29.74 ? 102  THR C OG1 1 
ATOM   3331 C  CG2 . THR C 3 8   ? 43.689 5.894   -13.734 1.00 22.83 ? 102  THR C CG2 1 
ATOM   3332 N  N   . TYR C 3 9   ? 46.404 4.419   -12.975 1.00 33.17 ? 103  TYR C N   1 
ATOM   3333 C  CA  . TYR C 3 9   ? 47.095 3.320   -13.635 1.00 31.98 ? 103  TYR C CA  1 
ATOM   3334 C  C   . TYR C 3 9   ? 46.270 2.050   -13.402 1.00 31.99 ? 103  TYR C C   1 
ATOM   3335 O  O   . TYR C 3 9   ? 46.434 1.374   -12.383 1.00 31.62 ? 103  TYR C O   1 
ATOM   3336 C  CB  . TYR C 3 9   ? 48.502 3.203   -13.027 1.00 35.38 ? 103  TYR C CB  1 
ATOM   3337 C  CG  . TYR C 3 9   ? 49.368 2.092   -13.576 1.00 39.84 ? 103  TYR C CG  1 
ATOM   3338 C  CD1 . TYR C 3 9   ? 49.527 1.918   -14.951 1.00 39.83 ? 103  TYR C CD1 1 
ATOM   3339 C  CD2 . TYR C 3 9   ? 50.047 1.221   -12.715 1.00 41.34 ? 103  TYR C CD2 1 
ATOM   3340 C  CE1 . TYR C 3 9   ? 50.337 0.907   -15.460 1.00 41.85 ? 103  TYR C CE1 1 
ATOM   3341 C  CE2 . TYR C 3 9   ? 50.865 0.198   -13.215 1.00 42.93 ? 103  TYR C CE2 1 
ATOM   3342 C  CZ  . TYR C 3 9   ? 51.003 0.050   -14.594 1.00 42.61 ? 103  TYR C CZ  1 
ATOM   3343 O  OH  . TYR C 3 9   ? 51.808 -0.942  -15.113 1.00 42.45 ? 103  TYR C OH  1 
ATOM   3344 N  N   . GLN C 3 10  ? 45.373 1.737   -14.339 1.00 32.67 ? 104  GLN C N   1 
ATOM   3345 C  CA  . GLN C 3 10  ? 44.510 0.558   -14.215 1.00 30.61 ? 104  GLN C CA  1 
ATOM   3346 C  C   . GLN C 3 10  ? 45.276 -0.745  -14.272 1.00 31.73 ? 104  GLN C C   1 
ATOM   3347 O  O   . GLN C 3 10  ? 44.853 -1.747  -13.696 1.00 34.73 ? 104  GLN C O   1 
ATOM   3348 C  CB  . GLN C 3 10  ? 43.437 0.565   -15.292 1.00 27.64 ? 104  GLN C CB  1 
ATOM   3349 C  CG  . GLN C 3 10  ? 42.634 1.844   -15.297 1.00 29.53 ? 104  GLN C CG  1 
ATOM   3350 C  CD  . GLN C 3 10  ? 41.388 1.738   -16.129 1.00 30.60 ? 104  GLN C CD  1 
ATOM   3351 O  OE1 . GLN C 3 10  ? 41.385 1.103   -17.188 1.00 33.52 ? 104  GLN C OE1 1 
ATOM   3352 N  NE2 . GLN C 3 10  ? 40.315 2.370   -15.665 1.00 31.18 ? 104  GLN C NE2 1 
ATOM   3353 N  N   . GLY C 3 11  ? 46.404 -0.731  -14.973 1.00 33.68 ? 105  GLY C N   1 
ATOM   3354 C  CA  . GLY C 3 11  ? 47.241 -1.914  -15.064 1.00 30.37 ? 105  GLY C CA  1 
ATOM   3355 C  C   . GLY C 3 11  ? 46.647 -3.102  -15.785 1.00 29.97 ? 105  GLY C C   1 
ATOM   3356 O  O   . GLY C 3 11  ? 45.563 -3.027  -16.383 1.00 27.59 ? 105  GLY C O   1 
ATOM   3357 N  N   . SER C 3 12  ? 47.372 -4.213  -15.714 1.00 30.08 ? 106  SER C N   1 
ATOM   3358 C  CA  . SER C 3 12  ? 46.960 -5.445  -16.363 1.00 32.40 ? 106  SER C CA  1 
ATOM   3359 C  C   . SER C 3 12  ? 45.666 -6.055  -15.810 1.00 33.91 ? 106  SER C C   1 
ATOM   3360 O  O   . SER C 3 12  ? 44.947 -6.759  -16.528 1.00 35.08 ? 106  SER C O   1 
ATOM   3361 C  CB  . SER C 3 12  ? 48.104 -6.466  -16.296 1.00 31.40 ? 106  SER C CB  1 
ATOM   3362 O  OG  . SER C 3 12  ? 49.095 -6.070  -15.367 1.00 29.95 ? 106  SER C OG  1 
ATOM   3363 N  N   . TYR C 3 13  ? 45.353 -5.766  -14.551 1.00 34.28 ? 107  TYR C N   1 
ATOM   3364 C  CA  . TYR C 3 13  ? 44.155 -6.314  -13.915 1.00 32.70 ? 107  TYR C CA  1 
ATOM   3365 C  C   . TYR C 3 13  ? 42.906 -5.460  -14.084 1.00 34.18 ? 107  TYR C C   1 
ATOM   3366 O  O   . TYR C 3 13  ? 41.849 -5.795  -13.530 1.00 35.02 ? 107  TYR C O   1 
ATOM   3367 C  CB  . TYR C 3 13  ? 44.429 -6.524  -12.423 1.00 29.18 ? 107  TYR C CB  1 
ATOM   3368 C  CG  . TYR C 3 13  ? 45.608 -7.422  -12.195 1.00 28.85 ? 107  TYR C CG  1 
ATOM   3369 C  CD1 . TYR C 3 13  ? 45.520 -8.798  -12.450 1.00 28.50 ? 107  TYR C CD1 1 
ATOM   3370 C  CD2 . TYR C 3 13  ? 46.846 -6.893  -11.832 1.00 27.27 ? 107  TYR C CD2 1 
ATOM   3371 C  CE1 . TYR C 3 13  ? 46.648 -9.627  -12.363 1.00 26.89 ? 107  TYR C CE1 1 
ATOM   3372 C  CE2 . TYR C 3 13  ? 47.974 -7.709  -11.739 1.00 27.92 ? 107  TYR C CE2 1 
ATOM   3373 C  CZ  . TYR C 3 13  ? 47.867 -9.074  -12.012 1.00 28.20 ? 107  TYR C CZ  1 
ATOM   3374 O  OH  . TYR C 3 13  ? 48.988 -9.871  -11.960 1.00 30.69 ? 107  TYR C OH  1 
ATOM   3375 N  N   . GLY C 3 14  ? 43.022 -4.366  -14.839 1.00 34.47 ? 108  GLY C N   1 
ATOM   3376 C  CA  . GLY C 3 14  ? 41.881 -3.483  -15.046 1.00 34.36 ? 108  GLY C CA  1 
ATOM   3377 C  C   . GLY C 3 14  ? 41.353 -2.945  -13.724 1.00 35.07 ? 108  GLY C C   1 
ATOM   3378 O  O   . GLY C 3 14  ? 40.154 -3.002  -13.447 1.00 33.89 ? 108  GLY C O   1 
ATOM   3379 N  N   . PHE C 3 15  ? 42.258 -2.406  -12.910 1.00 35.27 ? 109  PHE C N   1 
ATOM   3380 C  CA  . PHE C 3 15  ? 41.904 -1.878  -11.598 1.00 36.50 ? 109  PHE C CA  1 
ATOM   3381 C  C   . PHE C 3 15  ? 41.175 -0.530  -11.565 1.00 38.18 ? 109  PHE C C   1 
ATOM   3382 O  O   . PHE C 3 15  ? 41.686 0.483   -12.040 1.00 41.46 ? 109  PHE C O   1 
ATOM   3383 C  CB  . PHE C 3 15  ? 43.168 -1.789  -10.750 1.00 34.51 ? 109  PHE C CB  1 
ATOM   3384 C  CG  . PHE C 3 15  ? 42.952 -1.181  -9.401  1.00 36.63 ? 109  PHE C CG  1 
ATOM   3385 C  CD1 . PHE C 3 15  ? 41.808 -1.475  -8.665  1.00 36.16 ? 109  PHE C CD1 1 
ATOM   3386 C  CD2 . PHE C 3 15  ? 43.925 -0.359  -8.833  1.00 37.31 ? 109  PHE C CD2 1 
ATOM   3387 C  CE1 . PHE C 3 15  ? 41.638 -0.962  -7.374  1.00 37.81 ? 109  PHE C CE1 1 
ATOM   3388 C  CE2 . PHE C 3 15  ? 43.765 0.160   -7.541  1.00 36.68 ? 109  PHE C CE2 1 
ATOM   3389 C  CZ  . PHE C 3 15  ? 42.622 -0.143  -6.812  1.00 36.29 ? 109  PHE C CZ  1 
ATOM   3390 N  N   . ARG C 3 16  ? 39.971 -0.524  -11.012 1.00 36.89 ? 110  ARG C N   1 
ATOM   3391 C  CA  . ARG C 3 16  ? 39.224 0.716   -10.872 1.00 36.22 ? 110  ARG C CA  1 
ATOM   3392 C  C   . ARG C 3 16  ? 38.578 0.736   -9.472  1.00 35.56 ? 110  ARG C C   1 
ATOM   3393 O  O   . ARG C 3 16  ? 38.506 -0.296  -8.793  1.00 35.47 ? 110  ARG C O   1 
ATOM   3394 C  CB  . ARG C 3 16  ? 38.196 0.881   -12.011 1.00 35.77 ? 110  ARG C CB  1 
ATOM   3395 C  CG  . ARG C 3 16  ? 37.323 -0.322  -12.288 1.00 41.77 ? 110  ARG C CG  1 
ATOM   3396 C  CD  . ARG C 3 16  ? 37.065 -0.504  -13.789 1.00 43.55 ? 110  ARG C CD  1 
ATOM   3397 N  NE  . ARG C 3 16  ? 36.357 -1.757  -14.094 1.00 48.68 ? 110  ARG C NE  1 
ATOM   3398 C  CZ  . ARG C 3 16  ? 36.731 -2.972  -13.675 1.00 49.19 ? 110  ARG C CZ  1 
ATOM   3399 N  NH1 . ARG C 3 16  ? 37.811 -3.124  -12.922 1.00 48.56 ? 110  ARG C NH1 1 
ATOM   3400 N  NH2 . ARG C 3 16  ? 36.023 -4.046  -14.007 1.00 49.13 ? 110  ARG C NH2 1 
ATOM   3401 N  N   . LEU C 3 17  ? 38.165 1.921   -9.029  1.00 34.01 ? 111  LEU C N   1 
ATOM   3402 C  CA  . LEU C 3 17  ? 37.546 2.113   -7.718  1.00 30.03 ? 111  LEU C CA  1 
ATOM   3403 C  C   . LEU C 3 17  ? 36.056 2.349   -7.850  1.00 29.15 ? 111  LEU C C   1 
ATOM   3404 O  O   . LEU C 3 17  ? 35.578 2.753   -8.907  1.00 30.55 ? 111  LEU C O   1 
ATOM   3405 C  CB  . LEU C 3 17  ? 38.149 3.325   -7.014  1.00 26.89 ? 111  LEU C CB  1 
ATOM   3406 C  CG  . LEU C 3 17  ? 39.625 3.250   -6.664  1.00 25.07 ? 111  LEU C CG  1 
ATOM   3407 C  CD1 . LEU C 3 17  ? 40.123 4.629   -6.251  1.00 22.04 ? 111  LEU C CD1 1 
ATOM   3408 C  CD2 . LEU C 3 17  ? 39.815 2.219   -5.546  1.00 25.01 ? 111  LEU C CD2 1 
ATOM   3409 N  N   . GLY C 3 18  ? 35.335 2.111   -6.759  1.00 29.64 ? 112  GLY C N   1 
ATOM   3410 C  CA  . GLY C 3 18  ? 33.896 2.303   -6.743  1.00 29.07 ? 112  GLY C CA  1 
ATOM   3411 C  C   . GLY C 3 18  ? 33.499 2.825   -5.378  1.00 29.10 ? 112  GLY C C   1 
ATOM   3412 O  O   . GLY C 3 18  ? 34.281 2.734   -4.430  1.00 31.74 ? 112  GLY C O   1 
ATOM   3413 N  N   . PHE C 3 19  ? 32.296 3.378   -5.267  1.00 27.54 ? 113  PHE C N   1 
ATOM   3414 C  CA  . PHE C 3 19  ? 31.826 3.922   -4.000  1.00 25.02 ? 113  PHE C CA  1 
ATOM   3415 C  C   . PHE C 3 19  ? 30.328 3.741   -3.872  1.00 25.71 ? 113  PHE C C   1 
ATOM   3416 O  O   . PHE C 3 19  ? 29.593 3.863   -4.849  1.00 26.55 ? 113  PHE C O   1 
ATOM   3417 C  CB  . PHE C 3 19  ? 32.151 5.405   -3.916  1.00 23.35 ? 113  PHE C CB  1 
ATOM   3418 C  CG  . PHE C 3 19  ? 33.609 5.707   -3.989  1.00 22.77 ? 113  PHE C CG  1 
ATOM   3419 C  CD1 . PHE C 3 19  ? 34.405 5.613   -2.859  1.00 23.97 ? 113  PHE C CD1 1 
ATOM   3420 C  CD2 . PHE C 3 19  ? 34.194 6.077   -5.199  1.00 22.19 ? 113  PHE C CD2 1 
ATOM   3421 C  CE1 . PHE C 3 19  ? 35.774 5.887   -2.933  1.00 26.95 ? 113  PHE C CE1 1 
ATOM   3422 C  CE2 . PHE C 3 19  ? 35.554 6.349   -5.284  1.00 21.39 ? 113  PHE C CE2 1 
ATOM   3423 C  CZ  . PHE C 3 19  ? 36.348 6.255   -4.151  1.00 24.22 ? 113  PHE C CZ  1 
ATOM   3424 N  N   . LEU C 3 20  ? 29.869 3.436   -2.668  1.00 26.80 ? 114  LEU C N   1 
ATOM   3425 C  CA  . LEU C 3 20  ? 28.441 3.264   -2.462  1.00 29.79 ? 114  LEU C CA  1 
ATOM   3426 C  C   . LEU C 3 20  ? 27.716 4.563   -2.825  1.00 33.17 ? 114  LEU C C   1 
ATOM   3427 O  O   . LEU C 3 20  ? 28.347 5.594   -3.088  1.00 34.54 ? 114  LEU C O   1 
ATOM   3428 C  CB  . LEU C 3 20  ? 28.157 2.922   -1.003  1.00 28.05 ? 114  LEU C CB  1 
ATOM   3429 C  CG  . LEU C 3 20  ? 28.719 1.618   -0.451  1.00 24.86 ? 114  LEU C CG  1 
ATOM   3430 C  CD1 . LEU C 3 20  ? 28.237 1.444   0.984   1.00 24.31 ? 114  LEU C CD1 1 
ATOM   3431 C  CD2 . LEU C 3 20  ? 28.254 0.459   -1.301  1.00 22.17 ? 114  LEU C CD2 1 
ATOM   3432 N  N   . HIS C 3 21  ? 26.391 4.499   -2.861  1.00 35.13 ? 115  HIS C N   1 
ATOM   3433 C  CA  . HIS C 3 21  ? 25.567 5.666   -3.154  1.00 38.49 ? 115  HIS C CA  1 
ATOM   3434 C  C   . HIS C 3 21  ? 25.154 6.096   -1.762  1.00 40.73 ? 115  HIS C C   1 
ATOM   3435 O  O   . HIS C 3 21  ? 24.871 5.239   -0.922  1.00 44.94 ? 115  HIS C O   1 
ATOM   3436 C  CB  . HIS C 3 21  ? 24.333 5.252   -3.951  1.00 41.29 ? 115  HIS C CB  1 
ATOM   3437 C  CG  . HIS C 3 21  ? 24.654 4.479   -5.193  1.00 45.31 ? 115  HIS C CG  1 
ATOM   3438 N  ND1 . HIS C 3 21  ? 25.055 5.083   -6.366  1.00 44.58 ? 115  HIS C ND1 1 
ATOM   3439 C  CD2 . HIS C 3 21  ? 24.685 3.145   -5.427  1.00 44.86 ? 115  HIS C CD2 1 
ATOM   3440 C  CE1 . HIS C 3 21  ? 25.321 4.156   -7.268  1.00 46.02 ? 115  HIS C CE1 1 
ATOM   3441 N  NE2 . HIS C 3 21  ? 25.105 2.971   -6.723  1.00 46.16 ? 115  HIS C NE2 1 
ATOM   3442 N  N   . SER C 3 22  ? 25.131 7.394   -1.489  1.00 39.31 ? 116  SER C N   1 
ATOM   3443 C  CA  . SER C 3 22  ? 24.755 7.836   -0.153  1.00 37.74 ? 116  SER C CA  1 
ATOM   3444 C  C   . SER C 3 22  ? 23.915 9.092   -0.175  1.00 38.01 ? 116  SER C C   1 
ATOM   3445 O  O   . SER C 3 22  ? 23.986 9.883   -1.118  1.00 37.56 ? 116  SER C O   1 
ATOM   3446 C  CB  . SER C 3 22  ? 26.005 8.070   0.700   1.00 36.47 ? 116  SER C CB  1 
ATOM   3447 O  OG  . SER C 3 22  ? 26.699 6.856   0.930   1.00 35.98 ? 116  SER C OG  1 
ATOM   3448 N  N   . GLY C 3 23  ? 23.113 9.264   0.871   1.00 38.02 ? 117  GLY C N   1 
ATOM   3449 C  CA  . GLY C 3 23  ? 22.277 10.443  0.969   1.00 38.06 ? 117  GLY C CA  1 
ATOM   3450 C  C   . GLY C 3 23  ? 23.156 11.669  1.130   1.00 39.18 ? 117  GLY C C   1 
ATOM   3451 O  O   . GLY C 3 23  ? 24.379 11.590  0.954   1.00 39.48 ? 117  GLY C O   1 
ATOM   3452 N  N   . THR C 3 24  ? 22.552 12.806  1.459   1.00 39.72 ? 118  THR C N   1 
ATOM   3453 C  CA  . THR C 3 24  ? 23.330 14.023  1.639   1.00 40.75 ? 118  THR C CA  1 
ATOM   3454 C  C   . THR C 3 24  ? 22.821 14.922  2.759   1.00 43.23 ? 118  THR C C   1 
ATOM   3455 O  O   . THR C 3 24  ? 23.207 16.084  2.849   1.00 44.77 ? 118  THR C O   1 
ATOM   3456 C  CB  . THR C 3 24  ? 23.381 14.834  0.352   1.00 38.35 ? 118  THR C CB  1 
ATOM   3457 O  OG1 . THR C 3 24  ? 22.048 15.045  -0.118  1.00 35.50 ? 118  THR C OG1 1 
ATOM   3458 C  CG2 . THR C 3 24  ? 24.216 14.108  -0.705  1.00 34.35 ? 118  THR C CG2 1 
ATOM   3459 N  N   . ALA C 3 25  ? 21.956 14.388  3.613   1.00 45.65 ? 119  ALA C N   1 
ATOM   3460 C  CA  . ALA C 3 25  ? 21.439 15.165  4.730   1.00 49.08 ? 119  ALA C CA  1 
ATOM   3461 C  C   . ALA C 3 25  ? 22.638 15.554  5.589   1.00 52.28 ? 119  ALA C C   1 
ATOM   3462 O  O   . ALA C 3 25  ? 23.733 15.024  5.396   1.00 55.55 ? 119  ALA C O   1 
ATOM   3463 C  CB  . ALA C 3 25  ? 20.455 14.322  5.542   1.00 47.12 ? 119  ALA C CB  1 
ATOM   3464 N  N   . LYS C 3 26  ? 22.453 16.482  6.523   1.00 54.27 ? 120  LYS C N   1 
ATOM   3465 C  CA  . LYS C 3 26  ? 23.556 16.879  7.396   1.00 56.77 ? 120  LYS C CA  1 
ATOM   3466 C  C   . LYS C 3 26  ? 24.095 15.593  8.029   1.00 56.28 ? 120  LYS C C   1 
ATOM   3467 O  O   . LYS C 3 26  ? 25.297 15.309  8.023   1.00 56.63 ? 120  LYS C O   1 
ATOM   3468 C  CB  . LYS C 3 26  ? 23.047 17.812  8.499   1.00 58.06 ? 120  LYS C CB  1 
ATOM   3469 C  CG  . LYS C 3 26  ? 22.564 19.172  8.024   1.00 60.45 ? 120  LYS C CG  1 
ATOM   3470 C  CD  . LYS C 3 26  ? 21.766 19.875  9.122   1.00 64.94 ? 120  LYS C CD  1 
ATOM   3471 C  CE  . LYS C 3 26  ? 22.553 19.962  10.438  1.00 67.73 ? 120  LYS C CE  1 
ATOM   3472 N  NZ  . LYS C 3 26  ? 21.765 20.581  11.554  1.00 68.33 ? 120  LYS C NZ  1 
ATOM   3473 N  N   . SER C 3 27  ? 23.155 14.817  8.548   1.00 53.72 ? 121  SER C N   1 
ATOM   3474 C  CA  . SER C 3 27  ? 23.404 13.552  9.215   1.00 52.03 ? 121  SER C CA  1 
ATOM   3475 C  C   . SER C 3 27  ? 24.474 12.606  8.614   1.00 50.17 ? 121  SER C C   1 
ATOM   3476 O  O   . SER C 3 27  ? 25.502 12.353  9.247   1.00 51.03 ? 121  SER C O   1 
ATOM   3477 C  CB  . SER C 3 27  ? 22.059 12.819  9.340   1.00 50.41 ? 121  SER C CB  1 
ATOM   3478 O  OG  . SER C 3 27  ? 22.122 11.757  10.269  1.00 50.33 ? 121  SER C OG  1 
ATOM   3479 N  N   . VAL C 3 28  ? 24.223 12.098  7.406   1.00 47.22 ? 122  VAL C N   1 
ATOM   3480 C  CA  . VAL C 3 28  ? 25.103 11.138  6.720   1.00 43.30 ? 122  VAL C CA  1 
ATOM   3481 C  C   . VAL C 3 28  ? 26.575 11.149  7.103   1.00 41.87 ? 122  VAL C C   1 
ATOM   3482 O  O   . VAL C 3 28  ? 27.236 12.192  7.082   1.00 40.36 ? 122  VAL C O   1 
ATOM   3483 C  CB  . VAL C 3 28  ? 25.004 11.265  5.172   1.00 43.15 ? 122  VAL C CB  1 
ATOM   3484 C  CG1 . VAL C 3 28  ? 25.839 12.447  4.664   1.00 40.41 ? 122  VAL C CG1 1 
ATOM   3485 C  CG2 . VAL C 3 28  ? 25.452 9.969   4.532   1.00 42.00 ? 122  VAL C CG2 1 
ATOM   3486 N  N   . THR C 3 29  ? 27.078 9.962   7.437   1.00 40.49 ? 123  THR C N   1 
ATOM   3487 C  CA  . THR C 3 29  ? 28.466 9.772   7.855   1.00 37.36 ? 123  THR C CA  1 
ATOM   3488 C  C   . THR C 3 29  ? 29.483 9.703   6.718   1.00 37.69 ? 123  THR C C   1 
ATOM   3489 O  O   . THR C 3 29  ? 30.663 10.009  6.916   1.00 38.12 ? 123  THR C O   1 
ATOM   3490 C  CB  . THR C 3 29  ? 28.617 8.482   8.656   1.00 36.10 ? 123  THR C CB  1 
ATOM   3491 O  OG1 . THR C 3 29  ? 28.010 7.407   7.931   1.00 36.41 ? 123  THR C OG1 1 
ATOM   3492 C  CG2 . THR C 3 29  ? 27.973 8.613   10.018  1.00 34.10 ? 123  THR C CG2 1 
ATOM   3493 N  N   . CYS C 3 30  ? 29.044 9.295   5.533   1.00 37.00 ? 124  CYS C N   1 
ATOM   3494 C  CA  . CYS C 3 30  ? 29.971 9.194   4.415   1.00 36.27 ? 124  CYS C CA  1 
ATOM   3495 C  C   . CYS C 3 30  ? 29.242 9.222   3.090   1.00 34.10 ? 124  CYS C C   1 
ATOM   3496 O  O   . CYS C 3 30  ? 28.432 8.342   2.802   1.00 37.16 ? 124  CYS C O   1 
ATOM   3497 C  CB  . CYS C 3 30  ? 30.783 7.895   4.531   1.00 36.65 ? 124  CYS C CB  1 
ATOM   3498 S  SG  . CYS C 3 30  ? 32.031 7.670   3.235   1.00 44.73 ? 124  CYS C SG  1 
ATOM   3499 N  N   . THR C 3 31  ? 29.541 10.227  2.277   1.00 32.09 ? 125  THR C N   1 
ATOM   3500 C  CA  . THR C 3 31  ? 28.898 10.371  0.975   1.00 31.27 ? 125  THR C CA  1 
ATOM   3501 C  C   . THR C 3 31  ? 29.975 10.643  -0.072  1.00 29.32 ? 125  THR C C   1 
ATOM   3502 O  O   . THR C 3 31  ? 30.945 11.345  0.198   1.00 31.04 ? 125  THR C O   1 
ATOM   3503 C  CB  . THR C 3 31  ? 27.868 11.547  1.002   1.00 31.24 ? 125  THR C CB  1 
ATOM   3504 O  OG1 . THR C 3 31  ? 26.788 11.278  0.097   1.00 30.43 ? 125  THR C OG1 1 
ATOM   3505 C  CG2 . THR C 3 31  ? 28.539 12.856  0.607   1.00 29.96 ? 125  THR C CG2 1 
ATOM   3506 N  N   . TYR C 3 32  ? 29.806 10.089  -1.263  1.00 30.09 ? 126  TYR C N   1 
ATOM   3507 C  CA  . TYR C 3 32  ? 30.787 10.284  -2.324  1.00 31.43 ? 126  TYR C CA  1 
ATOM   3508 C  C   . TYR C 3 32  ? 30.239 11.098  -3.492  1.00 31.03 ? 126  TYR C C   1 
ATOM   3509 O  O   . TYR C 3 32  ? 29.103 10.894  -3.923  1.00 30.75 ? 126  TYR C O   1 
ATOM   3510 C  CB  . TYR C 3 32  ? 31.303 8.918   -2.810  1.00 29.82 ? 126  TYR C CB  1 
ATOM   3511 C  CG  . TYR C 3 32  ? 32.127 8.988   -4.075  1.00 28.89 ? 126  TYR C CG  1 
ATOM   3512 C  CD1 . TYR C 3 32  ? 31.546 8.735   -5.312  1.00 28.62 ? 126  TYR C CD1 1 
ATOM   3513 C  CD2 . TYR C 3 32  ? 33.480 9.319   -4.038  1.00 26.04 ? 126  TYR C CD2 1 
ATOM   3514 C  CE1 . TYR C 3 32  ? 32.286 8.803   -6.486  1.00 29.16 ? 126  TYR C CE1 1 
ATOM   3515 C  CE2 . TYR C 3 32  ? 34.230 9.396   -5.208  1.00 28.67 ? 126  TYR C CE2 1 
ATOM   3516 C  CZ  . TYR C 3 32  ? 33.621 9.132   -6.432  1.00 28.98 ? 126  TYR C CZ  1 
ATOM   3517 O  OH  . TYR C 3 32  ? 34.341 9.182   -7.608  1.00 29.12 ? 126  TYR C OH  1 
ATOM   3518 N  N   . SER C 3 33  ? 31.049 12.022  -3.999  1.00 30.58 ? 127  SER C N   1 
ATOM   3519 C  CA  . SER C 3 33  ? 30.615 12.848  -5.117  1.00 34.12 ? 127  SER C CA  1 
ATOM   3520 C  C   . SER C 3 33  ? 31.328 12.522  -6.422  1.00 34.87 ? 127  SER C C   1 
ATOM   3521 O  O   . SER C 3 33  ? 32.493 12.898  -6.625  1.00 35.64 ? 127  SER C O   1 
ATOM   3522 C  CB  . SER C 3 33  ? 30.801 14.328  -4.807  1.00 37.28 ? 127  SER C CB  1 
ATOM   3523 O  OG  . SER C 3 33  ? 30.536 15.099  -5.968  1.00 40.47 ? 127  SER C OG  1 
ATOM   3524 N  N   . PRO C 3 34  ? 30.638 11.800  -7.323  1.00 33.03 ? 128  PRO C N   1 
ATOM   3525 C  CA  . PRO C 3 34  ? 31.195 11.420  -8.621  1.00 32.31 ? 128  PRO C CA  1 
ATOM   3526 C  C   . PRO C 3 34  ? 31.639 12.643  -9.402  1.00 31.60 ? 128  PRO C C   1 
ATOM   3527 O  O   . PRO C 3 34  ? 32.699 12.649  -10.031 1.00 32.33 ? 128  PRO C O   1 
ATOM   3528 C  CB  . PRO C 3 34  ? 30.029 10.705  -9.294  1.00 32.55 ? 128  PRO C CB  1 
ATOM   3529 C  CG  . PRO C 3 34  ? 29.394 9.992   -8.139  1.00 30.85 ? 128  PRO C CG  1 
ATOM   3530 C  CD  . PRO C 3 34  ? 29.384 11.066  -7.060  1.00 31.94 ? 128  PRO C CD  1 
ATOM   3531 N  N   . ALA C 3 35  ? 30.823 13.686  -9.351  1.00 29.61 ? 129  ALA C N   1 
ATOM   3532 C  CA  . ALA C 3 35  ? 31.126 14.909  -10.066 1.00 30.59 ? 129  ALA C CA  1 
ATOM   3533 C  C   . ALA C 3 35  ? 32.547 15.395  -9.777  1.00 33.92 ? 129  ALA C C   1 
ATOM   3534 O  O   . ALA C 3 35  ? 33.349 15.599  -10.697 1.00 33.77 ? 129  ALA C O   1 
ATOM   3535 C  CB  . ALA C 3 35  ? 30.118 15.973  -9.687  1.00 31.53 ? 129  ALA C CB  1 
ATOM   3536 N  N   . LEU C 3 36  ? 32.853 15.569  -8.492  1.00 35.31 ? 130  LEU C N   1 
ATOM   3537 C  CA  . LEU C 3 36  ? 34.168 16.042  -8.059  1.00 34.46 ? 130  LEU C CA  1 
ATOM   3538 C  C   . LEU C 3 36  ? 35.160 14.905  -7.810  1.00 34.66 ? 130  LEU C C   1 
ATOM   3539 O  O   . LEU C 3 36  ? 36.350 15.155  -7.592  1.00 34.09 ? 130  LEU C O   1 
ATOM   3540 C  CB  . LEU C 3 36  ? 34.032 16.841  -6.755  1.00 35.41 ? 130  LEU C CB  1 
ATOM   3541 C  CG  . LEU C 3 36  ? 33.449 18.258  -6.658  1.00 31.31 ? 130  LEU C CG  1 
ATOM   3542 C  CD1 . LEU C 3 36  ? 32.062 18.352  -7.248  1.00 31.15 ? 130  LEU C CD1 1 
ATOM   3543 C  CD2 . LEU C 3 36  ? 33.407 18.614  -5.197  1.00 33.00 ? 130  LEU C CD2 1 
ATOM   3544 N  N   . ASN C 3 37  ? 34.673 13.664  -7.856  1.00 34.55 ? 131  ASN C N   1 
ATOM   3545 C  CA  . ASN C 3 37  ? 35.506 12.497  -7.562  1.00 32.00 ? 131  ASN C CA  1 
ATOM   3546 C  C   . ASN C 3 37  ? 36.100 12.742  -6.177  1.00 33.14 ? 131  ASN C C   1 
ATOM   3547 O  O   . ASN C 3 37  ? 37.316 12.648  -5.965  1.00 32.90 ? 131  ASN C O   1 
ATOM   3548 C  CB  . ASN C 3 37  ? 36.625 12.338  -8.581  1.00 30.73 ? 131  ASN C CB  1 
ATOM   3549 C  CG  . ASN C 3 37  ? 37.557 11.180  -8.239  1.00 34.09 ? 131  ASN C CG  1 
ATOM   3550 O  OD1 . ASN C 3 37  ? 37.113 10.108  -7.792  1.00 31.66 ? 131  ASN C OD1 1 
ATOM   3551 N  ND2 . ASN C 3 37  ? 38.854 11.387  -8.451  1.00 35.34 ? 131  ASN C ND2 1 
ATOM   3552 N  N   . LYS C 3 38  ? 35.225 13.075  -5.236  1.00 32.74 ? 132  LYS C N   1 
ATOM   3553 C  CA  . LYS C 3 38  ? 35.655 13.375  -3.887  1.00 33.57 ? 132  LYS C CA  1 
ATOM   3554 C  C   . LYS C 3 38  ? 34.713 12.782  -2.863  1.00 33.23 ? 132  LYS C C   1 
ATOM   3555 O  O   . LYS C 3 38  ? 33.492 12.750  -3.047  1.00 33.06 ? 132  LYS C O   1 
ATOM   3556 C  CB  . LYS C 3 38  ? 35.729 14.891  -3.708  1.00 36.64 ? 132  LYS C CB  1 
ATOM   3557 C  CG  . LYS C 3 38  ? 35.949 15.372  -2.281  1.00 37.85 ? 132  LYS C CG  1 
ATOM   3558 C  CD  . LYS C 3 38  ? 36.093 16.887  -2.288  1.00 38.18 ? 132  LYS C CD  1 
ATOM   3559 C  CE  . LYS C 3 38  ? 36.313 17.462  -0.906  1.00 34.66 ? 132  LYS C CE  1 
ATOM   3560 N  NZ  . LYS C 3 38  ? 36.689 18.901  -1.004  1.00 34.57 ? 132  LYS C NZ  1 
ATOM   3561 N  N   . MET C 3 39  ? 35.299 12.308  -1.779  1.00 33.02 ? 133  MET C N   1 
ATOM   3562 C  CA  . MET C 3 39  ? 34.536 11.716  -0.706  1.00 33.26 ? 133  MET C CA  1 
ATOM   3563 C  C   . MET C 3 39  ? 34.483 12.651  0.487   1.00 31.22 ? 133  MET C C   1 
ATOM   3564 O  O   . MET C 3 39  ? 35.481 13.295  0.842   1.00 27.72 ? 133  MET C O   1 
ATOM   3565 C  CB  . MET C 3 39  ? 35.170 10.402  -0.274  1.00 37.60 ? 133  MET C CB  1 
ATOM   3566 C  CG  . MET C 3 39  ? 34.912 10.089  1.179   1.00 45.01 ? 133  MET C CG  1 
ATOM   3567 S  SD  . MET C 3 39  ? 35.425 8.445   1.601   1.00 52.91 ? 133  MET C SD  1 
ATOM   3568 C  CE  . MET C 3 39  ? 34.044 7.514   0.846   1.00 51.76 ? 133  MET C CE  1 
ATOM   3569 N  N   . PHE C 3 40  ? 33.311 12.715  1.103   1.00 29.64 ? 134  PHE C N   1 
ATOM   3570 C  CA  . PHE C 3 40  ? 33.119 13.551  2.270   1.00 31.23 ? 134  PHE C CA  1 
ATOM   3571 C  C   . PHE C 3 40  ? 32.693 12.595  3.383   1.00 32.50 ? 134  PHE C C   1 
ATOM   3572 O  O   . PHE C 3 40  ? 31.795 11.774  3.175   1.00 34.58 ? 134  PHE C O   1 
ATOM   3573 C  CB  . PHE C 3 40  ? 32.036 14.608  1.988   1.00 29.41 ? 134  PHE C CB  1 
ATOM   3574 C  CG  . PHE C 3 40  ? 32.351 15.523  0.816   1.00 23.92 ? 134  PHE C CG  1 
ATOM   3575 C  CD1 . PHE C 3 40  ? 32.205 15.081  -0.499  1.00 26.39 ? 134  PHE C CD1 1 
ATOM   3576 C  CD2 . PHE C 3 40  ? 32.782 16.830  1.029   1.00 24.40 ? 134  PHE C CD2 1 
ATOM   3577 C  CE1 . PHE C 3 40  ? 32.486 15.930  -1.595  1.00 23.89 ? 134  PHE C CE1 1 
ATOM   3578 C  CE2 . PHE C 3 40  ? 33.067 17.689  -0.060  1.00 27.04 ? 134  PHE C CE2 1 
ATOM   3579 C  CZ  . PHE C 3 40  ? 32.918 17.233  -1.373  1.00 22.34 ? 134  PHE C CZ  1 
ATOM   3580 N  N   . CYS C 3 41  ? 33.348 12.677  4.544   1.00 33.14 ? 135  CYS C N   1 
ATOM   3581 C  CA  . CYS C 3 41  ? 33.026 11.797  5.676   1.00 32.26 ? 135  CYS C CA  1 
ATOM   3582 C  C   . CYS C 3 41  ? 33.343 12.414  7.039   1.00 33.38 ? 135  CYS C C   1 
ATOM   3583 O  O   . CYS C 3 41  ? 34.090 13.391  7.140   1.00 32.63 ? 135  CYS C O   1 
ATOM   3584 C  CB  . CYS C 3 41  ? 33.798 10.492  5.556   1.00 33.34 ? 135  CYS C CB  1 
ATOM   3585 S  SG  . CYS C 3 41  ? 35.595 10.746  5.606   1.00 32.88 ? 135  CYS C SG  1 
ATOM   3586 N  N   . GLN C 3 42  ? 32.773 11.834  8.093   1.00 34.77 ? 136  GLN C N   1 
ATOM   3587 C  CA  . GLN C 3 42  ? 33.001 12.323  9.446   1.00 34.93 ? 136  GLN C CA  1 
ATOM   3588 C  C   . GLN C 3 42  ? 34.200 11.608  10.043  1.00 35.91 ? 136  GLN C C   1 
ATOM   3589 O  O   . GLN C 3 42  ? 34.515 10.480  9.671   1.00 34.55 ? 136  GLN C O   1 
ATOM   3590 C  CB  . GLN C 3 42  ? 31.772 12.079  10.333  1.00 35.47 ? 136  GLN C CB  1 
ATOM   3591 C  CG  . GLN C 3 42  ? 30.472 12.617  9.748   1.00 41.69 ? 136  GLN C CG  1 
ATOM   3592 C  CD  . GLN C 3 42  ? 29.285 12.552  10.716  1.00 43.14 ? 136  GLN C CD  1 
ATOM   3593 O  OE1 . GLN C 3 42  ? 28.962 11.495  11.271  1.00 41.56 ? 136  GLN C OE1 1 
ATOM   3594 N  NE2 . GLN C 3 42  ? 28.622 13.691  10.904  1.00 43.78 ? 136  GLN C NE2 1 
ATOM   3595 N  N   . LEU C 3 43  ? 34.855 12.267  10.988  1.00 38.84 ? 137  LEU C N   1 
ATOM   3596 C  CA  . LEU C 3 43  ? 36.027 11.710  11.643  1.00 39.07 ? 137  LEU C CA  1 
ATOM   3597 C  C   . LEU C 3 43  ? 35.727 10.327  12.223  1.00 39.92 ? 137  LEU C C   1 
ATOM   3598 O  O   . LEU C 3 43  ? 34.720 10.132  12.916  1.00 39.39 ? 137  LEU C O   1 
ATOM   3599 C  CB  . LEU C 3 43  ? 36.486 12.663  12.746  1.00 39.56 ? 137  LEU C CB  1 
ATOM   3600 C  CG  . LEU C 3 43  ? 37.916 12.553  13.266  1.00 40.31 ? 137  LEU C CG  1 
ATOM   3601 C  CD1 . LEU C 3 43  ? 38.123 13.646  14.304  1.00 44.86 ? 137  LEU C CD1 1 
ATOM   3602 C  CD2 . LEU C 3 43  ? 38.172 11.187  13.877  1.00 40.87 ? 137  LEU C CD2 1 
ATOM   3603 N  N   . ALA C 3 44  ? 36.606 9.372   11.918  1.00 38.42 ? 138  ALA C N   1 
ATOM   3604 C  CA  . ALA C 3 44  ? 36.477 8.005   12.399  1.00 38.82 ? 138  ALA C CA  1 
ATOM   3605 C  C   . ALA C 3 44  ? 35.097 7.421   12.146  1.00 40.73 ? 138  ALA C C   1 
ATOM   3606 O  O   . ALA C 3 44  ? 34.323 7.210   13.079  1.00 44.94 ? 138  ALA C O   1 
ATOM   3607 C  CB  . ALA C 3 44  ? 36.797 7.949   13.882  1.00 39.28 ? 138  ALA C CB  1 
ATOM   3608 N  N   . LYS C 3 45  ? 34.787 7.163   10.882  1.00 40.23 ? 139  LYS C N   1 
ATOM   3609 C  CA  . LYS C 3 45  ? 33.501 6.585   10.511  1.00 37.66 ? 139  LYS C CA  1 
ATOM   3610 C  C   . LYS C 3 45  ? 33.712 5.822   9.213   1.00 35.44 ? 139  LYS C C   1 
ATOM   3611 O  O   . LYS C 3 45  ? 34.428 6.285   8.322   1.00 35.71 ? 139  LYS C O   1 
ATOM   3612 C  CB  . LYS C 3 45  ? 32.456 7.683   10.325  1.00 39.02 ? 139  LYS C CB  1 
ATOM   3613 C  CG  . LYS C 3 45  ? 32.161 8.487   11.594  1.00 40.17 ? 139  LYS C CG  1 
ATOM   3614 C  CD  . LYS C 3 45  ? 31.152 7.779   12.485  1.00 41.99 ? 139  LYS C CD  1 
ATOM   3615 C  CE  . LYS C 3 45  ? 30.935 8.523   13.812  1.00 45.12 ? 139  LYS C CE  1 
ATOM   3616 N  NZ  . LYS C 3 45  ? 32.103 8.417   14.773  1.00 44.43 ? 139  LYS C NZ  1 
ATOM   3617 N  N   . THR C 3 46  ? 33.096 4.650   9.120   1.00 31.70 ? 140  THR C N   1 
ATOM   3618 C  CA  . THR C 3 46  ? 33.224 3.793   7.953   1.00 30.70 ? 140  THR C CA  1 
ATOM   3619 C  C   . THR C 3 46  ? 33.198 4.495   6.583   1.00 32.23 ? 140  THR C C   1 
ATOM   3620 O  O   . THR C 3 46  ? 32.232 5.175   6.225   1.00 31.72 ? 140  THR C O   1 
ATOM   3621 C  CB  . THR C 3 46  ? 32.140 2.705   7.943   1.00 28.67 ? 140  THR C CB  1 
ATOM   3622 O  OG1 . THR C 3 46  ? 31.985 2.162   9.261   1.00 27.71 ? 140  THR C OG1 1 
ATOM   3623 C  CG2 . THR C 3 46  ? 32.544 1.577   6.983   1.00 26.65 ? 140  THR C CG2 1 
ATOM   3624 N  N   . CYS C 3 47  ? 34.283 4.327   5.833   1.00 31.02 ? 141  CYS C N   1 
ATOM   3625 C  CA  . CYS C 3 47  ? 34.406 4.893   4.499   1.00 34.25 ? 141  CYS C CA  1 
ATOM   3626 C  C   . CYS C 3 47  ? 34.584 3.717   3.564   1.00 33.54 ? 141  CYS C C   1 
ATOM   3627 O  O   . CYS C 3 47  ? 35.691 3.209   3.391   1.00 34.86 ? 141  CYS C O   1 
ATOM   3628 C  CB  . CYS C 3 47  ? 35.624 5.805   4.389   1.00 36.08 ? 141  CYS C CB  1 
ATOM   3629 S  SG  . CYS C 3 47  ? 35.319 7.490   4.905   1.00 45.66 ? 141  CYS C SG  1 
ATOM   3630 N  N   . PRO C 3 48  ? 33.488 3.244   2.973   1.00 32.02 ? 142  PRO C N   1 
ATOM   3631 C  CA  . PRO C 3 48  ? 33.638 2.107   2.068   1.00 31.73 ? 142  PRO C CA  1 
ATOM   3632 C  C   . PRO C 3 48  ? 34.213 2.540   0.725   1.00 32.09 ? 142  PRO C C   1 
ATOM   3633 O  O   . PRO C 3 48  ? 33.697 3.467   0.091   1.00 32.80 ? 142  PRO C O   1 
ATOM   3634 C  CB  . PRO C 3 48  ? 32.207 1.575   1.932   1.00 32.60 ? 142  PRO C CB  1 
ATOM   3635 C  CG  . PRO C 3 48  ? 31.507 2.072   3.195   1.00 32.48 ? 142  PRO C CG  1 
ATOM   3636 C  CD  . PRO C 3 48  ? 32.076 3.456   3.337   1.00 31.01 ? 142  PRO C CD  1 
ATOM   3637 N  N   . VAL C 3 49  ? 35.290 1.871   0.318   1.00 30.09 ? 143  VAL C N   1 
ATOM   3638 C  CA  . VAL C 3 49  ? 35.954 2.105   -0.961  1.00 28.08 ? 143  VAL C CA  1 
ATOM   3639 C  C   . VAL C 3 49  ? 35.915 0.738   -1.640  1.00 30.23 ? 143  VAL C C   1 
ATOM   3640 O  O   . VAL C 3 49  ? 36.301 -0.268  -1.037  1.00 29.41 ? 143  VAL C O   1 
ATOM   3641 C  CB  . VAL C 3 49  ? 37.418 2.515   -0.766  1.00 26.24 ? 143  VAL C CB  1 
ATOM   3642 C  CG1 . VAL C 3 49  ? 38.094 2.737   -2.113  1.00 21.59 ? 143  VAL C CG1 1 
ATOM   3643 C  CG2 . VAL C 3 49  ? 37.486 3.775   0.072   1.00 30.03 ? 143  VAL C CG2 1 
ATOM   3644 N  N   . GLN C 3 50  ? 35.449 0.692   -2.884  1.00 31.56 ? 144  GLN C N   1 
ATOM   3645 C  CA  . GLN C 3 50  ? 35.347 -0.575  -3.594  1.00 28.85 ? 144  GLN C CA  1 
ATOM   3646 C  C   . GLN C 3 50  ? 36.466 -0.810  -4.601  1.00 28.51 ? 144  GLN C C   1 
ATOM   3647 O  O   . GLN C 3 50  ? 36.860 0.093   -5.339  1.00 27.90 ? 144  GLN C O   1 
ATOM   3648 C  CB  . GLN C 3 50  ? 33.988 -0.656  -4.292  1.00 25.81 ? 144  GLN C CB  1 
ATOM   3649 C  CG  . GLN C 3 50  ? 32.821 -0.321  -3.375  1.00 29.82 ? 144  GLN C CG  1 
ATOM   3650 C  CD  . GLN C 3 50  ? 31.475 -0.367  -4.085  1.00 33.06 ? 144  GLN C CD  1 
ATOM   3651 O  OE1 . GLN C 3 50  ? 31.363 0.035   -5.242  1.00 38.13 ? 144  GLN C OE1 1 
ATOM   3652 N  NE2 . GLN C 3 50  ? 30.444 -0.839  -3.388  1.00 31.47 ? 144  GLN C NE2 1 
ATOM   3653 N  N   . LEU C 3 51  ? 36.984 -2.032  -4.607  1.00 28.52 ? 145  LEU C N   1 
ATOM   3654 C  CA  . LEU C 3 51  ? 38.029 -2.421  -5.541  1.00 29.82 ? 145  LEU C CA  1 
ATOM   3655 C  C   . LEU C 3 51  ? 37.355 -3.241  -6.640  1.00 31.19 ? 145  LEU C C   1 
ATOM   3656 O  O   . LEU C 3 51  ? 36.666 -4.231  -6.358  1.00 32.34 ? 145  LEU C O   1 
ATOM   3657 C  CB  . LEU C 3 51  ? 39.096 -3.277  -4.841  1.00 27.74 ? 145  LEU C CB  1 
ATOM   3658 C  CG  . LEU C 3 51  ? 39.896 -2.597  -3.725  1.00 28.87 ? 145  LEU C CG  1 
ATOM   3659 C  CD1 . LEU C 3 51  ? 40.843 -3.582  -3.064  1.00 30.96 ? 145  LEU C CD1 1 
ATOM   3660 C  CD2 . LEU C 3 51  ? 40.670 -1.448  -4.307  1.00 28.56 ? 145  LEU C CD2 1 
ATOM   3661 N  N   . TRP C 3 52  ? 37.531 -2.816  -7.886  1.00 30.86 ? 146  TRP C N   1 
ATOM   3662 C  CA  . TRP C 3 52  ? 36.964 -3.528  -9.026  1.00 30.10 ? 146  TRP C CA  1 
ATOM   3663 C  C   . TRP C 3 52  ? 38.108 -3.922  -9.959  1.00 30.03 ? 146  TRP C C   1 
ATOM   3664 O  O   . TRP C 3 52  ? 38.975 -3.100  -10.242 1.00 28.83 ? 146  TRP C O   1 
ATOM   3665 C  CB  . TRP C 3 52  ? 36.007 -2.630  -9.810  1.00 32.02 ? 146  TRP C CB  1 
ATOM   3666 C  CG  . TRP C 3 52  ? 34.735 -2.262  -9.101  1.00 33.69 ? 146  TRP C CG  1 
ATOM   3667 C  CD1 . TRP C 3 52  ? 34.601 -1.446  -8.009  1.00 32.61 ? 146  TRP C CD1 1 
ATOM   3668 C  CD2 . TRP C 3 52  ? 33.412 -2.698  -9.441  1.00 31.86 ? 146  TRP C CD2 1 
ATOM   3669 N  NE1 . TRP C 3 52  ? 33.274 -1.347  -7.649  1.00 32.55 ? 146  TRP C NE1 1 
ATOM   3670 C  CE2 . TRP C 3 52  ? 32.522 -2.106  -8.508  1.00 32.74 ? 146  TRP C CE2 1 
ATOM   3671 C  CE3 . TRP C 3 52  ? 32.892 -3.531  -10.438 1.00 28.02 ? 146  TRP C CE3 1 
ATOM   3672 C  CZ2 . TRP C 3 52  ? 31.138 -2.323  -8.545  1.00 30.84 ? 146  TRP C CZ2 1 
ATOM   3673 C  CZ3 . TRP C 3 52  ? 31.511 -3.749  -10.476 1.00 31.58 ? 146  TRP C CZ3 1 
ATOM   3674 C  CH2 . TRP C 3 52  ? 30.651 -3.144  -9.532  1.00 31.18 ? 146  TRP C CH2 1 
ATOM   3675 N  N   . VAL C 3 53  ? 38.111 -5.165  -10.434 1.00 30.36 ? 147  VAL C N   1 
ATOM   3676 C  CA  . VAL C 3 53  ? 39.150 -5.626  -11.361 1.00 31.27 ? 147  VAL C CA  1 
ATOM   3677 C  C   . VAL C 3 53  ? 38.549 -6.500  -12.462 1.00 32.17 ? 147  VAL C C   1 
ATOM   3678 O  O   . VAL C 3 53  ? 37.577 -7.212  -12.224 1.00 31.35 ? 147  VAL C O   1 
ATOM   3679 C  CB  . VAL C 3 53  ? 40.242 -6.454  -10.648 1.00 29.34 ? 147  VAL C CB  1 
ATOM   3680 C  CG1 . VAL C 3 53  ? 41.065 -5.562  -9.720  1.00 25.73 ? 147  VAL C CG1 1 
ATOM   3681 C  CG2 . VAL C 3 53  ? 39.593 -7.601  -9.889  1.00 26.56 ? 147  VAL C CG2 1 
ATOM   3682 N  N   . ASP C 3 54  ? 39.129 -6.439  -13.663 1.00 32.52 ? 148  ASP C N   1 
ATOM   3683 C  CA  . ASP C 3 54  ? 38.653 -7.247  -14.789 1.00 34.91 ? 148  ASP C CA  1 
ATOM   3684 C  C   . ASP C 3 54  ? 39.225 -8.658  -14.670 1.00 35.14 ? 148  ASP C C   1 
ATOM   3685 O  O   . ASP C 3 54  ? 38.611 -9.628  -15.120 1.00 35.39 ? 148  ASP C O   1 
ATOM   3686 C  CB  . ASP C 3 54  ? 39.062 -6.610  -16.130 1.00 36.31 ? 148  ASP C CB  1 
ATOM   3687 C  CG  . ASP C 3 54  ? 38.295 -5.315  -16.423 1.00 42.17 ? 148  ASP C CG  1 
ATOM   3688 O  OD1 . ASP C 3 54  ? 38.868 -4.397  -17.064 1.00 39.42 ? 148  ASP C OD1 1 
ATOM   3689 O  OD2 . ASP C 3 54  ? 37.110 -5.218  -16.018 1.00 45.11 ? 148  ASP C OD2 1 
ATOM   3690 N  N   . SER C 3 55  ? 40.401 -8.763  -14.056 1.00 34.89 ? 149  SER C N   1 
ATOM   3691 C  CA  . SER C 3 55  ? 41.051 -10.053 -13.852 1.00 35.24 ? 149  SER C CA  1 
ATOM   3692 C  C   . SER C 3 55  ? 41.544 -10.138 -12.409 1.00 34.31 ? 149  SER C C   1 
ATOM   3693 O  O   . SER C 3 55  ? 42.161 -9.209  -11.895 1.00 33.14 ? 149  SER C O   1 
ATOM   3694 C  CB  . SER C 3 55  ? 42.230 -10.213 -14.812 1.00 36.43 ? 149  SER C CB  1 
ATOM   3695 O  OG  . SER C 3 55  ? 41.799 -10.106 -16.160 1.00 41.49 ? 149  SER C OG  1 
ATOM   3696 N  N   . THR C 3 56  ? 41.266 -11.256 -11.756 1.00 33.73 ? 150  THR C N   1 
ATOM   3697 C  CA  . THR C 3 56  ? 41.686 -11.436 -10.380 1.00 33.79 ? 150  THR C CA  1 
ATOM   3698 C  C   . THR C 3 56  ? 43.195 -11.441 -10.230 1.00 33.11 ? 150  THR C C   1 
ATOM   3699 O  O   . THR C 3 56  ? 43.878 -12.238 -10.855 1.00 33.35 ? 150  THR C O   1 
ATOM   3700 C  CB  . THR C 3 56  ? 41.170 -12.760 -9.806  1.00 34.85 ? 150  THR C CB  1 
ATOM   3701 O  OG1 . THR C 3 56  ? 39.736 -12.790 -9.882  1.00 35.58 ? 150  THR C OG1 1 
ATOM   3702 C  CG2 . THR C 3 56  ? 41.618 -12.911 -8.340  1.00 33.94 ? 150  THR C CG2 1 
ATOM   3703 N  N   . PRO C 3 57  ? 43.736 -10.527 -9.412  1.00 33.11 ? 151  PRO C N   1 
ATOM   3704 C  CA  . PRO C 3 57  ? 45.183 -10.484 -9.207  1.00 33.78 ? 151  PRO C CA  1 
ATOM   3705 C  C   . PRO C 3 57  ? 45.559 -11.720 -8.403  1.00 36.20 ? 151  PRO C C   1 
ATOM   3706 O  O   . PRO C 3 57  ? 44.742 -12.229 -7.636  1.00 34.46 ? 151  PRO C O   1 
ATOM   3707 C  CB  . PRO C 3 57  ? 45.392 -9.184  -8.437  1.00 34.21 ? 151  PRO C CB  1 
ATOM   3708 C  CG  . PRO C 3 57  ? 44.079 -8.958  -7.761  1.00 32.74 ? 151  PRO C CG  1 
ATOM   3709 C  CD  . PRO C 3 57  ? 43.084 -9.351  -8.813  1.00 31.34 ? 151  PRO C CD  1 
ATOM   3710 N  N   . PRO C 3 58  ? 46.795 -12.220 -8.572  1.00 38.79 ? 152  PRO C N   1 
ATOM   3711 C  CA  . PRO C 3 58  ? 47.264 -13.411 -7.858  1.00 39.40 ? 152  PRO C CA  1 
ATOM   3712 C  C   . PRO C 3 58  ? 47.296 -13.242 -6.357  1.00 39.89 ? 152  PRO C C   1 
ATOM   3713 O  O   . PRO C 3 58  ? 47.648 -12.176 -5.857  1.00 41.32 ? 152  PRO C O   1 
ATOM   3714 C  CB  . PRO C 3 58  ? 48.660 -13.621 -8.427  1.00 40.50 ? 152  PRO C CB  1 
ATOM   3715 C  CG  . PRO C 3 58  ? 49.117 -12.227 -8.672  1.00 41.50 ? 152  PRO C CG  1 
ATOM   3716 C  CD  . PRO C 3 58  ? 47.901 -11.604 -9.327  1.00 39.21 ? 152  PRO C CD  1 
ATOM   3717 N  N   . PRO C 3 59  ? 46.910 -14.286 -5.610  1.00 41.05 ? 153  PRO C N   1 
ATOM   3718 C  CA  . PRO C 3 59  ? 46.948 -14.142 -4.148  1.00 39.96 ? 153  PRO C CA  1 
ATOM   3719 C  C   . PRO C 3 59  ? 48.358 -13.728 -3.719  1.00 39.53 ? 153  PRO C C   1 
ATOM   3720 O  O   . PRO C 3 59  ? 49.352 -14.151 -4.307  1.00 41.46 ? 153  PRO C O   1 
ATOM   3721 C  CB  . PRO C 3 59  ? 46.499 -15.517 -3.633  1.00 37.17 ? 153  PRO C CB  1 
ATOM   3722 C  CG  . PRO C 3 59  ? 46.642 -16.433 -4.831  1.00 40.30 ? 153  PRO C CG  1 
ATOM   3723 C  CD  . PRO C 3 59  ? 46.300 -15.563 -6.007  1.00 39.81 ? 153  PRO C CD  1 
ATOM   3724 N  N   . GLY C 3 60  ? 48.433 -12.867 -2.714  1.00 40.48 ? 154  GLY C N   1 
ATOM   3725 C  CA  . GLY C 3 60  ? 49.717 -12.357 -2.267  1.00 38.77 ? 154  GLY C CA  1 
ATOM   3726 C  C   . GLY C 3 60  ? 49.751 -10.883 -2.646  1.00 38.60 ? 154  GLY C C   1 
ATOM   3727 O  O   . GLY C 3 60  ? 50.657 -10.133 -2.258  1.00 38.68 ? 154  GLY C O   1 
ATOM   3728 N  N   . THR C 3 61  ? 48.750 -10.468 -3.422  1.00 36.53 ? 155  THR C N   1 
ATOM   3729 C  CA  . THR C 3 61  ? 48.634 -9.074  -3.842  1.00 36.51 ? 155  THR C CA  1 
ATOM   3730 C  C   . THR C 3 61  ? 48.116 -8.259  -2.656  1.00 32.83 ? 155  THR C C   1 
ATOM   3731 O  O   . THR C 3 61  ? 47.290 -8.737  -1.871  1.00 27.66 ? 155  THR C O   1 
ATOM   3732 C  CB  . THR C 3 61  ? 47.634 -8.909  -5.031  1.00 38.94 ? 155  THR C CB  1 
ATOM   3733 O  OG1 . THR C 3 61  ? 48.045 -9.725  -6.140  1.00 41.63 ? 155  THR C OG1 1 
ATOM   3734 C  CG2 . THR C 3 61  ? 47.581 -7.455  -5.485  1.00 38.28 ? 155  THR C CG2 1 
ATOM   3735 N  N   . ARG C 3 62  ? 48.598 -7.031  -2.518  1.00 33.44 ? 156  ARG C N   1 
ATOM   3736 C  CA  . ARG C 3 62  ? 48.136 -6.206  -1.415  1.00 35.09 ? 156  ARG C CA  1 
ATOM   3737 C  C   . ARG C 3 62  ? 47.562 -4.866  -1.879  1.00 33.87 ? 156  ARG C C   1 
ATOM   3738 O  O   . ARG C 3 62  ? 47.818 -4.418  -3.002  1.00 34.39 ? 156  ARG C O   1 
ATOM   3739 C  CB  . ARG C 3 62  ? 49.268 -6.022  -0.395  1.00 35.44 ? 156  ARG C CB  1 
ATOM   3740 C  CG  . ARG C 3 62  ? 49.774 -7.362  0.159   1.00 35.82 ? 156  ARG C CG  1 
ATOM   3741 C  CD  . ARG C 3 62  ? 50.202 -7.288  1.615   1.00 32.48 ? 156  ARG C CD  1 
ATOM   3742 N  NE  . ARG C 3 62  ? 51.377 -6.442  1.808   1.00 34.99 ? 156  ARG C NE  1 
ATOM   3743 C  CZ  . ARG C 3 62  ? 51.920 -6.195  3.000   1.00 38.53 ? 156  ARG C CZ  1 
ATOM   3744 N  NH1 . ARG C 3 62  ? 51.390 -6.741  4.093   1.00 37.80 ? 156  ARG C NH1 1 
ATOM   3745 N  NH2 . ARG C 3 62  ? 52.976 -5.387  3.108   1.00 35.12 ? 156  ARG C NH2 1 
ATOM   3746 N  N   . VAL C 3 63  ? 46.760 -4.259  -1.010  1.00 31.34 ? 157  VAL C N   1 
ATOM   3747 C  CA  . VAL C 3 63  ? 46.112 -2.986  -1.284  1.00 26.80 ? 157  VAL C CA  1 
ATOM   3748 C  C   . VAL C 3 63  ? 46.644 -1.939  -0.319  1.00 27.77 ? 157  VAL C C   1 
ATOM   3749 O  O   . VAL C 3 63  ? 46.399 -2.015  0.895   1.00 29.47 ? 157  VAL C O   1 
ATOM   3750 C  CB  . VAL C 3 63  ? 44.593 -3.093  -1.071  1.00 24.70 ? 157  VAL C CB  1 
ATOM   3751 C  CG1 . VAL C 3 63  ? 43.945 -1.750  -1.324  1.00 24.35 ? 157  VAL C CG1 1 
ATOM   3752 C  CG2 . VAL C 3 63  ? 44.008 -4.169  -1.971  1.00 20.66 ? 157  VAL C CG2 1 
ATOM   3753 N  N   . ARG C 3 64  ? 47.368 -0.963  -0.852  1.00 26.91 ? 158  ARG C N   1 
ATOM   3754 C  CA  . ARG C 3 64  ? 47.929 0.106   -0.029  1.00 29.96 ? 158  ARG C CA  1 
ATOM   3755 C  C   . ARG C 3 64  ? 47.091 1.385   -0.115  1.00 28.99 ? 158  ARG C C   1 
ATOM   3756 O  O   . ARG C 3 64  ? 46.496 1.677   -1.156  1.00 30.45 ? 158  ARG C O   1 
ATOM   3757 C  CB  . ARG C 3 64  ? 49.365 0.408   -0.476  1.00 30.32 ? 158  ARG C CB  1 
ATOM   3758 C  CG  . ARG C 3 64  ? 50.081 1.479   0.339   1.00 29.81 ? 158  ARG C CG  1 
ATOM   3759 C  CD  . ARG C 3 64  ? 51.559 1.488   -0.024  1.00 31.52 ? 158  ARG C CD  1 
ATOM   3760 N  NE  . ARG C 3 64  ? 52.142 0.160   0.174   1.00 33.95 ? 158  ARG C NE  1 
ATOM   3761 C  CZ  . ARG C 3 64  ? 52.666 -0.266  1.323   1.00 34.33 ? 158  ARG C CZ  1 
ATOM   3762 N  NH1 . ARG C 3 64  ? 52.693 0.533   2.386   1.00 34.46 ? 158  ARG C NH1 1 
ATOM   3763 N  NH2 . ARG C 3 64  ? 53.152 -1.497  1.413   1.00 32.36 ? 158  ARG C NH2 1 
ATOM   3764 N  N   . ALA C 3 65  ? 47.032 2.134   0.983   1.00 26.55 ? 159  ALA C N   1 
ATOM   3765 C  CA  . ALA C 3 65  ? 46.297 3.399   1.008   1.00 27.81 ? 159  ALA C CA  1 
ATOM   3766 C  C   . ALA C 3 65  ? 47.232 4.454   1.592   1.00 28.85 ? 159  ALA C C   1 
ATOM   3767 O  O   . ALA C 3 65  ? 47.822 4.253   2.657   1.00 28.95 ? 159  ALA C O   1 
ATOM   3768 C  CB  . ALA C 3 65  ? 45.042 3.286   1.869   1.00 26.77 ? 159  ALA C CB  1 
ATOM   3769 N  N   . MET C 3 66  ? 47.368 5.573   0.893   1.00 27.87 ? 160  MET C N   1 
ATOM   3770 C  CA  . MET C 3 66  ? 48.241 6.648   1.338   1.00 28.81 ? 160  MET C CA  1 
ATOM   3771 C  C   . MET C 3 66  ? 47.651 8.009   0.960   1.00 29.80 ? 160  MET C C   1 
ATOM   3772 O  O   . MET C 3 66  ? 47.074 8.180   -0.127  1.00 30.66 ? 160  MET C O   1 
ATOM   3773 C  CB  . MET C 3 66  ? 49.622 6.472   0.698   1.00 28.16 ? 160  MET C CB  1 
ATOM   3774 C  CG  . MET C 3 66  ? 50.606 7.580   1.001   1.00 31.07 ? 160  MET C CG  1 
ATOM   3775 S  SD  . MET C 3 66  ? 52.150 7.415   0.038   1.00 33.51 ? 160  MET C SD  1 
ATOM   3776 C  CE  . MET C 3 66  ? 52.853 5.901   0.757   1.00 27.70 ? 160  MET C CE  1 
ATOM   3777 N  N   . ALA C 3 67  ? 47.794 8.978   1.857   1.00 28.44 ? 161  ALA C N   1 
ATOM   3778 C  CA  . ALA C 3 67  ? 47.273 10.303  1.594   1.00 28.01 ? 161  ALA C CA  1 
ATOM   3779 C  C   . ALA C 3 67  ? 48.408 11.261  1.273   1.00 28.22 ? 161  ALA C C   1 
ATOM   3780 O  O   . ALA C 3 67  ? 49.524 11.096  1.758   1.00 30.27 ? 161  ALA C O   1 
ATOM   3781 C  CB  . ALA C 3 67  ? 46.487 10.807  2.800   1.00 22.16 ? 161  ALA C CB  1 
ATOM   3782 N  N   . ILE C 3 68  ? 48.126 12.228  0.408   1.00 28.98 ? 162  ILE C N   1 
ATOM   3783 C  CA  . ILE C 3 68  ? 49.085 13.272  0.072   1.00 30.56 ? 162  ILE C CA  1 
ATOM   3784 C  C   . ILE C 3 68  ? 48.249 14.520  -0.077  1.00 30.53 ? 162  ILE C C   1 
ATOM   3785 O  O   . ILE C 3 68  ? 47.037 14.438  -0.288  1.00 30.40 ? 162  ILE C O   1 
ATOM   3786 C  CB  . ILE C 3 68  ? 49.856 13.046  -1.256  1.00 31.16 ? 162  ILE C CB  1 
ATOM   3787 C  CG1 . ILE C 3 68  ? 48.891 12.936  -2.427  1.00 32.51 ? 162  ILE C CG1 1 
ATOM   3788 C  CG2 . ILE C 3 68  ? 50.755 11.837  -1.139  1.00 31.92 ? 162  ILE C CG2 1 
ATOM   3789 C  CD1 . ILE C 3 68  ? 49.610 12.866  -3.768  1.00 32.94 ? 162  ILE C CD1 1 
ATOM   3790 N  N   . TYR C 3 69  ? 48.882 15.675  0.061   1.00 32.91 ? 163  TYR C N   1 
ATOM   3791 C  CA  . TYR C 3 69  ? 48.156 16.926  -0.074  1.00 33.52 ? 163  TYR C CA  1 
ATOM   3792 C  C   . TYR C 3 69  ? 47.890 17.195  -1.549  1.00 33.28 ? 163  TYR C C   1 
ATOM   3793 O  O   . TYR C 3 69  ? 48.746 16.936  -2.404  1.00 32.17 ? 163  TYR C O   1 
ATOM   3794 C  CB  . TYR C 3 69  ? 48.944 18.058  0.590   1.00 32.23 ? 163  TYR C CB  1 
ATOM   3795 C  CG  . TYR C 3 69  ? 48.790 18.037  2.097   1.00 31.59 ? 163  TYR C CG  1 
ATOM   3796 C  CD1 . TYR C 3 69  ? 49.894 17.845  2.936   1.00 30.84 ? 163  TYR C CD1 1 
ATOM   3797 C  CD2 . TYR C 3 69  ? 47.528 18.177  2.685   1.00 31.06 ? 163  TYR C CD2 1 
ATOM   3798 C  CE1 . TYR C 3 69  ? 49.746 17.791  4.330   1.00 29.78 ? 163  TYR C CE1 1 
ATOM   3799 C  CE2 . TYR C 3 69  ? 47.371 18.125  4.078   1.00 31.85 ? 163  TYR C CE2 1 
ATOM   3800 C  CZ  . TYR C 3 69  ? 48.486 17.931  4.890   1.00 29.36 ? 163  TYR C CZ  1 
ATOM   3801 O  OH  . TYR C 3 69  ? 48.335 17.870  6.255   1.00 28.14 ? 163  TYR C OH  1 
ATOM   3802 N  N   . LYS C 3 70  ? 46.695 17.697  -1.845  1.00 31.11 ? 164  LYS C N   1 
ATOM   3803 C  CA  . LYS C 3 70  ? 46.325 17.940  -3.225  1.00 34.31 ? 164  LYS C CA  1 
ATOM   3804 C  C   . LYS C 3 70  ? 47.058 19.105  -3.868  1.00 36.99 ? 164  LYS C C   1 
ATOM   3805 O  O   . LYS C 3 70  ? 47.381 19.048  -5.055  1.00 37.44 ? 164  LYS C O   1 
ATOM   3806 C  CB  . LYS C 3 70  ? 44.813 18.148  -3.332  1.00 32.93 ? 164  LYS C CB  1 
ATOM   3807 C  CG  . LYS C 3 70  ? 44.329 18.360  -4.748  1.00 32.20 ? 164  LYS C CG  1 
ATOM   3808 C  CD  . LYS C 3 70  ? 42.825 18.577  -4.805  1.00 33.86 ? 164  LYS C CD  1 
ATOM   3809 C  CE  . LYS C 3 70  ? 42.412 19.064  -6.185  1.00 34.13 ? 164  LYS C CE  1 
ATOM   3810 N  NZ  . LYS C 3 70  ? 40.954 18.903  -6.415  1.00 35.91 ? 164  LYS C NZ  1 
ATOM   3811 N  N   . GLN C 3 71  ? 47.331 20.149  -3.088  1.00 40.12 ? 165  GLN C N   1 
ATOM   3812 C  CA  . GLN C 3 71  ? 48.011 21.344  -3.596  1.00 41.36 ? 165  GLN C CA  1 
ATOM   3813 C  C   . GLN C 3 71  ? 49.526 21.222  -3.723  1.00 44.53 ? 165  GLN C C   1 
ATOM   3814 O  O   . GLN C 3 71  ? 50.207 20.660  -2.855  1.00 43.70 ? 165  GLN C O   1 
ATOM   3815 C  CB  . GLN C 3 71  ? 47.679 22.536  -2.712  1.00 41.34 ? 165  GLN C CB  1 
ATOM   3816 C  CG  . GLN C 3 71  ? 46.212 22.872  -2.717  1.00 45.31 ? 165  GLN C CG  1 
ATOM   3817 C  CD  . GLN C 3 71  ? 45.833 23.759  -1.561  1.00 48.16 ? 165  GLN C CD  1 
ATOM   3818 O  OE1 . GLN C 3 71  ? 45.943 23.360  -0.390  1.00 47.57 ? 165  GLN C OE1 1 
ATOM   3819 N  NE2 . GLN C 3 71  ? 45.389 24.977  -1.874  1.00 46.33 ? 165  GLN C NE2 1 
ATOM   3820 N  N   . SER C 3 72  ? 50.044 21.784  -4.813  1.00 47.29 ? 166  SER C N   1 
ATOM   3821 C  CA  . SER C 3 72  ? 51.468 21.754  -5.129  1.00 48.04 ? 166  SER C CA  1 
ATOM   3822 C  C   . SER C 3 72  ? 52.374 22.239  -4.009  1.00 48.13 ? 166  SER C C   1 
ATOM   3823 O  O   . SER C 3 72  ? 53.321 21.549  -3.631  1.00 47.82 ? 166  SER C O   1 
ATOM   3824 C  CB  . SER C 3 72  ? 51.727 22.591  -6.376  1.00 50.31 ? 166  SER C CB  1 
ATOM   3825 O  OG  . SER C 3 72  ? 50.713 22.366  -7.338  1.00 52.68 ? 166  SER C OG  1 
ATOM   3826 N  N   . GLN C 3 73  ? 52.091 23.431  -3.487  1.00 50.41 ? 167  GLN C N   1 
ATOM   3827 C  CA  . GLN C 3 73  ? 52.908 24.006  -2.419  1.00 52.25 ? 167  GLN C CA  1 
ATOM   3828 C  C   . GLN C 3 73  ? 52.973 23.090  -1.198  1.00 51.93 ? 167  GLN C C   1 
ATOM   3829 O  O   . GLN C 3 73  ? 53.895 23.184  -0.376  1.00 53.17 ? 167  GLN C O   1 
ATOM   3830 C  CB  . GLN C 3 73  ? 52.374 25.392  -2.010  1.00 55.11 ? 167  GLN C CB  1 
ATOM   3831 C  CG  . GLN C 3 73  ? 50.929 25.426  -1.488  1.00 60.03 ? 167  GLN C CG  1 
ATOM   3832 C  CD  . GLN C 3 73  ? 49.880 25.608  -2.597  1.00 62.02 ? 167  GLN C CD  1 
ATOM   3833 O  OE1 . GLN C 3 73  ? 49.903 24.909  -3.622  1.00 62.24 ? 167  GLN C OE1 1 
ATOM   3834 N  NE2 . GLN C 3 73  ? 48.946 26.545  -2.386  1.00 58.56 ? 167  GLN C NE2 1 
ATOM   3835 N  N   . HIS C 3 74  ? 52.012 22.179  -1.097  1.00 50.45 ? 168  HIS C N   1 
ATOM   3836 C  CA  . HIS C 3 74  ? 51.967 21.273  0.038   1.00 49.26 ? 168  HIS C CA  1 
ATOM   3837 C  C   . HIS C 3 74  ? 52.339 19.815  -0.237  1.00 48.61 ? 168  HIS C C   1 
ATOM   3838 O  O   . HIS C 3 74  ? 52.664 19.084  0.691   1.00 49.95 ? 168  HIS C O   1 
ATOM   3839 C  CB  . HIS C 3 74  ? 50.575 21.355  0.673   1.00 48.80 ? 168  HIS C CB  1 
ATOM   3840 C  CG  . HIS C 3 74  ? 50.252 22.705  1.238   1.00 48.25 ? 168  HIS C CG  1 
ATOM   3841 N  ND1 . HIS C 3 74  ? 49.052 23.345  1.003   1.00 49.40 ? 168  HIS C ND1 1 
ATOM   3842 C  CD2 . HIS C 3 74  ? 50.969 23.533  2.035   1.00 45.19 ? 168  HIS C CD2 1 
ATOM   3843 C  CE1 . HIS C 3 74  ? 49.044 24.509  1.630   1.00 45.01 ? 168  HIS C CE1 1 
ATOM   3844 N  NE2 . HIS C 3 74  ? 50.196 24.646  2.263   1.00 46.66 ? 168  HIS C NE2 1 
ATOM   3845 N  N   . MET C 3 75  ? 52.320 19.397  -1.499  1.00 49.39 ? 169  MET C N   1 
ATOM   3846 C  CA  . MET C 3 75  ? 52.622 18.006  -1.848  1.00 50.56 ? 169  MET C CA  1 
ATOM   3847 C  C   . MET C 3 75  ? 53.809 17.328  -1.171  1.00 48.23 ? 169  MET C C   1 
ATOM   3848 O  O   . MET C 3 75  ? 53.702 16.172  -0.752  1.00 50.65 ? 169  MET C O   1 
ATOM   3849 C  CB  . MET C 3 75  ? 52.779 17.858  -3.366  1.00 53.74 ? 169  MET C CB  1 
ATOM   3850 C  CG  . MET C 3 75  ? 51.467 17.910  -4.142  1.00 59.40 ? 169  MET C CG  1 
ATOM   3851 S  SD  . MET C 3 75  ? 51.699 17.691  -5.930  1.00 64.88 ? 169  MET C SD  1 
ATOM   3852 C  CE  . MET C 3 75  ? 51.611 15.871  -6.079  1.00 64.51 ? 169  MET C CE  1 
ATOM   3853 N  N   . THR C 3 76  ? 54.937 18.020  -1.062  1.00 45.84 ? 170  THR C N   1 
ATOM   3854 C  CA  . THR C 3 76  ? 56.126 17.412  -0.456  1.00 44.46 ? 170  THR C CA  1 
ATOM   3855 C  C   . THR C 3 76  ? 55.953 17.212  1.040   1.00 44.26 ? 170  THR C C   1 
ATOM   3856 O  O   . THR C 3 76  ? 56.787 16.567  1.686   1.00 43.00 ? 170  THR C O   1 
ATOM   3857 C  CB  . THR C 3 76  ? 57.390 18.275  -0.651  1.00 44.16 ? 170  THR C CB  1 
ATOM   3858 O  OG1 . THR C 3 76  ? 57.367 19.352  0.289   1.00 42.43 ? 170  THR C OG1 1 
ATOM   3859 C  CG2 . THR C 3 76  ? 57.445 18.857  -2.062  1.00 45.36 ? 170  THR C CG2 1 
ATOM   3860 N  N   . GLU C 3 77  ? 54.882 17.775  1.594   1.00 43.28 ? 171  GLU C N   1 
ATOM   3861 C  CA  . GLU C 3 77  ? 54.609 17.650  3.025   1.00 42.83 ? 171  GLU C CA  1 
ATOM   3862 C  C   . GLU C 3 77  ? 53.894 16.342  3.353   1.00 40.14 ? 171  GLU C C   1 
ATOM   3863 O  O   . GLU C 3 77  ? 52.971 15.929  2.647   1.00 38.89 ? 171  GLU C O   1 
ATOM   3864 C  CB  . GLU C 3 77  ? 53.764 18.830  3.515   1.00 47.82 ? 171  GLU C CB  1 
ATOM   3865 C  CG  . GLU C 3 77  ? 54.412 19.649  4.642   1.00 56.05 ? 171  GLU C CG  1 
ATOM   3866 C  CD  . GLU C 3 77  ? 54.619 18.852  5.932   1.00 58.85 ? 171  GLU C CD  1 
ATOM   3867 O  OE1 . GLU C 3 77  ? 53.626 18.312  6.476   1.00 58.26 ? 171  GLU C OE1 1 
ATOM   3868 O  OE2 . GLU C 3 77  ? 55.777 18.774  6.405   1.00 61.79 ? 171  GLU C OE2 1 
ATOM   3869 N  N   . VAL C 3 78  ? 54.335 15.704  4.434   1.00 37.63 ? 172  VAL C N   1 
ATOM   3870 C  CA  . VAL C 3 78  ? 53.783 14.438  4.903   1.00 36.18 ? 172  VAL C CA  1 
ATOM   3871 C  C   . VAL C 3 78  ? 52.435 14.619  5.581   1.00 36.75 ? 172  VAL C C   1 
ATOM   3872 O  O   . VAL C 3 78  ? 52.332 15.368  6.552   1.00 38.02 ? 172  VAL C O   1 
ATOM   3873 C  CB  . VAL C 3 78  ? 54.700 13.805  5.943   1.00 37.63 ? 172  VAL C CB  1 
ATOM   3874 C  CG1 . VAL C 3 78  ? 54.052 12.552  6.515   1.00 35.92 ? 172  VAL C CG1 1 
ATOM   3875 C  CG2 . VAL C 3 78  ? 56.052 13.508  5.322   1.00 38.50 ? 172  VAL C CG2 1 
ATOM   3876 N  N   . VAL C 3 79  ? 51.407 13.919  5.102   1.00 35.46 ? 173  VAL C N   1 
ATOM   3877 C  CA  . VAL C 3 79  ? 50.085 14.035  5.719   1.00 31.41 ? 173  VAL C CA  1 
ATOM   3878 C  C   . VAL C 3 79  ? 50.029 13.204  6.999   1.00 30.07 ? 173  VAL C C   1 
ATOM   3879 O  O   . VAL C 3 79  ? 50.302 12.004  6.976   1.00 26.96 ? 173  VAL C O   1 
ATOM   3880 C  CB  . VAL C 3 79  ? 48.958 13.554  4.781   1.00 28.72 ? 173  VAL C CB  1 
ATOM   3881 C  CG1 . VAL C 3 79  ? 47.617 13.865  5.407   1.00 27.36 ? 173  VAL C CG1 1 
ATOM   3882 C  CG2 . VAL C 3 79  ? 49.072 14.227  3.417   1.00 26.52 ? 173  VAL C CG2 1 
ATOM   3883 N  N   . ARG C 3 80  ? 49.666 13.842  8.111   1.00 31.01 ? 174  ARG C N   1 
ATOM   3884 C  CA  . ARG C 3 80  ? 49.592 13.145  9.394   1.00 33.11 ? 174  ARG C CA  1 
ATOM   3885 C  C   . ARG C 3 80  ? 48.582 13.768  10.351  1.00 33.15 ? 174  ARG C C   1 
ATOM   3886 O  O   . ARG C 3 80  ? 48.083 14.860  10.099  1.00 37.00 ? 174  ARG C O   1 
ATOM   3887 C  CB  . ARG C 3 80  ? 50.969 13.126  10.047  1.00 36.28 ? 174  ARG C CB  1 
ATOM   3888 C  CG  . ARG C 3 80  ? 51.548 14.506  10.340  1.00 43.31 ? 174  ARG C CG  1 
ATOM   3889 C  CD  . ARG C 3 80  ? 53.071 14.416  10.423  1.00 47.94 ? 174  ARG C CD  1 
ATOM   3890 N  NE  . ARG C 3 80  ? 53.485 13.287  11.256  1.00 52.88 ? 174  ARG C NE  1 
ATOM   3891 C  CZ  . ARG C 3 80  ? 54.663 12.681  11.167  1.00 56.01 ? 174  ARG C CZ  1 
ATOM   3892 N  NH1 . ARG C 3 80  ? 55.561 13.093  10.274  1.00 57.42 ? 174  ARG C NH1 1 
ATOM   3893 N  NH2 . ARG C 3 80  ? 54.937 11.655  11.967  1.00 58.30 ? 174  ARG C NH2 1 
ATOM   3894 N  N   . ARG C 3 81  ? 48.273 13.075  11.445  1.00 30.81 ? 175  ARG C N   1 
ATOM   3895 C  CA  . ARG C 3 81  ? 47.309 13.596  12.418  1.00 30.01 ? 175  ARG C CA  1 
ATOM   3896 C  C   . ARG C 3 81  ? 47.899 14.773  13.170  1.00 28.22 ? 175  ARG C C   1 
ATOM   3897 O  O   . ARG C 3 81  ? 49.119 14.870  13.317  1.00 31.02 ? 175  ARG C O   1 
ATOM   3898 C  CB  . ARG C 3 81  ? 46.929 12.540  13.454  1.00 29.04 ? 175  ARG C CB  1 
ATOM   3899 C  CG  . ARG C 3 81  ? 46.474 11.226  12.885  1.00 32.46 ? 175  ARG C CG  1 
ATOM   3900 C  CD  . ARG C 3 81  ? 46.075 10.288  14.000  1.00 30.66 ? 175  ARG C CD  1 
ATOM   3901 N  NE  . ARG C 3 81  ? 44.801 10.671  14.598  1.00 28.98 ? 175  ARG C NE  1 
ATOM   3902 C  CZ  . ARG C 3 81  ? 44.247 10.024  15.615  1.00 27.11 ? 175  ARG C CZ  1 
ATOM   3903 N  NH1 . ARG C 3 81  ? 44.870 8.976   16.142  1.00 26.78 ? 175  ARG C NH1 1 
ATOM   3904 N  NH2 . ARG C 3 81  ? 43.061 10.400  16.084  1.00 26.25 ? 175  ARG C NH2 1 
ATOM   3905 N  N   . CYS C 3 82  ? 47.034 15.655  13.664  1.00 25.92 ? 176  CYS C N   1 
ATOM   3906 C  CA  . CYS C 3 82  ? 47.509 16.803  14.429  1.00 25.49 ? 176  CYS C CA  1 
ATOM   3907 C  C   . CYS C 3 82  ? 47.978 16.311  15.794  1.00 25.87 ? 176  CYS C C   1 
ATOM   3908 O  O   . CYS C 3 82  ? 47.575 15.238  16.263  1.00 25.15 ? 176  CYS C O   1 
ATOM   3909 C  CB  . CYS C 3 82  ? 46.396 17.830  14.610  1.00 24.67 ? 176  CYS C CB  1 
ATOM   3910 S  SG  . CYS C 3 82  ? 44.969 17.203  15.534  1.00 28.23 ? 176  CYS C SG  1 
ATOM   3911 N  N   . PRO C 3 83  ? 48.861 17.073  16.445  1.00 26.53 ? 177  PRO C N   1 
ATOM   3912 C  CA  . PRO C 3 83  ? 49.334 16.634  17.762  1.00 26.52 ? 177  PRO C CA  1 
ATOM   3913 C  C   . PRO C 3 83  ? 48.164 16.390  18.710  1.00 27.75 ? 177  PRO C C   1 
ATOM   3914 O  O   . PRO C 3 83  ? 48.206 15.506  19.561  1.00 28.30 ? 177  PRO C O   1 
ATOM   3915 C  CB  . PRO C 3 83  ? 50.216 17.797  18.204  1.00 24.27 ? 177  PRO C CB  1 
ATOM   3916 C  CG  . PRO C 3 83  ? 50.818 18.260  16.882  1.00 23.61 ? 177  PRO C CG  1 
ATOM   3917 C  CD  . PRO C 3 83  ? 49.595 18.267  15.985  1.00 25.62 ? 177  PRO C CD  1 
ATOM   3918 N  N   . HIS C 3 84  ? 47.103 17.168  18.548  1.00 30.67 ? 178  HIS C N   1 
ATOM   3919 C  CA  . HIS C 3 84  ? 45.951 17.021  19.416  1.00 33.36 ? 178  HIS C CA  1 
ATOM   3920 C  C   . HIS C 3 84  ? 45.391 15.610  19.392  1.00 35.66 ? 178  HIS C C   1 
ATOM   3921 O  O   . HIS C 3 84  ? 45.334 14.950  20.431  1.00 39.39 ? 178  HIS C O   1 
ATOM   3922 C  CB  . HIS C 3 84  ? 44.851 18.009  19.041  1.00 33.11 ? 178  HIS C CB  1 
ATOM   3923 C  CG  . HIS C 3 84  ? 43.581 17.802  19.804  1.00 38.01 ? 178  HIS C CG  1 
ATOM   3924 N  ND1 . HIS C 3 84  ? 42.387 17.479  19.192  1.00 41.06 ? 178  HIS C ND1 1 
ATOM   3925 C  CD2 . HIS C 3 84  ? 43.320 17.851  21.133  1.00 40.18 ? 178  HIS C CD2 1 
ATOM   3926 C  CE1 . HIS C 3 84  ? 41.446 17.338  20.109  1.00 41.50 ? 178  HIS C CE1 1 
ATOM   3927 N  NE2 . HIS C 3 84  ? 41.985 17.558  21.295  1.00 41.92 ? 178  HIS C NE2 1 
ATOM   3928 N  N   . HIS C 3 85  ? 44.979 15.146  18.216  1.00 36.32 ? 179  HIS C N   1 
ATOM   3929 C  CA  . HIS C 3 85  ? 44.405 13.808  18.080  1.00 38.65 ? 179  HIS C CA  1 
ATOM   3930 C  C   . HIS C 3 85  ? 45.405 12.654  18.254  1.00 40.52 ? 179  HIS C C   1 
ATOM   3931 O  O   . HIS C 3 85  ? 45.007 11.502  18.471  1.00 37.94 ? 179  HIS C O   1 
ATOM   3932 C  CB  . HIS C 3 85  ? 43.698 13.661  16.727  1.00 40.34 ? 179  HIS C CB  1 
ATOM   3933 C  CG  . HIS C 3 85  ? 42.390 14.388  16.637  1.00 42.05 ? 179  HIS C CG  1 
ATOM   3934 N  ND1 . HIS C 3 85  ? 42.300 15.737  16.365  1.00 44.43 ? 179  HIS C ND1 1 
ATOM   3935 C  CD2 . HIS C 3 85  ? 41.116 13.947  16.770  1.00 42.48 ? 179  HIS C CD2 1 
ATOM   3936 C  CE1 . HIS C 3 85  ? 41.028 16.094  16.331  1.00 43.46 ? 179  HIS C CE1 1 
ATOM   3937 N  NE2 . HIS C 3 85  ? 40.289 15.027  16.574  1.00 43.18 ? 179  HIS C NE2 1 
ATOM   3938 N  N   . GLU C 3 86  ? 46.698 12.957  18.151  1.00 42.20 ? 180  GLU C N   1 
ATOM   3939 C  CA  . GLU C 3 86  ? 47.733 11.938  18.324  1.00 44.07 ? 180  GLU C CA  1 
ATOM   3940 C  C   . GLU C 3 86  ? 47.797 11.524  19.800  1.00 47.73 ? 180  GLU C C   1 
ATOM   3941 O  O   . GLU C 3 86  ? 48.038 10.354  20.128  1.00 47.60 ? 180  GLU C O   1 
ATOM   3942 C  CB  . GLU C 3 86  ? 49.089 12.498  17.884  1.00 44.35 ? 180  GLU C CB  1 
ATOM   3943 C  CG  . GLU C 3 86  ? 50.249 11.542  18.082  1.00 46.88 ? 180  GLU C CG  1 
ATOM   3944 C  CD  . GLU C 3 86  ? 51.567 12.079  17.540  1.00 49.69 ? 180  GLU C CD  1 
ATOM   3945 O  OE1 . GLU C 3 86  ? 52.594 11.378  17.689  1.00 51.13 ? 180  GLU C OE1 1 
ATOM   3946 O  OE2 . GLU C 3 86  ? 51.582 13.193  16.967  1.00 50.35 ? 180  GLU C OE2 1 
ATOM   3947 N  N   . ARG C 3 87  ? 47.568 12.501  20.679  1.00 49.44 ? 181  ARG C N   1 
ATOM   3948 C  CA  . ARG C 3 87  ? 47.598 12.294  22.122  1.00 49.07 ? 181  ARG C CA  1 
ATOM   3949 C  C   . ARG C 3 87  ? 46.275 11.729  22.624  1.00 49.87 ? 181  ARG C C   1 
ATOM   3950 O  O   . ARG C 3 87  ? 46.048 11.648  23.830  1.00 51.51 ? 181  ARG C O   1 
ATOM   3951 C  CB  . ARG C 3 87  ? 47.868 13.621  22.846  1.00 47.47 ? 181  ARG C CB  1 
ATOM   3952 C  CG  . ARG C 3 87  ? 49.081 14.395  22.348  1.00 48.34 ? 181  ARG C CG  1 
ATOM   3953 C  CD  . ARG C 3 87  ? 49.441 15.498  23.329  1.00 48.56 ? 181  ARG C CD  1 
ATOM   3954 N  NE  . ARG C 3 87  ? 48.283 16.314  23.689  1.00 49.42 ? 181  ARG C NE  1 
ATOM   3955 C  CZ  . ARG C 3 87  ? 47.907 17.419  23.048  1.00 51.22 ? 181  ARG C CZ  1 
ATOM   3956 N  NH1 . ARG C 3 87  ? 48.600 17.856  21.998  1.00 49.31 ? 181  ARG C NH1 1 
ATOM   3957 N  NH2 . ARG C 3 87  ? 46.838 18.095  23.465  1.00 51.05 ? 181  ARG C NH2 1 
ATOM   3958 N  N   . CYS C 3 88  ? 45.389 11.373  21.703  1.00 49.79 ? 182  CYS C N   1 
ATOM   3959 C  CA  . CYS C 3 88  ? 44.087 10.848  22.090  1.00 52.31 ? 182  CYS C CA  1 
ATOM   3960 C  C   . CYS C 3 88  ? 44.044 9.356   22.321  1.00 52.57 ? 182  CYS C C   1 
ATOM   3961 O  O   . CYS C 3 88  ? 44.849 8.585   21.778  1.00 49.83 ? 182  CYS C O   1 
ATOM   3962 C  CB  . CYS C 3 88  ? 43.023 11.194  21.045  1.00 54.06 ? 182  CYS C CB  1 
ATOM   3963 S  SG  . CYS C 3 88  ? 42.467 12.885  21.109  1.00 58.93 ? 182  CYS C SG  1 
ATOM   3964 N  N   . SER C 3 89  ? 43.072 8.968   23.137  1.00 52.90 ? 183  SER C N   1 
ATOM   3965 C  CA  . SER C 3 89  ? 42.849 7.576   23.453  1.00 53.66 ? 183  SER C CA  1 
ATOM   3966 C  C   . SER C 3 89  ? 41.799 7.080   22.459  1.00 53.11 ? 183  SER C C   1 
ATOM   3967 O  O   . SER C 3 89  ? 40.661 6.766   22.832  1.00 54.23 ? 183  SER C O   1 
ATOM   3968 C  CB  . SER C 3 89  ? 42.344 7.435   24.894  1.00 54.39 ? 183  SER C CB  1 
ATOM   3969 O  OG  . SER C 3 89  ? 42.146 6.072   25.243  1.00 58.07 ? 183  SER C OG  1 
ATOM   3970 N  N   . ASP C 3 90  ? 42.173 7.048   21.182  1.00 49.93 ? 184  ASP C N   1 
ATOM   3971 C  CA  . ASP C 3 90  ? 41.261 6.563   20.157  1.00 47.85 ? 184  ASP C CA  1 
ATOM   3972 C  C   . ASP C 3 90  ? 41.905 5.429   19.358  1.00 45.83 ? 184  ASP C C   1 
ATOM   3973 O  O   . ASP C 3 90  ? 41.568 5.199   18.199  1.00 45.65 ? 184  ASP C O   1 
ATOM   3974 C  CB  . ASP C 3 90  ? 40.812 7.705   19.229  1.00 46.88 ? 184  ASP C CB  1 
ATOM   3975 C  CG  . ASP C 3 90  ? 41.965 8.368   18.504  1.00 46.60 ? 184  ASP C CG  1 
ATOM   3976 O  OD1 . ASP C 3 90  ? 42.689 7.668   17.772  1.00 46.03 ? 184  ASP C OD1 1 
ATOM   3977 O  OD2 . ASP C 3 90  ? 42.141 9.597   18.660  1.00 48.17 ? 184  ASP C OD2 1 
ATOM   3978 N  N   . SER C 3 91  ? 42.831 4.720   19.998  1.00 44.66 ? 185  SER C N   1 
ATOM   3979 C  CA  . SER C 3 91  ? 43.515 3.593   19.373  1.00 42.43 ? 185  SER C CA  1 
ATOM   3980 C  C   . SER C 3 91  ? 42.524 2.469   19.106  1.00 42.76 ? 185  SER C C   1 
ATOM   3981 O  O   . SER C 3 91  ? 41.489 2.372   19.768  1.00 44.37 ? 185  SER C O   1 
ATOM   3982 C  CB  . SER C 3 91  ? 44.621 3.069   20.282  1.00 40.96 ? 185  SER C CB  1 
ATOM   3983 O  OG  . SER C 3 91  ? 45.143 1.860   19.762  1.00 40.87 ? 185  SER C OG  1 
ATOM   3984 N  N   . ASP C 3 92  ? 42.840 1.616   18.139  1.00 41.83 ? 186  ASP C N   1 
ATOM   3985 C  CA  . ASP C 3 92  ? 41.959 0.502   17.797  1.00 41.49 ? 186  ASP C CA  1 
ATOM   3986 C  C   . ASP C 3 92  ? 42.624 -0.823  18.147  1.00 42.36 ? 186  ASP C C   1 
ATOM   3987 O  O   . ASP C 3 92  ? 42.012 -1.882  18.031  1.00 43.37 ? 186  ASP C O   1 
ATOM   3988 C  CB  . ASP C 3 92  ? 41.630 0.530   16.304  1.00 39.62 ? 186  ASP C CB  1 
ATOM   3989 C  CG  . ASP C 3 92  ? 42.860 0.335   15.438  1.00 38.57 ? 186  ASP C CG  1 
ATOM   3990 O  OD1 . ASP C 3 92  ? 43.906 0.928   15.762  1.00 41.89 ? 186  ASP C OD1 1 
ATOM   3991 O  OD2 . ASP C 3 92  ? 42.788 -0.395  14.431  1.00 38.67 ? 186  ASP C OD2 1 
ATOM   3992 N  N   . GLY C 3 93  ? 43.879 -0.758  18.576  1.00 42.35 ? 187  GLY C N   1 
ATOM   3993 C  CA  . GLY C 3 93  ? 44.593 -1.970  18.925  1.00 43.50 ? 187  GLY C CA  1 
ATOM   3994 C  C   . GLY C 3 93  ? 45.586 -2.414  17.862  1.00 44.16 ? 187  GLY C C   1 
ATOM   3995 O  O   . GLY C 3 93  ? 46.493 -3.205  18.142  1.00 45.25 ? 187  GLY C O   1 
ATOM   3996 N  N   . LEU C 3 94  ? 45.430 -1.912  16.640  1.00 44.06 ? 188  LEU C N   1 
ATOM   3997 C  CA  . LEU C 3 94  ? 46.335 -2.293  15.559  1.00 41.79 ? 188  LEU C CA  1 
ATOM   3998 C  C   . LEU C 3 94  ? 47.059 -1.129  14.900  1.00 39.73 ? 188  LEU C C   1 
ATOM   3999 O  O   . LEU C 3 94  ? 48.153 -1.305  14.361  1.00 40.21 ? 188  LEU C O   1 
ATOM   4000 C  CB  . LEU C 3 94  ? 45.579 -3.087  14.480  1.00 41.69 ? 188  LEU C CB  1 
ATOM   4001 C  CG  . LEU C 3 94  ? 45.204 -4.543  14.795  1.00 43.96 ? 188  LEU C CG  1 
ATOM   4002 C  CD1 . LEU C 3 94  ? 44.411 -5.151  13.639  1.00 43.85 ? 188  LEU C CD1 1 
ATOM   4003 C  CD2 . LEU C 3 94  ? 46.472 -5.356  15.049  1.00 41.78 ? 188  LEU C CD2 1 
ATOM   4004 N  N   . ALA C 3 95  ? 46.477 0.061   14.969  1.00 37.45 ? 189  ALA C N   1 
ATOM   4005 C  CA  . ALA C 3 95  ? 47.072 1.217   14.313  1.00 39.08 ? 189  ALA C CA  1 
ATOM   4006 C  C   . ALA C 3 95  ? 47.740 2.278   15.188  1.00 39.37 ? 189  ALA C C   1 
ATOM   4007 O  O   . ALA C 3 95  ? 47.160 2.747   16.168  1.00 41.01 ? 189  ALA C O   1 
ATOM   4008 C  CB  . ALA C 3 95  ? 46.018 1.882   13.434  1.00 38.62 ? 189  ALA C CB  1 
ATOM   4009 N  N   . PRO C 3 96  ? 48.974 2.674   14.828  1.00 39.31 ? 190  PRO C N   1 
ATOM   4010 C  CA  . PRO C 3 96  ? 49.762 3.691   15.537  1.00 40.41 ? 190  PRO C CA  1 
ATOM   4011 C  C   . PRO C 3 96  ? 48.983 5.010   15.518  1.00 43.04 ? 190  PRO C C   1 
ATOM   4012 O  O   . PRO C 3 96  ? 48.380 5.371   14.500  1.00 43.40 ? 190  PRO C O   1 
ATOM   4013 C  CB  . PRO C 3 96  ? 51.043 3.770   14.716  1.00 38.72 ? 190  PRO C CB  1 
ATOM   4014 C  CG  . PRO C 3 96  ? 51.192 2.366   14.209  1.00 39.71 ? 190  PRO C CG  1 
ATOM   4015 C  CD  . PRO C 3 96  ? 49.777 2.045   13.765  1.00 39.79 ? 190  PRO C CD  1 
ATOM   4016 N  N   . PRO C 3 97  ? 49.011 5.759   16.636  1.00 43.19 ? 191  PRO C N   1 
ATOM   4017 C  CA  . PRO C 3 97  ? 48.319 7.041   16.818  1.00 42.53 ? 191  PRO C CA  1 
ATOM   4018 C  C   . PRO C 3 97  ? 48.636 8.174   15.839  1.00 42.17 ? 191  PRO C C   1 
ATOM   4019 O  O   . PRO C 3 97  ? 47.897 9.165   15.778  1.00 40.25 ? 191  PRO C O   1 
ATOM   4020 C  CB  . PRO C 3 97  ? 48.679 7.412   18.249  1.00 43.90 ? 191  PRO C CB  1 
ATOM   4021 C  CG  . PRO C 3 97  ? 50.086 6.925   18.345  1.00 43.85 ? 191  PRO C CG  1 
ATOM   4022 C  CD  . PRO C 3 97  ? 49.985 5.545   17.722  1.00 43.43 ? 191  PRO C CD  1 
ATOM   4023 N  N   . GLN C 3 98  ? 49.721 8.033   15.078  1.00 40.72 ? 192  GLN C N   1 
ATOM   4024 C  CA  . GLN C 3 98  ? 50.116 9.075   14.128  1.00 40.63 ? 192  GLN C CA  1 
ATOM   4025 C  C   . GLN C 3 98  ? 49.535 8.896   12.721  1.00 38.45 ? 192  GLN C C   1 
ATOM   4026 O  O   . GLN C 3 98  ? 49.618 9.807   11.891  1.00 35.13 ? 192  GLN C O   1 
ATOM   4027 C  CB  . GLN C 3 98  ? 51.649 9.161   14.022  1.00 42.66 ? 192  GLN C CB  1 
ATOM   4028 C  CG  . GLN C 3 98  ? 52.279 8.042   13.206  1.00 48.56 ? 192  GLN C CG  1 
ATOM   4029 C  CD  . GLN C 3 98  ? 52.823 6.905   14.063  1.00 53.46 ? 192  GLN C CD  1 
ATOM   4030 O  OE1 . GLN C 3 98  ? 52.201 6.494   15.054  1.00 54.30 ? 192  GLN C OE1 1 
ATOM   4031 N  NE2 . GLN C 3 98  ? 53.985 6.376   13.671  1.00 52.82 ? 192  GLN C NE2 1 
ATOM   4032 N  N   . HIS C 3 99  ? 48.956 7.732   12.439  1.00 36.39 ? 193  HIS C N   1 
ATOM   4033 C  CA  . HIS C 3 99  ? 48.387 7.507   11.117  1.00 32.26 ? 193  HIS C CA  1 
ATOM   4034 C  C   . HIS C 3 99  ? 46.992 8.111   10.976  1.00 28.71 ? 193  HIS C C   1 
ATOM   4035 O  O   . HIS C 3 99  ? 46.154 7.955   11.863  1.00 26.74 ? 193  HIS C O   1 
ATOM   4036 C  CB  . HIS C 3 99  ? 48.360 6.010   10.795  1.00 31.89 ? 193  HIS C CB  1 
ATOM   4037 C  CG  . HIS C 3 99  ? 49.716 5.425   10.553  1.00 34.26 ? 193  HIS C CG  1 
ATOM   4038 N  ND1 . HIS C 3 99  ? 49.905 4.207   9.936   1.00 36.95 ? 193  HIS C ND1 1 
ATOM   4039 C  CD2 . HIS C 3 99  ? 50.954 5.892   10.842  1.00 36.94 ? 193  HIS C CD2 1 
ATOM   4040 C  CE1 . HIS C 3 99  ? 51.198 3.950   9.851   1.00 34.68 ? 193  HIS C CE1 1 
ATOM   4041 N  NE2 . HIS C 3 99  ? 51.857 4.957   10.394  1.00 36.08 ? 193  HIS C NE2 1 
ATOM   4042 N  N   . LEU C 3 100 ? 46.767 8.815   9.863   1.00 26.84 ? 194  LEU C N   1 
ATOM   4043 C  CA  . LEU C 3 100 ? 45.482 9.454   9.564   1.00 25.12 ? 194  LEU C CA  1 
ATOM   4044 C  C   . LEU C 3 100 ? 44.455 8.433   9.065   1.00 24.80 ? 194  LEU C C   1 
ATOM   4045 O  O   . LEU C 3 100 ? 43.300 8.439   9.495   1.00 24.96 ? 194  LEU C O   1 
ATOM   4046 C  CB  . LEU C 3 100 ? 45.666 10.544  8.495   1.00 21.46 ? 194  LEU C CB  1 
ATOM   4047 C  CG  . LEU C 3 100 ? 44.393 11.241  7.966   1.00 23.93 ? 194  LEU C CG  1 
ATOM   4048 C  CD1 . LEU C 3 100 ? 43.752 12.074  9.054   1.00 21.49 ? 194  LEU C CD1 1 
ATOM   4049 C  CD2 . LEU C 3 100 ? 44.728 12.144  6.784   1.00 22.82 ? 194  LEU C CD2 1 
ATOM   4050 N  N   . ILE C 3 101 ? 44.901 7.556   8.167   1.00 24.59 ? 195  ILE C N   1 
ATOM   4051 C  CA  . ILE C 3 101 ? 44.056 6.530   7.556   1.00 25.04 ? 195  ILE C CA  1 
ATOM   4052 C  C   . ILE C 3 101 ? 44.176 5.141   8.187   1.00 24.13 ? 195  ILE C C   1 
ATOM   4053 O  O   . ILE C 3 101 ? 45.249 4.547   8.184   1.00 23.52 ? 195  ILE C O   1 
ATOM   4054 C  CB  . ILE C 3 101 ? 44.400 6.367   6.048   1.00 24.74 ? 195  ILE C CB  1 
ATOM   4055 C  CG1 . ILE C 3 101 ? 44.316 7.722   5.337   1.00 25.88 ? 195  ILE C CG1 1 
ATOM   4056 C  CG2 . ILE C 3 101 ? 43.455 5.372   5.410   1.00 22.51 ? 195  ILE C CG2 1 
ATOM   4057 C  CD1 . ILE C 3 101 ? 44.733 7.675   3.884   1.00 22.22 ? 195  ILE C CD1 1 
ATOM   4058 N  N   . ARG C 3 102 ? 43.071 4.622   8.707   1.00 25.36 ? 196  ARG C N   1 
ATOM   4059 C  CA  . ARG C 3 102 ? 43.062 3.283   9.296   1.00 30.00 ? 196  ARG C CA  1 
ATOM   4060 C  C   . ARG C 3 102 ? 42.131 2.382   8.491   1.00 30.27 ? 196  ARG C C   1 
ATOM   4061 O  O   . ARG C 3 102 ? 41.448 2.825   7.563   1.00 30.56 ? 196  ARG C O   1 
ATOM   4062 C  CB  . ARG C 3 102 ? 42.532 3.303   10.730  1.00 31.15 ? 196  ARG C CB  1 
ATOM   4063 C  CG  . ARG C 3 102 ? 43.295 4.152   11.693  1.00 30.70 ? 196  ARG C CG  1 
ATOM   4064 C  CD  . ARG C 3 102 ? 42.714 3.979   13.082  1.00 28.94 ? 196  ARG C CD  1 
ATOM   4065 N  NE  . ARG C 3 102 ? 43.434 4.804   14.043  1.00 31.74 ? 196  ARG C NE  1 
ATOM   4066 C  CZ  . ARG C 3 102 ? 42.995 5.096   15.261  1.00 31.70 ? 196  ARG C CZ  1 
ATOM   4067 N  NH1 . ARG C 3 102 ? 43.732 5.863   16.058  1.00 32.20 ? 196  ARG C NH1 1 
ATOM   4068 N  NH2 . ARG C 3 102 ? 41.820 4.631   15.677  1.00 29.87 ? 196  ARG C NH2 1 
ATOM   4069 N  N   . VAL C 3 103 ? 42.098 1.114   8.873   1.00 29.94 ? 197  VAL C N   1 
ATOM   4070 C  CA  . VAL C 3 103 ? 41.220 0.147   8.231   1.00 31.91 ? 197  VAL C CA  1 
ATOM   4071 C  C   . VAL C 3 103 ? 40.542 -0.672  9.316   1.00 31.77 ? 197  VAL C C   1 
ATOM   4072 O  O   . VAL C 3 103 ? 41.213 -1.229  10.182  1.00 32.12 ? 197  VAL C O   1 
ATOM   4073 C  CB  . VAL C 3 103 ? 41.982 -0.833  7.322   1.00 31.41 ? 197  VAL C CB  1 
ATOM   4074 C  CG1 . VAL C 3 103 ? 41.022 -1.930  6.846   1.00 29.56 ? 197  VAL C CG1 1 
ATOM   4075 C  CG2 . VAL C 3 103 ? 42.582 -0.092  6.129   1.00 28.78 ? 197  VAL C CG2 1 
ATOM   4076 N  N   . GLU C 3 104 ? 39.219 -0.743  9.278   1.00 32.39 ? 198  GLU C N   1 
ATOM   4077 C  CA  . GLU C 3 104 ? 38.490 -1.516  10.276  1.00 33.86 ? 198  GLU C CA  1 
ATOM   4078 C  C   . GLU C 3 104 ? 37.927 -2.773  9.647   1.00 34.96 ? 198  GLU C C   1 
ATOM   4079 O  O   . GLU C 3 104 ? 37.703 -2.824  8.435   1.00 36.43 ? 198  GLU C O   1 
ATOM   4080 C  CB  . GLU C 3 104 ? 37.347 -0.691  10.889  1.00 32.68 ? 198  GLU C CB  1 
ATOM   4081 C  CG  . GLU C 3 104 ? 36.472 0.017   9.876   1.00 37.43 ? 198  GLU C CG  1 
ATOM   4082 C  CD  . GLU C 3 104 ? 35.019 0.113   10.315  1.00 41.49 ? 198  GLU C CD  1 
ATOM   4083 O  OE1 . GLU C 3 104 ? 34.299 1.006   9.808   1.00 41.54 ? 198  GLU C OE1 1 
ATOM   4084 O  OE2 . GLU C 3 104 ? 34.590 -0.714  11.152  1.00 43.51 ? 198  GLU C OE2 1 
ATOM   4085 N  N   . GLY C 3 105 ? 37.686 -3.786  10.469  1.00 35.80 ? 199  GLY C N   1 
ATOM   4086 C  CA  . GLY C 3 105 ? 37.126 -5.021  9.947   1.00 38.11 ? 199  GLY C CA  1 
ATOM   4087 C  C   . GLY C 3 105 ? 38.152 -6.074  9.573   1.00 38.10 ? 199  GLY C C   1 
ATOM   4088 O  O   . GLY C 3 105 ? 38.005 -7.238  9.941   1.00 42.96 ? 199  GLY C O   1 
ATOM   4089 N  N   . ASN C 3 106 ? 39.183 -5.688  8.833   1.00 37.77 ? 200  ASN C N   1 
ATOM   4090 C  CA  . ASN C 3 106 ? 40.202 -6.647  8.444   1.00 38.65 ? 200  ASN C CA  1 
ATOM   4091 C  C   . ASN C 3 106 ? 41.229 -6.765  9.552   1.00 39.12 ? 200  ASN C C   1 
ATOM   4092 O  O   . ASN C 3 106 ? 41.609 -5.768  10.162  1.00 41.60 ? 200  ASN C O   1 
ATOM   4093 C  CB  . ASN C 3 106 ? 40.877 -6.233  7.141   1.00 36.85 ? 200  ASN C CB  1 
ATOM   4094 C  CG  . ASN C 3 106 ? 42.097 -7.071  6.833   1.00 37.65 ? 200  ASN C CG  1 
ATOM   4095 O  OD1 . ASN C 3 106 ? 42.102 -8.285  7.033   1.00 40.14 ? 200  ASN C OD1 1 
ATOM   4096 N  ND2 . ASN C 3 106 ? 43.143 -6.427  6.335   1.00 43.18 ? 200  ASN C ND2 1 
ATOM   4097 N  N   . LEU C 3 107 ? 41.672 -7.988  9.810   1.00 38.30 ? 201  LEU C N   1 
ATOM   4098 C  CA  . LEU C 3 107 ? 42.626 -8.230  10.870  1.00 39.18 ? 201  LEU C CA  1 
ATOM   4099 C  C   . LEU C 3 107 ? 44.073 -8.427  10.438  1.00 41.24 ? 201  LEU C C   1 
ATOM   4100 O  O   . LEU C 3 107 ? 44.932 -8.658  11.286  1.00 41.44 ? 201  LEU C O   1 
ATOM   4101 C  CB  . LEU C 3 107 ? 42.157 -9.425  11.699  1.00 39.10 ? 201  LEU C CB  1 
ATOM   4102 C  CG  . LEU C 3 107 ? 41.158 -9.136  12.836  1.00 42.12 ? 201  LEU C CG  1 
ATOM   4103 C  CD1 . LEU C 3 107 ? 40.049 -8.182  12.377  1.00 41.42 ? 201  LEU C CD1 1 
ATOM   4104 C  CD2 . LEU C 3 107 ? 40.568 -10.457 13.331  1.00 39.09 ? 201  LEU C CD2 1 
ATOM   4105 N  N   . ARG C 3 108 ? 44.364 -8.339  9.140   1.00 43.65 ? 202  ARG C N   1 
ATOM   4106 C  CA  . ARG C 3 108 ? 45.747 -8.511  8.716   1.00 45.57 ? 202  ARG C CA  1 
ATOM   4107 C  C   . ARG C 3 108 ? 46.339 -7.145  8.380   1.00 44.05 ? 202  ARG C C   1 
ATOM   4108 O  O   . ARG C 3 108 ? 47.377 -7.052  7.731   1.00 44.97 ? 202  ARG C O   1 
ATOM   4109 C  CB  . ARG C 3 108 ? 45.809 -9.397  7.465   1.00 50.69 ? 202  ARG C CB  1 
ATOM   4110 C  CG  . ARG C 3 108 ? 44.773 -10.526 7.411   1.00 55.94 ? 202  ARG C CG  1 
ATOM   4111 C  CD  . ARG C 3 108 ? 45.292 -11.821 8.016   1.00 61.01 ? 202  ARG C CD  1 
ATOM   4112 N  NE  . ARG C 3 108 ? 46.280 -12.474 7.160   1.00 64.07 ? 202  ARG C NE  1 
ATOM   4113 C  CZ  . ARG C 3 108 ? 46.014 -12.967 5.953   1.00 66.21 ? 202  ARG C CZ  1 
ATOM   4114 N  NH1 . ARG C 3 108 ? 46.979 -13.547 5.245   1.00 65.90 ? 202  ARG C NH1 1 
ATOM   4115 N  NH2 . ARG C 3 108 ? 44.786 -12.878 5.452   1.00 65.40 ? 202  ARG C NH2 1 
ATOM   4116 N  N   . VAL C 3 109 ? 45.667 -6.090  8.818   1.00 42.34 ? 203  VAL C N   1 
ATOM   4117 C  CA  . VAL C 3 109 ? 46.099 -4.729  8.537   1.00 43.98 ? 203  VAL C CA  1 
ATOM   4118 C  C   . VAL C 3 109 ? 47.513 -4.435  8.998   1.00 44.86 ? 203  VAL C C   1 
ATOM   4119 O  O   . VAL C 3 109 ? 47.837 -4.650  10.164  1.00 45.42 ? 203  VAL C O   1 
ATOM   4120 C  CB  . VAL C 3 109 ? 45.196 -3.714  9.239   1.00 44.53 ? 203  VAL C CB  1 
ATOM   4121 C  CG1 . VAL C 3 109 ? 45.340 -2.353  8.580   1.00 41.15 ? 203  VAL C CG1 1 
ATOM   4122 C  CG2 . VAL C 3 109 ? 43.764 -4.200  9.221   1.00 47.97 ? 203  VAL C CG2 1 
ATOM   4123 N  N   . GLU C 3 110 ? 48.347 -3.928  8.094   1.00 43.90 ? 204  GLU C N   1 
ATOM   4124 C  CA  . GLU C 3 110 ? 49.718 -3.567  8.442   1.00 42.16 ? 204  GLU C CA  1 
ATOM   4125 C  C   . GLU C 3 110 ? 49.930 -2.068  8.257   1.00 40.59 ? 204  GLU C C   1 
ATOM   4126 O  O   . GLU C 3 110 ? 49.554 -1.498  7.226   1.00 41.39 ? 204  GLU C O   1 
ATOM   4127 C  CB  . GLU C 3 110 ? 50.719 -4.329  7.573   1.00 44.15 ? 204  GLU C CB  1 
ATOM   4128 C  CG  . GLU C 3 110 ? 50.764 -5.814  7.862   1.00 51.05 ? 204  GLU C CG  1 
ATOM   4129 C  CD  . GLU C 3 110 ? 51.896 -6.516  7.131   1.00 55.63 ? 204  GLU C CD  1 
ATOM   4130 O  OE1 . GLU C 3 110 ? 52.077 -7.739  7.364   1.00 56.25 ? 204  GLU C OE1 1 
ATOM   4131 O  OE2 . GLU C 3 110 ? 52.598 -5.846  6.327   1.00 56.02 ? 204  GLU C OE2 1 
ATOM   4132 N  N   . TYR C 3 111 ? 50.525 -1.423  9.255   1.00 37.90 ? 205  TYR C N   1 
ATOM   4133 C  CA  . TYR C 3 111 ? 50.781 0.005   9.150   1.00 36.28 ? 205  TYR C CA  1 
ATOM   4134 C  C   . TYR C 3 111 ? 52.252 0.238   8.874   1.00 37.69 ? 205  TYR C C   1 
ATOM   4135 O  O   . TYR C 3 111 ? 53.119 -0.405  9.466   1.00 40.94 ? 205  TYR C O   1 
ATOM   4136 C  CB  . TYR C 3 111 ? 50.324 0.734   10.418  1.00 32.78 ? 205  TYR C CB  1 
ATOM   4137 C  CG  . TYR C 3 111 ? 48.817 0.693   10.581  1.00 29.04 ? 205  TYR C CG  1 
ATOM   4138 C  CD1 . TYR C 3 111 ? 48.193 -0.420  11.133  1.00 28.31 ? 205  TYR C CD1 1 
ATOM   4139 C  CD2 . TYR C 3 111 ? 48.012 1.723   10.092  1.00 27.65 ? 205  TYR C CD2 1 
ATOM   4140 C  CE1 . TYR C 3 111 ? 46.813 -0.516  11.190  1.00 29.94 ? 205  TYR C CE1 1 
ATOM   4141 C  CE2 . TYR C 3 111 ? 46.622 1.640   10.139  1.00 28.73 ? 205  TYR C CE2 1 
ATOM   4142 C  CZ  . TYR C 3 111 ? 46.028 0.512   10.688  1.00 31.17 ? 205  TYR C CZ  1 
ATOM   4143 O  OH  . TYR C 3 111 ? 44.654 0.385   10.723  1.00 34.00 ? 205  TYR C OH  1 
ATOM   4144 N  N   . LEU C 3 112 ? 52.535 1.152   7.957   1.00 38.57 ? 206  LEU C N   1 
ATOM   4145 C  CA  . LEU C 3 112 ? 53.907 1.437   7.591   1.00 38.13 ? 206  LEU C CA  1 
ATOM   4146 C  C   . LEU C 3 112 ? 54.322 2.890   7.728   1.00 39.41 ? 206  LEU C C   1 
ATOM   4147 O  O   . LEU C 3 112 ? 53.573 3.805   7.399   1.00 39.41 ? 206  LEU C O   1 
ATOM   4148 C  CB  . LEU C 3 112 ? 54.151 1.005   6.147   1.00 38.62 ? 206  LEU C CB  1 
ATOM   4149 C  CG  . LEU C 3 112 ? 55.561 1.242   5.585   1.00 39.49 ? 206  LEU C CG  1 
ATOM   4150 C  CD1 . LEU C 3 112 ? 56.554 0.237   6.213   1.00 35.01 ? 206  LEU C CD1 1 
ATOM   4151 C  CD2 . LEU C 3 112 ? 55.529 1.100   4.053   1.00 37.08 ? 206  LEU C CD2 1 
ATOM   4152 N  N   . ASP C 3 113 ? 55.541 3.075   8.214   1.00 41.83 ? 207  ASP C N   1 
ATOM   4153 C  CA  . ASP C 3 113 ? 56.151 4.382   8.365   1.00 44.11 ? 207  ASP C CA  1 
ATOM   4154 C  C   . ASP C 3 113 ? 57.433 4.269   7.546   1.00 44.90 ? 207  ASP C C   1 
ATOM   4155 O  O   . ASP C 3 113 ? 58.475 3.886   8.074   1.00 46.53 ? 207  ASP C O   1 
ATOM   4156 C  CB  . ASP C 3 113 ? 56.488 4.635   9.831   1.00 45.50 ? 207  ASP C CB  1 
ATOM   4157 C  CG  . ASP C 3 113 ? 55.290 5.062   10.628  1.00 49.15 ? 207  ASP C CG  1 
ATOM   4158 O  OD1 . ASP C 3 113 ? 55.084 6.289   10.767  1.00 51.12 ? 207  ASP C OD1 1 
ATOM   4159 O  OD2 . ASP C 3 113 ? 54.548 4.174   11.104  1.00 51.09 ? 207  ASP C OD2 1 
ATOM   4160 N  N   . ASP C 3 114 ? 57.352 4.564   6.253   1.00 45.57 ? 208  ASP C N   1 
ATOM   4161 C  CA  . ASP C 3 114 ? 58.528 4.467   5.403   1.00 47.18 ? 208  ASP C CA  1 
ATOM   4162 C  C   . ASP C 3 114 ? 59.667 5.219   6.074   1.00 47.44 ? 208  ASP C C   1 
ATOM   4163 O  O   . ASP C 3 114 ? 59.532 6.402   6.376   1.00 47.65 ? 208  ASP C O   1 
ATOM   4164 C  CB  . ASP C 3 114 ? 58.244 5.061   4.028   1.00 48.97 ? 208  ASP C CB  1 
ATOM   4165 C  CG  . ASP C 3 114 ? 59.385 4.841   3.067   1.00 48.51 ? 208  ASP C CG  1 
ATOM   4166 O  OD1 . ASP C 3 114 ? 59.749 3.667   2.860   1.00 47.33 ? 208  ASP C OD1 1 
ATOM   4167 O  OD2 . ASP C 3 114 ? 59.923 5.833   2.528   1.00 51.85 ? 208  ASP C OD2 1 
ATOM   4168 N  N   . ARG C 3 115 ? 60.790 4.548   6.316   1.00 48.99 ? 209  ARG C N   1 
ATOM   4169 C  CA  . ARG C 3 115 ? 61.884 5.234   6.992   1.00 52.16 ? 209  ARG C CA  1 
ATOM   4170 C  C   . ARG C 3 115 ? 62.728 6.147   6.104   1.00 54.31 ? 209  ARG C C   1 
ATOM   4171 O  O   . ARG C 3 115 ? 63.788 6.611   6.521   1.00 55.04 ? 209  ARG C O   1 
ATOM   4172 C  CB  . ARG C 3 115 ? 62.788 4.251   7.760   1.00 52.50 ? 209  ARG C CB  1 
ATOM   4173 C  CG  . ARG C 3 115 ? 63.866 3.537   6.948   1.00 54.52 ? 209  ARG C CG  1 
ATOM   4174 C  CD  . ARG C 3 115 ? 65.148 3.342   7.783   1.00 54.79 ? 209  ARG C CD  1 
ATOM   4175 N  NE  . ARG C 3 115 ? 65.929 4.578   7.886   1.00 55.33 ? 209  ARG C NE  1 
ATOM   4176 C  CZ  . ARG C 3 115 ? 67.096 4.691   8.520   1.00 55.82 ? 209  ARG C CZ  1 
ATOM   4177 N  NH1 . ARG C 3 115 ? 67.635 3.640   9.126   1.00 56.84 ? 209  ARG C NH1 1 
ATOM   4178 N  NH2 . ARG C 3 115 ? 67.736 5.855   8.536   1.00 54.58 ? 209  ARG C NH2 1 
ATOM   4179 N  N   . ASN C 3 116 ? 62.244 6.430   4.895   1.00 56.85 ? 210  ASN C N   1 
ATOM   4180 C  CA  . ASN C 3 116 ? 62.950 7.322   3.970   1.00 57.50 ? 210  ASN C CA  1 
ATOM   4181 C  C   . ASN C 3 116 ? 62.074 8.498   3.510   1.00 57.19 ? 210  ASN C C   1 
ATOM   4182 O  O   . ASN C 3 116 ? 62.534 9.647   3.444   1.00 57.83 ? 210  ASN C O   1 
ATOM   4183 C  CB  . ASN C 3 116 ? 63.439 6.535   2.755   1.00 59.57 ? 210  ASN C CB  1 
ATOM   4184 C  CG  . ASN C 3 116 ? 64.554 5.569   3.102   1.00 62.38 ? 210  ASN C CG  1 
ATOM   4185 O  OD1 . ASN C 3 116 ? 65.578 5.963   3.670   1.00 65.85 ? 210  ASN C OD1 1 
ATOM   4186 N  ND2 . ASN C 3 116 ? 64.366 4.299   2.761   1.00 62.86 ? 210  ASN C ND2 1 
ATOM   4187 N  N   . THR C 3 117 ? 60.817 8.216   3.177   1.00 54.10 ? 211  THR C N   1 
ATOM   4188 C  CA  . THR C 3 117 ? 59.914 9.282   2.762   1.00 52.35 ? 211  THR C CA  1 
ATOM   4189 C  C   . THR C 3 117 ? 59.171 9.773   3.996   1.00 50.95 ? 211  THR C C   1 
ATOM   4190 O  O   . THR C 3 117 ? 58.612 10.869  4.001   1.00 49.11 ? 211  THR C O   1 
ATOM   4191 C  CB  . THR C 3 117 ? 58.880 8.807   1.714   1.00 52.17 ? 211  THR C CB  1 
ATOM   4192 O  OG1 . THR C 3 117 ? 58.201 7.637   2.191   1.00 51.57 ? 211  THR C OG1 1 
ATOM   4193 C  CG2 . THR C 3 117 ? 59.562 8.512   0.395   1.00 52.09 ? 211  THR C CG2 1 
ATOM   4194 N  N   . PHE C 3 118 ? 59.177 8.943   5.037   1.00 49.39 ? 212  PHE C N   1 
ATOM   4195 C  CA  . PHE C 3 118 ? 58.520 9.258   6.293   1.00 49.85 ? 212  PHE C CA  1 
ATOM   4196 C  C   . PHE C 3 118 ? 56.995 9.254   6.132   1.00 49.74 ? 212  PHE C C   1 
ATOM   4197 O  O   . PHE C 3 118 ? 56.248 9.578   7.063   1.00 51.06 ? 212  PHE C O   1 
ATOM   4198 C  CB  . PHE C 3 118 ? 59.029 10.609  6.793   1.00 52.98 ? 212  PHE C CB  1 
ATOM   4199 C  CG  . PHE C 3 118 ? 60.532 10.711  6.810   1.00 57.11 ? 212  PHE C CG  1 
ATOM   4200 C  CD1 . PHE C 3 118 ? 61.299 9.787   7.525   1.00 59.08 ? 212  PHE C CD1 1 
ATOM   4201 C  CD2 . PHE C 3 118 ? 61.185 11.716  6.103   1.00 57.96 ? 212  PHE C CD2 1 
ATOM   4202 C  CE1 . PHE C 3 118 ? 62.691 9.865   7.531   1.00 58.82 ? 212  PHE C CE1 1 
ATOM   4203 C  CE2 . PHE C 3 118 ? 62.579 11.803  6.104   1.00 57.79 ? 212  PHE C CE2 1 
ATOM   4204 C  CZ  . PHE C 3 118 ? 63.331 10.877  6.817   1.00 59.28 ? 212  PHE C CZ  1 
ATOM   4205 N  N   . ARG C 3 119 ? 56.540 8.847   4.951   1.00 47.00 ? 213  ARG C N   1 
ATOM   4206 C  CA  . ARG C 3 119 ? 55.119 8.803   4.658   1.00 43.18 ? 213  ARG C CA  1 
ATOM   4207 C  C   . ARG C 3 119 ? 54.375 7.633   5.287   1.00 42.18 ? 213  ARG C C   1 
ATOM   4208 O  O   . ARG C 3 119 ? 54.899 6.525   5.390   1.00 43.91 ? 213  ARG C O   1 
ATOM   4209 C  CB  . ARG C 3 119 ? 54.924 8.826   3.147   1.00 41.46 ? 213  ARG C CB  1 
ATOM   4210 C  CG  . ARG C 3 119 ? 55.243 10.196  2.559   1.00 36.40 ? 213  ARG C CG  1 
ATOM   4211 C  CD  . ARG C 3 119 ? 55.158 10.214  1.041   1.00 34.74 ? 213  ARG C CD  1 
ATOM   4212 N  NE  . ARG C 3 119 ? 55.470 11.538  0.507   1.00 31.36 ? 213  ARG C NE  1 
ATOM   4213 C  CZ  . ARG C 3 119 ? 54.706 12.608  0.676   1.00 26.98 ? 213  ARG C CZ  1 
ATOM   4214 N  NH1 . ARG C 3 119 ? 53.574 12.509  1.361   1.00 26.86 ? 213  ARG C NH1 1 
ATOM   4215 N  NH2 . ARG C 3 119 ? 55.077 13.777  0.161   1.00 27.90 ? 213  ARG C NH2 1 
ATOM   4216 N  N   . HIS C 3 120 ? 53.146 7.894   5.726   1.00 41.15 ? 214  HIS C N   1 
ATOM   4217 C  CA  . HIS C 3 120 ? 52.317 6.865   6.353   1.00 36.58 ? 214  HIS C CA  1 
ATOM   4218 C  C   . HIS C 3 120 ? 51.515 6.154   5.290   1.00 35.28 ? 214  HIS C C   1 
ATOM   4219 O  O   . HIS C 3 120 ? 51.134 6.750   4.273   1.00 34.19 ? 214  HIS C O   1 
ATOM   4220 C  CB  . HIS C 3 120 ? 51.375 7.485   7.372   1.00 34.76 ? 214  HIS C CB  1 
ATOM   4221 C  CG  . HIS C 3 120 ? 52.081 8.223   8.456   1.00 34.41 ? 214  HIS C CG  1 
ATOM   4222 N  ND1 . HIS C 3 120 ? 51.426 9.047   9.344   1.00 35.81 ? 214  HIS C ND1 1 
ATOM   4223 C  CD2 . HIS C 3 120 ? 53.391 8.268   8.793   1.00 34.69 ? 214  HIS C CD2 1 
ATOM   4224 C  CE1 . HIS C 3 120 ? 52.303 9.570   10.183  1.00 36.85 ? 214  HIS C CE1 1 
ATOM   4225 N  NE2 . HIS C 3 120 ? 53.502 9.114   9.869   1.00 37.06 ? 214  HIS C NE2 1 
ATOM   4226 N  N   . SER C 3 121 ? 51.238 4.881   5.545   1.00 34.79 ? 215  SER C N   1 
ATOM   4227 C  CA  . SER C 3 121 ? 50.529 4.040   4.595   1.00 32.07 ? 215  SER C CA  1 
ATOM   4228 C  C   . SER C 3 121 ? 49.922 2.849   5.330   1.00 31.51 ? 215  SER C C   1 
ATOM   4229 O  O   . SER C 3 121 ? 50.512 2.348   6.285   1.00 31.27 ? 215  SER C O   1 
ATOM   4230 C  CB  . SER C 3 121 ? 51.544 3.541   3.568   1.00 34.16 ? 215  SER C CB  1 
ATOM   4231 O  OG  . SER C 3 121 ? 50.926 2.933   2.456   1.00 42.43 ? 215  SER C OG  1 
ATOM   4232 N  N   . VAL C 3 122 ? 48.742 2.406   4.900   1.00 31.21 ? 216  VAL C N   1 
ATOM   4233 C  CA  . VAL C 3 122 ? 48.092 1.250   5.513   1.00 29.67 ? 216  VAL C CA  1 
ATOM   4234 C  C   . VAL C 3 122 ? 47.794 0.253   4.398   1.00 31.41 ? 216  VAL C C   1 
ATOM   4235 O  O   . VAL C 3 122 ? 47.217 0.610   3.366   1.00 29.93 ? 216  VAL C O   1 
ATOM   4236 C  CB  . VAL C 3 122 ? 46.778 1.624   6.228   1.00 26.60 ? 216  VAL C CB  1 
ATOM   4237 C  CG1 . VAL C 3 122 ? 45.859 2.393   5.288   1.00 25.60 ? 216  VAL C CG1 1 
ATOM   4238 C  CG2 . VAL C 3 122 ? 46.089 0.363   6.696   1.00 23.09 ? 216  VAL C CG2 1 
ATOM   4239 N  N   . VAL C 3 123 ? 48.193 -0.997  4.616   1.00 35.11 ? 217  VAL C N   1 
ATOM   4240 C  CA  . VAL C 3 123 ? 48.022 -2.054  3.622   1.00 35.90 ? 217  VAL C CA  1 
ATOM   4241 C  C   . VAL C 3 123 ? 47.356 -3.305  4.190   1.00 34.01 ? 217  VAL C C   1 
ATOM   4242 O  O   . VAL C 3 123 ? 47.536 -3.647  5.361   1.00 31.03 ? 217  VAL C O   1 
ATOM   4243 C  CB  . VAL C 3 123 ? 49.397 -2.472  3.036   1.00 39.25 ? 217  VAL C CB  1 
ATOM   4244 C  CG1 . VAL C 3 123 ? 50.238 -3.158  4.125   1.00 39.04 ? 217  VAL C CG1 1 
ATOM   4245 C  CG2 . VAL C 3 123 ? 49.209 -3.391  1.830   1.00 39.72 ? 217  VAL C CG2 1 
ATOM   4246 N  N   . VAL C 3 124 ? 46.585 -3.979  3.340   1.00 33.81 ? 218  VAL C N   1 
ATOM   4247 C  CA  . VAL C 3 124 ? 45.899 -5.213  3.709   1.00 33.39 ? 218  VAL C CA  1 
ATOM   4248 C  C   . VAL C 3 124 ? 45.975 -6.199  2.557   1.00 33.88 ? 218  VAL C C   1 
ATOM   4249 O  O   . VAL C 3 124 ? 46.144 -5.809  1.397   1.00 35.23 ? 218  VAL C O   1 
ATOM   4250 C  CB  . VAL C 3 124 ? 44.407 -4.991  4.020   1.00 31.75 ? 218  VAL C CB  1 
ATOM   4251 C  CG1 . VAL C 3 124 ? 44.264 -4.004  5.141   1.00 33.90 ? 218  VAL C CG1 1 
ATOM   4252 C  CG2 . VAL C 3 124 ? 43.667 -4.516  2.773   1.00 27.68 ? 218  VAL C CG2 1 
ATOM   4253 N  N   . PRO C 3 125 ? 45.850 -7.496  2.861   1.00 34.40 ? 219  PRO C N   1 
ATOM   4254 C  CA  . PRO C 3 125 ? 45.910 -8.515  1.809   1.00 33.35 ? 219  PRO C CA  1 
ATOM   4255 C  C   . PRO C 3 125 ? 44.739 -8.351  0.853   1.00 34.06 ? 219  PRO C C   1 
ATOM   4256 O  O   . PRO C 3 125 ? 43.601 -8.141  1.288   1.00 35.82 ? 219  PRO C O   1 
ATOM   4257 C  CB  . PRO C 3 125 ? 45.830 -9.820  2.594   1.00 31.23 ? 219  PRO C CB  1 
ATOM   4258 C  CG  . PRO C 3 125 ? 46.475 -9.458  3.913   1.00 30.36 ? 219  PRO C CG  1 
ATOM   4259 C  CD  . PRO C 3 125 ? 45.842 -8.120  4.196   1.00 32.91 ? 219  PRO C CD  1 
ATOM   4260 N  N   . TYR C 3 126 ? 45.012 -8.426  -0.445  1.00 32.46 ? 220  TYR C N   1 
ATOM   4261 C  CA  . TYR C 3 126 ? 43.944 -8.309  -1.421  1.00 31.13 ? 220  TYR C CA  1 
ATOM   4262 C  C   . TYR C 3 126 ? 43.149 -9.601  -1.449  1.00 31.42 ? 220  TYR C C   1 
ATOM   4263 O  O   . TYR C 3 126 ? 43.723 -10.680 -1.547  1.00 31.73 ? 220  TYR C O   1 
ATOM   4264 C  CB  . TYR C 3 126 ? 44.492 -8.051  -2.831  1.00 30.85 ? 220  TYR C CB  1 
ATOM   4265 C  CG  . TYR C 3 126 ? 43.438 -8.287  -3.892  1.00 30.09 ? 220  TYR C CG  1 
ATOM   4266 C  CD1 . TYR C 3 126 ? 43.244 -9.555  -4.451  1.00 29.84 ? 220  TYR C CD1 1 
ATOM   4267 C  CD2 . TYR C 3 126 ? 42.544 -7.280  -4.235  1.00 30.19 ? 220  TYR C CD2 1 
ATOM   4268 C  CE1 . TYR C 3 126 ? 42.171 -9.811  -5.319  1.00 27.78 ? 220  TYR C CE1 1 
ATOM   4269 C  CE2 . TYR C 3 126 ? 41.478 -7.524  -5.099  1.00 31.32 ? 220  TYR C CE2 1 
ATOM   4270 C  CZ  . TYR C 3 126 ? 41.294 -8.789  -5.637  1.00 29.44 ? 220  TYR C CZ  1 
ATOM   4271 O  OH  . TYR C 3 126 ? 40.232 -9.000  -6.493  1.00 29.16 ? 220  TYR C OH  1 
ATOM   4272 N  N   . GLU C 3 127 ? 41.829 -9.489  -1.382  1.00 31.75 ? 221  GLU C N   1 
ATOM   4273 C  CA  . GLU C 3 127 ? 40.964 -10.654 -1.431  1.00 34.45 ? 221  GLU C CA  1 
ATOM   4274 C  C   . GLU C 3 127 ? 39.969 -10.424 -2.558  1.00 33.76 ? 221  GLU C C   1 
ATOM   4275 O  O   . GLU C 3 127 ? 39.503 -9.302  -2.755  1.00 33.71 ? 221  GLU C O   1 
ATOM   4276 C  CB  . GLU C 3 127 ? 40.218 -10.817 -0.108  1.00 37.78 ? 221  GLU C CB  1 
ATOM   4277 C  CG  . GLU C 3 127 ? 41.119 -11.147 1.072   1.00 45.63 ? 221  GLU C CG  1 
ATOM   4278 C  CD  . GLU C 3 127 ? 41.066 -10.088 2.161   1.00 51.29 ? 221  GLU C CD  1 
ATOM   4279 O  OE1 . GLU C 3 127 ? 39.933 -9.742  2.585   1.00 53.18 ? 221  GLU C OE1 1 
ATOM   4280 O  OE2 . GLU C 3 127 ? 42.148 -9.605  2.593   1.00 51.88 ? 221  GLU C OE2 1 
ATOM   4281 N  N   . PRO C 3 128 ? 39.637 -11.476 -3.323  1.00 31.45 ? 222  PRO C N   1 
ATOM   4282 C  CA  . PRO C 3 128 ? 38.681 -11.321 -4.426  1.00 32.33 ? 222  PRO C CA  1 
ATOM   4283 C  C   . PRO C 3 128 ? 37.281 -11.062 -3.883  1.00 31.56 ? 222  PRO C C   1 
ATOM   4284 O  O   . PRO C 3 128 ? 37.005 -11.316 -2.718  1.00 33.31 ? 222  PRO C O   1 
ATOM   4285 C  CB  . PRO C 3 128 ? 38.767 -12.662 -5.146  1.00 30.81 ? 222  PRO C CB  1 
ATOM   4286 C  CG  . PRO C 3 128 ? 38.957 -13.606 -3.999  1.00 29.48 ? 222  PRO C CG  1 
ATOM   4287 C  CD  . PRO C 3 128 ? 40.013 -12.888 -3.154  1.00 29.91 ? 222  PRO C CD  1 
ATOM   4288 N  N   . PRO C 3 129 ? 36.379 -10.556 -4.728  1.00 32.19 ? 223  PRO C N   1 
ATOM   4289 C  CA  . PRO C 3 129 ? 34.995 -10.264 -4.330  1.00 32.78 ? 223  PRO C CA  1 
ATOM   4290 C  C   . PRO C 3 129 ? 34.322 -11.456 -3.681  1.00 33.46 ? 223  PRO C C   1 
ATOM   4291 O  O   . PRO C 3 129 ? 34.694 -12.596 -3.931  1.00 31.67 ? 223  PRO C O   1 
ATOM   4292 C  CB  . PRO C 3 129 ? 34.321 -9.904  -5.649  1.00 31.93 ? 223  PRO C CB  1 
ATOM   4293 C  CG  . PRO C 3 129 ? 35.445 -9.280  -6.431  1.00 35.53 ? 223  PRO C CG  1 
ATOM   4294 C  CD  . PRO C 3 129 ? 36.618 -10.190 -6.135  1.00 31.30 ? 223  PRO C CD  1 
ATOM   4295 N  N   . GLU C 3 130 ? 33.341 -11.189 -2.830  1.00 38.65 ? 224  GLU C N   1 
ATOM   4296 C  CA  . GLU C 3 130 ? 32.609 -12.260 -2.167  1.00 43.18 ? 224  GLU C CA  1 
ATOM   4297 C  C   . GLU C 3 130 ? 31.844 -12.936 -3.290  1.00 46.18 ? 224  GLU C C   1 
ATOM   4298 O  O   . GLU C 3 130 ? 31.866 -12.466 -4.426  1.00 46.59 ? 224  GLU C O   1 
ATOM   4299 C  CB  . GLU C 3 130 ? 31.603 -11.678 -1.179  1.00 46.02 ? 224  GLU C CB  1 
ATOM   4300 C  CG  . GLU C 3 130 ? 31.302 -12.562 -0.003  1.00 48.77 ? 224  GLU C CG  1 
ATOM   4301 C  CD  . GLU C 3 130 ? 32.237 -12.281 1.153   1.00 53.22 ? 224  GLU C CD  1 
ATOM   4302 O  OE1 . GLU C 3 130 ? 33.421 -11.957 0.891   1.00 52.12 ? 224  GLU C OE1 1 
ATOM   4303 O  OE2 . GLU C 3 130 ? 31.793 -12.388 2.322   1.00 55.93 ? 224  GLU C OE2 1 
ATOM   4304 N  N   . VAL C 3 131 ? 31.168 -14.038 -2.989  1.00 50.34 ? 225  VAL C N   1 
ATOM   4305 C  CA  . VAL C 3 131 ? 30.378 -14.706 -4.014  1.00 50.62 ? 225  VAL C CA  1 
ATOM   4306 C  C   . VAL C 3 131 ? 29.112 -13.866 -4.056  1.00 50.47 ? 225  VAL C C   1 
ATOM   4307 O  O   . VAL C 3 131 ? 28.522 -13.585 -3.008  1.00 50.70 ? 225  VAL C O   1 
ATOM   4308 C  CB  . VAL C 3 131 ? 30.034 -16.155 -3.621  1.00 51.84 ? 225  VAL C CB  1 
ATOM   4309 C  CG1 . VAL C 3 131 ? 29.304 -16.843 -4.762  1.00 51.95 ? 225  VAL C CG1 1 
ATOM   4310 C  CG2 . VAL C 3 131 ? 31.310 -16.914 -3.272  1.00 52.12 ? 225  VAL C CG2 1 
ATOM   4311 N  N   . GLY C 3 132 ? 28.717 -13.436 -5.251  1.00 49.69 ? 226  GLY C N   1 
ATOM   4312 C  CA  . GLY C 3 132 ? 27.530 -12.607 -5.369  1.00 50.62 ? 226  GLY C CA  1 
ATOM   4313 C  C   . GLY C 3 132 ? 27.866 -11.129 -5.538  1.00 50.48 ? 226  GLY C C   1 
ATOM   4314 O  O   . GLY C 3 132 ? 26.998 -10.302 -5.845  1.00 48.92 ? 226  GLY C O   1 
ATOM   4315 N  N   . SER C 3 133 ? 29.128 -10.783 -5.315  1.00 49.50 ? 227  SER C N   1 
ATOM   4316 C  CA  . SER C 3 133 ? 29.559 -9.408  -5.486  1.00 47.87 ? 227  SER C CA  1 
ATOM   4317 C  C   . SER C 3 133 ? 30.387 -9.340  -6.752  1.00 47.14 ? 227  SER C C   1 
ATOM   4318 O  O   . SER C 3 133 ? 30.722 -10.366 -7.351  1.00 46.64 ? 227  SER C O   1 
ATOM   4319 C  CB  . SER C 3 133 ? 30.409 -8.939  -4.306  1.00 48.40 ? 227  SER C CB  1 
ATOM   4320 O  OG  . SER C 3 133 ? 29.623 -8.739  -3.147  1.00 51.49 ? 227  SER C OG  1 
ATOM   4321 N  N   . ASP C 3 134 ? 30.697 -8.120  -7.164  1.00 45.51 ? 228  ASP C N   1 
ATOM   4322 C  CA  . ASP C 3 134 ? 31.513 -7.902  -8.341  1.00 44.11 ? 228  ASP C CA  1 
ATOM   4323 C  C   . ASP C 3 134 ? 32.740 -7.137  -7.882  1.00 40.67 ? 228  ASP C C   1 
ATOM   4324 O  O   . ASP C 3 134 ? 33.700 -6.952  -8.628  1.00 38.77 ? 228  ASP C O   1 
ATOM   4325 C  CB  . ASP C 3 134 ? 30.734 -7.106  -9.380  1.00 48.10 ? 228  ASP C CB  1 
ATOM   4326 C  CG  . ASP C 3 134 ? 29.711 -7.954  -10.102 1.00 51.08 ? 228  ASP C CG  1 
ATOM   4327 O  OD1 . ASP C 3 134 ? 30.122 -8.901  -10.811 1.00 49.68 ? 228  ASP C OD1 1 
ATOM   4328 O  OD2 . ASP C 3 134 ? 28.499 -7.676  -9.953  1.00 55.36 ? 228  ASP C OD2 1 
ATOM   4329 N  N   . CYS C 3 135 ? 32.707 -6.707  -6.629  1.00 37.94 ? 229  CYS C N   1 
ATOM   4330 C  CA  . CYS C 3 135 ? 33.832 -5.974  -6.098  1.00 35.66 ? 229  CYS C CA  1 
ATOM   4331 C  C   . CYS C 3 135 ? 34.186 -6.357  -4.675  1.00 34.04 ? 229  CYS C C   1 
ATOM   4332 O  O   . CYS C 3 135 ? 33.409 -7.012  -3.973  1.00 31.83 ? 229  CYS C O   1 
ATOM   4333 C  CB  . CYS C 3 135 ? 33.580 -4.458  -6.194  1.00 35.96 ? 229  CYS C CB  1 
ATOM   4334 S  SG  . CYS C 3 135 ? 32.114 -3.813  -5.342  1.00 33.50 ? 229  CYS C SG  1 
ATOM   4335 N  N   . THR C 3 136 ? 35.389 -5.949  -4.278  1.00 32.53 ? 230  THR C N   1 
ATOM   4336 C  CA  . THR C 3 136 ? 35.932 -6.192  -2.947  1.00 29.63 ? 230  THR C CA  1 
ATOM   4337 C  C   . THR C 3 136 ? 35.844 -4.861  -2.216  1.00 27.77 ? 230  THR C C   1 
ATOM   4338 O  O   . THR C 3 136 ? 36.318 -3.851  -2.724  1.00 26.51 ? 230  THR C O   1 
ATOM   4339 C  CB  . THR C 3 136 ? 37.407 -6.578  -3.038  1.00 28.23 ? 230  THR C CB  1 
ATOM   4340 O  OG1 . THR C 3 136 ? 37.534 -7.800  -3.770  1.00 32.46 ? 230  THR C OG1 1 
ATOM   4341 C  CG2 . THR C 3 136 ? 38.004 -6.739  -1.659  1.00 30.08 ? 230  THR C CG2 1 
ATOM   4342 N  N   . THR C 3 137 ? 35.254 -4.852  -1.029  1.00 29.13 ? 231  THR C N   1 
ATOM   4343 C  CA  . THR C 3 137 ? 35.111 -3.610  -0.279  1.00 26.93 ? 231  THR C CA  1 
ATOM   4344 C  C   . THR C 3 137 ? 36.076 -3.529  0.894   1.00 27.11 ? 231  THR C C   1 
ATOM   4345 O  O   . THR C 3 137 ? 36.286 -4.505  1.618   1.00 27.02 ? 231  THR C O   1 
ATOM   4346 C  CB  . THR C 3 137 ? 33.657 -3.444  0.257   1.00 28.08 ? 231  THR C CB  1 
ATOM   4347 O  OG1 . THR C 3 137 ? 32.727 -3.461  -0.840  1.00 28.75 ? 231  THR C OG1 1 
ATOM   4348 C  CG2 . THR C 3 137 ? 33.505 -2.134  1.008   1.00 24.50 ? 231  THR C CG2 1 
ATOM   4349 N  N   . ILE C 3 138 ? 36.668 -2.354  1.065   1.00 27.98 ? 232  ILE C N   1 
ATOM   4350 C  CA  . ILE C 3 138 ? 37.601 -2.107  2.150   1.00 28.14 ? 232  ILE C CA  1 
ATOM   4351 C  C   . ILE C 3 138 ? 37.047 -0.931  2.933   1.00 31.55 ? 232  ILE C C   1 
ATOM   4352 O  O   . ILE C 3 138 ? 36.647 0.079   2.349   1.00 34.69 ? 232  ILE C O   1 
ATOM   4353 C  CB  . ILE C 3 138 ? 39.002 -1.755  1.612   1.00 27.11 ? 232  ILE C CB  1 
ATOM   4354 C  CG1 . ILE C 3 138 ? 39.580 -2.945  0.831   1.00 27.19 ? 232  ILE C CG1 1 
ATOM   4355 C  CG2 . ILE C 3 138 ? 39.916 -1.402  2.757   1.00 23.66 ? 232  ILE C CG2 1 
ATOM   4356 C  CD1 . ILE C 3 138 ? 40.949 -2.683  0.187   1.00 25.14 ? 232  ILE C CD1 1 
ATOM   4357 N  N   . HIS C 3 139 ? 37.003 -1.064  4.254   1.00 32.54 ? 233  HIS C N   1 
ATOM   4358 C  CA  . HIS C 3 139 ? 36.479 0.003   5.096   1.00 31.26 ? 233  HIS C CA  1 
ATOM   4359 C  C   . HIS C 3 139 ? 37.582 0.864   5.675   1.00 31.39 ? 233  HIS C C   1 
ATOM   4360 O  O   . HIS C 3 139 ? 38.396 0.384   6.464   1.00 33.72 ? 233  HIS C O   1 
ATOM   4361 C  CB  . HIS C 3 139 ? 35.648 -0.587  6.229   1.00 33.61 ? 233  HIS C CB  1 
ATOM   4362 C  CG  . HIS C 3 139 ? 34.337 -1.147  5.779   1.00 35.07 ? 233  HIS C CG  1 
ATOM   4363 N  ND1 . HIS C 3 139 ? 33.288 -1.369  6.644   1.00 36.35 ? 233  HIS C ND1 1 
ATOM   4364 C  CD2 . HIS C 3 139 ? 33.889 -1.493  4.548   1.00 37.80 ? 233  HIS C CD2 1 
ATOM   4365 C  CE1 . HIS C 3 139 ? 32.249 -1.822  5.963   1.00 39.60 ? 233  HIS C CE1 1 
ATOM   4366 N  NE2 . HIS C 3 139 ? 32.587 -1.906  4.688   1.00 36.05 ? 233  HIS C NE2 1 
ATOM   4367 N  N   . TYR C 3 140 ? 37.609 2.136   5.282   1.00 29.05 ? 234  TYR C N   1 
ATOM   4368 C  CA  . TYR C 3 140 ? 38.618 3.068   5.769   1.00 25.40 ? 234  TYR C CA  1 
ATOM   4369 C  C   . TYR C 3 140 ? 38.068 3.996   6.835   1.00 26.36 ? 234  TYR C C   1 
ATOM   4370 O  O   . TYR C 3 140 ? 36.861 4.160   6.962   1.00 27.08 ? 234  TYR C O   1 
ATOM   4371 C  CB  . TYR C 3 140 ? 39.152 3.918   4.623   1.00 21.77 ? 234  TYR C CB  1 
ATOM   4372 C  CG  . TYR C 3 140 ? 40.067 3.154   3.702   1.00 23.59 ? 234  TYR C CG  1 
ATOM   4373 C  CD1 . TYR C 3 140 ? 39.633 2.725   2.441   1.00 20.14 ? 234  TYR C CD1 1 
ATOM   4374 C  CD2 . TYR C 3 140 ? 41.351 2.809   4.114   1.00 21.05 ? 234  TYR C CD2 1 
ATOM   4375 C  CE1 . TYR C 3 140 ? 40.459 1.969   1.622   1.00 19.57 ? 234  TYR C CE1 1 
ATOM   4376 C  CE2 . TYR C 3 140 ? 42.179 2.052   3.308   1.00 20.82 ? 234  TYR C CE2 1 
ATOM   4377 C  CZ  . TYR C 3 140 ? 41.732 1.634   2.071   1.00 21.45 ? 234  TYR C CZ  1 
ATOM   4378 O  OH  . TYR C 3 140 ? 42.564 0.862   1.297   1.00 25.89 ? 234  TYR C OH  1 
ATOM   4379 N  N   . ASN C 3 141 ? 38.970 4.603   7.597   1.00 27.46 ? 235  ASN C N   1 
ATOM   4380 C  CA  . ASN C 3 141 ? 38.604 5.561   8.635   1.00 25.96 ? 235  ASN C CA  1 
ATOM   4381 C  C   . ASN C 3 141 ? 39.613 6.696   8.569   1.00 21.02 ? 235  ASN C C   1 
ATOM   4382 O  O   . ASN C 3 141 ? 40.810 6.450   8.486   1.00 19.55 ? 235  ASN C O   1 
ATOM   4383 C  CB  . ASN C 3 141 ? 38.684 4.913   10.022  1.00 31.83 ? 235  ASN C CB  1 
ATOM   4384 C  CG  . ASN C 3 141 ? 37.526 3.989   10.306  1.00 35.48 ? 235  ASN C CG  1 
ATOM   4385 O  OD1 . ASN C 3 141 ? 37.546 3.229   11.280  1.00 37.45 ? 235  ASN C OD1 1 
ATOM   4386 N  ND2 . ASN C 3 141 ? 36.499 4.050   9.464   1.00 39.23 ? 235  ASN C ND2 1 
ATOM   4387 N  N   . TYR C 3 142 ? 39.143 7.932   8.587   1.00 18.69 ? 236  TYR C N   1 
ATOM   4388 C  CA  . TYR C 3 142 ? 40.061 9.056   8.568   1.00 21.44 ? 236  TYR C CA  1 
ATOM   4389 C  C   . TYR C 3 142 ? 39.976 9.623   9.980   1.00 24.68 ? 236  TYR C C   1 
ATOM   4390 O  O   . TYR C 3 142 ? 38.903 10.033  10.425  1.00 24.11 ? 236  TYR C O   1 
ATOM   4391 C  CB  . TYR C 3 142 ? 39.631 10.043  7.499   1.00 22.23 ? 236  TYR C CB  1 
ATOM   4392 C  CG  . TYR C 3 142 ? 39.791 9.471   6.096   1.00 23.69 ? 236  TYR C CG  1 
ATOM   4393 C  CD1 . TYR C 3 142 ? 40.822 9.899   5.257   1.00 25.86 ? 236  TYR C CD1 1 
ATOM   4394 C  CD2 . TYR C 3 142 ? 38.927 8.489   5.619   1.00 19.43 ? 236  TYR C CD2 1 
ATOM   4395 C  CE1 . TYR C 3 142 ? 40.983 9.359   3.980   1.00 27.32 ? 236  TYR C CE1 1 
ATOM   4396 C  CE2 . TYR C 3 142 ? 39.080 7.947   4.349   1.00 23.17 ? 236  TYR C CE2 1 
ATOM   4397 C  CZ  . TYR C 3 142 ? 40.108 8.384   3.532   1.00 26.18 ? 236  TYR C CZ  1 
ATOM   4398 O  OH  . TYR C 3 142 ? 40.259 7.854   2.262   1.00 27.08 ? 236  TYR C OH  1 
ATOM   4399 N  N   . MET C 3 143 ? 41.110 9.615   10.684  1.00 26.09 ? 237  MET C N   1 
ATOM   4400 C  CA  . MET C 3 143 ? 41.173 10.032  12.085  1.00 29.25 ? 237  MET C CA  1 
ATOM   4401 C  C   . MET C 3 143 ? 41.434 11.482  12.447  1.00 30.52 ? 237  MET C C   1 
ATOM   4402 O  O   . MET C 3 143 ? 41.845 11.761  13.579  1.00 28.43 ? 237  MET C O   1 
ATOM   4403 C  CB  . MET C 3 143 ? 42.201 9.169   12.811  1.00 30.69 ? 237  MET C CB  1 
ATOM   4404 C  CG  . MET C 3 143 ? 41.966 7.686   12.608  1.00 33.36 ? 237  MET C CG  1 
ATOM   4405 S  SD  . MET C 3 143 ? 40.250 7.265   12.985  1.00 34.12 ? 237  MET C SD  1 
ATOM   4406 C  CE  . MET C 3 143 ? 40.272 7.528   14.789  1.00 32.79 ? 237  MET C CE  1 
ATOM   4407 N  N   . CYS C 3 144 ? 41.192 12.396  11.509  1.00 32.23 ? 238  CYS C N   1 
ATOM   4408 C  CA  . CYS C 3 144 ? 41.393 13.833  11.729  1.00 31.10 ? 238  CYS C CA  1 
ATOM   4409 C  C   . CYS C 3 144 ? 40.489 14.563  10.743  1.00 31.00 ? 238  CYS C C   1 
ATOM   4410 O  O   . CYS C 3 144 ? 40.273 14.076  9.634   1.00 30.30 ? 238  CYS C O   1 
ATOM   4411 C  CB  . CYS C 3 144 ? 42.855 14.232  11.437  1.00 34.27 ? 238  CYS C CB  1 
ATOM   4412 S  SG  . CYS C 3 144 ? 43.984 14.600  12.850  1.00 36.93 ? 238  CYS C SG  1 
ATOM   4413 N  N   . ASN C 3 145 ? 39.951 15.716  11.141  1.00 31.56 ? 239  ASN C N   1 
ATOM   4414 C  CA  . ASN C 3 145 ? 39.111 16.499  10.236  1.00 30.07 ? 239  ASN C CA  1 
ATOM   4415 C  C   . ASN C 3 145 ? 40.047 17.299  9.352   1.00 29.47 ? 239  ASN C C   1 
ATOM   4416 O  O   . ASN C 3 145 ? 41.157 17.619  9.760   1.00 29.43 ? 239  ASN C O   1 
ATOM   4417 C  CB  . ASN C 3 145 ? 38.204 17.448  11.012  1.00 30.48 ? 239  ASN C CB  1 
ATOM   4418 C  CG  . ASN C 3 145 ? 37.054 16.731  11.665  1.00 34.25 ? 239  ASN C CG  1 
ATOM   4419 O  OD1 . ASN C 3 145 ? 36.157 16.224  10.981  1.00 38.29 ? 239  ASN C OD1 1 
ATOM   4420 N  ND2 . ASN C 3 145 ? 37.070 16.669  12.995  1.00 30.16 ? 239  ASN C ND2 1 
ATOM   4421 N  N   . SER C 3 146 ? 39.605 17.624  8.144   1.00 30.55 ? 240  SER C N   1 
ATOM   4422 C  CA  . SER C 3 146 ? 40.433 18.380  7.220   1.00 30.68 ? 240  SER C CA  1 
ATOM   4423 C  C   . SER C 3 146 ? 40.879 19.720  7.799   1.00 30.02 ? 240  SER C C   1 
ATOM   4424 O  O   . SER C 3 146 ? 41.904 20.258  7.395   1.00 30.28 ? 240  SER C O   1 
ATOM   4425 C  CB  . SER C 3 146 ? 39.682 18.602  5.905   1.00 32.02 ? 240  SER C CB  1 
ATOM   4426 O  OG  . SER C 3 146 ? 39.408 17.369  5.257   1.00 33.33 ? 240  SER C OG  1 
ATOM   4427 N  N   . SER C 3 147 ? 40.126 20.247  8.759   1.00 30.28 ? 241  SER C N   1 
ATOM   4428 C  CA  . SER C 3 147 ? 40.454 21.546  9.363   1.00 32.96 ? 241  SER C CA  1 
ATOM   4429 C  C   . SER C 3 147 ? 41.312 21.484  10.626  1.00 33.92 ? 241  SER C C   1 
ATOM   4430 O  O   . SER C 3 147 ? 41.586 22.519  11.235  1.00 33.93 ? 241  SER C O   1 
ATOM   4431 C  CB  . SER C 3 147 ? 39.174 22.309  9.706   1.00 31.93 ? 241  SER C CB  1 
ATOM   4432 O  OG  . SER C 3 147 ? 38.468 21.648  10.747  1.00 36.43 ? 241  SER C OG  1 
ATOM   4433 N  N   . CYS C 3 148 ? 41.727 20.285  11.028  1.00 34.01 ? 242  CYS C N   1 
ATOM   4434 C  CA  . CYS C 3 148 ? 42.538 20.148  12.231  1.00 33.10 ? 242  CYS C CA  1 
ATOM   4435 C  C   . CYS C 3 148 ? 43.765 21.045  12.215  1.00 32.98 ? 242  CYS C C   1 
ATOM   4436 O  O   . CYS C 3 148 ? 44.656 20.898  11.378  1.00 32.25 ? 242  CYS C O   1 
ATOM   4437 C  CB  . CYS C 3 148 ? 42.971 18.688  12.444  1.00 33.12 ? 242  CYS C CB  1 
ATOM   4438 S  SG  . CYS C 3 148 ? 41.733 17.643  13.293  1.00 33.01 ? 242  CYS C SG  1 
ATOM   4439 N  N   . MET C 3 149 ? 43.793 21.979  13.160  1.00 34.92 ? 243  MET C N   1 
ATOM   4440 C  CA  . MET C 3 149 ? 44.901 22.912  13.307  1.00 33.17 ? 243  MET C CA  1 
ATOM   4441 C  C   . MET C 3 149 ? 46.094 22.082  13.744  1.00 32.76 ? 243  MET C C   1 
ATOM   4442 O  O   . MET C 3 149 ? 46.007 21.349  14.733  1.00 33.85 ? 243  MET C O   1 
ATOM   4443 C  CB  . MET C 3 149 ? 44.539 23.946  14.371  1.00 34.40 ? 243  MET C CB  1 
ATOM   4444 C  CG  . MET C 3 149 ? 45.562 25.052  14.553  1.00 38.56 ? 243  MET C CG  1 
ATOM   4445 S  SD  . MET C 3 149 ? 45.936 25.841  12.987  1.00 41.24 ? 243  MET C SD  1 
ATOM   4446 C  CE  . MET C 3 149 ? 44.472 26.881  12.734  1.00 35.70 ? 243  MET C CE  1 
ATOM   4447 N  N   . GLY C 3 150 ? 47.190 22.167  12.994  1.00 31.03 ? 244  GLY C N   1 
ATOM   4448 C  CA  . GLY C 3 150 ? 48.375 21.391  13.335  1.00 28.26 ? 244  GLY C CA  1 
ATOM   4449 C  C   . GLY C 3 150 ? 48.517 20.170  12.455  1.00 24.93 ? 244  GLY C C   1 
ATOM   4450 O  O   . GLY C 3 150 ? 49.613 19.619  12.321  1.00 20.93 ? 244  GLY C O   1 
ATOM   4451 N  N   . GLY C 3 151 ? 47.395 19.754  11.866  1.00 25.42 ? 245  GLY C N   1 
ATOM   4452 C  CA  . GLY C 3 151 ? 47.381 18.608  10.980  1.00 27.22 ? 245  GLY C CA  1 
ATOM   4453 C  C   . GLY C 3 151 ? 47.148 19.080  9.558   1.00 29.08 ? 245  GLY C C   1 
ATOM   4454 O  O   . GLY C 3 151 ? 47.810 20.005  9.085   1.00 29.37 ? 245  GLY C O   1 
ATOM   4455 N  N   . MET C 3 152 ? 46.203 18.462  8.864   1.00 31.37 ? 246  MET C N   1 
ATOM   4456 C  CA  . MET C 3 152 ? 45.928 18.865  7.497   1.00 32.54 ? 246  MET C CA  1 
ATOM   4457 C  C   . MET C 3 152 ? 45.730 20.375  7.424   1.00 33.86 ? 246  MET C C   1 
ATOM   4458 O  O   . MET C 3 152 ? 46.114 21.020  6.438   1.00 35.20 ? 246  MET C O   1 
ATOM   4459 C  CB  . MET C 3 152 ? 44.723 18.097  6.961   1.00 32.51 ? 246  MET C CB  1 
ATOM   4460 C  CG  . MET C 3 152 ? 45.102 16.662  6.629   1.00 32.76 ? 246  MET C CG  1 
ATOM   4461 S  SD  . MET C 3 152 ? 43.717 15.665  6.132   1.00 37.55 ? 246  MET C SD  1 
ATOM   4462 C  CE  . MET C 3 152 ? 42.946 15.376  7.769   1.00 33.97 ? 246  MET C CE  1 
ATOM   4463 N  N   . ASN C 3 153 ? 45.149 20.938  8.480   1.00 34.19 ? 247  ASN C N   1 
ATOM   4464 C  CA  . ASN C 3 153 ? 44.945 22.381  8.579   1.00 31.40 ? 247  ASN C CA  1 
ATOM   4465 C  C   . ASN C 3 153 ? 44.257 22.999  7.370   1.00 32.62 ? 247  ASN C C   1 
ATOM   4466 O  O   . ASN C 3 153 ? 44.780 23.937  6.772   1.00 35.77 ? 247  ASN C O   1 
ATOM   4467 C  CB  . ASN C 3 153 ? 46.300 23.067  8.773   1.00 30.94 ? 247  ASN C CB  1 
ATOM   4468 C  CG  . ASN C 3 153 ? 46.167 24.518  9.167   1.00 31.80 ? 247  ASN C CG  1 
ATOM   4469 O  OD1 . ASN C 3 153 ? 47.108 25.304  9.015   1.00 32.83 ? 247  ASN C OD1 1 
ATOM   4470 N  ND2 . ASN C 3 153 ? 45.000 24.884  9.696   1.00 32.96 ? 247  ASN C ND2 1 
ATOM   4471 N  N   . ARG C 3 154 ? 43.093 22.475  7.007   1.00 30.98 ? 248  ARG C N   1 
ATOM   4472 C  CA  . ARG C 3 154 ? 42.335 22.995  5.874   1.00 28.55 ? 248  ARG C CA  1 
ATOM   4473 C  C   . ARG C 3 154 ? 42.883 22.613  4.491   1.00 28.10 ? 248  ARG C C   1 
ATOM   4474 O  O   . ARG C 3 154 ? 42.284 22.964  3.463   1.00 27.11 ? 248  ARG C O   1 
ATOM   4475 C  CB  . ARG C 3 154 ? 42.222 24.523  5.972   1.00 28.28 ? 248  ARG C CB  1 
ATOM   4476 C  CG  . ARG C 3 154 ? 41.450 25.031  7.189   1.00 28.55 ? 248  ARG C CG  1 
ATOM   4477 C  CD  . ARG C 3 154 ? 41.264 26.544  7.118   1.00 29.25 ? 248  ARG C CD  1 
ATOM   4478 N  NE  . ARG C 3 154 ? 42.556 27.211  7.003   1.00 35.01 ? 248  ARG C NE  1 
ATOM   4479 C  CZ  . ARG C 3 154 ? 43.432 27.319  7.999   1.00 36.25 ? 248  ARG C CZ  1 
ATOM   4480 N  NH1 . ARG C 3 154 ? 44.593 27.927  7.801   1.00 37.28 ? 248  ARG C NH1 1 
ATOM   4481 N  NH2 . ARG C 3 154 ? 43.136 26.847  9.202   1.00 38.93 ? 248  ARG C NH2 1 
ATOM   4482 N  N   . ARG C 3 155 ? 44.011 21.907  4.446   1.00 26.30 ? 249  ARG C N   1 
ATOM   4483 C  CA  . ARG C 3 155 ? 44.567 21.502  3.155   1.00 24.81 ? 249  ARG C CA  1 
ATOM   4484 C  C   . ARG C 3 155 ? 43.899 20.246  2.643   1.00 26.90 ? 249  ARG C C   1 
ATOM   4485 O  O   . ARG C 3 155 ? 43.934 19.203  3.301   1.00 29.21 ? 249  ARG C O   1 
ATOM   4486 C  CB  . ARG C 3 155 ? 46.065 21.242  3.263   1.00 23.06 ? 249  ARG C CB  1 
ATOM   4487 C  CG  . ARG C 3 155 ? 46.870 22.470  3.589   1.00 23.14 ? 249  ARG C CG  1 
ATOM   4488 C  CD  . ARG C 3 155 ? 48.313 22.124  3.895   1.00 23.86 ? 249  ARG C CD  1 
ATOM   4489 N  NE  . ARG C 3 155 ? 48.507 21.542  5.222   1.00 21.72 ? 249  ARG C NE  1 
ATOM   4490 C  CZ  . ARG C 3 155 ? 49.706 21.380  5.782   1.00 26.13 ? 249  ARG C CZ  1 
ATOM   4491 N  NH1 . ARG C 3 155 ? 50.813 21.757  5.136   1.00 20.26 ? 249  ARG C NH1 1 
ATOM   4492 N  NH2 . ARG C 3 155 ? 49.805 20.838  6.992   1.00 30.10 ? 249  ARG C NH2 1 
ATOM   4493 N  N   . PRO C 3 156 ? 43.279 20.318  1.455   1.00 28.86 ? 250  PRO C N   1 
ATOM   4494 C  CA  . PRO C 3 156 ? 42.618 19.126  0.905   1.00 28.08 ? 250  PRO C CA  1 
ATOM   4495 C  C   . PRO C 3 156 ? 43.644 18.025  0.632   1.00 28.41 ? 250  PRO C C   1 
ATOM   4496 O  O   . PRO C 3 156 ? 44.808 18.312  0.332   1.00 26.77 ? 250  PRO C O   1 
ATOM   4497 C  CB  . PRO C 3 156 ? 41.972 19.653  -0.371  1.00 27.52 ? 250  PRO C CB  1 
ATOM   4498 C  CG  . PRO C 3 156 ? 42.943 20.712  -0.819  1.00 28.69 ? 250  PRO C CG  1 
ATOM   4499 C  CD  . PRO C 3 156 ? 43.260 21.431  0.487   1.00 28.05 ? 250  PRO C CD  1 
ATOM   4500 N  N   . ILE C 3 157 ? 43.228 16.767  0.767   1.00 31.31 ? 251  ILE C N   1 
ATOM   4501 C  CA  . ILE C 3 157 ? 44.140 15.654  0.502   1.00 31.55 ? 251  ILE C CA  1 
ATOM   4502 C  C   . ILE C 3 157 ? 43.582 14.725  -0.562  1.00 31.03 ? 251  ILE C C   1 
ATOM   4503 O  O   . ILE C 3 157 ? 42.430 14.852  -0.994  1.00 30.23 ? 251  ILE C O   1 
ATOM   4504 C  CB  . ILE C 3 157 ? 44.424 14.797  1.764   1.00 30.98 ? 251  ILE C CB  1 
ATOM   4505 C  CG1 . ILE C 3 157 ? 43.107 14.440  2.461   1.00 30.61 ? 251  ILE C CG1 1 
ATOM   4506 C  CG2 . ILE C 3 157 ? 45.390 15.521  2.686   1.00 30.93 ? 251  ILE C CG2 1 
ATOM   4507 C  CD1 . ILE C 3 157 ? 43.267 13.449  3.611   1.00 29.84 ? 251  ILE C CD1 1 
ATOM   4508 N  N   . LEU C 3 158 ? 44.428 13.794  -0.980  1.00 31.99 ? 252  LEU C N   1 
ATOM   4509 C  CA  . LEU C 3 158 ? 44.062 12.793  -1.960  1.00 32.41 ? 252  LEU C CA  1 
ATOM   4510 C  C   . LEU C 3 158 ? 44.424 11.452  -1.338  1.00 32.46 ? 252  LEU C C   1 
ATOM   4511 O  O   . LEU C 3 158 ? 45.474 11.316  -0.703  1.00 35.17 ? 252  LEU C O   1 
ATOM   4512 C  CB  . LEU C 3 158 ? 44.845 13.010  -3.263  1.00 33.03 ? 252  LEU C CB  1 
ATOM   4513 C  CG  . LEU C 3 158 ? 44.015 13.576  -4.422  1.00 34.20 ? 252  LEU C CG  1 
ATOM   4514 C  CD1 . LEU C 3 158 ? 43.171 14.718  -3.914  1.00 36.69 ? 252  LEU C CD1 1 
ATOM   4515 C  CD2 . LEU C 3 158 ? 44.908 14.044  -5.558  1.00 33.21 ? 252  LEU C CD2 1 
ATOM   4516 N  N   . THR C 3 159 ? 43.533 10.478  -1.456  1.00 30.82 ? 253  THR C N   1 
ATOM   4517 C  CA  . THR C 3 159 ? 43.841 9.157   -0.948  1.00 28.20 ? 253  THR C CA  1 
ATOM   4518 C  C   . THR C 3 159 ? 44.258 8.411   -2.208  1.00 28.00 ? 253  THR C C   1 
ATOM   4519 O  O   . THR C 3 159 ? 43.517 8.367   -3.197  1.00 26.25 ? 253  THR C O   1 
ATOM   4520 C  CB  . THR C 3 159 ? 42.616 8.464   -0.302  1.00 29.63 ? 253  THR C CB  1 
ATOM   4521 O  OG1 . THR C 3 159 ? 42.195 9.206   0.853   1.00 31.83 ? 253  THR C OG1 1 
ATOM   4522 C  CG2 . THR C 3 159 ? 42.978 7.054   0.143   1.00 27.32 ? 253  THR C CG2 1 
ATOM   4523 N  N   . ILE C 3 160 ? 45.466 7.866   -2.185  1.00 28.59 ? 254  ILE C N   1 
ATOM   4524 C  CA  . ILE C 3 160 ? 45.989 7.116   -3.314  1.00 27.81 ? 254  ILE C CA  1 
ATOM   4525 C  C   . ILE C 3 160 ? 45.925 5.629   -2.998  1.00 26.92 ? 254  ILE C C   1 
ATOM   4526 O  O   . ILE C 3 160 ? 46.594 5.171   -2.075  1.00 28.59 ? 254  ILE C O   1 
ATOM   4527 C  CB  . ILE C 3 160 ? 47.435 7.514   -3.557  1.00 28.05 ? 254  ILE C CB  1 
ATOM   4528 C  CG1 . ILE C 3 160 ? 47.479 9.000   -3.905  1.00 25.75 ? 254  ILE C CG1 1 
ATOM   4529 C  CG2 . ILE C 3 160 ? 48.056 6.640   -4.641  1.00 21.79 ? 254  ILE C CG2 1 
ATOM   4530 C  CD1 . ILE C 3 160 ? 48.872 9.573   -3.864  1.00 29.64 ? 254  ILE C CD1 1 
ATOM   4531 N  N   . ILE C 3 161 ? 45.111 4.887   -3.745  1.00 26.21 ? 255  ILE C N   1 
ATOM   4532 C  CA  . ILE C 3 161 ? 44.983 3.442   -3.547  1.00 26.98 ? 255  ILE C CA  1 
ATOM   4533 C  C   . ILE C 3 161 ? 45.860 2.725   -4.577  1.00 27.96 ? 255  ILE C C   1 
ATOM   4534 O  O   . ILE C 3 161 ? 45.728 2.958   -5.784  1.00 30.33 ? 255  ILE C O   1 
ATOM   4535 C  CB  . ILE C 3 161 ? 43.525 2.959   -3.744  1.00 24.68 ? 255  ILE C CB  1 
ATOM   4536 C  CG1 . ILE C 3 161 ? 42.581 3.714   -2.811  1.00 22.28 ? 255  ILE C CG1 1 
ATOM   4537 C  CG2 . ILE C 3 161 ? 43.434 1.463   -3.437  1.00 29.21 ? 255  ILE C CG2 1 
ATOM   4538 C  CD1 . ILE C 3 161 ? 42.846 3.463   -1.348  1.00 21.69 ? 255  ILE C CD1 1 
ATOM   4539 N  N   . THR C 3 162 ? 46.752 1.860   -4.109  1.00 27.88 ? 256  THR C N   1 
ATOM   4540 C  CA  . THR C 3 162 ? 47.627 1.135   -5.018  1.00 31.29 ? 256  THR C CA  1 
ATOM   4541 C  C   . THR C 3 162 ? 47.518 -0.365  -4.836  1.00 31.33 ? 256  THR C C   1 
ATOM   4542 O  O   . THR C 3 162 ? 47.408 -0.850  -3.720  1.00 32.60 ? 256  THR C O   1 
ATOM   4543 C  CB  . THR C 3 162 ? 49.122 1.523   -4.832  1.00 32.43 ? 256  THR C CB  1 
ATOM   4544 O  OG1 . THR C 3 162 ? 49.518 1.279   -3.475  1.00 36.44 ? 256  THR C OG1 1 
ATOM   4545 C  CG2 . THR C 3 162 ? 49.349 2.985   -5.191  1.00 29.25 ? 256  THR C CG2 1 
ATOM   4546 N  N   . LEU C 3 163 ? 47.554 -1.086  -5.950  1.00 32.90 ? 257  LEU C N   1 
ATOM   4547 C  CA  . LEU C 3 163 ? 47.485 -2.536  -5.957  1.00 33.20 ? 257  LEU C CA  1 
ATOM   4548 C  C   . LEU C 3 163 ? 48.923 -2.985  -6.232  1.00 36.06 ? 257  LEU C C   1 
ATOM   4549 O  O   . LEU C 3 163 ? 49.487 -2.655  -7.281  1.00 35.73 ? 257  LEU C O   1 
ATOM   4550 C  CB  . LEU C 3 163 ? 46.567 -2.982  -7.085  1.00 33.00 ? 257  LEU C CB  1 
ATOM   4551 C  CG  . LEU C 3 163 ? 45.650 -4.167  -6.819  1.00 36.17 ? 257  LEU C CG  1 
ATOM   4552 C  CD1 . LEU C 3 163 ? 44.816 -3.910  -5.573  1.00 35.33 ? 257  LEU C CD1 1 
ATOM   4553 C  CD2 . LEU C 3 163 ? 44.767 -4.383  -8.042  1.00 35.58 ? 257  LEU C CD2 1 
ATOM   4554 N  N   . GLU C 3 164 ? 49.526 -3.708  -5.290  1.00 37.71 ? 258  GLU C N   1 
ATOM   4555 C  CA  . GLU C 3 164 ? 50.906 -4.157  -5.464  1.00 39.23 ? 258  GLU C CA  1 
ATOM   4556 C  C   . GLU C 3 164 ? 51.081 -5.647  -5.212  1.00 39.99 ? 258  GLU C C   1 
ATOM   4557 O  O   . GLU C 3 164 ? 50.230 -6.281  -4.581  1.00 40.54 ? 258  GLU C O   1 
ATOM   4558 C  CB  . GLU C 3 164 ? 51.830 -3.362  -4.544  1.00 39.33 ? 258  GLU C CB  1 
ATOM   4559 C  CG  . GLU C 3 164 ? 51.583 -3.576  -3.059  1.00 42.57 ? 258  GLU C CG  1 
ATOM   4560 C  CD  . GLU C 3 164 ? 52.175 -2.460  -2.200  1.00 44.35 ? 258  GLU C CD  1 
ATOM   4561 O  OE1 . GLU C 3 164 ? 52.433 -2.715  -1.002  1.00 46.29 ? 258  GLU C OE1 1 
ATOM   4562 O  OE2 . GLU C 3 164 ? 52.367 -1.328  -2.713  1.00 41.39 ? 258  GLU C OE2 1 
ATOM   4563 N  N   . ASP C 3 165 ? 52.180 -6.207  -5.718  1.00 39.34 ? 259  ASP C N   1 
ATOM   4564 C  CA  . ASP C 3 165 ? 52.450 -7.632  -5.532  1.00 40.14 ? 259  ASP C CA  1 
ATOM   4565 C  C   . ASP C 3 165 ? 53.031 -7.926  -4.158  1.00 39.75 ? 259  ASP C C   1 
ATOM   4566 O  O   . ASP C 3 165 ? 53.268 -7.021  -3.356  1.00 38.33 ? 259  ASP C O   1 
ATOM   4567 C  CB  . ASP C 3 165 ? 53.416 -8.172  -6.598  1.00 40.09 ? 259  ASP C CB  1 
ATOM   4568 C  CG  . ASP C 3 165 ? 54.779 -7.493  -6.566  1.00 42.09 ? 259  ASP C CG  1 
ATOM   4569 O  OD1 . ASP C 3 165 ? 55.381 -7.354  -5.476  1.00 38.73 ? 259  ASP C OD1 1 
ATOM   4570 O  OD2 . ASP C 3 165 ? 55.253 -7.105  -7.652  1.00 44.82 ? 259  ASP C OD2 1 
ATOM   4571 N  N   . SER C 3 166 ? 53.261 -9.208  -3.904  1.00 42.33 ? 260  SER C N   1 
ATOM   4572 C  CA  . SER C 3 166 ? 53.822 -9.666  -2.635  1.00 44.89 ? 260  SER C CA  1 
ATOM   4573 C  C   . SER C 3 166 ? 55.077 -8.889  -2.236  1.00 44.81 ? 260  SER C C   1 
ATOM   4574 O  O   . SER C 3 166 ? 55.370 -8.747  -1.052  1.00 42.06 ? 260  SER C O   1 
ATOM   4575 C  CB  . SER C 3 166 ? 54.184 -11.154 -2.727  1.00 46.11 ? 260  SER C CB  1 
ATOM   4576 O  OG  . SER C 3 166 ? 55.245 -11.351 -3.655  1.00 45.23 ? 260  SER C OG  1 
ATOM   4577 N  N   . SER C 3 167 ? 55.814 -8.396  -3.228  1.00 46.88 ? 261  SER C N   1 
ATOM   4578 C  CA  . SER C 3 167 ? 57.050 -7.669  -2.962  1.00 47.99 ? 261  SER C CA  1 
ATOM   4579 C  C   . SER C 3 167 ? 56.937 -6.145  -2.980  1.00 47.54 ? 261  SER C C   1 
ATOM   4580 O  O   . SER C 3 167 ? 57.897 -5.453  -2.631  1.00 46.31 ? 261  SER C O   1 
ATOM   4581 C  CB  . SER C 3 167 ? 58.146 -8.122  -3.935  1.00 51.15 ? 261  SER C CB  1 
ATOM   4582 O  OG  . SER C 3 167 ? 58.461 -9.496  -3.746  1.00 54.14 ? 261  SER C OG  1 
ATOM   4583 N  N   . GLY C 3 168 ? 55.782 -5.620  -3.385  1.00 45.72 ? 262  GLY C N   1 
ATOM   4584 C  CA  . GLY C 3 168 ? 55.603 -4.177  -3.387  1.00 43.55 ? 262  GLY C CA  1 
ATOM   4585 C  C   . GLY C 3 168 ? 55.694 -3.470  -4.723  1.00 45.47 ? 262  GLY C C   1 
ATOM   4586 O  O   . GLY C 3 168 ? 55.771 -2.238  -4.775  1.00 45.34 ? 262  GLY C O   1 
ATOM   4587 N  N   . ASN C 3 169 ? 55.679 -4.228  -5.814  1.00 46.87 ? 263  ASN C N   1 
ATOM   4588 C  CA  . ASN C 3 169 ? 55.755 -3.618  -7.136  1.00 46.94 ? 263  ASN C CA  1 
ATOM   4589 C  C   . ASN C 3 169 ? 54.358 -3.178  -7.576  1.00 45.56 ? 263  ASN C C   1 
ATOM   4590 O  O   . ASN C 3 169 ? 53.358 -3.823  -7.247  1.00 45.55 ? 263  ASN C O   1 
ATOM   4591 C  CB  . ASN C 3 169 ? 56.358 -4.610  -8.138  1.00 51.02 ? 263  ASN C CB  1 
ATOM   4592 C  CG  . ASN C 3 169 ? 57.725 -5.134  -7.690  1.00 54.43 ? 263  ASN C CG  1 
ATOM   4593 O  OD1 . ASN C 3 169 ? 58.697 -4.376  -7.610  1.00 55.19 ? 263  ASN C OD1 1 
ATOM   4594 N  ND2 . ASN C 3 169 ? 57.798 -6.429  -7.386  1.00 53.67 ? 263  ASN C ND2 1 
ATOM   4595 N  N   . LEU C 3 170 ? 54.300 -2.076  -8.313  1.00 42.92 ? 264  LEU C N   1 
ATOM   4596 C  CA  . LEU C 3 170 ? 53.040 -1.525  -8.792  1.00 41.28 ? 264  LEU C CA  1 
ATOM   4597 C  C   . LEU C 3 170 ? 52.310 -2.422  -9.796  1.00 40.74 ? 264  LEU C C   1 
ATOM   4598 O  O   . LEU C 3 170 ? 52.882 -2.862  -10.799 1.00 38.75 ? 264  LEU C O   1 
ATOM   4599 C  CB  . LEU C 3 170 ? 53.285 -0.152  -9.425  1.00 41.36 ? 264  LEU C CB  1 
ATOM   4600 C  CG  . LEU C 3 170 ? 52.049 0.677   -9.775  1.00 42.33 ? 264  LEU C CG  1 
ATOM   4601 C  CD1 . LEU C 3 170 ? 51.421 1.178   -8.485  1.00 43.73 ? 264  LEU C CD1 1 
ATOM   4602 C  CD2 . LEU C 3 170 ? 52.430 1.852   -10.662 1.00 42.81 ? 264  LEU C CD2 1 
ATOM   4603 N  N   . LEU C 3 171 ? 51.033 -2.673  -9.510  1.00 40.10 ? 265  LEU C N   1 
ATOM   4604 C  CA  . LEU C 3 171 ? 50.168 -3.484  -10.359 1.00 35.98 ? 265  LEU C CA  1 
ATOM   4605 C  C   . LEU C 3 171 ? 49.006 -2.604  -10.798 1.00 34.01 ? 265  LEU C C   1 
ATOM   4606 O  O   . LEU C 3 171 ? 48.449 -2.786  -11.881 1.00 33.54 ? 265  LEU C O   1 
ATOM   4607 C  CB  . LEU C 3 171 ? 49.644 -4.683  -9.579  1.00 35.02 ? 265  LEU C CB  1 
ATOM   4608 C  CG  . LEU C 3 171 ? 50.720 -5.644  -9.065  1.00 35.08 ? 265  LEU C CG  1 
ATOM   4609 C  CD1 . LEU C 3 171 ? 50.109 -6.637  -8.084  1.00 33.42 ? 265  LEU C CD1 1 
ATOM   4610 C  CD2 . LEU C 3 171 ? 51.365 -6.361  -10.240 1.00 33.69 ? 265  LEU C CD2 1 
ATOM   4611 N  N   . GLY C 3 172 ? 48.656 -1.641  -9.947  1.00 32.80 ? 266  GLY C N   1 
ATOM   4612 C  CA  . GLY C 3 172 ? 47.564 -0.726  -10.250 1.00 32.22 ? 266  GLY C CA  1 
ATOM   4613 C  C   . GLY C 3 172 ? 47.508 0.454   -9.297  1.00 30.18 ? 266  GLY C C   1 
ATOM   4614 O  O   . GLY C 3 172 ? 48.021 0.372   -8.181  1.00 30.32 ? 266  GLY C O   1 
ATOM   4615 N  N   . ARG C 3 173 ? 46.888 1.550   -9.729  1.00 30.76 ? 267  ARG C N   1 
ATOM   4616 C  CA  . ARG C 3 173 ? 46.773 2.752   -8.897  1.00 30.22 ? 267  ARG C CA  1 
ATOM   4617 C  C   . ARG C 3 173 ? 45.563 3.622   -9.249  1.00 30.58 ? 267  ARG C C   1 
ATOM   4618 O  O   . ARG C 3 173 ? 45.196 3.766   -10.419 1.00 30.57 ? 267  ARG C O   1 
ATOM   4619 C  CB  . ARG C 3 173 ? 48.051 3.583   -9.017  1.00 29.94 ? 267  ARG C CB  1 
ATOM   4620 C  CG  . ARG C 3 173 ? 48.027 4.942   -8.321  1.00 29.66 ? 267  ARG C CG  1 
ATOM   4621 C  CD  . ARG C 3 173 ? 49.451 5.528   -8.245  1.00 33.73 ? 267  ARG C CD  1 
ATOM   4622 N  NE  . ARG C 3 173 ? 50.166 5.429   -9.522  1.00 36.16 ? 267  ARG C NE  1 
ATOM   4623 C  CZ  . ARG C 3 173 ? 51.486 5.292   -9.630  1.00 38.01 ? 267  ARG C CZ  1 
ATOM   4624 N  NH1 . ARG C 3 173 ? 52.243 5.240   -8.544  1.00 41.03 ? 267  ARG C NH1 1 
ATOM   4625 N  NH2 . ARG C 3 173 ? 52.051 5.183   -10.823 1.00 38.81 ? 267  ARG C NH2 1 
ATOM   4626 N  N   . ASN C 3 174 ? 44.936 4.197   -8.228  1.00 28.79 ? 268  ASN C N   1 
ATOM   4627 C  CA  . ASN C 3 174 ? 43.787 5.075   -8.435  1.00 26.13 ? 268  ASN C CA  1 
ATOM   4628 C  C   . ASN C 3 174 ? 43.718 6.009   -7.252  1.00 25.72 ? 268  ASN C C   1 
ATOM   4629 O  O   . ASN C 3 174 ? 44.418 5.799   -6.260  1.00 27.21 ? 268  ASN C O   1 
ATOM   4630 C  CB  . ASN C 3 174 ? 42.487 4.271   -8.547  1.00 25.61 ? 268  ASN C CB  1 
ATOM   4631 C  CG  . ASN C 3 174 ? 42.316 3.626   -9.914  1.00 26.13 ? 268  ASN C CG  1 
ATOM   4632 O  OD1 . ASN C 3 174 ? 42.070 4.314   -10.909 1.00 24.93 ? 268  ASN C OD1 1 
ATOM   4633 N  ND2 . ASN C 3 174 ? 42.456 2.301   -9.973  1.00 22.18 ? 268  ASN C ND2 1 
ATOM   4634 N  N   . SER C 3 175 ? 42.888 7.043   -7.349  1.00 24.00 ? 269  SER C N   1 
ATOM   4635 C  CA  . SER C 3 175 ? 42.768 7.977   -6.254  1.00 22.70 ? 269  SER C CA  1 
ATOM   4636 C  C   . SER C 3 175 ? 41.482 8.789   -6.263  1.00 24.64 ? 269  SER C C   1 
ATOM   4637 O  O   . SER C 3 175 ? 40.761 8.850   -7.259  1.00 24.41 ? 269  SER C O   1 
ATOM   4638 C  CB  . SER C 3 175 ? 43.958 8.924   -6.253  1.00 22.93 ? 269  SER C CB  1 
ATOM   4639 O  OG  . SER C 3 175 ? 43.868 9.838   -7.324  1.00 23.40 ? 269  SER C OG  1 
ATOM   4640 N  N   . PHE C 3 176 ? 41.204 9.409   -5.123  1.00 24.73 ? 270  PHE C N   1 
ATOM   4641 C  CA  . PHE C 3 176 ? 40.031 10.235  -4.953  1.00 21.77 ? 270  PHE C CA  1 
ATOM   4642 C  C   . PHE C 3 176 ? 40.373 11.290  -3.911  1.00 25.37 ? 270  PHE C C   1 
ATOM   4643 O  O   . PHE C 3 176 ? 41.223 11.065  -3.050  1.00 25.79 ? 270  PHE C O   1 
ATOM   4644 C  CB  . PHE C 3 176 ? 38.840 9.393   -4.495  1.00 18.07 ? 270  PHE C CB  1 
ATOM   4645 C  CG  . PHE C 3 176 ? 39.090 8.594   -3.250  1.00 19.68 ? 270  PHE C CG  1 
ATOM   4646 C  CD1 . PHE C 3 176 ? 39.735 7.365   -3.313  1.00 19.84 ? 270  PHE C CD1 1 
ATOM   4647 C  CD2 . PHE C 3 176 ? 38.650 9.061   -2.000  1.00 23.29 ? 270  PHE C CD2 1 
ATOM   4648 C  CE1 . PHE C 3 176 ? 39.938 6.604   -2.148  1.00 22.42 ? 270  PHE C CE1 1 
ATOM   4649 C  CE2 . PHE C 3 176 ? 38.848 8.310   -0.825  1.00 21.31 ? 270  PHE C CE2 1 
ATOM   4650 C  CZ  . PHE C 3 176 ? 39.492 7.080   -0.898  1.00 20.99 ? 270  PHE C CZ  1 
ATOM   4651 N  N   . GLU C 3 177 ? 39.730 12.450  -4.000  1.00 28.97 ? 271  GLU C N   1 
ATOM   4652 C  CA  . GLU C 3 177 ? 39.977 13.535  -3.054  1.00 29.38 ? 271  GLU C CA  1 
ATOM   4653 C  C   . GLU C 3 177 ? 39.124 13.276  -1.835  1.00 29.62 ? 271  GLU C C   1 
ATOM   4654 O  O   . GLU C 3 177 ? 38.049 12.671  -1.937  1.00 28.14 ? 271  GLU C O   1 
ATOM   4655 C  CB  . GLU C 3 177 ? 39.617 14.892  -3.686  1.00 32.62 ? 271  GLU C CB  1 
ATOM   4656 C  CG  . GLU C 3 177 ? 39.505 16.056  -2.710  1.00 37.59 ? 271  GLU C CG  1 
ATOM   4657 C  CD  . GLU C 3 177 ? 39.249 17.393  -3.409  1.00 42.56 ? 271  GLU C CD  1 
ATOM   4658 O  OE1 . GLU C 3 177 ? 38.871 18.368  -2.713  1.00 42.21 ? 271  GLU C OE1 1 
ATOM   4659 O  OE2 . GLU C 3 177 ? 39.434 17.473  -4.648  1.00 44.63 ? 271  GLU C OE2 1 
ATOM   4660 N  N   . VAL C 3 178 ? 39.593 13.732  -0.678  1.00 29.81 ? 272  VAL C N   1 
ATOM   4661 C  CA  . VAL C 3 178 ? 38.847 13.510  0.548   1.00 27.21 ? 272  VAL C CA  1 
ATOM   4662 C  C   . VAL C 3 178 ? 38.692 14.769  1.388   1.00 27.95 ? 272  VAL C C   1 
ATOM   4663 O  O   . VAL C 3 178 ? 39.588 15.607  1.452   1.00 29.85 ? 272  VAL C O   1 
ATOM   4664 C  CB  . VAL C 3 178 ? 39.543 12.428  1.413   1.00 25.97 ? 272  VAL C CB  1 
ATOM   4665 C  CG1 . VAL C 3 178 ? 38.760 12.167  2.689   1.00 23.29 ? 272  VAL C CG1 1 
ATOM   4666 C  CG2 . VAL C 3 178 ? 39.688 11.157  0.622   1.00 27.30 ? 272  VAL C CG2 1 
ATOM   4667 N  N   . ARG C 3 179 ? 37.535 14.897  2.023   1.00 28.07 ? 273  ARG C N   1 
ATOM   4668 C  CA  . ARG C 3 179 ? 37.277 16.004  2.923   1.00 28.64 ? 273  ARG C CA  1 
ATOM   4669 C  C   . ARG C 3 179 ? 36.697 15.385  4.189   1.00 30.91 ? 273  ARG C C   1 
ATOM   4670 O  O   . ARG C 3 179 ? 35.599 14.822  4.157   1.00 32.31 ? 273  ARG C O   1 
ATOM   4671 C  CB  . ARG C 3 179 ? 36.268 16.975  2.328   1.00 25.90 ? 273  ARG C CB  1 
ATOM   4672 C  CG  . ARG C 3 179 ? 35.961 18.141  3.248   1.00 29.08 ? 273  ARG C CG  1 
ATOM   4673 C  CD  . ARG C 3 179 ? 35.100 19.188  2.551   1.00 34.60 ? 273  ARG C CD  1 
ATOM   4674 N  NE  . ARG C 3 179 ? 34.687 20.241  3.476   1.00 39.49 ? 273  ARG C NE  1 
ATOM   4675 C  CZ  . ARG C 3 179 ? 35.512 21.118  4.041   1.00 39.31 ? 273  ARG C CZ  1 
ATOM   4676 N  NH1 . ARG C 3 179 ? 36.812 21.083  3.771   1.00 39.83 ? 273  ARG C NH1 1 
ATOM   4677 N  NH2 . ARG C 3 179 ? 35.038 22.011  4.902   1.00 38.37 ? 273  ARG C NH2 1 
ATOM   4678 N  N   . VAL C 3 180 ? 37.440 15.444  5.289   1.00 30.30 ? 274  VAL C N   1 
ATOM   4679 C  CA  . VAL C 3 180 ? 36.945 14.906  6.545   1.00 29.85 ? 274  VAL C CA  1 
ATOM   4680 C  C   . VAL C 3 180 ? 36.329 16.091  7.275   1.00 31.28 ? 274  VAL C C   1 
ATOM   4681 O  O   . VAL C 3 180 ? 37.014 17.064  7.584   1.00 31.05 ? 274  VAL C O   1 
ATOM   4682 C  CB  . VAL C 3 180 ? 38.075 14.315  7.378   1.00 29.27 ? 274  VAL C CB  1 
ATOM   4683 C  CG1 . VAL C 3 180 ? 37.516 13.636  8.615   1.00 29.47 ? 274  VAL C CG1 1 
ATOM   4684 C  CG2 . VAL C 3 180 ? 38.844 13.323  6.540   1.00 30.63 ? 274  VAL C CG2 1 
ATOM   4685 N  N   . CYS C 3 181 ? 35.028 16.029  7.535   1.00 33.50 ? 275  CYS C N   1 
ATOM   4686 C  CA  . CYS C 3 181 ? 34.377 17.144  8.203   1.00 34.93 ? 275  CYS C CA  1 
ATOM   4687 C  C   . CYS C 3 181 ? 33.171 16.760  9.032   1.00 35.06 ? 275  CYS C C   1 
ATOM   4688 O  O   . CYS C 3 181 ? 32.809 15.593  9.123   1.00 36.04 ? 275  CYS C O   1 
ATOM   4689 C  CB  . CYS C 3 181 ? 33.988 18.211  7.178   1.00 34.00 ? 275  CYS C CB  1 
ATOM   4690 S  SG  . CYS C 3 181 ? 33.143 17.582  5.706   1.00 37.23 ? 275  CYS C SG  1 
ATOM   4691 N  N   . ALA C 3 182 ? 32.560 17.763  9.647   1.00 36.70 ? 276  ALA C N   1 
ATOM   4692 C  CA  . ALA C 3 182 ? 31.394 17.563  10.499  1.00 37.32 ? 276  ALA C CA  1 
ATOM   4693 C  C   . ALA C 3 182 ? 30.151 17.180  9.690   1.00 37.64 ? 276  ALA C C   1 
ATOM   4694 O  O   . ALA C 3 182 ? 29.441 16.228  10.038  1.00 36.38 ? 276  ALA C O   1 
ATOM   4695 C  CB  . ALA C 3 182 ? 31.129 18.837  11.310  1.00 32.85 ? 276  ALA C CB  1 
ATOM   4696 N  N   . CYS C 3 183 ? 29.897 17.912  8.606   1.00 37.44 ? 277  CYS C N   1 
ATOM   4697 C  CA  . CYS C 3 183 ? 28.726 17.655  7.772   1.00 39.94 ? 277  CYS C CA  1 
ATOM   4698 C  C   . CYS C 3 183 ? 29.055 17.252  6.340   1.00 38.66 ? 277  CYS C C   1 
ATOM   4699 O  O   . CYS C 3 183 ? 28.997 18.077  5.426   1.00 39.06 ? 277  CYS C O   1 
ATOM   4700 C  CB  . CYS C 3 183 ? 27.825 18.890  7.740   1.00 40.90 ? 277  CYS C CB  1 
ATOM   4701 S  SG  . CYS C 3 183 ? 27.129 19.309  9.338   1.00 51.81 ? 277  CYS C SG  1 
ATOM   4702 N  N   . PRO C 3 184 ? 29.382 15.970  6.119   1.00 37.25 ? 278  PRO C N   1 
ATOM   4703 C  CA  . PRO C 3 184 ? 29.712 15.514  4.763   1.00 36.35 ? 278  PRO C CA  1 
ATOM   4704 C  C   . PRO C 3 184 ? 28.632 15.914  3.767   1.00 35.02 ? 278  PRO C C   1 
ATOM   4705 O  O   . PRO C 3 184 ? 28.919 16.554  2.755   1.00 32.51 ? 278  PRO C O   1 
ATOM   4706 C  CB  . PRO C 3 184 ? 29.827 13.994  4.920   1.00 36.41 ? 278  PRO C CB  1 
ATOM   4707 C  CG  . PRO C 3 184 ? 30.267 13.828  6.371   1.00 34.25 ? 278  PRO C CG  1 
ATOM   4708 C  CD  . PRO C 3 184 ? 29.409 14.853  7.085   1.00 35.11 ? 278  PRO C CD  1 
ATOM   4709 N  N   . GLY C 3 185 ? 27.390 15.541  4.070   1.00 36.70 ? 279  GLY C N   1 
ATOM   4710 C  CA  . GLY C 3 185 ? 26.279 15.868  3.192   1.00 38.10 ? 279  GLY C CA  1 
ATOM   4711 C  C   . GLY C 3 185 ? 26.223 17.345  2.856   1.00 40.08 ? 279  GLY C C   1 
ATOM   4712 O  O   . GLY C 3 185 ? 26.236 17.728  1.682   1.00 39.79 ? 279  GLY C O   1 
ATOM   4713 N  N   . ARG C 3 186 ? 26.172 18.185  3.885   1.00 41.00 ? 280  ARG C N   1 
ATOM   4714 C  CA  . ARG C 3 186 ? 26.105 19.624  3.675   1.00 41.52 ? 280  ARG C CA  1 
ATOM   4715 C  C   . ARG C 3 186 ? 27.259 20.132  2.799   1.00 41.06 ? 280  ARG C C   1 
ATOM   4716 O  O   . ARG C 3 186 ? 27.029 20.902  1.868   1.00 41.00 ? 280  ARG C O   1 
ATOM   4717 C  CB  . ARG C 3 186 ? 26.096 20.359  5.022   1.00 45.07 ? 280  ARG C CB  1 
ATOM   4718 C  CG  . ARG C 3 186 ? 25.407 21.725  4.970   1.00 51.57 ? 280  ARG C CG  1 
ATOM   4719 C  CD  . ARG C 3 186 ? 25.398 22.413  6.334   1.00 56.55 ? 280  ARG C CD  1 
ATOM   4720 N  NE  . ARG C 3 186 ? 26.757 22.715  6.791   1.00 60.21 ? 280  ARG C NE  1 
ATOM   4721 C  CZ  . ARG C 3 186 ? 27.051 23.281  7.958   1.00 59.48 ? 280  ARG C CZ  1 
ATOM   4722 N  NH1 . ARG C 3 186 ? 26.080 23.613  8.801   1.00 60.08 ? 280  ARG C NH1 1 
ATOM   4723 N  NH2 . ARG C 3 186 ? 28.318 23.508  8.282   1.00 58.18 ? 280  ARG C NH2 1 
ATOM   4724 N  N   . ASP C 3 187 ? 28.488 19.696  3.081   1.00 39.90 ? 281  ASP C N   1 
ATOM   4725 C  CA  . ASP C 3 187 ? 29.655 20.134  2.304   1.00 39.48 ? 281  ASP C CA  1 
ATOM   4726 C  C   . ASP C 3 187 ? 29.703 19.588  0.887   1.00 38.30 ? 281  ASP C C   1 
ATOM   4727 O  O   . ASP C 3 187 ? 30.174 20.264  -0.027  1.00 36.96 ? 281  ASP C O   1 
ATOM   4728 C  CB  . ASP C 3 187 ? 30.967 19.752  2.998   1.00 41.95 ? 281  ASP C CB  1 
ATOM   4729 C  CG  . ASP C 3 187 ? 31.224 20.560  4.245   1.00 44.34 ? 281  ASP C CG  1 
ATOM   4730 O  OD1 . ASP C 3 187 ? 32.408 20.675  4.627   1.00 47.43 ? 281  ASP C OD1 1 
ATOM   4731 O  OD2 . ASP C 3 187 ? 30.250 21.075  4.845   1.00 44.35 ? 281  ASP C OD2 1 
ATOM   4732 N  N   . ARG C 3 188 ? 29.249 18.356  0.696   1.00 37.83 ? 282  ARG C N   1 
ATOM   4733 C  CA  . ARG C 3 188 ? 29.264 17.796  -0.644  1.00 37.38 ? 282  ARG C CA  1 
ATOM   4734 C  C   . ARG C 3 188 ? 28.414 18.692  -1.533  1.00 37.75 ? 282  ARG C C   1 
ATOM   4735 O  O   . ARG C 3 188 ? 28.884 19.165  -2.562  1.00 38.85 ? 282  ARG C O   1 
ATOM   4736 C  CB  . ARG C 3 188 ? 28.701 16.370  -0.665  1.00 37.91 ? 282  ARG C CB  1 
ATOM   4737 C  CG  . ARG C 3 188 ? 28.495 15.835  -2.081  1.00 38.73 ? 282  ARG C CG  1 
ATOM   4738 C  CD  . ARG C 3 188 ? 27.724 14.518  -2.115  1.00 40.86 ? 282  ARG C CD  1 
ATOM   4739 N  NE  . ARG C 3 188 ? 27.362 14.145  -3.485  1.00 39.96 ? 282  ARG C NE  1 
ATOM   4740 C  CZ  . ARG C 3 188 ? 26.800 12.990  -3.836  1.00 39.69 ? 282  ARG C CZ  1 
ATOM   4741 N  NH1 . ARG C 3 188 ? 26.512 12.758  -5.110  1.00 42.44 ? 282  ARG C NH1 1 
ATOM   4742 N  NH2 . ARG C 3 188 ? 26.536 12.060  -2.923  1.00 41.17 ? 282  ARG C NH2 1 
ATOM   4743 N  N   . ARG C 3 189 ? 27.171 18.940  -1.124  1.00 37.96 ? 283  ARG C N   1 
ATOM   4744 C  CA  . ARG C 3 189 ? 26.278 19.772  -1.915  1.00 37.65 ? 283  ARG C CA  1 
ATOM   4745 C  C   . ARG C 3 189 ? 26.812 21.179  -2.148  1.00 39.11 ? 283  ARG C C   1 
ATOM   4746 O  O   . ARG C 3 189 ? 26.704 21.700  -3.265  1.00 41.43 ? 283  ARG C O   1 
ATOM   4747 C  CB  . ARG C 3 189 ? 24.876 19.784  -1.293  1.00 38.53 ? 283  ARG C CB  1 
ATOM   4748 C  CG  . ARG C 3 189 ? 24.142 18.463  -1.556  1.00 38.06 ? 283  ARG C CG  1 
ATOM   4749 C  CD  . ARG C 3 189 ? 22.719 18.423  -1.043  1.00 36.51 ? 283  ARG C CD  1 
ATOM   4750 N  NE  . ARG C 3 189 ? 22.650 18.236  0.403   1.00 38.57 ? 283  ARG C NE  1 
ATOM   4751 C  CZ  . ARG C 3 189 ? 22.540 19.230  1.278   1.00 40.46 ? 283  ARG C CZ  1 
ATOM   4752 N  NH1 . ARG C 3 189 ? 22.484 20.483  0.843   1.00 40.98 ? 283  ARG C NH1 1 
ATOM   4753 N  NH2 . ARG C 3 189 ? 22.485 18.973  2.584   1.00 38.65 ? 283  ARG C NH2 1 
ATOM   4754 N  N   . THR C 3 190 ? 27.411 21.791  -1.126  1.00 38.39 ? 284  THR C N   1 
ATOM   4755 C  CA  . THR C 3 190 ? 27.969 23.129  -1.300  1.00 38.37 ? 284  THR C CA  1 
ATOM   4756 C  C   . THR C 3 190 ? 29.061 23.099  -2.367  1.00 40.83 ? 284  THR C C   1 
ATOM   4757 O  O   . THR C 3 190 ? 29.006 23.854  -3.340  1.00 39.24 ? 284  THR C O   1 
ATOM   4758 C  CB  . THR C 3 190 ? 28.589 23.686  -0.003  1.00 36.83 ? 284  THR C CB  1 
ATOM   4759 O  OG1 . THR C 3 190 ? 27.551 24.022  0.929   1.00 37.76 ? 284  THR C OG1 1 
ATOM   4760 C  CG2 . THR C 3 190 ? 29.409 24.932  -0.306  1.00 34.59 ? 284  THR C CG2 1 
ATOM   4761 N  N   . GLU C 3 191 ? 30.047 22.222  -2.192  1.00 43.54 ? 285  GLU C N   1 
ATOM   4762 C  CA  . GLU C 3 191 ? 31.147 22.131  -3.153  1.00 47.34 ? 285  GLU C CA  1 
ATOM   4763 C  C   . GLU C 3 191 ? 30.650 21.779  -4.550  1.00 47.86 ? 285  GLU C C   1 
ATOM   4764 O  O   . GLU C 3 191 ? 31.267 22.159  -5.551  1.00 48.57 ? 285  GLU C O   1 
ATOM   4765 C  CB  . GLU C 3 191 ? 32.182 21.096  -2.700  1.00 48.33 ? 285  GLU C CB  1 
ATOM   4766 C  CG  . GLU C 3 191 ? 32.697 21.325  -1.283  1.00 49.50 ? 285  GLU C CG  1 
ATOM   4767 C  CD  . GLU C 3 191 ? 34.151 20.933  -1.112  1.00 50.19 ? 285  GLU C CD  1 
ATOM   4768 O  OE1 . GLU C 3 191 ? 34.630 20.976  0.043   1.00 49.25 ? 285  GLU C OE1 1 
ATOM   4769 O  OE2 . GLU C 3 191 ? 34.808 20.593  -2.129  1.00 49.95 ? 285  GLU C OE2 1 
ATOM   4770 N  N   . GLU C 3 192 ? 29.536 21.057  -4.615  1.00 47.62 ? 286  GLU C N   1 
ATOM   4771 C  CA  . GLU C 3 192 ? 28.961 20.673  -5.897  1.00 49.05 ? 286  GLU C CA  1 
ATOM   4772 C  C   . GLU C 3 192 ? 28.198 21.820  -6.562  1.00 50.77 ? 286  GLU C C   1 
ATOM   4773 O  O   . GLU C 3 192 ? 28.296 21.996  -7.775  1.00 51.09 ? 286  GLU C O   1 
ATOM   4774 C  CB  . GLU C 3 192 ? 28.048 19.449  -5.742  1.00 47.29 ? 286  GLU C CB  1 
ATOM   4775 C  CG  . GLU C 3 192 ? 28.766 18.112  -5.922  1.00 45.19 ? 286  GLU C CG  1 
ATOM   4776 C  CD  . GLU C 3 192 ? 27.815 16.923  -5.904  1.00 45.77 ? 286  GLU C CD  1 
ATOM   4777 O  OE1 . GLU C 3 192 ? 26.744 17.014  -6.536  1.00 47.73 ? 286  GLU C OE1 1 
ATOM   4778 O  OE2 . GLU C 3 192 ? 28.138 15.892  -5.274  1.00 44.53 ? 286  GLU C OE2 1 
ATOM   4779 N  N   . GLU C 3 193 ? 27.424 22.593  -5.802  1.00 52.53 ? 287  GLU C N   1 
ATOM   4780 C  CA  . GLU C 3 193 ? 26.719 23.708  -6.437  1.00 55.63 ? 287  GLU C CA  1 
ATOM   4781 C  C   . GLU C 3 193 ? 27.771 24.727  -6.885  1.00 54.55 ? 287  GLU C C   1 
ATOM   4782 O  O   . GLU C 3 193 ? 27.580 25.443  -7.868  1.00 55.34 ? 287  GLU C O   1 
ATOM   4783 C  CB  . GLU C 3 193 ? 25.674 24.343  -5.494  1.00 60.41 ? 287  GLU C CB  1 
ATOM   4784 C  CG  . GLU C 3 193 ? 26.181 24.949  -4.174  1.00 68.88 ? 287  GLU C CG  1 
ATOM   4785 C  CD  . GLU C 3 193 ? 26.425 26.459  -4.243  1.00 72.55 ? 287  GLU C CD  1 
ATOM   4786 O  OE1 . GLU C 3 193 ? 25.647 27.164  -4.928  1.00 75.00 ? 287  GLU C OE1 1 
ATOM   4787 O  OE2 . GLU C 3 193 ? 27.383 26.947  -3.596  1.00 73.47 ? 287  GLU C OE2 1 
ATOM   4788 N  N   . ASN C 3 194 ? 28.896 24.756  -6.174  1.00 53.11 ? 288  ASN C N   1 
ATOM   4789 C  CA  . ASN C 3 194 ? 30.001 25.644  -6.505  1.00 52.43 ? 288  ASN C CA  1 
ATOM   4790 C  C   . ASN C 3 194 ? 30.558 25.289  -7.875  1.00 51.62 ? 288  ASN C C   1 
ATOM   4791 O  O   . ASN C 3 194 ? 30.783 26.157  -8.716  1.00 51.22 ? 288  ASN C O   1 
ATOM   4792 C  CB  . ASN C 3 194 ? 31.122 25.516  -5.473  1.00 54.58 ? 288  ASN C CB  1 
ATOM   4793 C  CG  . ASN C 3 194 ? 30.948 26.462  -4.295  1.00 57.95 ? 288  ASN C CG  1 
ATOM   4794 O  OD1 . ASN C 3 194 ? 29.997 26.348  -3.512  1.00 56.16 ? 288  ASN C OD1 1 
ATOM   4795 N  ND2 . ASN C 3 194 ? 31.875 27.411  -4.166  1.00 59.30 ? 288  ASN C ND2 1 
ATOM   4796 N  N   . LEU C 3 195 ? 30.783 24.001  -8.097  1.00 50.56 ? 289  LEU C N   1 
ATOM   4797 C  CA  . LEU C 3 195 ? 31.322 23.551  -9.369  1.00 49.58 ? 289  LEU C CA  1 
ATOM   4798 C  C   . LEU C 3 195 ? 30.405 23.940  -10.537 1.00 50.37 ? 289  LEU C C   1 
ATOM   4799 O  O   . LEU C 3 195 ? 30.826 24.787  -11.361 1.00 50.82 ? 289  LEU C O   1 
ATOM   4800 C  CB  . LEU C 3 195 ? 31.518 22.036  -9.344  1.00 45.27 ? 289  LEU C CB  1 
ATOM   4801 C  CG  . LEU C 3 195 ? 32.190 21.522  -10.613 1.00 44.02 ? 289  LEU C CG  1 
ATOM   4802 C  CD1 . LEU C 3 195 ? 33.629 22.023  -10.652 1.00 44.10 ? 289  LEU C CD1 1 
ATOM   4803 C  CD2 . LEU C 3 195 ? 32.134 20.010  -10.657 1.00 42.94 ? 289  LEU C CD2 1 
ATOM   4804 N  N   . ARG C 3 196 ? 29.274 23.401  -10.612 1.00 48.71 ? 290  ARG C N   1 
ATOM   4805 N  N   . ASN D 2 2   ? 60.598 23.753  29.046  1.00 51.94 ? 1725 ASN D N   1 
ATOM   4806 C  CA  . ASN D 2 2   ? 61.884 24.235  28.457  1.00 51.88 ? 1725 ASN D CA  1 
ATOM   4807 C  C   . ASN D 2 2   ? 61.919 25.750  28.385  1.00 51.07 ? 1725 ASN D C   1 
ATOM   4808 O  O   . ASN D 2 2   ? 61.058 26.386  27.776  1.00 48.90 ? 1725 ASN D O   1 
ATOM   4809 C  CB  . ASN D 2 2   ? 62.097 23.652  27.052  1.00 51.80 ? 1725 ASN D CB  1 
ATOM   4810 C  CG  . ASN D 2 2   ? 63.368 24.174  26.383  1.00 51.23 ? 1725 ASN D CG  1 
ATOM   4811 O  OD1 . ASN D 2 2   ? 64.275 24.687  27.045  1.00 51.19 ? 1725 ASN D OD1 1 
ATOM   4812 N  ND2 . ASN D 2 2   ? 63.441 24.027  25.067  1.00 50.30 ? 1725 ASN D ND2 1 
ATOM   4813 N  N   . LYS D 2 3   ? 62.931 26.319  29.022  1.00 51.03 ? 1726 LYS D N   1 
ATOM   4814 C  CA  . LYS D 2 3   ? 63.108 27.764  29.050  1.00 49.93 ? 1726 LYS D CA  1 
ATOM   4815 C  C   . LYS D 2 3   ? 63.675 28.325  27.735  1.00 47.38 ? 1726 LYS D C   1 
ATOM   4816 O  O   . LYS D 2 3   ? 63.775 29.540  27.559  1.00 45.07 ? 1726 LYS D O   1 
ATOM   4817 C  CB  . LYS D 2 3   ? 64.037 28.157  30.198  1.00 52.12 ? 1726 LYS D CB  1 
ATOM   4818 C  CG  . LYS D 2 3   ? 63.612 27.679  31.577  1.00 55.42 ? 1726 LYS D CG  1 
ATOM   4819 C  CD  . LYS D 2 3   ? 64.644 28.116  32.634  1.00 59.44 ? 1726 LYS D CD  1 
ATOM   4820 C  CE  . LYS D 2 3   ? 66.038 27.509  32.362  1.00 61.08 ? 1726 LYS D CE  1 
ATOM   4821 N  NZ  . LYS D 2 3   ? 67.129 28.027  33.258  1.00 60.41 ? 1726 LYS D NZ  1 
ATOM   4822 N  N   . THR D 2 4   ? 64.060 27.454  26.812  1.00 45.64 ? 1727 THR D N   1 
ATOM   4823 C  CA  . THR D 2 4   ? 64.601 27.936  25.543  1.00 43.91 ? 1727 THR D CA  1 
ATOM   4824 C  C   . THR D 2 4   ? 63.803 27.399  24.367  1.00 42.62 ? 1727 THR D C   1 
ATOM   4825 O  O   . THR D 2 4   ? 64.309 27.331  23.248  1.00 45.65 ? 1727 THR D O   1 
ATOM   4826 C  CB  . THR D 2 4   ? 66.077 27.518  25.348  1.00 43.04 ? 1727 THR D CB  1 
ATOM   4827 O  OG1 . THR D 2 4   ? 66.169 26.086  25.306  1.00 43.06 ? 1727 THR D OG1 1 
ATOM   4828 C  CG2 . THR D 2 4   ? 66.935 28.060  26.484  1.00 42.50 ? 1727 THR D CG2 1 
ATOM   4829 N  N   . LEU D 2 5   ? 62.554 27.021  24.616  1.00 39.99 ? 1728 LEU D N   1 
ATOM   4830 C  CA  . LEU D 2 5   ? 61.706 26.469  23.566  1.00 35.19 ? 1728 LEU D CA  1 
ATOM   4831 C  C   . LEU D 2 5   ? 61.608 27.356  22.335  1.00 36.81 ? 1728 LEU D C   1 
ATOM   4832 O  O   . LEU D 2 5   ? 61.764 26.868  21.208  1.00 36.90 ? 1728 LEU D O   1 
ATOM   4833 C  CB  . LEU D 2 5   ? 60.296 26.207  24.097  1.00 32.17 ? 1728 LEU D CB  1 
ATOM   4834 C  CG  . LEU D 2 5   ? 59.291 25.580  23.122  1.00 32.38 ? 1728 LEU D CG  1 
ATOM   4835 C  CD1 . LEU D 2 5   ? 59.847 24.286  22.530  1.00 27.96 ? 1728 LEU D CD1 1 
ATOM   4836 C  CD2 . LEU D 2 5   ? 57.991 25.294  23.861  1.00 33.88 ? 1728 LEU D CD2 1 
ATOM   4837 N  N   . PHE D 2 6   ? 61.354 28.651  22.541  1.00 36.54 ? 1729 PHE D N   1 
ATOM   4838 C  CA  . PHE D 2 6   ? 61.197 29.590  21.420  1.00 35.51 ? 1729 PHE D CA  1 
ATOM   4839 C  C   . PHE D 2 6   ? 62.411 30.468  21.117  1.00 36.54 ? 1729 PHE D C   1 
ATOM   4840 O  O   . PHE D 2 6   ? 62.324 31.403  20.308  1.00 33.45 ? 1729 PHE D O   1 
ATOM   4841 C  CB  . PHE D 2 6   ? 59.975 30.499  21.647  1.00 36.64 ? 1729 PHE D CB  1 
ATOM   4842 C  CG  . PHE D 2 6   ? 58.680 29.743  21.839  1.00 36.81 ? 1729 PHE D CG  1 
ATOM   4843 C  CD1 . PHE D 2 6   ? 58.002 29.798  23.055  1.00 32.59 ? 1729 PHE D CD1 1 
ATOM   4844 C  CD2 . PHE D 2 6   ? 58.186 28.913  20.831  1.00 36.23 ? 1729 PHE D CD2 1 
ATOM   4845 C  CE1 . PHE D 2 6   ? 56.864 29.033  23.274  1.00 30.83 ? 1729 PHE D CE1 1 
ATOM   4846 C  CE2 . PHE D 2 6   ? 57.046 28.142  21.043  1.00 34.97 ? 1729 PHE D CE2 1 
ATOM   4847 C  CZ  . PHE D 2 6   ? 56.385 28.204  22.274  1.00 32.75 ? 1729 PHE D CZ  1 
ATOM   4848 N  N   . LEU D 2 7   ? 63.542 30.176  21.758  1.00 36.86 ? 1730 LEU D N   1 
ATOM   4849 C  CA  . LEU D 2 7   ? 64.758 30.957  21.532  1.00 33.97 ? 1730 LEU D CA  1 
ATOM   4850 C  C   . LEU D 2 7   ? 65.019 31.051  20.038  1.00 32.89 ? 1730 LEU D C   1 
ATOM   4851 O  O   . LEU D 2 7   ? 64.842 30.074  19.312  1.00 31.94 ? 1730 LEU D O   1 
ATOM   4852 C  CB  . LEU D 2 7   ? 65.954 30.291  22.218  1.00 33.29 ? 1730 LEU D CB  1 
ATOM   4853 C  CG  . LEU D 2 7   ? 67.333 30.882  21.897  1.00 33.93 ? 1730 LEU D CG  1 
ATOM   4854 C  CD1 . LEU D 2 7   ? 67.334 32.398  22.052  1.00 31.53 ? 1730 LEU D CD1 1 
ATOM   4855 C  CD2 . LEU D 2 7   ? 68.347 30.249  22.819  1.00 33.09 ? 1730 LEU D CD2 1 
ATOM   4856 N  N   . GLY D 2 8   ? 65.438 32.222  19.574  1.00 34.01 ? 1731 GLY D N   1 
ATOM   4857 C  CA  . GLY D 2 8   ? 65.709 32.386  18.153  1.00 32.68 ? 1731 GLY D CA  1 
ATOM   4858 C  C   . GLY D 2 8   ? 64.534 32.949  17.368  1.00 35.29 ? 1731 GLY D C   1 
ATOM   4859 O  O   . GLY D 2 8   ? 64.716 33.446  16.254  1.00 35.29 ? 1731 GLY D O   1 
ATOM   4860 N  N   . TYR D 2 9   ? 63.327 32.872  17.932  1.00 34.86 ? 1732 TYR D N   1 
ATOM   4861 C  CA  . TYR D 2 9   ? 62.152 33.405  17.255  1.00 33.12 ? 1732 TYR D CA  1 
ATOM   4862 C  C   . TYR D 2 9   ? 61.710 34.745  17.828  1.00 33.92 ? 1732 TYR D C   1 
ATOM   4863 O  O   . TYR D 2 9   ? 61.925 35.042  19.010  1.00 37.74 ? 1732 TYR D O   1 
ATOM   4864 C  CB  . TYR D 2 9   ? 60.976 32.433  17.341  1.00 35.20 ? 1732 TYR D CB  1 
ATOM   4865 C  CG  . TYR D 2 9   ? 61.118 31.191  16.490  1.00 37.37 ? 1732 TYR D CG  1 
ATOM   4866 C  CD1 . TYR D 2 9   ? 61.876 30.102  16.923  1.00 36.03 ? 1732 TYR D CD1 1 
ATOM   4867 C  CD2 . TYR D 2 9   ? 60.460 31.093  15.258  1.00 37.46 ? 1732 TYR D CD2 1 
ATOM   4868 C  CE1 . TYR D 2 9   ? 61.969 28.937  16.150  1.00 37.65 ? 1732 TYR D CE1 1 
ATOM   4869 C  CE2 . TYR D 2 9   ? 60.548 29.937  14.479  1.00 36.01 ? 1732 TYR D CE2 1 
ATOM   4870 C  CZ  . TYR D 2 9   ? 61.300 28.865  14.931  1.00 37.11 ? 1732 TYR D CZ  1 
ATOM   4871 O  OH  . TYR D 2 9   ? 61.372 27.725  14.163  1.00 37.90 ? 1732 TYR D OH  1 
ATOM   4872 N  N   . ALA D 2 10  ? 61.094 35.556  16.975  1.00 31.20 ? 1733 ALA D N   1 
ATOM   4873 C  CA  . ALA D 2 10  ? 60.584 36.858  17.369  1.00 28.30 ? 1733 ALA D CA  1 
ATOM   4874 C  C   . ALA D 2 10  ? 59.093 36.789  17.015  1.00 31.53 ? 1733 ALA D C   1 
ATOM   4875 O  O   . ALA D 2 10  ? 58.719 36.086  16.055  1.00 30.51 ? 1733 ALA D O   1 
ATOM   4876 C  CB  . ALA D 2 10  ? 61.292 37.957  16.584  1.00 24.54 ? 1733 ALA D CB  1 
ATOM   4877 N  N   . PHE D 2 11  ? 58.243 37.511  17.757  1.00 29.52 ? 1734 PHE D N   1 
ATOM   4878 C  CA  . PHE D 2 11  ? 56.803 37.435  17.515  1.00 24.74 ? 1734 PHE D CA  1 
ATOM   4879 C  C   . PHE D 2 11  ? 56.005 38.731  17.485  1.00 23.52 ? 1734 PHE D C   1 
ATOM   4880 O  O   . PHE D 2 11  ? 56.366 39.732  18.105  1.00 22.82 ? 1734 PHE D O   1 
ATOM   4881 C  CB  . PHE D 2 11  ? 56.175 36.528  18.567  1.00 24.24 ? 1734 PHE D CB  1 
ATOM   4882 C  CG  . PHE D 2 11  ? 56.729 35.135  18.578  1.00 25.63 ? 1734 PHE D CG  1 
ATOM   4883 C  CD1 . PHE D 2 11  ? 56.110 34.124  17.853  1.00 23.99 ? 1734 PHE D CD1 1 
ATOM   4884 C  CD2 . PHE D 2 11  ? 57.872 34.835  19.317  1.00 24.52 ? 1734 PHE D CD2 1 
ATOM   4885 C  CE1 . PHE D 2 11  ? 56.621 32.832  17.866  1.00 28.07 ? 1734 PHE D CE1 1 
ATOM   4886 C  CE2 . PHE D 2 11  ? 58.393 33.545  19.336  1.00 27.44 ? 1734 PHE D CE2 1 
ATOM   4887 C  CZ  . PHE D 2 11  ? 57.768 32.539  18.611  1.00 27.11 ? 1734 PHE D CZ  1 
ATOM   4888 N  N   . LEU D 2 12  ? 54.906 38.687  16.743  1.00 22.69 ? 1735 LEU D N   1 
ATOM   4889 C  CA  . LEU D 2 12  ? 53.977 39.800  16.650  1.00 25.47 ? 1735 LEU D CA  1 
ATOM   4890 C  C   . LEU D 2 12  ? 52.656 39.142  16.963  1.00 25.85 ? 1735 LEU D C   1 
ATOM   4891 O  O   . LEU D 2 12  ? 52.377 38.042  16.479  1.00 25.80 ? 1735 LEU D O   1 
ATOM   4892 C  CB  . LEU D 2 12  ? 53.937 40.410  15.249  1.00 25.40 ? 1735 LEU D CB  1 
ATOM   4893 C  CG  . LEU D 2 12  ? 54.946 41.533  14.999  1.00 27.62 ? 1735 LEU D CG  1 
ATOM   4894 C  CD1 . LEU D 2 12  ? 54.738 42.101  13.606  1.00 30.35 ? 1735 LEU D CD1 1 
ATOM   4895 C  CD2 . LEU D 2 12  ? 54.768 42.643  16.038  1.00 24.46 ? 1735 LEU D CD2 1 
ATOM   4896 N  N   . LEU D 2 13  ? 51.854 39.788  17.794  1.00 26.67 ? 1736 LEU D N   1 
ATOM   4897 C  CA  . LEU D 2 13  ? 50.567 39.222  18.175  1.00 27.52 ? 1736 LEU D CA  1 
ATOM   4898 C  C   . LEU D 2 13  ? 49.492 40.193  17.729  1.00 29.05 ? 1736 LEU D C   1 
ATOM   4899 O  O   . LEU D 2 13  ? 49.708 41.406  17.738  1.00 27.84 ? 1736 LEU D O   1 
ATOM   4900 C  CB  . LEU D 2 13  ? 50.489 39.030  19.696  1.00 29.81 ? 1736 LEU D CB  1 
ATOM   4901 C  CG  . LEU D 2 13  ? 51.514 38.188  20.493  1.00 30.64 ? 1736 LEU D CG  1 
ATOM   4902 C  CD1 . LEU D 2 13  ? 51.191 36.710  20.389  1.00 30.44 ? 1736 LEU D CD1 1 
ATOM   4903 C  CD2 . LEU D 2 13  ? 52.933 38.475  20.010  1.00 29.17 ? 1736 LEU D CD2 1 
ATOM   4904 N  N   . THR D 2 14  ? 48.337 39.671  17.331  1.00 30.75 ? 1737 THR D N   1 
ATOM   4905 C  CA  . THR D 2 14  ? 47.263 40.540  16.890  1.00 32.79 ? 1737 THR D CA  1 
ATOM   4906 C  C   . THR D 2 14  ? 45.891 39.919  17.116  1.00 37.79 ? 1737 THR D C   1 
ATOM   4907 O  O   . THR D 2 14  ? 45.701 38.714  16.935  1.00 38.07 ? 1737 THR D O   1 
ATOM   4908 C  CB  . THR D 2 14  ? 47.427 40.906  15.404  1.00 33.71 ? 1737 THR D CB  1 
ATOM   4909 O  OG1 . THR D 2 14  ? 46.519 41.964  15.065  1.00 35.12 ? 1737 THR D OG1 1 
ATOM   4910 C  CG2 . THR D 2 14  ? 47.145 39.701  14.525  1.00 34.69 ? 1737 THR D CG2 1 
ATOM   4911 N  N   . MET D 2 15  ? 44.942 40.756  17.528  1.00 42.90 ? 1738 MET D N   1 
ATOM   4912 C  CA  . MET D 2 15  ? 43.571 40.326  17.796  1.00 46.26 ? 1738 MET D CA  1 
ATOM   4913 C  C   . MET D 2 15  ? 42.653 40.738  16.652  1.00 47.43 ? 1738 MET D C   1 
ATOM   4914 O  O   . MET D 2 15  ? 42.666 41.896  16.230  1.00 49.28 ? 1738 MET D O   1 
ATOM   4915 C  CB  . MET D 2 15  ? 43.067 40.955  19.102  1.00 49.70 ? 1738 MET D CB  1 
ATOM   4916 C  CG  . MET D 2 15  ? 43.313 40.122  20.345  1.00 54.07 ? 1738 MET D CG  1 
ATOM   4917 S  SD  . MET D 2 15  ? 42.451 38.525  20.245  1.00 62.92 ? 1738 MET D SD  1 
ATOM   4918 C  CE  . MET D 2 15  ? 40.697 39.066  20.490  1.00 60.63 ? 1738 MET D CE  1 
ATOM   4919 N  N   . ALA D 2 16  ? 41.854 39.796  16.159  1.00 46.76 ? 1739 ALA D N   1 
ATOM   4920 C  CA  . ALA D 2 16  ? 40.929 40.072  15.059  1.00 48.28 ? 1739 ALA D CA  1 
ATOM   4921 C  C   . ALA D 2 16  ? 39.712 40.902  15.483  1.00 50.47 ? 1739 ALA D C   1 
ATOM   4922 O  O   . ALA D 2 16  ? 39.146 40.681  16.555  1.00 50.05 ? 1739 ALA D O   1 
ATOM   4923 C  CB  . ALA D 2 16  ? 40.464 38.767  14.440  1.00 48.25 ? 1739 ALA D CB  1 
ATOM   4924 N  N   . THR D 2 17  ? 39.320 41.846  14.622  1.00 53.04 ? 1740 THR D N   1 
ATOM   4925 C  CA  . THR D 2 17  ? 38.173 42.747  14.842  1.00 53.80 ? 1740 THR D CA  1 
ATOM   4926 C  C   . THR D 2 17  ? 36.833 42.005  14.980  1.00 53.22 ? 1740 THR D C   1 
ATOM   4927 O  O   . THR D 2 17  ? 35.937 42.431  15.721  1.00 50.97 ? 1740 THR D O   1 
ATOM   4928 C  CB  . THR D 2 17  ? 38.049 43.786  13.672  1.00 54.31 ? 1740 THR D CB  1 
ATOM   4929 O  OG1 . THR D 2 17  ? 36.833 44.533  13.807  1.00 54.31 ? 1740 THR D OG1 1 
ATOM   4930 C  CG2 . THR D 2 17  ? 38.043 43.084  12.314  1.00 55.29 ? 1740 THR D CG2 1 
ATOM   4931 N  N   . PHE D 2 48  ? 41.924 32.459  22.608  1.00 33.60 ? 1771 PHE D N   1 
ATOM   4932 C  CA  . PHE D 2 48  ? 43.139 33.216  22.334  1.00 34.33 ? 1771 PHE D CA  1 
ATOM   4933 C  C   . PHE D 2 48  ? 43.259 34.412  23.271  1.00 35.56 ? 1771 PHE D C   1 
ATOM   4934 O  O   . PHE D 2 48  ? 42.366 35.262  23.337  1.00 39.67 ? 1771 PHE D O   1 
ATOM   4935 C  CB  . PHE D 2 48  ? 43.151 33.699  20.881  1.00 30.30 ? 1771 PHE D CB  1 
ATOM   4936 C  CG  . PHE D 2 48  ? 44.397 34.460  20.507  1.00 29.90 ? 1771 PHE D CG  1 
ATOM   4937 C  CD1 . PHE D 2 48  ? 45.659 33.984  20.873  1.00 29.11 ? 1771 PHE D CD1 1 
ATOM   4938 C  CD2 . PHE D 2 48  ? 44.317 35.646  19.780  1.00 29.43 ? 1771 PHE D CD2 1 
ATOM   4939 C  CE1 . PHE D 2 48  ? 46.821 34.680  20.521  1.00 27.43 ? 1771 PHE D CE1 1 
ATOM   4940 C  CE2 . PHE D 2 48  ? 45.482 36.348  19.420  1.00 26.90 ? 1771 PHE D CE2 1 
ATOM   4941 C  CZ  . PHE D 2 48  ? 46.729 35.862  19.793  1.00 25.44 ? 1771 PHE D CZ  1 
ATOM   4942 N  N   . ASN D 2 49  ? 44.383 34.481  23.971  1.00 32.23 ? 1772 ASN D N   1 
ATOM   4943 C  CA  . ASN D 2 49  ? 44.644 35.528  24.940  1.00 30.93 ? 1772 ASN D CA  1 
ATOM   4944 C  C   . ASN D 2 49  ? 46.044 36.116  24.684  1.00 33.03 ? 1772 ASN D C   1 
ATOM   4945 O  O   . ASN D 2 49  ? 47.051 35.519  25.084  1.00 34.24 ? 1772 ASN D O   1 
ATOM   4946 C  CB  . ASN D 2 49  ? 44.568 34.871  26.322  1.00 29.15 ? 1772 ASN D CB  1 
ATOM   4947 C  CG  . ASN D 2 49  ? 44.781 35.844  27.451  1.00 29.96 ? 1772 ASN D CG  1 
ATOM   4948 O  OD1 . ASN D 2 49  ? 45.794 36.549  27.502  1.00 28.98 ? 1772 ASN D OD1 1 
ATOM   4949 N  ND2 . ASN D 2 49  ? 43.823 35.887  28.375  1.00 27.79 ? 1772 ASN D ND2 1 
ATOM   4950 N  N   . LYS D 2 50  ? 46.115 37.270  24.025  1.00 33.18 ? 1773 LYS D N   1 
ATOM   4951 C  CA  . LYS D 2 50  ? 47.404 37.891  23.713  1.00 35.63 ? 1773 LYS D CA  1 
ATOM   4952 C  C   . LYS D 2 50  ? 48.392 37.894  24.872  1.00 35.63 ? 1773 LYS D C   1 
ATOM   4953 O  O   . LYS D 2 50  ? 49.529 37.439  24.719  1.00 33.96 ? 1773 LYS D O   1 
ATOM   4954 C  CB  . LYS D 2 50  ? 47.214 39.327  23.216  1.00 38.06 ? 1773 LYS D CB  1 
ATOM   4955 C  CG  . LYS D 2 50  ? 46.583 39.438  21.846  1.00 40.54 ? 1773 LYS D CG  1 
ATOM   4956 C  CD  . LYS D 2 50  ? 46.327 40.902  21.472  1.00 44.34 ? 1773 LYS D CD  1 
ATOM   4957 C  CE  . LYS D 2 50  ? 47.612 41.718  21.343  1.00 44.61 ? 1773 LYS D CE  1 
ATOM   4958 N  NZ  . LYS D 2 50  ? 47.318 43.104  20.854  1.00 44.79 ? 1773 LYS D NZ  1 
ATOM   4959 N  N   . GLN D 2 51  ? 47.966 38.395  26.029  1.00 36.55 ? 1774 GLN D N   1 
ATOM   4960 C  CA  . GLN D 2 51  ? 48.857 38.451  27.182  1.00 36.48 ? 1774 GLN D CA  1 
ATOM   4961 C  C   . GLN D 2 51  ? 49.296 37.079  27.655  1.00 35.26 ? 1774 GLN D C   1 
ATOM   4962 O  O   . GLN D 2 51  ? 50.460 36.895  28.016  1.00 37.90 ? 1774 GLN D O   1 
ATOM   4963 C  CB  . GLN D 2 51  ? 48.214 39.237  28.328  1.00 40.45 ? 1774 GLN D CB  1 
ATOM   4964 C  CG  . GLN D 2 51  ? 48.169 40.746  28.076  1.00 41.80 ? 1774 GLN D CG  1 
ATOM   4965 C  CD  . GLN D 2 51  ? 47.274 41.124  26.899  1.00 46.74 ? 1774 GLN D CD  1 
ATOM   4966 O  OE1 . GLN D 2 51  ? 47.428 42.203  26.301  1.00 47.93 ? 1774 GLN D OE1 1 
ATOM   4967 N  NE2 . GLN D 2 51  ? 46.321 40.243  26.567  1.00 46.01 ? 1774 GLN D NE2 1 
ATOM   4968 N  N   . TYR D 2 52  ? 48.397 36.099  27.643  1.00 34.22 ? 1775 TYR D N   1 
ATOM   4969 C  CA  . TYR D 2 52  ? 48.808 34.770  28.095  1.00 34.43 ? 1775 TYR D CA  1 
ATOM   4970 C  C   . TYR D 2 52  ? 49.841 34.195  27.128  1.00 32.05 ? 1775 TYR D C   1 
ATOM   4971 O  O   . TYR D 2 52  ? 50.917 33.784  27.552  1.00 31.64 ? 1775 TYR D O   1 
ATOM   4972 C  CB  . TYR D 2 52  ? 47.617 33.813  28.229  1.00 36.07 ? 1775 TYR D CB  1 
ATOM   4973 C  CG  . TYR D 2 52  ? 48.009 32.402  28.664  1.00 39.89 ? 1775 TYR D CG  1 
ATOM   4974 C  CD1 . TYR D 2 52  ? 48.350 32.116  29.995  1.00 42.04 ? 1775 TYR D CD1 1 
ATOM   4975 C  CD2 . TYR D 2 52  ? 48.040 31.353  27.742  1.00 41.09 ? 1775 TYR D CD2 1 
ATOM   4976 C  CE1 . TYR D 2 52  ? 48.711 30.817  30.397  1.00 40.22 ? 1775 TYR D CE1 1 
ATOM   4977 C  CE2 . TYR D 2 52  ? 48.396 30.057  28.128  1.00 42.14 ? 1775 TYR D CE2 1 
ATOM   4978 C  CZ  . TYR D 2 52  ? 48.729 29.794  29.453  1.00 43.31 ? 1775 TYR D CZ  1 
ATOM   4979 O  OH  . TYR D 2 52  ? 49.067 28.503  29.814  1.00 41.42 ? 1775 TYR D OH  1 
ATOM   4980 N  N   . THR D 2 53  ? 49.518 34.171  25.835  1.00 31.30 ? 1776 THR D N   1 
ATOM   4981 C  CA  . THR D 2 53  ? 50.443 33.661  24.820  1.00 30.79 ? 1776 THR D CA  1 
ATOM   4982 C  C   . THR D 2 53  ? 51.823 34.332  24.947  1.00 31.75 ? 1776 THR D C   1 
ATOM   4983 O  O   . THR D 2 53  ? 52.875 33.675  24.888  1.00 27.36 ? 1776 THR D O   1 
ATOM   4984 C  CB  . THR D 2 53  ? 49.896 33.915  23.408  1.00 30.53 ? 1776 THR D CB  1 
ATOM   4985 O  OG1 . THR D 2 53  ? 48.758 33.073  23.177  1.00 31.78 ? 1776 THR D OG1 1 
ATOM   4986 C  CG2 . THR D 2 53  ? 50.960 33.639  22.365  1.00 30.62 ? 1776 THR D CG2 1 
ATOM   4987 N  N   . GLU D 2 54  ? 51.819 35.648  25.114  1.00 33.55 ? 1777 GLU D N   1 
ATOM   4988 C  CA  . GLU D 2 54  ? 53.072 36.362  25.284  1.00 35.71 ? 1777 GLU D CA  1 
ATOM   4989 C  C   . GLU D 2 54  ? 53.837 35.767  26.469  1.00 36.04 ? 1777 GLU D C   1 
ATOM   4990 O  O   . GLU D 2 54  ? 55.050 35.555  26.391  1.00 36.35 ? 1777 GLU D O   1 
ATOM   4991 C  CB  . GLU D 2 54  ? 52.812 37.851  25.506  1.00 36.69 ? 1777 GLU D CB  1 
ATOM   4992 C  CG  . GLU D 2 54  ? 52.682 38.632  24.214  1.00 40.48 ? 1777 GLU D CG  1 
ATOM   4993 C  CD  . GLU D 2 54  ? 52.709 40.135  24.428  1.00 43.09 ? 1777 GLU D CD  1 
ATOM   4994 O  OE1 . GLU D 2 54  ? 53.549 40.608  25.231  1.00 43.83 ? 1777 GLU D OE1 1 
ATOM   4995 O  OE2 . GLU D 2 54  ? 51.901 40.843  23.782  1.00 43.64 ? 1777 GLU D OE2 1 
ATOM   4996 N  N   . SER D 2 55  ? 53.132 35.482  27.560  1.00 35.26 ? 1778 SER D N   1 
ATOM   4997 C  CA  . SER D 2 55  ? 53.800 34.895  28.713  1.00 35.67 ? 1778 SER D CA  1 
ATOM   4998 C  C   . SER D 2 55  ? 54.425 33.563  28.342  1.00 35.42 ? 1778 SER D C   1 
ATOM   4999 O  O   . SER D 2 55  ? 55.586 33.308  28.664  1.00 35.23 ? 1778 SER D O   1 
ATOM   5000 C  CB  . SER D 2 55  ? 52.831 34.694  29.880  1.00 36.44 ? 1778 SER D CB  1 
ATOM   5001 O  OG  . SER D 2 55  ? 53.168 35.569  30.952  1.00 35.95 ? 1778 SER D OG  1 
ATOM   5002 N  N   . GLN D 2 56  ? 53.667 32.705  27.665  1.00 37.09 ? 1779 GLN D N   1 
ATOM   5003 C  CA  . GLN D 2 56  ? 54.216 31.404  27.278  1.00 38.98 ? 1779 GLN D CA  1 
ATOM   5004 C  C   . GLN D 2 56  ? 55.435 31.611  26.377  1.00 39.56 ? 1779 GLN D C   1 
ATOM   5005 O  O   . GLN D 2 56  ? 56.430 30.881  26.470  1.00 39.71 ? 1779 GLN D O   1 
ATOM   5006 C  CB  . GLN D 2 56  ? 53.204 30.572  26.498  1.00 39.77 ? 1779 GLN D CB  1 
ATOM   5007 C  CG  . GLN D 2 56  ? 51.870 30.344  27.153  1.00 42.66 ? 1779 GLN D CG  1 
ATOM   5008 C  CD  . GLN D 2 56  ? 51.083 29.280  26.404  1.00 46.39 ? 1779 GLN D CD  1 
ATOM   5009 O  OE1 . GLN D 2 56  ? 51.363 28.084  26.533  1.00 47.97 ? 1779 GLN D OE1 1 
ATOM   5010 N  NE2 . GLN D 2 56  ? 50.115 29.709  25.593  1.00 45.13 ? 1779 GLN D NE2 1 
ATOM   5011 N  N   . LEU D 2 57  ? 55.343 32.605  25.494  1.00 37.32 ? 1780 LEU D N   1 
ATOM   5012 C  CA  . LEU D 2 57  ? 56.431 32.902  24.571  1.00 34.72 ? 1780 LEU D CA  1 
ATOM   5013 C  C   . LEU D 2 57  ? 57.695 33.348  25.289  1.00 35.62 ? 1780 LEU D C   1 
ATOM   5014 O  O   . LEU D 2 57  ? 58.781 32.818  25.032  1.00 35.93 ? 1780 LEU D O   1 
ATOM   5015 C  CB  . LEU D 2 57  ? 56.004 33.981  23.577  1.00 32.29 ? 1780 LEU D CB  1 
ATOM   5016 C  CG  . LEU D 2 57  ? 55.034 33.509  22.495  1.00 30.44 ? 1780 LEU D CG  1 
ATOM   5017 C  CD1 . LEU D 2 57  ? 54.505 34.692  21.690  1.00 25.59 ? 1780 LEU D CD1 1 
ATOM   5018 C  CD2 . LEU D 2 57  ? 55.754 32.511  21.601  1.00 30.01 ? 1780 LEU D CD2 1 
ATOM   5019 N  N   . ARG D 2 58  ? 57.567 34.322  26.188  1.00 34.66 ? 1781 ARG D N   1 
ATOM   5020 C  CA  . ARG D 2 58  ? 58.745 34.796  26.905  1.00 32.68 ? 1781 ARG D CA  1 
ATOM   5021 C  C   . ARG D 2 58  ? 59.336 33.712  27.794  1.00 32.24 ? 1781 ARG D C   1 
ATOM   5022 O  O   . ARG D 2 58  ? 60.558 33.586  27.897  1.00 29.58 ? 1781 ARG D O   1 
ATOM   5023 C  CB  . ARG D 2 58  ? 58.426 36.045  27.729  1.00 31.50 ? 1781 ARG D CB  1 
ATOM   5024 C  CG  . ARG D 2 58  ? 58.004 37.227  26.885  1.00 31.95 ? 1781 ARG D CG  1 
ATOM   5025 C  CD  . ARG D 2 58  ? 58.087 38.553  27.636  1.00 34.18 ? 1781 ARG D CD  1 
ATOM   5026 N  NE  . ARG D 2 58  ? 57.187 39.529  27.027  1.00 39.52 ? 1781 ARG D NE  1 
ATOM   5027 C  CZ  . ARG D 2 58  ? 57.485 40.806  26.801  1.00 41.27 ? 1781 ARG D CZ  1 
ATOM   5028 N  NH1 . ARG D 2 58  ? 58.680 41.279  27.133  1.00 41.29 ? 1781 ARG D NH1 1 
ATOM   5029 N  NH2 . ARG D 2 58  ? 56.578 41.611  26.245  1.00 40.06 ? 1781 ARG D NH2 1 
ATOM   5030 N  N   . ALA D 2 59  ? 58.477 32.913  28.420  1.00 32.76 ? 1782 ALA D N   1 
ATOM   5031 C  CA  . ALA D 2 59  ? 58.968 31.850  29.285  1.00 34.22 ? 1782 ALA D CA  1 
ATOM   5032 C  C   . ALA D 2 59  ? 59.913 30.911  28.506  1.00 35.32 ? 1782 ALA D C   1 
ATOM   5033 O  O   . ALA D 2 59  ? 60.734 30.201  29.103  1.00 35.16 ? 1782 ALA D O   1 
ATOM   5034 C  CB  . ALA D 2 59  ? 57.792 31.080  29.872  1.00 33.58 ? 1782 ALA D CB  1 
ATOM   5035 N  N   . GLY D 2 60  ? 59.797 30.934  27.175  1.00 34.11 ? 1783 GLY D N   1 
ATOM   5036 C  CA  . GLY D 2 60  ? 60.629 30.095  26.331  1.00 33.25 ? 1783 GLY D CA  1 
ATOM   5037 C  C   . GLY D 2 60  ? 61.675 30.893  25.572  1.00 34.69 ? 1783 GLY D C   1 
ATOM   5038 O  O   . GLY D 2 60  ? 62.127 30.498  24.493  1.00 35.60 ? 1783 GLY D O   1 
ATOM   5039 N  N   . ALA D 2 61  ? 62.053 32.030  26.142  1.00 36.02 ? 1784 ALA D N   1 
ATOM   5040 C  CA  . ALA D 2 61  ? 63.063 32.901  25.556  1.00 36.84 ? 1784 ALA D CA  1 
ATOM   5041 C  C   . ALA D 2 61  ? 62.614 33.516  24.239  1.00 38.35 ? 1784 ALA D C   1 
ATOM   5042 O  O   . ALA D 2 61  ? 63.435 33.989  23.452  1.00 40.00 ? 1784 ALA D O   1 
ATOM   5043 C  CB  . ALA D 2 61  ? 64.365 32.132  25.359  1.00 36.90 ? 1784 ALA D CB  1 
ATOM   5044 N  N   . GLY D 2 62  ? 61.311 33.503  23.991  1.00 38.18 ? 1785 GLY D N   1 
ATOM   5045 C  CA  . GLY D 2 62  ? 60.817 34.102  22.766  1.00 37.30 ? 1785 GLY D CA  1 
ATOM   5046 C  C   . GLY D 2 62  ? 60.932 35.619  22.847  1.00 37.60 ? 1785 GLY D C   1 
ATOM   5047 O  O   . GLY D 2 62  ? 60.725 36.218  23.913  1.00 36.70 ? 1785 GLY D O   1 
ATOM   5048 N  N   . TYR D 2 63  ? 61.268 36.255  21.726  1.00 36.54 ? 1786 TYR D N   1 
ATOM   5049 C  CA  . TYR D 2 63  ? 61.387 37.707  21.700  1.00 35.57 ? 1786 TYR D CA  1 
ATOM   5050 C  C   . TYR D 2 63  ? 60.068 38.314  21.265  1.00 35.77 ? 1786 TYR D C   1 
ATOM   5051 O  O   . TYR D 2 63  ? 59.545 37.981  20.207  1.00 35.68 ? 1786 TYR D O   1 
ATOM   5052 C  CB  . TYR D 2 63  ? 62.488 38.145  20.738  1.00 39.98 ? 1786 TYR D CB  1 
ATOM   5053 C  CG  . TYR D 2 63  ? 62.698 39.645  20.717  1.00 45.25 ? 1786 TYR D CG  1 
ATOM   5054 C  CD1 . TYR D 2 63  ? 61.736 40.495  20.174  1.00 47.27 ? 1786 TYR D CD1 1 
ATOM   5055 C  CD2 . TYR D 2 63  ? 63.845 40.221  21.275  1.00 48.76 ? 1786 TYR D CD2 1 
ATOM   5056 C  CE1 . TYR D 2 63  ? 61.902 41.881  20.186  1.00 48.81 ? 1786 TYR D CE1 1 
ATOM   5057 C  CE2 . TYR D 2 63  ? 64.022 41.608  21.292  1.00 49.77 ? 1786 TYR D CE2 1 
ATOM   5058 C  CZ  . TYR D 2 63  ? 63.044 42.432  20.745  1.00 50.50 ? 1786 TYR D CZ  1 
ATOM   5059 O  OH  . TYR D 2 63  ? 63.197 43.806  20.752  1.00 52.09 ? 1786 TYR D OH  1 
ATOM   5060 N  N   . ILE D 2 64  ? 59.532 39.214  22.078  1.00 37.49 ? 1787 ILE D N   1 
ATOM   5061 C  CA  . ILE D 2 64  ? 58.259 39.847  21.763  1.00 38.47 ? 1787 ILE D CA  1 
ATOM   5062 C  C   . ILE D 2 64  ? 58.424 41.171  21.043  1.00 38.97 ? 1787 ILE D C   1 
ATOM   5063 O  O   . ILE D 2 64  ? 58.981 42.114  21.600  1.00 37.51 ? 1787 ILE D O   1 
ATOM   5064 C  CB  . ILE D 2 64  ? 57.446 40.090  23.031  1.00 38.12 ? 1787 ILE D CB  1 
ATOM   5065 C  CG1 . ILE D 2 64  ? 57.165 38.746  23.713  1.00 38.16 ? 1787 ILE D CG1 1 
ATOM   5066 C  CG2 . ILE D 2 64  ? 56.176 40.849  22.692  1.00 38.27 ? 1787 ILE D CG2 1 
ATOM   5067 C  CD1 . ILE D 2 64  ? 56.725 37.637  22.745  1.00 35.92 ? 1787 ILE D CD1 1 
ATOM   5068 N  N   . LEU D 2 65  ? 57.927 41.241  19.809  1.00 41.21 ? 1788 LEU D N   1 
ATOM   5069 C  CA  . LEU D 2 65  ? 58.030 42.464  19.025  1.00 42.55 ? 1788 LEU D CA  1 
ATOM   5070 C  C   . LEU D 2 65  ? 56.915 43.434  19.347  1.00 45.92 ? 1788 LEU D C   1 
ATOM   5071 O  O   . LEU D 2 65  ? 55.710 43.104  19.275  1.00 47.23 ? 1788 LEU D O   1 
ATOM   5072 C  CB  . LEU D 2 65  ? 58.024 42.172  17.517  1.00 40.64 ? 1788 LEU D CB  1 
ATOM   5073 C  CG  . LEU D 2 65  ? 59.217 41.438  16.894  1.00 41.33 ? 1788 LEU D CG  1 
ATOM   5074 C  CD1 . LEU D 2 65  ? 59.046 41.374  15.373  1.00 39.04 ? 1788 LEU D CD1 1 
ATOM   5075 C  CD2 . LEU D 2 65  ? 60.514 42.153  17.246  1.00 39.34 ? 1788 LEU D CD2 1 
ATOM   5076 N  N   . GLU D 2 66  ? 57.375 44.638  19.687  1.00 48.15 ? 1789 GLU D N   1 
ATOM   5077 C  CA  . GLU D 2 66  ? 56.546 45.773  20.045  1.00 52.46 ? 1789 GLU D CA  1 
ATOM   5078 C  C   . GLU D 2 66  ? 55.769 46.217  18.818  1.00 52.24 ? 1789 GLU D C   1 
ATOM   5079 O  O   . GLU D 2 66  ? 54.547 46.377  18.870  1.00 53.82 ? 1789 GLU D O   1 
ATOM   5080 C  CB  . GLU D 2 66  ? 57.440 46.905  20.576  1.00 54.99 ? 1789 GLU D CB  1 
ATOM   5081 C  CG  . GLU D 2 66  ? 58.092 46.577  21.935  1.00 60.24 ? 1789 GLU D CG  1 
ATOM   5082 C  CD  . GLU D 2 66  ? 59.012 47.682  22.468  1.00 63.44 ? 1789 GLU D CD  1 
ATOM   5083 O  OE1 . GLU D 2 66  ? 58.659 48.879  22.336  1.00 65.09 ? 1789 GLU D OE1 1 
ATOM   5084 O  OE2 . GLU D 2 66  ? 60.082 47.347  23.036  1.00 62.59 ? 1789 GLU D OE2 1 
ATOM   5085 N  N   . ASP D 2 67  ? 56.482 46.406  17.712  1.00 51.42 ? 1790 ASP D N   1 
ATOM   5086 C  CA  . ASP D 2 67  ? 55.849 46.798  16.464  1.00 48.82 ? 1790 ASP D CA  1 
ATOM   5087 C  C   . ASP D 2 67  ? 56.564 46.158  15.272  1.00 46.67 ? 1790 ASP D C   1 
ATOM   5088 O  O   . ASP D 2 67  ? 57.667 45.616  15.405  1.00 45.37 ? 1790 ASP D O   1 
ATOM   5089 C  CB  . ASP D 2 67  ? 55.847 48.316  16.313  1.00 51.62 ? 1790 ASP D CB  1 
ATOM   5090 C  CG  . ASP D 2 67  ? 54.665 48.810  15.491  1.00 58.31 ? 1790 ASP D CG  1 
ATOM   5091 O  OD1 . ASP D 2 67  ? 54.291 48.113  14.517  1.00 59.99 ? 1790 ASP D OD1 1 
ATOM   5092 O  OD2 . ASP D 2 67  ? 54.109 49.891  15.809  1.00 60.20 ? 1790 ASP D OD2 1 
ATOM   5093 N  N   . PHE D 2 68  ? 55.924 46.223  14.107  1.00 43.50 ? 1791 PHE D N   1 
ATOM   5094 C  CA  . PHE D 2 68  ? 56.474 45.653  12.883  1.00 40.68 ? 1791 PHE D CA  1 
ATOM   5095 C  C   . PHE D 2 68  ? 57.861 46.184  12.537  1.00 41.15 ? 1791 PHE D C   1 
ATOM   5096 O  O   . PHE D 2 68  ? 58.607 45.539  11.809  1.00 41.48 ? 1791 PHE D O   1 
ATOM   5097 C  CB  . PHE D 2 68  ? 55.523 45.915  11.714  1.00 36.58 ? 1791 PHE D CB  1 
ATOM   5098 C  CG  . PHE D 2 68  ? 56.090 45.538  10.388  1.00 32.51 ? 1791 PHE D CG  1 
ATOM   5099 C  CD1 . PHE D 2 68  ? 56.508 46.511  9.498   1.00 32.95 ? 1791 PHE D CD1 1 
ATOM   5100 C  CD2 . PHE D 2 68  ? 56.276 44.205  10.057  1.00 33.42 ? 1791 PHE D CD2 1 
ATOM   5101 C  CE1 . PHE D 2 68  ? 57.117 46.161  8.293   1.00 33.92 ? 1791 PHE D CE1 1 
ATOM   5102 C  CE2 . PHE D 2 68  ? 56.881 43.842  8.856   1.00 33.96 ? 1791 PHE D CE2 1 
ATOM   5103 C  CZ  . PHE D 2 68  ? 57.305 44.822  7.972   1.00 33.24 ? 1791 PHE D CZ  1 
ATOM   5104 N  N   . ASN D 2 69  ? 58.197 47.356  13.064  1.00 43.40 ? 1792 ASN D N   1 
ATOM   5105 C  CA  . ASN D 2 69  ? 59.486 47.998  12.809  1.00 45.26 ? 1792 ASN D CA  1 
ATOM   5106 C  C   . ASN D 2 69  ? 60.720 47.156  13.183  1.00 45.43 ? 1792 ASN D C   1 
ATOM   5107 O  O   . ASN D 2 69  ? 61.597 47.623  13.908  1.00 43.57 ? 1792 ASN D O   1 
ATOM   5108 C  CB  . ASN D 2 69  ? 59.536 49.341  13.552  1.00 47.47 ? 1792 ASN D CB  1 
ATOM   5109 C  CG  . ASN D 2 69  ? 60.343 50.399  12.809  1.00 50.25 ? 1792 ASN D CG  1 
ATOM   5110 O  OD1 . ASN D 2 69  ? 60.017 50.758  11.678  1.00 50.37 ? 1792 ASN D OD1 1 
ATOM   5111 N  ND2 . ASN D 2 69  ? 61.398 50.910  13.447  1.00 52.15 ? 1792 ASN D ND2 1 
ATOM   5112 N  N   . GLU D 2 70  ? 60.783 45.923  12.683  1.00 46.76 ? 1793 GLU D N   1 
ATOM   5113 C  CA  . GLU D 2 70  ? 61.909 45.015  12.926  1.00 46.42 ? 1793 GLU D CA  1 
ATOM   5114 C  C   . GLU D 2 70  ? 61.877 43.832  11.952  1.00 44.21 ? 1793 GLU D C   1 
ATOM   5115 O  O   . GLU D 2 70  ? 62.732 43.704  11.069  1.00 41.80 ? 1793 GLU D O   1 
ATOM   5116 C  CB  . GLU D 2 70  ? 61.890 44.478  14.365  1.00 48.14 ? 1793 GLU D CB  1 
ATOM   5117 C  CG  . GLU D 2 70  ? 62.474 45.405  15.433  1.00 50.68 ? 1793 GLU D CG  1 
ATOM   5118 C  CD  . GLU D 2 70  ? 61.404 46.087  16.287  1.00 54.97 ? 1793 GLU D CD  1 
ATOM   5119 O  OE1 . GLU D 2 70  ? 61.700 46.422  17.462  1.00 51.92 ? 1793 GLU D OE1 1 
ATOM   5120 O  OE2 . GLU D 2 70  ? 60.273 46.296  15.782  1.00 56.08 ? 1793 GLU D OE2 1 
ATOM   5121 N  N   . ASN D 2 74  ? 67.217 43.265  11.013  1.00 36.01 ? 1797 ASN D N   1 
ATOM   5122 C  CA  . ASN D 2 74  ? 67.141 41.890  11.524  1.00 37.14 ? 1797 ASN D CA  1 
ATOM   5123 C  C   . ASN D 2 74  ? 67.905 40.896  10.663  1.00 37.61 ? 1797 ASN D C   1 
ATOM   5124 O  O   . ASN D 2 74  ? 67.563 40.674  9.499   1.00 40.35 ? 1797 ASN D O   1 
ATOM   5125 C  CB  . ASN D 2 74  ? 65.683 41.416  11.650  1.00 34.48 ? 1797 ASN D CB  1 
ATOM   5126 C  CG  . ASN D 2 74  ? 65.578 39.920  11.960  1.00 35.87 ? 1797 ASN D CG  1 
ATOM   5127 O  OD1 . ASN D 2 74  ? 66.505 39.315  12.506  1.00 36.82 ? 1797 ASN D OD1 1 
ATOM   5128 N  ND2 . ASN D 2 74  ? 64.440 39.321  11.619  1.00 36.05 ? 1797 ASN D ND2 1 
ATOM   5129 N  N   . THR D 2 75  ? 68.934 40.294  11.249  1.00 37.07 ? 1798 THR D N   1 
ATOM   5130 C  CA  . THR D 2 75  ? 69.755 39.319  10.547  1.00 37.95 ? 1798 THR D CA  1 
ATOM   5131 C  C   . THR D 2 75  ? 69.894 38.015  11.338  1.00 40.05 ? 1798 THR D C   1 
ATOM   5132 O  O   . THR D 2 75  ? 70.801 37.214  11.074  1.00 40.55 ? 1798 THR D O   1 
ATOM   5133 C  CB  . THR D 2 75  ? 71.193 39.896  10.204  1.00 36.47 ? 1798 THR D CB  1 
ATOM   5134 O  OG1 . THR D 2 75  ? 71.723 40.634  11.316  1.00 30.72 ? 1798 THR D OG1 1 
ATOM   5135 C  CG2 . THR D 2 75  ? 71.128 40.814  8.985   1.00 34.70 ? 1798 THR D CG2 1 
ATOM   5136 N  N   . ALA D 2 76  ? 68.989 37.787  12.292  1.00 40.65 ? 1799 ALA D N   1 
ATOM   5137 C  CA  . ALA D 2 76  ? 69.051 36.561  13.092  1.00 41.14 ? 1799 ALA D CA  1 
ATOM   5138 C  C   . ALA D 2 76  ? 67.707 35.942  13.482  1.00 42.17 ? 1799 ALA D C   1 
ATOM   5139 O  O   . ALA D 2 76  ? 67.618 34.725  13.668  1.00 42.50 ? 1799 ALA D O   1 
ATOM   5140 C  CB  . ALA D 2 76  ? 69.874 36.803  14.349  1.00 40.03 ? 1799 ALA D CB  1 
ATOM   5141 N  N   . TYR D 2 77  ? 66.658 36.749  13.603  1.00 42.16 ? 1800 TYR D N   1 
ATOM   5142 C  CA  . TYR D 2 77  ? 65.378 36.179  14.007  1.00 42.42 ? 1800 TYR D CA  1 
ATOM   5143 C  C   . TYR D 2 77  ? 64.376 35.846  12.910  1.00 41.20 ? 1800 TYR D C   1 
ATOM   5144 O  O   . TYR D 2 77  ? 64.239 36.568  11.917  1.00 42.23 ? 1800 TYR D O   1 
ATOM   5145 C  CB  . TYR D 2 77  ? 64.700 37.087  15.032  1.00 44.79 ? 1800 TYR D CB  1 
ATOM   5146 C  CG  . TYR D 2 77  ? 65.566 37.373  16.227  1.00 48.78 ? 1800 TYR D CG  1 
ATOM   5147 C  CD1 . TYR D 2 77  ? 66.508 38.400  16.198  1.00 50.28 ? 1800 TYR D CD1 1 
ATOM   5148 C  CD2 . TYR D 2 77  ? 65.495 36.576  17.366  1.00 49.39 ? 1800 TYR D CD2 1 
ATOM   5149 C  CE1 . TYR D 2 77  ? 67.364 38.626  17.273  1.00 51.99 ? 1800 TYR D CE1 1 
ATOM   5150 C  CE2 . TYR D 2 77  ? 66.347 36.791  18.445  1.00 52.95 ? 1800 TYR D CE2 1 
ATOM   5151 C  CZ  . TYR D 2 77  ? 67.280 37.815  18.391  1.00 53.03 ? 1800 TYR D CZ  1 
ATOM   5152 O  OH  . TYR D 2 77  ? 68.141 38.014  19.445  1.00 55.00 ? 1800 TYR D OH  1 
ATOM   5153 N  N   . GLN D 2 78  ? 63.688 34.727  13.108  1.00 37.77 ? 1801 GLN D N   1 
ATOM   5154 C  CA  . GLN D 2 78  ? 62.640 34.270  12.213  1.00 35.19 ? 1801 GLN D CA  1 
ATOM   5155 C  C   . GLN D 2 78  ? 61.365 34.846  12.836  1.00 35.12 ? 1801 GLN D C   1 
ATOM   5156 O  O   . GLN D 2 78  ? 60.950 34.425  13.917  1.00 35.54 ? 1801 GLN D O   1 
ATOM   5157 C  CB  . GLN D 2 78  ? 62.574 32.736  12.204  1.00 34.14 ? 1801 GLN D CB  1 
ATOM   5158 C  CG  . GLN D 2 78  ? 61.283 32.178  11.617  1.00 31.84 ? 1801 GLN D CG  1 
ATOM   5159 C  CD  . GLN D 2 78  ? 61.091 32.564  10.162  1.00 36.46 ? 1801 GLN D CD  1 
ATOM   5160 O  OE1 . GLN D 2 78  ? 61.725 31.997  9.270   1.00 40.97 ? 1801 GLN D OE1 1 
ATOM   5161 N  NE2 . GLN D 2 78  ? 60.226 33.549  9.912   1.00 34.30 ? 1801 GLN D NE2 1 
ATOM   5162 N  N   . CYS D 2 79  ? 60.750 35.821  12.177  1.00 34.28 ? 1802 CYS D N   1 
ATOM   5163 C  CA  . CYS D 2 79  ? 59.541 36.423  12.729  1.00 34.02 ? 1802 CYS D CA  1 
ATOM   5164 C  C   . CYS D 2 79  ? 58.268 35.636  12.422  1.00 32.15 ? 1802 CYS D C   1 
ATOM   5165 O  O   . CYS D 2 79  ? 58.089 35.126  11.313  1.00 31.98 ? 1802 CYS D O   1 
ATOM   5166 C  CB  . CYS D 2 79  ? 59.384 37.864  12.225  1.00 32.63 ? 1802 CYS D CB  1 
ATOM   5167 S  SG  . CYS D 2 79  ? 60.748 38.965  12.697  1.00 32.34 ? 1802 CYS D SG  1 
ATOM   5168 N  N   . LEU D 2 80  ? 57.390 35.536  13.417  1.00 29.24 ? 1803 LEU D N   1 
ATOM   5169 C  CA  . LEU D 2 80  ? 56.124 34.840  13.244  1.00 28.52 ? 1803 LEU D CA  1 
ATOM   5170 C  C   . LEU D 2 80  ? 55.016 35.708  13.807  1.00 28.67 ? 1803 LEU D C   1 
ATOM   5171 O  O   . LEU D 2 80  ? 55.178 36.353  14.843  1.00 30.52 ? 1803 LEU D O   1 
ATOM   5172 C  CB  . LEU D 2 80  ? 56.119 33.493  13.975  1.00 29.02 ? 1803 LEU D CB  1 
ATOM   5173 C  CG  . LEU D 2 80  ? 57.107 32.373  13.610  1.00 31.80 ? 1803 LEU D CG  1 
ATOM   5174 C  CD1 . LEU D 2 80  ? 56.662 31.102  14.326  1.00 31.26 ? 1803 LEU D CD1 1 
ATOM   5175 C  CD2 . LEU D 2 80  ? 57.152 32.134  12.092  1.00 27.27 ? 1803 LEU D CD2 1 
ATOM   5176 N  N   . LEU D 2 81  ? 53.891 35.744  13.113  1.00 30.49 ? 1804 LEU D N   1 
ATOM   5177 C  CA  . LEU D 2 81  ? 52.757 36.525  13.576  1.00 30.70 ? 1804 LEU D CA  1 
ATOM   5178 C  C   . LEU D 2 81  ? 51.837 35.529  14.295  1.00 30.86 ? 1804 LEU D C   1 
ATOM   5179 O  O   . LEU D 2 81  ? 51.624 34.413  13.812  1.00 33.50 ? 1804 LEU D O   1 
ATOM   5180 C  CB  . LEU D 2 81  ? 52.048 37.156  12.379  1.00 27.86 ? 1804 LEU D CB  1 
ATOM   5181 C  CG  . LEU D 2 81  ? 51.061 38.292  12.633  1.00 28.35 ? 1804 LEU D CG  1 
ATOM   5182 C  CD1 . LEU D 2 81  ? 50.401 38.661  11.330  1.00 29.12 ? 1804 LEU D CD1 1 
ATOM   5183 C  CD2 . LEU D 2 81  ? 50.006 37.858  13.626  1.00 31.15 ? 1804 LEU D CD2 1 
ATOM   5184 N  N   . ILE D 2 82  ? 51.310 35.916  15.452  1.00 28.31 ? 1805 ILE D N   1 
ATOM   5185 C  CA  . ILE D 2 82  ? 50.425 35.030  16.202  1.00 28.19 ? 1805 ILE D CA  1 
ATOM   5186 C  C   . ILE D 2 82  ? 49.014 35.635  16.273  1.00 28.49 ? 1805 ILE D C   1 
ATOM   5187 O  O   . ILE D 2 82  ? 48.849 36.806  16.629  1.00 26.83 ? 1805 ILE D O   1 
ATOM   5188 C  CB  . ILE D 2 82  ? 50.942 34.817  17.638  1.00 24.97 ? 1805 ILE D CB  1 
ATOM   5189 C  CG1 . ILE D 2 82  ? 52.416 34.381  17.617  1.00 25.53 ? 1805 ILE D CG1 1 
ATOM   5190 C  CG2 . ILE D 2 82  ? 50.074 33.788  18.345  1.00 23.36 ? 1805 ILE D CG2 1 
ATOM   5191 C  CD1 . ILE D 2 82  ? 52.662 32.924  17.218  1.00 27.62 ? 1805 ILE D CD1 1 
ATOM   5192 N  N   . ALA D 2 83  ? 48.007 34.832  15.925  1.00 27.80 ? 1806 ALA D N   1 
ATOM   5193 C  CA  . ALA D 2 83  ? 46.622 35.279  15.947  1.00 29.31 ? 1806 ALA D CA  1 
ATOM   5194 C  C   . ALA D 2 83  ? 45.671 34.093  16.047  1.00 30.80 ? 1806 ALA D C   1 
ATOM   5195 O  O   . ALA D 2 83  ? 46.064 32.945  15.825  1.00 30.17 ? 1806 ALA D O   1 
ATOM   5196 C  CB  . ALA D 2 83  ? 46.319 36.088  14.696  1.00 29.74 ? 1806 ALA D CB  1 
ATOM   5197 N  N   . ASP D 2 84  ? 44.414 34.380  16.376  1.00 33.59 ? 1807 ASP D N   1 
ATOM   5198 C  CA  . ASP D 2 84  ? 43.389 33.346  16.511  1.00 34.54 ? 1807 ASP D CA  1 
ATOM   5199 C  C   . ASP D 2 84  ? 42.708 33.065  15.185  1.00 33.47 ? 1807 ASP D C   1 
ATOM   5200 O  O   . ASP D 2 84  ? 42.018 32.061  15.040  1.00 36.51 ? 1807 ASP D O   1 
ATOM   5201 C  CB  . ASP D 2 84  ? 42.315 33.793  17.507  1.00 37.05 ? 1807 ASP D CB  1 
ATOM   5202 C  CG  . ASP D 2 84  ? 41.683 35.143  17.129  1.00 44.37 ? 1807 ASP D CG  1 
ATOM   5203 O  OD1 . ASP D 2 84  ? 41.249 35.302  15.966  1.00 46.40 ? 1807 ASP D OD1 1 
ATOM   5204 O  OD2 . ASP D 2 84  ? 41.608 36.051  17.994  1.00 47.37 ? 1807 ASP D OD2 1 
ATOM   5205 N  N   . GLN D 2 85  ? 42.880 33.967  14.226  1.00 31.64 ? 1808 GLN D N   1 
ATOM   5206 C  CA  . GLN D 2 85  ? 42.253 33.815  12.923  1.00 30.45 ? 1808 GLN D CA  1 
ATOM   5207 C  C   . GLN D 2 85  ? 42.759 34.903  12.004  1.00 29.86 ? 1808 GLN D C   1 
ATOM   5208 O  O   . GLN D 2 85  ? 43.459 35.816  12.438  1.00 31.45 ? 1808 GLN D O   1 
ATOM   5209 C  CB  . GLN D 2 85  ? 40.735 33.931  13.056  1.00 31.10 ? 1808 GLN D CB  1 
ATOM   5210 C  CG  . GLN D 2 85  ? 40.218 35.347  13.271  1.00 33.68 ? 1808 GLN D CG  1 
ATOM   5211 C  CD  . GLN D 2 85  ? 38.724 35.382  13.633  1.00 38.73 ? 1808 GLN D CD  1 
ATOM   5212 O  OE1 . GLN D 2 85  ? 37.887 34.755  12.971  1.00 38.08 ? 1808 GLN D OE1 1 
ATOM   5213 N  NE2 . GLN D 2 85  ? 38.390 36.124  14.688  1.00 39.77 ? 1808 GLN D NE2 1 
ATOM   5214 N  N   . HIS D 2 86  ? 42.408 34.815  10.730  1.00 28.08 ? 1809 HIS D N   1 
ATOM   5215 C  CA  . HIS D 2 86  ? 42.843 35.836  9.794   1.00 27.19 ? 1809 HIS D CA  1 
ATOM   5216 C  C   . HIS D 2 86  ? 42.075 37.107  10.132  1.00 27.43 ? 1809 HIS D C   1 
ATOM   5217 O  O   . HIS D 2 86  ? 40.876 37.052  10.427  1.00 24.62 ? 1809 HIS D O   1 
ATOM   5218 C  CB  . HIS D 2 86  ? 42.520 35.423  8.363   1.00 25.25 ? 1809 HIS D CB  1 
ATOM   5219 C  CG  . HIS D 2 86  ? 41.056 35.264  8.104   1.00 24.23 ? 1809 HIS D CG  1 
ATOM   5220 N  ND1 . HIS D 2 86  ? 40.329 34.187  8.570   1.00 26.07 ? 1809 HIS D ND1 1 
ATOM   5221 C  CD2 . HIS D 2 86  ? 40.174 36.064  7.459   1.00 20.18 ? 1809 HIS D CD2 1 
ATOM   5222 C  CE1 . HIS D 2 86  ? 39.061 34.329  8.221   1.00 23.42 ? 1809 HIS D CE1 1 
ATOM   5223 N  NE2 . HIS D 2 86  ? 38.941 35.460  7.546   1.00 24.72 ? 1809 HIS D NE2 1 
ATOM   5224 N  N   . CYS D 2 87  ? 42.765 38.247  10.108  1.00 30.24 ? 1810 CYS D N   1 
ATOM   5225 C  CA  . CYS D 2 87  ? 42.119 39.526  10.389  1.00 31.01 ? 1810 CYS D CA  1 
ATOM   5226 C  C   . CYS D 2 87  ? 42.666 40.675  9.569   1.00 31.64 ? 1810 CYS D C   1 
ATOM   5227 O  O   . CYS D 2 87  ? 43.701 40.553  8.907   1.00 32.79 ? 1810 CYS D O   1 
ATOM   5228 C  CB  . CYS D 2 87  ? 42.207 39.877  11.869  1.00 30.10 ? 1810 CYS D CB  1 
ATOM   5229 S  SG  . CYS D 2 87  ? 43.600 39.158  12.676  1.00 30.84 ? 1810 CYS D SG  1 
ATOM   5230 N  N   . ARG D 2 88  ? 41.937 41.788  9.618   1.00 31.72 ? 1811 ARG D N   1 
ATOM   5231 C  CA  . ARG D 2 88  ? 42.272 43.007  8.892   1.00 29.75 ? 1811 ARG D CA  1 
ATOM   5232 C  C   . ARG D 2 88  ? 42.858 44.060  9.833   1.00 31.80 ? 1811 ARG D C   1 
ATOM   5233 O  O   . ARG D 2 88  ? 42.215 45.077  10.115  1.00 33.65 ? 1811 ARG D O   1 
ATOM   5234 C  CB  . ARG D 2 88  ? 41.007 43.583  8.238   1.00 25.29 ? 1811 ARG D CB  1 
ATOM   5235 C  CG  . ARG D 2 88  ? 40.314 42.656  7.246   1.00 22.47 ? 1811 ARG D CG  1 
ATOM   5236 C  CD  . ARG D 2 88  ? 38.844 43.069  7.024   1.00 23.68 ? 1811 ARG D CD  1 
ATOM   5237 N  NE  . ARG D 2 88  ? 38.670 44.269  6.203   1.00 25.01 ? 1811 ARG D NE  1 
ATOM   5238 C  CZ  . ARG D 2 88  ? 38.737 44.288  4.871   1.00 25.60 ? 1811 ARG D CZ  1 
ATOM   5239 N  NH1 . ARG D 2 88  ? 38.978 43.170  4.197   1.00 27.89 ? 1811 ARG D NH1 1 
ATOM   5240 N  NH2 . ARG D 2 88  ? 38.535 45.420  4.205   1.00 21.67 ? 1811 ARG D NH2 1 
ATOM   5241 N  N   . THR D 2 89  ? 44.074 43.825  10.312  1.00 31.01 ? 1812 THR D N   1 
ATOM   5242 C  CA  . THR D 2 89  ? 44.724 44.767  11.201  1.00 31.88 ? 1812 THR D CA  1 
ATOM   5243 C  C   . THR D 2 89  ? 46.058 45.206  10.599  1.00 33.32 ? 1812 THR D C   1 
ATOM   5244 O  O   . THR D 2 89  ? 46.628 44.508  9.762   1.00 35.31 ? 1812 THR D O   1 
ATOM   5245 C  CB  . THR D 2 89  ? 44.972 44.117  12.559  1.00 33.83 ? 1812 THR D CB  1 
ATOM   5246 O  OG1 . THR D 2 89  ? 45.893 43.027  12.398  1.00 32.99 ? 1812 THR D OG1 1 
ATOM   5247 C  CG2 . THR D 2 89  ? 43.649 43.595  13.141  1.00 30.65 ? 1812 THR D CG2 1 
ATOM   5248 N  N   . ARG D 2 90  ? 46.548 46.364  11.027  1.00 33.03 ? 1813 ARG D N   1 
ATOM   5249 C  CA  . ARG D 2 90  ? 47.816 46.892  10.543  1.00 33.02 ? 1813 ARG D CA  1 
ATOM   5250 C  C   . ARG D 2 90  ? 48.885 45.793  10.616  1.00 33.93 ? 1813 ARG D C   1 
ATOM   5251 O  O   . ARG D 2 90  ? 49.595 45.522  9.641   1.00 35.61 ? 1813 ARG D O   1 
ATOM   5252 C  CB  . ARG D 2 90  ? 48.227 48.089  11.404  1.00 32.23 ? 1813 ARG D CB  1 
ATOM   5253 C  CG  . ARG D 2 90  ? 49.429 48.859  10.904  1.00 36.56 ? 1813 ARG D CG  1 
ATOM   5254 C  CD  . ARG D 2 90  ? 49.819 49.934  11.904  1.00 39.14 ? 1813 ARG D CD  1 
ATOM   5255 N  NE  . ARG D 2 90  ? 50.306 49.321  13.135  1.00 44.44 ? 1813 ARG D NE  1 
ATOM   5256 C  CZ  . ARG D 2 90  ? 51.580 49.010  13.367  1.00 46.30 ? 1813 ARG D CZ  1 
ATOM   5257 N  NH1 . ARG D 2 90  ? 52.512 49.269  12.452  1.00 41.62 ? 1813 ARG D NH1 1 
ATOM   5258 N  NH2 . ARG D 2 90  ? 51.914 48.411  14.510  1.00 46.52 ? 1813 ARG D NH2 1 
ATOM   5259 N  N   . LYS D 2 91  ? 48.985 45.143  11.769  1.00 32.01 ? 1814 LYS D N   1 
ATOM   5260 C  CA  . LYS D 2 91  ? 49.972 44.093  11.941  1.00 32.43 ? 1814 LYS D CA  1 
ATOM   5261 C  C   . LYS D 2 91  ? 49.768 42.918  10.970  1.00 31.64 ? 1814 LYS D C   1 
ATOM   5262 O  O   . LYS D 2 91  ? 50.744 42.321  10.492  1.00 30.93 ? 1814 LYS D O   1 
ATOM   5263 C  CB  . LYS D 2 91  ? 49.956 43.598  13.393  1.00 33.88 ? 1814 LYS D CB  1 
ATOM   5264 C  CG  . LYS D 2 91  ? 50.360 44.650  14.414  1.00 35.86 ? 1814 LYS D CG  1 
ATOM   5265 C  CD  . LYS D 2 91  ? 50.222 44.121  15.838  1.00 37.96 ? 1814 LYS D CD  1 
ATOM   5266 C  CE  . LYS D 2 91  ? 50.789 45.113  16.858  1.00 40.60 ? 1814 LYS D CE  1 
ATOM   5267 N  NZ  . LYS D 2 91  ? 50.431 44.777  18.274  1.00 40.38 ? 1814 LYS D NZ  1 
ATOM   5268 N  N   . TYR D 2 92  ? 48.516 42.581  10.672  1.00 29.55 ? 1815 TYR D N   1 
ATOM   5269 C  CA  . TYR D 2 92  ? 48.261 41.464  9.760   1.00 30.71 ? 1815 TYR D CA  1 
ATOM   5270 C  C   . TYR D 2 92  ? 48.709 41.822  8.349   1.00 30.43 ? 1815 TYR D C   1 
ATOM   5271 O  O   . TYR D 2 92  ? 49.476 41.098  7.720   1.00 33.33 ? 1815 TYR D O   1 
ATOM   5272 C  CB  . TYR D 2 92  ? 46.776 41.108  9.728   1.00 31.46 ? 1815 TYR D CB  1 
ATOM   5273 C  CG  . TYR D 2 92  ? 46.532 39.630  9.534   1.00 31.54 ? 1815 TYR D CG  1 
ATOM   5274 C  CD1 . TYR D 2 92  ? 46.650 38.750  10.606  1.00 30.71 ? 1815 TYR D CD1 1 
ATOM   5275 C  CD2 . TYR D 2 92  ? 46.224 39.102  8.274   1.00 32.73 ? 1815 TYR D CD2 1 
ATOM   5276 C  CE1 . TYR D 2 92  ? 46.473 37.386  10.441  1.00 30.69 ? 1815 TYR D CE1 1 
ATOM   5277 C  CE2 . TYR D 2 92  ? 46.042 37.726  8.096   1.00 32.56 ? 1815 TYR D CE2 1 
ATOM   5278 C  CZ  . TYR D 2 92  ? 46.172 36.876  9.193   1.00 32.19 ? 1815 TYR D CZ  1 
ATOM   5279 O  OH  . TYR D 2 92  ? 46.019 35.516  9.057   1.00 32.64 ? 1815 TYR D OH  1 
ATOM   5280 N  N   . PHE D 2 93  ? 48.224 42.950  7.858   1.00 29.15 ? 1816 PHE D N   1 
ATOM   5281 C  CA  . PHE D 2 93  ? 48.581 43.398  6.530   1.00 31.20 ? 1816 PHE D CA  1 
ATOM   5282 C  C   . PHE D 2 93  ? 50.106 43.587  6.382   1.00 33.41 ? 1816 PHE D C   1 
ATOM   5283 O  O   . PHE D 2 93  ? 50.670 43.318  5.320   1.00 35.58 ? 1816 PHE D O   1 
ATOM   5284 C  CB  . PHE D 2 93  ? 47.837 44.695  6.234   1.00 31.77 ? 1816 PHE D CB  1 
ATOM   5285 C  CG  . PHE D 2 93  ? 46.319 44.559  6.225   1.00 30.61 ? 1816 PHE D CG  1 
ATOM   5286 C  CD1 . PHE D 2 93  ? 45.510 45.661  6.514   1.00 30.91 ? 1816 PHE D CD1 1 
ATOM   5287 C  CD2 . PHE D 2 93  ? 45.705 43.380  5.827   1.00 30.59 ? 1816 PHE D CD2 1 
ATOM   5288 C  CE1 . PHE D 2 93  ? 44.112 45.592  6.396   1.00 30.28 ? 1816 PHE D CE1 1 
ATOM   5289 C  CE2 . PHE D 2 93  ? 44.309 43.299  5.703   1.00 31.16 ? 1816 PHE D CE2 1 
ATOM   5290 C  CZ  . PHE D 2 93  ? 43.514 44.415  5.988   1.00 32.08 ? 1816 PHE D CZ  1 
ATOM   5291 N  N   . LEU D 2 94  ? 50.780 44.025  7.442   1.00 32.59 ? 1817 LEU D N   1 
ATOM   5292 C  CA  . LEU D 2 94  ? 52.220 44.228  7.351   1.00 32.88 ? 1817 LEU D CA  1 
ATOM   5293 C  C   . LEU D 2 94  ? 52.936 42.900  7.176   1.00 34.58 ? 1817 LEU D C   1 
ATOM   5294 O  O   . LEU D 2 94  ? 53.938 42.809  6.454   1.00 36.67 ? 1817 LEU D O   1 
ATOM   5295 C  CB  . LEU D 2 94  ? 52.743 44.943  8.604   1.00 34.21 ? 1817 LEU D CB  1 
ATOM   5296 C  CG  . LEU D 2 94  ? 52.332 46.412  8.777   1.00 33.87 ? 1817 LEU D CG  1 
ATOM   5297 C  CD1 . LEU D 2 94  ? 52.622 46.862  10.196  1.00 31.02 ? 1817 LEU D CD1 1 
ATOM   5298 C  CD2 . LEU D 2 94  ? 53.076 47.282  7.760   1.00 33.96 ? 1817 LEU D CD2 1 
ATOM   5299 N  N   . CYS D 2 95  ? 52.416 41.861  7.824   1.00 32.85 ? 1818 CYS D N   1 
ATOM   5300 C  CA  . CYS D 2 95  ? 53.044 40.552  7.732   1.00 33.22 ? 1818 CYS D CA  1 
ATOM   5301 C  C   . CYS D 2 95  ? 52.756 39.892  6.381   1.00 32.94 ? 1818 CYS D C   1 
ATOM   5302 O  O   . CYS D 2 95  ? 53.594 39.164  5.841   1.00 35.28 ? 1818 CYS D O   1 
ATOM   5303 C  CB  . CYS D 2 95  ? 52.585 39.674  8.905   1.00 33.49 ? 1818 CYS D CB  1 
ATOM   5304 S  SG  . CYS D 2 95  ? 53.051 40.354  10.551  1.00 31.45 ? 1818 CYS D SG  1 
ATOM   5305 N  N   . LEU D 2 96  ? 51.579 40.153  5.825   1.00 30.61 ? 1819 LEU D N   1 
ATOM   5306 C  CA  . LEU D 2 96  ? 51.246 39.590  4.529   1.00 28.44 ? 1819 LEU D CA  1 
ATOM   5307 C  C   . LEU D 2 96  ? 52.130 40.255  3.503   1.00 29.13 ? 1819 LEU D C   1 
ATOM   5308 O  O   . LEU D 2 96  ? 52.580 39.619  2.548   1.00 30.91 ? 1819 LEU D O   1 
ATOM   5309 C  CB  . LEU D 2 96  ? 49.790 39.856  4.181   1.00 26.58 ? 1819 LEU D CB  1 
ATOM   5310 C  CG  . LEU D 2 96  ? 48.757 39.024  4.930   1.00 24.31 ? 1819 LEU D CG  1 
ATOM   5311 C  CD1 . LEU D 2 96  ? 47.349 39.473  4.509   1.00 21.03 ? 1819 LEU D CD1 1 
ATOM   5312 C  CD2 . LEU D 2 96  ? 48.997 37.538  4.621   1.00 20.70 ? 1819 LEU D CD2 1 
ATOM   5313 N  N   . ALA D 2 97  ? 52.390 41.540  3.715   1.00 29.66 ? 1820 ALA D N   1 
ATOM   5314 C  CA  . ALA D 2 97  ? 53.219 42.299  2.793   1.00 28.92 ? 1820 ALA D CA  1 
ATOM   5315 C  C   . ALA D 2 97  ? 54.703 41.961  2.903   1.00 28.05 ? 1820 ALA D C   1 
ATOM   5316 O  O   . ALA D 2 97  ? 55.423 42.058  1.910   1.00 29.77 ? 1820 ALA D O   1 
ATOM   5317 C  CB  . ALA D 2 97  ? 52.997 43.790  3.010   1.00 29.03 ? 1820 ALA D CB  1 
ATOM   5318 N  N   . SER D 2 98  ? 55.150 41.527  4.083   1.00 25.56 ? 1821 SER D N   1 
ATOM   5319 C  CA  . SER D 2 98  ? 56.569 41.225  4.301   1.00 26.11 ? 1821 SER D CA  1 
ATOM   5320 C  C   . SER D 2 98  ? 56.976 39.751  4.352   1.00 28.02 ? 1821 SER D C   1 
ATOM   5321 O  O   . SER D 2 98  ? 58.163 39.424  4.556   1.00 26.22 ? 1821 SER D O   1 
ATOM   5322 C  CB  . SER D 2 98  ? 57.031 41.885  5.591   1.00 25.02 ? 1821 SER D CB  1 
ATOM   5323 O  OG  . SER D 2 98  ? 56.279 41.372  6.679   1.00 28.20 ? 1821 SER D OG  1 
ATOM   5324 N  N   . GLY D 2 99  ? 56.014 38.853  4.195   1.00 27.34 ? 1822 GLY D N   1 
ATOM   5325 C  CA  . GLY D 2 99  ? 56.365 37.446  4.234   1.00 27.58 ? 1822 GLY D CA  1 
ATOM   5326 C  C   . GLY D 2 99  ? 56.511 36.847  5.625   1.00 29.69 ? 1822 GLY D C   1 
ATOM   5327 O  O   . GLY D 2 99  ? 56.970 35.708  5.774   1.00 31.67 ? 1822 GLY D O   1 
ATOM   5328 N  N   . ILE D 2 100 ? 56.162 37.604  6.655   1.00 28.77 ? 1823 ILE D N   1 
ATOM   5329 C  CA  . ILE D 2 100 ? 56.225 37.068  8.006   1.00 30.73 ? 1823 ILE D CA  1 
ATOM   5330 C  C   . ILE D 2 100 ? 54.996 36.158  8.076   1.00 30.97 ? 1823 ILE D C   1 
ATOM   5331 O  O   . ILE D 2 100 ? 53.864 36.634  7.972   1.00 30.49 ? 1823 ILE D O   1 
ATOM   5332 C  CB  . ILE D 2 100 ? 56.070 38.184  9.069   1.00 34.30 ? 1823 ILE D CB  1 
ATOM   5333 C  CG1 . ILE D 2 100 ? 57.331 39.054  9.107   1.00 35.61 ? 1823 ILE D CG1 1 
ATOM   5334 C  CG2 . ILE D 2 100 ? 55.764 37.562  10.442  1.00 33.37 ? 1823 ILE D CG2 1 
ATOM   5335 C  CD1 . ILE D 2 100 ? 57.198 40.283  10.023  1.00 36.56 ? 1823 ILE D CD1 1 
ATOM   5336 N  N   . PRO D 2 101 ? 55.197 34.842  8.249   1.00 30.19 ? 1824 PRO D N   1 
ATOM   5337 C  CA  . PRO D 2 101 ? 54.065 33.910  8.317   1.00 26.79 ? 1824 PRO D CA  1 
ATOM   5338 C  C   . PRO D 2 101 ? 53.057 34.190  9.418   1.00 26.46 ? 1824 PRO D C   1 
ATOM   5339 O  O   . PRO D 2 101 ? 53.421 34.545  10.535  1.00 28.90 ? 1824 PRO D O   1 
ATOM   5340 C  CB  . PRO D 2 101 ? 54.742 32.557  8.477   1.00 27.66 ? 1824 PRO D CB  1 
ATOM   5341 C  CG  . PRO D 2 101 ? 56.039 32.899  9.145   1.00 29.32 ? 1824 PRO D CG  1 
ATOM   5342 C  CD  . PRO D 2 101 ? 56.476 34.132  8.424   1.00 28.55 ? 1824 PRO D CD  1 
ATOM   5343 N  N   . CYS D 2 102 ? 51.782 34.038  9.079   1.00 26.15 ? 1825 CYS D N   1 
ATOM   5344 C  CA  . CYS D 2 102 ? 50.681 34.250  10.010  1.00 25.89 ? 1825 CYS D CA  1 
ATOM   5345 C  C   . CYS D 2 102 ? 50.334 32.904  10.633  1.00 28.94 ? 1825 CYS D C   1 
ATOM   5346 O  O   . CYS D 2 102 ? 49.693 32.051  9.996   1.00 27.88 ? 1825 CYS D O   1 
ATOM   5347 C  CB  . CYS D 2 102 ? 49.470 34.808  9.262   1.00 23.81 ? 1825 CYS D CB  1 
ATOM   5348 S  SG  . CYS D 2 102 ? 49.634 36.564  8.795   1.00 29.96 ? 1825 CYS D SG  1 
ATOM   5349 N  N   . VAL D 2 103 ? 50.752 32.712  11.880  1.00 28.27 ? 1826 VAL D N   1 
ATOM   5350 C  CA  . VAL D 2 103 ? 50.521 31.445  12.555  1.00 27.61 ? 1826 VAL D CA  1 
ATOM   5351 C  C   . VAL D 2 103 ? 49.457 31.487  13.650  1.00 29.32 ? 1826 VAL D C   1 
ATOM   5352 O  O   . VAL D 2 103 ? 49.308 32.495  14.359  1.00 30.08 ? 1826 VAL D O   1 
ATOM   5353 C  CB  . VAL D 2 103 ? 51.833 30.933  13.157  1.00 26.53 ? 1826 VAL D CB  1 
ATOM   5354 C  CG1 . VAL D 2 103 ? 51.662 29.508  13.682  1.00 25.24 ? 1826 VAL D CG1 1 
ATOM   5355 C  CG2 . VAL D 2 103 ? 52.922 30.999  12.111  1.00 26.47 ? 1826 VAL D CG2 1 
ATOM   5356 N  N   . SER D 2 104 ? 48.724 30.382  13.777  1.00 27.07 ? 1827 SER D N   1 
ATOM   5357 C  CA  . SER D 2 104 ? 47.672 30.253  14.779  1.00 29.00 ? 1827 SER D CA  1 
ATOM   5358 C  C   . SER D 2 104 ? 48.279 30.079  16.167  1.00 27.69 ? 1827 SER D C   1 
ATOM   5359 O  O   . SER D 2 104 ? 49.271 29.373  16.331  1.00 23.70 ? 1827 SER D O   1 
ATOM   5360 C  CB  . SER D 2 104 ? 46.793 29.038  14.479  1.00 30.51 ? 1827 SER D CB  1 
ATOM   5361 O  OG  . SER D 2 104 ? 45.911 28.771  15.565  1.00 31.42 ? 1827 SER D OG  1 
ATOM   5362 N  N   . HIS D 2 105 ? 47.673 30.703  17.172  1.00 25.71 ? 1828 HIS D N   1 
ATOM   5363 C  CA  . HIS D 2 105 ? 48.214 30.580  18.516  1.00 27.13 ? 1828 HIS D CA  1 
ATOM   5364 C  C   . HIS D 2 105 ? 48.303 29.124  18.963  1.00 26.49 ? 1828 HIS D C   1 
ATOM   5365 O  O   . HIS D 2 105 ? 49.092 28.803  19.858  1.00 24.95 ? 1828 HIS D O   1 
ATOM   5366 C  CB  . HIS D 2 105 ? 47.369 31.350  19.530  1.00 30.05 ? 1828 HIS D CB  1 
ATOM   5367 C  CG  . HIS D 2 105 ? 46.013 30.766  19.758  1.00 31.61 ? 1828 HIS D CG  1 
ATOM   5368 N  ND1 . HIS D 2 105 ? 45.384 30.807  20.983  1.00 34.60 ? 1828 HIS D ND1 1 
ATOM   5369 C  CD2 . HIS D 2 105 ? 45.150 30.155  18.912  1.00 32.68 ? 1828 HIS D CD2 1 
ATOM   5370 C  CE1 . HIS D 2 105 ? 44.191 30.246  20.883  1.00 33.80 ? 1828 HIS D CE1 1 
ATOM   5371 N  NE2 . HIS D 2 105 ? 44.026 29.842  19.636  1.00 32.52 ? 1828 HIS D NE2 1 
ATOM   5372 N  N   . VAL D 2 106 ? 47.502 28.249  18.347  1.00 23.10 ? 1829 VAL D N   1 
ATOM   5373 C  CA  . VAL D 2 106 ? 47.499 26.838  18.713  1.00 21.55 ? 1829 VAL D CA  1 
ATOM   5374 C  C   . VAL D 2 106 ? 48.908 26.264  18.548  1.00 22.88 ? 1829 VAL D C   1 
ATOM   5375 O  O   . VAL D 2 106 ? 49.270 25.282  19.187  1.00 21.04 ? 1829 VAL D O   1 
ATOM   5376 C  CB  . VAL D 2 106 ? 46.495 26.028  17.839  1.00 24.92 ? 1829 VAL D CB  1 
ATOM   5377 C  CG1 . VAL D 2 106 ? 46.457 24.579  18.287  1.00 23.59 ? 1829 VAL D CG1 1 
ATOM   5378 C  CG2 . VAL D 2 106 ? 45.105 26.629  17.931  1.00 21.62 ? 1829 VAL D CG2 1 
ATOM   5379 N  N   . TRP D 2 107 ? 49.708 26.879  17.683  1.00 25.76 ? 1830 TRP D N   1 
ATOM   5380 C  CA  . TRP D 2 107 ? 51.084 26.429  17.468  1.00 25.97 ? 1830 TRP D CA  1 
ATOM   5381 C  C   . TRP D 2 107 ? 51.844 26.622  18.771  1.00 28.45 ? 1830 TRP D C   1 
ATOM   5382 O  O   . TRP D 2 107 ? 52.745 25.846  19.104  1.00 27.67 ? 1830 TRP D O   1 
ATOM   5383 C  CB  . TRP D 2 107 ? 51.774 27.267  16.400  1.00 23.83 ? 1830 TRP D CB  1 
ATOM   5384 C  CG  . TRP D 2 107 ? 53.249 26.984  16.276  1.00 26.72 ? 1830 TRP D CG  1 
ATOM   5385 C  CD1 . TRP D 2 107 ? 53.826 25.915  15.663  1.00 25.11 ? 1830 TRP D CD1 1 
ATOM   5386 C  CD2 . TRP D 2 107 ? 54.329 27.809  16.742  1.00 26.93 ? 1830 TRP D CD2 1 
ATOM   5387 N  NE1 . TRP D 2 107 ? 55.196 26.021  15.707  1.00 26.43 ? 1830 TRP D NE1 1 
ATOM   5388 C  CE2 . TRP D 2 107 ? 55.532 27.176  16.362  1.00 27.95 ? 1830 TRP D CE2 1 
ATOM   5389 C  CE3 . TRP D 2 107 ? 54.396 29.021  17.439  1.00 27.28 ? 1830 TRP D CE3 1 
ATOM   5390 C  CZ2 . TRP D 2 107 ? 56.791 27.716  16.652  1.00 27.79 ? 1830 TRP D CZ2 1 
ATOM   5391 C  CZ3 . TRP D 2 107 ? 55.647 29.557  17.727  1.00 27.79 ? 1830 TRP D CZ3 1 
ATOM   5392 C  CH2 . TRP D 2 107 ? 56.826 28.905  17.332  1.00 27.99 ? 1830 TRP D CH2 1 
ATOM   5393 N  N   . VAL D 2 108 ? 51.503 27.689  19.489  1.00 28.40 ? 1831 VAL D N   1 
ATOM   5394 C  CA  . VAL D 2 108 ? 52.155 27.963  20.750  1.00 28.99 ? 1831 VAL D CA  1 
ATOM   5395 C  C   . VAL D 2 108 ? 51.671 26.925  21.748  1.00 32.20 ? 1831 VAL D C   1 
ATOM   5396 O  O   . VAL D 2 108 ? 52.473 26.303  22.444  1.00 33.40 ? 1831 VAL D O   1 
ATOM   5397 C  CB  . VAL D 2 108 ? 51.819 29.359  21.246  1.00 29.69 ? 1831 VAL D CB  1 
ATOM   5398 C  CG1 . VAL D 2 108 ? 52.495 29.612  22.593  1.00 29.77 ? 1831 VAL D CG1 1 
ATOM   5399 C  CG2 . VAL D 2 108 ? 52.279 30.380  20.215  1.00 29.48 ? 1831 VAL D CG2 1 
ATOM   5400 N  N   . HIS D 2 109 ? 50.359 26.715  21.792  1.00 34.87 ? 1832 HIS D N   1 
ATOM   5401 C  CA  . HIS D 2 109 ? 49.776 25.737  22.702  1.00 35.77 ? 1832 HIS D CA  1 
ATOM   5402 C  C   . HIS D 2 109 ? 50.404 24.364  22.527  1.00 36.81 ? 1832 HIS D C   1 
ATOM   5403 O  O   . HIS D 2 109 ? 51.051 23.857  23.438  1.00 39.00 ? 1832 HIS D O   1 
ATOM   5404 C  CB  . HIS D 2 109 ? 48.272 25.630  22.486  1.00 37.04 ? 1832 HIS D CB  1 
ATOM   5405 C  CG  . HIS D 2 109 ? 47.625 24.553  23.300  1.00 38.82 ? 1832 HIS D CG  1 
ATOM   5406 N  ND1 . HIS D 2 109 ? 47.709 24.509  24.674  1.00 39.05 ? 1832 HIS D ND1 1 
ATOM   5407 C  CD2 . HIS D 2 109 ? 46.867 23.490  22.935  1.00 38.84 ? 1832 HIS D CD2 1 
ATOM   5408 C  CE1 . HIS D 2 109 ? 47.031 23.467  25.123  1.00 40.24 ? 1832 HIS D CE1 1 
ATOM   5409 N  NE2 . HIS D 2 109 ? 46.509 22.833  24.087  1.00 40.58 ? 1832 HIS D NE2 1 
ATOM   5410 N  N   . ASP D 2 110 ? 50.213 23.759  21.360  1.00 38.70 ? 1833 ASP D N   1 
ATOM   5411 C  CA  . ASP D 2 110 ? 50.769 22.434  21.102  1.00 39.35 ? 1833 ASP D CA  1 
ATOM   5412 C  C   . ASP D 2 110 ? 52.277 22.357  21.368  1.00 39.85 ? 1833 ASP D C   1 
ATOM   5413 O  O   . ASP D 2 110 ? 52.792 21.309  21.771  1.00 39.43 ? 1833 ASP D O   1 
ATOM   5414 C  CB  . ASP D 2 110 ? 50.487 21.998  19.654  1.00 39.72 ? 1833 ASP D CB  1 
ATOM   5415 C  CG  . ASP D 2 110 ? 49.069 21.499  19.453  1.00 40.56 ? 1833 ASP D CG  1 
ATOM   5416 O  OD1 . ASP D 2 110 ? 48.455 21.010  20.436  1.00 43.89 ? 1833 ASP D OD1 1 
ATOM   5417 O  OD2 . ASP D 2 110 ? 48.577 21.573  18.303  1.00 39.39 ? 1833 ASP D OD2 1 
ATOM   5418 N  N   . SER D 2 111 ? 52.983 23.459  21.139  1.00 39.33 ? 1834 SER D N   1 
ATOM   5419 C  CA  . SER D 2 111 ? 54.426 23.479  21.340  1.00 42.97 ? 1834 SER D CA  1 
ATOM   5420 C  C   . SER D 2 111 ? 54.810 23.417  22.814  1.00 44.39 ? 1834 SER D C   1 
ATOM   5421 O  O   . SER D 2 111 ? 55.735 22.693  23.195  1.00 46.11 ? 1834 SER D O   1 
ATOM   5422 C  CB  . SER D 2 111 ? 55.036 24.728  20.683  1.00 45.31 ? 1834 SER D CB  1 
ATOM   5423 O  OG  . SER D 2 111 ? 55.098 24.584  19.268  1.00 46.22 ? 1834 SER D OG  1 
ATOM   5424 N  N   . CYS D 2 112 ? 54.116 24.184  23.645  1.00 43.58 ? 1835 CYS D N   1 
ATOM   5425 C  CA  . CYS D 2 112 ? 54.407 24.155  25.067  1.00 42.60 ? 1835 CYS D CA  1 
ATOM   5426 C  C   . CYS D 2 112 ? 53.981 22.789  25.608  1.00 44.49 ? 1835 CYS D C   1 
ATOM   5427 O  O   . CYS D 2 112 ? 54.794 22.065  26.181  1.00 44.85 ? 1835 CYS D O   1 
ATOM   5428 C  CB  . CYS D 2 112 ? 53.677 25.293  25.789  1.00 41.76 ? 1835 CYS D CB  1 
ATOM   5429 S  SG  . CYS D 2 112 ? 54.319 26.950  25.371  1.00 34.49 ? 1835 CYS D SG  1 
ATOM   5430 N  N   . HIS D 2 113 ? 52.719 22.423  25.395  1.00 46.51 ? 1836 HIS D N   1 
ATOM   5431 C  CA  . HIS D 2 113 ? 52.218 21.135  25.861  1.00 47.59 ? 1836 HIS D CA  1 
ATOM   5432 C  C   . HIS D 2 113 ? 53.193 19.991  25.571  1.00 47.52 ? 1836 HIS D C   1 
ATOM   5433 O  O   . HIS D 2 113 ? 53.469 19.169  26.443  1.00 47.86 ? 1836 HIS D O   1 
ATOM   5434 C  CB  . HIS D 2 113 ? 50.874 20.814  25.214  1.00 51.21 ? 1836 HIS D CB  1 
ATOM   5435 C  CG  . HIS D 2 113 ? 50.263 19.541  25.708  1.00 54.53 ? 1836 HIS D CG  1 
ATOM   5436 N  ND1 . HIS D 2 113 ? 49.318 19.510  26.712  1.00 55.31 ? 1836 HIS D ND1 1 
ATOM   5437 C  CD2 . HIS D 2 113 ? 50.499 18.250  25.371  1.00 55.35 ? 1836 HIS D CD2 1 
ATOM   5438 C  CE1 . HIS D 2 113 ? 48.998 18.254  26.972  1.00 56.44 ? 1836 HIS D CE1 1 
ATOM   5439 N  NE2 . HIS D 2 113 ? 49.702 17.470  26.173  1.00 57.43 ? 1836 HIS D NE2 1 
ATOM   5440 N  N   . ALA D 2 114 ? 53.713 19.936  24.348  1.00 46.82 ? 1837 ALA D N   1 
ATOM   5441 C  CA  . ALA D 2 114 ? 54.639 18.872  23.969  1.00 45.15 ? 1837 ALA D CA  1 
ATOM   5442 C  C   . ALA D 2 114 ? 56.058 19.254  24.338  1.00 43.84 ? 1837 ALA D C   1 
ATOM   5443 O  O   . ALA D 2 114 ? 56.974 18.426  24.298  1.00 41.68 ? 1837 ALA D O   1 
ATOM   5444 C  CB  . ALA D 2 114 ? 54.545 18.609  22.471  1.00 45.20 ? 1837 ALA D CB  1 
ATOM   5445 N  N   . ASN D 2 115 ? 56.229 20.517  24.706  1.00 43.36 ? 1838 ASN D N   1 
ATOM   5446 C  CA  . ASN D 2 115 ? 57.540 21.029  25.062  1.00 44.41 ? 1838 ASN D CA  1 
ATOM   5447 C  C   . ASN D 2 115 ? 58.513 20.630  23.960  1.00 43.23 ? 1838 ASN D C   1 
ATOM   5448 O  O   . ASN D 2 115 ? 59.556 20.029  24.211  1.00 40.51 ? 1838 ASN D O   1 
ATOM   5449 C  CB  . ASN D 2 115 ? 57.997 20.459  26.405  1.00 47.74 ? 1838 ASN D CB  1 
ATOM   5450 C  CG  . ASN D 2 115 ? 59.124 21.267  27.015  1.00 50.62 ? 1838 ASN D CG  1 
ATOM   5451 O  OD1 . ASN D 2 115 ? 58.975 22.474  27.265  1.00 53.13 ? 1838 ASN D OD1 1 
ATOM   5452 N  ND2 . ASN D 2 115 ? 60.262 20.617  27.253  1.00 48.97 ? 1838 ASN D ND2 1 
ATOM   5453 N  N   . GLN D 2 116 ? 58.139 20.966  22.730  1.00 45.65 ? 1839 GLN D N   1 
ATOM   5454 C  CA  . GLN D 2 116 ? 58.942 20.670  21.542  1.00 44.18 ? 1839 GLN D CA  1 
ATOM   5455 C  C   . GLN D 2 116 ? 58.329 21.476  20.392  1.00 39.98 ? 1839 GLN D C   1 
ATOM   5456 O  O   . GLN D 2 116 ? 57.118 21.408  20.164  1.00 40.29 ? 1839 GLN D O   1 
ATOM   5457 C  CB  . GLN D 2 116 ? 58.877 19.169  21.243  1.00 49.16 ? 1839 GLN D CB  1 
ATOM   5458 C  CG  . GLN D 2 116 ? 60.192 18.561  20.786  1.00 55.32 ? 1839 GLN D CG  1 
ATOM   5459 C  CD  . GLN D 2 116 ? 60.473 18.804  19.317  1.00 59.21 ? 1839 GLN D CD  1 
ATOM   5460 O  OE1 . GLN D 2 116 ? 60.464 19.944  18.844  1.00 62.13 ? 1839 GLN D OE1 1 
ATOM   5461 N  NE2 . GLN D 2 116 ? 60.727 17.726  18.582  1.00 60.66 ? 1839 GLN D NE2 1 
ATOM   5462 N  N   . LEU D 2 117 ? 59.149 22.249  19.684  1.00 36.21 ? 1840 LEU D N   1 
ATOM   5463 C  CA  . LEU D 2 117 ? 58.645 23.066  18.579  1.00 35.10 ? 1840 LEU D CA  1 
ATOM   5464 C  C   . LEU D 2 117 ? 57.965 22.278  17.477  1.00 34.87 ? 1840 LEU D C   1 
ATOM   5465 O  O   . LEU D 2 117 ? 58.557 21.360  16.904  1.00 34.75 ? 1840 LEU D O   1 
ATOM   5466 C  CB  . LEU D 2 117 ? 59.762 23.884  17.924  1.00 37.25 ? 1840 LEU D CB  1 
ATOM   5467 C  CG  . LEU D 2 117 ? 60.205 25.240  18.486  1.00 39.50 ? 1840 LEU D CG  1 
ATOM   5468 C  CD1 . LEU D 2 117 ? 60.973 25.978  17.383  1.00 36.16 ? 1840 LEU D CD1 1 
ATOM   5469 C  CD2 . LEU D 2 117 ? 58.999 26.077  18.939  1.00 37.97 ? 1840 LEU D CD2 1 
ATOM   5470 N  N   . GLN D 2 118 ? 56.724 22.653  17.174  1.00 34.06 ? 1841 GLN D N   1 
ATOM   5471 C  CA  . GLN D 2 118 ? 55.973 22.006  16.108  1.00 33.40 ? 1841 GLN D CA  1 
ATOM   5472 C  C   . GLN D 2 118 ? 56.291 22.721  14.796  1.00 32.34 ? 1841 GLN D C   1 
ATOM   5473 O  O   . GLN D 2 118 ? 56.851 23.815  14.791  1.00 30.62 ? 1841 GLN D O   1 
ATOM   5474 C  CB  . GLN D 2 118 ? 54.476 22.094  16.392  1.00 35.38 ? 1841 GLN D CB  1 
ATOM   5475 C  CG  . GLN D 2 118 ? 54.069 21.391  17.658  1.00 36.54 ? 1841 GLN D CG  1 
ATOM   5476 C  CD  . GLN D 2 118 ? 54.462 19.934  17.624  1.00 38.52 ? 1841 GLN D CD  1 
ATOM   5477 O  OE1 . GLN D 2 118 ? 53.953 19.160  16.804  1.00 40.00 ? 1841 GLN D OE1 1 
ATOM   5478 N  NE2 . GLN D 2 118 ? 55.382 19.550  18.501  1.00 37.26 ? 1841 GLN D NE2 1 
ATOM   5479 N  N   . ASN D 2 119 ? 55.951 22.095  13.678  1.00 35.52 ? 1842 ASN D N   1 
ATOM   5480 C  CA  . ASN D 2 119 ? 56.196 22.715  12.382  1.00 36.83 ? 1842 ASN D CA  1 
ATOM   5481 C  C   . ASN D 2 119 ? 55.067 23.733  12.203  1.00 36.27 ? 1842 ASN D C   1 
ATOM   5482 O  O   . ASN D 2 119 ? 53.904 23.353  12.043  1.00 37.57 ? 1842 ASN D O   1 
ATOM   5483 C  CB  . ASN D 2 119 ? 56.141 21.669  11.271  1.00 36.26 ? 1842 ASN D CB  1 
ATOM   5484 C  CG  . ASN D 2 119 ? 56.471 22.254  9.919   1.00 38.02 ? 1842 ASN D CG  1 
ATOM   5485 O  OD1 . ASN D 2 119 ? 56.113 23.401  9.622   1.00 39.56 ? 1842 ASN D OD1 1 
ATOM   5486 N  ND2 . ASN D 2 119 ? 57.149 21.472  9.080   1.00 38.23 ? 1842 ASN D ND2 1 
ATOM   5487 N  N   . TYR D 2 120 ? 55.393 25.020  12.226  1.00 34.33 ? 1843 TYR D N   1 
ATOM   5488 C  CA  . TYR D 2 120 ? 54.338 26.008  12.113  1.00 33.28 ? 1843 TYR D CA  1 
ATOM   5489 C  C   . TYR D 2 120 ? 53.638 26.007  10.767  1.00 33.00 ? 1843 TYR D C   1 
ATOM   5490 O  O   . TYR D 2 120 ? 52.519 26.505  10.640  1.00 32.43 ? 1843 TYR D O   1 
ATOM   5491 C  CB  . TYR D 2 120 ? 54.861 27.401  12.474  1.00 33.14 ? 1843 TYR D CB  1 
ATOM   5492 C  CG  . TYR D 2 120 ? 55.854 27.981  11.508  1.00 34.12 ? 1843 TYR D CG  1 
ATOM   5493 C  CD1 . TYR D 2 120 ? 55.496 28.250  10.193  1.00 34.44 ? 1843 TYR D CD1 1 
ATOM   5494 C  CD2 . TYR D 2 120 ? 57.148 28.285  11.917  1.00 35.98 ? 1843 TYR D CD2 1 
ATOM   5495 C  CE1 . TYR D 2 120 ? 56.393 28.806  9.315   1.00 36.12 ? 1843 TYR D CE1 1 
ATOM   5496 C  CE2 . TYR D 2 120 ? 58.057 28.839  11.043  1.00 37.73 ? 1843 TYR D CE2 1 
ATOM   5497 C  CZ  . TYR D 2 120 ? 57.672 29.099  9.742   1.00 38.48 ? 1843 TYR D CZ  1 
ATOM   5498 O  OH  . TYR D 2 120 ? 58.568 29.659  8.858   1.00 43.54 ? 1843 TYR D OH  1 
ATOM   5499 N  N   . ARG D 2 121 ? 54.270 25.421  9.763   1.00 33.92 ? 1844 ARG D N   1 
ATOM   5500 C  CA  . ARG D 2 121 ? 53.641 25.385  8.453   1.00 36.61 ? 1844 ARG D CA  1 
ATOM   5501 C  C   . ARG D 2 121 ? 52.353 24.546  8.467   1.00 35.93 ? 1844 ARG D C   1 
ATOM   5502 O  O   . ARG D 2 121 ? 51.597 24.527  7.486   1.00 34.30 ? 1844 ARG D O   1 
ATOM   5503 C  CB  . ARG D 2 121 ? 54.669 24.916  7.411   1.00 38.10 ? 1844 ARG D CB  1 
ATOM   5504 C  CG  . ARG D 2 121 ? 55.736 26.018  7.149   1.00 43.56 ? 1844 ARG D CG  1 
ATOM   5505 C  CD  . ARG D 2 121 ? 56.932 25.564  6.302   1.00 48.89 ? 1844 ARG D CD  1 
ATOM   5506 N  NE  . ARG D 2 121 ? 58.056 25.048  7.098   1.00 55.44 ? 1844 ARG D NE  1 
ATOM   5507 C  CZ  . ARG D 2 121 ? 58.962 25.807  7.724   1.00 57.76 ? 1844 ARG D CZ  1 
ATOM   5508 N  NH1 . ARG D 2 121 ? 58.890 27.131  7.655   1.00 58.36 ? 1844 ARG D NH1 1 
ATOM   5509 N  NH2 . ARG D 2 121 ? 59.950 25.243  8.416   1.00 56.76 ? 1844 ARG D NH2 1 
ATOM   5510 N  N   . ASN D 2 122 ? 52.088 23.885  9.596   1.00 34.16 ? 1845 ASN D N   1 
ATOM   5511 C  CA  . ASN D 2 122 ? 50.878 23.083  9.734   1.00 34.74 ? 1845 ASN D CA  1 
ATOM   5512 C  C   . ASN D 2 122 ? 49.840 23.865  10.539  1.00 32.35 ? 1845 ASN D C   1 
ATOM   5513 O  O   . ASN D 2 122 ? 48.755 23.366  10.849  1.00 32.04 ? 1845 ASN D O   1 
ATOM   5514 C  CB  . ASN D 2 122 ? 51.209 21.757  10.411  1.00 38.74 ? 1845 ASN D CB  1 
ATOM   5515 C  CG  . ASN D 2 122 ? 52.246 20.963  9.636   1.00 41.90 ? 1845 ASN D CG  1 
ATOM   5516 O  OD1 . ASN D 2 122 ? 52.108 20.753  8.427   1.00 40.64 ? 1845 ASN D OD1 1 
ATOM   5517 N  ND2 . ASN D 2 122 ? 53.293 20.519  10.329  1.00 44.28 ? 1845 ASN D ND2 1 
ATOM   5518 N  N   . TYR D 2 123 ? 50.189 25.107  10.865  1.00 31.27 ? 1846 TYR D N   1 
ATOM   5519 C  CA  . TYR D 2 123 ? 49.302 25.984  11.625  1.00 29.74 ? 1846 TYR D CA  1 
ATOM   5520 C  C   . TYR D 2 123 ? 49.123 27.334  10.943  1.00 28.40 ? 1846 TYR D C   1 
ATOM   5521 O  O   . TYR D 2 123 ? 48.673 28.282  11.583  1.00 26.39 ? 1846 TYR D O   1 
ATOM   5522 C  CB  . TYR D 2 123 ? 49.841 26.243  13.045  1.00 30.64 ? 1846 TYR D CB  1 
ATOM   5523 C  CG  . TYR D 2 123 ? 50.067 25.011  13.905  1.00 30.38 ? 1846 TYR D CG  1 
ATOM   5524 C  CD1 . TYR D 2 123 ? 51.177 24.185  13.701  1.00 27.82 ? 1846 TYR D CD1 1 
ATOM   5525 C  CD2 . TYR D 2 123 ? 49.175 24.679  14.932  1.00 31.19 ? 1846 TYR D CD2 1 
ATOM   5526 C  CE1 . TYR D 2 123 ? 51.399 23.060  14.497  1.00 28.41 ? 1846 TYR D CE1 1 
ATOM   5527 C  CE2 . TYR D 2 123 ? 49.387 23.552  15.739  1.00 30.30 ? 1846 TYR D CE2 1 
ATOM   5528 C  CZ  . TYR D 2 123 ? 50.502 22.749  15.513  1.00 29.02 ? 1846 TYR D CZ  1 
ATOM   5529 O  OH  . TYR D 2 123 ? 50.720 21.636  16.292  1.00 29.15 ? 1846 TYR D OH  1 
ATOM   5530 N  N   . LEU D 2 124 ? 49.478 27.432  9.661   1.00 28.06 ? 1847 LEU D N   1 
ATOM   5531 C  CA  . LEU D 2 124 ? 49.335 28.693  8.937   1.00 27.09 ? 1847 LEU D CA  1 
ATOM   5532 C  C   . LEU D 2 124 ? 47.874 29.131  8.919   1.00 26.71 ? 1847 LEU D C   1 
ATOM   5533 O  O   . LEU D 2 124 ? 46.980 28.305  8.751   1.00 27.20 ? 1847 LEU D O   1 
ATOM   5534 C  CB  . LEU D 2 124 ? 49.847 28.545  7.501   1.00 26.63 ? 1847 LEU D CB  1 
ATOM   5535 C  CG  . LEU D 2 124 ? 51.369 28.508  7.315   1.00 28.72 ? 1847 LEU D CG  1 
ATOM   5536 C  CD1 . LEU D 2 124 ? 51.726 28.227  5.843   1.00 27.95 ? 1847 LEU D CD1 1 
ATOM   5537 C  CD2 . LEU D 2 124 ? 51.960 29.845  7.776   1.00 27.04 ? 1847 LEU D CD2 1 
ATOM   5538 N  N   . LEU D 2 125 ? 47.636 30.424  9.123   1.00 25.23 ? 1848 LEU D N   1 
ATOM   5539 C  CA  . LEU D 2 125 ? 46.282 30.972  9.112   1.00 25.04 ? 1848 LEU D CA  1 
ATOM   5540 C  C   . LEU D 2 125 ? 45.946 31.408  7.686   1.00 27.63 ? 1848 LEU D C   1 
ATOM   5541 O  O   . LEU D 2 125 ? 46.848 31.657  6.871   1.00 29.99 ? 1848 LEU D O   1 
ATOM   5542 C  CB  . LEU D 2 125 ? 46.180 32.177  10.058  1.00 22.59 ? 1848 LEU D CB  1 
ATOM   5543 C  CG  . LEU D 2 125 ? 46.243 31.887  11.560  1.00 24.38 ? 1848 LEU D CG  1 
ATOM   5544 C  CD1 . LEU D 2 125 ? 46.233 33.184  12.359  1.00 25.04 ? 1848 LEU D CD1 1 
ATOM   5545 C  CD2 . LEU D 2 125 ? 45.037 31.039  11.949  1.00 25.94 ? 1848 LEU D CD2 1 
ATOM   5546 N  N   . PRO D 2 126 ? 44.646 31.512  7.362   1.00 27.57 ? 1849 PRO D N   1 
ATOM   5547 C  CA  . PRO D 2 126 ? 44.266 31.924  6.003   1.00 27.17 ? 1849 PRO D CA  1 
ATOM   5548 C  C   . PRO D 2 126 ? 44.751 33.350  5.729   1.00 29.05 ? 1849 PRO D C   1 
ATOM   5549 O  O   . PRO D 2 126 ? 45.042 34.102  6.663   1.00 29.34 ? 1849 PRO D O   1 
ATOM   5550 C  CB  . PRO D 2 126 ? 42.733 31.832  6.028   1.00 28.15 ? 1849 PRO D CB  1 
ATOM   5551 C  CG  . PRO D 2 126 ? 42.431 30.837  7.146   1.00 24.00 ? 1849 PRO D CG  1 
ATOM   5552 C  CD  . PRO D 2 126 ? 43.454 31.245  8.191   1.00 26.19 ? 1849 PRO D CD  1 
ATOM   5553 N  N   . ALA D 2 127 ? 44.845 33.731  4.458   1.00 30.42 ? 1850 ALA D N   1 
ATOM   5554 C  CA  . ALA D 2 127 ? 45.282 35.089  4.135   1.00 30.69 ? 1850 ALA D CA  1 
ATOM   5555 C  C   . ALA D 2 127 ? 44.171 36.084  4.465   1.00 29.68 ? 1850 ALA D C   1 
ATOM   5556 O  O   . ALA D 2 127 ? 44.416 37.112  5.082   1.00 31.23 ? 1850 ALA D O   1 
ATOM   5557 C  CB  . ALA D 2 127 ? 45.667 35.193  2.648   1.00 29.77 ? 1850 ALA D CB  1 
ATOM   5558 N  N   . GLY D 2 128 ? 42.949 35.766  4.049   1.00 30.06 ? 1851 GLY D N   1 
ATOM   5559 C  CA  . GLY D 2 128 ? 41.821 36.643  4.307   1.00 34.04 ? 1851 GLY D CA  1 
ATOM   5560 C  C   . GLY D 2 128 ? 40.638 36.341  3.393   1.00 38.57 ? 1851 GLY D C   1 
ATOM   5561 O  O   . GLY D 2 128 ? 40.666 35.383  2.610   1.00 38.98 ? 1851 GLY D O   1 
ATOM   5562 N  N   . TYR D 2 129 ? 39.589 37.150  3.503   1.00 40.47 ? 1852 TYR D N   1 
ATOM   5563 C  CA  . TYR D 2 129 ? 38.398 36.982  2.678   1.00 41.51 ? 1852 TYR D CA  1 
ATOM   5564 C  C   . TYR D 2 129 ? 38.656 37.658  1.333   1.00 41.49 ? 1852 TYR D C   1 
ATOM   5565 O  O   . TYR D 2 129 ? 39.024 38.830  1.287   1.00 42.39 ? 1852 TYR D O   1 
ATOM   5566 C  CB  . TYR D 2 129 ? 37.184 37.638  3.356   1.00 44.56 ? 1852 TYR D CB  1 
ATOM   5567 C  CG  . TYR D 2 129 ? 35.862 37.303  2.701   1.00 46.49 ? 1852 TYR D CG  1 
ATOM   5568 C  CD1 . TYR D 2 129 ? 35.127 36.185  3.097   1.00 48.30 ? 1852 TYR D CD1 1 
ATOM   5569 C  CD2 . TYR D 2 129 ? 35.372 38.074  1.650   1.00 48.57 ? 1852 TYR D CD2 1 
ATOM   5570 C  CE1 . TYR D 2 129 ? 33.936 35.841  2.460   1.00 51.79 ? 1852 TYR D CE1 1 
ATOM   5571 C  CE2 . TYR D 2 129 ? 34.184 37.741  1.002   1.00 51.87 ? 1852 TYR D CE2 1 
ATOM   5572 C  CZ  . TYR D 2 129 ? 33.471 36.625  1.410   1.00 53.71 ? 1852 TYR D CZ  1 
ATOM   5573 O  OH  . TYR D 2 129 ? 32.302 36.294  0.760   1.00 56.47 ? 1852 TYR D OH  1 
ATOM   5574 N  N   . SER D 2 130 ? 38.465 36.921  0.243   1.00 41.59 ? 1853 SER D N   1 
ATOM   5575 C  CA  . SER D 2 130 ? 38.679 37.455  -1.103  1.00 41.49 ? 1853 SER D CA  1 
ATOM   5576 C  C   . SER D 2 130 ? 37.391 37.998  -1.708  1.00 42.07 ? 1853 SER D C   1 
ATOM   5577 O  O   . SER D 2 130 ? 36.398 37.286  -1.782  1.00 42.53 ? 1853 SER D O   1 
ATOM   5578 C  CB  . SER D 2 130 ? 39.236 36.354  -2.013  1.00 40.34 ? 1853 SER D CB  1 
ATOM   5579 O  OG  . SER D 2 130 ? 38.993 36.630  -3.385  1.00 41.29 ? 1853 SER D OG  1 
ATOM   5580 N  N   . LEU D 2 131 ? 37.404 39.257  -2.137  1.00 43.94 ? 1854 LEU D N   1 
ATOM   5581 C  CA  . LEU D 2 131 ? 36.227 39.858  -2.763  1.00 43.94 ? 1854 LEU D CA  1 
ATOM   5582 C  C   . LEU D 2 131 ? 35.931 39.145  -4.080  1.00 45.74 ? 1854 LEU D C   1 
ATOM   5583 O  O   . LEU D 2 131 ? 34.787 38.800  -4.373  1.00 45.20 ? 1854 LEU D O   1 
ATOM   5584 C  CB  . LEU D 2 131 ? 36.474 41.344  -3.032  1.00 42.62 ? 1854 LEU D CB  1 
ATOM   5585 C  CG  . LEU D 2 131 ? 36.068 42.320  -1.920  1.00 41.94 ? 1854 LEU D CG  1 
ATOM   5586 C  CD1 . LEU D 2 131 ? 36.818 43.629  -2.089  1.00 41.33 ? 1854 LEU D CD1 1 
ATOM   5587 C  CD2 . LEU D 2 131 ? 34.555 42.559  -1.957  1.00 40.42 ? 1854 LEU D CD2 1 
ATOM   5588 N  N   . GLU D 2 132 ? 36.983 38.924  -4.862  1.00 47.86 ? 1855 GLU D N   1 
ATOM   5589 C  CA  . GLU D 2 132 ? 36.881 38.256  -6.154  1.00 49.96 ? 1855 GLU D CA  1 
ATOM   5590 C  C   . GLU D 2 132 ? 36.375 36.813  -6.057  1.00 51.18 ? 1855 GLU D C   1 
ATOM   5591 O  O   . GLU D 2 132 ? 35.364 36.465  -6.668  1.00 52.86 ? 1855 GLU D O   1 
ATOM   5592 C  CB  . GLU D 2 132 ? 38.252 38.280  -6.847  1.00 52.30 ? 1855 GLU D CB  1 
ATOM   5593 C  CG  . GLU D 2 132 ? 38.330 37.565  -8.201  1.00 53.62 ? 1855 GLU D CG  1 
ATOM   5594 C  CD  . GLU D 2 132 ? 37.363 38.127  -9.229  1.00 55.53 ? 1855 GLU D CD  1 
ATOM   5595 O  OE1 . GLU D 2 132 ? 37.078 39.346  -9.181  1.00 57.87 ? 1855 GLU D OE1 1 
ATOM   5596 O  OE2 . GLU D 2 132 ? 36.896 37.352  -10.094 1.00 55.76 ? 1855 GLU D OE2 1 
ATOM   5597 N  N   . GLU D 2 133 ? 37.069 35.973  -5.292  1.00 49.98 ? 1856 GLU D N   1 
ATOM   5598 C  CA  . GLU D 2 133 ? 36.668 34.578  -5.171  1.00 49.33 ? 1856 GLU D CA  1 
ATOM   5599 C  C   . GLU D 2 133 ? 35.469 34.380  -4.235  1.00 50.28 ? 1856 GLU D C   1 
ATOM   5600 O  O   . GLU D 2 133 ? 34.876 33.302  -4.196  1.00 50.48 ? 1856 GLU D O   1 
ATOM   5601 C  CB  . GLU D 2 133 ? 37.853 33.739  -4.700  1.00 50.82 ? 1856 GLU D CB  1 
ATOM   5602 C  CG  . GLU D 2 133 ? 39.130 33.934  -5.512  1.00 53.80 ? 1856 GLU D CG  1 
ATOM   5603 C  CD  . GLU D 2 133 ? 39.131 33.162  -6.824  1.00 56.96 ? 1856 GLU D CD  1 
ATOM   5604 O  OE1 . GLU D 2 133 ? 38.969 31.922  -6.777  1.00 58.70 ? 1856 GLU D OE1 1 
ATOM   5605 O  OE2 . GLU D 2 133 ? 39.304 33.786  -7.900  1.00 57.20 ? 1856 GLU D OE2 1 
ATOM   5606 N  N   . GLN D 2 134 ? 35.107 35.419  -3.489  1.00 50.56 ? 1857 GLN D N   1 
ATOM   5607 C  CA  . GLN D 2 134 ? 33.968 35.354  -2.564  1.00 50.02 ? 1857 GLN D CA  1 
ATOM   5608 C  C   . GLN D 2 134 ? 34.072 34.265  -1.494  1.00 47.20 ? 1857 GLN D C   1 
ATOM   5609 O  O   . GLN D 2 134 ? 33.075 33.626  -1.145  1.00 46.29 ? 1857 GLN D O   1 
ATOM   5610 C  CB  . GLN D 2 134 ? 32.665 35.177  -3.346  1.00 53.81 ? 1857 GLN D CB  1 
ATOM   5611 C  CG  . GLN D 2 134 ? 32.211 36.426  -4.109  1.00 61.96 ? 1857 GLN D CG  1 
ATOM   5612 C  CD  . GLN D 2 134 ? 31.727 37.564  -3.191  1.00 66.25 ? 1857 GLN D CD  1 
ATOM   5613 O  OE1 . GLN D 2 134 ? 32.495 38.108  -2.384  1.00 68.61 ? 1857 GLN D OE1 1 
ATOM   5614 N  NE2 . GLN D 2 134 ? 30.448 37.926  -3.318  1.00 65.00 ? 1857 GLN D NE2 1 
ATOM   5615 N  N   . ARG D 2 135 ? 35.277 34.067  -0.968  1.00 42.83 ? 1858 ARG D N   1 
ATOM   5616 C  CA  . ARG D 2 135 ? 35.509 33.065  0.070   1.00 40.40 ? 1858 ARG D CA  1 
ATOM   5617 C  C   . ARG D 2 135 ? 36.828 33.331  0.786   1.00 37.93 ? 1858 ARG D C   1 
ATOM   5618 O  O   . ARG D 2 135 ? 37.605 34.180  0.359   1.00 39.39 ? 1858 ARG D O   1 
ATOM   5619 C  CB  . ARG D 2 135 ? 35.530 31.650  -0.535  1.00 36.94 ? 1858 ARG D CB  1 
ATOM   5620 C  CG  . ARG D 2 135 ? 36.624 31.400  -1.554  1.00 34.88 ? 1858 ARG D CG  1 
ATOM   5621 C  CD  . ARG D 2 135 ? 36.659 29.933  -1.975  1.00 38.31 ? 1858 ARG D CD  1 
ATOM   5622 N  NE  . ARG D 2 135 ? 37.532 29.688  -3.129  1.00 42.79 ? 1858 ARG D NE  1 
ATOM   5623 C  CZ  . ARG D 2 135 ? 38.850 29.497  -3.064  1.00 42.81 ? 1858 ARG D CZ  1 
ATOM   5624 N  NH1 . ARG D 2 135 ? 39.545 29.287  -4.180  1.00 38.83 ? 1858 ARG D NH1 1 
ATOM   5625 N  NH2 . ARG D 2 135 ? 39.470 29.499  -1.885  1.00 43.38 ? 1858 ARG D NH2 1 
ATOM   5626 N  N   . ILE D 2 136 ? 37.074 32.607  1.877   1.00 35.16 ? 1859 ILE D N   1 
ATOM   5627 C  CA  . ILE D 2 136 ? 38.314 32.760  2.636   1.00 31.94 ? 1859 ILE D CA  1 
ATOM   5628 C  C   . ILE D 2 136 ? 39.415 32.055  1.853   1.00 29.90 ? 1859 ILE D C   1 
ATOM   5629 O  O   . ILE D 2 136 ? 39.322 30.853  1.623   1.00 25.85 ? 1859 ILE D O   1 
ATOM   5630 C  CB  . ILE D 2 136 ? 38.246 32.070  4.032   1.00 31.68 ? 1859 ILE D CB  1 
ATOM   5631 C  CG1 . ILE D 2 136 ? 37.030 32.546  4.834   1.00 30.04 ? 1859 ILE D CG1 1 
ATOM   5632 C  CG2 . ILE D 2 136 ? 39.510 32.369  4.814   1.00 33.40 ? 1859 ILE D CG2 1 
ATOM   5633 C  CD1 . ILE D 2 136 ? 36.990 34.030  5.066   1.00 29.82 ? 1859 ILE D CD1 1 
ATOM   5634 N  N   . LEU D 2 137 ? 40.447 32.792  1.443   1.00 30.33 ? 1860 LEU D N   1 
ATOM   5635 C  CA  . LEU D 2 137 ? 41.557 32.194  0.710   1.00 30.66 ? 1860 LEU D CA  1 
ATOM   5636 C  C   . LEU D 2 137 ? 42.694 31.796  1.649   1.00 29.36 ? 1860 LEU D C   1 
ATOM   5637 O  O   . LEU D 2 137 ? 43.002 32.504  2.613   1.00 30.25 ? 1860 LEU D O   1 
ATOM   5638 C  CB  . LEU D 2 137 ? 42.105 33.162  -0.341  1.00 31.76 ? 1860 LEU D CB  1 
ATOM   5639 C  CG  . LEU D 2 137 ? 41.188 33.617  -1.474  1.00 35.59 ? 1860 LEU D CG  1 
ATOM   5640 C  CD1 . LEU D 2 137 ? 42.007 34.461  -2.464  1.00 35.98 ? 1860 LEU D CD1 1 
ATOM   5641 C  CD2 . LEU D 2 137 ? 40.572 32.401  -2.171  1.00 35.19 ? 1860 LEU D CD2 1 
ATOM   5642 N  N   . ASP D 2 138 ? 43.309 30.657  1.358   1.00 25.91 ? 1861 ASP D N   1 
ATOM   5643 C  CA  . ASP D 2 138 ? 44.430 30.168  2.146   1.00 27.43 ? 1861 ASP D CA  1 
ATOM   5644 C  C   . ASP D 2 138 ? 45.662 30.964  1.700   1.00 23.76 ? 1861 ASP D C   1 
ATOM   5645 O  O   . ASP D 2 138 ? 45.619 31.649  0.685   1.00 19.87 ? 1861 ASP D O   1 
ATOM   5646 C  CB  . ASP D 2 138 ? 44.626 28.658  1.896   1.00 30.61 ? 1861 ASP D CB  1 
ATOM   5647 C  CG  . ASP D 2 138 ? 43.942 27.776  2.961   1.00 33.70 ? 1861 ASP D CG  1 
ATOM   5648 O  OD1 . ASP D 2 138 ? 42.927 28.214  3.574   1.00 28.05 ? 1861 ASP D OD1 1 
ATOM   5649 O  OD2 . ASP D 2 138 ? 44.431 26.632  3.167   1.00 34.23 ? 1861 ASP D OD2 1 
ATOM   5650 N  N   . TRP D 2 139 ? 46.748 30.890  2.460   1.00 23.56 ? 1862 TRP D N   1 
ATOM   5651 C  CA  . TRP D 2 139 ? 47.951 31.627  2.103   1.00 24.47 ? 1862 TRP D CA  1 
ATOM   5652 C  C   . TRP D 2 139 ? 48.957 30.740  1.392   1.00 25.70 ? 1862 TRP D C   1 
ATOM   5653 O  O   . TRP D 2 139 ? 49.139 29.571  1.741   1.00 25.41 ? 1862 TRP D O   1 
ATOM   5654 C  CB  . TRP D 2 139 ? 48.602 32.234  3.355   1.00 24.32 ? 1862 TRP D CB  1 
ATOM   5655 C  CG  . TRP D 2 139 ? 49.915 32.922  3.087   1.00 21.69 ? 1862 TRP D CG  1 
ATOM   5656 C  CD1 . TRP D 2 139 ? 50.125 34.261  2.992   1.00 22.22 ? 1862 TRP D CD1 1 
ATOM   5657 C  CD2 . TRP D 2 139 ? 51.183 32.297  2.827   1.00 23.02 ? 1862 TRP D CD2 1 
ATOM   5658 N  NE1 . TRP D 2 139 ? 51.443 34.515  2.685   1.00 22.84 ? 1862 TRP D NE1 1 
ATOM   5659 C  CE2 . TRP D 2 139 ? 52.114 33.328  2.579   1.00 19.81 ? 1862 TRP D CE2 1 
ATOM   5660 C  CE3 . TRP D 2 139 ? 51.621 30.964  2.772   1.00 25.81 ? 1862 TRP D CE3 1 
ATOM   5661 C  CZ2 . TRP D 2 139 ? 53.456 33.076  2.285   1.00 22.39 ? 1862 TRP D CZ2 1 
ATOM   5662 C  CZ3 . TRP D 2 139 ? 52.967 30.711  2.472   1.00 24.71 ? 1862 TRP D CZ3 1 
ATOM   5663 C  CH2 . TRP D 2 139 ? 53.864 31.762  2.233   1.00 23.22 ? 1862 TRP D CH2 1 
ATOM   5664 N  N   . GLN D 2 140 ? 49.608 31.306  0.385   1.00 28.87 ? 1863 GLN D N   1 
ATOM   5665 C  CA  . GLN D 2 140 ? 50.619 30.582  -0.358  1.00 32.24 ? 1863 GLN D CA  1 
ATOM   5666 C  C   . GLN D 2 140 ? 51.757 31.513  -0.726  1.00 33.29 ? 1863 GLN D C   1 
ATOM   5667 O  O   . GLN D 2 140 ? 51.577 32.742  -0.810  1.00 30.55 ? 1863 GLN D O   1 
ATOM   5668 C  CB  . GLN D 2 140 ? 50.018 29.915  -1.601  1.00 35.65 ? 1863 GLN D CB  1 
ATOM   5669 C  CG  . GLN D 2 140 ? 49.143 30.787  -2.505  1.00 42.54 ? 1863 GLN D CG  1 
ATOM   5670 C  CD  . GLN D 2 140 ? 48.486 29.965  -3.633  1.00 44.91 ? 1863 GLN D CD  1 
ATOM   5671 O  OE1 . GLN D 2 140 ? 49.160 29.191  -4.326  1.00 43.12 ? 1863 GLN D OE1 1 
ATOM   5672 N  NE2 . GLN D 2 140 ? 47.171 30.134  -3.813  1.00 44.05 ? 1863 GLN D NE2 1 
ATOM   5673 N  N   . PRO D 2 141 ? 52.958 30.946  -0.926  1.00 35.03 ? 1864 PRO D N   1 
ATOM   5674 C  CA  . PRO D 2 141 ? 54.113 31.778  -1.283  1.00 34.83 ? 1864 PRO D CA  1 
ATOM   5675 C  C   . PRO D 2 141 ? 53.750 32.723  -2.440  1.00 35.34 ? 1864 PRO D C   1 
ATOM   5676 O  O   . PRO D 2 141 ? 53.073 32.314  -3.391  1.00 32.18 ? 1864 PRO D O   1 
ATOM   5677 C  CB  . PRO D 2 141 ? 55.169 30.741  -1.677  1.00 35.30 ? 1864 PRO D CB  1 
ATOM   5678 C  CG  . PRO D 2 141 ? 54.808 29.531  -0.815  1.00 32.09 ? 1864 PRO D CG  1 
ATOM   5679 C  CD  . PRO D 2 141 ? 53.298 29.509  -0.960  1.00 32.06 ? 1864 PRO D CD  1 
ATOM   5680 N  N   . ARG D 2 142 ? 54.169 33.986  -2.344  1.00 34.67 ? 1865 ARG D N   1 
ATOM   5681 C  CA  . ARG D 2 142 ? 53.891 34.951  -3.402  1.00 33.14 ? 1865 ARG D CA  1 
ATOM   5682 C  C   . ARG D 2 142 ? 55.074 35.888  -3.620  1.00 35.08 ? 1865 ARG D C   1 
ATOM   5683 O  O   . ARG D 2 142 ? 56.071 35.843  -2.890  1.00 33.50 ? 1865 ARG D O   1 
ATOM   5684 C  CB  . ARG D 2 142 ? 52.589 35.753  -3.115  1.00 29.39 ? 1865 ARG D CB  1 
ATOM   5685 C  CG  . ARG D 2 142 ? 52.508 36.531  -1.772  1.00 27.80 ? 1865 ARG D CG  1 
ATOM   5686 C  CD  . ARG D 2 142 ? 52.096 35.658  -0.564  1.00 26.80 ? 1865 ARG D CD  1 
ATOM   5687 N  NE  . ARG D 2 142 ? 50.642 35.589  -0.359  1.00 24.67 ? 1865 ARG D NE  1 
ATOM   5688 C  CZ  . ARG D 2 142 ? 49.876 36.643  -0.066  1.00 22.45 ? 1865 ARG D CZ  1 
ATOM   5689 N  NH1 . ARG D 2 142 ? 50.418 37.853  0.063   1.00 19.22 ? 1865 ARG D NH1 1 
ATOM   5690 N  NH2 . ARG D 2 142 ? 48.562 36.500  0.082   1.00 14.13 ? 1865 ARG D NH2 1 
ATOM   5691 N  N   . GLU D 2 143 ? 54.967 36.716  -4.651  1.00 37.69 ? 1866 GLU D N   1 
ATOM   5692 C  CA  . GLU D 2 143 ? 56.015 37.668  -4.971  1.00 42.23 ? 1866 GLU D CA  1 
ATOM   5693 C  C   . GLU D 2 143 ? 55.499 39.033  -4.559  1.00 42.61 ? 1866 GLU D C   1 
ATOM   5694 O  O   . GLU D 2 143 ? 54.337 39.339  -4.790  1.00 46.17 ? 1866 GLU D O   1 
ATOM   5695 C  CB  . GLU D 2 143 ? 56.291 37.634  -6.470  1.00 44.95 ? 1866 GLU D CB  1 
ATOM   5696 C  CG  . GLU D 2 143 ? 55.075 37.957  -7.327  1.00 51.08 ? 1866 GLU D CG  1 
ATOM   5697 C  CD  . GLU D 2 143 ? 55.245 37.500  -8.773  1.00 56.38 ? 1866 GLU D CD  1 
ATOM   5698 O  OE1 . GLU D 2 143 ? 54.327 37.742  -9.600  1.00 56.79 ? 1866 GLU D OE1 1 
ATOM   5699 O  OE2 . GLU D 2 143 ? 56.299 36.890  -9.076  1.00 57.09 ? 1866 GLU D OE2 1 
ATOM   5700 N  N   . ASN D 2 144 ? 56.347 39.837  -3.931  1.00 42.15 ? 1867 ASN D N   1 
ATOM   5701 C  CA  . ASN D 2 144 ? 55.968 41.183  -3.497  1.00 41.33 ? 1867 ASN D CA  1 
ATOM   5702 C  C   . ASN D 2 144 ? 54.957 41.788  -4.481  1.00 39.13 ? 1867 ASN D C   1 
ATOM   5703 O  O   . ASN D 2 144 ? 55.302 42.195  -5.594  1.00 39.91 ? 1867 ASN D O   1 
ATOM   5704 C  CB  . ASN D 2 144 ? 57.233 42.027  -3.419  1.00 42.07 ? 1867 ASN D CB  1 
ATOM   5705 C  CG  . ASN D 2 144 ? 58.405 41.226  -2.903  1.00 44.76 ? 1867 ASN D CG  1 
ATOM   5706 O  OD1 . ASN D 2 144 ? 59.535 41.365  -3.387  1.00 47.59 ? 1867 ASN D OD1 1 
ATOM   5707 N  ND2 . ASN D 2 144 ? 58.143 40.368  -1.913  1.00 43.78 ? 1867 ASN D ND2 1 
ATOM   5708 N  N   . PRO D 2 145 ? 53.686 41.848  -4.076  1.00 37.08 ? 1868 PRO D N   1 
ATOM   5709 C  CA  . PRO D 2 145 ? 52.589 42.382  -4.888  1.00 38.46 ? 1868 PRO D CA  1 
ATOM   5710 C  C   . PRO D 2 145 ? 52.653 43.842  -5.330  1.00 39.41 ? 1868 PRO D C   1 
ATOM   5711 O  O   . PRO D 2 145 ? 51.832 44.275  -6.145  1.00 40.49 ? 1868 PRO D O   1 
ATOM   5712 C  CB  . PRO D 2 145 ? 51.359 42.094  -4.034  1.00 36.67 ? 1868 PRO D CB  1 
ATOM   5713 C  CG  . PRO D 2 145 ? 51.894 42.182  -2.654  1.00 37.76 ? 1868 PRO D CG  1 
ATOM   5714 C  CD  . PRO D 2 145 ? 53.193 41.421  -2.759  1.00 38.34 ? 1868 PRO D CD  1 
ATOM   5715 N  N   . PHE D 2 146 ? 53.607 44.605  -4.810  1.00 37.96 ? 1869 PHE D N   1 
ATOM   5716 C  CA  . PHE D 2 146 ? 53.702 46.005  -5.204  1.00 37.62 ? 1869 PHE D CA  1 
ATOM   5717 C  C   . PHE D 2 146 ? 55.046 46.317  -5.842  1.00 38.04 ? 1869 PHE D C   1 
ATOM   5718 O  O   . PHE D 2 146 ? 55.422 47.478  -5.988  1.00 36.90 ? 1869 PHE D O   1 
ATOM   5719 C  CB  . PHE D 2 146 ? 53.465 46.904  -3.990  1.00 34.70 ? 1869 PHE D CB  1 
ATOM   5720 C  CG  . PHE D 2 146 ? 52.130 46.690  -3.339  1.00 33.94 ? 1869 PHE D CG  1 
ATOM   5721 C  CD1 . PHE D 2 146 ? 52.048 46.271  -2.008  1.00 31.66 ? 1869 PHE D CD1 1 
ATOM   5722 C  CD2 . PHE D 2 146 ? 50.951 46.890  -4.060  1.00 34.48 ? 1869 PHE D CD2 1 
ATOM   5723 C  CE1 . PHE D 2 146 ? 50.812 46.053  -1.401  1.00 31.37 ? 1869 PHE D CE1 1 
ATOM   5724 C  CE2 . PHE D 2 146 ? 49.701 46.674  -3.464  1.00 35.54 ? 1869 PHE D CE2 1 
ATOM   5725 C  CZ  . PHE D 2 146 ? 49.631 46.255  -2.130  1.00 34.39 ? 1869 PHE D CZ  1 
ATOM   5726 N  N   . GLN D 2 147 ? 55.751 45.265  -6.242  1.00 39.97 ? 1870 GLN D N   1 
ATOM   5727 C  CA  . GLN D 2 147 ? 57.066 45.391  -6.858  1.00 40.94 ? 1870 GLN D CA  1 
ATOM   5728 C  C   . GLN D 2 147 ? 57.135 46.513  -7.898  1.00 40.76 ? 1870 GLN D C   1 
ATOM   5729 O  O   . GLN D 2 147 ? 56.295 46.587  -8.795  1.00 41.47 ? 1870 GLN D O   1 
ATOM   5730 C  CB  . GLN D 2 147 ? 57.448 44.059  -7.516  1.00 41.25 ? 1870 GLN D CB  1 
ATOM   5731 C  CG  . GLN D 2 147 ? 58.937 43.899  -7.784  1.00 43.34 ? 1870 GLN D CG  1 
ATOM   5732 C  CD  . GLN D 2 147 ? 59.714 43.498  -6.540  1.00 44.95 ? 1870 GLN D CD  1 
ATOM   5733 O  OE1 . GLN D 2 147 ? 60.939 43.615  -6.494  1.00 44.82 ? 1870 GLN D OE1 1 
ATOM   5734 N  NE2 . GLN D 2 147 ? 59.004 43.004  -5.532  1.00 46.93 ? 1870 GLN D NE2 1 
ATOM   5735 N  N   . ASN D 2 148 ? 58.129 47.388  -7.756  1.00 39.95 ? 1871 ASN D N   1 
ATOM   5736 C  CA  . ASN D 2 148 ? 58.356 48.485  -8.700  1.00 39.49 ? 1871 ASN D CA  1 
ATOM   5737 C  C   . ASN D 2 148 ? 57.150 49.382  -8.951  1.00 37.25 ? 1871 ASN D C   1 
ATOM   5738 O  O   . ASN D 2 148 ? 57.078 50.056  -9.973  1.00 37.43 ? 1871 ASN D O   1 
ATOM   5739 C  CB  . ASN D 2 148 ? 58.838 47.899  -10.028 1.00 40.88 ? 1871 ASN D CB  1 
ATOM   5740 C  CG  . ASN D 2 148 ? 59.971 46.889  -9.840  1.00 46.25 ? 1871 ASN D CG  1 
ATOM   5741 O  OD1 . ASN D 2 148 ? 59.934 45.775  -10.394 1.00 46.98 ? 1871 ASN D OD1 1 
ATOM   5742 N  ND2 . ASN D 2 148 ? 60.984 47.272  -9.056  1.00 42.49 ? 1871 ASN D ND2 1 
ATOM   5743 N  N   . LEU D 2 149 ? 56.207 49.391  -8.018  1.00 36.47 ? 1872 LEU D N   1 
ATOM   5744 C  CA  . LEU D 2 149 ? 55.012 50.207  -8.160  1.00 33.89 ? 1872 LEU D CA  1 
ATOM   5745 C  C   . LEU D 2 149 ? 55.293 51.573  -7.550  1.00 33.90 ? 1872 LEU D C   1 
ATOM   5746 O  O   . LEU D 2 149 ? 55.842 51.660  -6.445  1.00 33.16 ? 1872 LEU D O   1 
ATOM   5747 C  CB  . LEU D 2 149 ? 53.836 49.550  -7.431  1.00 31.63 ? 1872 LEU D CB  1 
ATOM   5748 C  CG  . LEU D 2 149 ? 52.423 49.972  -7.828  1.00 30.47 ? 1872 LEU D CG  1 
ATOM   5749 C  CD1 . LEU D 2 149 ? 52.107 49.404  -9.192  1.00 29.68 ? 1872 LEU D CD1 1 
ATOM   5750 C  CD2 . LEU D 2 149 ? 51.417 49.452  -6.815  1.00 31.77 ? 1872 LEU D CD2 1 
ATOM   5751 N  N   . LYS D 2 150 ? 54.950 52.630  -8.286  1.00 32.40 ? 1873 LYS D N   1 
ATOM   5752 C  CA  . LYS D 2 150 ? 55.126 54.003  -7.813  1.00 31.95 ? 1873 LYS D CA  1 
ATOM   5753 C  C   . LYS D 2 150 ? 53.729 54.524  -7.516  1.00 31.20 ? 1873 LYS D C   1 
ATOM   5754 O  O   . LYS D 2 150 ? 52.909 54.716  -8.423  1.00 30.03 ? 1873 LYS D O   1 
ATOM   5755 C  CB  . LYS D 2 150 ? 55.814 54.855  -8.874  1.00 34.43 ? 1873 LYS D CB  1 
ATOM   5756 C  CG  . LYS D 2 150 ? 57.339 54.833  -8.773  1.00 38.19 ? 1873 LYS D CG  1 
ATOM   5757 C  CD  . LYS D 2 150 ? 58.001 55.395  -10.027 1.00 42.27 ? 1873 LYS D CD  1 
ATOM   5758 C  CE  . LYS D 2 150 ? 57.935 54.382  -11.170 1.00 46.38 ? 1873 LYS D CE  1 
ATOM   5759 N  NZ  . LYS D 2 150 ? 58.622 53.085  -10.822 1.00 49.25 ? 1873 LYS D NZ  1 
ATOM   5760 N  N   . VAL D 2 151 ? 53.443 54.744  -6.240  1.00 30.02 ? 1874 VAL D N   1 
ATOM   5761 C  CA  . VAL D 2 151 ? 52.104 55.171  -5.872  1.00 31.76 ? 1874 VAL D CA  1 
ATOM   5762 C  C   . VAL D 2 151 ? 51.998 56.514  -5.171  1.00 34.14 ? 1874 VAL D C   1 
ATOM   5763 O  O   . VAL D 2 151 ? 52.922 56.957  -4.479  1.00 34.30 ? 1874 VAL D O   1 
ATOM   5764 C  CB  . VAL D 2 151 ? 51.412 54.096  -4.970  1.00 30.91 ? 1874 VAL D CB  1 
ATOM   5765 C  CG1 . VAL D 2 151 ? 52.171 52.769  -5.056  1.00 28.97 ? 1874 VAL D CG1 1 
ATOM   5766 C  CG2 . VAL D 2 151 ? 51.339 54.573  -3.533  1.00 26.67 ? 1874 VAL D CG2 1 
ATOM   5767 N  N   . LEU D 2 152 ? 50.842 57.144  -5.356  1.00 35.18 ? 1875 LEU D N   1 
ATOM   5768 C  CA  . LEU D 2 152 ? 50.546 58.421  -4.737  1.00 35.80 ? 1875 LEU D CA  1 
ATOM   5769 C  C   . LEU D 2 152 ? 49.417 58.177  -3.749  1.00 36.36 ? 1875 LEU D C   1 
ATOM   5770 O  O   . LEU D 2 152 ? 48.357 57.660  -4.116  1.00 37.50 ? 1875 LEU D O   1 
ATOM   5771 C  CB  . LEU D 2 152 ? 50.099 59.446  -5.779  1.00 38.95 ? 1875 LEU D CB  1 
ATOM   5772 C  CG  . LEU D 2 152 ? 49.654 60.802  -5.224  1.00 38.18 ? 1875 LEU D CG  1 
ATOM   5773 C  CD1 . LEU D 2 152 ? 50.810 61.429  -4.467  1.00 39.48 ? 1875 LEU D CD1 1 
ATOM   5774 C  CD2 . LEU D 2 152 ? 49.206 61.710  -6.363  1.00 38.45 ? 1875 LEU D CD2 1 
ATOM   5775 N  N   . LEU D 2 153 ? 49.668 58.521  -2.490  1.00 37.06 ? 1876 LEU D N   1 
ATOM   5776 C  CA  . LEU D 2 153 ? 48.681 58.366  -1.429  1.00 34.62 ? 1876 LEU D CA  1 
ATOM   5777 C  C   . LEU D 2 153 ? 48.058 59.717  -1.169  1.00 33.34 ? 1876 LEU D C   1 
ATOM   5778 O  O   . LEU D 2 153 ? 48.752 60.677  -0.832  1.00 34.00 ? 1876 LEU D O   1 
ATOM   5779 C  CB  . LEU D 2 153 ? 49.336 57.873  -0.147  1.00 34.40 ? 1876 LEU D CB  1 
ATOM   5780 C  CG  . LEU D 2 153 ? 49.431 56.364  0.030   1.00 36.69 ? 1876 LEU D CG  1 
ATOM   5781 C  CD1 . LEU D 2 153 ? 50.239 56.067  1.295   1.00 38.81 ? 1876 LEU D CD1 1 
ATOM   5782 C  CD2 . LEU D 2 153 ? 48.025 55.768  0.111   1.00 30.68 ? 1876 LEU D CD2 1 
ATOM   5783 N  N   . VAL D 2 154 ? 46.745 59.787  -1.324  1.00 32.46 ? 1877 VAL D N   1 
ATOM   5784 C  CA  . VAL D 2 154 ? 46.015 61.027  -1.109  1.00 30.87 ? 1877 VAL D CA  1 
ATOM   5785 C  C   . VAL D 2 154 ? 44.989 60.823  -0.012  1.00 29.70 ? 1877 VAL D C   1 
ATOM   5786 O  O   . VAL D 2 154 ? 44.107 59.982  -0.154  1.00 24.64 ? 1877 VAL D O   1 
ATOM   5787 C  CB  . VAL D 2 154 ? 45.276 61.451  -2.403  1.00 30.73 ? 1877 VAL D CB  1 
ATOM   5788 C  CG1 . VAL D 2 154 ? 44.289 62.585  -2.112  1.00 27.26 ? 1877 VAL D CG1 1 
ATOM   5789 C  CG2 . VAL D 2 154 ? 46.292 61.864  -3.460  1.00 25.71 ? 1877 VAL D CG2 1 
ATOM   5790 N  N   . SER D 2 155 ? 45.098 61.590  1.072   1.00 32.69 ? 1878 SER D N   1 
ATOM   5791 C  CA  . SER D 2 155 ? 44.143 61.471  2.176   1.00 36.50 ? 1878 SER D CA  1 
ATOM   5792 C  C   . SER D 2 155 ? 44.329 62.535  3.252   1.00 40.53 ? 1878 SER D C   1 
ATOM   5793 O  O   . SER D 2 155 ? 45.415 63.110  3.393   1.00 41.95 ? 1878 SER D O   1 
ATOM   5794 C  CB  . SER D 2 155 ? 44.263 60.085  2.817   1.00 34.24 ? 1878 SER D CB  1 
ATOM   5795 O  OG  . SER D 2 155 ? 43.347 59.906  3.883   1.00 30.38 ? 1878 SER D OG  1 
ATOM   5796 N  N   . ASP D 2 156 ? 43.265 62.788  4.014   1.00 42.99 ? 1879 ASP D N   1 
ATOM   5797 C  CA  . ASP D 2 156 ? 43.331 63.767  5.090   1.00 48.78 ? 1879 ASP D CA  1 
ATOM   5798 C  C   . ASP D 2 156 ? 43.604 63.097  6.441   1.00 51.87 ? 1879 ASP D C   1 
ATOM   5799 O  O   . ASP D 2 156 ? 43.611 63.765  7.483   1.00 55.05 ? 1879 ASP D O   1 
ATOM   5800 C  CB  . ASP D 2 156 ? 42.036 64.572  5.181   1.00 50.10 ? 1879 ASP D CB  1 
ATOM   5801 C  CG  . ASP D 2 156 ? 40.858 63.725  5.585   1.00 53.64 ? 1879 ASP D CG  1 
ATOM   5802 O  OD1 . ASP D 2 156 ? 41.017 62.882  6.500   1.00 55.37 ? 1879 ASP D OD1 1 
ATOM   5803 O  OD2 . ASP D 2 156 ? 39.772 63.911  4.995   1.00 54.89 ? 1879 ASP D OD2 1 
ATOM   5804 N  N   . GLN D 2 157 ? 43.809 61.780  6.419   1.00 51.05 ? 1880 GLN D N   1 
ATOM   5805 C  CA  . GLN D 2 157 ? 44.108 61.022  7.630   1.00 50.35 ? 1880 GLN D CA  1 
ATOM   5806 C  C   . GLN D 2 157 ? 45.620 60.795  7.684   1.00 52.12 ? 1880 GLN D C   1 
ATOM   5807 O  O   . GLN D 2 157 ? 46.120 59.730  7.318   1.00 53.56 ? 1880 GLN D O   1 
ATOM   5808 C  CB  . GLN D 2 157 ? 43.373 59.677  7.614   1.00 50.36 ? 1880 GLN D CB  1 
ATOM   5809 C  CG  . GLN D 2 157 ? 41.858 59.756  7.820   1.00 52.88 ? 1880 GLN D CG  1 
ATOM   5810 C  CD  . GLN D 2 157 ? 41.469 60.097  9.256   1.00 56.52 ? 1880 GLN D CD  1 
ATOM   5811 O  OE1 . GLN D 2 157 ? 41.824 59.381  10.200  1.00 56.68 ? 1880 GLN D OE1 1 
ATOM   5812 N  NE2 . GLN D 2 157 ? 40.734 61.193  9.426   1.00 56.47 ? 1880 GLN D NE2 1 
ATOM   5813 N  N   . GLN D 2 158 ? 46.337 61.815  8.144   1.00 53.66 ? 1881 GLN D N   1 
ATOM   5814 C  CA  . GLN D 2 158 ? 47.794 61.797  8.251   1.00 55.16 ? 1881 GLN D CA  1 
ATOM   5815 C  C   . GLN D 2 158 ? 48.362 60.621  9.034   1.00 55.52 ? 1881 GLN D C   1 
ATOM   5816 O  O   . GLN D 2 158 ? 49.575 60.414  9.046   1.00 57.88 ? 1881 GLN D O   1 
ATOM   5817 C  CB  . GLN D 2 158 ? 48.263 63.109  8.892   1.00 55.98 ? 1881 GLN D CB  1 
ATOM   5818 C  CG  . GLN D 2 158 ? 49.759 63.221  9.144   1.00 58.37 ? 1881 GLN D CG  1 
ATOM   5819 C  CD  . GLN D 2 158 ? 50.586 62.881  7.919   1.00 60.75 ? 1881 GLN D CD  1 
ATOM   5820 O  OE1 . GLN D 2 158 ? 50.352 63.408  6.829   1.00 61.55 ? 1881 GLN D OE1 1 
ATOM   5821 N  NE2 . GLN D 2 158 ? 51.569 61.998  8.096   1.00 60.98 ? 1881 GLN D NE2 1 
ATOM   5822 N  N   . GLN D 2 159 ? 47.506 59.842  9.683   1.00 54.94 ? 1882 GLN D N   1 
ATOM   5823 C  CA  . GLN D 2 159 ? 48.009 58.719  10.470  1.00 55.16 ? 1882 GLN D CA  1 
ATOM   5824 C  C   . GLN D 2 159 ? 47.416 57.358  10.110  1.00 54.40 ? 1882 GLN D C   1 
ATOM   5825 O  O   . GLN D 2 159 ? 48.152 56.397  9.866   1.00 52.78 ? 1882 GLN D O   1 
ATOM   5826 C  CB  . GLN D 2 159 ? 47.779 58.983  11.959  1.00 55.28 ? 1882 GLN D CB  1 
ATOM   5827 C  CG  . GLN D 2 159 ? 48.500 58.016  12.880  1.00 56.39 ? 1882 GLN D CG  1 
ATOM   5828 C  CD  . GLN D 2 159 ? 47.607 57.517  14.005  1.00 58.69 ? 1882 GLN D CD  1 
ATOM   5829 O  OE1 . GLN D 2 159 ? 46.764 58.260  14.514  1.00 59.43 ? 1882 GLN D OE1 1 
ATOM   5830 N  NE2 . GLN D 2 159 ? 47.796 56.258  14.408  1.00 56.86 ? 1882 GLN D NE2 1 
ATOM   5831 N  N   . ASN D 2 160 ? 46.091 57.268  10.085  1.00 52.74 ? 1883 ASN D N   1 
ATOM   5832 C  CA  . ASN D 2 160 ? 45.446 56.001  9.772   1.00 52.64 ? 1883 ASN D CA  1 
ATOM   5833 C  C   . ASN D 2 160 ? 45.371 55.708  8.281   1.00 51.39 ? 1883 ASN D C   1 
ATOM   5834 O  O   . ASN D 2 160 ? 44.766 54.712  7.868   1.00 52.33 ? 1883 ASN D O   1 
ATOM   5835 C  CB  . ASN D 2 160 ? 44.037 55.938  10.379  1.00 55.05 ? 1883 ASN D CB  1 
ATOM   5836 C  CG  . ASN D 2 160 ? 44.059 55.894  11.895  1.00 58.52 ? 1883 ASN D CG  1 
ATOM   5837 O  OD1 . ASN D 2 160 ? 43.097 55.456  12.529  1.00 60.04 ? 1883 ASN D OD1 1 
ATOM   5838 N  ND2 . ASN D 2 160 ? 45.160 56.358  12.487  1.00 59.13 ? 1883 ASN D ND2 1 
ATOM   5839 N  N   . PHE D 2 161 ? 45.978 56.564  7.468   1.00 47.50 ? 1884 PHE D N   1 
ATOM   5840 C  CA  . PHE D 2 161 ? 45.969 56.335  6.035   1.00 44.08 ? 1884 PHE D CA  1 
ATOM   5841 C  C   . PHE D 2 161 ? 47.338 56.579  5.418   1.00 44.48 ? 1884 PHE D C   1 
ATOM   5842 O  O   . PHE D 2 161 ? 48.053 55.630  5.095   1.00 45.62 ? 1884 PHE D O   1 
ATOM   5843 C  CB  . PHE D 2 161 ? 44.944 57.228  5.357   1.00 41.68 ? 1884 PHE D CB  1 
ATOM   5844 C  CG  . PHE D 2 161 ? 44.620 56.808  3.959   1.00 42.85 ? 1884 PHE D CG  1 
ATOM   5845 C  CD1 . PHE D 2 161 ? 43.441 56.121  3.682   1.00 42.93 ? 1884 PHE D CD1 1 
ATOM   5846 C  CD2 . PHE D 2 161 ? 45.503 57.071  2.918   1.00 42.85 ? 1884 PHE D CD2 1 
ATOM   5847 C  CE1 . PHE D 2 161 ? 43.143 55.701  2.387   1.00 40.60 ? 1884 PHE D CE1 1 
ATOM   5848 C  CE2 . PHE D 2 161 ? 45.214 56.658  1.622   1.00 43.64 ? 1884 PHE D CE2 1 
ATOM   5849 C  CZ  . PHE D 2 161 ? 44.029 55.970  1.358   1.00 41.99 ? 1884 PHE D CZ  1 
ATOM   5850 N  N   . LEU D 2 162 ? 47.709 57.848  5.263   1.00 43.23 ? 1885 LEU D N   1 
ATOM   5851 C  CA  . LEU D 2 162 ? 48.994 58.192  4.661   1.00 42.23 ? 1885 LEU D CA  1 
ATOM   5852 C  C   . LEU D 2 162 ? 50.166 57.445  5.306   1.00 41.45 ? 1885 LEU D C   1 
ATOM   5853 O  O   . LEU D 2 162 ? 50.991 56.861  4.611   1.00 40.57 ? 1885 LEU D O   1 
ATOM   5854 C  CB  . LEU D 2 162 ? 49.213 59.710  4.724   1.00 41.65 ? 1885 LEU D CB  1 
ATOM   5855 C  CG  . LEU D 2 162 ? 48.124 60.590  4.093   1.00 40.75 ? 1885 LEU D CG  1 
ATOM   5856 C  CD1 . LEU D 2 162 ? 48.528 62.048  4.232   1.00 41.11 ? 1885 LEU D CD1 1 
ATOM   5857 C  CD2 . LEU D 2 162 ? 47.930 60.240  2.614   1.00 40.73 ? 1885 LEU D CD2 1 
ATOM   5858 N  N   . GLU D 2 163 ? 50.239 57.457  6.632   1.00 43.34 ? 1886 GLU D N   1 
ATOM   5859 C  CA  . GLU D 2 163 ? 51.316 56.758  7.332   1.00 44.14 ? 1886 GLU D CA  1 
ATOM   5860 C  C   . GLU D 2 163 ? 51.140 55.235  7.257   1.00 42.50 ? 1886 GLU D C   1 
ATOM   5861 O  O   . GLU D 2 163 ? 52.101 54.506  7.018   1.00 44.25 ? 1886 GLU D O   1 
ATOM   5862 C  CB  . GLU D 2 163 ? 51.361 57.180  8.804   1.00 46.44 ? 1886 GLU D CB  1 
ATOM   5863 C  CG  . GLU D 2 163 ? 51.736 58.634  9.032   1.00 50.87 ? 1886 GLU D CG  1 
ATOM   5864 C  CD  . GLU D 2 163 ? 51.774 59.018  10.514  1.00 52.90 ? 1886 GLU D CD  1 
ATOM   5865 O  OE1 . GLU D 2 163 ? 52.146 60.178  10.810  1.00 53.10 ? 1886 GLU D OE1 1 
ATOM   5866 O  OE2 . GLU D 2 163 ? 51.435 58.170  11.377  1.00 52.66 ? 1886 GLU D OE2 1 
ATOM   5867 N  N   . LEU D 2 164 ? 49.907 54.769  7.455   1.00 39.95 ? 1887 LEU D N   1 
ATOM   5868 C  CA  . LEU D 2 164 ? 49.574 53.338  7.437   1.00 38.56 ? 1887 LEU D CA  1 
ATOM   5869 C  C   . LEU D 2 164 ? 49.828 52.585  6.128   1.00 37.85 ? 1887 LEU D C   1 
ATOM   5870 O  O   . LEU D 2 164 ? 50.480 51.539  6.112   1.00 38.91 ? 1887 LEU D O   1 
ATOM   5871 C  CB  . LEU D 2 164 ? 48.100 53.130  7.805   1.00 38.16 ? 1887 LEU D CB  1 
ATOM   5872 C  CG  . LEU D 2 164 ? 47.615 51.695  7.535   1.00 40.58 ? 1887 LEU D CG  1 
ATOM   5873 C  CD1 . LEU D 2 164 ? 48.294 50.773  8.525   1.00 41.29 ? 1887 LEU D CD1 1 
ATOM   5874 C  CD2 . LEU D 2 164 ? 46.093 51.572  7.647   1.00 40.38 ? 1887 LEU D CD2 1 
ATOM   5875 N  N   . TRP D 2 165 ? 49.277 53.085  5.035   1.00 34.68 ? 1888 TRP D N   1 
ATOM   5876 C  CA  . TRP D 2 165 ? 49.463 52.417  3.766   1.00 34.15 ? 1888 TRP D CA  1 
ATOM   5877 C  C   . TRP D 2 165 ? 50.842 52.671  3.175   1.00 36.41 ? 1888 TRP D C   1 
ATOM   5878 O  O   . TRP D 2 165 ? 51.341 51.868  2.389   1.00 38.08 ? 1888 TRP D O   1 
ATOM   5879 C  CB  . TRP D 2 165 ? 48.369 52.845  2.803   1.00 31.46 ? 1888 TRP D CB  1 
ATOM   5880 C  CG  . TRP D 2 165 ? 47.043 52.440  3.313   1.00 27.60 ? 1888 TRP D CG  1 
ATOM   5881 C  CD1 . TRP D 2 165 ? 46.033 53.257  3.734   1.00 27.11 ? 1888 TRP D CD1 1 
ATOM   5882 C  CD2 . TRP D 2 165 ? 46.591 51.101  3.520   1.00 25.80 ? 1888 TRP D CD2 1 
ATOM   5883 N  NE1 . TRP D 2 165 ? 44.975 52.505  4.195   1.00 24.02 ? 1888 TRP D NE1 1 
ATOM   5884 C  CE2 . TRP D 2 165 ? 45.292 51.178  4.075   1.00 25.18 ? 1888 TRP D CE2 1 
ATOM   5885 C  CE3 . TRP D 2 165 ? 47.159 49.841  3.295   1.00 21.24 ? 1888 TRP D CE3 1 
ATOM   5886 C  CZ2 . TRP D 2 165 ? 44.551 50.040  4.404   1.00 25.13 ? 1888 TRP D CZ2 1 
ATOM   5887 C  CZ3 . TRP D 2 165 ? 46.433 48.718  3.622   1.00 22.40 ? 1888 TRP D CZ3 1 
ATOM   5888 C  CH2 . TRP D 2 165 ? 45.137 48.821  4.173   1.00 24.41 ? 1888 TRP D CH2 1 
ATOM   5889 N  N   . SER D 2 166 ? 51.462 53.781  3.556   1.00 36.57 ? 1889 SER D N   1 
ATOM   5890 C  CA  . SER D 2 166 ? 52.802 54.094  3.068   1.00 38.17 ? 1889 SER D CA  1 
ATOM   5891 C  C   . SER D 2 166 ? 53.707 52.927  3.418   1.00 36.64 ? 1889 SER D C   1 
ATOM   5892 O  O   . SER D 2 166 ? 54.247 52.247  2.549   1.00 37.61 ? 1889 SER D O   1 
ATOM   5893 C  CB  . SER D 2 166 ? 53.345 55.349  3.756   1.00 40.49 ? 1889 SER D CB  1 
ATOM   5894 O  OG  . SER D 2 166 ? 54.750 55.442  3.574   1.00 43.55 ? 1889 SER D OG  1 
ATOM   5895 N  N   . GLU D 2 167 ? 53.865 52.713  4.717   1.00 35.86 ? 1890 GLU D N   1 
ATOM   5896 C  CA  . GLU D 2 167 ? 54.693 51.643  5.247   1.00 32.47 ? 1890 GLU D CA  1 
ATOM   5897 C  C   . GLU D 2 167 ? 54.298 50.285  4.681   1.00 33.57 ? 1890 GLU D C   1 
ATOM   5898 O  O   . GLU D 2 167 ? 55.162 49.473  4.326   1.00 35.51 ? 1890 GLU D O   1 
ATOM   5899 C  CB  . GLU D 2 167 ? 54.575 51.636  6.774   1.00 31.64 ? 1890 GLU D CB  1 
ATOM   5900 C  CG  . GLU D 2 167 ? 55.159 50.427  7.471   1.00 31.65 ? 1890 GLU D CG  1 
ATOM   5901 C  CD  . GLU D 2 167 ? 55.066 50.527  8.992   1.00 32.13 ? 1890 GLU D CD  1 
ATOM   5902 O  OE1 . GLU D 2 167 ? 53.983 50.906  9.508   1.00 31.86 ? 1890 GLU D OE1 1 
ATOM   5903 O  OE2 . GLU D 2 167 ? 56.078 50.218  9.666   1.00 31.26 ? 1890 GLU D OE2 1 
ATOM   5904 N  N   . ILE D 2 168 ? 52.998 50.026  4.589   1.00 32.26 ? 1891 ILE D N   1 
ATOM   5905 C  CA  . ILE D 2 168 ? 52.544 48.735  4.073   1.00 32.57 ? 1891 ILE D CA  1 
ATOM   5906 C  C   . ILE D 2 168 ? 52.893 48.529  2.593   1.00 31.76 ? 1891 ILE D C   1 
ATOM   5907 O  O   . ILE D 2 168 ? 53.405 47.471  2.207   1.00 29.60 ? 1891 ILE D O   1 
ATOM   5908 C  CB  . ILE D 2 168 ? 51.026 48.551  4.302   1.00 31.06 ? 1891 ILE D CB  1 
ATOM   5909 C  CG1 . ILE D 2 168 ? 50.766 48.381  5.804   1.00 29.52 ? 1891 ILE D CG1 1 
ATOM   5910 C  CG2 . ILE D 2 168 ? 50.508 47.348  3.525   1.00 28.55 ? 1891 ILE D CG2 1 
ATOM   5911 C  CD1 . ILE D 2 168 ? 49.311 48.186  6.157   1.00 31.67 ? 1891 ILE D CD1 1 
ATOM   5912 N  N   . LEU D 2 169 ? 52.634 49.542  1.771   1.00 31.63 ? 1892 LEU D N   1 
ATOM   5913 C  CA  . LEU D 2 169 ? 52.949 49.458  0.350   1.00 29.18 ? 1892 LEU D CA  1 
ATOM   5914 C  C   . LEU D 2 169 ? 54.457 49.277  0.113   1.00 31.44 ? 1892 LEU D C   1 
ATOM   5915 O  O   . LEU D 2 169 ? 54.856 48.501  -0.760  1.00 30.12 ? 1892 LEU D O   1 
ATOM   5916 C  CB  . LEU D 2 169 ? 52.443 50.708  -0.367  1.00 26.30 ? 1892 LEU D CB  1 
ATOM   5917 C  CG  . LEU D 2 169 ? 50.928 50.767  -0.573  1.00 23.39 ? 1892 LEU D CG  1 
ATOM   5918 C  CD1 . LEU D 2 169 ? 50.479 52.222  -0.746  1.00 23.26 ? 1892 LEU D CD1 1 
ATOM   5919 C  CD2 . LEU D 2 169 ? 50.546 49.903  -1.784  1.00 19.01 ? 1892 LEU D CD2 1 
ATOM   5920 N  N   . MET D 2 170 ? 55.289 49.975  0.894   1.00 33.65 ? 1893 MET D N   1 
ATOM   5921 C  CA  . MET D 2 170 ? 56.752 49.877  0.760   1.00 33.73 ? 1893 MET D CA  1 
ATOM   5922 C  C   . MET D 2 170 ? 57.295 48.494  1.126   1.00 33.82 ? 1893 MET D C   1 
ATOM   5923 O  O   . MET D 2 170 ? 57.983 47.856  0.319   1.00 32.15 ? 1893 MET D O   1 
ATOM   5924 C  CB  . MET D 2 170 ? 57.449 50.941  1.622   1.00 32.16 ? 1893 MET D CB  1 
ATOM   5925 C  CG  . MET D 2 170 ? 57.322 52.370  1.084   1.00 31.95 ? 1893 MET D CG  1 
ATOM   5926 S  SD  . MET D 2 170 ? 57.985 52.588  -0.610  1.00 36.09 ? 1893 MET D SD  1 
ATOM   5927 C  CE  . MET D 2 170 ? 59.781 52.385  -0.317  1.00 31.02 ? 1893 MET D CE  1 
ATOM   5928 N  N   . THR D 2 171 ? 56.992 48.021  2.334   1.00 34.89 ? 1894 THR D N   1 
ATOM   5929 C  CA  . THR D 2 171 ? 57.482 46.704  2.734   1.00 35.66 ? 1894 THR D CA  1 
ATOM   5930 C  C   . THR D 2 171 ? 56.881 45.662  1.798   1.00 33.48 ? 1894 THR D C   1 
ATOM   5931 O  O   . THR D 2 171 ? 57.321 44.515  1.764   1.00 34.71 ? 1894 THR D O   1 
ATOM   5932 C  CB  . THR D 2 171 ? 57.117 46.349  4.204   1.00 36.72 ? 1894 THR D CB  1 
ATOM   5933 O  OG1 . THR D 2 171 ? 55.718 46.078  4.299   1.00 38.25 ? 1894 THR D OG1 1 
ATOM   5934 C  CG2 . THR D 2 171 ? 57.476 47.505  5.144   1.00 39.12 ? 1894 THR D CG2 1 
ATOM   5935 N  N   . GLY D 2 172 ? 55.864 46.068  1.046   1.00 30.95 ? 1895 GLY D N   1 
ATOM   5936 C  CA  . GLY D 2 172 ? 55.251 45.171  0.086   1.00 30.08 ? 1895 GLY D CA  1 
ATOM   5937 C  C   . GLY D 2 172 ? 55.944 45.285  -1.271  1.00 32.03 ? 1895 GLY D C   1 
ATOM   5938 O  O   . GLY D 2 172 ? 55.403 44.849  -2.295  1.00 32.37 ? 1895 GLY D O   1 
ATOM   5939 N  N   . GLY D 2 173 ? 57.130 45.897  -1.291  1.00 31.42 ? 1896 GLY D N   1 
ATOM   5940 C  CA  . GLY D 2 173 ? 57.885 46.031  -2.532  1.00 29.22 ? 1896 GLY D CA  1 
ATOM   5941 C  C   . GLY D 2 173 ? 57.703 47.257  -3.424  1.00 28.51 ? 1896 GLY D C   1 
ATOM   5942 O  O   . GLY D 2 173 ? 58.302 47.326  -4.507  1.00 25.50 ? 1896 GLY D O   1 
ATOM   5943 N  N   . ALA D 2 174 ? 56.899 48.228  -3.001  1.00 28.60 ? 1897 ALA D N   1 
ATOM   5944 C  CA  . ALA D 2 174 ? 56.686 49.421  -3.821  1.00 30.84 ? 1897 ALA D CA  1 
ATOM   5945 C  C   . ALA D 2 174 ? 58.004 50.137  -4.126  1.00 32.81 ? 1897 ALA D C   1 
ATOM   5946 O  O   . ALA D 2 174 ? 58.932 50.137  -3.309  1.00 33.08 ? 1897 ALA D O   1 
ATOM   5947 C  CB  . ALA D 2 174 ? 55.724 50.373  -3.119  1.00 31.76 ? 1897 ALA D CB  1 
ATOM   5948 N  N   . ALA D 2 175 ? 58.089 50.734  -5.312  1.00 33.39 ? 1898 ALA D N   1 
ATOM   5949 C  CA  . ALA D 2 175 ? 59.287 51.466  -5.700  1.00 32.98 ? 1898 ALA D CA  1 
ATOM   5950 C  C   . ALA D 2 175 ? 59.345 52.727  -4.848  1.00 33.32 ? 1898 ALA D C   1 
ATOM   5951 O  O   . ALA D 2 175 ? 60.418 53.156  -4.418  1.00 35.53 ? 1898 ALA D O   1 
ATOM   5952 C  CB  . ALA D 2 175 ? 59.216 51.840  -7.178  1.00 31.82 ? 1898 ALA D CB  1 
ATOM   5953 N  N   . SER D 2 176 ? 58.178 53.319  -4.612  1.00 32.42 ? 1899 SER D N   1 
ATOM   5954 C  CA  . SER D 2 176 ? 58.090 54.535  -3.807  1.00 34.01 ? 1899 SER D CA  1 
ATOM   5955 C  C   . SER D 2 176 ? 56.639 54.935  -3.557  1.00 35.24 ? 1899 SER D C   1 
ATOM   5956 O  O   . SER D 2 176 ? 55.729 54.566  -4.318  1.00 36.61 ? 1899 SER D O   1 
ATOM   5957 C  CB  . SER D 2 176 ? 58.835 55.691  -4.492  1.00 31.11 ? 1899 SER D CB  1 
ATOM   5958 O  OG  . SER D 2 176 ? 58.381 55.876  -5.824  1.00 26.52 ? 1899 SER D OG  1 
ATOM   5959 N  N   . VAL D 2 177 ? 56.432 55.699  -2.488  1.00 33.31 ? 1900 VAL D N   1 
ATOM   5960 C  CA  . VAL D 2 177 ? 55.098 56.151  -2.115  1.00 33.27 ? 1900 VAL D CA  1 
ATOM   5961 C  C   . VAL D 2 177 ? 55.105 57.634  -1.778  1.00 34.95 ? 1900 VAL D C   1 
ATOM   5962 O  O   . VAL D 2 177 ? 55.721 58.039  -0.797  1.00 35.56 ? 1900 VAL D O   1 
ATOM   5963 C  CB  . VAL D 2 177 ? 54.604 55.379  -0.884  1.00 29.77 ? 1900 VAL D CB  1 
ATOM   5964 C  CG1 . VAL D 2 177 ? 53.168 55.750  -0.559  1.00 31.15 ? 1900 VAL D CG1 1 
ATOM   5965 C  CG2 . VAL D 2 177 ? 54.720 53.903  -1.142  1.00 31.71 ? 1900 VAL D CG2 1 
ATOM   5966 N  N   . LYS D 2 178 ? 54.430 58.444  -2.585  1.00 37.52 ? 1901 LYS D N   1 
ATOM   5967 C  CA  . LYS D 2 178 ? 54.372 59.876  -2.310  1.00 41.37 ? 1901 LYS D CA  1 
ATOM   5968 C  C   . LYS D 2 178 ? 53.118 60.177  -1.504  1.00 42.90 ? 1901 LYS D C   1 
ATOM   5969 O  O   . LYS D 2 178 ? 51.990 60.034  -1.991  1.00 42.46 ? 1901 LYS D O   1 
ATOM   5970 C  CB  . LYS D 2 178 ? 54.355 60.703  -3.598  1.00 42.79 ? 1901 LYS D CB  1 
ATOM   5971 C  CG  . LYS D 2 178 ? 53.888 62.150  -3.394  1.00 48.11 ? 1901 LYS D CG  1 
ATOM   5972 C  CD  . LYS D 2 178 ? 54.897 63.005  -2.624  1.00 52.69 ? 1901 LYS D CD  1 
ATOM   5973 C  CE  . LYS D 2 178 ? 56.124 63.340  -3.483  1.00 56.87 ? 1901 LYS D CE  1 
ATOM   5974 N  NZ  . LYS D 2 178 ? 55.738 63.998  -4.776  1.00 56.29 ? 1901 LYS D NZ  1 
ATOM   5975 N  N   . GLN D 2 179 ? 53.331 60.593  -0.264  1.00 42.25 ? 1902 GLN D N   1 
ATOM   5976 C  CA  . GLN D 2 179 ? 52.247 60.930  0.633   1.00 41.50 ? 1902 GLN D CA  1 
ATOM   5977 C  C   . GLN D 2 179 ? 51.797 62.366  0.412   1.00 42.64 ? 1902 GLN D C   1 
ATOM   5978 O  O   . GLN D 2 179 ? 52.615 63.290  0.437   1.00 39.97 ? 1902 GLN D O   1 
ATOM   5979 C  CB  . GLN D 2 179 ? 52.730 60.732  2.060   1.00 39.93 ? 1902 GLN D CB  1 
ATOM   5980 C  CG  . GLN D 2 179 ? 53.209 59.321  2.275   1.00 38.91 ? 1902 GLN D CG  1 
ATOM   5981 C  CD  . GLN D 2 179 ? 53.746 59.084  3.660   1.00 37.09 ? 1902 GLN D CD  1 
ATOM   5982 O  OE1 . GLN D 2 179 ? 53.140 59.500  4.648   1.00 33.05 ? 1902 GLN D OE1 1 
ATOM   5983 N  NE2 . GLN D 2 179 ? 54.885 58.394  3.746   1.00 36.83 ? 1902 GLN D NE2 1 
ATOM   5984 N  N   . HIS D 2 180 ? 50.497 62.544  0.189   1.00 43.31 ? 1903 HIS D N   1 
ATOM   5985 C  CA  . HIS D 2 180 ? 49.943 63.866  -0.028  1.00 44.76 ? 1903 HIS D CA  1 
ATOM   5986 C  C   . HIS D 2 180 ? 48.637 64.068  0.729   1.00 45.48 ? 1903 HIS D C   1 
ATOM   5987 O  O   . HIS D 2 180 ? 47.698 63.281  0.586   1.00 44.78 ? 1903 HIS D O   1 
ATOM   5988 C  CB  . HIS D 2 180 ? 49.700 64.117  -1.511  1.00 47.20 ? 1903 HIS D CB  1 
ATOM   5989 C  CG  . HIS D 2 180 ? 49.118 65.465  -1.786  1.00 49.82 ? 1903 HIS D CG  1 
ATOM   5990 N  ND1 . HIS D 2 180 ? 49.794 66.634  -1.505  1.00 52.36 ? 1903 HIS D ND1 1 
ATOM   5991 C  CD2 . HIS D 2 180 ? 47.898 65.833  -2.240  1.00 50.10 ? 1903 HIS D CD2 1 
ATOM   5992 C  CE1 . HIS D 2 180 ? 49.013 67.664  -1.772  1.00 53.39 ? 1903 HIS D CE1 1 
ATOM   5993 N  NE2 . HIS D 2 180 ? 47.856 67.206  -2.219  1.00 53.01 ? 1903 HIS D NE2 1 
ATOM   5994 N  N   . HIS D 2 181 ? 48.580 65.136  1.524   1.00 47.65 ? 1904 HIS D N   1 
ATOM   5995 C  CA  . HIS D 2 181 ? 47.388 65.449  2.306   1.00 48.36 ? 1904 HIS D CA  1 
ATOM   5996 C  C   . HIS D 2 181 ? 46.294 66.096  1.446   1.00 49.88 ? 1904 HIS D C   1 
ATOM   5997 O  O   . HIS D 2 181 ? 46.548 67.051  0.705   1.00 50.22 ? 1904 HIS D O   1 
ATOM   5998 C  CB  . HIS D 2 181 ? 47.753 66.368  3.468   1.00 48.98 ? 1904 HIS D CB  1 
ATOM   5999 C  CG  . HIS D 2 181 ? 46.670 66.497  4.492   1.00 51.84 ? 1904 HIS D CG  1 
ATOM   6000 N  ND1 . HIS D 2 181 ? 46.871 66.211  5.827   1.00 53.17 ? 1904 HIS D ND1 1 
ATOM   6001 C  CD2 . HIS D 2 181 ? 45.373 66.870  4.377   1.00 51.74 ? 1904 HIS D CD2 1 
ATOM   6002 C  CE1 . HIS D 2 181 ? 45.742 66.400  6.490   1.00 53.44 ? 1904 HIS D CE1 1 
ATOM   6003 N  NE2 . HIS D 2 181 ? 44.818 66.800  5.633   1.00 53.51 ? 1904 HIS D NE2 1 
ATOM   6004 N  N   . SER D 2 182 ? 45.076 65.567  1.558   1.00 50.32 ? 1905 SER D N   1 
ATOM   6005 C  CA  . SER D 2 182 ? 43.933 66.054  0.784   1.00 51.72 ? 1905 SER D CA  1 
ATOM   6006 C  C   . SER D 2 182 ? 43.744 67.562  0.860   1.00 53.67 ? 1905 SER D C   1 
ATOM   6007 O  O   . SER D 2 182 ? 43.499 68.224  -0.153  1.00 56.50 ? 1905 SER D O   1 
ATOM   6008 C  CB  . SER D 2 182 ? 42.637 65.371  1.245   1.00 50.28 ? 1905 SER D CB  1 
ATOM   6009 O  OG  . SER D 2 182 ? 42.622 63.990  0.921   1.00 51.01 ? 1905 SER D OG  1 
ATOM   6010 N  N   . SER D 2 183 ? 43.851 68.112  2.060   1.00 54.66 ? 1906 SER D N   1 
ATOM   6011 C  CA  . SER D 2 183 ? 43.663 69.543  2.229   1.00 56.49 ? 1906 SER D CA  1 
ATOM   6012 C  C   . SER D 2 183 ? 44.951 70.346  2.095   1.00 58.69 ? 1906 SER D C   1 
ATOM   6013 O  O   . SER D 2 183 ? 44.975 71.542  2.380   1.00 57.42 ? 1906 SER D O   1 
ATOM   6014 C  CB  . SER D 2 183 ? 42.990 69.825  3.575   1.00 56.50 ? 1906 SER D CB  1 
ATOM   6015 O  OG  . SER D 2 183 ? 43.593 69.071  4.612   1.00 57.83 ? 1906 SER D OG  1 
ATOM   6016 N  N   . ALA D 2 184 ? 46.026 69.696  1.666   1.00 61.52 ? 1907 ALA D N   1 
ATOM   6017 C  CA  . ALA D 2 184 ? 47.289 70.399  1.501   1.00 64.56 ? 1907 ALA D CA  1 
ATOM   6018 C  C   . ALA D 2 184 ? 47.496 70.738  0.031   1.00 66.45 ? 1907 ALA D C   1 
ATOM   6019 O  O   . ALA D 2 184 ? 47.499 69.854  -0.820  1.00 67.50 ? 1907 ALA D O   1 
ATOM   6020 C  CB  . ALA D 2 184 ? 48.436 69.544  2.012   1.00 65.02 ? 1907 ALA D CB  1 
ATOM   6021 N  N   . HIS D 2 185 ? 47.653 72.021  -0.267  1.00 68.71 ? 1908 HIS D N   1 
ATOM   6022 C  CA  . HIS D 2 185 ? 47.869 72.458  -1.642  1.00 71.06 ? 1908 HIS D CA  1 
ATOM   6023 C  C   . HIS D 2 185 ? 49.334 72.309  -2.035  1.00 70.22 ? 1908 HIS D C   1 
ATOM   6024 O  O   . HIS D 2 185 ? 50.184 73.114  -1.642  1.00 70.15 ? 1908 HIS D O   1 
ATOM   6025 C  CB  . HIS D 2 185 ? 47.408 73.918  -1.837  1.00 75.00 ? 1908 HIS D CB  1 
ATOM   6026 C  CG  . HIS D 2 185 ? 47.600 74.799  -0.634  1.00 78.76 ? 1908 HIS D CG  1 
ATOM   6027 N  ND1 . HIS D 2 185 ? 47.260 76.136  -0.635  1.00 79.95 ? 1908 HIS D ND1 1 
ATOM   6028 C  CD2 . HIS D 2 185 ? 48.068 74.534  0.612   1.00 79.80 ? 1908 HIS D CD2 1 
ATOM   6029 C  CE1 . HIS D 2 185 ? 47.508 76.655  0.555   1.00 80.71 ? 1908 HIS D CE1 1 
ATOM   6030 N  NE2 . HIS D 2 185 ? 47.998 75.704  1.330   1.00 80.41 ? 1908 HIS D NE2 1 
ATOM   6031 N  N   . ASN D 2 186 ? 49.629 71.267  -2.807  1.00 69.14 ? 1909 ASN D N   1 
ATOM   6032 C  CA  . ASN D 2 186 ? 51.000 71.032  -3.237  1.00 68.47 ? 1909 ASN D CA  1 
ATOM   6033 C  C   . ASN D 2 186 ? 51.167 71.251  -4.737  1.00 67.26 ? 1909 ASN D C   1 
ATOM   6034 O  O   . ASN D 2 186 ? 50.339 70.824  -5.547  1.00 66.72 ? 1909 ASN D O   1 
ATOM   6035 C  CB  . ASN D 2 186 ? 51.449 69.613  -2.863  1.00 68.52 ? 1909 ASN D CB  1 
ATOM   6036 C  CG  . ASN D 2 186 ? 52.967 69.470  -2.824  1.00 68.96 ? 1909 ASN D CG  1 
ATOM   6037 O  OD1 . ASN D 2 186 ? 53.500 68.387  -2.563  1.00 67.26 ? 1909 ASN D OD1 1 
ATOM   6038 N  ND2 . ASN D 2 186 ? 53.670 70.569  -3.077  1.00 69.61 ? 1909 ASN D ND2 1 
ATOM   6039 N  N   . LYS D 2 187 ? 52.247 71.940  -5.086  1.00 66.27 ? 1910 LYS D N   1 
ATOM   6040 C  CA  . LYS D 2 187 ? 52.581 72.241  -6.469  1.00 65.71 ? 1910 LYS D CA  1 
ATOM   6041 C  C   . LYS D 2 187 ? 53.512 71.138  -6.962  1.00 64.61 ? 1910 LYS D C   1 
ATOM   6042 O  O   . LYS D 2 187 ? 53.541 70.800  -8.147  1.00 66.28 ? 1910 LYS D O   1 
ATOM   6043 C  CB  . LYS D 2 187 ? 53.312 73.586  -6.550  1.00 67.10 ? 1910 LYS D CB  1 
ATOM   6044 C  CG  . LYS D 2 187 ? 52.608 74.759  -5.869  1.00 67.14 ? 1910 LYS D CG  1 
ATOM   6045 C  CD  . LYS D 2 187 ? 53.306 76.075  -6.223  1.00 68.79 ? 1910 LYS D CD  1 
ATOM   6046 C  CE  . LYS D 2 187 ? 52.620 77.288  -5.599  1.00 70.33 ? 1910 LYS D CE  1 
ATOM   6047 N  NZ  . LYS D 2 187 ? 52.686 77.287  -4.104  1.00 70.39 ? 1910 LYS D NZ  1 
ATOM   6048 N  N   . ASP D 2 188 ? 54.264 70.588  -6.017  1.00 61.94 ? 1911 ASP D N   1 
ATOM   6049 C  CA  . ASP D 2 188 ? 55.243 69.532  -6.242  1.00 60.53 ? 1911 ASP D CA  1 
ATOM   6050 C  C   . ASP D 2 188 ? 54.746 68.276  -6.992  1.00 57.75 ? 1911 ASP D C   1 
ATOM   6051 O  O   . ASP D 2 188 ? 55.533 67.582  -7.637  1.00 57.14 ? 1911 ASP D O   1 
ATOM   6052 C  CB  . ASP D 2 188 ? 55.826 69.133  -4.875  1.00 63.57 ? 1911 ASP D CB  1 
ATOM   6053 C  CG  . ASP D 2 188 ? 56.988 68.157  -4.985  1.00 68.87 ? 1911 ASP D CG  1 
ATOM   6054 O  OD1 . ASP D 2 188 ? 57.983 68.492  -5.673  1.00 70.28 ? 1911 ASP D OD1 1 
ATOM   6055 O  OD2 . ASP D 2 188 ? 56.911 67.060  -4.375  1.00 68.64 ? 1911 ASP D OD2 1 
ATOM   6056 N  N   . ILE D 2 189 ? 53.450 67.994  -6.925  1.00 54.48 ? 1912 ILE D N   1 
ATOM   6057 C  CA  . ILE D 2 189 ? 52.890 66.802  -7.558  1.00 50.96 ? 1912 ILE D CA  1 
ATOM   6058 C  C   . ILE D 2 189 ? 52.825 66.794  -9.098  1.00 50.66 ? 1912 ILE D C   1 
ATOM   6059 O  O   . ILE D 2 189 ? 52.275 67.709  -9.721  1.00 50.82 ? 1912 ILE D O   1 
ATOM   6060 C  CB  . ILE D 2 189 ? 51.466 66.519  -7.001  1.00 49.61 ? 1912 ILE D CB  1 
ATOM   6061 C  CG1 . ILE D 2 189 ? 51.451 66.662  -5.475  1.00 48.78 ? 1912 ILE D CG1 1 
ATOM   6062 C  CG2 . ILE D 2 189 ? 51.028 65.117  -7.373  1.00 47.67 ? 1912 ILE D CG2 1 
ATOM   6063 C  CD1 . ILE D 2 189 ? 52.386 65.722  -4.737  1.00 47.73 ? 1912 ILE D CD1 1 
ATOM   6064 N  N   . ALA D 2 190 ? 53.389 65.743  -9.693  1.00 47.70 ? 1913 ALA D N   1 
ATOM   6065 C  CA  . ALA D 2 190 ? 53.402 65.536  -11.141 1.00 46.49 ? 1913 ALA D CA  1 
ATOM   6066 C  C   . ALA D 2 190 ? 52.781 64.159  -11.347 1.00 45.91 ? 1913 ALA D C   1 
ATOM   6067 O  O   . ALA D 2 190 ? 53.488 63.161  -11.499 1.00 46.07 ? 1913 ALA D O   1 
ATOM   6068 C  CB  . ALA D 2 190 ? 54.839 65.558  -11.666 1.00 46.01 ? 1913 ALA D CB  1 
ATOM   6069 N  N   . LEU D 2 191 ? 51.455 64.116  -11.347 1.00 46.18 ? 1914 LEU D N   1 
ATOM   6070 C  CA  . LEU D 2 191 ? 50.710 62.867  -11.469 1.00 46.60 ? 1914 LEU D CA  1 
ATOM   6071 C  C   . LEU D 2 191 ? 51.195 61.853  -12.512 1.00 47.81 ? 1914 LEU D C   1 
ATOM   6072 O  O   . LEU D 2 191 ? 51.024 60.642  -12.327 1.00 49.95 ? 1914 LEU D O   1 
ATOM   6073 C  CB  . LEU D 2 191 ? 49.231 63.197  -11.679 1.00 46.36 ? 1914 LEU D CB  1 
ATOM   6074 C  CG  . LEU D 2 191 ? 48.693 64.168  -10.617 1.00 46.68 ? 1914 LEU D CG  1 
ATOM   6075 C  CD1 . LEU D 2 191 ? 47.241 64.477  -10.900 1.00 47.70 ? 1914 LEU D CD1 1 
ATOM   6076 C  CD2 . LEU D 2 191 ? 48.844 63.572  -9.225  1.00 44.25 ? 1914 LEU D CD2 1 
ATOM   6077 N  N   . GLY D 2 192 ? 51.818 62.331  -13.586 1.00 47.38 ? 1915 GLY D N   1 
ATOM   6078 C  CA  . GLY D 2 192 ? 52.290 61.430  -14.630 1.00 43.61 ? 1915 GLY D CA  1 
ATOM   6079 C  C   . GLY D 2 192 ? 53.449 60.514  -14.269 1.00 42.40 ? 1915 GLY D C   1 
ATOM   6080 O  O   . GLY D 2 192 ? 53.869 59.689  -15.084 1.00 42.53 ? 1915 GLY D O   1 
ATOM   6081 N  N   . VAL D 2 193 ? 53.982 60.640  -13.059 1.00 40.43 ? 1916 VAL D N   1 
ATOM   6082 C  CA  . VAL D 2 193 ? 55.094 59.787  -12.664 1.00 39.48 ? 1916 VAL D CA  1 
ATOM   6083 C  C   . VAL D 2 193 ? 54.603 58.602  -11.845 1.00 39.55 ? 1916 VAL D C   1 
ATOM   6084 O  O   . VAL D 2 193 ? 55.386 57.710  -11.504 1.00 41.19 ? 1916 VAL D O   1 
ATOM   6085 C  CB  . VAL D 2 193 ? 56.150 60.569  -11.840 1.00 40.42 ? 1916 VAL D CB  1 
ATOM   6086 C  CG1 . VAL D 2 193 ? 55.547 61.071  -10.552 1.00 42.93 ? 1916 VAL D CG1 1 
ATOM   6087 C  CG2 . VAL D 2 193 ? 57.344 59.684  -11.545 1.00 42.43 ? 1916 VAL D CG2 1 
ATOM   6088 N  N   . PHE D 2 194 ? 53.303 58.577  -11.551 1.00 38.38 ? 1917 PHE D N   1 
ATOM   6089 C  CA  . PHE D 2 194 ? 52.719 57.492  -10.752 1.00 35.75 ? 1917 PHE D CA  1 
ATOM   6090 C  C   . PHE D 2 194 ? 52.014 56.384  -11.555 1.00 33.75 ? 1917 PHE D C   1 
ATOM   6091 O  O   . PHE D 2 194 ? 51.544 56.606  -12.677 1.00 37.27 ? 1917 PHE D O   1 
ATOM   6092 C  CB  . PHE D 2 194 ? 51.723 58.061  -9.732  1.00 34.42 ? 1917 PHE D CB  1 
ATOM   6093 C  CG  . PHE D 2 194 ? 52.309 59.097  -8.805  1.00 33.15 ? 1917 PHE D CG  1 
ATOM   6094 C  CD1 . PHE D 2 194 ? 51.929 60.442  -8.910  1.00 35.59 ? 1917 PHE D CD1 1 
ATOM   6095 C  CD2 . PHE D 2 194 ? 53.219 58.733  -7.820  1.00 30.41 ? 1917 PHE D CD2 1 
ATOM   6096 C  CE1 . PHE D 2 194 ? 52.449 61.406  -8.047  1.00 33.06 ? 1917 PHE D CE1 1 
ATOM   6097 C  CE2 . PHE D 2 194 ? 53.745 59.680  -6.954  1.00 32.77 ? 1917 PHE D CE2 1 
ATOM   6098 C  CZ  . PHE D 2 194 ? 53.360 61.026  -7.064  1.00 32.94 ? 1917 PHE D CZ  1 
ATOM   6099 N  N   . ASP D 2 195 ? 51.944 55.196  -10.959 1.00 29.97 ? 1918 ASP D N   1 
ATOM   6100 C  CA  . ASP D 2 195 ? 51.292 54.045  -11.574 1.00 28.67 ? 1918 ASP D CA  1 
ATOM   6101 C  C   . ASP D 2 195 ? 49.856 53.961  -11.097 1.00 27.67 ? 1918 ASP D C   1 
ATOM   6102 O  O   . ASP D 2 195 ? 48.984 53.461  -11.806 1.00 30.34 ? 1918 ASP D O   1 
ATOM   6103 C  CB  . ASP D 2 195 ? 51.995 52.744  -11.178 1.00 28.35 ? 1918 ASP D CB  1 
ATOM   6104 C  CG  . ASP D 2 195 ? 53.442 52.702  -11.626 1.00 31.44 ? 1918 ASP D CG  1 
ATOM   6105 O  OD1 . ASP D 2 195 ? 54.342 52.578  -10.761 1.00 31.38 ? 1918 ASP D OD1 1 
ATOM   6106 O  OD2 . ASP D 2 195 ? 53.683 52.788  -12.851 1.00 35.65 ? 1918 ASP D OD2 1 
ATOM   6107 N  N   . VAL D 2 196 ? 49.607 54.451  -9.889  1.00 27.27 ? 1919 VAL D N   1 
ATOM   6108 C  CA  . VAL D 2 196 ? 48.262 54.380  -9.326  1.00 25.84 ? 1919 VAL D CA  1 
ATOM   6109 C  C   . VAL D 2 196 ? 48.082 55.346  -8.154  1.00 27.82 ? 1919 VAL D C   1 
ATOM   6110 O  O   . VAL D 2 196 ? 49.048 55.651  -7.421  1.00 28.96 ? 1919 VAL D O   1 
ATOM   6111 C  CB  . VAL D 2 196 ? 47.996 52.935  -8.824  1.00 23.85 ? 1919 VAL D CB  1 
ATOM   6112 C  CG1 . VAL D 2 196 ? 48.959 52.613  -7.681  1.00 21.39 ? 1919 VAL D CG1 1 
ATOM   6113 C  CG2 . VAL D 2 196 ? 46.565 52.771  -8.377  1.00 23.52 ? 1919 VAL D CG2 1 
ATOM   6114 N  N   . VAL D 2 197 ? 46.859 55.837  -7.976  1.00 26.00 ? 1920 VAL D N   1 
ATOM   6115 C  CA  . VAL D 2 197 ? 46.595 56.719  -6.846  1.00 29.11 ? 1920 VAL D CA  1 
ATOM   6116 C  C   . VAL D 2 197 ? 45.707 55.975  -5.862  1.00 30.34 ? 1920 VAL D C   1 
ATOM   6117 O  O   . VAL D 2 197 ? 44.592 55.565  -6.200  1.00 33.03 ? 1920 VAL D O   1 
ATOM   6118 C  CB  . VAL D 2 197 ? 45.877 58.011  -7.248  1.00 31.03 ? 1920 VAL D CB  1 
ATOM   6119 C  CG1 . VAL D 2 197 ? 45.598 58.834  -6.010  1.00 30.81 ? 1920 VAL D CG1 1 
ATOM   6120 C  CG2 . VAL D 2 197 ? 46.728 58.809  -8.217  1.00 29.86 ? 1920 VAL D CG2 1 
ATOM   6121 N  N   . VAL D 2 198 ? 46.213 55.784  -4.651  1.00 31.03 ? 1921 VAL D N   1 
ATOM   6122 C  CA  . VAL D 2 198 ? 45.465 55.103  -3.601  1.00 31.04 ? 1921 VAL D CA  1 
ATOM   6123 C  C   . VAL D 2 198 ? 44.920 56.190  -2.692  1.00 33.78 ? 1921 VAL D C   1 
ATOM   6124 O  O   . VAL D 2 198 ? 45.694 56.914  -2.049  1.00 35.07 ? 1921 VAL D O   1 
ATOM   6125 C  CB  . VAL D 2 198 ? 46.370 54.189  -2.763  1.00 29.95 ? 1921 VAL D CB  1 
ATOM   6126 C  CG1 . VAL D 2 198 ? 45.571 53.573  -1.637  1.00 28.13 ? 1921 VAL D CG1 1 
ATOM   6127 C  CG2 . VAL D 2 198 ? 46.977 53.110  -3.640  1.00 30.83 ? 1921 VAL D CG2 1 
ATOM   6128 N  N   . THR D 2 199 ? 43.599 56.307  -2.615  1.00 34.83 ? 1922 THR D N   1 
ATOM   6129 C  CA  . THR D 2 199 ? 43.018 57.359  -1.795  1.00 34.93 ? 1922 THR D CA  1 
ATOM   6130 C  C   . THR D 2 199 ? 41.700 56.966  -1.147  1.00 36.53 ? 1922 THR D C   1 
ATOM   6131 O  O   . THR D 2 199 ? 41.331 55.789  -1.132  1.00 36.67 ? 1922 THR D O   1 
ATOM   6132 C  CB  . THR D 2 199 ? 42.823 58.639  -2.651  1.00 35.20 ? 1922 THR D CB  1 
ATOM   6133 O  OG1 . THR D 2 199 ? 42.276 59.689  -1.849  1.00 37.09 ? 1922 THR D OG1 1 
ATOM   6134 C  CG2 . THR D 2 199 ? 41.893 58.359  -3.826  1.00 34.68 ? 1922 THR D CG2 1 
ATOM   6135 N  N   . ASP D 2 200 ? 41.005 57.962  -0.597  1.00 39.35 ? 1923 ASP D N   1 
ATOM   6136 C  CA  . ASP D 2 200 ? 39.715 57.756  0.061   1.00 41.76 ? 1923 ASP D CA  1 
ATOM   6137 C  C   . ASP D 2 200 ? 38.734 58.856  -0.387  1.00 41.85 ? 1923 ASP D C   1 
ATOM   6138 O  O   . ASP D 2 200 ? 39.064 59.673  -1.248  1.00 43.09 ? 1923 ASP D O   1 
ATOM   6139 C  CB  . ASP D 2 200 ? 39.902 57.753  1.592   1.00 42.62 ? 1923 ASP D CB  1 
ATOM   6140 C  CG  . ASP D 2 200 ? 40.362 59.093  2.136   1.00 46.09 ? 1923 ASP D CG  1 
ATOM   6141 O  OD1 . ASP D 2 200 ? 40.836 59.133  3.303   1.00 45.13 ? 1923 ASP D OD1 1 
ATOM   6142 O  OD2 . ASP D 2 200 ? 40.239 60.102  1.406   1.00 45.49 ? 1923 ASP D OD2 1 
ATOM   6143 N  N   . PRO D 2 201 ? 37.518 58.889  0.177   1.00 40.76 ? 1924 PRO D N   1 
ATOM   6144 C  CA  . PRO D 2 201 ? 36.572 59.929  -0.248  1.00 38.99 ? 1924 PRO D CA  1 
ATOM   6145 C  C   . PRO D 2 201 ? 36.986 61.386  -0.042  1.00 39.12 ? 1924 PRO D C   1 
ATOM   6146 O  O   . PRO D 2 201 ? 36.332 62.291  -0.561  1.00 36.50 ? 1924 PRO D O   1 
ATOM   6147 C  CB  . PRO D 2 201 ? 35.310 59.576  0.528   1.00 40.02 ? 1924 PRO D CB  1 
ATOM   6148 C  CG  . PRO D 2 201 ? 35.388 58.067  0.595   1.00 39.78 ? 1924 PRO D CG  1 
ATOM   6149 C  CD  . PRO D 2 201 ? 36.835 57.852  0.970   1.00 38.69 ? 1924 PRO D CD  1 
ATOM   6150 N  N   . SER D 2 202 ? 38.059 61.620  0.710   1.00 39.10 ? 1925 SER D N   1 
ATOM   6151 C  CA  . SER D 2 202 ? 38.515 62.985  0.961   1.00 38.27 ? 1925 SER D CA  1 
ATOM   6152 C  C   . SER D 2 202 ? 39.414 63.502  -0.163  1.00 39.79 ? 1925 SER D C   1 
ATOM   6153 O  O   . SER D 2 202 ? 39.991 64.590  -0.063  1.00 40.57 ? 1925 SER D O   1 
ATOM   6154 C  CB  . SER D 2 202 ? 39.282 63.046  2.279   1.00 36.50 ? 1925 SER D CB  1 
ATOM   6155 O  OG  . SER D 2 202 ? 40.558 62.445  2.148   1.00 36.52 ? 1925 SER D OG  1 
ATOM   6156 N  N   . CYS D 2 203 ? 39.531 62.727  -1.234  1.00 41.29 ? 1926 CYS D N   1 
ATOM   6157 C  CA  . CYS D 2 203 ? 40.379 63.125  -2.353  1.00 42.76 ? 1926 CYS D CA  1 
ATOM   6158 C  C   . CYS D 2 203 ? 39.850 64.393  -3.018  1.00 41.52 ? 1926 CYS D C   1 
ATOM   6159 O  O   . CYS D 2 203 ? 38.674 64.466  -3.392  1.00 42.79 ? 1926 CYS D O   1 
ATOM   6160 C  CB  . CYS D 2 203 ? 40.466 61.994  -3.382  1.00 45.01 ? 1926 CYS D CB  1 
ATOM   6161 S  SG  . CYS D 2 203 ? 41.617 62.324  -4.738  1.00 51.81 ? 1926 CYS D SG  1 
ATOM   6162 N  N   . PRO D 2 204 ? 40.711 65.416  -3.165  1.00 40.29 ? 1927 PRO D N   1 
ATOM   6163 C  CA  . PRO D 2 204 ? 40.263 66.659  -3.797  1.00 38.76 ? 1927 PRO D CA  1 
ATOM   6164 C  C   . PRO D 2 204 ? 39.820 66.382  -5.221  1.00 37.79 ? 1927 PRO D C   1 
ATOM   6165 O  O   . PRO D 2 204 ? 40.438 65.572  -5.925  1.00 40.45 ? 1927 PRO D O   1 
ATOM   6166 C  CB  . PRO D 2 204 ? 41.491 67.565  -3.704  1.00 37.51 ? 1927 PRO D CB  1 
ATOM   6167 C  CG  . PRO D 2 204 ? 42.628 66.612  -3.685  1.00 39.87 ? 1927 PRO D CG  1 
ATOM   6168 C  CD  . PRO D 2 204 ? 42.137 65.498  -2.796  1.00 40.93 ? 1927 PRO D CD  1 
ATOM   6169 N  N   . ALA D 2 205 ? 38.741 67.040  -5.630  1.00 34.70 ? 1928 ALA D N   1 
ATOM   6170 C  CA  . ALA D 2 205 ? 38.186 66.858  -6.962  1.00 35.33 ? 1928 ALA D CA  1 
ATOM   6171 C  C   . ALA D 2 205 ? 39.153 67.212  -8.077  1.00 35.95 ? 1928 ALA D C   1 
ATOM   6172 O  O   . ALA D 2 205 ? 39.027 66.710  -9.194  1.00 38.08 ? 1928 ALA D O   1 
ATOM   6173 C  CB  . ALA D 2 205 ? 36.923 67.680  -7.112  1.00 34.98 ? 1928 ALA D CB  1 
ATOM   6174 N  N   . SER D 2 206 ? 40.116 68.075  -7.787  1.00 34.35 ? 1929 SER D N   1 
ATOM   6175 C  CA  . SER D 2 206 ? 41.065 68.468  -8.816  1.00 38.82 ? 1929 SER D CA  1 
ATOM   6176 C  C   . SER D 2 206 ? 41.991 67.306  -9.191  1.00 40.88 ? 1929 SER D C   1 
ATOM   6177 O  O   . SER D 2 206 ? 42.441 67.177  -10.343 1.00 39.76 ? 1929 SER D O   1 
ATOM   6178 C  CB  . SER D 2 206 ? 41.889 69.674  -8.340  1.00 38.36 ? 1929 SER D CB  1 
ATOM   6179 O  OG  . SER D 2 206 ? 42.611 69.381  -7.156  1.00 40.65 ? 1929 SER D OG  1 
ATOM   6180 N  N   . VAL D 2 207 ? 42.273 66.462  -8.207  1.00 42.41 ? 1930 VAL D N   1 
ATOM   6181 C  CA  . VAL D 2 207 ? 43.140 65.318  -8.424  1.00 42.24 ? 1930 VAL D CA  1 
ATOM   6182 C  C   . VAL D 2 207 ? 42.407 64.210  -9.185  1.00 42.10 ? 1930 VAL D C   1 
ATOM   6183 O  O   . VAL D 2 207 ? 43.015 63.475  -9.967  1.00 43.10 ? 1930 VAL D O   1 
ATOM   6184 C  CB  . VAL D 2 207 ? 43.651 64.805  -7.086  1.00 42.07 ? 1930 VAL D CB  1 
ATOM   6185 C  CG1 . VAL D 2 207 ? 44.622 63.649  -7.294  1.00 40.40 ? 1930 VAL D CG1 1 
ATOM   6186 C  CG2 . VAL D 2 207 ? 44.319 65.955  -6.354  1.00 40.01 ? 1930 VAL D CG2 1 
ATOM   6187 N  N   . LEU D 2 208 ? 41.102 64.094  -8.959  1.00 40.17 ? 1931 LEU D N   1 
ATOM   6188 C  CA  . LEU D 2 208 ? 40.312 63.091  -9.664  1.00 41.05 ? 1931 LEU D CA  1 
ATOM   6189 C  C   . LEU D 2 208 ? 40.283 63.482  -11.155 1.00 40.80 ? 1931 LEU D C   1 
ATOM   6190 O  O   . LEU D 2 208 ? 40.565 62.668  -12.046 1.00 37.34 ? 1931 LEU D O   1 
ATOM   6191 C  CB  . LEU D 2 208 ? 38.878 63.046  -9.105  1.00 40.36 ? 1931 LEU D CB  1 
ATOM   6192 C  CG  . LEU D 2 208 ? 38.698 62.789  -7.603  1.00 41.38 ? 1931 LEU D CG  1 
ATOM   6193 C  CD1 . LEU D 2 208 ? 37.221 62.579  -7.288  1.00 41.20 ? 1931 LEU D CD1 1 
ATOM   6194 C  CD2 . LEU D 2 208 ? 39.492 61.567  -7.193  1.00 41.94 ? 1931 LEU D CD2 1 
ATOM   6195 N  N   . LYS D 2 209 ? 39.935 64.739  -11.412 1.00 40.73 ? 1932 LYS D N   1 
ATOM   6196 C  CA  . LYS D 2 209 ? 39.876 65.255  -12.773 1.00 41.49 ? 1932 LYS D CA  1 
ATOM   6197 C  C   . LYS D 2 209 ? 41.209 65.031  -13.521 1.00 41.07 ? 1932 LYS D C   1 
ATOM   6198 O  O   . LYS D 2 209 ? 41.223 64.527  -14.647 1.00 41.57 ? 1932 LYS D O   1 
ATOM   6199 C  CB  . LYS D 2 209 ? 39.535 66.751  -12.743 1.00 43.64 ? 1932 LYS D CB  1 
ATOM   6200 C  CG  . LYS D 2 209 ? 38.040 67.094  -12.688 1.00 47.37 ? 1932 LYS D CG  1 
ATOM   6201 C  CD  . LYS D 2 209 ? 37.376 66.937  -14.064 1.00 51.03 ? 1932 LYS D CD  1 
ATOM   6202 C  CE  . LYS D 2 209 ? 36.136 67.834  -14.235 1.00 52.00 ? 1932 LYS D CE  1 
ATOM   6203 N  NZ  . LYS D 2 209 ? 34.961 67.428  -13.402 1.00 52.57 ? 1932 LYS D NZ  1 
ATOM   6204 N  N   . CYS D 2 210 ? 42.328 65.413  -12.906 1.00 39.32 ? 1933 CYS D N   1 
ATOM   6205 C  CA  . CYS D 2 210 ? 43.641 65.222  -13.537 1.00 38.85 ? 1933 CYS D CA  1 
ATOM   6206 C  C   . CYS D 2 210 ? 43.916 63.747  -13.820 1.00 38.78 ? 1933 CYS D C   1 
ATOM   6207 O  O   . CYS D 2 210 ? 44.301 63.376  -14.926 1.00 37.83 ? 1933 CYS D O   1 
ATOM   6208 C  CB  . CYS D 2 210 ? 44.766 65.736  -12.642 1.00 39.31 ? 1933 CYS D CB  1 
ATOM   6209 S  SG  . CYS D 2 210 ? 44.924 67.513  -12.543 1.00 46.23 ? 1933 CYS D SG  1 
ATOM   6210 N  N   . ALA D 2 211 ? 43.744 62.912  -12.799 1.00 38.11 ? 1934 ALA D N   1 
ATOM   6211 C  CA  . ALA D 2 211 ? 43.955 61.483  -12.940 1.00 34.77 ? 1934 ALA D CA  1 
ATOM   6212 C  C   . ALA D 2 211 ? 43.217 60.974  -14.172 1.00 33.46 ? 1934 ALA D C   1 
ATOM   6213 O  O   . ALA D 2 211 ? 43.781 60.231  -14.961 1.00 33.27 ? 1934 ALA D O   1 
ATOM   6214 C  CB  . ALA D 2 211 ? 43.465 60.766  -11.698 1.00 34.54 ? 1934 ALA D CB  1 
ATOM   6215 N  N   . GLU D 2 212 ? 41.958 61.369  -14.334 1.00 35.01 ? 1935 GLU D N   1 
ATOM   6216 C  CA  . GLU D 2 212 ? 41.177 60.950  -15.492 1.00 37.45 ? 1935 GLU D CA  1 
ATOM   6217 C  C   . GLU D 2 212 ? 41.901 61.323  -16.782 1.00 38.57 ? 1935 GLU D C   1 
ATOM   6218 O  O   . GLU D 2 212 ? 42.170 60.472  -17.631 1.00 40.07 ? 1935 GLU D O   1 
ATOM   6219 C  CB  . GLU D 2 212 ? 39.812 61.635  -15.502 1.00 40.55 ? 1935 GLU D CB  1 
ATOM   6220 C  CG  . GLU D 2 212 ? 38.821 61.069  -14.523 1.00 49.33 ? 1935 GLU D CG  1 
ATOM   6221 C  CD  . GLU D 2 212 ? 37.432 61.647  -14.719 1.00 52.70 ? 1935 GLU D CD  1 
ATOM   6222 O  OE1 . GLU D 2 212 ? 37.219 62.840  -14.396 1.00 54.67 ? 1935 GLU D OE1 1 
ATOM   6223 O  OE2 . GLU D 2 212 ? 36.555 60.904  -15.209 1.00 55.12 ? 1935 GLU D OE2 1 
ATOM   6224 N  N   . ALA D 2 213 ? 42.198 62.612  -16.925 1.00 38.28 ? 1936 ALA D N   1 
ATOM   6225 C  CA  . ALA D 2 213 ? 42.882 63.134  -18.105 1.00 36.98 ? 1936 ALA D CA  1 
ATOM   6226 C  C   . ALA D 2 213 ? 44.152 62.352  -18.417 1.00 37.25 ? 1936 ALA D C   1 
ATOM   6227 O  O   . ALA D 2 213 ? 44.425 62.029  -19.572 1.00 40.56 ? 1936 ALA D O   1 
ATOM   6228 C  CB  . ALA D 2 213 ? 43.222 64.599  -17.903 1.00 33.74 ? 1936 ALA D CB  1 
ATOM   6229 N  N   . LEU D 2 214 ? 44.936 62.060  -17.388 1.00 35.74 ? 1937 LEU D N   1 
ATOM   6230 C  CA  . LEU D 2 214 ? 46.177 61.303  -17.548 1.00 34.63 ? 1937 LEU D CA  1 
ATOM   6231 C  C   . LEU D 2 214 ? 45.940 59.791  -17.584 1.00 36.67 ? 1937 LEU D C   1 
ATOM   6232 O  O   . LEU D 2 214 ? 46.883 59.018  -17.748 1.00 35.61 ? 1937 LEU D O   1 
ATOM   6233 C  CB  . LEU D 2 214 ? 47.126 61.600  -16.393 1.00 32.11 ? 1937 LEU D CB  1 
ATOM   6234 C  CG  . LEU D 2 214 ? 47.689 63.013  -16.294 1.00 35.27 ? 1937 LEU D CG  1 
ATOM   6235 C  CD1 . LEU D 2 214 ? 48.406 63.185  -14.957 1.00 34.35 ? 1937 LEU D CD1 1 
ATOM   6236 C  CD2 . LEU D 2 214 ? 48.644 63.256  -17.462 1.00 33.77 ? 1937 LEU D CD2 1 
ATOM   6237 N  N   . GLN D 2 215 ? 44.693 59.363  -17.421 1.00 37.83 ? 1938 GLN D N   1 
ATOM   6238 C  CA  . GLN D 2 215 ? 44.405 57.936  -17.418 1.00 38.69 ? 1938 GLN D CA  1 
ATOM   6239 C  C   . GLN D 2 215 ? 45.216 57.255  -16.308 1.00 37.24 ? 1938 GLN D C   1 
ATOM   6240 O  O   . GLN D 2 215 ? 45.848 56.215  -16.521 1.00 35.66 ? 1938 GLN D O   1 
ATOM   6241 C  CB  . GLN D 2 215 ? 44.769 57.314  -18.774 1.00 41.57 ? 1938 GLN D CB  1 
ATOM   6242 C  CG  . GLN D 2 215 ? 43.963 57.857  -19.958 1.00 47.96 ? 1938 GLN D CG  1 
ATOM   6243 C  CD  . GLN D 2 215 ? 43.906 56.875  -21.125 1.00 50.72 ? 1938 GLN D CD  1 
ATOM   6244 O  OE1 . GLN D 2 215 ? 43.406 55.757  -20.982 1.00 53.76 ? 1938 GLN D OE1 1 
ATOM   6245 N  NE2 . GLN D 2 215 ? 44.418 57.288  -22.282 1.00 53.45 ? 1938 GLN D NE2 1 
ATOM   6246 N  N   . LEU D 2 216 ? 45.209 57.863  -15.126 1.00 35.26 ? 1939 LEU D N   1 
ATOM   6247 C  CA  . LEU D 2 216 ? 45.914 57.322  -13.973 1.00 32.04 ? 1939 LEU D CA  1 
ATOM   6248 C  C   . LEU D 2 216 ? 44.853 56.717  -13.056 1.00 31.17 ? 1939 LEU D C   1 
ATOM   6249 O  O   . LEU D 2 216 ? 44.046 57.434  -12.455 1.00 28.41 ? 1939 LEU D O   1 
ATOM   6250 C  CB  . LEU D 2 216 ? 46.668 58.440  -13.258 1.00 31.36 ? 1939 LEU D CB  1 
ATOM   6251 C  CG  . LEU D 2 216 ? 47.347 58.113  -11.922 1.00 34.46 ? 1939 LEU D CG  1 
ATOM   6252 C  CD1 . LEU D 2 216 ? 48.331 56.938  -12.064 1.00 30.36 ? 1939 LEU D CD1 1 
ATOM   6253 C  CD2 . LEU D 2 216 ? 48.055 59.370  -11.422 1.00 31.62 ? 1939 LEU D CD2 1 
ATOM   6254 N  N   . PRO D 2 217 ? 44.840 55.381  -12.939 1.00 31.47 ? 1940 PRO D N   1 
ATOM   6255 C  CA  . PRO D 2 217 ? 43.867 54.681  -12.099 1.00 29.57 ? 1940 PRO D CA  1 
ATOM   6256 C  C   . PRO D 2 217 ? 43.855 55.206  -10.671 1.00 28.77 ? 1940 PRO D C   1 
ATOM   6257 O  O   . PRO D 2 217 ? 44.897 55.516  -10.096 1.00 27.30 ? 1940 PRO D O   1 
ATOM   6258 C  CB  . PRO D 2 217 ? 44.323 53.236  -12.199 1.00 28.56 ? 1940 PRO D CB  1 
ATOM   6259 C  CG  . PRO D 2 217 ? 45.806 53.389  -12.269 1.00 29.17 ? 1940 PRO D CG  1 
ATOM   6260 C  CD  . PRO D 2 217 ? 45.958 54.489  -13.284 1.00 31.15 ? 1940 PRO D CD  1 
ATOM   6261 N  N   . VAL D 2 218 ? 42.655 55.319  -10.116 1.00 31.90 ? 1941 VAL D N   1 
ATOM   6262 C  CA  . VAL D 2 218 ? 42.465 55.803  -8.752  1.00 35.50 ? 1941 VAL D CA  1 
ATOM   6263 C  C   . VAL D 2 218 ? 41.681 54.726  -8.017  1.00 36.41 ? 1941 VAL D C   1 
ATOM   6264 O  O   . VAL D 2 218 ? 40.633 54.283  -8.496  1.00 37.09 ? 1941 VAL D O   1 
ATOM   6265 C  CB  . VAL D 2 218 ? 41.675 57.134  -8.762  1.00 37.49 ? 1941 VAL D CB  1 
ATOM   6266 C  CG1 . VAL D 2 218 ? 41.231 57.519  -7.345  1.00 38.53 ? 1941 VAL D CG1 1 
ATOM   6267 C  CG2 . VAL D 2 218 ? 42.557 58.231  -9.365  1.00 37.00 ? 1941 VAL D CG2 1 
ATOM   6268 N  N   . VAL D 2 219 ? 42.181 54.298  -6.860  1.00 35.88 ? 1942 VAL D N   1 
ATOM   6269 C  CA  . VAL D 2 219 ? 41.504 53.237  -6.120  1.00 34.26 ? 1942 VAL D CA  1 
ATOM   6270 C  C   . VAL D 2 219 ? 41.438 53.453  -4.616  1.00 34.13 ? 1942 VAL D C   1 
ATOM   6271 O  O   . VAL D 2 219 ? 42.095 54.348  -4.070  1.00 37.14 ? 1942 VAL D O   1 
ATOM   6272 C  CB  . VAL D 2 219 ? 42.202 51.902  -6.369  1.00 33.08 ? 1942 VAL D CB  1 
ATOM   6273 C  CG1 . VAL D 2 219 ? 42.362 51.682  -7.880  1.00 30.95 ? 1942 VAL D CG1 1 
ATOM   6274 C  CG2 . VAL D 2 219 ? 43.556 51.893  -5.660  1.00 28.81 ? 1942 VAL D CG2 1 
ATOM   6275 N  N   . SER D 2 220 ? 40.649 52.611  -3.955  1.00 29.37 ? 1943 SER D N   1 
ATOM   6276 C  CA  . SER D 2 220 ? 40.478 52.678  -2.514  1.00 30.22 ? 1943 SER D CA  1 
ATOM   6277 C  C   . SER D 2 220 ? 41.498 51.769  -1.848  1.00 31.02 ? 1943 SER D C   1 
ATOM   6278 O  O   . SER D 2 220 ? 42.132 50.948  -2.510  1.00 33.89 ? 1943 SER D O   1 
ATOM   6279 C  CB  . SER D 2 220 ? 39.068 52.225  -2.136  1.00 30.64 ? 1943 SER D CB  1 
ATOM   6280 O  OG  . SER D 2 220 ? 38.886 50.840  -2.383  1.00 33.36 ? 1943 SER D OG  1 
ATOM   6281 N  N   . GLN D 2 221 ? 41.652 51.891  -0.537  1.00 32.04 ? 1944 GLN D N   1 
ATOM   6282 C  CA  . GLN D 2 221 ? 42.623 51.051  0.146   1.00 32.71 ? 1944 GLN D CA  1 
ATOM   6283 C  C   . GLN D 2 221 ? 42.263 49.569  0.100   1.00 31.01 ? 1944 GLN D C   1 
ATOM   6284 O  O   . GLN D 2 221 ? 43.106 48.732  0.399   1.00 32.11 ? 1944 GLN D O   1 
ATOM   6285 C  CB  . GLN D 2 221 ? 42.807 51.502  1.591   1.00 34.02 ? 1944 GLN D CB  1 
ATOM   6286 C  CG  . GLN D 2 221 ? 41.550 51.443  2.413   1.00 36.38 ? 1944 GLN D CG  1 
ATOM   6287 C  CD  . GLN D 2 221 ? 41.845 51.651  3.865   1.00 36.71 ? 1944 GLN D CD  1 
ATOM   6288 O  OE1 . GLN D 2 221 ? 42.347 52.704  4.264   1.00 36.61 ? 1944 GLN D OE1 1 
ATOM   6289 N  NE2 . GLN D 2 221 ? 41.549 50.641  4.675   1.00 39.89 ? 1944 GLN D NE2 1 
ATOM   6290 N  N   . GLU D 2 222 ? 41.030 49.236  -0.278  1.00 31.81 ? 1945 GLU D N   1 
ATOM   6291 C  CA  . GLU D 2 222 ? 40.638 47.822  -0.355  1.00 31.02 ? 1945 GLU D CA  1 
ATOM   6292 C  C   . GLU D 2 222 ? 41.376 47.157  -1.508  1.00 29.78 ? 1945 GLU D C   1 
ATOM   6293 O  O   . GLU D 2 222 ? 41.548 45.942  -1.515  1.00 31.75 ? 1945 GLU D O   1 
ATOM   6294 C  CB  . GLU D 2 222 ? 39.124 47.650  -0.570  1.00 31.77 ? 1945 GLU D CB  1 
ATOM   6295 C  CG  . GLU D 2 222 ? 38.631 46.207  -0.364  1.00 30.22 ? 1945 GLU D CG  1 
ATOM   6296 C  CD  . GLU D 2 222 ? 38.631 45.776  1.107   1.00 34.04 ? 1945 GLU D CD  1 
ATOM   6297 O  OE1 . GLU D 2 222 ? 38.548 44.550  1.381   1.00 33.71 ? 1945 GLU D OE1 1 
ATOM   6298 O  OE2 . GLU D 2 222 ? 38.704 46.664  1.991   1.00 33.29 ? 1945 GLU D OE2 1 
ATOM   6299 N  N   . TRP D 2 223 ? 41.795 47.945  -2.494  1.00 26.97 ? 1946 TRP D N   1 
ATOM   6300 C  CA  . TRP D 2 223 ? 42.537 47.375  -3.609  1.00 26.20 ? 1946 TRP D CA  1 
ATOM   6301 C  C   . TRP D 2 223 ? 43.871 46.870  -3.031  1.00 27.65 ? 1946 TRP D C   1 
ATOM   6302 O  O   . TRP D 2 223 ? 44.321 45.760  -3.344  1.00 26.78 ? 1946 TRP D O   1 
ATOM   6303 C  CB  . TRP D 2 223 ? 42.801 48.437  -4.676  1.00 26.95 ? 1946 TRP D CB  1 
ATOM   6304 C  CG  . TRP D 2 223 ? 43.705 47.965  -5.769  1.00 24.00 ? 1946 TRP D CG  1 
ATOM   6305 C  CD1 . TRP D 2 223 ? 43.356 47.222  -6.861  1.00 24.09 ? 1946 TRP D CD1 1 
ATOM   6306 C  CD2 . TRP D 2 223 ? 45.123 48.139  -5.836  1.00 21.75 ? 1946 TRP D CD2 1 
ATOM   6307 N  NE1 . TRP D 2 223 ? 44.470 46.918  -7.603  1.00 22.28 ? 1946 TRP D NE1 1 
ATOM   6308 C  CE2 . TRP D 2 223 ? 45.572 47.466  -6.996  1.00 24.16 ? 1946 TRP D CE2 1 
ATOM   6309 C  CE3 . TRP D 2 223 ? 46.062 48.794  -5.027  1.00 23.42 ? 1946 TRP D CE3 1 
ATOM   6310 C  CZ2 . TRP D 2 223 ? 46.928 47.425  -7.369  1.00 22.11 ? 1946 TRP D CZ2 1 
ATOM   6311 C  CZ3 . TRP D 2 223 ? 47.416 48.756  -5.397  1.00 22.10 ? 1946 TRP D CZ3 1 
ATOM   6312 C  CH2 . TRP D 2 223 ? 47.829 48.073  -6.559  1.00 24.59 ? 1946 TRP D CH2 1 
ATOM   6313 N  N   . VAL D 2 224 ? 44.497 47.687  -2.183  1.00 25.70 ? 1947 VAL D N   1 
ATOM   6314 C  CA  . VAL D 2 224 ? 45.761 47.303  -1.566  1.00 25.51 ? 1947 VAL D CA  1 
ATOM   6315 C  C   . VAL D 2 224 ? 45.551 46.031  -0.759  1.00 26.48 ? 1947 VAL D C   1 
ATOM   6316 O  O   . VAL D 2 224 ? 46.287 45.049  -0.905  1.00 29.56 ? 1947 VAL D O   1 
ATOM   6317 C  CB  . VAL D 2 224 ? 46.292 48.397  -0.616  1.00 23.37 ? 1947 VAL D CB  1 
ATOM   6318 C  CG1 . VAL D 2 224 ? 47.545 47.904  0.086   1.00 23.30 ? 1947 VAL D CG1 1 
ATOM   6319 C  CG2 . VAL D 2 224 ? 46.600 49.656  -1.396  1.00 19.23 ? 1947 VAL D CG2 1 
ATOM   6320 N  N   . ILE D 2 225 ? 44.531 46.055  0.087   1.00 25.16 ? 1948 ILE D N   1 
ATOM   6321 C  CA  . ILE D 2 225 ? 44.201 44.924  0.940   1.00 27.02 ? 1948 ILE D CA  1 
ATOM   6322 C  C   . ILE D 2 225 ? 43.961 43.643  0.140   1.00 27.98 ? 1948 ILE D C   1 
ATOM   6323 O  O   . ILE D 2 225 ? 44.545 42.596  0.444   1.00 31.35 ? 1948 ILE D O   1 
ATOM   6324 C  CB  . ILE D 2 225 ? 42.961 45.252  1.796   1.00 27.95 ? 1948 ILE D CB  1 
ATOM   6325 C  CG1 . ILE D 2 225 ? 43.328 46.344  2.811   1.00 26.17 ? 1948 ILE D CG1 1 
ATOM   6326 C  CG2 . ILE D 2 225 ? 42.435 43.991  2.472   1.00 28.95 ? 1948 ILE D CG2 1 
ATOM   6327 C  CD1 . ILE D 2 225 ? 42.146 47.041  3.435   1.00 24.68 ? 1948 ILE D CD1 1 
ATOM   6328 N  N   . GLN D 2 226 ? 43.107 43.709  -0.874  1.00 26.53 ? 1949 GLN D N   1 
ATOM   6329 C  CA  . GLN D 2 226 ? 42.842 42.528  -1.693  1.00 28.34 ? 1949 GLN D CA  1 
ATOM   6330 C  C   . GLN D 2 226 ? 44.136 42.019  -2.342  1.00 30.88 ? 1949 GLN D C   1 
ATOM   6331 O  O   . GLN D 2 226 ? 44.322 40.809  -2.495  1.00 30.24 ? 1949 GLN D O   1 
ATOM   6332 C  CB  . GLN D 2 226 ? 41.809 42.831  -2.790  1.00 29.59 ? 1949 GLN D CB  1 
ATOM   6333 C  CG  . GLN D 2 226 ? 40.375 43.003  -2.306  1.00 29.97 ? 1949 GLN D CG  1 
ATOM   6334 C  CD  . GLN D 2 226 ? 39.852 41.782  -1.565  1.00 29.72 ? 1949 GLN D CD  1 
ATOM   6335 O  OE1 . GLN D 2 226 ? 39.814 40.677  -2.108  1.00 29.91 ? 1949 GLN D OE1 1 
ATOM   6336 N  NE2 . GLN D 2 226 ? 39.441 41.981  -0.317  1.00 28.00 ? 1949 GLN D NE2 1 
ATOM   6337 N  N   . CYS D 2 227 ? 45.024 42.935  -2.732  1.00 32.26 ? 1950 CYS D N   1 
ATOM   6338 C  CA  . CYS D 2 227 ? 46.299 42.538  -3.331  1.00 30.55 ? 1950 CYS D CA  1 
ATOM   6339 C  C   . CYS D 2 227 ? 47.089 41.692  -2.336  1.00 30.07 ? 1950 CYS D C   1 
ATOM   6340 O  O   . CYS D 2 227 ? 47.752 40.729  -2.708  1.00 28.59 ? 1950 CYS D O   1 
ATOM   6341 C  CB  . CYS D 2 227 ? 47.129 43.764  -3.698  1.00 32.50 ? 1950 CYS D CB  1 
ATOM   6342 S  SG  . CYS D 2 227 ? 46.564 44.626  -5.157  1.00 34.50 ? 1950 CYS D SG  1 
ATOM   6343 N  N   . LEU D 2 228 ? 47.017 42.063  -1.062  1.00 29.74 ? 1951 LEU D N   1 
ATOM   6344 C  CA  . LEU D 2 228 ? 47.722 41.330  -0.016  1.00 27.59 ? 1951 LEU D CA  1 
ATOM   6345 C  C   . LEU D 2 228 ? 47.093 39.973  0.247   1.00 26.80 ? 1951 LEU D C   1 
ATOM   6346 O  O   . LEU D 2 228 ? 47.798 38.968  0.421   1.00 28.09 ? 1951 LEU D O   1 
ATOM   6347 C  CB  . LEU D 2 228 ? 47.729 42.144  1.280   1.00 24.12 ? 1951 LEU D CB  1 
ATOM   6348 C  CG  . LEU D 2 228 ? 48.609 43.390  1.249   1.00 21.19 ? 1951 LEU D CG  1 
ATOM   6349 C  CD1 . LEU D 2 228 ? 48.241 44.268  2.434   1.00 25.56 ? 1951 LEU D CD1 1 
ATOM   6350 C  CD2 . LEU D 2 228 ? 50.088 42.992  1.285   1.00 16.31 ? 1951 LEU D CD2 1 
ATOM   6351 N  N   . ILE D 2 229 ? 45.764 39.950  0.292   1.00 26.78 ? 1952 ILE D N   1 
ATOM   6352 C  CA  . ILE D 2 229 ? 45.041 38.709  0.546   1.00 27.52 ? 1952 ILE D CA  1 
ATOM   6353 C  C   . ILE D 2 229 ? 45.210 37.740  -0.616  1.00 27.62 ? 1952 ILE D C   1 
ATOM   6354 O  O   . ILE D 2 229 ? 45.675 36.624  -0.415  1.00 31.23 ? 1952 ILE D O   1 
ATOM   6355 C  CB  . ILE D 2 229 ? 43.534 38.984  0.839   1.00 25.55 ? 1952 ILE D CB  1 
ATOM   6356 C  CG1 . ILE D 2 229 ? 43.397 39.608  2.235   1.00 26.93 ? 1952 ILE D CG1 1 
ATOM   6357 C  CG2 . ILE D 2 229 ? 42.733 37.701  0.805   1.00 24.30 ? 1952 ILE D CG2 1 
ATOM   6358 C  CD1 . ILE D 2 229 ? 42.003 40.128  2.578   1.00 29.35 ? 1952 ILE D CD1 1 
ATOM   6359 N  N   . VAL D 2 230 ? 44.865 38.164  -1.830  1.00 26.88 ? 1953 VAL D N   1 
ATOM   6360 C  CA  . VAL D 2 230 ? 45.008 37.292  -2.998  1.00 27.54 ? 1953 VAL D CA  1 
ATOM   6361 C  C   . VAL D 2 230 ? 46.464 36.906  -3.249  1.00 29.04 ? 1953 VAL D C   1 
ATOM   6362 O  O   . VAL D 2 230 ? 46.724 35.848  -3.801  1.00 30.26 ? 1953 VAL D O   1 
ATOM   6363 C  CB  . VAL D 2 230 ? 44.430 37.947  -4.296  1.00 29.01 ? 1953 VAL D CB  1 
ATOM   6364 C  CG1 . VAL D 2 230 ? 44.813 37.122  -5.510  1.00 25.04 ? 1953 VAL D CG1 1 
ATOM   6365 C  CG2 . VAL D 2 230 ? 42.897 38.062  -4.203  1.00 27.04 ? 1953 VAL D CG2 1 
ATOM   6366 N  N   . GLY D 2 231 ? 47.409 37.758  -2.855  1.00 31.30 ? 1954 GLY D N   1 
ATOM   6367 C  CA  . GLY D 2 231 ? 48.815 37.442  -3.040  1.00 34.05 ? 1954 GLY D CA  1 
ATOM   6368 C  C   . GLY D 2 231 ? 49.428 37.902  -4.351  1.00 39.32 ? 1954 GLY D C   1 
ATOM   6369 O  O   . GLY D 2 231 ? 50.526 37.474  -4.708  1.00 42.52 ? 1954 GLY D O   1 
ATOM   6370 N  N   . GLU D 2 232 ? 48.730 38.758  -5.086  1.00 40.43 ? 1955 GLU D N   1 
ATOM   6371 C  CA  . GLU D 2 232 ? 49.269 39.262  -6.342  1.00 41.13 ? 1955 GLU D CA  1 
ATOM   6372 C  C   . GLU D 2 232 ? 48.533 40.527  -6.746  1.00 39.99 ? 1955 GLU D C   1 
ATOM   6373 O  O   . GLU D 2 232 ? 47.457 40.808  -6.228  1.00 40.29 ? 1955 GLU D O   1 
ATOM   6374 C  CB  . GLU D 2 232 ? 49.167 38.195  -7.439  1.00 43.81 ? 1955 GLU D CB  1 
ATOM   6375 C  CG  . GLU D 2 232 ? 47.762 37.849  -7.933  1.00 48.71 ? 1955 GLU D CG  1 
ATOM   6376 C  CD  . GLU D 2 232 ? 47.782 36.702  -8.958  1.00 51.68 ? 1955 GLU D CD  1 
ATOM   6377 O  OE1 . GLU D 2 232 ? 46.761 36.500  -9.654  1.00 50.70 ? 1955 GLU D OE1 1 
ATOM   6378 O  OE2 . GLU D 2 232 ? 48.821 35.997  -9.061  1.00 49.80 ? 1955 GLU D OE2 1 
ATOM   6379 N  N   . ARG D 2 233 ? 49.114 41.301  -7.658  1.00 39.80 ? 1956 ARG D N   1 
ATOM   6380 C  CA  . ARG D 2 233 ? 48.476 42.539  -8.091  1.00 37.29 ? 1956 ARG D CA  1 
ATOM   6381 C  C   . ARG D 2 233 ? 47.224 42.213  -8.873  1.00 34.49 ? 1956 ARG D C   1 
ATOM   6382 O  O   . ARG D 2 233 ? 47.300 41.524  -9.887  1.00 37.11 ? 1956 ARG D O   1 
ATOM   6383 C  CB  . ARG D 2 233 ? 49.428 43.352  -8.960  1.00 35.44 ? 1956 ARG D CB  1 
ATOM   6384 C  CG  . ARG D 2 233 ? 48.977 44.793  -9.132  1.00 37.73 ? 1956 ARG D CG  1 
ATOM   6385 C  CD  . ARG D 2 233 ? 50.115 45.606  -9.665  1.00 38.35 ? 1956 ARG D CD  1 
ATOM   6386 N  NE  . ARG D 2 233 ? 51.346 45.191  -9.009  1.00 37.19 ? 1956 ARG D NE  1 
ATOM   6387 C  CZ  . ARG D 2 233 ? 52.552 45.565  -9.410  1.00 38.33 ? 1956 ARG D CZ  1 
ATOM   6388 N  NH1 . ARG D 2 233 ? 52.669 46.364  -10.469 1.00 39.14 ? 1956 ARG D NH1 1 
ATOM   6389 N  NH2 . ARG D 2 233 ? 53.631 45.137  -8.760  1.00 35.77 ? 1956 ARG D NH2 1 
ATOM   6390 N  N   . ILE D 2 234 ? 46.080 42.712  -8.413  1.00 32.79 ? 1957 ILE D N   1 
ATOM   6391 C  CA  . ILE D 2 234 ? 44.794 42.445  -9.073  1.00 32.76 ? 1957 ILE D CA  1 
ATOM   6392 C  C   . ILE D 2 234 ? 44.160 43.654  -9.769  1.00 30.70 ? 1957 ILE D C   1 
ATOM   6393 O  O   . ILE D 2 234 ? 44.593 44.790  -9.592  1.00 29.78 ? 1957 ILE D O   1 
ATOM   6394 C  CB  . ILE D 2 234 ? 43.776 41.916  -8.056  1.00 33.57 ? 1957 ILE D CB  1 
ATOM   6395 C  CG1 . ILE D 2 234 ? 43.631 42.934  -6.922  1.00 31.82 ? 1957 ILE D CG1 1 
ATOM   6396 C  CG2 . ILE D 2 234 ? 44.223 40.556  -7.527  1.00 31.79 ? 1957 ILE D CG2 1 
ATOM   6397 C  CD1 . ILE D 2 234 ? 42.604 42.561  -5.907  1.00 34.56 ? 1957 ILE D CD1 1 
ATOM   6398 N  N   . GLY D 2 235 ? 43.104 43.391  -10.531 1.00 30.36 ? 1958 GLY D N   1 
ATOM   6399 C  CA  . GLY D 2 235 ? 42.410 44.437  -11.267 1.00 31.32 ? 1958 GLY D CA  1 
ATOM   6400 C  C   . GLY D 2 235 ? 42.041 45.715  -10.535 1.00 32.03 ? 1958 GLY D C   1 
ATOM   6401 O  O   . GLY D 2 235 ? 41.378 45.693  -9.502  1.00 34.50 ? 1958 GLY D O   1 
ATOM   6402 N  N   . PHE D 2 236 ? 42.468 46.841  -11.089 1.00 31.42 ? 1959 PHE D N   1 
ATOM   6403 C  CA  . PHE D 2 236 ? 42.184 48.145  -10.508 1.00 30.76 ? 1959 PHE D CA  1 
ATOM   6404 C  C   . PHE D 2 236 ? 40.684 48.392  -10.414 1.00 30.90 ? 1959 PHE D C   1 
ATOM   6405 O  O   . PHE D 2 236 ? 40.216 49.127  -9.540  1.00 28.74 ? 1959 PHE D O   1 
ATOM   6406 C  CB  . PHE D 2 236 ? 42.808 49.242  -11.374 1.00 32.68 ? 1959 PHE D CB  1 
ATOM   6407 C  CG  . PHE D 2 236 ? 44.302 49.366  -11.239 1.00 32.19 ? 1959 PHE D CG  1 
ATOM   6408 C  CD1 . PHE D 2 236 ? 45.096 49.532  -12.369 1.00 33.21 ? 1959 PHE D CD1 1 
ATOM   6409 C  CD2 . PHE D 2 236 ? 44.910 49.367  -9.984  1.00 32.77 ? 1959 PHE D CD2 1 
ATOM   6410 C  CE1 . PHE D 2 236 ? 46.478 49.701  -12.256 1.00 34.38 ? 1959 PHE D CE1 1 
ATOM   6411 C  CE2 . PHE D 2 236 ? 46.289 49.536  -9.853  1.00 32.62 ? 1959 PHE D CE2 1 
ATOM   6412 C  CZ  . PHE D 2 236 ? 47.077 49.704  -10.990 1.00 34.33 ? 1959 PHE D CZ  1 
ATOM   6413 N  N   . LYS D 2 237 ? 39.934 47.778  -11.323 1.00 33.14 ? 1960 LYS D N   1 
ATOM   6414 C  CA  . LYS D 2 237 ? 38.484 47.953  -11.371 1.00 36.89 ? 1960 LYS D CA  1 
ATOM   6415 C  C   . LYS D 2 237 ? 37.763 46.613  -11.300 1.00 36.97 ? 1960 LYS D C   1 
ATOM   6416 O  O   . LYS D 2 237 ? 36.581 46.506  -11.628 1.00 34.43 ? 1960 LYS D O   1 
ATOM   6417 C  CB  . LYS D 2 237 ? 38.108 48.674  -12.668 1.00 41.87 ? 1960 LYS D CB  1 
ATOM   6418 C  CG  . LYS D 2 237 ? 38.877 49.979  -12.898 1.00 45.46 ? 1960 LYS D CG  1 
ATOM   6419 C  CD  . LYS D 2 237 ? 38.535 50.611  -14.239 1.00 49.58 ? 1960 LYS D CD  1 
ATOM   6420 C  CE  . LYS D 2 237 ? 39.110 52.022  -14.344 1.00 54.81 ? 1960 LYS D CE  1 
ATOM   6421 N  NZ  . LYS D 2 237 ? 40.588 52.083  -14.088 1.00 56.16 ? 1960 LYS D NZ  1 
ATOM   6422 N  N   . GLN D 2 238 ? 38.484 45.592  -10.853 1.00 38.74 ? 1961 GLN D N   1 
ATOM   6423 C  CA  . GLN D 2 238 ? 37.934 44.250  -10.744 1.00 39.59 ? 1961 GLN D CA  1 
ATOM   6424 C  C   . GLN D 2 238 ? 36.721 44.159  -9.805  1.00 38.95 ? 1961 GLN D C   1 
ATOM   6425 O  O   . GLN D 2 238 ? 36.004 43.155  -9.807  1.00 39.40 ? 1961 GLN D O   1 
ATOM   6426 C  CB  . GLN D 2 238 ? 39.048 43.298  -10.287 1.00 39.99 ? 1961 GLN D CB  1 
ATOM   6427 C  CG  . GLN D 2 238 ? 38.584 41.896  -9.943  1.00 42.58 ? 1961 GLN D CG  1 
ATOM   6428 C  CD  . GLN D 2 238 ? 39.575 41.156  -9.050  1.00 45.97 ? 1961 GLN D CD  1 
ATOM   6429 O  OE1 . GLN D 2 238 ? 40.477 40.459  -9.544  1.00 43.96 ? 1961 GLN D OE1 1 
ATOM   6430 N  NE2 . GLN D 2 238 ? 39.419 41.316  -7.720  1.00 42.47 ? 1961 GLN D NE2 1 
ATOM   6431 N  N   . HIS D 2 239 ? 36.492 45.198  -9.007  1.00 38.02 ? 1962 HIS D N   1 
ATOM   6432 C  CA  . HIS D 2 239 ? 35.361 45.198  -8.085  1.00 37.39 ? 1962 HIS D CA  1 
ATOM   6433 C  C   . HIS D 2 239 ? 35.005 46.622  -7.648  1.00 35.73 ? 1962 HIS D C   1 
ATOM   6434 O  O   . HIS D 2 239 ? 35.879 47.472  -7.488  1.00 34.26 ? 1962 HIS D O   1 
ATOM   6435 C  CB  . HIS D 2 239 ? 35.679 44.322  -6.862  1.00 38.66 ? 1962 HIS D CB  1 
ATOM   6436 C  CG  . HIS D 2 239 ? 34.518 44.141  -5.933  1.00 40.02 ? 1962 HIS D CG  1 
ATOM   6437 N  ND1 . HIS D 2 239 ? 33.941 45.191  -5.246  1.00 38.06 ? 1962 HIS D ND1 1 
ATOM   6438 C  CD2 . HIS D 2 239 ? 33.820 43.033  -5.587  1.00 39.00 ? 1962 HIS D CD2 1 
ATOM   6439 C  CE1 . HIS D 2 239 ? 32.938 44.737  -4.517  1.00 39.87 ? 1962 HIS D CE1 1 
ATOM   6440 N  NE2 . HIS D 2 239 ? 32.843 43.432  -4.706  1.00 42.93 ? 1962 HIS D NE2 1 
ATOM   6441 N  N   . PRO D 2 240 ? 33.706 46.899  -7.458  1.00 35.02 ? 1963 PRO D N   1 
ATOM   6442 C  CA  . PRO D 2 240 ? 33.239 48.222  -7.041  1.00 34.58 ? 1963 PRO D CA  1 
ATOM   6443 C  C   . PRO D 2 240 ? 33.848 48.816  -5.759  1.00 35.52 ? 1963 PRO D C   1 
ATOM   6444 O  O   . PRO D 2 240 ? 34.013 50.036  -5.665  1.00 34.55 ? 1963 PRO D O   1 
ATOM   6445 C  CB  . PRO D 2 240 ? 31.729 48.023  -6.932  1.00 34.29 ? 1963 PRO D CB  1 
ATOM   6446 C  CG  . PRO D 2 240 ? 31.458 47.053  -8.030  1.00 31.72 ? 1963 PRO D CG  1 
ATOM   6447 C  CD  . PRO D 2 240 ? 32.563 46.043  -7.824  1.00 34.02 ? 1963 PRO D CD  1 
ATOM   6448 N  N   . LYS D 2 241 ? 34.188 47.979  -4.780  1.00 36.90 ? 1964 LYS D N   1 
ATOM   6449 C  CA  . LYS D 2 241 ? 34.738 48.515  -3.536  1.00 37.96 ? 1964 LYS D CA  1 
ATOM   6450 C  C   . LYS D 2 241 ? 36.149 49.078  -3.719  1.00 36.88 ? 1964 LYS D C   1 
ATOM   6451 O  O   . LYS D 2 241 ? 36.750 49.584  -2.766  1.00 37.02 ? 1964 LYS D O   1 
ATOM   6452 C  CB  . LYS D 2 241 ? 34.703 47.449  -2.432  1.00 40.89 ? 1964 LYS D CB  1 
ATOM   6453 C  CG  . LYS D 2 241 ? 34.526 48.022  -1.017  1.00 43.91 ? 1964 LYS D CG  1 
ATOM   6454 C  CD  . LYS D 2 241 ? 34.034 46.942  -0.038  1.00 46.69 ? 1964 LYS D CD  1 
ATOM   6455 C  CE  . LYS D 2 241 ? 32.653 46.405  -0.449  1.00 47.10 ? 1964 LYS D CE  1 
ATOM   6456 N  NZ  . LYS D 2 241 ? 32.309 45.076  0.142   1.00 43.44 ? 1964 LYS D NZ  1 
ATOM   6457 N  N   . TYR D 2 242 ? 36.669 48.994  -4.947  1.00 35.04 ? 1965 TYR D N   1 
ATOM   6458 C  CA  . TYR D 2 242 ? 37.995 49.535  -5.263  1.00 34.06 ? 1965 TYR D CA  1 
ATOM   6459 C  C   . TYR D 2 242 ? 37.905 51.020  -5.623  1.00 35.48 ? 1965 TYR D C   1 
ATOM   6460 O  O   . TYR D 2 242 ? 38.896 51.741  -5.525  1.00 37.50 ? 1965 TYR D O   1 
ATOM   6461 C  CB  . TYR D 2 242 ? 38.645 48.779  -6.427  1.00 30.81 ? 1965 TYR D CB  1 
ATOM   6462 C  CG  . TYR D 2 242 ? 38.981 47.335  -6.118  1.00 32.44 ? 1965 TYR D CG  1 
ATOM   6463 C  CD1 . TYR D 2 242 ? 39.436 46.482  -7.117  1.00 32.85 ? 1965 TYR D CD1 1 
ATOM   6464 C  CD2 . TYR D 2 242 ? 38.797 46.806  -4.837  1.00 32.10 ? 1965 TYR D CD2 1 
ATOM   6465 C  CE1 . TYR D 2 242 ? 39.692 45.138  -6.861  1.00 32.93 ? 1965 TYR D CE1 1 
ATOM   6466 C  CE2 . TYR D 2 242 ? 39.052 45.459  -4.571  1.00 32.91 ? 1965 TYR D CE2 1 
ATOM   6467 C  CZ  . TYR D 2 242 ? 39.495 44.632  -5.589  1.00 34.54 ? 1965 TYR D CZ  1 
ATOM   6468 O  OH  . TYR D 2 242 ? 39.721 43.290  -5.348  1.00 37.40 ? 1965 TYR D OH  1 
ATOM   6469 N  N   . LYS D 2 243 ? 36.725 51.473  -6.047  1.00 36.54 ? 1966 LYS D N   1 
ATOM   6470 C  CA  . LYS D 2 243 ? 36.529 52.877  -6.385  1.00 37.71 ? 1966 LYS D CA  1 
ATOM   6471 C  C   . LYS D 2 243 ? 36.768 53.676  -5.114  1.00 37.68 ? 1966 LYS D C   1 
ATOM   6472 O  O   . LYS D 2 243 ? 36.235 53.345  -4.060  1.00 39.39 ? 1966 LYS D O   1 
ATOM   6473 C  CB  . LYS D 2 243 ? 35.109 53.103  -6.900  1.00 42.92 ? 1966 LYS D CB  1 
ATOM   6474 C  CG  . LYS D 2 243 ? 34.804 52.348  -8.192  1.00 48.57 ? 1966 LYS D CG  1 
ATOM   6475 C  CD  . LYS D 2 243 ? 33.313 52.387  -8.548  1.00 52.29 ? 1966 LYS D CD  1 
ATOM   6476 C  CE  . LYS D 2 243 ? 33.017 51.580  -9.825  1.00 53.49 ? 1966 LYS D CE  1 
ATOM   6477 N  NZ  . LYS D 2 243 ? 31.566 51.561  -10.207 1.00 52.87 ? 1966 LYS D NZ  1 
ATOM   6478 N  N   . HIS D 2 244 ? 37.578 54.722  -5.220  1.00 38.60 ? 1967 HIS D N   1 
ATOM   6479 C  CA  . HIS D 2 244 ? 37.947 55.571  -4.081  1.00 40.03 ? 1967 HIS D CA  1 
ATOM   6480 C  C   . HIS D 2 244 ? 36.789 56.089  -3.222  1.00 43.11 ? 1967 HIS D C   1 
ATOM   6481 O  O   . HIS D 2 244 ? 36.909 56.213  -2.000  1.00 44.02 ? 1967 HIS D O   1 
ATOM   6482 C  CB  . HIS D 2 244 ? 38.728 56.783  -4.585  1.00 36.03 ? 1967 HIS D CB  1 
ATOM   6483 C  CG  . HIS D 2 244 ? 37.905 57.703  -5.431  1.00 32.33 ? 1967 HIS D CG  1 
ATOM   6484 N  ND1 . HIS D 2 244 ? 37.470 58.934  -4.988  1.00 31.26 ? 1967 HIS D ND1 1 
ATOM   6485 C  CD2 . HIS D 2 244 ? 37.356 57.531  -6.658  1.00 30.21 ? 1967 HIS D CD2 1 
ATOM   6486 C  CE1 . HIS D 2 244 ? 36.685 59.478  -5.901  1.00 28.74 ? 1967 HIS D CE1 1 
ATOM   6487 N  NE2 . HIS D 2 244 ? 36.598 58.646  -6.923  1.00 27.65 ? 1967 HIS D NE2 1 
ATOM   6488 N  N   . ASP D 2 245 ? 35.676 56.406  -3.869  1.00 45.38 ? 1968 ASP D N   1 
ATOM   6489 C  CA  . ASP D 2 245 ? 34.523 56.969  -3.180  1.00 49.22 ? 1968 ASP D CA  1 
ATOM   6490 C  C   . ASP D 2 245 ? 33.509 55.955  -2.680  1.00 51.80 ? 1968 ASP D C   1 
ATOM   6491 O  O   . ASP D 2 245 ? 32.513 56.329  -2.054  1.00 52.87 ? 1968 ASP D O   1 
ATOM   6492 C  CB  . ASP D 2 245 ? 33.811 57.963  -4.106  1.00 48.33 ? 1968 ASP D CB  1 
ATOM   6493 C  CG  . ASP D 2 245 ? 33.512 57.368  -5.480  1.00 49.07 ? 1968 ASP D CG  1 
ATOM   6494 O  OD1 . ASP D 2 245 ? 33.172 56.167  -5.548  1.00 48.87 ? 1968 ASP D OD1 1 
ATOM   6495 O  OD2 . ASP D 2 245 ? 33.604 58.099  -6.491  1.00 48.47 ? 1968 ASP D OD2 1 
ATOM   6496 N  N   . TYR D 2 246 ? 33.728 54.682  -2.992  1.00 53.11 ? 1969 TYR D N   1 
ATOM   6497 C  CA  . TYR D 2 246 ? 32.807 53.652  -2.545  1.00 53.49 ? 1969 TYR D CA  1 
ATOM   6498 C  C   . TYR D 2 246 ? 32.883 53.542  -1.013  1.00 54.05 ? 1969 TYR D C   1 
ATOM   6499 O  O   . TYR D 2 246 ? 33.865 52.943  -0.517  1.00 55.01 ? 1969 TYR D O   1 
ATOM   6500 C  CB  . TYR D 2 246 ? 33.140 52.309  -3.205  1.00 52.53 ? 1969 TYR D CB  1 
ATOM   6501 C  CG  . TYR D 2 246 ? 32.144 51.226  -2.852  1.00 54.49 ? 1969 TYR D CG  1 
ATOM   6502 C  CD1 . TYR D 2 246 ? 32.070 50.720  -1.550  1.00 53.60 ? 1969 TYR D CD1 1 
ATOM   6503 C  CD2 . TYR D 2 246 ? 31.223 50.760  -3.793  1.00 54.04 ? 1969 TYR D CD2 1 
ATOM   6504 C  CE1 . TYR D 2 246 ? 31.099 49.787  -1.189  1.00 55.30 ? 1969 TYR D CE1 1 
ATOM   6505 C  CE2 . TYR D 2 246 ? 30.244 49.822  -3.442  1.00 54.22 ? 1969 TYR D CE2 1 
ATOM   6506 C  CZ  . TYR D 2 246 ? 30.186 49.346  -2.135  1.00 55.21 ? 1969 TYR D CZ  1 
ATOM   6507 O  OH  . TYR D 2 246 ? 29.193 48.470  -1.752  1.00 55.62 ? 1969 TYR D OH  1 
ATOM   6508 N  N   . VAL D 2 247 ? 31.975 54.074  -0.327  1.00 51.92 ? 1970 VAL D N   1 
HETATM 6509 ZN ZN  . ZN  E 4 .   ? 23.271 24.086  40.460  1.00 31.14 ? 1293 ZN  A ZN  1 
HETATM 6510 S  S   . SO4 F 5 .   ? 29.665 52.223  39.766  1.00 41.91 ? 2972 SO4 B S   1 
HETATM 6511 O  O1  . SO4 F 5 .   ? 29.566 51.221  40.857  1.00 36.85 ? 2972 SO4 B O1  1 
HETATM 6512 O  O2  . SO4 F 5 .   ? 31.075 52.635  39.581  1.00 40.69 ? 2972 SO4 B O2  1 
HETATM 6513 O  O3  . SO4 F 5 .   ? 28.850 53.403  40.115  1.00 46.16 ? 2972 SO4 B O3  1 
HETATM 6514 O  O4  . SO4 F 5 .   ? 29.120 51.682  38.501  1.00 40.31 ? 2972 SO4 B O4  1 
HETATM 6515 ZN ZN  . ZN  G 4 .   ? 43.220 16.102  14.283  1.00 31.44 ? 1290 ZN  C ZN  1 
HETATM 6516 S  S   . SO4 H 5 .   ? 46.830 44.586  17.487  1.00 57.14 ? 2970 SO4 D S   1 
HETATM 6517 O  O1  . SO4 H 5 .   ? 47.255 43.246  17.927  1.00 57.49 ? 2970 SO4 D O1  1 
HETATM 6518 O  O2  . SO4 H 5 .   ? 47.672 45.580  18.191  1.00 57.42 ? 2970 SO4 D O2  1 
HETATM 6519 O  O3  . SO4 H 5 .   ? 45.402 44.763  17.838  1.00 54.76 ? 2970 SO4 D O3  1 
HETATM 6520 O  O4  . SO4 H 5 .   ? 47.010 44.742  16.020  1.00 54.96 ? 2970 SO4 D O4  1 
HETATM 6521 O  O   . HOH I 6 .   ? 18.927 20.841  18.298  1.00 39.32 ? 2001 HOH A O   1 
HETATM 6522 O  O   . HOH I 6 .   ? 15.056 24.362  20.440  1.00 22.49 ? 2002 HOH A O   1 
HETATM 6523 O  O   . HOH I 6 .   ? 17.676 5.720   11.768  1.00 47.96 ? 2003 HOH A O   1 
HETATM 6524 O  O   . HOH I 6 .   ? 14.003 3.264   13.192  1.00 18.53 ? 2004 HOH A O   1 
HETATM 6525 O  O   . HOH I 6 .   ? 1.194  7.854   23.845  1.00 39.56 ? 2005 HOH A O   1 
HETATM 6526 O  O   . HOH I 6 .   ? 5.533  12.332  33.903  1.00 36.13 ? 2006 HOH A O   1 
HETATM 6527 O  O   . HOH I 6 .   ? 5.597  -2.205  23.585  1.00 41.99 ? 2007 HOH A O   1 
HETATM 6528 O  O   . HOH I 6 .   ? 4.623  1.312   13.720  1.00 24.00 ? 2008 HOH A O   1 
HETATM 6529 O  O   . HOH I 6 .   ? 24.701 2.285   22.287  1.00 46.01 ? 2009 HOH A O   1 
HETATM 6530 O  O   . HOH I 6 .   ? 23.027 16.624  28.833  1.00 17.94 ? 2010 HOH A O   1 
HETATM 6531 O  O   . HOH I 6 .   ? 20.420 17.464  46.503  1.00 26.54 ? 2011 HOH A O   1 
HETATM 6532 O  O   . HOH I 6 .   ? 22.926 22.969  24.342  1.00 20.33 ? 2012 HOH A O   1 
HETATM 6533 O  O   . HOH I 6 .   ? 11.777 28.528  25.908  1.00 32.52 ? 2013 HOH A O   1 
HETATM 6534 O  O   . HOH I 6 .   ? 24.877 19.645  26.792  1.00 21.56 ? 2014 HOH A O   1 
HETATM 6535 O  O   . HOH I 6 .   ? 22.911 23.547  35.983  1.00 28.53 ? 2015 HOH A O   1 
HETATM 6536 O  O   . HOH I 6 .   ? 13.983 0.311   32.366  1.00 13.68 ? 2016 HOH A O   1 
HETATM 6537 O  O   . HOH I 6 .   ? 14.546 -0.217  35.298  1.00 47.92 ? 2017 HOH A O   1 
HETATM 6538 O  O   . HOH I 6 .   ? 29.556 28.606  43.853  1.00 56.66 ? 2018 HOH A O   1 
HETATM 6539 O  O   . HOH I 6 .   ? 29.732 28.766  47.970  1.00 37.00 ? 2019 HOH A O   1 
HETATM 6540 O  O   . HOH I 6 .   ? 24.566 15.133  45.036  1.00 21.82 ? 2020 HOH A O   1 
HETATM 6541 O  O   . HOH I 6 .   ? 30.843 6.735   41.147  1.00 39.04 ? 2021 HOH A O   1 
HETATM 6542 O  O   . HOH I 6 .   ? 23.828 13.083  32.125  1.00 19.27 ? 2022 HOH A O   1 
HETATM 6543 O  O   . HOH I 6 .   ? 25.311 14.105  38.845  1.00 34.39 ? 2023 HOH A O   1 
HETATM 6544 O  O   . HOH I 6 .   ? 22.937 6.933   39.027  1.00 55.43 ? 2024 HOH A O   1 
HETATM 6545 O  O   . HOH I 6 .   ? 25.709 17.715  28.568  1.00 24.00 ? 2025 HOH A O   1 
HETATM 6546 O  O   . HOH I 6 .   ? 25.058 17.512  32.052  1.00 29.26 ? 2026 HOH A O   1 
HETATM 6547 O  O   . HOH I 6 .   ? 27.276 12.405  26.050  1.00 19.30 ? 2027 HOH A O   1 
HETATM 6548 O  O   . HOH I 6 .   ? 16.577 -0.061  31.986  1.00 24.49 ? 2028 HOH A O   1 
HETATM 6549 O  O   . HOH I 6 .   ? 13.942 -2.133  32.896  1.00 46.86 ? 2029 HOH A O   1 
HETATM 6550 O  O   . HOH I 6 .   ? 14.372 0.456   29.749  1.00 23.82 ? 2030 HOH A O   1 
HETATM 6551 O  O   . HOH I 6 .   ? 5.478  -5.812  31.928  1.00 36.07 ? 2031 HOH A O   1 
HETATM 6552 O  O   . HOH I 6 .   ? 1.167  -5.972  32.225  1.00 32.02 ? 2032 HOH A O   1 
HETATM 6553 O  O   . HOH I 6 .   ? 6.065  1.173   33.318  1.00 13.85 ? 2033 HOH A O   1 
HETATM 6554 O  O   . HOH I 6 .   ? 13.711 2.250   34.547  1.00 22.97 ? 2034 HOH A O   1 
HETATM 6555 O  O   . HOH I 6 .   ? 12.154 2.591   36.804  1.00 28.49 ? 2035 HOH A O   1 
HETATM 6556 O  O   . HOH I 6 .   ? 11.601 0.599   35.468  1.00 41.80 ? 2036 HOH A O   1 
HETATM 6557 O  O   . HOH I 6 .   ? 14.362 4.744   36.242  1.00 24.13 ? 2037 HOH A O   1 
HETATM 6558 O  O   . HOH I 6 .   ? 18.261 7.308   29.399  1.00 28.31 ? 2038 HOH A O   1 
HETATM 6559 O  O   . HOH I 6 .   ? 14.585 16.251  39.068  1.00 25.07 ? 2039 HOH A O   1 
HETATM 6560 O  O   . HOH I 6 .   ? 16.972 25.080  32.111  1.00 21.19 ? 2040 HOH A O   1 
HETATM 6561 O  O   . HOH I 6 .   ? 12.143 3.323   16.511  1.00 29.85 ? 2041 HOH A O   1 
HETATM 6562 O  O   . HOH I 6 .   ? 20.094 13.287  19.028  1.00 29.08 ? 2042 HOH A O   1 
HETATM 6563 O  O   . HOH I 6 .   ? 11.858 15.727  19.404  1.00 20.13 ? 2043 HOH A O   1 
HETATM 6564 O  O   . HOH I 6 .   ? 10.836 28.851  31.530  1.00 33.44 ? 2044 HOH A O   1 
HETATM 6565 O  O   . HOH J 6 .   ? 44.984 34.468  46.788  1.00 45.20 ? 2001 HOH B O   1 
HETATM 6566 O  O   . HOH J 6 .   ? 44.099 32.391  47.860  1.00 36.86 ? 2002 HOH B O   1 
HETATM 6567 O  O   . HOH J 6 .   ? 46.810 30.806  47.950  1.00 31.36 ? 2003 HOH B O   1 
HETATM 6568 O  O   . HOH J 6 .   ? 47.263 30.276  34.482  1.00 34.00 ? 2004 HOH B O   1 
HETATM 6569 O  O   . HOH J 6 .   ? 44.083 34.439  32.187  1.00 27.72 ? 2005 HOH B O   1 
HETATM 6570 O  O   . HOH J 6 .   ? 44.807 31.125  33.372  1.00 40.54 ? 2006 HOH B O   1 
HETATM 6571 O  O   . HOH J 6 .   ? 45.022 40.895  32.541  1.00 23.23 ? 2007 HOH B O   1 
HETATM 6572 O  O   . HOH J 6 .   ? 35.313 49.171  37.514  1.00 22.38 ? 2008 HOH B O   1 
HETATM 6573 O  O   . HOH J 6 .   ? 26.890 34.196  48.772  1.00 34.87 ? 2009 HOH B O   1 
HETATM 6574 O  O   . HOH J 6 .   ? 25.697 39.765  46.106  1.00 42.00 ? 2010 HOH B O   1 
HETATM 6575 O  O   . HOH J 6 .   ? 33.458 40.684  47.034  1.00 35.41 ? 2011 HOH B O   1 
HETATM 6576 O  O   . HOH J 6 .   ? 34.185 37.820  43.973  1.00 37.82 ? 2012 HOH B O   1 
HETATM 6577 O  O   . HOH J 6 .   ? 36.509 49.188  40.546  1.00 33.03 ? 2013 HOH B O   1 
HETATM 6578 O  O   . HOH J 6 .   ? 34.238 35.939  46.064  1.00 34.79 ? 2014 HOH B O   1 
HETATM 6579 O  O   . HOH J 6 .   ? 37.340 47.635  25.993  1.00 27.30 ? 2015 HOH B O   1 
HETATM 6580 O  O   . HOH J 6 .   ? 41.086 47.402  25.430  1.00 65.00 ? 2016 HOH B O   1 
HETATM 6581 O  O   . HOH J 6 .   ? 40.018 49.149  22.438  1.00 25.04 ? 2017 HOH B O   1 
HETATM 6582 O  O   . HOH J 6 .   ? 28.589 57.467  29.625  1.00 37.73 ? 2018 HOH B O   1 
HETATM 6583 O  O   . HOH J 6 .   ? 29.937 55.950  36.238  1.00 39.11 ? 2019 HOH B O   1 
HETATM 6584 O  O   . HOH J 6 .   ? 24.314 46.945  22.030  1.00 50.36 ? 2020 HOH B O   1 
HETATM 6585 O  O   . HOH J 6 .   ? 26.921 43.312  26.967  1.00 28.32 ? 2021 HOH B O   1 
HETATM 6586 O  O   . HOH J 6 .   ? 26.315 40.445  28.801  1.00 36.96 ? 2022 HOH B O   1 
HETATM 6587 O  O   . HOH J 6 .   ? 42.774 29.561  33.520  1.00 25.10 ? 2023 HOH B O   1 
HETATM 6588 O  O   . HOH J 6 .   ? 23.894 32.937  29.921  1.00 41.34 ? 2024 HOH B O   1 
HETATM 6589 O  O   . HOH J 6 .   ? 19.677 46.593  33.376  1.00 9.92  ? 2025 HOH B O   1 
HETATM 6590 O  O   . HOH J 6 .   ? 17.302 47.036  34.219  1.00 21.11 ? 2026 HOH B O   1 
HETATM 6591 O  O   . HOH J 6 .   ? 15.140 48.337  33.682  1.00 17.09 ? 2027 HOH B O   1 
HETATM 6592 O  O   . HOH J 6 .   ? 20.740 33.623  30.328  1.00 26.01 ? 2028 HOH B O   1 
HETATM 6593 O  O   . HOH J 6 .   ? 21.293 36.738  29.801  1.00 30.03 ? 2029 HOH B O   1 
HETATM 6594 O  O   . HOH J 6 .   ? 25.597 43.637  24.259  1.00 32.62 ? 2030 HOH B O   1 
HETATM 6595 O  O   . HOH J 6 .   ? 19.823 40.783  24.281  1.00 37.82 ? 2031 HOH B O   1 
HETATM 6596 O  O   . HOH J 6 .   ? 29.147 55.530  16.908  1.00 29.03 ? 2032 HOH B O   1 
HETATM 6597 O  O   . HOH J 6 .   ? 26.830 55.063  12.907  1.00 36.45 ? 2033 HOH B O   1 
HETATM 6598 O  O   . HOH J 6 .   ? 28.447 63.371  17.220  1.00 25.64 ? 2034 HOH B O   1 
HETATM 6599 O  O   . HOH J 6 .   ? 28.828 65.340  21.273  1.00 33.14 ? 2035 HOH B O   1 
HETATM 6600 O  O   . HOH J 6 .   ? 26.560 78.033  18.222  1.00 40.90 ? 2036 HOH B O   1 
HETATM 6601 O  O   . HOH J 6 .   ? 14.522 61.911  29.910  1.00 23.73 ? 2037 HOH B O   1 
HETATM 6602 O  O   . HOH J 6 .   ? 7.717  62.923  24.182  1.00 25.18 ? 2038 HOH B O   1 
HETATM 6603 O  O   . HOH J 6 .   ? 17.979 41.425  25.639  1.00 22.51 ? 2039 HOH B O   1 
HETATM 6604 O  O   . HOH J 6 .   ? 8.815  48.971  24.620  1.00 25.12 ? 2040 HOH B O   1 
HETATM 6605 O  O   . HOH J 6 .   ? 10.880 58.717  32.102  1.00 34.64 ? 2041 HOH B O   1 
HETATM 6606 O  O   . HOH J 6 .   ? 3.863  64.705  26.595  1.00 37.89 ? 2042 HOH B O   1 
HETATM 6607 O  O   . HOH J 6 .   ? 28.235 53.645  36.934  1.00 38.96 ? 2043 HOH B O   1 
HETATM 6608 O  O   . HOH K 6 .   ? 45.984 -3.656  -12.863 1.00 24.42 ? 2001 HOH C O   1 
HETATM 6609 O  O   . HOH K 6 .   ? 42.186 -7.357  -17.158 1.00 30.17 ? 2002 HOH C O   1 
HETATM 6610 O  O   . HOH K 6 .   ? 49.461 -3.977  -14.017 1.00 31.79 ? 2003 HOH C O   1 
HETATM 6611 O  O   . HOH K 6 .   ? 36.275 8.062   8.446   1.00 20.44 ? 2004 HOH C O   1 
HETATM 6612 O  O   . HOH K 6 .   ? 51.513 11.915  2.938   1.00 18.28 ? 2005 HOH C O   1 
HETATM 6613 O  O   . HOH K 6 .   ? 48.347 5.189   7.616   1.00 37.23 ? 2006 HOH C O   1 
HETATM 6614 O  O   . HOH K 6 .   ? 47.573 7.664   6.881   1.00 40.74 ? 2007 HOH C O   1 
HETATM 6615 O  O   . HOH K 6 .   ? 45.492 6.137   13.864  1.00 14.12 ? 2008 HOH C O   1 
HETATM 6616 O  O   . HOH K 6 .   ? 48.940 7.858   4.633   1.00 37.11 ? 2009 HOH C O   1 
HETATM 6617 O  O   . HOH K 6 .   ? 49.051 9.489   8.456   1.00 26.94 ? 2010 HOH C O   1 
HETATM 6618 O  O   . HOH L 6 .   ? 45.711 32.268  24.826  1.00 53.27 ? 2001 HOH D O   1 
HETATM 6619 O  O   . HOH L 6 .   ? 55.187 36.692  1.160   1.00 15.33 ? 2002 HOH D O   1 
HETATM 6620 O  O   . HOH L 6 .   ? 64.146 45.627  10.889  1.00 28.28 ? 2003 HOH D O   1 
HETATM 6621 O  O   . HOH L 6 .   ? 52.551 39.490  -0.129  1.00 14.63 ? 2004 HOH D O   1 
HETATM 6622 O  O   . HOH L 6 .   ? 53.167 36.935  2.953   1.00 32.74 ? 2005 HOH D O   1 
HETATM 6623 O  O   . HOH L 6 .   ? 55.024 38.985  -0.089  1.00 16.99 ? 2006 HOH D O   1 
HETATM 6624 O  O   . HOH L 6 .   ? 52.810 36.130  5.567   1.00 27.60 ? 2007 HOH D O   1 
HETATM 6625 O  O   . HOH L 6 .   ? 48.949 25.195  6.606   1.00 53.50 ? 2008 HOH D O   1 
HETATM 6626 O  O   . HOH L 6 .   ? 47.787 26.715  4.423   1.00 19.60 ? 2009 HOH D O   1 
HETATM 6627 O  O   . HOH L 6 .   ? 46.545 29.200  4.916   1.00 29.66 ? 2010 HOH D O   1 
HETATM 6628 O  O   . HOH L 6 .   ? 55.644 34.297  0.179   1.00 20.29 ? 2011 HOH D O   1 
HETATM 6629 O  O   . HOH L 6 .   ? 53.197 64.900  -14.271 1.00 39.69 ? 2012 HOH D O   1 
HETATM 6630 O  O   . HOH L 6 .   ? 36.039 51.135  -0.663  1.00 42.78 ? 2013 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   95   95   SER SER A . n 
A 1 2   SER 2   96   96   SER SER A . n 
A 1 3   VAL 3   97   97   VAL VAL A . n 
A 1 4   PRO 4   98   98   PRO PRO A . n 
A 1 5   SER 5   99   99   SER SER A . n 
A 1 6   GLN 6   100  100  GLN GLN A . n 
A 1 7   LYS 7   101  101  LYS LYS A . n 
A 1 8   THR 8   102  102  THR THR A . n 
A 1 9   TYR 9   103  103  TYR TYR A . n 
A 1 10  GLN 10  104  104  GLN GLN A . n 
A 1 11  GLY 11  105  105  GLY GLY A . n 
A 1 12  SER 12  106  106  SER SER A . n 
A 1 13  TYR 13  107  107  TYR TYR A . n 
A 1 14  GLY 14  108  108  GLY GLY A . n 
A 1 15  PHE 15  109  109  PHE PHE A . n 
A 1 16  ARG 16  110  110  ARG ARG A . n 
A 1 17  LEU 17  111  111  LEU LEU A . n 
A 1 18  GLY 18  112  112  GLY GLY A . n 
A 1 19  PHE 19  113  113  PHE PHE A . n 
A 1 20  LEU 20  114  114  LEU LEU A . n 
A 1 21  HIS 21  115  115  HIS HIS A . n 
A 1 22  SER 22  116  116  SER SER A . n 
A 1 23  GLY 23  117  117  GLY GLY A . n 
A 1 24  THR 24  118  118  THR THR A . n 
A 1 25  ALA 25  119  119  ALA ALA A . n 
A 1 26  LYS 26  120  120  LYS LYS A . n 
A 1 27  SER 27  121  121  SER SER A . n 
A 1 28  VAL 28  122  122  VAL VAL A . n 
A 1 29  THR 29  123  123  THR THR A . n 
A 1 30  CYS 30  124  124  CYS CYS A . n 
A 1 31  THR 31  125  125  THR THR A . n 
A 1 32  TYR 32  126  126  TYR TYR A . n 
A 1 33  SER 33  127  127  SER SER A . n 
A 1 34  PRO 34  128  128  PRO PRO A . n 
A 1 35  ALA 35  129  129  ALA ALA A . n 
A 1 36  LEU 36  130  130  LEU LEU A . n 
A 1 37  ASN 37  131  131  ASN ASN A . n 
A 1 38  LYS 38  132  132  LYS LYS A . n 
A 1 39  MET 39  133  133  MET MET A . n 
A 1 40  PHE 40  134  134  PHE PHE A . n 
A 1 41  CYS 41  135  135  CYS CYS A . n 
A 1 42  GLN 42  136  136  GLN GLN A . n 
A 1 43  LEU 43  137  137  LEU LEU A . n 
A 1 44  ALA 44  138  138  ALA ALA A . n 
A 1 45  LYS 45  139  139  LYS LYS A . n 
A 1 46  THR 46  140  140  THR THR A . n 
A 1 47  CYS 47  141  141  CYS CYS A . n 
A 1 48  PRO 48  142  142  PRO PRO A . n 
A 1 49  VAL 49  143  143  VAL VAL A . n 
A 1 50  GLN 50  144  144  GLN GLN A . n 
A 1 51  LEU 51  145  145  LEU LEU A . n 
A 1 52  TRP 52  146  146  TRP TRP A . n 
A 1 53  VAL 53  147  147  VAL VAL A . n 
A 1 54  ASP 54  148  148  ASP ASP A . n 
A 1 55  SER 55  149  149  SER SER A . n 
A 1 56  THR 56  150  150  THR THR A . n 
A 1 57  PRO 57  151  151  PRO PRO A . n 
A 1 58  PRO 58  152  152  PRO PRO A . n 
A 1 59  PRO 59  153  153  PRO PRO A . n 
A 1 60  GLY 60  154  154  GLY GLY A . n 
A 1 61  THR 61  155  155  THR THR A . n 
A 1 62  ARG 62  156  156  ARG ARG A . n 
A 1 63  VAL 63  157  157  VAL VAL A . n 
A 1 64  ARG 64  158  158  ARG ARG A . n 
A 1 65  ALA 65  159  159  ALA ALA A . n 
A 1 66  MET 66  160  160  MET MET A . n 
A 1 67  ALA 67  161  161  ALA ALA A . n 
A 1 68  ILE 68  162  162  ILE ILE A . n 
A 1 69  TYR 69  163  163  TYR TYR A . n 
A 1 70  LYS 70  164  164  LYS LYS A . n 
A 1 71  GLN 71  165  165  GLN GLN A . n 
A 1 72  SER 72  166  166  SER SER A . n 
A 1 73  GLN 73  167  167  GLN GLN A . n 
A 1 74  HIS 74  168  168  HIS HIS A . n 
A 1 75  MET 75  169  169  MET MET A . n 
A 1 76  THR 76  170  170  THR THR A . n 
A 1 77  GLU 77  171  171  GLU GLU A . n 
A 1 78  VAL 78  172  172  VAL VAL A . n 
A 1 79  VAL 79  173  173  VAL VAL A . n 
A 1 80  ARG 80  174  174  ARG ARG A . n 
A 1 81  ARG 81  175  175  ARG ARG A . n 
A 1 82  CYS 82  176  176  CYS CYS A . n 
A 1 83  PRO 83  177  177  PRO PRO A . n 
A 1 84  HIS 84  178  178  HIS HIS A . n 
A 1 85  HIS 85  179  179  HIS HIS A . n 
A 1 86  GLU 86  180  180  GLU GLU A . n 
A 1 87  ARG 87  181  181  ARG ARG A . n 
A 1 88  CYS 88  182  182  CYS CYS A . n 
A 1 89  SER 89  183  ?    ?   ?   A . n 
A 1 90  ASP 90  184  ?    ?   ?   A . n 
A 1 91  SER 91  185  ?    ?   ?   A . n 
A 1 92  ASP 92  186  ?    ?   ?   A . n 
A 1 93  GLY 93  187  ?    ?   ?   A . n 
A 1 94  LEU 94  188  ?    ?   ?   A . n 
A 1 95  ALA 95  189  189  ALA ALA A . n 
A 1 96  PRO 96  190  190  PRO PRO A . n 
A 1 97  PRO 97  191  191  PRO PRO A . n 
A 1 98  GLN 98  192  192  GLN GLN A . n 
A 1 99  HIS 99  193  193  HIS HIS A . n 
A 1 100 LEU 100 194  194  LEU LEU A . n 
A 1 101 ILE 101 195  195  ILE ILE A . n 
A 1 102 ARG 102 196  196  ARG ARG A . n 
A 1 103 VAL 103 197  197  VAL VAL A . n 
A 1 104 GLU 104 198  198  GLU GLU A . n 
A 1 105 GLY 105 199  199  GLY GLY A . n 
A 1 106 ASN 106 200  ?    ?   ?   A . n 
A 1 107 LEU 107 201  201  LEU LEU A . n 
A 1 108 ARG 108 202  202  ARG ARG A . n 
A 1 109 VAL 109 203  203  VAL VAL A . n 
A 1 110 GLU 110 204  204  GLU GLU A . n 
A 1 111 TYR 111 205  205  TYR TYR A . n 
A 1 112 LEU 112 206  206  LEU LEU A . n 
A 1 113 ASP 113 207  207  ASP ASP A . n 
A 1 114 ASP 114 208  208  ASP ASP A . n 
A 1 115 ARG 115 209  209  ARG ARG A . n 
A 1 116 ASN 116 210  210  ASN ASN A . n 
A 1 117 THR 117 211  211  THR THR A . n 
A 1 118 PHE 118 212  212  PHE PHE A . n 
A 1 119 ARG 119 213  213  ARG ARG A . n 
A 1 120 HIS 120 214  214  HIS HIS A . n 
A 1 121 SER 121 215  215  SER SER A . n 
A 1 122 VAL 122 216  216  VAL VAL A . n 
A 1 123 VAL 123 217  217  VAL VAL A . n 
A 1 124 VAL 124 218  218  VAL VAL A . n 
A 1 125 PRO 125 219  219  PRO PRO A . n 
A 1 126 TYR 126 220  220  TYR TYR A . n 
A 1 127 GLU 127 221  221  GLU GLU A . n 
A 1 128 PRO 128 222  222  PRO PRO A . n 
A 1 129 PRO 129 223  223  PRO PRO A . n 
A 1 130 GLU 130 224  ?    ?   ?   A . n 
A 1 131 VAL 131 225  ?    ?   ?   A . n 
A 1 132 GLY 132 226  ?    ?   ?   A . n 
A 1 133 SER 133 227  ?    ?   ?   A . n 
A 1 134 GLU 134 228  228  GLU GLU A . n 
A 1 135 CYS 135 229  229  CYS CYS A . n 
A 1 136 THR 136 230  230  THR THR A . n 
A 1 137 THR 137 231  231  THR THR A . n 
A 1 138 ILE 138 232  232  ILE ILE A . n 
A 1 139 HIS 139 233  233  HIS HIS A . n 
A 1 140 TYR 140 234  234  TYR TYR A . n 
A 1 141 ASN 141 235  235  ASN ASN A . n 
A 1 142 TYR 142 236  236  TYR TYR A . n 
A 1 143 MET 143 237  237  MET MET A . n 
A 1 144 CYS 144 238  238  CYS CYS A . n 
A 1 145 ASN 145 239  239  ASN ASN A . n 
A 1 146 SER 146 240  240  SER SER A . n 
A 1 147 SER 147 241  241  SER SER A . n 
A 1 148 CYS 148 242  242  CYS CYS A . n 
A 1 149 MET 149 243  243  MET MET A . n 
A 1 150 GLY 150 244  244  GLY GLY A . n 
A 1 151 GLY 151 245  245  GLY GLY A . n 
A 1 152 MET 152 246  246  MET MET A . n 
A 1 153 ASN 153 247  247  ASN ASN A . n 
A 1 154 ARG 154 248  248  ARG ARG A . n 
A 1 155 ARG 155 249  249  ARG ARG A . n 
A 1 156 PRO 156 250  250  PRO PRO A . n 
A 1 157 ILE 157 251  251  ILE ILE A . n 
A 1 158 LEU 158 252  252  LEU LEU A . n 
A 1 159 THR 159 253  253  THR THR A . n 
A 1 160 ILE 160 254  254  ILE ILE A . n 
A 1 161 ILE 161 255  255  ILE ILE A . n 
A 1 162 THR 162 256  256  THR THR A . n 
A 1 163 LEU 163 257  257  LEU LEU A . n 
A 1 164 GLU 164 258  258  GLU GLU A . n 
A 1 165 ASP 165 259  259  ASP ASP A . n 
A 1 166 SER 166 260  260  SER SER A . n 
A 1 167 SER 167 261  261  SER SER A . n 
A 1 168 GLY 168 262  262  GLY GLY A . n 
A 1 169 ASN 169 263  263  ASN ASN A . n 
A 1 170 LEU 170 264  264  LEU LEU A . n 
A 1 171 LEU 171 265  265  LEU LEU A . n 
A 1 172 GLY 172 266  266  GLY GLY A . n 
A 1 173 ARG 173 267  267  ARG ARG A . n 
A 1 174 ASN 174 268  268  ASN ASN A . n 
A 1 175 SER 175 269  269  SER SER A . n 
A 1 176 PHE 176 270  270  PHE PHE A . n 
A 1 177 GLU 177 271  271  GLU GLU A . n 
A 1 178 VAL 178 272  272  VAL VAL A . n 
A 1 179 ARG 179 273  273  ARG ARG A . n 
A 1 180 VAL 180 274  274  VAL VAL A . n 
A 1 181 CYS 181 275  275  CYS CYS A . n 
A 1 182 ALA 182 276  276  ALA ALA A . n 
A 1 183 CYS 183 277  277  CYS CYS A . n 
A 1 184 PRO 184 278  278  PRO PRO A . n 
A 1 185 GLY 185 279  279  GLY GLY A . n 
A 1 186 ARG 186 280  280  ARG ARG A . n 
A 1 187 ASP 187 281  281  ASP ASP A . n 
A 1 188 ARG 188 282  282  ARG ARG A . n 
A 1 189 ARG 189 283  283  ARG ARG A . n 
A 1 190 THR 190 284  284  THR THR A . n 
A 1 191 GLU 191 285  285  GLU GLU A . n 
A 1 192 GLU 192 286  286  GLU GLU A . n 
A 1 193 GLU 193 287  287  GLU GLU A . n 
A 1 194 ASN 194 288  288  ASN ASN A . n 
A 1 195 LEU 195 289  289  LEU LEU A . n 
A 1 196 ARG 196 290  290  ARG ARG A . n 
A 1 197 LYS 197 291  291  LYS LYS A . n 
A 1 198 LYS 198 292  292  LYS LYS A . n 
B 2 1   LEU 1   1724 1724 LEU LEU B . n 
B 2 2   ASN 2   1725 1725 ASN ASN B . n 
B 2 3   LYS 3   1726 1726 LYS LYS B . n 
B 2 4   THR 4   1727 1727 THR THR B . n 
B 2 5   LEU 5   1728 1728 LEU LEU B . n 
B 2 6   PHE 6   1729 1729 PHE PHE B . n 
B 2 7   LEU 7   1730 1730 LEU LEU B . n 
B 2 8   GLY 8   1731 1731 GLY GLY B . n 
B 2 9   TYR 9   1732 1732 TYR TYR B . n 
B 2 10  ALA 10  1733 1733 ALA ALA B . n 
B 2 11  PHE 11  1734 1734 PHE PHE B . n 
B 2 12  LEU 12  1735 1735 LEU LEU B . n 
B 2 13  LEU 13  1736 1736 LEU LEU B . n 
B 2 14  THR 14  1737 1737 THR THR B . n 
B 2 15  MET 15  1738 1738 MET MET B . n 
B 2 16  ALA 16  1739 1739 ALA ALA B . n 
B 2 17  THR 17  1740 1740 THR THR B . n 
B 2 18  THR 18  1741 1741 THR THR B . n 
B 2 19  SER 19  1742 1742 SER SER B . n 
B 2 20  ASP 20  1743 1743 ASP ASP B . n 
B 2 21  LYS 21  1744 1744 LYS LYS B . n 
B 2 22  LEU 22  1745 1745 LEU LEU B . n 
B 2 23  ALA 23  1746 1746 ALA ALA B . n 
B 2 24  SER 24  1747 1747 SER SER B . n 
B 2 25  ARG 25  1748 1748 ARG ARG B . n 
B 2 26  SER 26  1749 1749 SER SER B . n 
B 2 27  LYS 27  1750 ?    ?   ?   B . n 
B 2 28  LEU 28  1751 ?    ?   ?   B . n 
B 2 29  PRO 29  1752 ?    ?   ?   B . n 
B 2 30  ASP 30  1753 ?    ?   ?   B . n 
B 2 31  GLY 31  1754 ?    ?   ?   B . n 
B 2 32  PRO 32  1755 ?    ?   ?   B . n 
B 2 33  THR 33  1756 ?    ?   ?   B . n 
B 2 34  GLY 34  1757 ?    ?   ?   B . n 
B 2 35  SER 35  1758 ?    ?   ?   B . n 
B 2 36  SER 36  1759 ?    ?   ?   B . n 
B 2 37  GLU 37  1760 ?    ?   ?   B . n 
B 2 38  GLU 38  1761 ?    ?   ?   B . n 
B 2 39  GLU 39  1762 ?    ?   ?   B . n 
B 2 40  GLU 40  1763 ?    ?   ?   B . n 
B 2 41  GLU 41  1764 ?    ?   ?   B . n 
B 2 42  PHE 42  1765 ?    ?   ?   B . n 
B 2 43  LEU 43  1766 ?    ?   ?   B . n 
B 2 44  GLU 44  1767 ?    ?   ?   B . n 
B 2 45  ILE 45  1768 ?    ?   ?   B . n 
B 2 46  PRO 46  1769 1769 PRO PRO B . n 
B 2 47  PRO 47  1770 1770 PRO PRO B . n 
B 2 48  PHE 48  1771 1771 PHE PHE B . n 
B 2 49  ASN 49  1772 1772 ASN ASN B . n 
B 2 50  LYS 50  1773 1773 LYS LYS B . n 
B 2 51  GLN 51  1774 1774 GLN GLN B . n 
B 2 52  TYR 52  1775 1775 TYR TYR B . n 
B 2 53  THR 53  1776 1776 THR THR B . n 
B 2 54  GLU 54  1777 1777 GLU GLU B . n 
B 2 55  SER 55  1778 1778 SER SER B . n 
B 2 56  GLN 56  1779 1779 GLN GLN B . n 
B 2 57  LEU 57  1780 1780 LEU LEU B . n 
B 2 58  ARG 58  1781 1781 ARG ARG B . n 
B 2 59  ALA 59  1782 1782 ALA ALA B . n 
B 2 60  GLY 60  1783 1783 GLY GLY B . n 
B 2 61  ALA 61  1784 1784 ALA ALA B . n 
B 2 62  GLY 62  1785 1785 GLY GLY B . n 
B 2 63  TYR 63  1786 1786 TYR TYR B . n 
B 2 64  ILE 64  1787 1787 ILE ILE B . n 
B 2 65  LEU 65  1788 1788 LEU LEU B . n 
B 2 66  GLU 66  1789 1789 GLU GLU B . n 
B 2 67  ASP 67  1790 1790 ASP ASP B . n 
B 2 68  PHE 68  1791 1791 PHE PHE B . n 
B 2 69  ASN 69  1792 1792 ASN ASN B . n 
B 2 70  GLU 70  1793 ?    ?   ?   B . n 
B 2 71  ALA 71  1794 ?    ?   ?   B . n 
B 2 72  GLN 72  1795 ?    ?   ?   B . n 
B 2 73  CYS 73  1796 ?    ?   ?   B . n 
B 2 74  ASN 74  1797 ?    ?   ?   B . n 
B 2 75  THR 75  1798 1798 THR THR B . n 
B 2 76  ALA 76  1799 1799 ALA ALA B . n 
B 2 77  TYR 77  1800 1800 TYR TYR B . n 
B 2 78  GLN 78  1801 1801 GLN GLN B . n 
B 2 79  CYS 79  1802 1802 CYS CYS B . n 
B 2 80  LEU 80  1803 1803 LEU LEU B . n 
B 2 81  LEU 81  1804 1804 LEU LEU B . n 
B 2 82  ILE 82  1805 1805 ILE ILE B . n 
B 2 83  ALA 83  1806 1806 ALA ALA B . n 
B 2 84  ASP 84  1807 1807 ASP ASP B . n 
B 2 85  GLN 85  1808 1808 GLN GLN B . n 
B 2 86  HIS 86  1809 1809 HIS HIS B . n 
B 2 87  CYS 87  1810 1810 CYS CYS B . n 
B 2 88  ARG 88  1811 1811 ARG ARG B . n 
B 2 89  THR 89  1812 1812 THR THR B . n 
B 2 90  ARG 90  1813 1813 ARG ARG B . n 
B 2 91  LYS 91  1814 1814 LYS LYS B . n 
B 2 92  TYR 92  1815 1815 TYR TYR B . n 
B 2 93  PHE 93  1816 1816 PHE PHE B . n 
B 2 94  LEU 94  1817 1817 LEU LEU B . n 
B 2 95  CYS 95  1818 1818 CYS CYS B . n 
B 2 96  LEU 96  1819 1819 LEU LEU B . n 
B 2 97  ALA 97  1820 1820 ALA ALA B . n 
B 2 98  SER 98  1821 1821 SER SER B . n 
B 2 99  GLY 99  1822 1822 GLY GLY B . n 
B 2 100 ILE 100 1823 1823 ILE ILE B . n 
B 2 101 PRO 101 1824 1824 PRO PRO B . n 
B 2 102 CYS 102 1825 1825 CYS CYS B . n 
B 2 103 VAL 103 1826 1826 VAL VAL B . n 
B 2 104 SER 104 1827 1827 SER SER B . n 
B 2 105 HIS 105 1828 1828 HIS HIS B . n 
B 2 106 VAL 106 1829 1829 VAL VAL B . n 
B 2 107 TRP 107 1830 1830 TRP TRP B . n 
B 2 108 VAL 108 1831 1831 VAL VAL B . n 
B 2 109 HIS 109 1832 1832 HIS HIS B . n 
B 2 110 ASP 110 1833 1833 ASP ASP B . n 
B 2 111 SER 111 1834 1834 SER SER B . n 
B 2 112 CYS 112 1835 1835 CYS CYS B . n 
B 2 113 HIS 113 1836 1836 HIS HIS B . n 
B 2 114 ALA 114 1837 1837 ALA ALA B . n 
B 2 115 ASN 115 1838 1838 ASN ASN B . n 
B 2 116 GLN 116 1839 1839 GLN GLN B . n 
B 2 117 LEU 117 1840 1840 LEU LEU B . n 
B 2 118 GLN 118 1841 1841 GLN GLN B . n 
B 2 119 ASN 119 1842 1842 ASN ASN B . n 
B 2 120 TYR 120 1843 1843 TYR TYR B . n 
B 2 121 ARG 121 1844 1844 ARG ARG B . n 
B 2 122 ASN 122 1845 1845 ASN ASN B . n 
B 2 123 TYR 123 1846 1846 TYR TYR B . n 
B 2 124 LEU 124 1847 1847 LEU LEU B . n 
B 2 125 LEU 125 1848 1848 LEU LEU B . n 
B 2 126 PRO 126 1849 1849 PRO PRO B . n 
B 2 127 ALA 127 1850 1850 ALA ALA B . n 
B 2 128 GLY 128 1851 1851 GLY GLY B . n 
B 2 129 TYR 129 1852 1852 TYR TYR B . n 
B 2 130 SER 130 1853 1853 SER SER B . n 
B 2 131 LEU 131 1854 1854 LEU LEU B . n 
B 2 132 GLU 132 1855 1855 GLU GLU B . n 
B 2 133 GLU 133 1856 1856 GLU GLU B . n 
B 2 134 GLN 134 1857 1857 GLN GLN B . n 
B 2 135 ARG 135 1858 1858 ARG ARG B . n 
B 2 136 ILE 136 1859 1859 ILE ILE B . n 
B 2 137 LEU 137 1860 1860 LEU LEU B . n 
B 2 138 ASP 138 1861 1861 ASP ASP B . n 
B 2 139 TRP 139 1862 1862 TRP TRP B . n 
B 2 140 GLN 140 1863 1863 GLN GLN B . n 
B 2 141 PRO 141 1864 1864 PRO PRO B . n 
B 2 142 ARG 142 1865 1865 ARG ARG B . n 
B 2 143 GLU 143 1866 1866 GLU GLU B . n 
B 2 144 ASN 144 1867 1867 ASN ASN B . n 
B 2 145 PRO 145 1868 1868 PRO PRO B . n 
B 2 146 PHE 146 1869 1869 PHE PHE B . n 
B 2 147 GLN 147 1870 1870 GLN GLN B . n 
B 2 148 ASN 148 1871 1871 ASN ASN B . n 
B 2 149 LEU 149 1872 1872 LEU LEU B . n 
B 2 150 LYS 150 1873 1873 LYS LYS B . n 
B 2 151 VAL 151 1874 1874 VAL VAL B . n 
B 2 152 LEU 152 1875 1875 LEU LEU B . n 
B 2 153 LEU 153 1876 1876 LEU LEU B . n 
B 2 154 VAL 154 1877 1877 VAL VAL B . n 
B 2 155 SER 155 1878 1878 SER SER B . n 
B 2 156 ASP 156 1879 1879 ASP ASP B . n 
B 2 157 GLN 157 1880 1880 GLN GLN B . n 
B 2 158 GLN 158 1881 1881 GLN GLN B . n 
B 2 159 GLN 159 1882 1882 GLN GLN B . n 
B 2 160 ASN 160 1883 1883 ASN ASN B . n 
B 2 161 PHE 161 1884 1884 PHE PHE B . n 
B 2 162 LEU 162 1885 1885 LEU LEU B . n 
B 2 163 GLU 163 1886 1886 GLU GLU B . n 
B 2 164 LEU 164 1887 1887 LEU LEU B . n 
B 2 165 TRP 165 1888 1888 TRP TRP B . n 
B 2 166 SER 166 1889 1889 SER SER B . n 
B 2 167 GLU 167 1890 1890 GLU GLU B . n 
B 2 168 ILE 168 1891 1891 ILE ILE B . n 
B 2 169 LEU 169 1892 1892 LEU LEU B . n 
B 2 170 MET 170 1893 1893 MET MET B . n 
B 2 171 THR 171 1894 1894 THR THR B . n 
B 2 172 GLY 172 1895 1895 GLY GLY B . n 
B 2 173 GLY 173 1896 1896 GLY GLY B . n 
B 2 174 ALA 174 1897 1897 ALA ALA B . n 
B 2 175 ALA 175 1898 1898 ALA ALA B . n 
B 2 176 SER 176 1899 1899 SER SER B . n 
B 2 177 VAL 177 1900 1900 VAL VAL B . n 
B 2 178 LYS 178 1901 1901 LYS LYS B . n 
B 2 179 GLN 179 1902 1902 GLN GLN B . n 
B 2 180 HIS 180 1903 1903 HIS HIS B . n 
B 2 181 HIS 181 1904 1904 HIS HIS B . n 
B 2 182 SER 182 1905 1905 SER SER B . n 
B 2 183 SER 183 1906 1906 SER SER B . n 
B 2 184 ALA 184 1907 1907 ALA ALA B . n 
B 2 185 HIS 185 1908 1908 HIS HIS B . n 
B 2 186 ASN 186 1909 1909 ASN ASN B . n 
B 2 187 LYS 187 1910 1910 LYS LYS B . n 
B 2 188 ASP 188 1911 1911 ASP ASP B . n 
B 2 189 ILE 189 1912 1912 ILE ILE B . n 
B 2 190 ALA 190 1913 1913 ALA ALA B . n 
B 2 191 LEU 191 1914 1914 LEU LEU B . n 
B 2 192 GLY 192 1915 1915 GLY GLY B . n 
B 2 193 VAL 193 1916 1916 VAL VAL B . n 
B 2 194 PHE 194 1917 1917 PHE PHE B . n 
B 2 195 ASP 195 1918 1918 ASP ASP B . n 
B 2 196 VAL 196 1919 1919 VAL VAL B . n 
B 2 197 VAL 197 1920 1920 VAL VAL B . n 
B 2 198 VAL 198 1921 1921 VAL VAL B . n 
B 2 199 THR 199 1922 1922 THR THR B . n 
B 2 200 ASP 200 1923 1923 ASP ASP B . n 
B 2 201 PRO 201 1924 1924 PRO PRO B . n 
B 2 202 SER 202 1925 1925 SER SER B . n 
B 2 203 CYS 203 1926 1926 CYS CYS B . n 
B 2 204 PRO 204 1927 1927 PRO PRO B . n 
B 2 205 ALA 205 1928 1928 ALA ALA B . n 
B 2 206 SER 206 1929 1929 SER SER B . n 
B 2 207 VAL 207 1930 1930 VAL VAL B . n 
B 2 208 LEU 208 1931 1931 LEU LEU B . n 
B 2 209 LYS 209 1932 1932 LYS LYS B . n 
B 2 210 CYS 210 1933 1933 CYS CYS B . n 
B 2 211 ALA 211 1934 1934 ALA ALA B . n 
B 2 212 GLU 212 1935 1935 GLU GLU B . n 
B 2 213 ALA 213 1936 1936 ALA ALA B . n 
B 2 214 LEU 214 1937 1937 LEU LEU B . n 
B 2 215 GLN 215 1938 1938 GLN GLN B . n 
B 2 216 LEU 216 1939 1939 LEU LEU B . n 
B 2 217 PRO 217 1940 1940 PRO PRO B . n 
B 2 218 VAL 218 1941 1941 VAL VAL B . n 
B 2 219 VAL 219 1942 1942 VAL VAL B . n 
B 2 220 SER 220 1943 1943 SER SER B . n 
B 2 221 GLN 221 1944 1944 GLN GLN B . n 
B 2 222 GLU 222 1945 1945 GLU GLU B . n 
B 2 223 TRP 223 1946 1946 TRP TRP B . n 
B 2 224 VAL 224 1947 1947 VAL VAL B . n 
B 2 225 ILE 225 1948 1948 ILE ILE B . n 
B 2 226 GLN 226 1949 1949 GLN GLN B . n 
B 2 227 CYS 227 1950 1950 CYS CYS B . n 
B 2 228 LEU 228 1951 1951 LEU LEU B . n 
B 2 229 ILE 229 1952 1952 ILE ILE B . n 
B 2 230 VAL 230 1953 1953 VAL VAL B . n 
B 2 231 GLY 231 1954 1954 GLY GLY B . n 
B 2 232 GLU 232 1955 1955 GLU GLU B . n 
B 2 233 ARG 233 1956 1956 ARG ARG B . n 
B 2 234 ILE 234 1957 1957 ILE ILE B . n 
B 2 235 GLY 235 1958 1958 GLY GLY B . n 
B 2 236 PHE 236 1959 1959 PHE PHE B . n 
B 2 237 LYS 237 1960 1960 LYS LYS B . n 
B 2 238 GLN 238 1961 1961 GLN GLN B . n 
B 2 239 HIS 239 1962 1962 HIS HIS B . n 
B 2 240 PRO 240 1963 1963 PRO PRO B . n 
B 2 241 LYS 241 1964 1964 LYS LYS B . n 
B 2 242 TYR 242 1965 1965 TYR TYR B . n 
B 2 243 LYS 243 1966 1966 LYS LYS B . n 
B 2 244 HIS 244 1967 1967 HIS HIS B . n 
B 2 245 ASP 245 1968 1968 ASP ASP B . n 
B 2 246 TYR 246 1969 1969 TYR TYR B . n 
B 2 247 VAL 247 1970 1970 VAL VAL B . n 
B 2 248 SER 248 1971 1971 SER SER B . n 
B 2 249 HIS 249 1972 1972 HIS HIS B . n 
C 3 1   SER 1   95   95   SER SER C . n 
C 3 2   SER 2   96   96   SER SER C . n 
C 3 3   VAL 3   97   97   VAL VAL C . n 
C 3 4   PRO 4   98   98   PRO PRO C . n 
C 3 5   SER 5   99   99   SER SER C . n 
C 3 6   GLN 6   100  100  GLN GLN C . n 
C 3 7   LYS 7   101  101  LYS LYS C . n 
C 3 8   THR 8   102  102  THR THR C . n 
C 3 9   TYR 9   103  103  TYR TYR C . n 
C 3 10  GLN 10  104  104  GLN GLN C . n 
C 3 11  GLY 11  105  105  GLY GLY C . n 
C 3 12  SER 12  106  106  SER SER C . n 
C 3 13  TYR 13  107  107  TYR TYR C . n 
C 3 14  GLY 14  108  108  GLY GLY C . n 
C 3 15  PHE 15  109  109  PHE PHE C . n 
C 3 16  ARG 16  110  110  ARG ARG C . n 
C 3 17  LEU 17  111  111  LEU LEU C . n 
C 3 18  GLY 18  112  112  GLY GLY C . n 
C 3 19  PHE 19  113  113  PHE PHE C . n 
C 3 20  LEU 20  114  114  LEU LEU C . n 
C 3 21  HIS 21  115  115  HIS HIS C . n 
C 3 22  SER 22  116  116  SER SER C . n 
C 3 23  GLY 23  117  117  GLY GLY C . n 
C 3 24  THR 24  118  118  THR THR C . n 
C 3 25  ALA 25  119  119  ALA ALA C . n 
C 3 26  LYS 26  120  120  LYS LYS C . n 
C 3 27  SER 27  121  121  SER SER C . n 
C 3 28  VAL 28  122  122  VAL VAL C . n 
C 3 29  THR 29  123  123  THR THR C . n 
C 3 30  CYS 30  124  124  CYS CYS C . n 
C 3 31  THR 31  125  125  THR THR C . n 
C 3 32  TYR 32  126  126  TYR TYR C . n 
C 3 33  SER 33  127  127  SER SER C . n 
C 3 34  PRO 34  128  128  PRO PRO C . n 
C 3 35  ALA 35  129  129  ALA ALA C . n 
C 3 36  LEU 36  130  130  LEU LEU C . n 
C 3 37  ASN 37  131  131  ASN ASN C . n 
C 3 38  LYS 38  132  132  LYS LYS C . n 
C 3 39  MET 39  133  133  MET MET C . n 
C 3 40  PHE 40  134  134  PHE PHE C . n 
C 3 41  CYS 41  135  135  CYS CYS C . n 
C 3 42  GLN 42  136  136  GLN GLN C . n 
C 3 43  LEU 43  137  137  LEU LEU C . n 
C 3 44  ALA 44  138  138  ALA ALA C . n 
C 3 45  LYS 45  139  139  LYS LYS C . n 
C 3 46  THR 46  140  140  THR THR C . n 
C 3 47  CYS 47  141  141  CYS CYS C . n 
C 3 48  PRO 48  142  142  PRO PRO C . n 
C 3 49  VAL 49  143  143  VAL VAL C . n 
C 3 50  GLN 50  144  144  GLN GLN C . n 
C 3 51  LEU 51  145  145  LEU LEU C . n 
C 3 52  TRP 52  146  146  TRP TRP C . n 
C 3 53  VAL 53  147  147  VAL VAL C . n 
C 3 54  ASP 54  148  148  ASP ASP C . n 
C 3 55  SER 55  149  149  SER SER C . n 
C 3 56  THR 56  150  150  THR THR C . n 
C 3 57  PRO 57  151  151  PRO PRO C . n 
C 3 58  PRO 58  152  152  PRO PRO C . n 
C 3 59  PRO 59  153  153  PRO PRO C . n 
C 3 60  GLY 60  154  154  GLY GLY C . n 
C 3 61  THR 61  155  155  THR THR C . n 
C 3 62  ARG 62  156  156  ARG ARG C . n 
C 3 63  VAL 63  157  157  VAL VAL C . n 
C 3 64  ARG 64  158  158  ARG ARG C . n 
C 3 65  ALA 65  159  159  ALA ALA C . n 
C 3 66  MET 66  160  160  MET MET C . n 
C 3 67  ALA 67  161  161  ALA ALA C . n 
C 3 68  ILE 68  162  162  ILE ILE C . n 
C 3 69  TYR 69  163  163  TYR TYR C . n 
C 3 70  LYS 70  164  164  LYS LYS C . n 
C 3 71  GLN 71  165  165  GLN GLN C . n 
C 3 72  SER 72  166  166  SER SER C . n 
C 3 73  GLN 73  167  167  GLN GLN C . n 
C 3 74  HIS 74  168  168  HIS HIS C . n 
C 3 75  MET 75  169  169  MET MET C . n 
C 3 76  THR 76  170  170  THR THR C . n 
C 3 77  GLU 77  171  171  GLU GLU C . n 
C 3 78  VAL 78  172  172  VAL VAL C . n 
C 3 79  VAL 79  173  173  VAL VAL C . n 
C 3 80  ARG 80  174  174  ARG ARG C . n 
C 3 81  ARG 81  175  175  ARG ARG C . n 
C 3 82  CYS 82  176  176  CYS CYS C . n 
C 3 83  PRO 83  177  177  PRO PRO C . n 
C 3 84  HIS 84  178  178  HIS HIS C . n 
C 3 85  HIS 85  179  179  HIS HIS C . n 
C 3 86  GLU 86  180  180  GLU GLU C . n 
C 3 87  ARG 87  181  181  ARG ARG C . n 
C 3 88  CYS 88  182  182  CYS CYS C . n 
C 3 89  SER 89  183  183  SER SER C . n 
C 3 90  ASP 90  184  184  ASP ASP C . n 
C 3 91  SER 91  185  185  SER SER C . n 
C 3 92  ASP 92  186  186  ASP ASP C . n 
C 3 93  GLY 93  187  187  GLY GLY C . n 
C 3 94  LEU 94  188  188  LEU LEU C . n 
C 3 95  ALA 95  189  189  ALA ALA C . n 
C 3 96  PRO 96  190  190  PRO PRO C . n 
C 3 97  PRO 97  191  191  PRO PRO C . n 
C 3 98  GLN 98  192  192  GLN GLN C . n 
C 3 99  HIS 99  193  193  HIS HIS C . n 
C 3 100 LEU 100 194  194  LEU LEU C . n 
C 3 101 ILE 101 195  195  ILE ILE C . n 
C 3 102 ARG 102 196  196  ARG ARG C . n 
C 3 103 VAL 103 197  197  VAL VAL C . n 
C 3 104 GLU 104 198  198  GLU GLU C . n 
C 3 105 GLY 105 199  199  GLY GLY C . n 
C 3 106 ASN 106 200  200  ASN ASN C . n 
C 3 107 LEU 107 201  201  LEU LEU C . n 
C 3 108 ARG 108 202  202  ARG ARG C . n 
C 3 109 VAL 109 203  203  VAL VAL C . n 
C 3 110 GLU 110 204  204  GLU GLU C . n 
C 3 111 TYR 111 205  205  TYR TYR C . n 
C 3 112 LEU 112 206  206  LEU LEU C . n 
C 3 113 ASP 113 207  207  ASP ASP C . n 
C 3 114 ASP 114 208  208  ASP ASP C . n 
C 3 115 ARG 115 209  209  ARG ARG C . n 
C 3 116 ASN 116 210  210  ASN ASN C . n 
C 3 117 THR 117 211  211  THR THR C . n 
C 3 118 PHE 118 212  212  PHE PHE C . n 
C 3 119 ARG 119 213  213  ARG ARG C . n 
C 3 120 HIS 120 214  214  HIS HIS C . n 
C 3 121 SER 121 215  215  SER SER C . n 
C 3 122 VAL 122 216  216  VAL VAL C . n 
C 3 123 VAL 123 217  217  VAL VAL C . n 
C 3 124 VAL 124 218  218  VAL VAL C . n 
C 3 125 PRO 125 219  219  PRO PRO C . n 
C 3 126 TYR 126 220  220  TYR TYR C . n 
C 3 127 GLU 127 221  221  GLU GLU C . n 
C 3 128 PRO 128 222  222  PRO PRO C . n 
C 3 129 PRO 129 223  223  PRO PRO C . n 
C 3 130 GLU 130 224  224  GLU GLU C . n 
C 3 131 VAL 131 225  225  VAL VAL C . n 
C 3 132 GLY 132 226  226  GLY GLY C . n 
C 3 133 SER 133 227  227  SER SER C . n 
C 3 134 ASP 134 228  228  ASP ASP C . n 
C 3 135 CYS 135 229  229  CYS CYS C . n 
C 3 136 THR 136 230  230  THR THR C . n 
C 3 137 THR 137 231  231  THR THR C . n 
C 3 138 ILE 138 232  232  ILE ILE C . n 
C 3 139 HIS 139 233  233  HIS HIS C . n 
C 3 140 TYR 140 234  234  TYR TYR C . n 
C 3 141 ASN 141 235  235  ASN ASN C . n 
C 3 142 TYR 142 236  236  TYR TYR C . n 
C 3 143 MET 143 237  237  MET MET C . n 
C 3 144 CYS 144 238  238  CYS CYS C . n 
C 3 145 ASN 145 239  239  ASN ASN C . n 
C 3 146 SER 146 240  240  SER SER C . n 
C 3 147 SER 147 241  241  SER SER C . n 
C 3 148 CYS 148 242  242  CYS CYS C . n 
C 3 149 MET 149 243  243  MET MET C . n 
C 3 150 GLY 150 244  244  GLY GLY C . n 
C 3 151 GLY 151 245  245  GLY GLY C . n 
C 3 152 MET 152 246  246  MET MET C . n 
C 3 153 ASN 153 247  247  ASN ASN C . n 
C 3 154 ARG 154 248  248  ARG ARG C . n 
C 3 155 ARG 155 249  249  ARG ARG C . n 
C 3 156 PRO 156 250  250  PRO PRO C . n 
C 3 157 ILE 157 251  251  ILE ILE C . n 
C 3 158 LEU 158 252  252  LEU LEU C . n 
C 3 159 THR 159 253  253  THR THR C . n 
C 3 160 ILE 160 254  254  ILE ILE C . n 
C 3 161 ILE 161 255  255  ILE ILE C . n 
C 3 162 THR 162 256  256  THR THR C . n 
C 3 163 LEU 163 257  257  LEU LEU C . n 
C 3 164 GLU 164 258  258  GLU GLU C . n 
C 3 165 ASP 165 259  259  ASP ASP C . n 
C 3 166 SER 166 260  260  SER SER C . n 
C 3 167 SER 167 261  261  SER SER C . n 
C 3 168 GLY 168 262  262  GLY GLY C . n 
C 3 169 ASN 169 263  263  ASN ASN C . n 
C 3 170 LEU 170 264  264  LEU LEU C . n 
C 3 171 LEU 171 265  265  LEU LEU C . n 
C 3 172 GLY 172 266  266  GLY GLY C . n 
C 3 173 ARG 173 267  267  ARG ARG C . n 
C 3 174 ASN 174 268  268  ASN ASN C . n 
C 3 175 SER 175 269  269  SER SER C . n 
C 3 176 PHE 176 270  270  PHE PHE C . n 
C 3 177 GLU 177 271  271  GLU GLU C . n 
C 3 178 VAL 178 272  272  VAL VAL C . n 
C 3 179 ARG 179 273  273  ARG ARG C . n 
C 3 180 VAL 180 274  274  VAL VAL C . n 
C 3 181 CYS 181 275  275  CYS CYS C . n 
C 3 182 ALA 182 276  276  ALA ALA C . n 
C 3 183 CYS 183 277  277  CYS CYS C . n 
C 3 184 PRO 184 278  278  PRO PRO C . n 
C 3 185 GLY 185 279  279  GLY GLY C . n 
C 3 186 ARG 186 280  280  ARG ARG C . n 
C 3 187 ASP 187 281  281  ASP ASP C . n 
C 3 188 ARG 188 282  282  ARG ARG C . n 
C 3 189 ARG 189 283  283  ARG ARG C . n 
C 3 190 THR 190 284  284  THR THR C . n 
C 3 191 GLU 191 285  285  GLU GLU C . n 
C 3 192 GLU 192 286  286  GLU GLU C . n 
C 3 193 GLU 193 287  287  GLU GLU C . n 
C 3 194 ASN 194 288  288  ASN ASN C . n 
C 3 195 LEU 195 289  289  LEU LEU C . n 
C 3 196 ARG 196 290  290  ARG ARG C . n 
C 3 197 LYS 197 291  ?    ?   ?   C . n 
C 3 198 LYS 198 292  ?    ?   ?   C . n 
D 2 1   LEU 1   1724 ?    ?   ?   D . n 
D 2 2   ASN 2   1725 1725 ASN ASN D . n 
D 2 3   LYS 3   1726 1726 LYS LYS D . n 
D 2 4   THR 4   1727 1727 THR THR D . n 
D 2 5   LEU 5   1728 1728 LEU LEU D . n 
D 2 6   PHE 6   1729 1729 PHE PHE D . n 
D 2 7   LEU 7   1730 1730 LEU LEU D . n 
D 2 8   GLY 8   1731 1731 GLY GLY D . n 
D 2 9   TYR 9   1732 1732 TYR TYR D . n 
D 2 10  ALA 10  1733 1733 ALA ALA D . n 
D 2 11  PHE 11  1734 1734 PHE PHE D . n 
D 2 12  LEU 12  1735 1735 LEU LEU D . n 
D 2 13  LEU 13  1736 1736 LEU LEU D . n 
D 2 14  THR 14  1737 1737 THR THR D . n 
D 2 15  MET 15  1738 1738 MET MET D . n 
D 2 16  ALA 16  1739 1739 ALA ALA D . n 
D 2 17  THR 17  1740 1740 THR THR D . n 
D 2 18  THR 18  1741 ?    ?   ?   D . n 
D 2 19  SER 19  1742 ?    ?   ?   D . n 
D 2 20  ASP 20  1743 ?    ?   ?   D . n 
D 2 21  LYS 21  1744 ?    ?   ?   D . n 
D 2 22  LEU 22  1745 ?    ?   ?   D . n 
D 2 23  ALA 23  1746 ?    ?   ?   D . n 
D 2 24  SER 24  1747 ?    ?   ?   D . n 
D 2 25  ARG 25  1748 ?    ?   ?   D . n 
D 2 26  SER 26  1749 ?    ?   ?   D . n 
D 2 27  LYS 27  1750 ?    ?   ?   D . n 
D 2 28  LEU 28  1751 ?    ?   ?   D . n 
D 2 29  PRO 29  1752 ?    ?   ?   D . n 
D 2 30  ASP 30  1753 ?    ?   ?   D . n 
D 2 31  GLY 31  1754 ?    ?   ?   D . n 
D 2 32  PRO 32  1755 ?    ?   ?   D . n 
D 2 33  THR 33  1756 ?    ?   ?   D . n 
D 2 34  GLY 34  1757 ?    ?   ?   D . n 
D 2 35  SER 35  1758 ?    ?   ?   D . n 
D 2 36  SER 36  1759 ?    ?   ?   D . n 
D 2 37  GLU 37  1760 ?    ?   ?   D . n 
D 2 38  GLU 38  1761 ?    ?   ?   D . n 
D 2 39  GLU 39  1762 ?    ?   ?   D . n 
D 2 40  GLU 40  1763 ?    ?   ?   D . n 
D 2 41  GLU 41  1764 ?    ?   ?   D . n 
D 2 42  PHE 42  1765 ?    ?   ?   D . n 
D 2 43  LEU 43  1766 ?    ?   ?   D . n 
D 2 44  GLU 44  1767 ?    ?   ?   D . n 
D 2 45  ILE 45  1768 ?    ?   ?   D . n 
D 2 46  PRO 46  1769 ?    ?   ?   D . n 
D 2 47  PRO 47  1770 ?    ?   ?   D . n 
D 2 48  PHE 48  1771 1771 PHE PHE D . n 
D 2 49  ASN 49  1772 1772 ASN ASN D . n 
D 2 50  LYS 50  1773 1773 LYS LYS D . n 
D 2 51  GLN 51  1774 1774 GLN GLN D . n 
D 2 52  TYR 52  1775 1775 TYR TYR D . n 
D 2 53  THR 53  1776 1776 THR THR D . n 
D 2 54  GLU 54  1777 1777 GLU GLU D . n 
D 2 55  SER 55  1778 1778 SER SER D . n 
D 2 56  GLN 56  1779 1779 GLN GLN D . n 
D 2 57  LEU 57  1780 1780 LEU LEU D . n 
D 2 58  ARG 58  1781 1781 ARG ARG D . n 
D 2 59  ALA 59  1782 1782 ALA ALA D . n 
D 2 60  GLY 60  1783 1783 GLY GLY D . n 
D 2 61  ALA 61  1784 1784 ALA ALA D . n 
D 2 62  GLY 62  1785 1785 GLY GLY D . n 
D 2 63  TYR 63  1786 1786 TYR TYR D . n 
D 2 64  ILE 64  1787 1787 ILE ILE D . n 
D 2 65  LEU 65  1788 1788 LEU LEU D . n 
D 2 66  GLU 66  1789 1789 GLU GLU D . n 
D 2 67  ASP 67  1790 1790 ASP ASP D . n 
D 2 68  PHE 68  1791 1791 PHE PHE D . n 
D 2 69  ASN 69  1792 1792 ASN ASN D . n 
D 2 70  GLU 70  1793 1793 GLU GLU D . n 
D 2 71  ALA 71  1794 ?    ?   ?   D . n 
D 2 72  GLN 72  1795 ?    ?   ?   D . n 
D 2 73  CYS 73  1796 ?    ?   ?   D . n 
D 2 74  ASN 74  1797 1797 ASN ASN D . n 
D 2 75  THR 75  1798 1798 THR THR D . n 
D 2 76  ALA 76  1799 1799 ALA ALA D . n 
D 2 77  TYR 77  1800 1800 TYR TYR D . n 
D 2 78  GLN 78  1801 1801 GLN GLN D . n 
D 2 79  CYS 79  1802 1802 CYS CYS D . n 
D 2 80  LEU 80  1803 1803 LEU LEU D . n 
D 2 81  LEU 81  1804 1804 LEU LEU D . n 
D 2 82  ILE 82  1805 1805 ILE ILE D . n 
D 2 83  ALA 83  1806 1806 ALA ALA D . n 
D 2 84  ASP 84  1807 1807 ASP ASP D . n 
D 2 85  GLN 85  1808 1808 GLN GLN D . n 
D 2 86  HIS 86  1809 1809 HIS HIS D . n 
D 2 87  CYS 87  1810 1810 CYS CYS D . n 
D 2 88  ARG 88  1811 1811 ARG ARG D . n 
D 2 89  THR 89  1812 1812 THR THR D . n 
D 2 90  ARG 90  1813 1813 ARG ARG D . n 
D 2 91  LYS 91  1814 1814 LYS LYS D . n 
D 2 92  TYR 92  1815 1815 TYR TYR D . n 
D 2 93  PHE 93  1816 1816 PHE PHE D . n 
D 2 94  LEU 94  1817 1817 LEU LEU D . n 
D 2 95  CYS 95  1818 1818 CYS CYS D . n 
D 2 96  LEU 96  1819 1819 LEU LEU D . n 
D 2 97  ALA 97  1820 1820 ALA ALA D . n 
D 2 98  SER 98  1821 1821 SER SER D . n 
D 2 99  GLY 99  1822 1822 GLY GLY D . n 
D 2 100 ILE 100 1823 1823 ILE ILE D . n 
D 2 101 PRO 101 1824 1824 PRO PRO D . n 
D 2 102 CYS 102 1825 1825 CYS CYS D . n 
D 2 103 VAL 103 1826 1826 VAL VAL D . n 
D 2 104 SER 104 1827 1827 SER SER D . n 
D 2 105 HIS 105 1828 1828 HIS HIS D . n 
D 2 106 VAL 106 1829 1829 VAL VAL D . n 
D 2 107 TRP 107 1830 1830 TRP TRP D . n 
D 2 108 VAL 108 1831 1831 VAL VAL D . n 
D 2 109 HIS 109 1832 1832 HIS HIS D . n 
D 2 110 ASP 110 1833 1833 ASP ASP D . n 
D 2 111 SER 111 1834 1834 SER SER D . n 
D 2 112 CYS 112 1835 1835 CYS CYS D . n 
D 2 113 HIS 113 1836 1836 HIS HIS D . n 
D 2 114 ALA 114 1837 1837 ALA ALA D . n 
D 2 115 ASN 115 1838 1838 ASN ASN D . n 
D 2 116 GLN 116 1839 1839 GLN GLN D . n 
D 2 117 LEU 117 1840 1840 LEU LEU D . n 
D 2 118 GLN 118 1841 1841 GLN GLN D . n 
D 2 119 ASN 119 1842 1842 ASN ASN D . n 
D 2 120 TYR 120 1843 1843 TYR TYR D . n 
D 2 121 ARG 121 1844 1844 ARG ARG D . n 
D 2 122 ASN 122 1845 1845 ASN ASN D . n 
D 2 123 TYR 123 1846 1846 TYR TYR D . n 
D 2 124 LEU 124 1847 1847 LEU LEU D . n 
D 2 125 LEU 125 1848 1848 LEU LEU D . n 
D 2 126 PRO 126 1849 1849 PRO PRO D . n 
D 2 127 ALA 127 1850 1850 ALA ALA D . n 
D 2 128 GLY 128 1851 1851 GLY GLY D . n 
D 2 129 TYR 129 1852 1852 TYR TYR D . n 
D 2 130 SER 130 1853 1853 SER SER D . n 
D 2 131 LEU 131 1854 1854 LEU LEU D . n 
D 2 132 GLU 132 1855 1855 GLU GLU D . n 
D 2 133 GLU 133 1856 1856 GLU GLU D . n 
D 2 134 GLN 134 1857 1857 GLN GLN D . n 
D 2 135 ARG 135 1858 1858 ARG ARG D . n 
D 2 136 ILE 136 1859 1859 ILE ILE D . n 
D 2 137 LEU 137 1860 1860 LEU LEU D . n 
D 2 138 ASP 138 1861 1861 ASP ASP D . n 
D 2 139 TRP 139 1862 1862 TRP TRP D . n 
D 2 140 GLN 140 1863 1863 GLN GLN D . n 
D 2 141 PRO 141 1864 1864 PRO PRO D . n 
D 2 142 ARG 142 1865 1865 ARG ARG D . n 
D 2 143 GLU 143 1866 1866 GLU GLU D . n 
D 2 144 ASN 144 1867 1867 ASN ASN D . n 
D 2 145 PRO 145 1868 1868 PRO PRO D . n 
D 2 146 PHE 146 1869 1869 PHE PHE D . n 
D 2 147 GLN 147 1870 1870 GLN GLN D . n 
D 2 148 ASN 148 1871 1871 ASN ASN D . n 
D 2 149 LEU 149 1872 1872 LEU LEU D . n 
D 2 150 LYS 150 1873 1873 LYS LYS D . n 
D 2 151 VAL 151 1874 1874 VAL VAL D . n 
D 2 152 LEU 152 1875 1875 LEU LEU D . n 
D 2 153 LEU 153 1876 1876 LEU LEU D . n 
D 2 154 VAL 154 1877 1877 VAL VAL D . n 
D 2 155 SER 155 1878 1878 SER SER D . n 
D 2 156 ASP 156 1879 1879 ASP ASP D . n 
D 2 157 GLN 157 1880 1880 GLN GLN D . n 
D 2 158 GLN 158 1881 1881 GLN GLN D . n 
D 2 159 GLN 159 1882 1882 GLN GLN D . n 
D 2 160 ASN 160 1883 1883 ASN ASN D . n 
D 2 161 PHE 161 1884 1884 PHE PHE D . n 
D 2 162 LEU 162 1885 1885 LEU LEU D . n 
D 2 163 GLU 163 1886 1886 GLU GLU D . n 
D 2 164 LEU 164 1887 1887 LEU LEU D . n 
D 2 165 TRP 165 1888 1888 TRP TRP D . n 
D 2 166 SER 166 1889 1889 SER SER D . n 
D 2 167 GLU 167 1890 1890 GLU GLU D . n 
D 2 168 ILE 168 1891 1891 ILE ILE D . n 
D 2 169 LEU 169 1892 1892 LEU LEU D . n 
D 2 170 MET 170 1893 1893 MET MET D . n 
D 2 171 THR 171 1894 1894 THR THR D . n 
D 2 172 GLY 172 1895 1895 GLY GLY D . n 
D 2 173 GLY 173 1896 1896 GLY GLY D . n 
D 2 174 ALA 174 1897 1897 ALA ALA D . n 
D 2 175 ALA 175 1898 1898 ALA ALA D . n 
D 2 176 SER 176 1899 1899 SER SER D . n 
D 2 177 VAL 177 1900 1900 VAL VAL D . n 
D 2 178 LYS 178 1901 1901 LYS LYS D . n 
D 2 179 GLN 179 1902 1902 GLN GLN D . n 
D 2 180 HIS 180 1903 1903 HIS HIS D . n 
D 2 181 HIS 181 1904 1904 HIS HIS D . n 
D 2 182 SER 182 1905 1905 SER SER D . n 
D 2 183 SER 183 1906 1906 SER SER D . n 
D 2 184 ALA 184 1907 1907 ALA ALA D . n 
D 2 185 HIS 185 1908 1908 HIS HIS D . n 
D 2 186 ASN 186 1909 1909 ASN ASN D . n 
D 2 187 LYS 187 1910 1910 LYS LYS D . n 
D 2 188 ASP 188 1911 1911 ASP ASP D . n 
D 2 189 ILE 189 1912 1912 ILE ILE D . n 
D 2 190 ALA 190 1913 1913 ALA ALA D . n 
D 2 191 LEU 191 1914 1914 LEU LEU D . n 
D 2 192 GLY 192 1915 1915 GLY GLY D . n 
D 2 193 VAL 193 1916 1916 VAL VAL D . n 
D 2 194 PHE 194 1917 1917 PHE PHE D . n 
D 2 195 ASP 195 1918 1918 ASP ASP D . n 
D 2 196 VAL 196 1919 1919 VAL VAL D . n 
D 2 197 VAL 197 1920 1920 VAL VAL D . n 
D 2 198 VAL 198 1921 1921 VAL VAL D . n 
D 2 199 THR 199 1922 1922 THR THR D . n 
D 2 200 ASP 200 1923 1923 ASP ASP D . n 
D 2 201 PRO 201 1924 1924 PRO PRO D . n 
D 2 202 SER 202 1925 1925 SER SER D . n 
D 2 203 CYS 203 1926 1926 CYS CYS D . n 
D 2 204 PRO 204 1927 1927 PRO PRO D . n 
D 2 205 ALA 205 1928 1928 ALA ALA D . n 
D 2 206 SER 206 1929 1929 SER SER D . n 
D 2 207 VAL 207 1930 1930 VAL VAL D . n 
D 2 208 LEU 208 1931 1931 LEU LEU D . n 
D 2 209 LYS 209 1932 1932 LYS LYS D . n 
D 2 210 CYS 210 1933 1933 CYS CYS D . n 
D 2 211 ALA 211 1934 1934 ALA ALA D . n 
D 2 212 GLU 212 1935 1935 GLU GLU D . n 
D 2 213 ALA 213 1936 1936 ALA ALA D . n 
D 2 214 LEU 214 1937 1937 LEU LEU D . n 
D 2 215 GLN 215 1938 1938 GLN GLN D . n 
D 2 216 LEU 216 1939 1939 LEU LEU D . n 
D 2 217 PRO 217 1940 1940 PRO PRO D . n 
D 2 218 VAL 218 1941 1941 VAL VAL D . n 
D 2 219 VAL 219 1942 1942 VAL VAL D . n 
D 2 220 SER 220 1943 1943 SER SER D . n 
D 2 221 GLN 221 1944 1944 GLN GLN D . n 
D 2 222 GLU 222 1945 1945 GLU GLU D . n 
D 2 223 TRP 223 1946 1946 TRP TRP D . n 
D 2 224 VAL 224 1947 1947 VAL VAL D . n 
D 2 225 ILE 225 1948 1948 ILE ILE D . n 
D 2 226 GLN 226 1949 1949 GLN GLN D . n 
D 2 227 CYS 227 1950 1950 CYS CYS D . n 
D 2 228 LEU 228 1951 1951 LEU LEU D . n 
D 2 229 ILE 229 1952 1952 ILE ILE D . n 
D 2 230 VAL 230 1953 1953 VAL VAL D . n 
D 2 231 GLY 231 1954 1954 GLY GLY D . n 
D 2 232 GLU 232 1955 1955 GLU GLU D . n 
D 2 233 ARG 233 1956 1956 ARG ARG D . n 
D 2 234 ILE 234 1957 1957 ILE ILE D . n 
D 2 235 GLY 235 1958 1958 GLY GLY D . n 
D 2 236 PHE 236 1959 1959 PHE PHE D . n 
D 2 237 LYS 237 1960 1960 LYS LYS D . n 
D 2 238 GLN 238 1961 1961 GLN GLN D . n 
D 2 239 HIS 239 1962 1962 HIS HIS D . n 
D 2 240 PRO 240 1963 1963 PRO PRO D . n 
D 2 241 LYS 241 1964 1964 LYS LYS D . n 
D 2 242 TYR 242 1965 1965 TYR TYR D . n 
D 2 243 LYS 243 1966 1966 LYS LYS D . n 
D 2 244 HIS 244 1967 1967 HIS HIS D . n 
D 2 245 ASP 245 1968 1968 ASP ASP D . n 
D 2 246 TYR 246 1969 1969 TYR TYR D . n 
D 2 247 VAL 247 1970 1970 VAL VAL D . n 
D 2 248 SER 248 1971 ?    ?   ?   D . n 
D 2 249 HIS 249 1972 ?    ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  1293 1293 ZN  ZN  A . 
F 5 SO4 1  2972 2972 SO4 SO4 B . 
G 4 ZN  1  1290 1290 ZN  ZN  C . 
H 5 SO4 1  2970 2970 SO4 SO4 D . 
I 6 HOH 1  2001 2001 HOH HOH A . 
I 6 HOH 2  2002 2002 HOH HOH A . 
I 6 HOH 3  2003 2003 HOH HOH A . 
I 6 HOH 4  2004 2004 HOH HOH A . 
I 6 HOH 5  2005 2005 HOH HOH A . 
I 6 HOH 6  2006 2006 HOH HOH A . 
I 6 HOH 7  2007 2007 HOH HOH A . 
I 6 HOH 8  2008 2008 HOH HOH A . 
I 6 HOH 9  2009 2009 HOH HOH A . 
I 6 HOH 10 2010 2010 HOH HOH A . 
I 6 HOH 11 2011 2011 HOH HOH A . 
I 6 HOH 12 2012 2012 HOH HOH A . 
I 6 HOH 13 2013 2013 HOH HOH A . 
I 6 HOH 14 2014 2014 HOH HOH A . 
I 6 HOH 15 2015 2015 HOH HOH A . 
I 6 HOH 16 2016 2016 HOH HOH A . 
I 6 HOH 17 2017 2017 HOH HOH A . 
I 6 HOH 18 2018 2018 HOH HOH A . 
I 6 HOH 19 2019 2019 HOH HOH A . 
I 6 HOH 20 2020 2020 HOH HOH A . 
I 6 HOH 21 2021 2021 HOH HOH A . 
I 6 HOH 22 2022 2022 HOH HOH A . 
I 6 HOH 23 2023 2023 HOH HOH A . 
I 6 HOH 24 2024 2024 HOH HOH A . 
I 6 HOH 25 2025 2025 HOH HOH A . 
I 6 HOH 26 2026 2026 HOH HOH A . 
I 6 HOH 27 2027 2027 HOH HOH A . 
I 6 HOH 28 2028 2028 HOH HOH A . 
I 6 HOH 29 2029 2029 HOH HOH A . 
I 6 HOH 30 2030 2030 HOH HOH A . 
I 6 HOH 31 2031 2031 HOH HOH A . 
I 6 HOH 32 2032 2032 HOH HOH A . 
I 6 HOH 33 2033 2033 HOH HOH A . 
I 6 HOH 34 2034 2034 HOH HOH A . 
I 6 HOH 35 2035 2035 HOH HOH A . 
I 6 HOH 36 2036 2036 HOH HOH A . 
I 6 HOH 37 2037 2037 HOH HOH A . 
I 6 HOH 38 2038 2038 HOH HOH A . 
I 6 HOH 39 2039 2039 HOH HOH A . 
I 6 HOH 40 2040 2040 HOH HOH A . 
I 6 HOH 41 2041 2041 HOH HOH A . 
I 6 HOH 42 2042 2042 HOH HOH A . 
I 6 HOH 43 2043 2043 HOH HOH A . 
I 6 HOH 44 2044 2044 HOH HOH A . 
J 6 HOH 1  2001 2001 HOH HOH B . 
J 6 HOH 2  2002 2002 HOH HOH B . 
J 6 HOH 3  2003 2003 HOH HOH B . 
J 6 HOH 4  2004 2004 HOH HOH B . 
J 6 HOH 5  2005 2005 HOH HOH B . 
J 6 HOH 6  2006 2006 HOH HOH B . 
J 6 HOH 7  2007 2007 HOH HOH B . 
J 6 HOH 8  2008 2008 HOH HOH B . 
J 6 HOH 9  2009 2009 HOH HOH B . 
J 6 HOH 10 2010 2010 HOH HOH B . 
J 6 HOH 11 2011 2011 HOH HOH B . 
J 6 HOH 12 2012 2012 HOH HOH B . 
J 6 HOH 13 2013 2013 HOH HOH B . 
J 6 HOH 14 2014 2014 HOH HOH B . 
J 6 HOH 15 2015 2015 HOH HOH B . 
J 6 HOH 16 2016 2016 HOH HOH B . 
J 6 HOH 17 2017 2017 HOH HOH B . 
J 6 HOH 18 2018 2018 HOH HOH B . 
J 6 HOH 19 2019 2019 HOH HOH B . 
J 6 HOH 20 2020 2020 HOH HOH B . 
J 6 HOH 21 2021 2021 HOH HOH B . 
J 6 HOH 22 2022 2022 HOH HOH B . 
J 6 HOH 23 2023 2023 HOH HOH B . 
J 6 HOH 24 2024 2024 HOH HOH B . 
J 6 HOH 25 2025 2025 HOH HOH B . 
J 6 HOH 26 2026 2026 HOH HOH B . 
J 6 HOH 27 2027 2027 HOH HOH B . 
J 6 HOH 28 2028 2028 HOH HOH B . 
J 6 HOH 29 2029 2029 HOH HOH B . 
J 6 HOH 30 2030 2030 HOH HOH B . 
J 6 HOH 31 2031 2031 HOH HOH B . 
J 6 HOH 32 2032 2032 HOH HOH B . 
J 6 HOH 33 2033 2033 HOH HOH B . 
J 6 HOH 34 2034 2034 HOH HOH B . 
J 6 HOH 35 2035 2035 HOH HOH B . 
J 6 HOH 36 2036 2036 HOH HOH B . 
J 6 HOH 37 2037 2037 HOH HOH B . 
J 6 HOH 38 2038 2038 HOH HOH B . 
J 6 HOH 39 2039 2039 HOH HOH B . 
J 6 HOH 40 2040 2040 HOH HOH B . 
J 6 HOH 41 2041 2041 HOH HOH B . 
J 6 HOH 42 2042 2042 HOH HOH B . 
J 6 HOH 43 2043 2043 HOH HOH B . 
K 6 HOH 1  2001 2001 HOH HOH C . 
K 6 HOH 2  2002 2002 HOH HOH C . 
K 6 HOH 3  2003 2003 HOH HOH C . 
K 6 HOH 4  2004 2004 HOH HOH C . 
K 6 HOH 5  2005 2005 HOH HOH C . 
K 6 HOH 6  2006 2006 HOH HOH C . 
K 6 HOH 7  2007 2007 HOH HOH C . 
K 6 HOH 8  2008 2008 HOH HOH C . 
K 6 HOH 9  2009 2009 HOH HOH C . 
K 6 HOH 10 2010 2010 HOH HOH C . 
L 6 HOH 1  2001 2001 HOH HOH D . 
L 6 HOH 2  2002 2002 HOH HOH D . 
L 6 HOH 3  2003 2003 HOH HOH D . 
L 6 HOH 4  2004 2004 HOH HOH D . 
L 6 HOH 5  2005 2005 HOH HOH D . 
L 6 HOH 6  2006 2006 HOH HOH D . 
L 6 HOH 7  2007 2007 HOH HOH D . 
L 6 HOH 8  2008 2008 HOH HOH D . 
L 6 HOH 9  2009 2009 HOH HOH D . 
L 6 HOH 10 2010 2010 HOH HOH D . 
L 6 HOH 11 2011 2011 HOH HOH D . 
L 6 HOH 12 2012 2012 HOH HOH D . 
L 6 HOH 13 2013 2013 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1400  ? 
1 MORE         0.0   ? 
1 'SSA (A^2)'  25120 ? 
2 'ABSA (A^2)' 1230  ? 
2 MORE         -0.7  ? 
2 'SSA (A^2)'  23890 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 144 ? A CYS 238 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 SG  ? A CYS 148 ? A CYS 242 ? 1_555 111.3 ? 
2  SG  ? A CYS 144 ? A CYS 238 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 ND1 ? A HIS 85  ? A HIS 179 ? 1_555 105.4 ? 
3  SG  ? A CYS 148 ? A CYS 242 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 ND1 ? A HIS 85  ? A HIS 179 ? 1_555 105.2 ? 
4  SG  ? A CYS 144 ? A CYS 238 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 SG  ? A CYS 82  ? A CYS 176 ? 1_555 113.0 ? 
5  SG  ? A CYS 148 ? A CYS 242 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 SG  ? A CYS 82  ? A CYS 176 ? 1_555 118.0 ? 
6  ND1 ? A HIS 85  ? A HIS 179 ? 1_555 ZN ? E ZN . ? A ZN 1293 ? 1_555 SG  ? A CYS 82  ? A CYS 176 ? 1_555 102.5 ? 
7  SG  ? C CYS 148 ? C CYS 242 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 SG  ? C CYS 144 ? C CYS 238 ? 1_555 112.9 ? 
8  SG  ? C CYS 148 ? C CYS 242 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 SG  ? C CYS 82  ? C CYS 176 ? 1_555 112.1 ? 
9  SG  ? C CYS 144 ? C CYS 238 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 SG  ? C CYS 82  ? C CYS 176 ? 1_555 113.3 ? 
10 SG  ? C CYS 148 ? C CYS 242 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 ND1 ? C HIS 85  ? C HIS 179 ? 1_555 103.3 ? 
11 SG  ? C CYS 144 ? C CYS 238 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 ND1 ? C HIS 85  ? C HIS 179 ? 1_555 128.0 ? 
12 SG  ? C CYS 82  ? C CYS 176 ? 1_555 ZN ? G ZN . ? C ZN 1290 ? 1_555 ND1 ? C HIS 85  ? C HIS 179 ? 1_555 83.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-27 
2 'Structure model' 1 1 2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' 'Derived calculations'      
3 2 'Structure model' 'Non-polymer description'   
4 2 'Structure model' Other                       
5 2 'Structure model' 'Refinement description'    
6 2 'Structure model' 'Structure summary'         
7 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 96   ? ? -144.53 -41.73 
2  1 SER A 121  ? ? -118.21 66.92  
3  1 ALA A 138  ? ? 49.90   70.09  
4  1 ARG A 181  ? ? -74.38  23.74  
5  1 ARG A 202  ? ? -90.59  44.62  
6  1 ARG A 248  ? ? 76.92   -3.72  
7  1 ARG A 290  ? ? -24.52  -46.08 
8  1 THR B 1740 ? ? -57.31  170.46 
9  1 ALA B 1746 ? ? -65.15  74.28  
10 1 ARG B 1811 ? ? -108.55 73.03  
11 1 ASN B 1867 ? ? -31.89  105.84 
12 1 ASN B 1871 ? ? 48.45   23.04  
13 1 GLN B 1881 ? ? -59.30  -1.03  
14 1 GLN B 1882 ? ? -126.82 -54.01 
15 1 PHE B 1884 ? ? -136.18 -73.83 
16 1 ASP B 1911 ? ? -159.75 -18.67 
17 1 ILE B 1912 ? ? -69.86  99.52  
18 1 VAL B 1970 ? ? -97.53  -91.56 
19 1 SER B 1971 ? ? -165.05 -71.08 
20 1 LEU C 114  ? ? -59.84  171.14 
21 1 THR C 118  ? ? -143.45 14.52  
22 1 VAL C 122  ? ? -25.34  128.09 
23 1 ARG C 248  ? ? 75.49   -2.90  
24 1 ASN D 1792 ? ? -57.18  52.54  
25 1 ALA D 1799 ? ? -143.69 -28.03 
26 1 ARG D 1811 ? ? -104.17 70.49  
27 1 ASN D 1867 ? ? -32.89  105.44 
28 1 GLN D 1881 ? ? -53.87  -8.71  
29 1 GLN D 1882 ? ? -124.75 -52.35 
30 1 PHE D 1884 ? ? -135.96 -75.77 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B HIS 1972 ? CA  ? B HIS 249 CA  
2  1 Y 1 B HIS 1972 ? C   ? B HIS 249 C   
3  1 Y 1 B HIS 1972 ? O   ? B HIS 249 O   
4  1 Y 1 B HIS 1972 ? CB  ? B HIS 249 CB  
5  1 Y 1 B HIS 1972 ? CG  ? B HIS 249 CG  
6  1 Y 1 B HIS 1972 ? ND1 ? B HIS 249 ND1 
7  1 Y 1 B HIS 1972 ? CD2 ? B HIS 249 CD2 
8  1 Y 1 B HIS 1972 ? CE1 ? B HIS 249 CE1 
9  1 Y 1 B HIS 1972 ? NE2 ? B HIS 249 NE2 
10 1 Y 1 C ARG 290  ? CA  ? C ARG 196 CA  
11 1 Y 1 C ARG 290  ? C   ? C ARG 196 C   
12 1 Y 1 C ARG 290  ? O   ? C ARG 196 O   
13 1 Y 1 C ARG 290  ? CB  ? C ARG 196 CB  
14 1 Y 1 C ARG 290  ? CG  ? C ARG 196 CG  
15 1 Y 1 C ARG 290  ? CD  ? C ARG 196 CD  
16 1 Y 1 C ARG 290  ? NE  ? C ARG 196 NE  
17 1 Y 1 C ARG 290  ? CZ  ? C ARG 196 CZ  
18 1 Y 1 C ARG 290  ? NH1 ? C ARG 196 NH1 
19 1 Y 1 C ARG 290  ? NH2 ? C ARG 196 NH2 
20 1 Y 1 D VAL 1970 ? CA  ? D VAL 247 CA  
21 1 Y 1 D VAL 1970 ? C   ? D VAL 247 C   
22 1 Y 1 D VAL 1970 ? O   ? D VAL 247 O   
23 1 Y 1 D VAL 1970 ? CB  ? D VAL 247 CB  
24 1 Y 1 D VAL 1970 ? CG1 ? D VAL 247 CG1 
25 1 Y 1 D VAL 1970 ? CG2 ? D VAL 247 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 183  ? A SER 89  
2  1 Y 1 A ASP 184  ? A ASP 90  
3  1 Y 1 A SER 185  ? A SER 91  
4  1 Y 1 A ASP 186  ? A ASP 92  
5  1 Y 1 A GLY 187  ? A GLY 93  
6  1 Y 1 A LEU 188  ? A LEU 94  
7  1 Y 1 A ASN 200  ? A ASN 106 
8  1 Y 1 A GLU 224  ? A GLU 130 
9  1 Y 1 A VAL 225  ? A VAL 131 
10 1 Y 1 A GLY 226  ? A GLY 132 
11 1 Y 1 A SER 227  ? A SER 133 
12 1 Y 1 B LYS 1750 ? B LYS 27  
13 1 Y 1 B LEU 1751 ? B LEU 28  
14 1 Y 1 B PRO 1752 ? B PRO 29  
15 1 Y 1 B ASP 1753 ? B ASP 30  
16 1 Y 1 B GLY 1754 ? B GLY 31  
17 1 Y 1 B PRO 1755 ? B PRO 32  
18 1 Y 1 B THR 1756 ? B THR 33  
19 1 Y 1 B GLY 1757 ? B GLY 34  
20 1 Y 1 B SER 1758 ? B SER 35  
21 1 Y 1 B SER 1759 ? B SER 36  
22 1 Y 1 B GLU 1760 ? B GLU 37  
23 1 Y 1 B GLU 1761 ? B GLU 38  
24 1 Y 1 B GLU 1762 ? B GLU 39  
25 1 Y 1 B GLU 1763 ? B GLU 40  
26 1 Y 1 B GLU 1764 ? B GLU 41  
27 1 Y 1 B PHE 1765 ? B PHE 42  
28 1 Y 1 B LEU 1766 ? B LEU 43  
29 1 Y 1 B GLU 1767 ? B GLU 44  
30 1 Y 1 B ILE 1768 ? B ILE 45  
31 1 Y 1 B GLU 1793 ? B GLU 70  
32 1 Y 1 B ALA 1794 ? B ALA 71  
33 1 Y 1 B GLN 1795 ? B GLN 72  
34 1 Y 1 B CYS 1796 ? B CYS 73  
35 1 Y 1 B ASN 1797 ? B ASN 74  
36 1 Y 1 C LYS 291  ? C LYS 197 
37 1 Y 1 C LYS 292  ? C LYS 198 
38 1 Y 1 D LEU 1724 ? D LEU 1   
39 1 Y 1 D THR 1741 ? D THR 18  
40 1 Y 1 D SER 1742 ? D SER 19  
41 1 Y 1 D ASP 1743 ? D ASP 20  
42 1 Y 1 D LYS 1744 ? D LYS 21  
43 1 Y 1 D LEU 1745 ? D LEU 22  
44 1 Y 1 D ALA 1746 ? D ALA 23  
45 1 Y 1 D SER 1747 ? D SER 24  
46 1 Y 1 D ARG 1748 ? D ARG 25  
47 1 Y 1 D SER 1749 ? D SER 26  
48 1 Y 1 D LYS 1750 ? D LYS 27  
49 1 Y 1 D LEU 1751 ? D LEU 28  
50 1 Y 1 D PRO 1752 ? D PRO 29  
51 1 Y 1 D ASP 1753 ? D ASP 30  
52 1 Y 1 D GLY 1754 ? D GLY 31  
53 1 Y 1 D PRO 1755 ? D PRO 32  
54 1 Y 1 D THR 1756 ? D THR 33  
55 1 Y 1 D GLY 1757 ? D GLY 34  
56 1 Y 1 D SER 1758 ? D SER 35  
57 1 Y 1 D SER 1759 ? D SER 36  
58 1 Y 1 D GLU 1760 ? D GLU 37  
59 1 Y 1 D GLU 1761 ? D GLU 38  
60 1 Y 1 D GLU 1762 ? D GLU 39  
61 1 Y 1 D GLU 1763 ? D GLU 40  
62 1 Y 1 D GLU 1764 ? D GLU 41  
63 1 Y 1 D PHE 1765 ? D PHE 42  
64 1 Y 1 D LEU 1766 ? D LEU 43  
65 1 Y 1 D GLU 1767 ? D GLU 44  
66 1 Y 1 D ILE 1768 ? D ILE 45  
67 1 Y 1 D PRO 1769 ? D PRO 46  
68 1 Y 1 D PRO 1770 ? D PRO 47  
69 1 Y 1 D ALA 1794 ? D ALA 71  
70 1 Y 1 D GLN 1795 ? D GLN 72  
71 1 Y 1 D CYS 1796 ? D CYS 73  
72 1 Y 1 D SER 1971 ? D SER 248 
73 1 Y 1 D HIS 1972 ? D HIS 249 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 'SULFATE ION' SO4 
6 water         HOH 
#