data_1GZK
# 
_entry.id   1GZK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GZK         
PDBE  EBI-9887     
WWPDB D_1290009887 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GZN unspecified 'STRUCTURE OF THE PKB KINASE DOMAIN' 
PDB 1GZO unspecified 'STRUCTURE OF THE PKB KINASE DOMAIN UNPHOSPHORYLATED' 
PDB 1O6K unspecified 'STRUCTURE OF ACTIVATED FORM OF PKB KINASE DOMAIN S474D WITH GSK3 PEPTIDE AND AMP-PNP' 
PDB 1O6L unspecified 
'CRYSTAL STRUCTURE OF AN ACTIVATED AKT/ PROTEIN KINASE B (PKB-PIF CHIMERA) TERNARY COMPLEX WITH AMP-PNP AND GSK3 PEPTIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GZK 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barford, D.'    1 
'Yang, J.'       2 
'Hemmings, B.A.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            9 
_citation.page_first                1227 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12086620 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(02)00550-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, J.'       1 
primary 'Cron, P.'       2 
primary 'Thompson, V.'   3 
primary 'Good, V.'       4 
primary 'Hess, D.'       5 
primary 'Hemmings, B.A.' 6 
primary 'Barford, D.'    7 
# 
_cell.entry_id           1GZK 
_cell.length_a           148.405 
_cell.length_b           148.405 
_cell.length_c           38.547 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GZK 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RAC-BETA SERINE/THREONINE PROTEIN KINASE' 36490.875 1   2.7.1.- ? 'KINASE DOMAIN, RESIDUES (146 - 460)' ? 
2 water   nat water                                      18.015    284 ?       ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROTEIN KINASE AKT-2, PROTEIN KINASE B BETA, RAC-PK-BETA, PKB BETA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRL
CFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLL
KKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRL
CFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLL
KKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   VAL n 
1 3   THR n 
1 4   MET n 
1 5   ASN n 
1 6   ASP n 
1 7   PHE n 
1 8   ASP n 
1 9   TYR n 
1 10  LEU n 
1 11  LYS n 
1 12  LEU n 
1 13  LEU n 
1 14  GLY n 
1 15  LYS n 
1 16  GLY n 
1 17  THR n 
1 18  PHE n 
1 19  GLY n 
1 20  LYS n 
1 21  VAL n 
1 22  ILE n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  LYS n 
1 28  ALA n 
1 29  THR n 
1 30  GLY n 
1 31  ARG n 
1 32  TYR n 
1 33  TYR n 
1 34  ALA n 
1 35  MET n 
1 36  LYS n 
1 37  ILE n 
1 38  LEU n 
1 39  ARG n 
1 40  LYS n 
1 41  GLU n 
1 42  VAL n 
1 43  ILE n 
1 44  ILE n 
1 45  ALA n 
1 46  LYS n 
1 47  ASP n 
1 48  GLU n 
1 49  VAL n 
1 50  ALA n 
1 51  HIS n 
1 52  THR n 
1 53  VAL n 
1 54  THR n 
1 55  GLU n 
1 56  SER n 
1 57  ARG n 
1 58  VAL n 
1 59  LEU n 
1 60  GLN n 
1 61  ASN n 
1 62  THR n 
1 63  ARG n 
1 64  HIS n 
1 65  PRO n 
1 66  PHE n 
1 67  LEU n 
1 68  THR n 
1 69  ALA n 
1 70  LEU n 
1 71  LYS n 
1 72  TYR n 
1 73  ALA n 
1 74  PHE n 
1 75  GLN n 
1 76  THR n 
1 77  HIS n 
1 78  ASP n 
1 79  ARG n 
1 80  LEU n 
1 81  CYS n 
1 82  PHE n 
1 83  VAL n 
1 84  MET n 
1 85  GLU n 
1 86  TYR n 
1 87  ALA n 
1 88  ASN n 
1 89  GLY n 
1 90  GLY n 
1 91  GLU n 
1 92  LEU n 
1 93  PHE n 
1 94  PHE n 
1 95  HIS n 
1 96  LEU n 
1 97  SER n 
1 98  ARG n 
1 99  GLU n 
1 100 ARG n 
1 101 VAL n 
1 102 PHE n 
1 103 THR n 
1 104 GLU n 
1 105 GLU n 
1 106 ARG n 
1 107 ALA n 
1 108 ARG n 
1 109 PHE n 
1 110 TYR n 
1 111 GLY n 
1 112 ALA n 
1 113 GLU n 
1 114 ILE n 
1 115 VAL n 
1 116 SER n 
1 117 ALA n 
1 118 LEU n 
1 119 GLU n 
1 120 TYR n 
1 121 LEU n 
1 122 HIS n 
1 123 SER n 
1 124 ARG n 
1 125 ASP n 
1 126 VAL n 
1 127 VAL n 
1 128 TYR n 
1 129 ARG n 
1 130 ASP n 
1 131 ILE n 
1 132 LYS n 
1 133 LEU n 
1 134 GLU n 
1 135 ASN n 
1 136 LEU n 
1 137 MET n 
1 138 LEU n 
1 139 ASP n 
1 140 LYS n 
1 141 ASP n 
1 142 GLY n 
1 143 HIS n 
1 144 ILE n 
1 145 LYS n 
1 146 ILE n 
1 147 THR n 
1 148 ASP n 
1 149 PHE n 
1 150 GLY n 
1 151 LEU n 
1 152 CYS n 
1 153 LYS n 
1 154 GLU n 
1 155 GLY n 
1 156 ILE n 
1 157 SER n 
1 158 ASP n 
1 159 GLY n 
1 160 ALA n 
1 161 THR n 
1 162 MET n 
1 163 LYS n 
1 164 THR n 
1 165 PHE n 
1 166 CYS n 
1 167 GLY n 
1 168 THR n 
1 169 PRO n 
1 170 GLU n 
1 171 TYR n 
1 172 LEU n 
1 173 ALA n 
1 174 PRO n 
1 175 GLU n 
1 176 VAL n 
1 177 LEU n 
1 178 GLU n 
1 179 ASP n 
1 180 ASN n 
1 181 ASP n 
1 182 TYR n 
1 183 GLY n 
1 184 ARG n 
1 185 ALA n 
1 186 VAL n 
1 187 ASP n 
1 188 TRP n 
1 189 TRP n 
1 190 GLY n 
1 191 LEU n 
1 192 GLY n 
1 193 VAL n 
1 194 VAL n 
1 195 MET n 
1 196 TYR n 
1 197 GLU n 
1 198 MET n 
1 199 MET n 
1 200 CYS n 
1 201 GLY n 
1 202 ARG n 
1 203 LEU n 
1 204 PRO n 
1 205 PHE n 
1 206 TYR n 
1 207 ASN n 
1 208 GLN n 
1 209 ASP n 
1 210 HIS n 
1 211 GLU n 
1 212 ARG n 
1 213 LEU n 
1 214 PHE n 
1 215 GLU n 
1 216 LEU n 
1 217 ILE n 
1 218 LEU n 
1 219 MET n 
1 220 GLU n 
1 221 GLU n 
1 222 ILE n 
1 223 ARG n 
1 224 PHE n 
1 225 PRO n 
1 226 ARG n 
1 227 THR n 
1 228 LEU n 
1 229 SER n 
1 230 PRO n 
1 231 GLU n 
1 232 ALA n 
1 233 LYS n 
1 234 SER n 
1 235 LEU n 
1 236 LEU n 
1 237 ALA n 
1 238 GLY n 
1 239 LEU n 
1 240 LEU n 
1 241 LYS n 
1 242 LYS n 
1 243 ASP n 
1 244 PRO n 
1 245 LYS n 
1 246 GLN n 
1 247 ARG n 
1 248 LEU n 
1 249 GLY n 
1 250 GLY n 
1 251 GLY n 
1 252 PRO n 
1 253 SER n 
1 254 ASP n 
1 255 ALA n 
1 256 LYS n 
1 257 GLU n 
1 258 VAL n 
1 259 MET n 
1 260 GLU n 
1 261 HIS n 
1 262 ARG n 
1 263 PHE n 
1 264 PHE n 
1 265 LEU n 
1 266 SER n 
1 267 ILE n 
1 268 ASN n 
1 269 TRP n 
1 270 GLN n 
1 271 ASP n 
1 272 VAL n 
1 273 VAL n 
1 274 GLN n 
1 275 LYS n 
1 276 LYS n 
1 277 LEU n 
1 278 LEU n 
1 279 PRO n 
1 280 PRO n 
1 281 PHE n 
1 282 LYS n 
1 283 PRO n 
1 284 GLN n 
1 285 VAL n 
1 286 THR n 
1 287 SER n 
1 288 GLU n 
1 289 VAL n 
1 290 ASP n 
1 291 THR n 
1 292 ARG n 
1 293 TYR n 
1 294 PHE n 
1 295 ASP n 
1 296 ASP n 
1 297 GLU n 
1 298 PHE n 
1 299 THR n 
1 300 ALA n 
1 301 GLN n 
1 302 SER n 
1 303 ILE n 
1 304 THR n 
1 305 ILE n 
1 306 THR n 
1 307 PRO n 
1 308 PRO n 
1 309 ASP n 
1 310 ARG n 
1 311 TYR n 
1 312 ASP n 
1 313 SER n 
1 314 LEU n 
1 315 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'SPODOPTERA FRUGIPERDA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AKT2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P31751 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GZK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 315 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P31751 
_struct_ref_seq.db_align_beg                  146 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  460 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       146 
_struct_ref_seq.pdbx_auth_seq_align_end       460 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1GZK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   49 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10MG/ML PROTEIN, 30% PEG4K, 0.2 M LITHIUM SULPHATE, 0.1 M TRIS, pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2001-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.97920 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GZK 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   113677 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.0000 
_reflns.B_iso_Wilson_estimate        33.3 
_reflns.pdbx_redundancy              4.000 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GZK 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18974 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2389406.94 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.98 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    95.8 
_refine.ls_R_factor_obs                          0.248 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_R_factor_R_free                       0.319 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.4 
_refine.ls_number_reflns_R_free                  1398 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               60.6 
_refine.aniso_B[1][1]                            8.34 
_refine.aniso_B[2][2]                            8.34 
_refine.aniso_B[3][3]                            -16.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.80 
_refine.solvent_model_param_bsol                 300 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1CDK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1GZK 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.41 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.51 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2197 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             284 
_refine_hist.number_atoms_total               2481 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        34.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.01  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.71  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.91  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.26  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.53  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             2422 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.percent_reflns_obs               80.9 
_refine_ls_shell.R_factor_R_free                  0.425 
_refine_ls_shell.R_factor_R_free_error            0.031 
_refine_ls_shell.percent_reflns_R_free            7.1 
_refine_ls_shell.number_reflns_R_free             184 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARAM19X.PRO 
_pdbx_xplor_file.topol_file       ? 
# 
_struct.entry_id                  1GZK 
_struct.title                     
'Molecular mechanism for the regulation of protein kinase B/Akt by hydrophobic motif phosphorylation' 
_struct.pdbx_descriptor           'RAC-BETA SERINE/THREONINE PROTEIN KINASE (E.C.2.7.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GZK 
_struct_keywords.pdbx_keywords   KINASE 
_struct_keywords.text            'KINASE, TRANSFERASE, SERINE/THREONINE-PROTEIN KINASE, ATP-BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 3   ? ASN A 5   ? THR A 148 ASN A 150 5 ? 3  
HELX_P HELX_P2  2  ARG A 57  ? THR A 62  ? ARG A 202 THR A 207 1 ? 6  
HELX_P HELX_P3  3  GLU A 91  ? ARG A 98  ? GLU A 236 ARG A 243 1 ? 8  
HELX_P HELX_P4  4  THR A 103 ? ARG A 124 ? THR A 248 ARG A 269 1 ? 22 
HELX_P HELX_P5  5  LYS A 132 ? GLU A 134 ? LYS A 277 GLU A 279 5 ? 3  
HELX_P HELX_P6  6  ALA A 173 ? ASN A 180 ? ALA A 318 ASN A 325 1 ? 8  
HELX_P HELX_P7  7  ARG A 184 ? GLY A 201 ? ARG A 329 GLY A 346 1 ? 18 
HELX_P HELX_P8  8  ARG A 212 ? GLU A 220 ? ARG A 357 GLU A 365 1 ? 9  
HELX_P HELX_P9  9  SER A 229 ? LEU A 240 ? SER A 374 LEU A 385 1 ? 12 
HELX_P HELX_P10 10 ASP A 243 ? ARG A 247 ? ASP A 388 ARG A 392 5 ? 5  
HELX_P HELX_P11 11 ASP A 254 ? GLU A 260 ? ASP A 399 GLU A 405 1 ? 7  
HELX_P HELX_P12 12 ASN A 268 ? GLN A 274 ? ASN A 413 GLN A 419 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 7   ? LYS A 15  ? PHE A 152 LYS A 160 
AA 2 GLY A 19  ? GLU A 26  ? GLY A 164 GLU A 171 
AA 3 TYR A 32  ? ARG A 39  ? TYR A 177 ARG A 184 
AA 4 ARG A 79  ? GLU A 85  ? ARG A 224 GLU A 230 
AA 5 LEU A 70  ? GLN A 75  ? LEU A 215 GLN A 220 
AB 1 LEU A 136 ? LEU A 138 ? LEU A 281 LEU A 283 
AB 2 ILE A 144 ? ILE A 146 ? ILE A 289 ILE A 291 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 13  ? N LEU A 158 O VAL A 21  ? O VAL A 166 
AA 2 3 N VAL A 24  ? N VAL A 169 O TYR A 33  ? O TYR A 178 
AA 3 4 N LEU A 38  ? N LEU A 183 O LEU A 80  ? O LEU A 225 
AA 4 5 O VAL A 83  ? O VAL A 228 N LYS A 71  ? N LYS A 216 
AB 1 2 N MET A 137 ? N MET A 282 O LYS A 145 ? O LYS A 290 
# 
_database_PDB_matrix.entry_id          1GZK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GZK 
_atom_sites.fract_transf_matrix[1][1]   0.006738 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006738 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025942 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 1   ? -40.045 81.109  -47.107 1.00   76.25  ? 146  LYS A N   1 
ATOM   2    C CA  . LYS A 1 1   ? -38.666 81.513  -47.520 1.00   76.08  ? 146  LYS A CA  1 
ATOM   3    C C   . LYS A 1 1   ? -38.395 80.980  -48.924 1.00   75.77  ? 146  LYS A C   1 
ATOM   4    O O   . LYS A 1 1   ? -39.051 80.019  -49.364 1.00   77.22  ? 146  LYS A O   1 
ATOM   5    C CB  . LYS A 1 1   ? -37.621 80.941  -46.528 1.00   77.08  ? 146  LYS A CB  1 
ATOM   6    N N   . VAL A 1 2   ? -37.443 81.598  -49.631 1.00   73.20  ? 147  VAL A N   1 
ATOM   7    C CA  . VAL A 1 2   ? -37.102 81.140  -50.973 1.00   69.82  ? 147  VAL A CA  1 
ATOM   8    C C   . VAL A 1 2   ? -36.073 80.036  -50.869 1.00   67.19  ? 147  VAL A C   1 
ATOM   9    O O   . VAL A 1 2   ? -35.263 79.994  -49.942 1.00   66.05  ? 147  VAL A O   1 
ATOM   10   C CB  . VAL A 1 2   ? -36.555 82.283  -51.815 1.00   69.69  ? 147  VAL A CB  1 
ATOM   11   N N   . THR A 1 3   ? -36.112 79.142  -51.842 1.00   65.41  ? 148  THR A N   1 
ATOM   12   C CA  . THR A 1 3   ? -35.192 78.020  -51.896 1.00   63.08  ? 148  THR A CA  1 
ATOM   13   C C   . THR A 1 3   ? -35.032 77.564  -53.329 1.00   61.82  ? 148  THR A C   1 
ATOM   14   O O   . THR A 1 3   ? -35.907 77.797  -54.174 1.00   60.73  ? 148  THR A O   1 
ATOM   15   C CB  . THR A 1 3   ? -35.694 76.859  -51.025 1.00   63.95  ? 148  THR A CB  1 
ATOM   16   O OG1 . THR A 1 3   ? -35.127 76.996  -49.716 1.00   66.74  ? 148  THR A OG1 1 
ATOM   17   C CG2 . THR A 1 3   ? -35.324 75.510  -51.608 1.00   64.01  ? 148  THR A CG2 1 
ATOM   18   N N   . MET A 1 4   ? -33.906 76.909  -53.592 1.00   59.55  ? 149  MET A N   1 
ATOM   19   C CA  . MET A 1 4   ? -33.605 76.428  -54.921 1.00   58.87  ? 149  MET A CA  1 
ATOM   20   C C   . MET A 1 4   ? -34.774 75.826  -55.628 1.00   58.77  ? 149  MET A C   1 
ATOM   21   O O   . MET A 1 4   ? -34.920 75.983  -56.838 1.00   59.36  ? 149  MET A O   1 
ATOM   22   C CB  . MET A 1 4   ? -32.474 75.415  -54.867 1.00   58.21  ? 149  MET A CB  1 
ATOM   23   C CG  . MET A 1 4   ? -31.165 76.064  -54.584 1.00   57.97  ? 149  MET A CG  1 
ATOM   24   S SD  . MET A 1 4   ? -30.760 77.196  -55.915 1.00   54.56  ? 149  MET A SD  1 
ATOM   25   C CE  . MET A 1 4   ? -28.995 76.746  -56.032 1.00   57.14  ? 149  MET A CE  1 
ATOM   26   N N   . ASN A 1 5   ? -35.624 75.140  -54.879 1.00   61.13  ? 150  ASN A N   1 
ATOM   27   C CA  . ASN A 1 5   ? -36.774 74.485  -55.485 1.00   61.54  ? 150  ASN A CA  1 
ATOM   28   C C   . ASN A 1 5   ? -37.891 75.437  -55.900 1.00   59.97  ? 150  ASN A C   1 
ATOM   29   O O   . ASN A 1 5   ? -38.840 75.041  -56.561 1.00   60.40  ? 150  ASN A O   1 
ATOM   30   C CB  . ASN A 1 5   ? -37.300 73.393  -54.556 1.00   64.19  ? 150  ASN A CB  1 
ATOM   31   C CG  . ASN A 1 5   ? -38.320 72.518  -55.235 1.00   66.32  ? 150  ASN A CG  1 
ATOM   32   O OD1 . ASN A 1 5   ? -39.316 72.127  -54.623 1.00   68.30  ? 150  ASN A OD1 1 
ATOM   33   N ND2 . ASN A 1 5   ? -38.095 72.217  -56.516 1.00   65.57  ? 150  ASN A ND2 1 
ATOM   34   N N   . ASP A 1 6   ? -37.767 76.699  -55.534 1.00   58.66  ? 151  ASP A N   1 
ATOM   35   C CA  . ASP A 1 6   ? -38.760 77.692  -55.931 1.00   59.13  ? 151  ASP A CA  1 
ATOM   36   C C   . ASP A 1 6   ? -38.534 78.183  -57.383 1.00   58.85  ? 151  ASP A C   1 
ATOM   37   O O   . ASP A 1 6   ? -39.305 78.990  -57.912 1.00   56.32  ? 151  ASP A O   1 
ATOM   38   C CB  . ASP A 1 6   ? -38.685 78.914  -54.994 1.00   61.68  ? 151  ASP A CB  1 
ATOM   39   C CG  . ASP A 1 6   ? -39.358 78.678  -53.651 1.00   62.91  ? 151  ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 6   ? -40.536 78.260  -53.675 1.00   65.31  ? 151  ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 6   ? -38.731 78.925  -52.588 1.00   62.49  ? 151  ASP A OD2 1 
ATOM   42   N N   . PHE A 1 7   ? -37.486 77.699  -58.044 1.00   58.44  ? 152  PHE A N   1 
ATOM   43   C CA  . PHE A 1 7   ? -37.215 78.210  -59.379 1.00   57.45  ? 152  PHE A CA  1 
ATOM   44   C C   . PHE A 1 7   ? -36.934 77.198  -60.486 1.00   58.64  ? 152  PHE A C   1 
ATOM   45   O O   . PHE A 1 7   ? -36.441 76.094  -60.233 1.00   60.38  ? 152  PHE A O   1 
ATOM   46   C CB  . PHE A 1 7   ? -36.050 79.212  -59.290 1.00   54.30  ? 152  PHE A CB  1 
ATOM   47   C CG  . PHE A 1 7   ? -36.228 80.263  -58.224 1.00   50.39  ? 152  PHE A CG  1 
ATOM   48   C CD1 . PHE A 1 7   ? -36.970 81.414  -58.472 1.00   49.94  ? 152  PHE A CD1 1 
ATOM   49   C CD2 . PHE A 1 7   ? -35.675 80.088  -56.955 1.00   48.41  ? 152  PHE A CD2 1 
ATOM   50   C CE1 . PHE A 1 7   ? -37.163 82.390  -57.458 1.00   46.46  ? 152  PHE A CE1 1 
ATOM   51   C CE2 . PHE A 1 7   ? -35.861 81.046  -55.942 1.00   47.12  ? 152  PHE A CE2 1 
ATOM   52   C CZ  . PHE A 1 7   ? -36.609 82.202  -56.201 1.00   45.39  ? 152  PHE A CZ  1 
ATOM   53   N N   . ASP A 1 8   ? -37.270 77.588  -61.718 1.00   59.78  ? 153  ASP A N   1 
ATOM   54   C CA  . ASP A 1 8   ? -37.027 76.766  -62.904 1.00   60.29  ? 153  ASP A CA  1 
ATOM   55   C C   . ASP A 1 8   ? -35.781 77.320  -63.566 1.00   59.24  ? 153  ASP A C   1 
ATOM   56   O O   . ASP A 1 8   ? -35.626 78.535  -63.679 1.00   58.04  ? 153  ASP A O   1 
ATOM   57   C CB  . ASP A 1 8   ? -38.167 76.882  -63.918 1.00   63.56  ? 153  ASP A CB  1 
ATOM   58   C CG  . ASP A 1 8   ? -39.496 76.400  -63.371 1.00   68.01  ? 153  ASP A CG  1 
ATOM   59   O OD1 . ASP A 1 8   ? -39.589 75.215  -62.965 1.00   69.53  ? 153  ASP A OD1 1 
ATOM   60   O OD2 . ASP A 1 8   ? -40.456 77.212  -63.356 1.00   71.29  ? 153  ASP A OD2 1 
ATOM   61   N N   . TYR A 1 9   ? -34.897 76.438  -64.009 1.00   58.54  ? 154  TYR A N   1 
ATOM   62   C CA  . TYR A 1 9   ? -33.691 76.881  -64.685 1.00   57.09  ? 154  TYR A CA  1 
ATOM   63   C C   . TYR A 1 9   ? -33.960 77.212  -66.146 1.00   56.90  ? 154  TYR A C   1 
ATOM   64   O O   . TYR A 1 9   ? -34.495 76.379  -66.871 1.00   58.03  ? 154  TYR A O   1 
ATOM   65   C CB  . TYR A 1 9   ? -32.634 75.801  -64.650 1.00   56.21  ? 154  TYR A CB  1 
ATOM   66   C CG  . TYR A 1 9   ? -31.497 76.081  -65.604 1.00   56.38  ? 154  TYR A CG  1 
ATOM   67   C CD1 . TYR A 1 9   ? -30.446 76.917  -65.246 1.00   55.56  ? 154  TYR A CD1 1 
ATOM   68   C CD2 . TYR A 1 9   ? -31.462 75.476  -66.851 1.00   55.60  ? 154  TYR A CD2 1 
ATOM   69   C CE1 . TYR A 1 9   ? -29.387 77.129  -66.103 1.00   55.58  ? 154  TYR A CE1 1 
ATOM   70   C CE2 . TYR A 1 9   ? -30.420 75.670  -67.707 1.00   55.73  ? 154  TYR A CE2 1 
ATOM   71   C CZ  . TYR A 1 9   ? -29.375 76.491  -67.338 1.00   57.53  ? 154  TYR A CZ  1 
ATOM   72   O OH  . TYR A 1 9   ? -28.293 76.613  -68.193 1.00   59.30  ? 154  TYR A OH  1 
ATOM   73   N N   . LEU A 1 10  ? -33.578 78.414  -66.585 1.00   56.38  ? 155  LEU A N   1 
ATOM   74   C CA  . LEU A 1 10  ? -33.759 78.798  -67.986 1.00   53.79  ? 155  LEU A CA  1 
ATOM   75   C C   . LEU A 1 10  ? -32.448 78.736  -68.729 1.00   51.54  ? 155  LEU A C   1 
ATOM   76   O O   . LEU A 1 10  ? -32.318 78.001  -69.685 1.00   50.81  ? 155  LEU A O   1 
ATOM   77   C CB  . LEU A 1 10  ? -34.389 80.175  -68.077 1.00   52.98  ? 155  LEU A CB  1 
ATOM   78   C CG  . LEU A 1 10  ? -35.877 79.861  -68.021 1.00   53.51  ? 155  LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 10  ? -36.662 81.007  -67.535 1.00   52.00  ? 155  LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 10  ? -36.335 79.442  -69.417 1.00   55.55  ? 155  LEU A CD2 1 
ATOM   81   N N   . LYS A 1 11  ? -31.455 79.486  -68.286 1.00   51.76  ? 156  LYS A N   1 
ATOM   82   C CA  . LYS A 1 11  ? -30.155 79.428  -68.950 1.00   52.20  ? 156  LYS A CA  1 
ATOM   83   C C   . LYS A 1 11  ? -29.084 80.103  -68.134 1.00   52.01  ? 156  LYS A C   1 
ATOM   84   O O   . LYS A 1 11  ? -29.358 80.756  -67.123 1.00   51.01  ? 156  LYS A O   1 
ATOM   85   C CB  . LYS A 1 11  ? -30.211 80.086  -70.336 1.00   54.27  ? 156  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 11  ? -30.564 81.562  -70.325 1.00   57.13  ? 156  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 11  ? -30.402 82.181  -71.709 1.00   59.25  ? 156  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 11  ? -30.002 83.642  -71.587 1.00   59.66  ? 156  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 11  ? -29.730 84.223  -72.929 1.00   62.65  ? 156  LYS A NZ  1 
ATOM   90   N N   . LEU A 1 12  ? -27.850 79.955  -68.581 1.00   52.85  ? 157  LEU A N   1 
ATOM   91   C CA  . LEU A 1 12  ? -26.754 80.589  -67.883 1.00   54.12  ? 157  LEU A CA  1 
ATOM   92   C C   . LEU A 1 12  ? -26.568 82.018  -68.372 1.00   55.45  ? 157  LEU A C   1 
ATOM   93   O O   . LEU A 1 12  ? -26.402 82.251  -69.562 1.00   54.65  ? 157  LEU A O   1 
ATOM   94   C CB  . LEU A 1 12  ? -25.453 79.817  -68.104 1.00   54.46  ? 157  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 12  ? -24.205 80.479  -67.507 1.00   53.08  ? 157  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 12  ? -24.361 80.756  -66.010 1.00   51.90  ? 157  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 12  ? -23.051 79.564  -67.768 1.00   54.83  ? 157  LEU A CD2 1 
ATOM   98   N N   . LEU A 1 13  ? -26.591 82.971  -67.448 1.00   57.34  ? 158  LEU A N   1 
ATOM   99   C CA  . LEU A 1 13  ? -26.404 84.363  -67.818 1.00   59.98  ? 158  LEU A CA  1 
ATOM   100  C C   . LEU A 1 13  ? -24.940 84.702  -67.706 1.00   62.14  ? 158  LEU A C   1 
ATOM   101  O O   . LEU A 1 13  ? -24.427 85.507  -68.465 1.00   62.30  ? 158  LEU A O   1 
ATOM   102  C CB  . LEU A 1 13  ? -27.236 85.280  -66.924 1.00   58.24  ? 158  LEU A CB  1 
ATOM   103  C CG  . LEU A 1 13  ? -28.709 85.319  -67.330 1.00   57.26  ? 158  LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 13  ? -29.520 86.195  -66.364 1.00   57.62  ? 158  LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 13  ? -28.798 85.862  -68.761 1.00   56.26  ? 158  LEU A CD2 1 
ATOM   106  N N   . GLY A 1 14  ? -24.261 84.066  -66.763 1.00   65.62  ? 159  GLY A N   1 
ATOM   107  C CA  . GLY A 1 14  ? -22.844 84.325  -66.605 1.00   69.53  ? 159  GLY A CA  1 
ATOM   108  C C   . GLY A 1 14  ? -22.087 83.439  -65.627 1.00   72.15  ? 159  GLY A C   1 
ATOM   109  O O   . GLY A 1 14  ? -22.588 83.075  -64.565 1.00   71.51  ? 159  GLY A O   1 
ATOM   110  N N   . LYS A 1 15  ? -20.866 83.082  -65.996 1.00   75.21  ? 160  LYS A N   1 
ATOM   111  C CA  . LYS A 1 15  ? -20.031 82.275  -65.121 1.00   79.10  ? 160  LYS A CA  1 
ATOM   112  C C   . LYS A 1 15  ? -18.976 83.235  -64.578 1.00   81.39  ? 160  LYS A C   1 
ATOM   113  O O   . LYS A 1 15  ? -18.932 84.406  -64.964 1.00   82.66  ? 160  LYS A O   1 
ATOM   114  C CB  . LYS A 1 15  ? -19.362 81.143  -65.901 1.00   78.98  ? 160  LYS A CB  1 
ATOM   115  C CG  . LYS A 1 15  ? -18.558 80.177  -65.027 1.00   80.29  ? 160  LYS A CG  1 
ATOM   116  C CD  . LYS A 1 15  ? -18.090 78.956  -65.832 1.00   81.58  ? 160  LYS A CD  1 
ATOM   117  C CE  . LYS A 1 15  ? -17.322 77.934  -64.979 1.00   81.28  ? 160  LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 15  ? -16.776 76.833  -65.831 1.00   79.13  ? 160  LYS A NZ  1 
ATOM   119  N N   . GLY A 1 16  ? -18.125 82.757  -63.684 1.00   83.46  ? 161  GLY A N   1 
ATOM   120  C CA  . GLY A 1 16  ? -17.105 83.634  -63.142 1.00   85.41  ? 161  GLY A CA  1 
ATOM   121  C C   . GLY A 1 16  ? -16.340 83.016  -61.990 1.00   86.64  ? 161  GLY A C   1 
ATOM   122  O O   . GLY A 1 16  ? -16.697 81.938  -61.489 1.00   86.69  ? 161  GLY A O   1 
ATOM   123  N N   . THR A 1 17  ? -15.287 83.713  -61.569 1.00   86.93  ? 162  THR A N   1 
ATOM   124  C CA  . THR A 1 17  ? -14.439 83.261  -60.472 1.00   86.65  ? 162  THR A CA  1 
ATOM   125  C C   . THR A 1 17  ? -15.245 83.262  -59.177 1.00   85.63  ? 162  THR A C   1 
ATOM   126  O O   . THR A 1 17  ? -15.139 82.349  -58.356 1.00   85.96  ? 162  THR A O   1 
ATOM   127  C CB  . THR A 1 17  ? -13.253 84.195  -60.334 1.00   87.90  ? 162  THR A CB  1 
ATOM   128  O OG1 . THR A 1 17  ? -13.028 84.839  -61.598 1.00   88.96  ? 162  THR A OG1 1 
ATOM   129  C CG2 . THR A 1 17  ? -12.006 83.413  -59.929 1.00   88.26  ? 162  THR A CG2 1 
ATOM   130  N N   . PHE A 1 18  ? -16.048 84.309  -59.019 1.00   84.19  ? 163  PHE A N   1 
ATOM   131  C CA  . PHE A 1 18  ? -16.935 84.500  -57.876 1.00   82.48  ? 163  PHE A CA  1 
ATOM   132  C C   . PHE A 1 18  ? -18.036 83.413  -57.841 1.00   80.68  ? 163  PHE A C   1 
ATOM   133  O O   . PHE A 1 18  ? -18.452 82.947  -56.774 1.00   80.63  ? 163  PHE A O   1 
ATOM   134  C CB  . PHE A 1 18  ? -17.573 85.873  -58.016 1.00   83.55  ? 163  PHE A CB  1 
ATOM   135  C CG  . PHE A 1 18  ? -18.169 86.111  -59.381 1.00   84.44  ? 163  PHE A CG  1 
ATOM   136  C CD1 . PHE A 1 18  ? -19.542 85.955  -59.596 1.00   84.74  ? 163  PHE A CD1 1 
ATOM   137  C CD2 . PHE A 1 18  ? -17.351 86.461  -60.461 1.00   84.85  ? 163  PHE A CD2 1 
ATOM   138  C CE1 . PHE A 1 18  ? -20.101 86.147  -60.868 1.00   85.04  ? 163  PHE A CE1 1 
ATOM   139  C CE2 . PHE A 1 18  ? -17.896 86.654  -61.739 1.00   85.66  ? 163  PHE A CE2 1 
ATOM   140  C CZ  . PHE A 1 18  ? -19.276 86.497  -61.942 1.00   85.65  ? 163  PHE A CZ  1 
ATOM   141  N N   . GLY A 1 19  ? -18.499 83.007  -59.017 1.00   77.71  ? 164  GLY A N   1 
ATOM   142  C CA  . GLY A 1 19  ? -19.546 82.010  -59.083 1.00   73.98  ? 164  GLY A CA  1 
ATOM   143  C C   . GLY A 1 19  ? -20.234 82.069  -60.431 1.00   71.48  ? 164  GLY A C   1 
ATOM   144  O O   . GLY A 1 19  ? -19.574 82.040  -61.476 1.00   72.13  ? 164  GLY A O   1 
ATOM   145  N N   . LYS A 1 20  ? -21.556 82.171  -60.424 1.00   67.13  ? 165  LYS A N   1 
ATOM   146  C CA  . LYS A 1 20  ? -22.301 82.210  -61.673 1.00   62.40  ? 165  LYS A CA  1 
ATOM   147  C C   . LYS A 1 20  ? -23.612 82.971  -61.528 1.00   59.62  ? 165  LYS A C   1 
ATOM   148  O O   . LYS A 1 20  ? -24.043 83.276  -60.410 1.00   57.28  ? 165  LYS A O   1 
ATOM   149  C CB  . LYS A 1 20  ? -22.590 80.772  -62.132 1.00   63.50  ? 165  LYS A CB  1 
ATOM   150  C CG  . LYS A 1 20  ? -23.479 79.963  -61.187 1.00   63.84  ? 165  LYS A CG  1 
ATOM   151  C CD  . LYS A 1 20  ? -23.507 78.486  -61.580 1.00   66.32  ? 165  LYS A CD  1 
ATOM   152  C CE  . LYS A 1 20  ? -22.367 77.705  -60.912 1.00   66.72  ? 165  LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 20  ? -22.051 76.422  -61.607 1.00   66.91  ? 165  LYS A NZ  1 
ATOM   154  N N   . VAL A 1 21  ? -24.237 83.282  -62.663 1.00   56.63  ? 166  VAL A N   1 
ATOM   155  C CA  . VAL A 1 21  ? -25.514 83.980  -62.673 1.00   54.66  ? 166  VAL A CA  1 
ATOM   156  C C   . VAL A 1 21  ? -26.382 83.228  -63.659 1.00   54.88  ? 166  VAL A C   1 
ATOM   157  O O   . VAL A 1 21  ? -26.034 83.049  -64.834 1.00   53.37  ? 166  VAL A O   1 
ATOM   158  C CB  . VAL A 1 21  ? -25.391 85.469  -63.098 1.00   54.53  ? 166  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 21  ? -26.777 86.108  -63.143 1.00   52.46  ? 166  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 21  ? -24.503 86.246  -62.094 1.00   54.04  ? 166  VAL A CG2 1 
ATOM   161  N N   . ILE A 1 22  ? -27.517 82.774  -63.148 1.00   54.59  ? 167  ILE A N   1 
ATOM   162  C CA  . ILE A 1 22  ? -28.447 81.979  -63.923 1.00   54.10  ? 167  ILE A CA  1 
ATOM   163  C C   . ILE A 1 22  ? -29.738 82.726  -64.110 1.00   52.70  ? 167  ILE A C   1 
ATOM   164  O O   . ILE A 1 22  ? -30.148 83.495  -63.249 1.00   52.34  ? 167  ILE A O   1 
ATOM   165  C CB  . ILE A 1 22  ? -28.788 80.652  -63.176 1.00   54.25  ? 167  ILE A CB  1 
ATOM   166  C CG1 . ILE A 1 22  ? -27.529 79.797  -62.953 1.00   55.17  ? 167  ILE A CG1 1 
ATOM   167  C CG2 . ILE A 1 22  ? -29.834 79.893  -63.936 1.00   55.93  ? 167  ILE A CG2 1 
ATOM   168  C CD1 . ILE A 1 22  ? -26.832 79.328  -64.212 1.00   54.47  ? 167  ILE A CD1 1 
ATOM   169  N N   . LEU A 1 23  ? -30.378 82.480  -65.238 1.00   51.93  ? 168  LEU A N   1 
ATOM   170  C CA  . LEU A 1 23  ? -31.653 83.080  -65.533 1.00   52.61  ? 168  LEU A CA  1 
ATOM   171  C C   . LEU A 1 23  ? -32.675 82.066  -65.038 1.00   52.80  ? 168  LEU A C   1 
ATOM   172  O O   . LEU A 1 23  ? -32.741 80.944  -65.542 1.00   53.88  ? 168  LEU A O   1 
ATOM   173  C CB  . LEU A 1 23  ? -31.801 83.287  -67.049 1.00   52.93  ? 168  LEU A CB  1 
ATOM   174  C CG  . LEU A 1 23  ? -33.105 83.952  -67.534 1.00   53.27  ? 168  LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 23  ? -33.306 85.253  -66.802 1.00   52.36  ? 168  LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 23  ? -33.075 84.188  -69.034 1.00   53.15  ? 168  LEU A CD2 1 
ATOM   177  N N   . VAL A 1 24  ? -33.472 82.447  -64.049 1.00   54.05  ? 169  VAL A N   1 
ATOM   178  C CA  . VAL A 1 24  ? -34.492 81.534  -63.509 1.00   54.32  ? 169  VAL A CA  1 
ATOM   179  C C   . VAL A 1 24  ? -35.898 82.098  -63.547 1.00   56.31  ? 169  VAL A C   1 
ATOM   180  O O   . VAL A 1 24  ? -36.121 83.277  -63.808 1.00   54.76  ? 169  VAL A O   1 
ATOM   181  C CB  . VAL A 1 24  ? -34.228 81.160  -62.014 1.00   53.13  ? 169  VAL A CB  1 
ATOM   182  C CG1 . VAL A 1 24  ? -32.898 80.405  -61.871 1.00   49.87  ? 169  VAL A CG1 1 
ATOM   183  C CG2 . VAL A 1 24  ? -34.217 82.413  -61.173 1.00   48.58  ? 169  VAL A CG2 1 
ATOM   184  N N   . ARG A 1 25  ? -36.854 81.235  -63.262 1.00   59.11  ? 170  ARG A N   1 
ATOM   185  C CA  . ARG A 1 25  ? -38.230 81.658  -63.215 1.00   61.24  ? 170  ARG A CA  1 
ATOM   186  C C   . ARG A 1 25  ? -38.825 81.119  -61.950 1.00   61.96  ? 170  ARG A C   1 
ATOM   187  O O   . ARG A 1 25  ? -38.804 79.914  -61.725 1.00   60.38  ? 170  ARG A O   1 
ATOM   188  C CB  . ARG A 1 25  ? -39.033 81.120  -64.391 1.00   63.82  ? 170  ARG A CB  1 
ATOM   189  C CG  . ARG A 1 25  ? -40.481 81.649  -64.416 1.00   67.42  ? 170  ARG A CG  1 
ATOM   190  C CD  . ARG A 1 25  ? -41.373 80.687  -65.162 1.00   69.62  ? 170  ARG A CD  1 
ATOM   191  N NE  . ARG A 1 25  ? -40.611 80.076  -66.238 1.00   72.26  ? 170  ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 25  ? -40.749 78.811  -66.612 1.00   75.38  ? 170  ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 25  ? -41.635 78.031  -65.990 1.00   76.82  ? 170  ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 25  ? -39.989 78.321  -67.588 1.00   75.93  ? 170  ARG A NH2 1 
ATOM   195  N N   . GLU A 1 26  ? -39.347 82.029  -61.136 1.00   63.64  ? 171  GLU A N   1 
ATOM   196  C CA  . GLU A 1 26  ? -40.005 81.706  -59.878 1.00   65.21  ? 171  GLU A CA  1 
ATOM   197  C C   . GLU A 1 26  ? -41.356 81.057  -60.206 1.00   66.53  ? 171  GLU A C   1 
ATOM   198  O O   . GLU A 1 26  ? -42.270 81.731  -60.667 1.00   67.16  ? 171  GLU A O   1 
ATOM   199  C CB  . GLU A 1 26  ? -40.216 83.003  -59.075 1.00   65.48  ? 171  GLU A CB  1 
ATOM   200  C CG  . GLU A 1 26  ? -40.937 82.852  -57.722 1.00   66.47  ? 171  GLU A CG  1 
ATOM   201  C CD  . GLU A 1 26  ? -41.221 84.198  -57.049 1.00   66.87  ? 171  GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 26  ? -41.747 85.097  -57.744 1.00   67.90  ? 171  GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 26  ? -40.935 84.368  -55.842 1.00   65.19  ? 171  GLU A OE2 1 
ATOM   204  N N   . LYS A 1 27  ? -41.473 79.751  -59.974 1.00   67.68  ? 172  LYS A N   1 
ATOM   205  C CA  . LYS A 1 27  ? -42.710 79.011  -60.239 1.00   68.60  ? 172  LYS A CA  1 
ATOM   206  C C   . LYS A 1 27  ? -43.988 79.622  -59.648 1.00   69.60  ? 172  LYS A C   1 
ATOM   207  O O   . LYS A 1 27  ? -45.086 79.459  -60.190 1.00   69.74  ? 172  LYS A O   1 
ATOM   208  C CB  . LYS A 1 27  ? -42.557 77.575  -59.743 1.00   67.68  ? 172  LYS A CB  1 
ATOM   209  C CG  . LYS A 1 27  ? -41.742 76.734  -60.689 1.00   68.43  ? 172  LYS A CG  1 
ATOM   210  C CD  . LYS A 1 27  ? -41.317 75.403  -60.092 1.00   67.22  ? 172  LYS A CD  1 
ATOM   211  C CE  . LYS A 1 27  ? -40.263 75.604  -59.036 1.00   68.02  ? 172  LYS A CE  1 
ATOM   212  N NZ  . LYS A 1 27  ? -39.555 74.341  -58.713 1.00   67.42  ? 172  LYS A NZ  1 
ATOM   213  N N   . ALA A 1 28  ? -43.846 80.336  -58.542 1.00   71.12  ? 173  ALA A N   1 
ATOM   214  C CA  . ALA A 1 28  ? -44.997 80.945  -57.884 1.00   72.46  ? 173  ALA A CA  1 
ATOM   215  C C   . ALA A 1 28  ? -45.576 82.133  -58.645 1.00   73.14  ? 173  ALA A C   1 
ATOM   216  O O   . ALA A 1 28  ? -46.786 82.341  -58.646 1.00   73.08  ? 173  ALA A O   1 
ATOM   217  C CB  . ALA A 1 28  ? -44.623 81.376  -56.455 1.00   72.19  ? 173  ALA A CB  1 
ATOM   218  N N   . THR A 1 29  ? -44.722 82.901  -59.311 1.00   73.22  ? 174  THR A N   1 
ATOM   219  C CA  . THR A 1 29  ? -45.203 84.072  -60.011 1.00   72.40  ? 174  THR A CA  1 
ATOM   220  C C   . THR A 1 29  ? -45.086 83.954  -61.505 1.00   72.16  ? 174  THR A C   1 
ATOM   221  O O   . THR A 1 29  ? -45.809 84.621  -62.242 1.00   73.47  ? 174  THR A O   1 
ATOM   222  C CB  . THR A 1 29  ? -44.419 85.303  -59.583 1.00   72.72  ? 174  THR A CB  1 
ATOM   223  O OG1 . THR A 1 29  ? -43.051 85.146  -59.981 1.00   74.03  ? 174  THR A OG1 1 
ATOM   224  C CG2 . THR A 1 29  ? -44.483 85.472  -58.072 1.00   71.57  ? 174  THR A CG2 1 
ATOM   225  N N   . GLY A 1 30  ? -44.180 83.102  -61.958 1.00   71.20  ? 175  GLY A N   1 
ATOM   226  C CA  . GLY A 1 30  ? -43.966 82.963  -63.385 1.00   68.63  ? 175  GLY A CA  1 
ATOM   227  C C   . GLY A 1 30  ? -43.030 84.087  -63.784 1.00   67.11  ? 175  GLY A C   1 
ATOM   228  O O   . GLY A 1 30  ? -42.692 84.239  -64.949 1.00   67.93  ? 175  GLY A O   1 
ATOM   229  N N   . ARG A 1 31  ? -42.613 84.876  -62.801 1.00   65.70  ? 176  ARG A N   1 
ATOM   230  C CA  . ARG A 1 31  ? -41.710 86.005  -63.020 1.00   66.25  ? 176  ARG A CA  1 
ATOM   231  C C   . ARG A 1 31  ? -40.225 85.627  -63.223 1.00   64.85  ? 176  ARG A C   1 
ATOM   232  O O   . ARG A 1 31  ? -39.719 84.692  -62.616 1.00   65.06  ? 176  ARG A O   1 
ATOM   233  C CB  . ARG A 1 31  ? -41.814 86.961  -61.838 1.00   68.62  ? 176  ARG A CB  1 
ATOM   234  C CG  . ARG A 1 31  ? -43.137 87.680  -61.709 1.00   72.65  ? 176  ARG A CG  1 
ATOM   235  C CD  . ARG A 1 31  ? -43.317 88.697  -62.823 1.00   76.60  ? 176  ARG A CD  1 
ATOM   236  N NE  . ARG A 1 31  ? -44.635 89.332  -62.771 1.00   81.66  ? 176  ARG A NE  1 
ATOM   237  C CZ  . ARG A 1 31  ? -45.200 89.993  -63.785 1.00   83.89  ? 176  ARG A CZ  1 
ATOM   238  N NH1 . ARG A 1 31  ? -44.566 90.115  -64.951 1.00   84.54  ? 176  ARG A NH1 1 
ATOM   239  N NH2 . ARG A 1 31  ? -46.411 90.528  -63.639 1.00   85.39  ? 176  ARG A NH2 1 
ATOM   240  N N   . TYR A 1 32  ? -39.518 86.374  -64.060 1.00   63.21  ? 177  TYR A N   1 
ATOM   241  C CA  . TYR A 1 32  ? -38.113 86.089  -64.307 1.00   61.15  ? 177  TYR A CA  1 
ATOM   242  C C   . TYR A 1 32  ? -37.142 86.883  -63.461 1.00   60.68  ? 177  TYR A C   1 
ATOM   243  O O   . TYR A 1 32  ? -37.349 88.065  -63.177 1.00   60.58  ? 177  TYR A O   1 
ATOM   244  C CB  . TYR A 1 32  ? -37.766 86.332  -65.762 1.00   61.92  ? 177  TYR A CB  1 
ATOM   245  C CG  . TYR A 1 32  ? -38.437 85.382  -66.699 1.00   62.12  ? 177  TYR A CG  1 
ATOM   246  C CD1 . TYR A 1 32  ? -39.770 85.539  -67.054 1.00   63.13  ? 177  TYR A CD1 1 
ATOM   247  C CD2 . TYR A 1 32  ? -37.755 84.310  -67.207 1.00   62.47  ? 177  TYR A CD2 1 
ATOM   248  C CE1 . TYR A 1 32  ? -40.400 84.631  -67.904 1.00   63.22  ? 177  TYR A CE1 1 
ATOM   249  C CE2 . TYR A 1 32  ? -38.376 83.410  -68.046 1.00   64.42  ? 177  TYR A CE2 1 
ATOM   250  C CZ  . TYR A 1 32  ? -39.690 83.569  -68.389 1.00   63.01  ? 177  TYR A CZ  1 
ATOM   251  O OH  . TYR A 1 32  ? -40.269 82.633  -69.200 1.00   62.69  ? 177  TYR A OH  1 
ATOM   252  N N   . TYR A 1 33  ? -36.067 86.213  -63.065 1.00   59.25  ? 178  TYR A N   1 
ATOM   253  C CA  . TYR A 1 33  ? -35.020 86.837  -62.273 1.00   58.48  ? 178  TYR A CA  1 
ATOM   254  C C   . TYR A 1 33  ? -33.689 86.266  -62.674 1.00   56.50  ? 178  TYR A C   1 
ATOM   255  O O   . TYR A 1 33  ? -33.593 85.246  -63.350 1.00   55.01  ? 178  TYR A O   1 
ATOM   256  C CB  . TYR A 1 33  ? -35.191 86.575  -60.770 1.00   60.09  ? 178  TYR A CB  1 
ATOM   257  C CG  . TYR A 1 33  ? -36.522 86.995  -60.191 1.00   61.91  ? 178  TYR A CG  1 
ATOM   258  C CD1 . TYR A 1 33  ? -37.677 86.256  -60.456 1.00   60.73  ? 178  TYR A CD1 1 
ATOM   259  C CD2 . TYR A 1 33  ? -36.636 88.155  -59.412 1.00   61.64  ? 178  TYR A CD2 1 
ATOM   260  C CE1 . TYR A 1 33  ? -38.905 86.654  -59.976 1.00   61.14  ? 178  TYR A CE1 1 
ATOM   261  C CE2 . TYR A 1 33  ? -37.875 88.565  -58.922 1.00   62.34  ? 178  TYR A CE2 1 
ATOM   262  C CZ  . TYR A 1 33  ? -38.999 87.805  -59.217 1.00   62.33  ? 178  TYR A CZ  1 
ATOM   263  O OH  . TYR A 1 33  ? -40.232 88.204  -58.778 1.00   66.05  ? 178  TYR A OH  1 
ATOM   264  N N   . ALA A 1 34  ? -32.653 86.961  -62.260 1.00   55.64  ? 179  ALA A N   1 
ATOM   265  C CA  . ALA A 1 34  ? -31.321 86.486  -62.495 1.00   54.70  ? 179  ALA A CA  1 
ATOM   266  C C   . ALA A 1 34  ? -30.884 86.068  -61.092 1.00   53.36  ? 179  ALA A C   1 
ATOM   267  O O   . ALA A 1 34  ? -31.109 86.798  -60.120 1.00   51.81  ? 179  ALA A O   1 
ATOM   268  C CB  . ALA A 1 34  ? -30.441 87.596  -63.026 1.00   55.22  ? 179  ALA A CB  1 
ATOM   269  N N   . MET A 1 35  ? -30.312 84.873  -60.991 1.00   53.42  ? 180  MET A N   1 
ATOM   270  C CA  . MET A 1 35  ? -29.837 84.342  -59.710 1.00   53.63  ? 180  MET A CA  1 
ATOM   271  C C   . MET A 1 35  ? -28.328 84.247  -59.740 1.00   53.87  ? 180  MET A C   1 
ATOM   272  O O   . MET A 1 35  ? -27.738 83.552  -60.575 1.00   53.21  ? 180  MET A O   1 
ATOM   273  C CB  . MET A 1 35  ? -30.422 82.954  -59.430 1.00   52.04  ? 180  MET A CB  1 
ATOM   274  C CG  . MET A 1 35  ? -29.999 82.355  -58.091 1.00   52.95  ? 180  MET A CG  1 
ATOM   275  S SD  . MET A 1 35  ? -30.530 80.627  -57.827 1.00   52.86  ? 180  MET A SD  1 
ATOM   276  C CE  . MET A 1 35  ? -32.229 80.845  -57.377 1.00   49.38  ? 180  MET A CE  1 
ATOM   277  N N   . LYS A 1 36  ? -27.717 84.983  -58.828 1.00   55.48  ? 181  LYS A N   1 
ATOM   278  C CA  . LYS A 1 36  ? -26.275 85.030  -58.690 1.00   57.64  ? 181  LYS A CA  1 
ATOM   279  C C   . LYS A 1 36  ? -25.946 83.992  -57.623 1.00   57.27  ? 181  LYS A C   1 
ATOM   280  O O   . LYS A 1 36  ? -26.445 84.064  -56.495 1.00   57.19  ? 181  LYS A O   1 
ATOM   281  C CB  . LYS A 1 36  ? -25.860 86.429  -58.243 1.00   58.85  ? 181  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 36  ? -24.387 86.718  -58.354 1.00   65.26  ? 181  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 36  ? -24.110 88.236  -58.165 1.00   68.72  ? 181  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 36  ? -22.655 88.590  -58.500 1.00   70.65  ? 181  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 36  ? -22.279 89.984  -58.114 1.00   71.81  ? 181  LYS A NZ  1 
ATOM   286  N N   . ILE A 1 37  ? -25.131 83.015  -58.000 1.00   58.04  ? 182  ILE A N   1 
ATOM   287  C CA  . ILE A 1 37  ? -24.731 81.929  -57.103 1.00   59.11  ? 182  ILE A CA  1 
ATOM   288  C C   . ILE A 1 37  ? -23.266 82.074  -56.722 1.00   60.10  ? 182  ILE A C   1 
ATOM   289  O O   . ILE A 1 37  ? -22.370 81.708  -57.480 1.00   59.32  ? 182  ILE A O   1 
ATOM   290  C CB  . ILE A 1 37  ? -24.970 80.556  -57.774 1.00   57.49  ? 182  ILE A CB  1 
ATOM   291  C CG1 . ILE A 1 37  ? -26.450 80.395  -58.089 1.00   55.92  ? 182  ILE A CG1 1 
ATOM   292  C CG2 . ILE A 1 37  ? -24.538 79.436  -56.861 1.00   57.44  ? 182  ILE A CG2 1 
ATOM   293  C CD1 . ILE A 1 37  ? -26.744 79.185  -58.925 1.00   53.48  ? 182  ILE A CD1 1 
ATOM   294  N N   . LEU A 1 38  ? -23.040 82.626  -55.540 1.00   62.54  ? 183  LEU A N   1 
ATOM   295  C CA  . LEU A 1 38  ? -21.695 82.852  -55.049 1.00   65.45  ? 183  LEU A CA  1 
ATOM   296  C C   . LEU A 1 38  ? -21.176 81.759  -54.142 1.00   68.13  ? 183  LEU A C   1 
ATOM   297  O O   . LEU A 1 38  ? -21.823 81.406  -53.149 1.00   67.72  ? 183  LEU A O   1 
ATOM   298  C CB  . LEU A 1 38  ? -21.626 84.166  -54.279 1.00   64.46  ? 183  LEU A CB  1 
ATOM   299  C CG  . LEU A 1 38  ? -21.846 85.429  -55.098 1.00   65.29  ? 183  LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 38  ? -21.602 86.613  -54.199 1.00   65.84  ? 183  LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 38  ? -20.905 85.463  -56.314 1.00   65.04  ? 183  LEU A CD2 1 
ATOM   302  N N   . ARG A 1 39  ? -19.994 81.250  -54.485 1.00   70.64  ? 184  ARG A N   1 
ATOM   303  C CA  . ARG A 1 39  ? -19.340 80.229  -53.692 1.00   73.38  ? 184  ARG A CA  1 
ATOM   304  C C   . ARG A 1 39  ? -19.055 80.893  -52.349 1.00   75.14  ? 184  ARG A C   1 
ATOM   305  O O   . ARG A 1 39  ? -18.630 82.048  -52.302 1.00   74.19  ? 184  ARG A O   1 
ATOM   306  C CB  . ARG A 1 39  ? -18.009 79.827  -54.325 1.00   73.57  ? 184  ARG A CB  1 
ATOM   307  C CG  . ARG A 1 39  ? -18.059 79.535  -55.814 1.00   75.56  ? 184  ARG A CG  1 
ATOM   308  C CD  . ARG A 1 39  ? -18.355 78.063  -56.093 1.00   77.09  ? 184  ARG A CD  1 
ATOM   309  N NE  . ARG A 1 39  ? -18.240 77.689  -57.516 1.00   79.18  ? 184  ARG A NE  1 
ATOM   310  C CZ  . ARG A 1 39  ? -18.915 78.249  -58.530 1.00   79.96  ? 184  ARG A CZ  1 
ATOM   311  N NH1 . ARG A 1 39  ? -19.783 79.246  -58.329 1.00   80.11  ? 184  ARG A NH1 1 
ATOM   312  N NH2 . ARG A 1 39  ? -18.745 77.785  -59.761 1.00   79.74  ? 184  ARG A NH2 1 
ATOM   313  N N   . LYS A 1 40  ? -19.327 80.186  -51.257 1.00   77.69  ? 185  LYS A N   1 
ATOM   314  C CA  . LYS A 1 40  ? -19.040 80.719  -49.934 1.00   80.13  ? 185  LYS A CA  1 
ATOM   315  C C   . LYS A 1 40  ? -17.528 80.573  -49.846 1.00   82.21  ? 185  LYS A C   1 
ATOM   316  O O   . LYS A 1 40  ? -16.824 81.434  -49.311 1.00   81.90  ? 185  LYS A O   1 
ATOM   317  C CB  . LYS A 1 40  ? -19.720 79.878  -48.844 1.00   79.24  ? 185  LYS A CB  1 
ATOM   318  C CG  . LYS A 1 40  ? -21.172 80.265  -48.555 1.00   79.53  ? 185  LYS A CG  1 
ATOM   319  C CD  . LYS A 1 40  ? -21.823 79.330  -47.519 1.00   78.86  ? 185  LYS A CD  1 
ATOM   320  C CE  . LYS A 1 40  ? -23.277 79.715  -47.216 1.00   77.23  ? 185  LYS A CE  1 
ATOM   321  N NZ  . LYS A 1 40  ? -24.009 78.673  -46.434 1.00   76.75  ? 185  LYS A NZ  1 
ATOM   322  N N   . GLU A 1 41  ? -17.048 79.466  -50.411 1.00   84.76  ? 186  GLU A N   1 
ATOM   323  C CA  . GLU A 1 41  ? -15.632 79.133  -50.446 1.00   86.77  ? 186  GLU A CA  1 
ATOM   324  C C   . GLU A 1 41  ? -14.818 80.313  -50.970 1.00   87.92  ? 186  GLU A C   1 
ATOM   325  O O   . GLU A 1 41  ? -13.906 80.798  -50.299 1.00   89.50  ? 186  GLU A O   1 
ATOM   326  C CB  . GLU A 1 41  ? -15.432 77.905  -51.333 1.00   87.50  ? 186  GLU A CB  1 
ATOM   327  C CG  . GLU A 1 41  ? -14.022 77.372  -51.342 1.00   88.86  ? 186  GLU A CG  1 
ATOM   328  C CD  . GLU A 1 41  ? -13.941 75.980  -51.920 1.00   89.20  ? 186  GLU A CD  1 
ATOM   329  O OE1 . GLU A 1 41  ? -14.242 75.810  -53.121 1.00   88.39  ? 186  GLU A OE1 1 
ATOM   330  O OE2 . GLU A 1 41  ? -13.580 75.052  -51.163 1.00   89.85  ? 186  GLU A OE2 1 
ATOM   331  N N   . VAL A 1 42  ? -15.164 80.781  -52.165 1.00   89.13  ? 187  VAL A N   1 
ATOM   332  C CA  . VAL A 1 42  ? -14.489 81.914  -52.794 1.00   89.98  ? 187  VAL A CA  1 
ATOM   333  C C   . VAL A 1 42  ? -14.492 83.179  -51.932 1.00   90.81  ? 187  VAL A C   1 
ATOM   334  O O   . VAL A 1 42  ? -13.533 83.945  -51.963 1.00   91.74  ? 187  VAL A O   1 
ATOM   335  C CB  . VAL A 1 42  ? -15.134 82.243  -54.171 1.00   90.30  ? 187  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 42  ? -14.829 83.692  -54.577 1.00   89.94  ? 187  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 42  ? -14.621 81.271  -55.229 1.00   89.25  ? 187  VAL A CG2 1 
ATOM   338  N N   . ILE A 1 43  ? -15.564 83.406  -51.174 1.00   91.58  ? 188  ILE A N   1 
ATOM   339  C CA  . ILE A 1 43  ? -15.658 84.592  -50.321 1.00   92.25  ? 188  ILE A CA  1 
ATOM   340  C C   . ILE A 1 43  ? -15.238 84.284  -48.886 1.00   92.96  ? 188  ILE A C   1 
ATOM   341  O O   . ILE A 1 43  ? -14.826 85.178  -48.135 1.00   93.09  ? 188  ILE A O   1 
ATOM   342  C CB  . ILE A 1 43  ? -17.107 85.192  -50.307 1.00   92.81  ? 188  ILE A CB  1 
ATOM   343  C CG1 . ILE A 1 43  ? -17.207 86.293  -49.240 1.00   92.55  ? 188  ILE A CG1 1 
ATOM   344  C CG2 . ILE A 1 43  ? -18.141 84.097  -50.051 1.00   92.94  ? 188  ILE A CG2 1 
ATOM   345  C CD1 . ILE A 1 43  ? -18.576 86.911  -49.092 1.00   92.03  ? 188  ILE A CD1 1 
ATOM   346  N N   . VAL A 1 53  ? -18.182 91.120  -49.056 1.00   117.04 ? 198  VAL A N   1 
ATOM   347  C CA  . VAL A 1 53  ? -19.236 91.732  -48.247 1.00   117.38 ? 198  VAL A CA  1 
ATOM   348  C C   . VAL A 1 53  ? -19.793 92.990  -48.912 1.00   117.64 ? 198  VAL A C   1 
ATOM   349  O O   . VAL A 1 53  ? -21.009 93.186  -48.979 1.00   117.65 ? 198  VAL A O   1 
ATOM   350  C CB  . VAL A 1 53  ? -18.698 92.069  -46.861 1.00   116.97 ? 198  VAL A CB  1 
ATOM   351  N N   . THR A 1 54  ? -18.896 93.839  -49.407 1.00   118.03 ? 199  THR A N   1 
ATOM   352  C CA  . THR A 1 54  ? -19.291 95.083  -50.072 1.00   117.93 ? 199  THR A CA  1 
ATOM   353  C C   . THR A 1 54  ? -20.274 94.809  -51.205 1.00   117.47 ? 199  THR A C   1 
ATOM   354  O O   . THR A 1 54  ? -20.788 95.735  -51.826 1.00   117.89 ? 199  THR A O   1 
ATOM   355  C CB  . THR A 1 54  ? -18.056 95.803  -50.620 1.00   117.46 ? 199  THR A CB  1 
ATOM   356  N N   . GLU A 1 55  ? -20.530 93.532  -51.470 1.00   116.84 ? 200  GLU A N   1 
ATOM   357  C CA  . GLU A 1 55  ? -21.443 93.138  -52.535 1.00   116.43 ? 200  GLU A CA  1 
ATOM   358  C C   . GLU A 1 55  ? -22.794 92.678  -51.972 1.00   115.92 ? 200  GLU A C   1 
ATOM   359  O O   . GLU A 1 55  ? -23.842 92.870  -52.592 1.00   115.47 ? 200  GLU A O   1 
ATOM   360  C CB  . GLU A 1 55  ? -20.804 92.019  -53.377 1.00   116.36 ? 200  GLU A CB  1 
ATOM   361  N N   . SER A 1 56  ? -22.766 92.071  -50.794 1.00   115.38 ? 201  SER A N   1 
ATOM   362  C CA  . SER A 1 56  ? -23.986 91.587  -50.176 1.00   114.67 ? 201  SER A CA  1 
ATOM   363  C C   . SER A 1 56  ? -24.597 92.709  -49.357 1.00   114.47 ? 201  SER A C   1 
ATOM   364  O O   . SER A 1 56  ? -23.917 93.687  -49.035 1.00   115.21 ? 201  SER A O   1 
ATOM   365  C CB  . SER A 1 56  ? -23.682 90.388  -49.287 1.00   114.64 ? 201  SER A CB  1 
ATOM   366  N N   . ARG A 1 57  ? -25.879 92.558  -49.027 1.00   113.37 ? 202  ARG A N   1 
ATOM   367  C CA  . ARG A 1 57  ? -26.615 93.539  -48.236 1.00   111.18 ? 202  ARG A CA  1 
ATOM   368  C C   . ARG A 1 57  ? -26.590 94.924  -48.876 1.00   109.74 ? 202  ARG A C   1 
ATOM   369  O O   . ARG A 1 57  ? -27.643 95.499  -49.165 1.00   109.26 ? 202  ARG A O   1 
ATOM   370  C CB  . ARG A 1 57  ? -26.049 93.596  -46.812 1.00   111.46 ? 202  ARG A CB  1 
ATOM   371  N N   . VAL A 1 58  ? -25.387 95.452  -49.098 1.00   108.15 ? 203  VAL A N   1 
ATOM   372  C CA  . VAL A 1 58  ? -25.223 96.773  -49.697 1.00   106.39 ? 203  VAL A CA  1 
ATOM   373  C C   . VAL A 1 58  ? -26.171 96.861  -50.875 1.00   105.05 ? 203  VAL A C   1 
ATOM   374  O O   . VAL A 1 58  ? -27.056 97.714  -50.902 1.00   105.44 ? 203  VAL A O   1 
ATOM   375  C CB  . VAL A 1 58  ? -23.769 96.988  -50.148 1.00   105.73 ? 203  VAL A CB  1 
ATOM   376  N N   . LEU A 1 59  ? -25.998 95.960  -51.837 1.00   103.09 ? 204  LEU A N   1 
ATOM   377  C CA  . LEU A 1 59  ? -26.864 95.934  -53.002 1.00   100.61 ? 204  LEU A CA  1 
ATOM   378  C C   . LEU A 1 59  ? -28.246 95.505  -52.541 1.00   99.31  ? 204  LEU A C   1 
ATOM   379  O O   . LEU A 1 59  ? -29.257 96.006  -53.043 1.00   99.73  ? 204  LEU A O   1 
ATOM   380  C CB  . LEU A 1 59  ? -26.332 94.954  -54.037 1.00   101.11 ? 204  LEU A CB  1 
ATOM   381  N N   . GLN A 1 60  ? -28.279 94.583  -51.574 1.00   96.75  ? 205  GLN A N   1 
ATOM   382  C CA  . GLN A 1 60  ? -29.530 94.054  -51.029 1.00   93.42  ? 205  GLN A CA  1 
ATOM   383  C C   . GLN A 1 60  ? -30.491 95.183  -50.711 1.00   91.25  ? 205  GLN A C   1 
ATOM   384  O O   . GLN A 1 60  ? -31.710 95.064  -50.894 1.00   91.46  ? 205  GLN A O   1 
ATOM   385  C CB  . GLN A 1 60  ? -29.260 93.239  -49.773 1.00   93.15  ? 205  GLN A CB  1 
ATOM   386  N N   . ASN A 1 61  ? -29.941 96.292  -50.241 1.00   87.33  ? 206  ASN A N   1 
ATOM   387  C CA  . ASN A 1 61  ? -30.793 97.404  -49.911 1.00   83.45  ? 206  ASN A CA  1 
ATOM   388  C C   . ASN A 1 61  ? -30.747 98.550  -50.911 1.00   80.31  ? 206  ASN A C   1 
ATOM   389  O O   . ASN A 1 61  ? -31.752 99.248  -51.074 1.00   81.01  ? 206  ASN A O   1 
ATOM   390  C CB  . ASN A 1 61  ? -30.477 97.898  -48.519 1.00   84.67  ? 206  ASN A CB  1 
ATOM   391  N N   . THR A 1 62  ? -29.627 98.759  -51.601 1.00   75.96  ? 207  THR A N   1 
ATOM   392  C CA  . THR A 1 62  ? -29.615 99.875  -52.549 1.00   71.55  ? 207  THR A CA  1 
ATOM   393  C C   . THR A 1 62  ? -30.720 99.664  -53.553 1.00   68.44  ? 207  THR A C   1 
ATOM   394  O O   . THR A 1 62  ? -30.674 98.769  -54.397 1.00   70.07  ? 207  THR A O   1 
ATOM   395  C CB  . THR A 1 62  ? -28.280 100.050 -53.294 1.00   71.55  ? 207  THR A CB  1 
ATOM   396  O OG1 . THR A 1 62  ? -27.933 98.828  -53.960 1.00   71.66  ? 207  THR A OG1 1 
ATOM   397  C CG2 . THR A 1 62  ? -27.180 100.493 -52.326 1.00   69.89  ? 207  THR A CG2 1 
ATOM   398  N N   . ARG A 1 63  ? -31.741 100.489 -53.425 1.00   64.31  ? 208  ARG A N   1 
ATOM   399  C CA  . ARG A 1 63  ? -32.893 100.421 -54.295 1.00   60.57  ? 208  ARG A CA  1 
ATOM   400  C C   . ARG A 1 63  ? -32.914 101.716 -55.094 1.00   55.33  ? 208  ARG A C   1 
ATOM   401  O O   . ARG A 1 63  ? -32.786 102.787 -54.528 1.00   55.64  ? 208  ARG A O   1 
ATOM   402  C CB  . ARG A 1 63  ? -34.149 100.293 -53.439 1.00   63.32  ? 208  ARG A CB  1 
ATOM   403  C CG  . ARG A 1 63  ? -35.434 100.217 -54.211 1.00   68.75  ? 208  ARG A CG  1 
ATOM   404  C CD  . ARG A 1 63  ? -35.872 98.781  -54.464 1.00   72.45  ? 208  ARG A CD  1 
ATOM   405  N NE  . ARG A 1 63  ? -37.169 98.791  -55.136 1.00   75.99  ? 208  ARG A NE  1 
ATOM   406  C CZ  . ARG A 1 63  ? -38.019 97.767  -55.188 1.00   77.45  ? 208  ARG A CZ  1 
ATOM   407  N NH1 . ARG A 1 63  ? -37.723 96.606  -54.601 1.00   77.11  ? 208  ARG A NH1 1 
ATOM   408  N NH2 . ARG A 1 63  ? -39.186 97.923  -55.816 1.00   78.15  ? 208  ARG A NH2 1 
ATOM   409  N N   . HIS A 1 64  ? -33.058 101.624 -56.408 1.00   49.69  ? 209  HIS A N   1 
ATOM   410  C CA  . HIS A 1 64  ? -33.103 102.807 -57.237 1.00   42.28  ? 209  HIS A CA  1 
ATOM   411  C C   . HIS A 1 64  ? -33.705 102.370 -58.533 1.00   41.85  ? 209  HIS A C   1 
ATOM   412  O O   . HIS A 1 64  ? -33.580 101.233 -58.910 1.00   41.07  ? 209  HIS A O   1 
ATOM   413  C CB  . HIS A 1 64  ? -31.710 103.322 -57.455 1.00   38.65  ? 209  HIS A CB  1 
ATOM   414  C CG  . HIS A 1 64  ? -31.631 104.591 -58.230 1.00   37.08  ? 209  HIS A CG  1 
ATOM   415  N ND1 . HIS A 1 64  ? -31.844 104.646 -59.592 1.00   35.24  ? 209  HIS A ND1 1 
ATOM   416  C CD2 . HIS A 1 64  ? -31.223 105.836 -57.858 1.00   37.92  ? 209  HIS A CD2 1 
ATOM   417  C CE1 . HIS A 1 64  ? -31.552 105.860 -60.027 1.00   36.16  ? 209  HIS A CE1 1 
ATOM   418  N NE2 . HIS A 1 64  ? -31.170 106.599 -58.999 1.00   35.10  ? 209  HIS A NE2 1 
ATOM   419  N N   . PRO A 1 65  ? -34.420 103.275 -59.219 1.00   41.88  ? 210  PRO A N   1 
ATOM   420  C CA  . PRO A 1 65  ? -35.067 103.015 -60.497 1.00   39.87  ? 210  PRO A CA  1 
ATOM   421  C C   . PRO A 1 65  ? -34.184 102.326 -61.505 1.00   40.74  ? 210  PRO A C   1 
ATOM   422  O O   . PRO A 1 65  ? -34.657 101.457 -62.243 1.00   40.12  ? 210  PRO A O   1 
ATOM   423  C CB  . PRO A 1 65  ? -35.433 104.416 -60.989 1.00   38.28  ? 210  PRO A CB  1 
ATOM   424  C CG  . PRO A 1 65  ? -35.776 105.107 -59.743 1.00   37.31  ? 210  PRO A CG  1 
ATOM   425  C CD  . PRO A 1 65  ? -34.821 104.596 -58.694 1.00   38.85  ? 210  PRO A CD  1 
ATOM   426  N N   . PHE A 1 66  ? -32.920 102.733 -61.568 1.00   39.68  ? 211  PHE A N   1 
ATOM   427  C CA  . PHE A 1 66  ? -32.044 102.158 -62.562 1.00   42.51  ? 211  PHE A CA  1 
ATOM   428  C C   . PHE A 1 66  ? -31.079 101.091 -62.053 1.00   44.07  ? 211  PHE A C   1 
ATOM   429  O O   . PHE A 1 66  ? -30.191 100.619 -62.779 1.00   44.68  ? 211  PHE A O   1 
ATOM   430  C CB  . PHE A 1 66  ? -31.305 103.285 -63.264 1.00   43.19  ? 211  PHE A CB  1 
ATOM   431  C CG  . PHE A 1 66  ? -32.216 104.408 -63.709 1.00   45.01  ? 211  PHE A CG  1 
ATOM   432  C CD1 . PHE A 1 66  ? -33.314 104.151 -64.506 1.00   43.30  ? 211  PHE A CD1 1 
ATOM   433  C CD2 . PHE A 1 66  ? -31.993 105.721 -63.286 1.00   45.12  ? 211  PHE A CD2 1 
ATOM   434  C CE1 . PHE A 1 66  ? -34.174 105.173 -64.862 1.00   45.16  ? 211  PHE A CE1 1 
ATOM   435  C CE2 . PHE A 1 66  ? -32.850 106.732 -63.642 1.00   42.68  ? 211  PHE A CE2 1 
ATOM   436  C CZ  . PHE A 1 66  ? -33.937 106.458 -64.428 1.00   42.18  ? 211  PHE A CZ  1 
ATOM   437  N N   . LEU A 1 67  ? -31.244 100.699 -60.802 1.00   44.56  ? 212  LEU A N   1 
ATOM   438  C CA  . LEU A 1 67  ? -30.399 99.656  -60.275 1.00   45.01  ? 212  LEU A CA  1 
ATOM   439  C C   . LEU A 1 67  ? -31.226 98.386  -60.142 1.00   45.26  ? 212  LEU A C   1 
ATOM   440  O O   . LEU A 1 67  ? -32.347 98.413  -59.665 1.00   44.95  ? 212  LEU A O   1 
ATOM   441  C CB  . LEU A 1 67  ? -29.816 100.085 -58.937 1.00   44.40  ? 212  LEU A CB  1 
ATOM   442  C CG  . LEU A 1 67  ? -28.674 101.108 -58.992 1.00   44.51  ? 212  LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 67  ? -28.195 101.442 -57.604 1.00   40.93  ? 212  LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 67  ? -27.542 100.536 -59.811 1.00   43.37  ? 212  LEU A CD2 1 
ATOM   445  N N   . THR A 1 68  ? -30.680 97.282  -60.628 1.00   46.87  ? 213  THR A N   1 
ATOM   446  C CA  . THR A 1 68  ? -31.317 95.972  -60.540 1.00   48.30  ? 213  THR A CA  1 
ATOM   447  C C   . THR A 1 68  ? -31.702 95.728  -59.073 1.00   47.13  ? 213  THR A C   1 
ATOM   448  O O   . THR A 1 68  ? -30.892 95.931  -58.180 1.00   47.75  ? 213  THR A O   1 
ATOM   449  C CB  . THR A 1 68  ? -30.308 94.887  -60.946 1.00   50.80  ? 213  THR A CB  1 
ATOM   450  O OG1 . THR A 1 68  ? -29.713 95.240  -62.200 1.00   51.69  ? 213  THR A OG1 1 
ATOM   451  C CG2 . THR A 1 68  ? -30.998 93.535  -61.072 1.00   50.92  ? 213  THR A CG2 1 
ATOM   452  N N   . ALA A 1 69  ? -32.912 95.277  -58.795 1.00   46.70  ? 214  ALA A N   1 
ATOM   453  C CA  . ALA A 1 69  ? -33.269 95.072  -57.393 1.00   47.31  ? 214  ALA A CA  1 
ATOM   454  C C   . ALA A 1 69  ? -33.067 93.654  -56.913 1.00   47.62  ? 214  ALA A C   1 
ATOM   455  O O   . ALA A 1 69  ? -33.242 92.707  -57.676 1.00   47.64  ? 214  ALA A O   1 
ATOM   456  C CB  . ALA A 1 69  ? -34.707 95.479  -57.160 1.00   46.55  ? 214  ALA A CB  1 
ATOM   457  N N   . LEU A 1 70  ? -32.706 93.521  -55.640 1.00   49.26  ? 215  LEU A N   1 
ATOM   458  C CA  . LEU A 1 70  ? -32.483 92.218  -54.999 1.00   51.06  ? 215  LEU A CA  1 
ATOM   459  C C   . LEU A 1 70  ? -33.821 91.731  -54.554 1.00   52.84  ? 215  LEU A C   1 
ATOM   460  O O   . LEU A 1 70  ? -34.354 92.262  -53.618 1.00   53.16  ? 215  LEU A O   1 
ATOM   461  C CB  . LEU A 1 70  ? -31.630 92.362  -53.753 1.00   49.97  ? 215  LEU A CB  1 
ATOM   462  C CG  . LEU A 1 70  ? -31.589 91.045  -52.987 1.00   52.51  ? 215  LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 70  ? -30.714 90.059  -53.751 1.00   50.33  ? 215  LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 70  ? -31.081 91.263  -51.573 1.00   50.09  ? 215  LEU A CD2 1 
ATOM   465  N N   . LYS A 1 71  ? -34.374 90.730  -55.218 1.00   55.96  ? 216  LYS A N   1 
ATOM   466  C CA  . LYS A 1 71  ? -35.678 90.232  -54.829 1.00   58.73  ? 216  LYS A CA  1 
ATOM   467  C C   . LYS A 1 71  ? -35.590 89.349  -53.576 1.00   59.93  ? 216  LYS A C   1 
ATOM   468  O O   . LYS A 1 71  ? -36.235 89.643  -52.571 1.00   61.24  ? 216  LYS A O   1 
ATOM   469  C CB  . LYS A 1 71  ? -36.301 89.476  -55.980 1.00   60.39  ? 216  LYS A CB  1 
ATOM   470  C CG  . LYS A 1 71  ? -37.709 89.112  -55.712 1.00   63.87  ? 216  LYS A CG  1 
ATOM   471  C CD  . LYS A 1 71  ? -38.551 90.347  -55.560 1.00   65.63  ? 216  LYS A CD  1 
ATOM   472  C CE  . LYS A 1 71  ? -40.018 89.964  -55.623 1.00   68.13  ? 216  LYS A CE  1 
ATOM   473  N NZ  . LYS A 1 71  ? -40.280 88.776  -54.768 1.00   69.42  ? 216  LYS A NZ  1 
ATOM   474  N N   . TYR A 1 72  ? -34.813 88.272  -53.619 1.00   59.42  ? 217  TYR A N   1 
ATOM   475  C CA  . TYR A 1 72  ? -34.653 87.448  -52.422 1.00   59.82  ? 217  TYR A CA  1 
ATOM   476  C C   . TYR A 1 72  ? -33.194 87.178  -52.260 1.00   59.90  ? 217  TYR A C   1 
ATOM   477  O O   . TYR A 1 72  ? -32.450 87.211  -53.235 1.00   60.08  ? 217  TYR A O   1 
ATOM   478  C CB  . TYR A 1 72  ? -35.329 86.084  -52.522 1.00   59.59  ? 217  TYR A CB  1 
ATOM   479  C CG  . TYR A 1 72  ? -36.761 86.108  -52.956 1.00   60.02  ? 217  TYR A CG  1 
ATOM   480  C CD1 . TYR A 1 72  ? -37.095 85.931  -54.286 1.00   58.14  ? 217  TYR A CD1 1 
ATOM   481  C CD2 . TYR A 1 72  ? -37.791 86.316  -52.028 1.00   60.71  ? 217  TYR A CD2 1 
ATOM   482  C CE1 . TYR A 1 72  ? -38.424 85.960  -54.698 1.00   61.33  ? 217  TYR A CE1 1 
ATOM   483  C CE2 . TYR A 1 72  ? -39.131 86.340  -52.430 1.00   60.37  ? 217  TYR A CE2 1 
ATOM   484  C CZ  . TYR A 1 72  ? -39.436 86.157  -53.759 1.00   61.30  ? 217  TYR A CZ  1 
ATOM   485  O OH  . TYR A 1 72  ? -40.744 86.102  -54.161 1.00   63.28  ? 217  TYR A OH  1 
ATOM   486  N N   . ALA A 1 73  ? -32.797 86.908  -51.023 1.00   60.59  ? 218  ALA A N   1 
ATOM   487  C CA  . ALA A 1 73  ? -31.422 86.565  -50.694 1.00   61.98  ? 218  ALA A CA  1 
ATOM   488  C C   . ALA A 1 73  ? -31.437 85.360  -49.767 1.00   62.54  ? 218  ALA A C   1 
ATOM   489  O O   . ALA A 1 73  ? -31.791 85.482  -48.596 1.00   63.77  ? 218  ALA A O   1 
ATOM   490  C CB  . ALA A 1 73  ? -30.723 87.716  -50.005 1.00   60.64  ? 218  ALA A CB  1 
ATOM   491  N N   . PHE A 1 74  ? -31.071 84.195  -50.292 1.00   62.83  ? 219  PHE A N   1 
ATOM   492  C CA  . PHE A 1 74  ? -31.012 82.994  -49.474 1.00   61.94  ? 219  PHE A CA  1 
ATOM   493  C C   . PHE A 1 74  ? -29.651 82.338  -49.668 1.00   63.86  ? 219  PHE A C   1 
ATOM   494  O O   . PHE A 1 74  ? -28.858 82.756  -50.523 1.00   63.72  ? 219  PHE A O   1 
ATOM   495  C CB  . PHE A 1 74  ? -32.139 82.011  -49.827 1.00   59.59  ? 219  PHE A CB  1 
ATOM   496  C CG  . PHE A 1 74  ? -31.962 81.317  -51.133 1.00   59.02  ? 219  PHE A CG  1 
ATOM   497  C CD1 . PHE A 1 74  ? -32.367 81.910  -52.309 1.00   57.92  ? 219  PHE A CD1 1 
ATOM   498  C CD2 . PHE A 1 74  ? -31.373 80.059  -51.189 1.00   58.93  ? 219  PHE A CD2 1 
ATOM   499  C CE1 . PHE A 1 74  ? -32.192 81.261  -53.530 1.00   58.02  ? 219  PHE A CE1 1 
ATOM   500  C CE2 . PHE A 1 74  ? -31.194 79.403  -52.402 1.00   59.91  ? 219  PHE A CE2 1 
ATOM   501  C CZ  . PHE A 1 74  ? -31.603 80.004  -53.576 1.00   59.20  ? 219  PHE A CZ  1 
ATOM   502  N N   . GLN A 1 75  ? -29.363 81.328  -48.857 1.00   65.23  ? 220  GLN A N   1 
ATOM   503  C CA  . GLN A 1 75  ? -28.093 80.639  -48.976 1.00   67.58  ? 220  GLN A CA  1 
ATOM   504  C C   . GLN A 1 75  ? -28.222 79.139  -48.813 1.00   66.50  ? 220  GLN A C   1 
ATOM   505  O O   . GLN A 1 75  ? -29.050 78.659  -48.045 1.00   65.64  ? 220  GLN A O   1 
ATOM   506  C CB  . GLN A 1 75  ? -27.089 81.177  -47.947 1.00   71.82  ? 220  GLN A CB  1 
ATOM   507  C CG  . GLN A 1 75  ? -27.516 81.069  -46.485 1.00   75.83  ? 220  GLN A CG  1 
ATOM   508  C CD  . GLN A 1 75  ? -26.319 81.158  -45.538 1.00   79.18  ? 220  GLN A CD  1 
ATOM   509  O OE1 . GLN A 1 75  ? -25.491 82.077  -45.642 1.00   81.50  ? 220  GLN A OE1 1 
ATOM   510  N NE2 . GLN A 1 75  ? -26.217 80.200  -44.611 1.00   79.94  ? 220  GLN A NE2 1 
ATOM   511  N N   . THR A 1 76  ? -27.414 78.405  -49.570 1.00   65.73  ? 221  THR A N   1 
ATOM   512  C CA  . THR A 1 76  ? -27.399 76.960  -49.483 1.00   63.38  ? 221  THR A CA  1 
ATOM   513  C C   . THR A 1 76  ? -26.303 76.804  -48.455 1.00   64.71  ? 221  THR A C   1 
ATOM   514  O O   . THR A 1 76  ? -25.766 77.805  -47.992 1.00   64.82  ? 221  THR A O   1 
ATOM   515  C CB  . THR A 1 76  ? -26.975 76.291  -50.818 1.00   61.34  ? 221  THR A CB  1 
ATOM   516  O OG1 . THR A 1 76  ? -25.677 76.744  -51.212 1.00   57.69  ? 221  THR A OG1 1 
ATOM   517  C CG2 . THR A 1 76  ? -27.961 76.612  -51.910 1.00   60.48  ? 221  THR A CG2 1 
ATOM   518  N N   . HIS A 1 77  ? -25.966 75.576  -48.085 1.00   66.22  ? 222  HIS A N   1 
ATOM   519  C CA  . HIS A 1 77  ? -24.907 75.365  -47.103 1.00   68.11  ? 222  HIS A CA  1 
ATOM   520  C C   . HIS A 1 77  ? -23.560 75.529  -47.813 1.00   68.65  ? 222  HIS A C   1 
ATOM   521  O O   . HIS A 1 77  ? -22.483 75.536  -47.207 1.00   70.62  ? 222  HIS A O   1 
ATOM   522  C CB  . HIS A 1 77  ? -25.028 73.954  -46.498 1.00   68.50  ? 222  HIS A CB  1 
ATOM   523  C CG  . HIS A 1 77  ? -23.841 73.081  -46.767 1.00   69.33  ? 222  HIS A CG  1 
ATOM   524  N ND1 . HIS A 1 77  ? -23.466 72.715  -48.042 1.00   67.82  ? 222  HIS A ND1 1 
ATOM   525  C CD2 . HIS A 1 77  ? -22.914 72.552  -45.931 1.00   68.70  ? 222  HIS A CD2 1 
ATOM   526  C CE1 . HIS A 1 77  ? -22.356 72.003  -47.979 1.00   69.49  ? 222  HIS A CE1 1 
ATOM   527  N NE2 . HIS A 1 77  ? -22.000 71.889  -46.710 1.00   69.29  ? 222  HIS A NE2 1 
ATOM   528  N N   . ASP A 1 78  ? -23.631 75.673  -49.117 1.00   67.79  ? 223  ASP A N   1 
ATOM   529  C CA  . ASP A 1 78  ? -22.435 75.797  -49.911 1.00   67.30  ? 223  ASP A CA  1 
ATOM   530  C C   . ASP A 1 78  ? -22.254 77.205  -50.453 1.00   66.46  ? 223  ASP A C   1 
ATOM   531  O O   . ASP A 1 78  ? -21.162 77.772  -50.384 1.00   66.72  ? 223  ASP A O   1 
ATOM   532  C CB  . ASP A 1 78  ? -22.527 74.821  -51.093 1.00   68.28  ? 223  ASP A CB  1 
ATOM   533  C CG  . ASP A 1 78  ? -21.200 74.554  -51.724 1.00   67.69  ? 223  ASP A CG  1 
ATOM   534  O OD1 . ASP A 1 78  ? -21.166 74.164  -52.920 1.00   69.20  ? 223  ASP A OD1 1 
ATOM   535  O OD2 . ASP A 1 78  ? -20.195 74.726  -51.010 1.00   66.92  ? 223  ASP A OD2 1 
ATOM   536  N N   . ARG A 1 79  ? -23.338 77.771  -50.977 1.00   64.35  ? 224  ARG A N   1 
ATOM   537  C CA  . ARG A 1 79  ? -23.255 79.061  -51.617 1.00   63.02  ? 224  ARG A CA  1 
ATOM   538  C C   . ARG A 1 79  ? -24.217 80.102  -51.128 1.00   63.79  ? 224  ARG A C   1 
ATOM   539  O O   . ARG A 1 79  ? -25.048 79.842  -50.250 1.00   65.18  ? 224  ARG A O   1 
ATOM   540  C CB  . ARG A 1 79  ? -23.442 78.836  -53.105 1.00   62.60  ? 224  ARG A CB  1 
ATOM   541  C CG  . ARG A 1 79  ? -22.890 77.477  -53.502 1.00   61.16  ? 224  ARG A CG  1 
ATOM   542  C CD  . ARG A 1 79  ? -22.761 77.320  -54.954 1.00   60.65  ? 224  ARG A CD  1 
ATOM   543  N NE  . ARG A 1 79  ? -21.868 76.228  -55.266 1.00   62.25  ? 224  ARG A NE  1 
ATOM   544  C CZ  . ARG A 1 79  ? -21.553 75.862  -56.498 1.00   63.64  ? 224  ARG A CZ  1 
ATOM   545  N NH1 . ARG A 1 79  ? -22.064 76.493  -57.541 1.00   65.12  ? 224  ARG A NH1 1 
ATOM   546  N NH2 . ARG A 1 79  ? -20.699 74.877  -56.696 1.00   67.20  ? 224  ARG A NH2 1 
ATOM   547  N N   . LEU A 1 80  ? -24.075 81.297  -51.691 1.00   64.13  ? 225  LEU A N   1 
ATOM   548  C CA  . LEU A 1 80  ? -24.936 82.428  -51.367 1.00   63.47  ? 225  LEU A CA  1 
ATOM   549  C C   . LEU A 1 80  ? -25.769 82.702  -52.619 1.00   62.65  ? 225  LEU A C   1 
ATOM   550  O O   . LEU A 1 80  ? -25.237 82.747  -53.739 1.00   62.37  ? 225  LEU A O   1 
ATOM   551  C CB  . LEU A 1 80  ? -24.094 83.649  -51.004 1.00   64.45  ? 225  LEU A CB  1 
ATOM   552  C CG  . LEU A 1 80  ? -23.121 83.464  -49.834 1.00   65.76  ? 225  LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 80  ? -22.313 84.733  -49.645 1.00   65.89  ? 225  LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 80  ? -23.889 83.146  -48.552 1.00   65.88  ? 225  LEU A CD2 1 
ATOM   555  N N   . CYS A 1 81  ? -27.075 82.861  -52.442 1.00   60.91  ? 226  CYS A N   1 
ATOM   556  C CA  . CYS A 1 81  ? -27.929 83.097  -53.589 1.00   60.44  ? 226  CYS A CA  1 
ATOM   557  C C   . CYS A 1 81  ? -28.701 84.403  -53.554 1.00   58.76  ? 226  CYS A C   1 
ATOM   558  O O   . CYS A 1 81  ? -29.349 84.757  -52.573 1.00   59.34  ? 226  CYS A O   1 
ATOM   559  C CB  . CYS A 1 81  ? -28.869 81.918  -53.788 1.00   59.81  ? 226  CYS A CB  1 
ATOM   560  S SG  . CYS A 1 81  ? -27.940 80.443  -54.213 1.00   65.76  ? 226  CYS A SG  1 
ATOM   561  N N   . PHE A 1 82  ? -28.604 85.123  -54.659 1.00   56.89  ? 227  PHE A N   1 
ATOM   562  C CA  . PHE A 1 82  ? -29.266 86.398  -54.793 1.00   54.23  ? 227  PHE A CA  1 
ATOM   563  C C   . PHE A 1 82  ? -30.143 86.396  -56.019 1.00   52.03  ? 227  PHE A C   1 
ATOM   564  O O   . PHE A 1 82  ? -29.679 86.310  -57.146 1.00   50.07  ? 227  PHE A O   1 
ATOM   565  C CB  . PHE A 1 82  ? -28.218 87.485  -54.868 1.00   54.34  ? 227  PHE A CB  1 
ATOM   566  C CG  . PHE A 1 82  ? -27.274 87.479  -53.701 1.00   54.53  ? 227  PHE A CG  1 
ATOM   567  C CD1 . PHE A 1 82  ? -26.139 86.680  -53.714 1.00   54.77  ? 227  PHE A CD1 1 
ATOM   568  C CD2 . PHE A 1 82  ? -27.512 88.276  -52.598 1.00   54.32  ? 227  PHE A CD2 1 
ATOM   569  C CE1 . PHE A 1 82  ? -25.255 86.684  -52.654 1.00   53.31  ? 227  PHE A CE1 1 
ATOM   570  C CE2 . PHE A 1 82  ? -26.629 88.285  -51.527 1.00   55.58  ? 227  PHE A CE2 1 
ATOM   571  C CZ  . PHE A 1 82  ? -25.498 87.488  -51.559 1.00   54.57  ? 227  PHE A CZ  1 
ATOM   572  N N   . VAL A 1 83  ? -31.433 86.453  -55.776 1.00   50.66  ? 228  VAL A N   1 
ATOM   573  C CA  . VAL A 1 83  ? -32.374 86.446  -56.859 1.00   51.22  ? 228  VAL A CA  1 
ATOM   574  C C   . VAL A 1 83  ? -32.667 87.909  -57.108 1.00   51.88  ? 228  VAL A C   1 
ATOM   575  O O   . VAL A 1 83  ? -33.152 88.617  -56.213 1.00   50.84  ? 228  VAL A O   1 
ATOM   576  C CB  . VAL A 1 83  ? -33.642 85.692  -56.443 1.00   51.07  ? 228  VAL A CB  1 
ATOM   577  C CG1 . VAL A 1 83  ? -34.644 85.725  -57.545 1.00   51.49  ? 228  VAL A CG1 1 
ATOM   578  C CG2 . VAL A 1 83  ? -33.283 84.247  -56.113 1.00   52.90  ? 228  VAL A CG2 1 
ATOM   579  N N   . MET A 1 84  ? -32.343 88.386  -58.307 1.00   52.24  ? 229  MET A N   1 
ATOM   580  C CA  . MET A 1 84  ? -32.596 89.792  -58.596 1.00   52.31  ? 229  MET A CA  1 
ATOM   581  C C   . MET A 1 84  ? -33.423 89.990  -59.832 1.00   50.54  ? 229  MET A C   1 
ATOM   582  O O   . MET A 1 84  ? -33.467 89.148  -60.727 1.00   48.89  ? 229  MET A O   1 
ATOM   583  C CB  . MET A 1 84  ? -31.284 90.550  -58.690 1.00   55.73  ? 229  MET A CB  1 
ATOM   584  C CG  . MET A 1 84  ? -30.396 90.242  -57.514 1.00   61.04  ? 229  MET A CG  1 
ATOM   585  S SD  . MET A 1 84  ? -28.742 90.777  -57.870 1.00   73.28  ? 229  MET A SD  1 
ATOM   586  C CE  . MET A 1 84  ? -28.462 90.039  -59.534 1.00   67.59  ? 229  MET A CE  1 
ATOM   587  N N   . GLU A 1 85  ? -34.110 91.116  -59.857 1.00   51.82  ? 230  GLU A N   1 
ATOM   588  C CA  . GLU A 1 85  ? -34.975 91.439  -60.973 1.00   53.84  ? 230  GLU A CA  1 
ATOM   589  C C   . GLU A 1 85  ? -34.190 91.384  -62.289 1.00   51.82  ? 230  GLU A C   1 
ATOM   590  O O   . GLU A 1 85  ? -33.015 91.767  -62.355 1.00   47.88  ? 230  GLU A O   1 
ATOM   591  C CB  . GLU A 1 85  ? -35.589 92.838  -60.771 1.00   56.51  ? 230  GLU A CB  1 
ATOM   592  C CG  . GLU A 1 85  ? -34.584 93.946  -60.991 1.00   61.35  ? 230  GLU A CG  1 
ATOM   593  C CD  . GLU A 1 85  ? -35.189 95.346  -61.060 1.00   62.04  ? 230  GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 85  ? -36.207 95.537  -61.757 1.00   62.60  ? 230  GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 85  ? -34.617 96.264  -60.427 1.00   63.31  ? 230  GLU A OE2 1 
ATOM   596  N N   . TYR A 1 86  ? -34.853 90.899  -63.329 1.00   51.60  ? 231  TYR A N   1 
ATOM   597  C CA  . TYR A 1 86  ? -34.230 90.819  -64.621 1.00   52.85  ? 231  TYR A CA  1 
ATOM   598  C C   . TYR A 1 86  ? -34.955 91.601  -65.711 1.00   53.79  ? 231  TYR A C   1 
ATOM   599  O O   . TYR A 1 86  ? -36.093 91.281  -66.085 1.00   54.67  ? 231  TYR A O   1 
ATOM   600  C CB  . TYR A 1 86  ? -34.112 89.372  -65.077 1.00   53.66  ? 231  TYR A CB  1 
ATOM   601  C CG  . TYR A 1 86  ? -33.328 89.214  -66.368 1.00   56.00  ? 231  TYR A CG  1 
ATOM   602  C CD1 . TYR A 1 86  ? -31.959 89.511  -66.425 1.00   54.55  ? 231  TYR A CD1 1 
ATOM   603  C CD2 . TYR A 1 86  ? -33.945 88.715  -67.521 1.00   57.40  ? 231  TYR A CD2 1 
ATOM   604  C CE1 . TYR A 1 86  ? -31.222 89.296  -67.605 1.00   55.82  ? 231  TYR A CE1 1 
ATOM   605  C CE2 . TYR A 1 86  ? -33.226 88.497  -68.696 1.00   56.14  ? 231  TYR A CE2 1 
ATOM   606  C CZ  . TYR A 1 86  ? -31.868 88.782  -68.741 1.00   56.41  ? 231  TYR A CZ  1 
ATOM   607  O OH  . TYR A 1 86  ? -31.167 88.538  -69.923 1.00   57.01  ? 231  TYR A OH  1 
ATOM   608  N N   . ALA A 1 87  ? -34.256 92.603  -66.233 1.00   53.00  ? 232  ALA A N   1 
ATOM   609  C CA  . ALA A 1 87  ? -34.745 93.450  -67.316 1.00   53.69  ? 232  ALA A CA  1 
ATOM   610  C C   . ALA A 1 87  ? -34.982 92.586  -68.540 1.00   54.12  ? 232  ALA A C   1 
ATOM   611  O O   . ALA A 1 87  ? -34.090 91.825  -68.948 1.00   55.06  ? 232  ALA A O   1 
ATOM   612  C CB  . ALA A 1 87  ? -33.705 94.504  -67.641 1.00   50.64  ? 232  ALA A CB  1 
ATOM   613  N N   . ASN A 1 88  ? -36.159 92.695  -69.146 1.00   53.73  ? 233  ASN A N   1 
ATOM   614  C CA  . ASN A 1 88  ? -36.415 91.880  -70.325 1.00   54.82  ? 233  ASN A CA  1 
ATOM   615  C C   . ASN A 1 88  ? -36.488 92.659  -71.629 1.00   54.93  ? 233  ASN A C   1 
ATOM   616  O O   . ASN A 1 88  ? -37.047 92.176  -72.604 1.00   55.82  ? 233  ASN A O   1 
ATOM   617  C CB  . ASN A 1 88  ? -37.692 91.061  -70.134 1.00   56.55  ? 233  ASN A CB  1 
ATOM   618  C CG  . ASN A 1 88  ? -38.894 91.928  -69.958 1.00   54.82  ? 233  ASN A CG  1 
ATOM   619  O OD1 . ASN A 1 88  ? -39.492 92.336  -70.919 1.00   54.30  ? 233  ASN A OD1 1 
ATOM   620  N ND2 . ASN A 1 88  ? -39.234 92.241  -68.713 1.00   57.26  ? 233  ASN A ND2 1 
ATOM   621  N N   . GLY A 1 89  ? -35.927 93.864  -71.649 1.00   55.31  ? 234  GLY A N   1 
ATOM   622  C CA  . GLY A 1 89  ? -35.922 94.650  -72.871 1.00   54.46  ? 234  GLY A CA  1 
ATOM   623  C C   . GLY A 1 89  ? -34.595 94.526  -73.617 1.00   55.55  ? 234  GLY A C   1 
ATOM   624  O O   . GLY A 1 89  ? -34.265 95.349  -74.486 1.00   55.56  ? 234  GLY A O   1 
ATOM   625  N N   . GLY A 1 90  ? -33.813 93.497  -73.285 1.00   53.61  ? 235  GLY A N   1 
ATOM   626  C CA  . GLY A 1 90  ? -32.551 93.309  -73.961 1.00   50.15  ? 235  GLY A CA  1 
ATOM   627  C C   . GLY A 1 90  ? -31.399 94.089  -73.382 1.00   49.74  ? 235  GLY A C   1 
ATOM   628  O O   . GLY A 1 90  ? -31.559 95.003  -72.570 1.00   49.12  ? 235  GLY A O   1 
ATOM   629  N N   . GLU A 1 91  ? -30.216 93.717  -73.833 1.00   50.48  ? 236  GLU A N   1 
ATOM   630  C CA  . GLU A 1 91  ? -28.963 94.312  -73.388 1.00   51.40  ? 236  GLU A CA  1 
ATOM   631  C C   . GLU A 1 91  ? -28.544 95.449  -74.284 1.00   50.71  ? 236  GLU A C   1 
ATOM   632  O O   . GLU A 1 91  ? -28.697 95.395  -75.505 1.00   49.47  ? 236  GLU A O   1 
ATOM   633  C CB  . GLU A 1 91  ? -27.887 93.230  -73.369 1.00   53.23  ? 236  GLU A CB  1 
ATOM   634  C CG  . GLU A 1 91  ? -28.413 91.961  -74.053 1.00   59.32  ? 236  GLU A CG  1 
ATOM   635  C CD  . GLU A 1 91  ? -28.306 90.709  -73.189 1.00   61.73  ? 236  GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 91  ? -28.905 89.669  -73.572 1.00   63.16  ? 236  GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 91  ? -27.616 90.765  -72.145 1.00   63.81  ? 236  GLU A OE2 1 
ATOM   638  N N   . LEU A 1 92  ? -28.003 96.476  -73.651 1.00   51.10  ? 237  LEU A N   1 
ATOM   639  C CA  . LEU A 1 92  ? -27.562 97.645  -74.352 1.00   53.03  ? 237  LEU A CA  1 
ATOM   640  C C   . LEU A 1 92  ? -26.584 97.312  -75.467 1.00   53.87  ? 237  LEU A C   1 
ATOM   641  O O   . LEU A 1 92  ? -26.703 97.826  -76.580 1.00   55.02  ? 237  LEU A O   1 
ATOM   642  C CB  . LEU A 1 92  ? -26.939 98.618  -73.376 1.00   52.13  ? 237  LEU A CB  1 
ATOM   643  C CG  . LEU A 1 92  ? -27.663 99.951  -73.212 1.00   52.99  ? 237  LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 92  ? -26.576 101.002 -73.230 1.00   52.16  ? 237  LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 92  ? -28.695 100.232 -74.328 1.00   51.27  ? 237  LEU A CD2 1 
ATOM   646  N N   . PHE A 1 93  ? -25.615 96.463  -75.170 1.00   55.24  ? 238  PHE A N   1 
ATOM   647  C CA  . PHE A 1 93  ? -24.642 96.060  -76.170 1.00   56.59  ? 238  PHE A CA  1 
ATOM   648  C C   . PHE A 1 93  ? -25.392 95.612  -77.443 1.00   55.85  ? 238  PHE A C   1 
ATOM   649  O O   . PHE A 1 93  ? -25.150 96.124  -78.540 1.00   55.62  ? 238  PHE A O   1 
ATOM   650  C CB  . PHE A 1 93  ? -23.783 94.924  -75.611 1.00   61.04  ? 238  PHE A CB  1 
ATOM   651  C CG  . PHE A 1 93  ? -23.201 94.040  -76.670 1.00   66.64  ? 238  PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 93  ? -22.118 94.477  -77.448 1.00   69.13  ? 238  PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 93  ? -23.775 92.798  -76.944 1.00   68.21  ? 238  PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 93  ? -21.612 93.696  -78.488 1.00   70.13  ? 238  PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 93  ? -23.288 92.003  -77.979 1.00   70.27  ? 238  PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 93  ? -22.200 92.452  -78.758 1.00   71.10  ? 238  PHE A CZ  1 
ATOM   657  N N   . PHE A 1 94  ? -26.330 94.684  -77.301 1.00   54.38  ? 239  PHE A N   1 
ATOM   658  C CA  . PHE A 1 94  ? -27.077 94.234  -78.467 1.00   53.99  ? 239  PHE A CA  1 
ATOM   659  C C   . PHE A 1 94  ? -27.746 95.375  -79.269 1.00   52.71  ? 239  PHE A C   1 
ATOM   660  O O   . PHE A 1 94  ? -27.702 95.360  -80.508 1.00   52.82  ? 239  PHE A O   1 
ATOM   661  C CB  . PHE A 1 94  ? -28.141 93.204  -78.046 1.00   56.74  ? 239  PHE A CB  1 
ATOM   662  C CG  . PHE A 1 94  ? -29.178 92.893  -79.129 1.00   60.07  ? 239  PHE A CG  1 
ATOM   663  C CD1 . PHE A 1 94  ? -28.857 92.077  -80.230 1.00   60.78  ? 239  PHE A CD1 1 
ATOM   664  C CD2 . PHE A 1 94  ? -30.484 93.421  -79.043 1.00   60.40  ? 239  PHE A CD2 1 
ATOM   665  C CE1 . PHE A 1 94  ? -29.827 91.788  -81.232 1.00   60.54  ? 239  PHE A CE1 1 
ATOM   666  C CE2 . PHE A 1 94  ? -31.455 93.141  -80.032 1.00   61.65  ? 239  PHE A CE2 1 
ATOM   667  C CZ  . PHE A 1 94  ? -31.123 92.320  -81.130 1.00   61.24  ? 239  PHE A CZ  1 
ATOM   668  N N   . HIS A 1 95  ? -28.380 96.332  -78.576 1.00   50.27  ? 240  HIS A N   1 
ATOM   669  C CA  . HIS A 1 95  ? -29.059 97.458  -79.230 1.00   48.35  ? 240  HIS A CA  1 
ATOM   670  C C   . HIS A 1 95  ? -28.031 98.390  -79.854 1.00   48.83  ? 240  HIS A C   1 
ATOM   671  O O   . HIS A 1 95  ? -28.125 98.766  -81.006 1.00   48.61  ? 240  HIS A O   1 
ATOM   672  C CB  . HIS A 1 95  ? -29.897 98.249  -78.224 1.00   47.46  ? 240  HIS A CB  1 
ATOM   673  C CG  . HIS A 1 95  ? -31.039 97.478  -77.663 1.00   42.79  ? 240  HIS A CG  1 
ATOM   674  N ND1 . HIS A 1 95  ? -32.044 96.972  -78.454 1.00   42.67  ? 240  HIS A ND1 1 
ATOM   675  C CD2 . HIS A 1 95  ? -31.304 97.064  -76.403 1.00   45.38  ? 240  HIS A CD2 1 
ATOM   676  C CE1 . HIS A 1 95  ? -32.878 96.269  -77.710 1.00   42.49  ? 240  HIS A CE1 1 
ATOM   677  N NE2 . HIS A 1 95  ? -32.452 96.306  -76.460 1.00   46.29  ? 240  HIS A NE2 1 
ATOM   678  N N   . LEU A 1 96  ? -27.041 98.770  -79.076 1.00   48.72  ? 241  LEU A N   1 
ATOM   679  C CA  . LEU A 1 96  ? -26.016 99.615  -79.608 1.00   48.27  ? 241  LEU A CA  1 
ATOM   680  C C   . LEU A 1 96  ? -25.512 99.068  -80.932 1.00   51.25  ? 241  LEU A C   1 
ATOM   681  O O   . LEU A 1 96  ? -25.641 99.713  -81.983 1.00   52.66  ? 241  LEU A O   1 
ATOM   682  C CB  . LEU A 1 96  ? -24.844 99.698  -78.635 1.00   43.93  ? 241  LEU A CB  1 
ATOM   683  C CG  . LEU A 1 96  ? -23.848 100.747 -79.142 1.00   42.18  ? 241  LEU A CG  1 
ATOM   684  C CD1 . LEU A 1 96  ? -24.552 102.091 -79.474 1.00   39.09  ? 241  LEU A CD1 1 
ATOM   685  C CD2 . LEU A 1 96  ? -22.754 100.912 -78.100 1.00   40.94  ? 241  LEU A CD2 1 
ATOM   686  N N   . SER A 1 97  ? -24.935 97.873  -80.885 1.00   53.88  ? 242  SER A N   1 
ATOM   687  C CA  . SER A 1 97  ? -24.373 97.279  -82.084 1.00   56.30  ? 242  SER A CA  1 
ATOM   688  C C   . SER A 1 97  ? -25.357 97.200  -83.248 1.00   57.94  ? 242  SER A C   1 
ATOM   689  O O   . SER A 1 97  ? -24.948 97.239  -84.400 1.00   58.64  ? 242  SER A O   1 
ATOM   690  C CB  . SER A 1 97  ? -23.801 95.908  -81.765 1.00   55.50  ? 242  SER A CB  1 
ATOM   691  O OG  . SER A 1 97  ? -24.823 94.960  -81.764 1.00   57.57  ? 242  SER A OG  1 
ATOM   692  N N   . ARG A 1 98  ? -26.653 97.117  -82.975 1.00   60.08  ? 243  ARG A N   1 
ATOM   693  C CA  . ARG A 1 98  ? -27.595 97.078  -84.081 1.00   62.59  ? 243  ARG A CA  1 
ATOM   694  C C   . ARG A 1 98  ? -27.809 98.463  -84.653 1.00   63.70  ? 243  ARG A C   1 
ATOM   695  O O   . ARG A 1 98  ? -28.764 98.690  -85.388 1.00   64.43  ? 243  ARG A O   1 
ATOM   696  C CB  . ARG A 1 98  ? -28.943 96.520  -83.638 1.00   65.15  ? 243  ARG A CB  1 
ATOM   697  C CG  . ARG A 1 98  ? -28.902 95.046  -83.184 1.00   69.57  ? 243  ARG A CG  1 
ATOM   698  C CD  . ARG A 1 98  ? -30.314 94.447  -83.128 1.00   71.22  ? 243  ARG A CD  1 
ATOM   699  N NE  . ARG A 1 98  ? -30.870 94.153  -84.450 1.00   74.51  ? 243  ARG A NE  1 
ATOM   700  C CZ  . ARG A 1 98  ? -32.154 93.892  -84.681 1.00   74.37  ? 243  ARG A CZ  1 
ATOM   701  N NH1 . ARG A 1 98  ? -33.011 93.893  -83.669 1.00   75.25  ? 243  ARG A NH1 1 
ATOM   702  N NH2 . ARG A 1 98  ? -32.578 93.631  -85.917 1.00   73.16  ? 243  ARG A NH2 1 
ATOM   703  N N   . GLU A 1 99  ? -26.923 99.396  -84.320 1.00   63.05  ? 244  GLU A N   1 
ATOM   704  C CA  . GLU A 1 99  ? -27.066 100.769 -84.791 1.00   62.40  ? 244  GLU A CA  1 
ATOM   705  C C   . GLU A 1 99  ? -25.704 101.415 -84.947 1.00   61.68  ? 244  GLU A C   1 
ATOM   706  O O   . GLU A 1 99  ? -25.594 102.533 -85.469 1.00   60.34  ? 244  GLU A O   1 
ATOM   707  C CB  . GLU A 1 99  ? -27.874 101.595 -83.787 1.00   63.60  ? 244  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 99  ? -29.122 100.899 -83.262 1.00   66.89  ? 244  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 99  ? -30.297 101.843 -83.089 1.00   69.41  ? 244  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 99  ? -30.883 101.872 -81.978 1.00   71.63  ? 244  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 99  ? -30.641 102.549 -84.071 1.00   71.41  ? 244  GLU A OE2 1 
ATOM   712  N N   . ARG A 1 100 ? -24.687 100.697 -84.470 1.00   59.40  ? 245  ARG A N   1 
ATOM   713  C CA  . ARG A 1 100 ? -23.296 101.124 -84.492 1.00   58.51  ? 245  ARG A CA  1 
ATOM   714  C C   . ARG A 1 100 ? -23.101 102.270 -83.515 1.00   56.48  ? 245  ARG A C   1 
ATOM   715  O O   . ARG A 1 100 ? -22.124 102.302 -82.775 1.00   56.74  ? 245  ARG A O   1 
ATOM   716  C CB  . ARG A 1 100 ? -22.852 101.538 -85.901 1.00   59.51  ? 245  ARG A CB  1 
ATOM   717  C CG  . ARG A 1 100 ? -21.610 102.417 -85.902 1.00   62.54  ? 245  ARG A CG  1 
ATOM   718  C CD  . ARG A 1 100 ? -20.293 101.673 -85.758 1.00   65.84  ? 245  ARG A CD  1 
ATOM   719  N NE  . ARG A 1 100 ? -19.771 101.255 -87.060 1.00   68.95  ? 245  ARG A NE  1 
ATOM   720  C CZ  . ARG A 1 100 ? -19.914 100.035 -87.584 1.00   70.10  ? 245  ARG A CZ  1 
ATOM   721  N NH1 . ARG A 1 100 ? -20.561 99.075  -86.919 1.00   70.25  ? 245  ARG A NH1 1 
ATOM   722  N NH2 . ARG A 1 100 ? -19.429 99.780  -88.797 1.00   69.60  ? 245  ARG A NH2 1 
ATOM   723  N N   . VAL A 1 101 ? -24.014 103.228 -83.534 1.00   54.00  ? 246  VAL A N   1 
ATOM   724  C CA  . VAL A 1 101 ? -23.920 104.329 -82.603 1.00   52.48  ? 246  VAL A CA  1 
ATOM   725  C C   . VAL A 1 101 ? -25.309 104.830 -82.265 1.00   51.00  ? 246  VAL A C   1 
ATOM   726  O O   . VAL A 1 101 ? -26.292 104.549 -82.954 1.00   48.69  ? 246  VAL A O   1 
ATOM   727  C CB  . VAL A 1 101 ? -23.101 105.521 -83.136 1.00   52.60  ? 246  VAL A CB  1 
ATOM   728  C CG1 . VAL A 1 101 ? -22.465 106.264 -81.987 1.00   53.74  ? 246  VAL A CG1 1 
ATOM   729  C CG2 . VAL A 1 101 ? -22.042 105.067 -84.083 1.00   55.11  ? 246  VAL A CG2 1 
ATOM   730  N N   . PHE A 1 102 ? -25.369 105.545 -81.161 1.00   49.22  ? 247  PHE A N   1 
ATOM   731  C CA  . PHE A 1 102 ? -26.601 106.104 -80.699 1.00   49.35  ? 247  PHE A CA  1 
ATOM   732  C C   . PHE A 1 102 ? -26.530 107.602 -80.935 1.00   50.40  ? 247  PHE A C   1 
ATOM   733  O O   . PHE A 1 102 ? -25.459 108.220 -80.857 1.00   47.84  ? 247  PHE A O   1 
ATOM   734  C CB  . PHE A 1 102 ? -26.769 105.908 -79.187 1.00   48.09  ? 247  PHE A CB  1 
ATOM   735  C CG  . PHE A 1 102 ? -27.272 104.576 -78.792 1.00   45.62  ? 247  PHE A CG  1 
ATOM   736  C CD1 . PHE A 1 102 ? -27.995 103.801 -79.674 1.00   47.19  ? 247  PHE A CD1 1 
ATOM   737  C CD2 . PHE A 1 102 ? -27.070 104.121 -77.514 1.00   44.79  ? 247  PHE A CD2 1 
ATOM   738  C CE1 . PHE A 1 102 ? -28.511 102.583 -79.273 1.00   47.09  ? 247  PHE A CE1 1 
ATOM   739  C CE2 . PHE A 1 102 ? -27.582 102.902 -77.097 1.00   46.82  ? 247  PHE A CE2 1 
ATOM   740  C CZ  . PHE A 1 102 ? -28.306 102.129 -77.980 1.00   46.08  ? 247  PHE A CZ  1 
ATOM   741  N N   . THR A 1 103 ? -27.691 108.171 -81.202 1.00   50.92  ? 248  THR A N   1 
ATOM   742  C CA  . THR A 1 103 ? -27.828 109.607 -81.367 1.00   53.80  ? 248  THR A CA  1 
ATOM   743  C C   . THR A 1 103 ? -27.352 110.264 -80.081 1.00   52.35  ? 248  THR A C   1 
ATOM   744  O O   . THR A 1 103 ? -27.504 109.710 -79.011 1.00   51.74  ? 248  THR A O   1 
ATOM   745  C CB  . THR A 1 103 ? -29.274 109.937 -81.573 1.00   54.69  ? 248  THR A CB  1 
ATOM   746  O OG1 . THR A 1 103 ? -29.533 110.014 -82.978 1.00   56.31  ? 248  THR A OG1 1 
ATOM   747  C CG2 . THR A 1 103 ? -29.632 111.199 -80.857 1.00   56.65  ? 248  THR A CG2 1 
ATOM   748  N N   . GLU A 1 104 ? -26.767 111.438 -80.176 1.00   53.79  ? 249  GLU A N   1 
ATOM   749  C CA  . GLU A 1 104 ? -26.303 112.077 -78.971 1.00   55.99  ? 249  GLU A CA  1 
ATOM   750  C C   . GLU A 1 104 ? -27.427 112.292 -77.961 1.00   56.74  ? 249  GLU A C   1 
ATOM   751  O O   . GLU A 1 104 ? -27.197 112.376 -76.768 1.00   57.59  ? 249  GLU A O   1 
ATOM   752  C CB  . GLU A 1 104 ? -25.620 113.393 -79.301 1.00   54.99  ? 249  GLU A CB  1 
ATOM   753  C CG  . GLU A 1 104 ? -24.243 113.221 -79.848 1.00   58.38  ? 249  GLU A CG  1 
ATOM   754  C CD  . GLU A 1 104 ? -23.457 114.516 -79.863 1.00   59.51  ? 249  GLU A CD  1 
ATOM   755  O OE1 . GLU A 1 104 ? -23.460 115.198 -78.822 1.00   62.44  ? 249  GLU A OE1 1 
ATOM   756  O OE2 . GLU A 1 104 ? -22.837 114.853 -80.900 1.00   60.01  ? 249  GLU A OE2 1 
ATOM   757  N N   . GLU A 1 105 ? -28.654 112.373 -78.416 1.00   57.05  ? 250  GLU A N   1 
ATOM   758  C CA  . GLU A 1 105 ? -29.695 112.578 -77.446 1.00   58.53  ? 250  GLU A CA  1 
ATOM   759  C C   . GLU A 1 105 ? -30.041 111.277 -76.788 1.00   57.88  ? 250  GLU A C   1 
ATOM   760  O O   . GLU A 1 105 ? -30.551 111.261 -75.668 1.00   59.38  ? 250  GLU A O   1 
ATOM   761  C CB  . GLU A 1 105 ? -30.941 113.190 -78.079 1.00   59.93  ? 250  GLU A CB  1 
ATOM   762  C CG  . GLU A 1 105 ? -30.988 114.708 -77.944 1.00   63.22  ? 250  GLU A CG  1 
ATOM   763  C CD  . GLU A 1 105 ? -30.940 115.191 -76.482 1.00   64.77  ? 250  GLU A CD  1 
ATOM   764  O OE1 . GLU A 1 105 ? -29.821 115.479 -75.978 1.00   63.38  ? 250  GLU A OE1 1 
ATOM   765  O OE2 . GLU A 1 105 ? -32.027 115.268 -75.842 1.00   64.75  ? 250  GLU A OE2 1 
ATOM   766  N N   . ARG A 1 106 ? -29.787 110.184 -77.491 1.00   54.79  ? 251  ARG A N   1 
ATOM   767  C CA  . ARG A 1 106 ? -30.053 108.870 -76.940 1.00   50.94  ? 251  ARG A CA  1 
ATOM   768  C C   . ARG A 1 106 ? -28.947 108.640 -75.911 1.00   47.65  ? 251  ARG A C   1 
ATOM   769  O O   . ARG A 1 106 ? -29.216 108.311 -74.766 1.00   46.86  ? 251  ARG A O   1 
ATOM   770  C CB  . ARG A 1 106 ? -30.002 107.815 -78.041 1.00   53.71  ? 251  ARG A CB  1 
ATOM   771  C CG  . ARG A 1 106 ? -31.290 107.014 -78.214 1.00   54.01  ? 251  ARG A CG  1 
ATOM   772  C CD  . ARG A 1 106 ? -30.997 105.536 -78.033 1.00   56.02  ? 251  ARG A CD  1 
ATOM   773  N NE  . ARG A 1 106 ? -31.619 104.681 -79.042 1.00   59.30  ? 251  ARG A NE  1 
ATOM   774  C CZ  . ARG A 1 106 ? -31.621 103.345 -79.005 1.00   60.00  ? 251  ARG A CZ  1 
ATOM   775  N NH1 . ARG A 1 106 ? -31.038 102.698 -78.008 1.00   60.30  ? 251  ARG A NH1 1 
ATOM   776  N NH2 . ARG A 1 106 ? -32.205 102.650 -79.968 1.00   60.77  ? 251  ARG A NH2 1 
ATOM   777  N N   . ALA A 1 107 ? -27.699 108.843 -76.291 1.00   44.95  ? 252  ALA A N   1 
ATOM   778  C CA  . ALA A 1 107 ? -26.634 108.641 -75.314 1.00   45.28  ? 252  ALA A CA  1 
ATOM   779  C C   . ALA A 1 107 ? -27.176 109.308 -74.068 1.00   44.45  ? 252  ALA A C   1 
ATOM   780  O O   . ALA A 1 107 ? -27.369 108.679 -73.025 1.00   45.80  ? 252  ALA A O   1 
ATOM   781  C CB  . ALA A 1 107 ? -25.346 109.337 -75.737 1.00   42.53  ? 252  ALA A CB  1 
ATOM   782  N N   . ARG A 1 108 ? -27.407 110.607 -74.210 1.00   42.32  ? 253  ARG A N   1 
ATOM   783  C CA  . ARG A 1 108 ? -27.930 111.466 -73.164 1.00   36.91  ? 253  ARG A CA  1 
ATOM   784  C C   . ARG A 1 108 ? -29.028 110.798 -72.388 1.00   34.62  ? 253  ARG A C   1 
ATOM   785  O O   . ARG A 1 108 ? -28.973 110.670 -71.181 1.00   36.96  ? 253  ARG A O   1 
ATOM   786  C CB  . ARG A 1 108 ? -28.438 112.694 -73.788 1.00   35.55  ? 253  ARG A CB  1 
ATOM   787  N N   . PHE A 1 109 ? -30.045 110.336 -73.064 1.00   32.31  ? 254  PHE A N   1 
ATOM   788  C CA  . PHE A 1 109 ? -31.089 109.736 -72.304 1.00   33.68  ? 254  PHE A CA  1 
ATOM   789  C C   . PHE A 1 109 ? -30.563 108.639 -71.389 1.00   36.85  ? 254  PHE A C   1 
ATOM   790  O O   . PHE A 1 109 ? -30.948 108.584 -70.232 1.00   38.14  ? 254  PHE A O   1 
ATOM   791  C CB  . PHE A 1 109 ? -32.114 109.149 -73.199 1.00   35.29  ? 254  PHE A CB  1 
ATOM   792  C CG  . PHE A 1 109 ? -33.190 108.466 -72.452 1.00   41.48  ? 254  PHE A CG  1 
ATOM   793  C CD1 . PHE A 1 109 ? -34.243 109.199 -71.920 1.00   40.79  ? 254  PHE A CD1 1 
ATOM   794  C CD2 . PHE A 1 109 ? -33.157 107.077 -72.276 1.00   42.94  ? 254  PHE A CD2 1 
ATOM   795  C CE1 . PHE A 1 109 ? -35.274 108.573 -71.223 1.00   42.86  ? 254  PHE A CE1 1 
ATOM   796  C CE2 . PHE A 1 109 ? -34.183 106.415 -71.581 1.00   45.98  ? 254  PHE A CE2 1 
ATOM   797  C CZ  . PHE A 1 109 ? -35.257 107.174 -71.049 1.00   45.06  ? 254  PHE A CZ  1 
ATOM   798  N N   . TYR A 1 110 ? -29.700 107.755 -71.911 1.00   37.46  ? 255  TYR A N   1 
ATOM   799  C CA  . TYR A 1 110 ? -29.125 106.643 -71.115 1.00   35.25  ? 255  TYR A CA  1 
ATOM   800  C C   . TYR A 1 110 ? -28.133 107.128 -70.091 1.00   34.83  ? 255  TYR A C   1 
ATOM   801  O O   . TYR A 1 110 ? -28.161 106.703 -68.955 1.00   38.17  ? 255  TYR A O   1 
ATOM   802  C CB  . TYR A 1 110 ? -28.433 105.580 -72.007 1.00   31.44  ? 255  TYR A CB  1 
ATOM   803  C CG  . TYR A 1 110 ? -29.415 104.868 -72.933 1.00   31.40  ? 255  TYR A CG  1 
ATOM   804  C CD1 . TYR A 1 110 ? -30.608 104.391 -72.455 1.00   30.61  ? 255  TYR A CD1 1 
ATOM   805  C CD2 . TYR A 1 110 ? -29.164 104.734 -74.298 1.00   31.48  ? 255  TYR A CD2 1 
ATOM   806  C CE1 . TYR A 1 110 ? -31.520 103.813 -73.300 1.00   33.33  ? 255  TYR A CE1 1 
ATOM   807  C CE2 . TYR A 1 110 ? -30.091 104.153 -75.149 1.00   28.00  ? 255  TYR A CE2 1 
ATOM   808  C CZ  . TYR A 1 110 ? -31.255 103.699 -74.640 1.00   28.84  ? 255  TYR A CZ  1 
ATOM   809  O OH  . TYR A 1 110 ? -32.180 103.102 -75.434 1.00   30.97  ? 255  TYR A OH  1 
ATOM   810  N N   . GLY A 1 111 ? -27.261 108.039 -70.464 1.00   33.73  ? 256  GLY A N   1 
ATOM   811  C CA  . GLY A 1 111 ? -26.288 108.454 -69.496 1.00   32.26  ? 256  GLY A CA  1 
ATOM   812  C C   . GLY A 1 111 ? -26.889 109.096 -68.281 1.00   37.05  ? 256  GLY A C   1 
ATOM   813  O O   . GLY A 1 111 ? -26.360 108.917 -67.163 1.00   40.28  ? 256  GLY A O   1 
ATOM   814  N N   . ALA A 1 112 ? -27.959 109.880 -68.474 1.00   34.96  ? 257  ALA A N   1 
ATOM   815  C CA  . ALA A 1 112 ? -28.589 110.573 -67.352 1.00   33.15  ? 257  ALA A CA  1 
ATOM   816  C C   . ALA A 1 112 ? -29.211 109.560 -66.366 1.00   31.14  ? 257  ALA A C   1 
ATOM   817  O O   . ALA A 1 112 ? -29.115 109.757 -65.189 1.00   32.90  ? 257  ALA A O   1 
ATOM   818  C CB  . ALA A 1 112 ? -29.699 111.583 -67.864 1.00   34.83  ? 257  ALA A CB  1 
ATOM   819  N N   . GLU A 1 113 ? -29.847 108.501 -66.836 1.00   31.91  ? 258  GLU A N   1 
ATOM   820  C CA  . GLU A 1 113 ? -30.415 107.546 -65.911 1.00   35.46  ? 258  GLU A CA  1 
ATOM   821  C C   . GLU A 1 113 ? -29.242 106.918 -65.115 1.00   38.02  ? 258  GLU A C   1 
ATOM   822  O O   . GLU A 1 113 ? -29.372 106.606 -63.912 1.00   41.48  ? 258  GLU A O   1 
ATOM   823  C CB  . GLU A 1 113 ? -31.260 106.493 -66.651 1.00   37.31  ? 258  GLU A CB  1 
ATOM   824  C CG  . GLU A 1 113 ? -32.414 107.111 -67.478 1.00   37.65  ? 258  GLU A CG  1 
ATOM   825  C CD  . GLU A 1 113 ? -33.579 106.134 -67.768 1.00   41.97  ? 258  GLU A CD  1 
ATOM   826  O OE1 . GLU A 1 113 ? -33.292 104.950 -68.079 1.00   42.50  ? 258  GLU A OE1 1 
ATOM   827  O OE2 . GLU A 1 113 ? -34.790 106.534 -67.693 1.00   40.30  ? 258  GLU A OE2 1 
ATOM   828  N N   . ILE A 1 114 ? -28.080 106.825 -65.751 1.00   35.19  ? 259  ILE A N   1 
ATOM   829  C CA  . ILE A 1 114 ? -26.930 106.274 -65.078 1.00   35.03  ? 259  ILE A CA  1 
ATOM   830  C C   . ILE A 1 114 ? -26.425 107.278 -64.084 1.00   34.34  ? 259  ILE A C   1 
ATOM   831  O O   . ILE A 1 114 ? -26.108 106.937 -62.936 1.00   35.65  ? 259  ILE A O   1 
ATOM   832  C CB  . ILE A 1 114 ? -25.787 105.873 -66.103 1.00   34.00  ? 259  ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 114 ? -26.183 104.598 -66.836 1.00   32.44  ? 259  ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 114 ? -24.470 105.688 -65.395 1.00   34.46  ? 259  ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 114 ? -25.227 104.210 -67.999 1.00   35.29  ? 259  ILE A CD1 1 
ATOM   836  N N   . VAL A 1 115 ? -26.318 108.527 -64.497 1.00   35.02  ? 260  VAL A N   1 
ATOM   837  C CA  . VAL A 1 115 ? -25.839 109.535 -63.544 1.00   33.85  ? 260  VAL A CA  1 
ATOM   838  C C   . VAL A 1 115 ? -26.687 109.575 -62.288 1.00   32.46  ? 260  VAL A C   1 
ATOM   839  O O   . VAL A 1 115 ? -26.181 109.782 -61.162 1.00   30.95  ? 260  VAL A O   1 
ATOM   840  C CB  . VAL A 1 115 ? -25.819 110.966 -64.144 1.00   31.72  ? 260  VAL A CB  1 
ATOM   841  C CG1 . VAL A 1 115 ? -25.288 111.931 -63.106 1.00   30.55  ? 260  VAL A CG1 1 
ATOM   842  C CG2 . VAL A 1 115 ? -24.879 111.031 -65.317 1.00   27.66  ? 260  VAL A CG2 1 
ATOM   843  N N   . SER A 1 116 ? -27.979 109.346 -62.492 1.00   33.83  ? 261  SER A N   1 
ATOM   844  C CA  . SER A 1 116 ? -28.952 109.341 -61.390 1.00   35.82  ? 261  SER A CA  1 
ATOM   845  C C   . SER A 1 116 ? -28.618 108.227 -60.368 1.00   36.17  ? 261  SER A C   1 
ATOM   846  O O   . SER A 1 116 ? -28.588 108.458 -59.132 1.00   34.21  ? 261  SER A O   1 
ATOM   847  C CB  . SER A 1 116 ? -30.369 109.177 -61.962 1.00   32.63  ? 261  SER A CB  1 
ATOM   848  O OG  . SER A 1 116 ? -31.315 109.135 -60.922 1.00   36.35  ? 261  SER A OG  1 
ATOM   849  N N   . ALA A 1 117 ? -28.356 107.030 -60.899 1.00   36.01  ? 262  ALA A N   1 
ATOM   850  C CA  . ALA A 1 117 ? -27.981 105.867 -60.077 1.00   36.09  ? 262  ALA A CA  1 
ATOM   851  C C   . ALA A 1 117 ? -26.692 106.163 -59.350 1.00   34.13  ? 262  ALA A C   1 
ATOM   852  O O   . ALA A 1 117 ? -26.607 106.037 -58.148 1.00   38.87  ? 262  ALA A O   1 
ATOM   853  C CB  . ALA A 1 117 ? -27.815 104.641 -60.953 1.00   37.91  ? 262  ALA A CB  1 
ATOM   854  N N   . LEU A 1 118 ? -25.687 106.599 -60.072 1.00   35.77  ? 263  LEU A N   1 
ATOM   855  C CA  . LEU A 1 118 ? -24.413 106.909 -59.443 1.00   36.36  ? 263  LEU A CA  1 
ATOM   856  C C   . LEU A 1 118 ? -24.461 107.993 -58.350 1.00   36.72  ? 263  LEU A C   1 
ATOM   857  O O   . LEU A 1 118 ? -23.767 107.882 -57.323 1.00   39.54  ? 263  LEU A O   1 
ATOM   858  C CB  . LEU A 1 118 ? -23.384 107.262 -60.533 1.00   33.32  ? 263  LEU A CB  1 
ATOM   859  C CG  . LEU A 1 118 ? -22.965 106.064 -61.410 1.00   36.70  ? 263  LEU A CG  1 
ATOM   860  C CD1 . LEU A 1 118 ? -21.917 106.533 -62.459 1.00   31.52  ? 263  LEU A CD1 1 
ATOM   861  C CD2 . LEU A 1 118 ? -22.389 104.933 -60.549 1.00   33.30  ? 263  LEU A CD2 1 
ATOM   862  N N   . GLU A 1 119 ? -25.228 109.056 -58.574 1.00   38.26  ? 264  GLU A N   1 
ATOM   863  C CA  . GLU A 1 119 ? -25.362 110.132 -57.568 1.00   38.85  ? 264  GLU A CA  1 
ATOM   864  C C   . GLU A 1 119 ? -25.878 109.513 -56.270 1.00   36.51  ? 264  GLU A C   1 
ATOM   865  O O   . GLU A 1 119 ? -25.456 109.860 -55.164 1.00   32.04  ? 264  GLU A O   1 
ATOM   866  C CB  . GLU A 1 119 ? -26.386 111.187 -58.014 1.00   43.94  ? 264  GLU A CB  1 
ATOM   867  C CG  . GLU A 1 119 ? -26.824 112.109 -56.856 1.00   50.48  ? 264  GLU A CG  1 
ATOM   868  C CD  . GLU A 1 119 ? -27.723 113.292 -57.289 1.00   54.11  ? 264  GLU A CD  1 
ATOM   869  O OE1 . GLU A 1 119 ? -28.746 113.094 -57.981 1.00   55.70  ? 264  GLU A OE1 1 
ATOM   870  O OE2 . GLU A 1 119 ? -27.411 114.430 -56.898 1.00   56.06  ? 264  GLU A OE2 1 
ATOM   871  N N   . TYR A 1 120 ? -26.810 108.587 -56.454 1.00   37.04  ? 265  TYR A N   1 
ATOM   872  C CA  . TYR A 1 120 ? -27.439 107.883 -55.376 1.00   37.40  ? 265  TYR A CA  1 
ATOM   873  C C   . TYR A 1 120 ? -26.460 106.992 -54.653 1.00   37.47  ? 265  TYR A C   1 
ATOM   874  O O   . TYR A 1 120 ? -26.352 107.073 -53.434 1.00   37.17  ? 265  TYR A O   1 
ATOM   875  C CB  . TYR A 1 120 ? -28.597 107.023 -55.883 1.00   43.00  ? 265  TYR A CB  1 
ATOM   876  C CG  . TYR A 1 120 ? -29.431 106.503 -54.721 1.00   48.28  ? 265  TYR A CG  1 
ATOM   877  C CD1 . TYR A 1 120 ? -30.054 107.400 -53.848 1.00   54.12  ? 265  TYR A CD1 1 
ATOM   878  C CD2 . TYR A 1 120 ? -29.571 105.146 -54.457 1.00   50.21  ? 265  TYR A CD2 1 
ATOM   879  C CE1 . TYR A 1 120 ? -30.791 106.964 -52.736 1.00   55.64  ? 265  TYR A CE1 1 
ATOM   880  C CE2 . TYR A 1 120 ? -30.329 104.700 -53.347 1.00   52.71  ? 265  TYR A CE2 1 
ATOM   881  C CZ  . TYR A 1 120 ? -30.934 105.625 -52.493 1.00   55.40  ? 265  TYR A CZ  1 
ATOM   882  O OH  . TYR A 1 120 ? -31.727 105.259 -51.403 1.00   58.97  ? 265  TYR A OH  1 
ATOM   883  N N   . LEU A 1 121 ? -25.749 106.135 -55.393 1.00   36.30  ? 266  LEU A N   1 
ATOM   884  C CA  . LEU A 1 121 ? -24.799 105.227 -54.746 1.00   34.22  ? 266  LEU A CA  1 
ATOM   885  C C   . LEU A 1 121 ? -23.733 106.043 -54.043 1.00   31.70  ? 266  LEU A C   1 
ATOM   886  O O   . LEU A 1 121 ? -23.408 105.764 -52.923 1.00   27.57  ? 266  LEU A O   1 
ATOM   887  C CB  . LEU A 1 121 ? -24.194 104.232 -55.751 1.00   32.77  ? 266  LEU A CB  1 
ATOM   888  C CG  . LEU A 1 121 ? -25.122 103.151 -56.351 1.00   32.97  ? 266  LEU A CG  1 
ATOM   889  C CD1 . LEU A 1 121 ? -24.498 102.478 -57.525 1.00   31.14  ? 266  LEU A CD1 1 
ATOM   890  C CD2 . LEU A 1 121 ? -25.451 102.100 -55.302 1.00   33.85  ? 266  LEU A CD2 1 
ATOM   891  N N   . HIS A 1 122 ? -23.248 107.107 -54.663 1.00   33.81  ? 267  HIS A N   1 
ATOM   892  C CA  . HIS A 1 122 ? -22.210 107.867 -53.987 1.00   34.91  ? 267  HIS A CA  1 
ATOM   893  C C   . HIS A 1 122 ? -22.736 108.566 -52.765 1.00   37.72  ? 267  HIS A C   1 
ATOM   894  O O   . HIS A 1 122 ? -21.970 108.838 -51.841 1.00   39.86  ? 267  HIS A O   1 
ATOM   895  C CB  . HIS A 1 122 ? -21.546 108.883 -54.924 1.00   35.97  ? 267  HIS A CB  1 
ATOM   896  C CG  . HIS A 1 122 ? -20.808 108.248 -56.068 1.00   38.57  ? 267  HIS A CG  1 
ATOM   897  N ND1 . HIS A 1 122 ? -20.125 108.977 -57.019 1.00   38.84  ? 267  HIS A ND1 1 
ATOM   898  C CD2 . HIS A 1 122 ? -20.720 106.956 -56.453 1.00   36.14  ? 267  HIS A CD2 1 
ATOM   899  C CE1 . HIS A 1 122 ? -19.660 108.157 -57.947 1.00   36.89  ? 267  HIS A CE1 1 
ATOM   900  N NE2 . HIS A 1 122 ? -20.012 106.926 -57.628 1.00   36.02  ? 267  HIS A NE2 1 
ATOM   901  N N   . SER A 1 123 ? -24.028 108.867 -52.725 1.00   38.27  ? 268  SER A N   1 
ATOM   902  C CA  . SER A 1 123 ? -24.541 109.521 -51.531 1.00   40.69  ? 268  SER A CA  1 
ATOM   903  C C   . SER A 1 123 ? -24.439 108.572 -50.339 1.00   40.47  ? 268  SER A C   1 
ATOM   904  O O   . SER A 1 123 ? -24.411 109.025 -49.213 1.00   39.79  ? 268  SER A O   1 
ATOM   905  C CB  . SER A 1 123 ? -25.998 109.953 -51.709 1.00   40.33  ? 268  SER A CB  1 
ATOM   906  O OG  . SER A 1 123 ? -26.857 108.827 -51.628 1.00   44.76  ? 268  SER A OG  1 
ATOM   907  N N   . ARG A 1 124 ? -24.416 107.266 -50.596 1.00   42.78  ? 269  ARG A N   1 
ATOM   908  C CA  . ARG A 1 124 ? -24.295 106.253 -49.558 1.00   46.50  ? 269  ARG A CA  1 
ATOM   909  C C   . ARG A 1 124 ? -22.855 105.718 -49.476 1.00   48.00  ? 269  ARG A C   1 
ATOM   910  O O   . ARG A 1 124 ? -22.655 104.566 -49.093 1.00   46.52  ? 269  ARG A O   1 
ATOM   911  C CB  . ARG A 1 124 ? -25.203 105.078 -49.882 1.00   50.67  ? 269  ARG A CB  1 
ATOM   912  C CG  . ARG A 1 124 ? -26.659 105.421 -50.067 1.00   57.04  ? 269  ARG A CG  1 
ATOM   913  C CD  . ARG A 1 124 ? -27.356 105.544 -48.713 1.00   62.38  ? 269  ARG A CD  1 
ATOM   914  N NE  . ARG A 1 124 ? -28.817 105.700 -48.788 1.00   67.63  ? 269  ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 124 ? -29.461 106.682 -49.437 1.00   69.52  ? 269  ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 124 ? -28.797 107.621 -50.104 1.00   70.58  ? 269  ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 124 ? -30.784 106.759 -49.374 1.00   70.80  ? 269  ARG A NH2 1 
ATOM   918  N N   . ASP A 1 125 ? -21.874 106.536 -49.865 1.00   49.21  ? 270  ASP A N   1 
ATOM   919  C CA  . ASP A 1 125 ? -20.458 106.147 -49.862 1.00   50.58  ? 270  ASP A CA  1 
ATOM   920  C C   . ASP A 1 125 ? -20.220 104.785 -50.546 1.00   48.51  ? 270  ASP A C   1 
ATOM   921  O O   . ASP A 1 125 ? -19.354 104.014 -50.143 1.00   48.31  ? 270  ASP A O   1 
ATOM   922  C CB  . ASP A 1 125 ? -19.918 106.096 -48.430 1.00   56.00  ? 270  ASP A CB  1 
ATOM   923  C CG  . ASP A 1 125 ? -18.586 106.874 -48.253 1.00   62.76  ? 270  ASP A CG  1 
ATOM   924  O OD1 . ASP A 1 125 ? -17.658 106.702 -49.096 1.00   63.82  ? 270  ASP A OD1 1 
ATOM   925  O OD2 . ASP A 1 125 ? -18.466 107.647 -47.251 1.00   65.70  ? 270  ASP A OD2 1 
ATOM   926  N N   . VAL A 1 126 ? -21.014 104.491 -51.564 1.00   43.95  ? 271  VAL A N   1 
ATOM   927  C CA  . VAL A 1 126 ? -20.882 103.260 -52.304 1.00   42.91  ? 271  VAL A CA  1 
ATOM   928  C C   . VAL A 1 126 ? -20.268 103.516 -53.675 1.00   44.64  ? 271  VAL A C   1 
ATOM   929  O O   . VAL A 1 126 ? -20.781 104.335 -54.443 1.00   44.41  ? 271  VAL A O   1 
ATOM   930  C CB  . VAL A 1 126 ? -22.207 102.615 -52.560 1.00   40.59  ? 271  VAL A CB  1 
ATOM   931  C CG1 . VAL A 1 126 ? -22.048 101.533 -53.583 1.00   39.14  ? 271  VAL A CG1 1 
ATOM   932  C CG2 . VAL A 1 126 ? -22.746 102.082 -51.297 1.00   42.26  ? 271  VAL A CG2 1 
ATOM   933  N N   . VAL A 1 127 ? -19.188 102.789 -53.981 1.00   43.11  ? 272  VAL A N   1 
ATOM   934  C CA  . VAL A 1 127 ? -18.499 102.935 -55.252 1.00   39.76  ? 272  VAL A CA  1 
ATOM   935  C C   . VAL A 1 127 ? -18.993 101.812 -56.114 1.00   39.10  ? 272  VAL A C   1 
ATOM   936  O O   . VAL A 1 127 ? -18.948 100.671 -55.717 1.00   40.36  ? 272  VAL A O   1 
ATOM   937  C CB  . VAL A 1 127 ? -16.986 102.814 -55.088 1.00   37.88  ? 272  VAL A CB  1 
ATOM   938  C CG1 . VAL A 1 127 ? -16.346 102.749 -56.473 1.00   40.43  ? 272  VAL A CG1 1 
ATOM   939  C CG2 . VAL A 1 127 ? -16.428 104.028 -54.340 1.00   36.90  ? 272  VAL A CG2 1 
ATOM   940  N N   . TYR A 1 128 ? -19.467 102.089 -57.304 1.00   37.88  ? 273  TYR A N   1 
ATOM   941  C CA  . TYR A 1 128 ? -19.980 100.961 -58.037 1.00   38.82  ? 273  TYR A CA  1 
ATOM   942  C C   . TYR A 1 128 ? -18.943 100.015 -58.688 1.00   39.56  ? 273  TYR A C   1 
ATOM   943  O O   . TYR A 1 128 ? -19.200 98.812  -58.793 1.00   38.50  ? 273  TYR A O   1 
ATOM   944  C CB  . TYR A 1 128 ? -20.975 101.429 -59.098 1.00   35.71  ? 273  TYR A CB  1 
ATOM   945  C CG  . TYR A 1 128 ? -21.858 100.320 -59.583 1.00   32.11  ? 273  TYR A CG  1 
ATOM   946  C CD1 . TYR A 1 128 ? -22.818 99.743  -58.755 1.00   33.56  ? 273  TYR A CD1 1 
ATOM   947  C CD2 . TYR A 1 128 ? -21.711 99.829  -60.848 1.00   33.18  ? 273  TYR A CD2 1 
ATOM   948  C CE1 . TYR A 1 128 ? -23.612 98.680  -59.212 1.00   35.77  ? 273  TYR A CE1 1 
ATOM   949  C CE2 . TYR A 1 128 ? -22.490 98.792  -61.310 1.00   35.36  ? 273  TYR A CE2 1 
ATOM   950  C CZ  . TYR A 1 128 ? -23.430 98.220  -60.500 1.00   34.29  ? 273  TYR A CZ  1 
ATOM   951  O OH  . TYR A 1 128 ? -24.161 97.189  -61.031 1.00   39.00  ? 273  TYR A OH  1 
ATOM   952  N N   . ARG A 1 129 ? -17.837 100.578 -59.165 1.00   39.25  ? 274  ARG A N   1 
ATOM   953  C CA  . ARG A 1 129 ? -16.763 99.840  -59.836 1.00   42.71  ? 274  ARG A CA  1 
ATOM   954  C C   . ARG A 1 129 ? -17.096 99.136  -61.157 1.00   42.85  ? 274  ARG A C   1 
ATOM   955  O O   . ARG A 1 129 ? -16.204 98.843  -61.932 1.00   43.02  ? 274  ARG A O   1 
ATOM   956  C CB  . ARG A 1 129 ? -16.156 98.796  -58.892 1.00   42.33  ? 274  ARG A CB  1 
ATOM   957  C CG  . ARG A 1 129 ? -15.560 99.324  -57.583 1.00   43.30  ? 274  ARG A CG  1 
ATOM   958  C CD  . ARG A 1 129 ? -15.022 98.106  -56.796 1.00   45.77  ? 274  ARG A CD  1 
ATOM   959  N NE  . ARG A 1 129 ? -14.411 98.426  -55.505 1.00   51.33  ? 274  ARG A NE  1 
ATOM   960  C CZ  . ARG A 1 129 ? -13.369 97.769  -54.983 1.00   50.82  ? 274  ARG A CZ  1 
ATOM   961  N NH1 . ARG A 1 129 ? -12.809 96.760  -55.654 1.00   50.13  ? 274  ARG A NH1 1 
ATOM   962  N NH2 . ARG A 1 129 ? -12.907 98.094  -53.782 1.00   49.00  ? 274  ARG A NH2 1 
ATOM   963  N N   . ASP A 1 130 ? -18.371 98.856  -61.410 1.00   45.37  ? 275  ASP A N   1 
ATOM   964  C CA  . ASP A 1 130 ? -18.786 98.154  -62.635 1.00   46.35  ? 275  ASP A CA  1 
ATOM   965  C C   . ASP A 1 130 ? -19.627 98.907  -63.667 1.00   45.62  ? 275  ASP A C   1 
ATOM   966  O O   . ASP A 1 130 ? -20.527 98.323  -64.282 1.00   45.99  ? 275  ASP A O   1 
ATOM   967  C CB  . ASP A 1 130 ? -19.539 96.864  -62.267 1.00   49.59  ? 275  ASP A CB  1 
ATOM   968  C CG  . ASP A 1 130 ? -18.617 95.770  -61.717 1.00   55.49  ? 275  ASP A CG  1 
ATOM   969  O OD1 . ASP A 1 130 ? -17.829 96.030  -60.771 1.00   53.18  ? 275  ASP A OD1 1 
ATOM   970  O OD2 . ASP A 1 130 ? -18.700 94.630  -62.244 1.00   61.12  ? 275  ASP A OD2 1 
ATOM   971  N N   . ILE A 1 131 ? -19.375 100.189 -63.881 1.00   44.96  ? 276  ILE A N   1 
ATOM   972  C CA  . ILE A 1 131 ? -20.158 100.857 -64.908 1.00   41.65  ? 276  ILE A CA  1 
ATOM   973  C C   . ILE A 1 131 ? -19.509 100.503 -66.231 1.00   41.11  ? 276  ILE A C   1 
ATOM   974  O O   . ILE A 1 131 ? -18.404 100.910 -66.510 1.00   39.75  ? 276  ILE A O   1 
ATOM   975  C CB  . ILE A 1 131 ? -20.161 102.420 -64.767 1.00   43.00  ? 276  ILE A CB  1 
ATOM   976  C CG1 . ILE A 1 131 ? -20.792 102.869 -63.429 1.00   40.99  ? 276  ILE A CG1 1 
ATOM   977  C CG2 . ILE A 1 131 ? -20.979 103.027 -65.909 1.00   39.66  ? 276  ILE A CG2 1 
ATOM   978  C CD1 . ILE A 1 131 ? -22.154 102.272 -63.126 1.00   37.54  ? 276  ILE A CD1 1 
ATOM   979  N N   . LYS A 1 132 ? -20.177 99.710  -67.048 1.00   41.98  ? 277  LYS A N   1 
ATOM   980  C CA  . LYS A 1 132 ? -19.618 99.379  -68.343 1.00   43.72  ? 277  LYS A CA  1 
ATOM   981  C C   . LYS A 1 132 ? -20.732 98.788  -69.167 1.00   42.80  ? 277  LYS A C   1 
ATOM   982  O O   . LYS A 1 132 ? -21.646 98.213  -68.619 1.00   46.70  ? 277  LYS A O   1 
ATOM   983  C CB  . LYS A 1 132 ? -18.391 98.452  -68.196 1.00   46.38  ? 277  LYS A CB  1 
ATOM   984  C CG  . LYS A 1 132 ? -18.535 97.217  -67.346 1.00   49.35  ? 277  LYS A CG  1 
ATOM   985  C CD  . LYS A 1 132 ? -17.147 96.546  -67.295 1.00   57.60  ? 277  LYS A CD  1 
ATOM   986  C CE  . LYS A 1 132 ? -17.092 95.222  -66.516 1.00   58.70  ? 277  LYS A CE  1 
ATOM   987  N NZ  . LYS A 1 132 ? -17.814 94.075  -67.187 1.00   62.82  ? 277  LYS A NZ  1 
ATOM   988  N N   . LEU A 1 133 ? -20.680 98.965  -70.477 1.00   42.46  ? 278  LEU A N   1 
ATOM   989  C CA  . LEU A 1 133 ? -21.740 98.542  -71.383 1.00   42.04  ? 278  LEU A CA  1 
ATOM   990  C C   . LEU A 1 133 ? -22.352 97.167  -71.195 1.00   43.94  ? 278  LEU A C   1 
ATOM   991  O O   . LEU A 1 133 ? -23.549 96.993  -71.389 1.00   43.51  ? 278  LEU A O   1 
ATOM   992  C CB  . LEU A 1 133 ? -21.254 98.699  -72.834 1.00   44.47  ? 278  LEU A CB  1 
ATOM   993  C CG  . LEU A 1 133 ? -22.242 98.504  -73.996 1.00   49.21  ? 278  LEU A CG  1 
ATOM   994  C CD1 . LEU A 1 133 ? -23.368 99.562  -73.926 1.00   49.08  ? 278  LEU A CD1 1 
ATOM   995  C CD2 . LEU A 1 133 ? -21.474 98.611  -75.353 1.00   50.10  ? 278  LEU A CD2 1 
ATOM   996  N N   . GLU A 1 134 ? -21.536 96.182  -70.836 1.00   44.05  ? 279  GLU A N   1 
ATOM   997  C CA  . GLU A 1 134 ? -22.020 94.818  -70.640 1.00   44.23  ? 279  GLU A CA  1 
ATOM   998  C C   . GLU A 1 134 ? -22.964 94.762  -69.428 1.00   42.98  ? 279  GLU A C   1 
ATOM   999  O O   . GLU A 1 134 ? -23.848 93.905  -69.328 1.00   40.38  ? 279  GLU A O   1 
ATOM   1000 C CB  . GLU A 1 134 ? -20.825 93.879  -70.412 1.00   49.00  ? 279  GLU A CB  1 
ATOM   1001 C CG  . GLU A 1 134 ? -19.580 94.145  -71.307 1.00   54.30  ? 279  GLU A CG  1 
ATOM   1002 C CD  . GLU A 1 134 ? -18.882 95.456  -70.970 1.00   57.44  ? 279  GLU A CD  1 
ATOM   1003 O OE1 . GLU A 1 134 ? -19.164 96.017  -69.897 1.00   61.10  ? 279  GLU A OE1 1 
ATOM   1004 O OE2 . GLU A 1 134 ? -18.045 95.940  -71.764 1.00   60.42  ? 279  GLU A OE2 1 
ATOM   1005 N N   . ASN A 1 135 ? -22.760 95.669  -68.482 1.00   41.08  ? 280  ASN A N   1 
ATOM   1006 C CA  . ASN A 1 135 ? -23.617 95.687  -67.341 1.00   41.84  ? 280  ASN A CA  1 
ATOM   1007 C C   . ASN A 1 135 ? -24.885 96.536  -67.589 1.00   42.06  ? 280  ASN A C   1 
ATOM   1008 O O   . ASN A 1 135 ? -25.611 96.841  -66.662 1.00   43.59  ? 280  ASN A O   1 
ATOM   1009 C CB  . ASN A 1 135 ? -22.830 96.199  -66.144 1.00   45.33  ? 280  ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 135 ? -21.789 95.169  -65.635 1.00   47.26  ? 280  ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 135 ? -20.895 94.797  -66.341 1.00   50.66  ? 280  ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 135 ? -21.924 94.733  -64.407 1.00   47.14  ? 280  ASN A ND2 1 
ATOM   1013 N N   . LEU A 1 136 ? -25.179 96.903  -68.830 1.00   40.27  ? 281  LEU A N   1 
ATOM   1014 C CA  . LEU A 1 136 ? -26.372 97.716  -69.076 1.00   38.92  ? 281  LEU A CA  1 
ATOM   1015 C C   . LEU A 1 136 ? -27.407 96.983  -69.860 1.00   40.94  ? 281  LEU A C   1 
ATOM   1016 O O   . LEU A 1 136 ? -27.104 96.362  -70.910 1.00   39.75  ? 281  LEU A O   1 
ATOM   1017 C CB  . LEU A 1 136 ? -26.052 99.012  -69.844 1.00   34.98  ? 281  LEU A CB  1 
ATOM   1018 C CG  . LEU A 1 136 ? -25.057 99.926  -69.108 1.00   32.96  ? 281  LEU A CG  1 
ATOM   1019 C CD1 . LEU A 1 136 ? -24.655 101.081 -69.967 1.00   29.25  ? 281  LEU A CD1 1 
ATOM   1020 C CD2 . LEU A 1 136 ? -25.644 100.348 -67.776 1.00   30.86  ? 281  LEU A CD2 1 
ATOM   1021 N N   . MET A 1 137 ? -28.627 97.051  -69.334 1.00   39.72  ? 282  MET A N   1 
ATOM   1022 C CA  . MET A 1 137 ? -29.785 96.466  -69.985 1.00   43.96  ? 282  MET A CA  1 
ATOM   1023 C C   . MET A 1 137 ? -30.937 97.496  -70.039 1.00   45.53  ? 282  MET A C   1 
ATOM   1024 O O   . MET A 1 137 ? -30.867 98.579  -69.429 1.00   43.49  ? 282  MET A O   1 
ATOM   1025 C CB  . MET A 1 137 ? -30.246 95.223  -69.228 1.00   46.19  ? 282  MET A CB  1 
ATOM   1026 C CG  . MET A 1 137 ? -29.137 94.183  -69.070 1.00   49.78  ? 282  MET A CG  1 
ATOM   1027 S SD  . MET A 1 137 ? -29.865 92.570  -69.176 1.00   56.01  ? 282  MET A SD  1 
ATOM   1028 C CE  . MET A 1 137 ? -30.539 92.498  -67.524 1.00   55.33  ? 282  MET A CE  1 
ATOM   1029 N N   . LEU A 1 138 ? -31.993 97.149  -70.769 1.00   45.62  ? 283  LEU A N   1 
ATOM   1030 C CA  . LEU A 1 138 ? -33.154 98.006  -70.854 1.00   44.66  ? 283  LEU A CA  1 
ATOM   1031 C C   . LEU A 1 138 ? -34.301 97.189  -70.301 1.00   46.29  ? 283  LEU A C   1 
ATOM   1032 O O   . LEU A 1 138 ? -34.348 95.973  -70.501 1.00   44.46  ? 283  LEU A O   1 
ATOM   1033 C CB  . LEU A 1 138 ? -33.481 98.329  -72.289 1.00   42.33  ? 283  LEU A CB  1 
ATOM   1034 C CG  . LEU A 1 138 ? -32.521 99.113  -73.143 1.00   42.31  ? 283  LEU A CG  1 
ATOM   1035 C CD1 . LEU A 1 138 ? -33.200 99.376  -74.500 1.00   39.49  ? 283  LEU A CD1 1 
ATOM   1036 C CD2 . LEU A 1 138 ? -32.123 100.386 -72.435 1.00   40.64  ? 283  LEU A CD2 1 
ATOM   1037 N N   . ASP A 1 139 ? -35.235 97.831  -69.606 1.00   48.04  ? 284  ASP A N   1 
ATOM   1038 C CA  . ASP A 1 139 ? -36.383 97.077  -69.136 1.00   49.63  ? 284  ASP A CA  1 
ATOM   1039 C C   . ASP A 1 139 ? -37.452 97.111  -70.229 1.00   49.62  ? 284  ASP A C   1 
ATOM   1040 O O   . ASP A 1 139 ? -37.255 97.709  -71.277 1.00   48.10  ? 284  ASP A O   1 
ATOM   1041 C CB  . ASP A 1 139 ? -36.940 97.630  -67.817 1.00   51.46  ? 284  ASP A CB  1 
ATOM   1042 C CG  . ASP A 1 139 ? -37.429 99.056  -67.914 1.00   51.30  ? 284  ASP A CG  1 
ATOM   1043 O OD1 . ASP A 1 139 ? -37.756 99.567  -69.011 1.00   50.57  ? 284  ASP A OD1 1 
ATOM   1044 O OD2 . ASP A 1 139 ? -37.500 99.671  -66.839 1.00   54.41  ? 284  ASP A OD2 1 
ATOM   1045 N N   . LYS A 1 140 ? -38.572 96.460  -69.979 1.00   50.82  ? 285  LYS A N   1 
ATOM   1046 C CA  . LYS A 1 140 ? -39.649 96.410  -70.948 1.00   53.62  ? 285  LYS A CA  1 
ATOM   1047 C C   . LYS A 1 140 ? -40.005 97.765  -71.559 1.00   53.90  ? 285  LYS A C   1 
ATOM   1048 O O   . LYS A 1 140 ? -40.384 97.837  -72.731 1.00   54.16  ? 285  LYS A O   1 
ATOM   1049 C CB  . LYS A 1 140 ? -40.893 95.786  -70.301 1.00   54.67  ? 285  LYS A CB  1 
ATOM   1050 C CG  . LYS A 1 140 ? -41.280 96.429  -68.970 1.00   57.34  ? 285  LYS A CG  1 
ATOM   1051 C CD  . LYS A 1 140 ? -42.251 95.550  -68.195 1.00   59.47  ? 285  LYS A CD  1 
ATOM   1052 C CE  . LYS A 1 140 ? -42.190 95.860  -66.704 1.00   60.84  ? 285  LYS A CE  1 
ATOM   1053 N NZ  . LYS A 1 140 ? -40.881 95.444  -66.081 1.00   61.72  ? 285  LYS A NZ  1 
ATOM   1054 N N   . ASP A 1 141 ? -39.868 98.834  -70.779 1.00   53.24  ? 286  ASP A N   1 
ATOM   1055 C CA  . ASP A 1 141 ? -40.231 100.158 -71.263 1.00   54.18  ? 286  ASP A CA  1 
ATOM   1056 C C   . ASP A 1 141 ? -39.170 101.033 -71.893 1.00   53.68  ? 286  ASP A C   1 
ATOM   1057 O O   . ASP A 1 141 ? -39.430 102.199 -72.174 1.00   57.81  ? 286  ASP A O   1 
ATOM   1058 C CB  . ASP A 1 141 ? -40.887 100.956 -70.144 1.00   55.49  ? 286  ASP A CB  1 
ATOM   1059 C CG  . ASP A 1 141 ? -42.099 100.257 -69.581 1.00   57.83  ? 286  ASP A CG  1 
ATOM   1060 O OD1 . ASP A 1 141 ? -42.941 99.827  -70.400 1.00   60.65  ? 286  ASP A OD1 1 
ATOM   1061 O OD2 . ASP A 1 141 ? -42.210 100.137 -68.335 1.00   59.23  ? 286  ASP A OD2 1 
ATOM   1062 N N   . GLY A 1 142 ? -37.976 100.530 -72.120 1.00   50.20  ? 287  GLY A N   1 
ATOM   1063 C CA  . GLY A 1 142 ? -36.997 101.410 -72.722 1.00   47.59  ? 287  GLY A CA  1 
ATOM   1064 C C   . GLY A 1 142 ? -36.087 102.029 -71.701 1.00   46.06  ? 287  GLY A C   1 
ATOM   1065 O O   . GLY A 1 142 ? -35.128 102.696 -72.063 1.00   46.45  ? 287  GLY A O   1 
ATOM   1066 N N   . HIS A 1 143 ? -36.385 101.814 -70.422 1.00   46.34  ? 288  HIS A N   1 
ATOM   1067 C CA  . HIS A 1 143 ? -35.543 102.328 -69.338 1.00   46.23  ? 288  HIS A CA  1 
ATOM   1068 C C   . HIS A 1 143 ? -34.297 101.460 -68.968 1.00   44.94  ? 288  HIS A C   1 
ATOM   1069 O O   . HIS A 1 143 ? -34.330 100.218 -69.007 1.00   41.99  ? 288  HIS A O   1 
ATOM   1070 C CB  . HIS A 1 143 ? -36.401 102.547 -68.109 1.00   46.12  ? 288  HIS A CB  1 
ATOM   1071 C CG  . HIS A 1 143 ? -37.175 103.814 -68.166 1.00   46.85  ? 288  HIS A CG  1 
ATOM   1072 N ND1 . HIS A 1 143 ? -36.565 105.050 -68.149 1.00   49.02  ? 288  HIS A ND1 1 
ATOM   1073 C CD2 . HIS A 1 143 ? -38.507 104.044 -68.234 1.00   44.28  ? 288  HIS A CD2 1 
ATOM   1074 C CE1 . HIS A 1 143 ? -37.493 105.990 -68.197 1.00   48.55  ? 288  HIS A CE1 1 
ATOM   1075 N NE2 . HIS A 1 143 ? -38.678 105.404 -68.246 1.00   44.81  ? 288  HIS A NE2 1 
ATOM   1076 N N   . ILE A 1 144 ? -33.213 102.140 -68.601 1.00   42.84  ? 289  ILE A N   1 
ATOM   1077 C CA  . ILE A 1 144 ? -31.966 101.488 -68.234 1.00   41.91  ? 289  ILE A CA  1 
ATOM   1078 C C   . ILE A 1 144 ? -31.956 100.747 -66.895 1.00   43.03  ? 289  ILE A C   1 
ATOM   1079 O O   . ILE A 1 144 ? -32.570 101.187 -65.911 1.00   43.94  ? 289  ILE A O   1 
ATOM   1080 C CB  . ILE A 1 144 ? -30.820 102.497 -68.211 1.00   42.18  ? 289  ILE A CB  1 
ATOM   1081 C CG1 . ILE A 1 144 ? -29.941 102.294 -69.465 1.00   41.99  ? 289  ILE A CG1 1 
ATOM   1082 C CG2 . ILE A 1 144 ? -30.094 102.434 -66.857 1.00   41.72  ? 289  ILE A CG2 1 
ATOM   1083 C CD1 . ILE A 1 144 ? -28.512 102.913 -69.397 1.00   43.89  ? 289  ILE A CD1 1 
ATOM   1084 N N   . LYS A 1 145 ? -31.267 99.605  -66.869 1.00   42.30  ? 290  LYS A N   1 
ATOM   1085 C CA  . LYS A 1 145 ? -31.127 98.816  -65.650 1.00   39.99  ? 290  LYS A CA  1 
ATOM   1086 C C   . LYS A 1 145 ? -29.673 98.454  -65.554 1.00   39.72  ? 290  LYS A C   1 
ATOM   1087 O O   . LYS A 1 145 ? -29.200 97.689  -66.347 1.00   39.17  ? 290  LYS A O   1 
ATOM   1088 C CB  . LYS A 1 145 ? -31.923 97.517  -65.714 1.00   37.31  ? 290  LYS A CB  1 
ATOM   1089 C CG  . LYS A 1 145 ? -33.329 97.620  -65.358 1.00   38.02  ? 290  LYS A CG  1 
ATOM   1090 C CD  . LYS A 1 145 ? -33.475 97.903  -63.860 1.00   39.65  ? 290  LYS A CD  1 
ATOM   1091 C CE  . LYS A 1 145 ? -34.870 98.372  -63.589 1.00   38.84  ? 290  LYS A CE  1 
ATOM   1092 N NZ  . LYS A 1 145 ? -34.949 98.781  -62.194 1.00   42.25  ? 290  LYS A NZ  1 
ATOM   1093 N N   . ILE A 1 146 ? -28.973 99.024  -64.587 1.00   40.86  ? 291  ILE A N   1 
ATOM   1094 C CA  . ILE A 1 146 ? -27.582 98.731  -64.347 1.00   40.01  ? 291  ILE A CA  1 
ATOM   1095 C C   . ILE A 1 146 ? -27.530 97.412  -63.565 1.00   42.76  ? 291  ILE A C   1 
ATOM   1096 O O   . ILE A 1 146 ? -27.972 97.303  -62.436 1.00   38.22  ? 291  ILE A O   1 
ATOM   1097 C CB  . ILE A 1 146 ? -26.983 99.834  -63.542 1.00   39.71  ? 291  ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 146 ? -26.945 101.101 -64.409 1.00   39.31  ? 291  ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 146 ? -25.646 99.440  -63.020 1.00   36.69  ? 291  ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 146 ? -26.462 102.321 -63.671 1.00   38.50  ? 291  ILE A CD1 1 
ATOM   1101 N N   . THR A 1 147 ? -26.969 96.414  -64.218 1.00   47.63  ? 292  THR A N   1 
ATOM   1102 C CA  . THR A 1 147 ? -26.838 95.057  -63.718 1.00   51.61  ? 292  THR A CA  1 
ATOM   1103 C C   . THR A 1 147 ? -25.564 94.894  -62.930 1.00   57.05  ? 292  THR A C   1 
ATOM   1104 O O   . THR A 1 147 ? -24.699 95.766  -62.921 1.00   58.41  ? 292  THR A O   1 
ATOM   1105 C CB  . THR A 1 147 ? -26.837 94.127  -64.913 1.00   52.20  ? 292  THR A CB  1 
ATOM   1106 O OG1 . THR A 1 147 ? -27.871 93.162  -64.781 1.00   50.38  ? 292  THR A OG1 1 
ATOM   1107 C CG2 . THR A 1 147 ? -25.502 93.489  -65.084 1.00   53.14  ? 292  THR A CG2 1 
ATOM   1108 N N   . ASP A 1 148 ? -25.444 93.767  -62.256 1.00   63.41  ? 293  ASP A N   1 
ATOM   1109 C CA  . ASP A 1 148 ? -24.260 93.497  -61.436 1.00   69.34  ? 293  ASP A CA  1 
ATOM   1110 C C   . ASP A 1 148 ? -23.601 92.218  -61.944 1.00   71.33  ? 293  ASP A C   1 
ATOM   1111 O O   . ASP A 1 148 ? -23.539 91.235  -61.209 1.00   73.80  ? 293  ASP A O   1 
ATOM   1112 C CB  . ASP A 1 148 ? -24.673 93.295  -59.959 1.00   72.01  ? 293  ASP A CB  1 
ATOM   1113 C CG  . ASP A 1 148 ? -23.582 93.706  -58.976 1.00   75.81  ? 293  ASP A CG  1 
ATOM   1114 O OD1 . ASP A 1 148 ? -22.412 93.270  -59.152 1.00   79.45  ? 293  ASP A OD1 1 
ATOM   1115 O OD2 . ASP A 1 148 ? -23.892 94.466  -58.024 1.00   76.49  ? 293  ASP A OD2 1 
ATOM   1116 N N   . PHE A 1 149 ? -23.124 92.217  -63.186 1.00   72.56  ? 294  PHE A N   1 
ATOM   1117 C CA  . PHE A 1 149 ? -22.496 91.028  -63.761 1.00   74.20  ? 294  PHE A CA  1 
ATOM   1118 C C   . PHE A 1 149 ? -22.488 91.068  -65.278 1.00   76.16  ? 294  PHE A C   1 
ATOM   1119 O O   . PHE A 1 149 ? -23.382 91.652  -65.902 1.00   77.48  ? 294  PHE A O   1 
ATOM   1120 C CB  . PHE A 1 149 ? -23.254 89.777  -63.326 1.00   72.94  ? 294  PHE A CB  1 
ATOM   1121 C CG  . PHE A 1 149 ? -24.713 89.804  -63.680 1.00   71.42  ? 294  PHE A CG  1 
ATOM   1122 C CD1 . PHE A 1 149 ? -25.129 89.493  -64.967 1.00   69.01  ? 294  PHE A CD1 1 
ATOM   1123 C CD2 . PHE A 1 149 ? -25.677 90.138  -62.716 1.00   70.34  ? 294  PHE A CD2 1 
ATOM   1124 C CE1 . PHE A 1 149 ? -26.491 89.511  -65.299 1.00   69.37  ? 294  PHE A CE1 1 
ATOM   1125 C CE2 . PHE A 1 149 ? -27.040 90.157  -63.035 1.00   69.60  ? 294  PHE A CE2 1 
ATOM   1126 C CZ  . PHE A 1 149 ? -27.450 89.841  -64.333 1.00   68.77  ? 294  PHE A CZ  1 
ATOM   1127 N N   . GLY A 1 150 ? -21.503 90.419  -65.885 1.00   77.16  ? 295  GLY A N   1 
ATOM   1128 C CA  . GLY A 1 150 ? -21.457 90.423  -67.331 1.00   78.43  ? 295  GLY A CA  1 
ATOM   1129 C C   . GLY A 1 150 ? -21.717 89.079  -67.983 1.00   79.27  ? 295  GLY A C   1 
ATOM   1130 O O   . GLY A 1 150 ? -21.350 88.033  -67.457 1.00   79.10  ? 295  GLY A O   1 
ATOM   1131 N N   . LEU A 1 151 ? -22.354 89.122  -69.148 1.00   80.54  ? 296  LEU A N   1 
ATOM   1132 C CA  . LEU A 1 151 ? -22.655 87.923  -69.921 1.00   80.86  ? 296  LEU A CA  1 
ATOM   1133 C C   . LEU A 1 151 ? -21.429 86.991  -69.970 1.00   80.56  ? 296  LEU A C   1 
ATOM   1134 O O   . LEU A 1 151 ? -21.421 85.965  -70.664 1.00   79.99  ? 296  LEU A O   1 
ATOM   1135 C CB  . LEU A 1 151 ? -23.082 88.331  -71.344 1.00   80.33  ? 296  LEU A CB  1 
ATOM   1136 N N   . THR A 1 168 ? -14.557 91.490  -75.058 1.00   64.95  ? 313  THR A N   1 
ATOM   1137 C CA  . THR A 1 168 ? -14.460 92.893  -74.682 1.00   63.42  ? 313  THR A CA  1 
ATOM   1138 C C   . THR A 1 168 ? -13.256 93.181  -73.761 1.00   61.81  ? 313  THR A C   1 
ATOM   1139 O O   . THR A 1 168 ? -13.034 92.505  -72.759 1.00   60.49  ? 313  THR A O   1 
ATOM   1140 C CB  . THR A 1 168 ? -15.793 93.388  -74.012 1.00   64.05  ? 313  THR A CB  1 
ATOM   1141 O OG1 . THR A 1 168 ? -16.126 92.561  -72.885 1.00   63.22  ? 313  THR A OG1 1 
ATOM   1142 C CG2 . THR A 1 168 ? -16.951 93.325  -75.033 1.00   65.25  ? 313  THR A CG2 1 
ATOM   1143 N N   . PRO A 1 169 ? -12.432 94.167  -74.136 1.00   59.97  ? 314  PRO A N   1 
ATOM   1144 C CA  . PRO A 1 169 ? -11.250 94.554  -73.351 1.00   59.41  ? 314  PRO A CA  1 
ATOM   1145 C C   . PRO A 1 169 ? -11.683 95.425  -72.168 1.00   58.79  ? 314  PRO A C   1 
ATOM   1146 O O   . PRO A 1 169 ? -12.540 96.294  -72.336 1.00   60.11  ? 314  PRO A O   1 
ATOM   1147 C CB  . PRO A 1 169 ? -10.413 95.364  -74.348 1.00   58.34  ? 314  PRO A CB  1 
ATOM   1148 C CG  . PRO A 1 169 ? -10.878 94.898  -75.677 1.00   60.91  ? 314  PRO A CG  1 
ATOM   1149 C CD  . PRO A 1 169 ? -12.363 94.713  -75.498 1.00   59.53  ? 314  PRO A CD  1 
ATOM   1150 N N   . GLU A 1 170 ? -11.117 95.199  -70.987 1.00   57.22  ? 315  GLU A N   1 
ATOM   1151 C CA  . GLU A 1 170 ? -11.451 96.008  -69.816 1.00   56.46  ? 315  GLU A CA  1 
ATOM   1152 C C   . GLU A 1 170 ? -10.797 97.386  -69.875 1.00   54.69  ? 315  GLU A C   1 
ATOM   1153 O O   . GLU A 1 170 ? -9.652  97.525  -70.272 1.00   53.79  ? 315  GLU A O   1 
ATOM   1154 C CB  . GLU A 1 170 ? -10.986 95.353  -68.523 1.00   59.19  ? 315  GLU A CB  1 
ATOM   1155 C CG  . GLU A 1 170 ? -11.897 94.292  -67.987 1.00   65.43  ? 315  GLU A CG  1 
ATOM   1156 C CD  . GLU A 1 170 ? -11.890 94.256  -66.461 1.00   67.92  ? 315  GLU A CD  1 
ATOM   1157 O OE1 . GLU A 1 170 ? -12.510 95.156  -65.845 1.00   69.10  ? 315  GLU A OE1 1 
ATOM   1158 O OE2 . GLU A 1 170 ? -11.263 93.337  -65.880 1.00   69.52  ? 315  GLU A OE2 1 
ATOM   1159 N N   . TYR A 1 171 ? -11.527 98.411  -69.463 1.00   51.37  ? 316  TYR A N   1 
ATOM   1160 C CA  . TYR A 1 171 ? -10.974 99.744  -69.471 1.00   47.71  ? 316  TYR A CA  1 
ATOM   1161 C C   . TYR A 1 171 ? -11.003 100.273 -68.057 1.00   47.39  ? 316  TYR A C   1 
ATOM   1162 O O   . TYR A 1 171 ? -11.812 101.158 -67.729 1.00   48.26  ? 316  TYR A O   1 
ATOM   1163 C CB  . TYR A 1 171 ? -11.787 100.647 -70.384 1.00   45.23  ? 316  TYR A CB  1 
ATOM   1164 C CG  . TYR A 1 171 ? -11.309 100.675 -71.805 1.00   42.33  ? 316  TYR A CG  1 
ATOM   1165 C CD1 . TYR A 1 171 ? -11.631 99.660  -72.691 1.00   39.80  ? 316  TYR A CD1 1 
ATOM   1166 C CD2 . TYR A 1 171 ? -10.573 101.767 -72.279 1.00   43.12  ? 316  TYR A CD2 1 
ATOM   1167 C CE1 . TYR A 1 171 ? -11.243 99.735  -74.044 1.00   43.15  ? 316  TYR A CE1 1 
ATOM   1168 C CE2 . TYR A 1 171 ? -10.183 101.856 -73.616 1.00   41.79  ? 316  TYR A CE2 1 
ATOM   1169 C CZ  . TYR A 1 171 ? -10.522 100.854 -74.496 1.00   41.34  ? 316  TYR A CZ  1 
ATOM   1170 O OH  . TYR A 1 171 ? -10.201 101.005 -75.827 1.00   42.90  ? 316  TYR A OH  1 
ATOM   1171 N N   . LEU A 1 172 ? -10.136 99.725  -67.215 1.00   44.30  ? 317  LEU A N   1 
ATOM   1172 C CA  . LEU A 1 172 ? -10.090 100.160 -65.839 1.00   44.80  ? 317  LEU A CA  1 
ATOM   1173 C C   . LEU A 1 172 ? -9.654  101.593 -65.782 1.00   44.37  ? 317  LEU A C   1 
ATOM   1174 O O   . LEU A 1 172 ? -8.978  102.061 -66.684 1.00   44.26  ? 317  LEU A O   1 
ATOM   1175 C CB  . LEU A 1 172 ? -9.125  99.307  -64.996 1.00   43.81  ? 317  LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 172 ? -9.543  97.868  -64.733 1.00   46.18  ? 317  LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 172 ? -8.509  97.222  -63.822 1.00   44.52  ? 317  LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 172 ? -10.940 97.819  -64.053 1.00   45.56  ? 317  LEU A CD2 1 
ATOM   1179 N N   . ALA A 1 173 ? -10.040 102.285 -64.711 1.00   43.32  ? 318  ALA A N   1 
ATOM   1180 C CA  . ALA A 1 173 ? -9.660  103.667 -64.553 1.00   43.46  ? 318  ALA A CA  1 
ATOM   1181 C C   . ALA A 1 173 ? -8.199  103.762 -64.225 1.00   42.17  ? 318  ALA A C   1 
ATOM   1182 O O   . ALA A 1 173 ? -7.659  102.988 -63.443 1.00   43.33  ? 318  ALA A O   1 
ATOM   1183 C CB  . ALA A 1 173 ? -10.465 104.346 -63.442 1.00   43.50  ? 318  ALA A CB  1 
ATOM   1184 N N   . PRO A 1 174 ? -7.537  104.738 -64.808 1.00   41.70  ? 319  PRO A N   1 
ATOM   1185 C CA  . PRO A 1 174 ? -6.118  104.914 -64.539 1.00   42.04  ? 319  PRO A CA  1 
ATOM   1186 C C   . PRO A 1 174 ? -5.728  104.817 -63.080 1.00   42.66  ? 319  PRO A C   1 
ATOM   1187 O O   . PRO A 1 174 ? -4.708  104.209 -62.763 1.00   43.63  ? 319  PRO A O   1 
ATOM   1188 C CB  . PRO A 1 174 ? -5.801  106.300 -65.143 1.00   42.36  ? 319  PRO A CB  1 
ATOM   1189 C CG  . PRO A 1 174 ? -7.122  106.890 -65.461 1.00   44.72  ? 319  PRO A CG  1 
ATOM   1190 C CD  . PRO A 1 174 ? -8.013  105.711 -65.791 1.00   42.66  ? 319  PRO A CD  1 
ATOM   1191 N N   . GLU A 1 175 ? -6.505  105.397 -62.170 1.00   41.73  ? 320  GLU A N   1 
ATOM   1192 C CA  . GLU A 1 175 ? -6.070  105.319 -60.788 1.00   43.54  ? 320  GLU A CA  1 
ATOM   1193 C C   . GLU A 1 175 ? -6.267  103.905 -60.260 1.00   43.15  ? 320  GLU A C   1 
ATOM   1194 O O   . GLU A 1 175 ? -5.751  103.529 -59.223 1.00   41.24  ? 320  GLU A O   1 
ATOM   1195 C CB  . GLU A 1 175 ? -6.766  106.384 -59.879 1.00   47.33  ? 320  GLU A CB  1 
ATOM   1196 C CG  . GLU A 1 175 ? -8.288  106.252 -59.715 1.00   46.52  ? 320  GLU A CG  1 
ATOM   1197 C CD  . GLU A 1 175 ? -9.043  106.825 -60.897 1.00   48.19  ? 320  GLU A CD  1 
ATOM   1198 O OE1 . GLU A 1 175 ? -8.451  106.885 -62.006 1.00   46.26  ? 320  GLU A OE1 1 
ATOM   1199 O OE2 . GLU A 1 175 ? -10.230 107.193 -60.711 1.00   45.05  ? 320  GLU A OE2 1 
ATOM   1200 N N   . VAL A 1 176 ? -7.042  103.109 -60.957 1.00   45.25  ? 321  VAL A N   1 
ATOM   1201 C CA  . VAL A 1 176 ? -7.165  101.751 -60.496 1.00   48.63  ? 321  VAL A CA  1 
ATOM   1202 C C   . VAL A 1 176 ? -5.917  100.972 -60.962 1.00   50.85  ? 321  VAL A C   1 
ATOM   1203 O O   . VAL A 1 176 ? -5.352  100.195 -60.182 1.00   52.07  ? 321  VAL A O   1 
ATOM   1204 C CB  . VAL A 1 176 ? -8.415  101.104 -61.026 1.00   49.16  ? 321  VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 176 ? -8.290  99.565  -60.923 1.00   47.27  ? 321  VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 176 ? -9.615  101.637 -60.228 1.00   50.73  ? 321  VAL A CG2 1 
ATOM   1207 N N   . LEU A 1 177 ? -5.498  101.191 -62.219 1.00   49.97  ? 322  LEU A N   1 
ATOM   1208 C CA  . LEU A 1 177 ? -4.296  100.551 -62.786 1.00   48.75  ? 322  LEU A CA  1 
ATOM   1209 C C   . LEU A 1 177 ? -3.050  101.024 -62.051 1.00   48.70  ? 322  LEU A C   1 
ATOM   1210 O O   . LEU A 1 177 ? -2.211  100.246 -61.665 1.00   49.34  ? 322  LEU A O   1 
ATOM   1211 C CB  . LEU A 1 177 ? -4.128  100.915 -64.254 1.00   46.53  ? 322  LEU A CB  1 
ATOM   1212 C CG  . LEU A 1 177 ? -5.251  100.504 -65.193 1.00   45.97  ? 322  LEU A CG  1 
ATOM   1213 C CD1 . LEU A 1 177 ? -4.995  101.008 -66.622 1.00   45.52  ? 322  LEU A CD1 1 
ATOM   1214 C CD2 . LEU A 1 177 ? -5.363  98.997  -65.139 1.00   46.08  ? 322  LEU A CD2 1 
ATOM   1215 N N   . GLU A 1 178 ? -2.927  102.310 -61.820 1.00   49.57  ? 323  GLU A N   1 
ATOM   1216 C CA  . GLU A 1 178 ? -1.730  102.747 -61.150 1.00   51.51  ? 323  GLU A CA  1 
ATOM   1217 C C   . GLU A 1 178 ? -1.701  102.570 -59.629 1.00   53.54  ? 323  GLU A C   1 
ATOM   1218 O O   . GLU A 1 178 ? -0.661  102.243 -59.068 1.00   55.27  ? 323  GLU A O   1 
ATOM   1219 C CB  . GLU A 1 178 ? -1.422  104.189 -61.524 1.00   50.07  ? 323  GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 178 ? -0.166  104.690 -60.875 1.00   51.59  ? 323  GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 178 ? 0.239   106.047 -61.373 1.00   52.88  ? 323  GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 178 ? -0.618  106.759 -61.953 1.00   52.17  ? 323  GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 178 ? 1.418   106.401 -61.164 1.00   53.13  ? 323  GLU A OE2 1 
ATOM   1224 N N   . ASP A 1 179 ? -2.828  102.753 -58.956 1.00   53.65  ? 324  ASP A N   1 
ATOM   1225 C CA  . ASP A 1 179 ? -2.836  102.629 -57.521 1.00   53.49  ? 324  ASP A CA  1 
ATOM   1226 C C   . ASP A 1 179 ? -3.856  101.718 -56.905 1.00   53.50  ? 324  ASP A C   1 
ATOM   1227 O O   . ASP A 1 179 ? -3.973  101.673 -55.685 1.00   53.27  ? 324  ASP A O   1 
ATOM   1228 C CB  . ASP A 1 179 ? -2.971  104.007 -56.907 1.00   55.86  ? 324  ASP A CB  1 
ATOM   1229 C CG  . ASP A 1 179 ? -1.697  104.768 -56.993 1.00   59.10  ? 324  ASP A CG  1 
ATOM   1230 O OD1 . ASP A 1 179 ? -0.676  104.136 -56.615 1.00   60.05  ? 324  ASP A OD1 1 
ATOM   1231 O OD2 . ASP A 1 179 ? -1.712  105.953 -57.428 1.00   57.74  ? 324  ASP A OD2 1 
ATOM   1232 N N   . ASN A 1 180 ? -4.606  100.999 -57.725 1.00   54.41  ? 325  ASN A N   1 
ATOM   1233 C CA  . ASN A 1 180 ? -5.604  100.104 -57.167 1.00   54.86  ? 325  ASN A CA  1 
ATOM   1234 C C   . ASN A 1 180 ? -6.532  100.935 -56.263 1.00   54.43  ? 325  ASN A C   1 
ATOM   1235 O O   . ASN A 1 180 ? -6.883  100.532 -55.162 1.00   53.00  ? 325  ASN A O   1 
ATOM   1236 C CB  . ASN A 1 180 ? -4.886  99.054  -56.347 1.00   54.64  ? 325  ASN A CB  1 
ATOM   1237 C CG  . ASN A 1 180 ? -5.797  98.002  -55.869 1.00   57.17  ? 325  ASN A CG  1 
ATOM   1238 O OD1 . ASN A 1 180 ? -6.559  97.421  -56.654 1.00   56.55  ? 325  ASN A OD1 1 
ATOM   1239 N ND2 . ASN A 1 180 ? -5.746  97.730  -54.568 1.00   58.55  ? 325  ASN A ND2 1 
ATOM   1240 N N   . ASP A 1 181 ? -6.928  102.096 -56.766 1.00   55.72  ? 326  ASP A N   1 
ATOM   1241 C CA  . ASP A 1 181 ? -7.758  103.054 -56.033 1.00   56.38  ? 326  ASP A CA  1 
ATOM   1242 C C   . ASP A 1 181 ? -9.203  103.184 -56.543 1.00   54.03  ? 326  ASP A C   1 
ATOM   1243 O O   . ASP A 1 181 ? -9.509  104.017 -57.399 1.00   54.29  ? 326  ASP A O   1 
ATOM   1244 C CB  . ASP A 1 181 ? -7.061  104.421 -56.093 1.00   59.58  ? 326  ASP A CB  1 
ATOM   1245 C CG  . ASP A 1 181 ? -7.889  105.527 -55.481 1.00   62.97  ? 326  ASP A CG  1 
ATOM   1246 O OD1 . ASP A 1 181 ? -7.674  106.716 -55.836 1.00   63.92  ? 326  ASP A OD1 1 
ATOM   1247 O OD2 . ASP A 1 181 ? -8.741  105.196 -54.633 1.00   65.18  ? 326  ASP A OD2 1 
ATOM   1248 N N   . TYR A 1 182 ? -10.087 102.363 -56.001 1.00   51.58  ? 327  TYR A N   1 
ATOM   1249 C CA  . TYR A 1 182 ? -11.484 102.388 -56.381 1.00   49.64  ? 327  TYR A CA  1 
ATOM   1250 C C   . TYR A 1 182 ? -12.284 103.415 -55.591 1.00   48.90  ? 327  TYR A C   1 
ATOM   1251 O O   . TYR A 1 182 ? -13.170 103.056 -54.826 1.00   50.23  ? 327  TYR A O   1 
ATOM   1252 C CB  . TYR A 1 182 ? -12.130 101.022 -56.182 1.00   48.69  ? 327  TYR A CB  1 
ATOM   1253 C CG  . TYR A 1 182 ? -11.616 99.959  -57.114 1.00   49.20  ? 327  TYR A CG  1 
ATOM   1254 C CD1 . TYR A 1 182 ? -10.423 99.287  -56.848 1.00   48.12  ? 327  TYR A CD1 1 
ATOM   1255 C CD2 . TYR A 1 182 ? -12.304 99.640  -58.273 1.00   47.36  ? 327  TYR A CD2 1 
ATOM   1256 C CE1 . TYR A 1 182 ? -9.944  98.337  -57.703 1.00   47.86  ? 327  TYR A CE1 1 
ATOM   1257 C CE2 . TYR A 1 182 ? -11.820 98.684  -59.149 1.00   49.09  ? 327  TYR A CE2 1 
ATOM   1258 C CZ  . TYR A 1 182 ? -10.636 98.037  -58.857 1.00   49.88  ? 327  TYR A CZ  1 
ATOM   1259 O OH  . TYR A 1 182 ? -10.129 97.103  -59.745 1.00   52.40  ? 327  TYR A OH  1 
ATOM   1260 N N   . GLY A 1 183 ? -11.957 104.687 -55.788 1.00   48.39  ? 328  GLY A N   1 
ATOM   1261 C CA  . GLY A 1 183 ? -12.662 105.778 -55.154 1.00   45.30  ? 328  GLY A CA  1 
ATOM   1262 C C   . GLY A 1 183 ? -13.779 106.175 -56.099 1.00   45.41  ? 328  GLY A C   1 
ATOM   1263 O O   . GLY A 1 183 ? -13.853 105.675 -57.236 1.00   45.82  ? 328  GLY A O   1 
ATOM   1264 N N   . ARG A 1 184 ? -14.627 107.086 -55.645 1.00   44.19  ? 329  ARG A N   1 
ATOM   1265 C CA  . ARG A 1 184 ? -15.780 107.531 -56.404 1.00   43.19  ? 329  ARG A CA  1 
ATOM   1266 C C   . ARG A 1 184 ? -15.536 107.815 -57.871 1.00   41.49  ? 329  ARG A C   1 
ATOM   1267 O O   . ARG A 1 184 ? -16.350 107.512 -58.720 1.00   43.21  ? 329  ARG A O   1 
ATOM   1268 C CB  . ARG A 1 184 ? -16.358 108.811 -55.791 1.00   43.31  ? 329  ARG A CB  1 
ATOM   1269 C CG  . ARG A 1 184 ? -16.379 108.887 -54.292 1.00   48.32  ? 329  ARG A CG  1 
ATOM   1270 C CD  . ARG A 1 184 ? -16.091 110.339 -53.826 1.00   49.99  ? 329  ARG A CD  1 
ATOM   1271 N NE  . ARG A 1 184 ? -16.626 111.214 -54.843 1.00   50.44  ? 329  ARG A NE  1 
ATOM   1272 C CZ  . ARG A 1 184 ? -16.165 112.410 -55.164 1.00   51.14  ? 329  ARG A CZ  1 
ATOM   1273 N NH1 . ARG A 1 184 ? -15.133 112.940 -54.521 1.00   48.16  ? 329  ARG A NH1 1 
ATOM   1274 N NH2 . ARG A 1 184 ? -16.707 113.030 -56.218 1.00   51.55  ? 329  ARG A NH2 1 
ATOM   1275 N N   . ALA A 1 185 ? -14.434 108.461 -58.171 1.00   42.42  ? 330  ALA A N   1 
ATOM   1276 C CA  . ALA A 1 185 ? -14.138 108.824 -59.543 1.00   41.74  ? 330  ALA A CA  1 
ATOM   1277 C C   . ALA A 1 185 ? -14.210 107.717 -60.579 1.00   40.90  ? 330  ALA A C   1 
ATOM   1278 O O   . ALA A 1 185 ? -14.645 107.952 -61.701 1.00   42.15  ? 330  ALA A O   1 
ATOM   1279 C CB  . ALA A 1 185 ? -12.784 109.471 -59.597 1.00   42.81  ? 330  ALA A CB  1 
ATOM   1280 N N   . VAL A 1 186 ? -13.789 106.514 -60.221 1.00   38.63  ? 331  VAL A N   1 
ATOM   1281 C CA  . VAL A 1 186 ? -13.805 105.450 -61.212 1.00   38.56  ? 331  VAL A CA  1 
ATOM   1282 C C   . VAL A 1 186 ? -15.175 105.243 -61.828 1.00   38.98  ? 331  VAL A C   1 
ATOM   1283 O O   . VAL A 1 186 ? -15.295 104.732 -62.946 1.00   42.23  ? 331  VAL A O   1 
ATOM   1284 C CB  . VAL A 1 186 ? -13.281 104.089 -60.631 1.00   37.86  ? 331  VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 186 ? -11.924 104.303 -59.915 1.00   34.96  ? 331  VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 186 ? -14.318 103.477 -59.707 1.00   35.04  ? 331  VAL A CG2 1 
ATOM   1287 N N   . ASP A 1 187 ? -16.217 105.635 -61.111 1.00   37.10  ? 332  ASP A N   1 
ATOM   1288 C CA  . ASP A 1 187 ? -17.554 105.484 -61.650 1.00   35.04  ? 332  ASP A CA  1 
ATOM   1289 C C   . ASP A 1 187 ? -17.772 106.483 -62.762 1.00   30.47  ? 332  ASP A C   1 
ATOM   1290 O O   . ASP A 1 187 ? -18.462 106.204 -63.745 1.00   30.07  ? 332  ASP A O   1 
ATOM   1291 C CB  . ASP A 1 187 ? -18.620 105.671 -60.531 1.00   36.04  ? 332  ASP A CB  1 
ATOM   1292 C CG  . ASP A 1 187 ? -18.799 104.418 -59.634 1.00   38.07  ? 332  ASP A CG  1 
ATOM   1293 O OD1 . ASP A 1 187 ? -18.470 103.314 -60.118 1.00   37.02  ? 332  ASP A OD1 1 
ATOM   1294 O OD2 . ASP A 1 187 ? -19.289 104.530 -58.468 1.00   36.75  ? 332  ASP A OD2 1 
ATOM   1295 N N   . TRP A 1 188 ? -17.217 107.672 -62.593 1.00   30.77  ? 333  TRP A N   1 
ATOM   1296 C CA  . TRP A 1 188 ? -17.378 108.738 -63.587 1.00   33.49  ? 333  TRP A CA  1 
ATOM   1297 C C   . TRP A 1 188 ? -16.540 108.351 -64.807 1.00   34.76  ? 333  TRP A C   1 
ATOM   1298 O O   . TRP A 1 188 ? -16.971 108.540 -65.944 1.00   34.37  ? 333  TRP A O   1 
ATOM   1299 C CB  . TRP A 1 188 ? -16.963 110.113 -62.972 1.00   34.98  ? 333  TRP A CB  1 
ATOM   1300 C CG  . TRP A 1 188 ? -17.959 110.577 -61.886 1.00   31.39  ? 333  TRP A CG  1 
ATOM   1301 C CD1 . TRP A 1 188 ? -17.673 110.891 -60.599 1.00   31.52  ? 333  TRP A CD1 1 
ATOM   1302 C CD2 . TRP A 1 188 ? -19.389 110.543 -61.981 1.00   29.29  ? 333  TRP A CD2 1 
ATOM   1303 N NE1 . TRP A 1 188 ? -18.825 111.047 -59.881 1.00   31.44  ? 333  TRP A NE1 1 
ATOM   1304 C CE2 . TRP A 1 188 ? -19.897 110.823 -60.705 1.00   29.37  ? 333  TRP A CE2 1 
ATOM   1305 C CE3 . TRP A 1 188 ? -20.291 110.271 -63.024 1.00   27.41  ? 333  TRP A CE3 1 
ATOM   1306 C CZ2 . TRP A 1 188 ? -21.275 110.839 -60.430 1.00   26.18  ? 333  TRP A CZ2 1 
ATOM   1307 C CZ3 . TRP A 1 188 ? -21.654 110.289 -62.743 1.00   27.70  ? 333  TRP A CZ3 1 
ATOM   1308 C CH2 . TRP A 1 188 ? -22.126 110.564 -61.448 1.00   22.72  ? 333  TRP A CH2 1 
ATOM   1309 N N   . TRP A 1 189 ? -15.370 107.755 -64.552 1.00   35.61  ? 334  TRP A N   1 
ATOM   1310 C CA  . TRP A 1 189 ? -14.517 107.265 -65.627 1.00   34.89  ? 334  TRP A CA  1 
ATOM   1311 C C   . TRP A 1 189 ? -15.324 106.194 -66.378 1.00   33.74  ? 334  TRP A C   1 
ATOM   1312 O O   . TRP A 1 189 ? -15.394 106.181 -67.615 1.00   37.03  ? 334  TRP A O   1 
ATOM   1313 C CB  . TRP A 1 189 ? -13.224 106.709 -65.023 1.00   37.26  ? 334  TRP A CB  1 
ATOM   1314 C CG  . TRP A 1 189 ? -12.417 105.804 -65.988 1.00   43.33  ? 334  TRP A CG  1 
ATOM   1315 C CD1 . TRP A 1 189 ? -12.530 104.446 -66.131 1.00   41.96  ? 334  TRP A CD1 1 
ATOM   1316 C CD2 . TRP A 1 189 ? -11.460 106.227 -66.974 1.00   43.18  ? 334  TRP A CD2 1 
ATOM   1317 N NE1 . TRP A 1 189 ? -11.713 104.006 -67.140 1.00   44.69  ? 334  TRP A NE1 1 
ATOM   1318 C CE2 . TRP A 1 189 ? -11.045 105.071 -67.677 1.00   43.66  ? 334  TRP A CE2 1 
ATOM   1319 C CE3 . TRP A 1 189 ? -10.915 107.468 -67.330 1.00   44.05  ? 334  TRP A CE3 1 
ATOM   1320 C CZ2 . TRP A 1 189 ? -10.110 105.117 -68.729 1.00   42.16  ? 334  TRP A CZ2 1 
ATOM   1321 C CZ3 . TRP A 1 189 ? -9.966  107.515 -68.396 1.00   44.50  ? 334  TRP A CZ3 1 
ATOM   1322 C CH2 . TRP A 1 189 ? -9.587  106.345 -69.070 1.00   41.44  ? 334  TRP A CH2 1 
ATOM   1323 N N   . GLY A 1 190 ? -15.995 105.317 -65.653 1.00   31.18  ? 335  GLY A N   1 
ATOM   1324 C CA  . GLY A 1 190 ? -16.777 104.324 -66.340 1.00   30.14  ? 335  GLY A CA  1 
ATOM   1325 C C   . GLY A 1 190 ? -17.930 104.899 -67.126 1.00   33.15  ? 335  GLY A C   1 
ATOM   1326 O O   . GLY A 1 190 ? -18.361 104.323 -68.155 1.00   33.70  ? 335  GLY A O   1 
ATOM   1327 N N   . LEU A 1 191 ? -18.477 106.010 -66.634 1.00   33.57  ? 336  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 191 ? -19.593 106.660 -67.324 1.00   33.87  ? 336  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 191 ? -19.063 107.170 -68.666 1.00   32.97  ? 336  LEU A C   1 
ATOM   1330 O O   . LEU A 1 191 ? -19.702 106.986 -69.710 1.00   32.34  ? 336  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 191 ? -20.183 107.858 -66.506 1.00   29.76  ? 336  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 191 ? -21.214 108.620 -67.360 1.00   29.42  ? 336  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 191 ? -22.378 107.704 -67.724 1.00   27.96  ? 336  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 191 ? -21.728 109.844 -66.625 1.00   31.60  ? 336  LEU A CD2 1 
ATOM   1335 N N   . GLY A 1 192 ? -17.895 107.803 -68.625 1.00   30.69  ? 337  GLY A N   1 
ATOM   1336 C CA  . GLY A 1 192 ? -17.315 108.309 -69.858 1.00   33.94  ? 337  GLY A CA  1 
ATOM   1337 C C   . GLY A 1 192 ? -16.993 107.284 -70.948 1.00   34.44  ? 337  GLY A C   1 
ATOM   1338 O O   . GLY A 1 192 ? -17.287 107.501 -72.135 1.00   34.28  ? 337  GLY A O   1 
ATOM   1339 N N   . VAL A 1 193 ? -16.383 106.172 -70.550 1.00   34.88  ? 338  VAL A N   1 
ATOM   1340 C CA  . VAL A 1 193 ? -16.072 105.097 -71.495 1.00   34.23  ? 338  VAL A CA  1 
ATOM   1341 C C   . VAL A 1 193 ? -17.383 104.553 -72.083 1.00   34.74  ? 338  VAL A C   1 
ATOM   1342 O O   . VAL A 1 193 ? -17.459 104.201 -73.228 1.00   34.41  ? 338  VAL A O   1 
ATOM   1343 C CB  . VAL A 1 193 ? -15.339 103.934 -70.771 1.00   33.94  ? 338  VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 193 ? -15.239 102.725 -71.720 1.00   35.20  ? 338  VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 193 ? -13.987 104.412 -70.241 1.00   28.56  ? 338  VAL A CG2 1 
ATOM   1346 N N   . VAL A 1 194 ? -18.430 104.510 -71.281 1.00   36.07  ? 339  VAL A N   1 
ATOM   1347 C CA  . VAL A 1 194 ? -19.705 104.009 -71.755 1.00   37.74  ? 339  VAL A CA  1 
ATOM   1348 C C   . VAL A 1 194 ? -20.374 104.952 -72.764 1.00   40.77  ? 339  VAL A C   1 
ATOM   1349 O O   . VAL A 1 194 ? -20.963 104.510 -73.750 1.00   41.41  ? 339  VAL A O   1 
ATOM   1350 C CB  . VAL A 1 194 ? -20.671 103.806 -70.580 1.00   37.99  ? 339  VAL A CB  1 
ATOM   1351 C CG1 . VAL A 1 194 ? -22.106 103.620 -71.100 1.00   37.92  ? 339  VAL A CG1 1 
ATOM   1352 C CG2 . VAL A 1 194 ? -20.213 102.658 -69.749 1.00   35.42  ? 339  VAL A CG2 1 
ATOM   1353 N N   . MET A 1 195 ? -20.346 106.247 -72.508 1.00   42.32  ? 340  MET A N   1 
ATOM   1354 C CA  . MET A 1 195 ? -20.961 107.148 -73.476 1.00   46.35  ? 340  MET A CA  1 
ATOM   1355 C C   . MET A 1 195 ? -20.080 107.393 -74.687 1.00   46.17  ? 340  MET A C   1 
ATOM   1356 O O   . MET A 1 195 ? -20.597 107.668 -75.771 1.00   47.40  ? 340  MET A O   1 
ATOM   1357 C CB  . MET A 1 195 ? -21.363 108.441 -72.809 1.00   47.20  ? 340  MET A CB  1 
ATOM   1358 C CG  . MET A 1 195 ? -22.505 108.146 -71.919 1.00   49.49  ? 340  MET A CG  1 
ATOM   1359 S SD  . MET A 1 195 ? -22.939 109.545 -70.990 1.00   58.17  ? 340  MET A SD  1 
ATOM   1360 C CE  . MET A 1 195 ? -21.308 110.133 -70.382 1.00   55.34  ? 340  MET A CE  1 
ATOM   1361 N N   . TYR A 1 196 ? -18.764 107.307 -74.505 1.00   46.91  ? 341  TYR A N   1 
ATOM   1362 C CA  . TYR A 1 196 ? -17.821 107.417 -75.629 1.00   47.05  ? 341  TYR A CA  1 
ATOM   1363 C C   . TYR A 1 196 ? -18.180 106.302 -76.619 1.00   46.99  ? 341  TYR A C   1 
ATOM   1364 O O   . TYR A 1 196 ? -18.246 106.529 -77.828 1.00   46.61  ? 341  TYR A O   1 
ATOM   1365 C CB  . TYR A 1 196 ? -16.389 107.176 -75.163 1.00   47.69  ? 341  TYR A CB  1 
ATOM   1366 C CG  . TYR A 1 196 ? -15.355 107.300 -76.259 1.00   49.98  ? 341  TYR A CG  1 
ATOM   1367 C CD1 . TYR A 1 196 ? -15.343 106.427 -77.360 1.00   49.63  ? 341  TYR A CD1 1 
ATOM   1368 C CD2 . TYR A 1 196 ? -14.368 108.279 -76.185 1.00   50.34  ? 341  TYR A CD2 1 
ATOM   1369 C CE1 . TYR A 1 196 ? -14.369 106.540 -78.362 1.00   48.85  ? 341  TYR A CE1 1 
ATOM   1370 C CE2 . TYR A 1 196 ? -13.394 108.399 -77.160 1.00   50.14  ? 341  TYR A CE2 1 
ATOM   1371 C CZ  . TYR A 1 196 ? -13.402 107.537 -78.244 1.00   50.09  ? 341  TYR A CZ  1 
ATOM   1372 O OH  . TYR A 1 196 ? -12.446 107.721 -79.202 1.00   50.03  ? 341  TYR A OH  1 
ATOM   1373 N N   . GLU A 1 197 ? -18.460 105.099 -76.117 1.00   45.82  ? 342  GLU A N   1 
ATOM   1374 C CA  . GLU A 1 197 ? -18.786 104.033 -77.038 1.00   45.02  ? 342  GLU A CA  1 
ATOM   1375 C C   . GLU A 1 197 ? -20.154 104.232 -77.649 1.00   44.19  ? 342  GLU A C   1 
ATOM   1376 O O   . GLU A 1 197 ? -20.380 103.862 -78.795 1.00   45.40  ? 342  GLU A O   1 
ATOM   1377 C CB  . GLU A 1 197 ? -18.687 102.648 -76.355 1.00   46.33  ? 342  GLU A CB  1 
ATOM   1378 C CG  . GLU A 1 197 ? -18.658 101.505 -77.367 1.00   46.34  ? 342  GLU A CG  1 
ATOM   1379 C CD  . GLU A 1 197 ? -18.577 100.051 -76.800 1.00   49.89  ? 342  GLU A CD  1 
ATOM   1380 O OE1 . GLU A 1 197 ? -18.235 99.798  -75.611 1.00   47.14  ? 342  GLU A OE1 1 
ATOM   1381 O OE2 . GLU A 1 197 ? -18.859 99.131  -77.608 1.00   50.39  ? 342  GLU A OE2 1 
ATOM   1382 N N   . MET A 1 198 ? -21.085 104.788 -76.888 1.00   44.46  ? 343  MET A N   1 
ATOM   1383 C CA  . MET A 1 198 ? -22.454 105.038 -77.385 1.00   44.17  ? 343  MET A CA  1 
ATOM   1384 C C   . MET A 1 198 ? -22.509 106.050 -78.503 1.00   45.11  ? 343  MET A C   1 
ATOM   1385 O O   . MET A 1 198 ? -23.271 105.902 -79.457 1.00   44.84  ? 343  MET A O   1 
ATOM   1386 C CB  . MET A 1 198 ? -23.340 105.583 -76.271 1.00   43.87  ? 343  MET A CB  1 
ATOM   1387 C CG  . MET A 1 198 ? -23.853 104.549 -75.364 1.00   43.98  ? 343  MET A CG  1 
ATOM   1388 S SD  . MET A 1 198 ? -24.642 105.270 -73.969 1.00   40.53  ? 343  MET A SD  1 
ATOM   1389 C CE  . MET A 1 198 ? -25.971 104.189 -74.013 1.00   40.66  ? 343  MET A CE  1 
ATOM   1390 N N   . MET A 1 199 ? -21.719 107.100 -78.350 1.00   46.42  ? 344  MET A N   1 
ATOM   1391 C CA  . MET A 1 199 ? -21.687 108.172 -79.312 1.00   50.91  ? 344  MET A CA  1 
ATOM   1392 C C   . MET A 1 199 ? -20.710 107.966 -80.484 1.00   53.05  ? 344  MET A C   1 
ATOM   1393 O O   . MET A 1 199 ? -20.981 108.441 -81.574 1.00   55.27  ? 344  MET A O   1 
ATOM   1394 C CB  . MET A 1 199 ? -21.434 109.493 -78.558 1.00   52.42  ? 344  MET A CB  1 
ATOM   1395 C CG  . MET A 1 199 ? -22.710 110.009 -77.792 1.00   52.38  ? 344  MET A CG  1 
ATOM   1396 S SD  . MET A 1 199 ? -22.442 111.376 -76.599 1.00   52.75  ? 344  MET A SD  1 
ATOM   1397 C CE  . MET A 1 199 ? -20.928 112.023 -77.219 1.00   55.10  ? 344  MET A CE  1 
ATOM   1398 N N   . CYS A 1 200 ? -19.610 107.235 -80.274 1.00   53.89  ? 345  CYS A N   1 
ATOM   1399 C CA  . CYS A 1 200 ? -18.617 106.955 -81.321 1.00   51.82  ? 345  CYS A CA  1 
ATOM   1400 C C   . CYS A 1 200 ? -18.791 105.561 -81.965 1.00   51.77  ? 345  CYS A C   1 
ATOM   1401 O O   . CYS A 1 200 ? -18.480 105.377 -83.137 1.00   51.99  ? 345  CYS A O   1 
ATOM   1402 C CB  . CYS A 1 200 ? -17.223 107.102 -80.749 1.00   51.33  ? 345  CYS A CB  1 
ATOM   1403 S SG  . CYS A 1 200 ? -17.073 108.655 -79.836 1.00   52.39  ? 345  CYS A SG  1 
ATOM   1404 N N   . GLY A 1 201 ? -19.311 104.599 -81.207 1.00   51.49  ? 346  GLY A N   1 
ATOM   1405 C CA  . GLY A 1 201 ? -19.564 103.257 -81.729 1.00   51.24  ? 346  GLY A CA  1 
ATOM   1406 C C   . GLY A 1 201 ? -18.439 102.248 -81.510 1.00   52.83  ? 346  GLY A C   1 
ATOM   1407 O O   . GLY A 1 201 ? -18.543 101.082 -81.894 1.00   53.11  ? 346  GLY A O   1 
ATOM   1408 N N   . ARG A 1 202 ? -17.375 102.691 -80.859 1.00   51.17  ? 347  ARG A N   1 
ATOM   1409 C CA  . ARG A 1 202 ? -16.216 101.864 -80.641 1.00   51.15  ? 347  ARG A CA  1 
ATOM   1410 C C   . ARG A 1 202 ? -15.533 102.421 -79.399 1.00   49.71  ? 347  ARG A C   1 
ATOM   1411 O O   . ARG A 1 202 ? -15.777 103.574 -79.048 1.00   50.69  ? 347  ARG A O   1 
ATOM   1412 C CB  . ARG A 1 202 ? -15.291 102.022 -81.852 1.00   52.03  ? 347  ARG A CB  1 
ATOM   1413 C CG  . ARG A 1 202 ? -14.883 103.465 -82.030 1.00   54.85  ? 347  ARG A CG  1 
ATOM   1414 C CD  . ARG A 1 202 ? -13.836 103.674 -83.104 1.00   58.64  ? 347  ARG A CD  1 
ATOM   1415 N NE  . ARG A 1 202 ? -13.378 105.069 -83.181 1.00   61.58  ? 347  ARG A NE  1 
ATOM   1416 C CZ  . ARG A 1 202 ? -14.046 106.064 -83.772 1.00   62.51  ? 347  ARG A CZ  1 
ATOM   1417 N NH1 . ARG A 1 202 ? -15.221 105.836 -84.355 1.00   61.51  ? 347  ARG A NH1 1 
ATOM   1418 N NH2 . ARG A 1 202 ? -13.535 107.296 -83.781 1.00   62.88  ? 347  ARG A NH2 1 
ATOM   1419 N N   . LEU A 1 203 ? -14.680 101.623 -78.751 1.00   47.78  ? 348  LEU A N   1 
ATOM   1420 C CA  . LEU A 1 203 ? -13.946 102.071 -77.564 1.00   46.32  ? 348  LEU A CA  1 
ATOM   1421 C C   . LEU A 1 203 ? -12.851 103.061 -77.943 1.00   47.17  ? 348  LEU A C   1 
ATOM   1422 O O   . LEU A 1 203 ? -12.546 103.234 -79.110 1.00   50.75  ? 348  LEU A O   1 
ATOM   1423 C CB  . LEU A 1 203 ? -13.385 100.876 -76.790 1.00   42.09  ? 348  LEU A CB  1 
ATOM   1424 C CG  . LEU A 1 203 ? -14.473 100.144 -75.987 1.00   41.27  ? 348  LEU A CG  1 
ATOM   1425 C CD1 . LEU A 1 203 ? -14.096 98.704  -75.716 1.00   39.71  ? 348  LEU A CD1 1 
ATOM   1426 C CD2 . LEU A 1 203 ? -14.691 100.852 -74.657 1.00   40.29  ? 348  LEU A CD2 1 
ATOM   1427 N N   . PRO A 1 204 ? -12.245 103.739 -76.970 1.00   47.10  ? 349  PRO A N   1 
ATOM   1428 C CA  . PRO A 1 204 ? -11.212 104.699 -77.344 1.00   46.69  ? 349  PRO A CA  1 
ATOM   1429 C C   . PRO A 1 204 ? -9.970  104.211 -78.015 1.00   49.45  ? 349  PRO A C   1 
ATOM   1430 O O   . PRO A 1 204 ? -9.361  104.936 -78.789 1.00   49.31  ? 349  PRO A O   1 
ATOM   1431 C CB  . PRO A 1 204 ? -10.905 105.422 -76.042 1.00   46.24  ? 349  PRO A CB  1 
ATOM   1432 C CG  . PRO A 1 204 ? -11.351 104.510 -75.033 1.00   47.45  ? 349  PRO A CG  1 
ATOM   1433 C CD  . PRO A 1 204 ? -12.605 103.895 -75.564 1.00   46.11  ? 349  PRO A CD  1 
ATOM   1434 N N   . PHE A 1 205 ? -9.556  102.995 -77.715 1.00   51.42  ? 350  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 205 ? -8.351  102.489 -78.350 1.00   53.12  ? 350  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 205 ? -8.714  101.228 -79.115 1.00   56.31  ? 350  PHE A C   1 
ATOM   1437 O O   . PHE A 1 205 ? -7.932  100.296 -79.209 1.00   56.61  ? 350  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 205 ? -7.310  102.197 -77.275 1.00   49.04  ? 350  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 205 ? -7.009  103.366 -76.397 1.00   43.76  ? 350  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 205 ? -7.228  103.293 -75.028 1.00   41.14  ? 350  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 205 ? -6.423  104.507 -76.923 1.00   42.19  ? 350  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 205 ? -6.865  104.320 -74.187 1.00   36.64  ? 350  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 205 ? -6.051  105.543 -76.104 1.00   37.95  ? 350  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 205 ? -6.270  105.451 -74.718 1.00   39.89  ? 350  PHE A CZ  1 
ATOM   1445 N N   . TYR A 1 206 ? -9.923  101.226 -79.663 1.00   61.96  ? 351  TYR A N   1 
ATOM   1446 C CA  . TYR A 1 206 ? -10.468 100.069 -80.363 1.00   67.33  ? 351  TYR A CA  1 
ATOM   1447 C C   . TYR A 1 206 ? -9.570  99.450  -81.421 1.00   69.94  ? 351  TYR A C   1 
ATOM   1448 O O   . TYR A 1 206 ? -9.694  98.260  -81.708 1.00   70.70  ? 351  TYR A O   1 
ATOM   1449 C CB  . TYR A 1 206 ? -11.820 100.413 -80.985 1.00   68.91  ? 351  TYR A CB  1 
ATOM   1450 C CG  . TYR A 1 206 ? -11.721 101.014 -82.364 1.00   72.16  ? 351  TYR A CG  1 
ATOM   1451 C CD1 . TYR A 1 206 ? -12.454 100.474 -83.429 1.00   73.29  ? 351  TYR A CD1 1 
ATOM   1452 C CD2 . TYR A 1 206 ? -10.869 102.097 -82.623 1.00   73.04  ? 351  TYR A CD2 1 
ATOM   1453 C CE1 . TYR A 1 206 ? -12.335 100.992 -84.720 1.00   74.65  ? 351  TYR A CE1 1 
ATOM   1454 C CE2 . TYR A 1 206 ? -10.746 102.628 -83.913 1.00   74.21  ? 351  TYR A CE2 1 
ATOM   1455 C CZ  . TYR A 1 206 ? -11.483 102.070 -84.955 1.00   74.86  ? 351  TYR A CZ  1 
ATOM   1456 O OH  . TYR A 1 206 ? -11.395 102.589 -86.232 1.00   76.81  ? 351  TYR A OH  1 
ATOM   1457 N N   . ASN A 1 207 ? -8.699  100.237 -82.032 1.00   72.09  ? 352  ASN A N   1 
ATOM   1458 C CA  . ASN A 1 207 ? -7.814  99.644  -83.018 1.00   76.53  ? 352  ASN A CA  1 
ATOM   1459 C C   . ASN A 1 207 ? -6.457  99.313  -82.399 1.00   77.87  ? 352  ASN A C   1 
ATOM   1460 O O   . ASN A 1 207 ? -6.021  98.163  -82.480 1.00   79.59  ? 352  ASN A O   1 
ATOM   1461 C CB  . ASN A 1 207 ? -7.649  100.544 -84.250 1.00   78.49  ? 352  ASN A CB  1 
ATOM   1462 C CG  . ASN A 1 207 ? -7.449  101.994 -83.893 1.00   80.93  ? 352  ASN A CG  1 
ATOM   1463 O OD1 . ASN A 1 207 ? -7.065  102.807 -84.741 1.00   82.09  ? 352  ASN A OD1 1 
ATOM   1464 N ND2 . ASN A 1 207 ? -7.715  102.337 -82.631 1.00   82.42  ? 352  ASN A ND2 1 
ATOM   1465 N N   . GLN A 1 208 ? -5.807  100.285 -81.756 1.00   78.28  ? 353  GLN A N   1 
ATOM   1466 C CA  . GLN A 1 208 ? -4.510  100.042 -81.143 1.00   79.12  ? 353  GLN A CA  1 
ATOM   1467 C C   . GLN A 1 208 ? -4.426  98.725  -80.380 1.00   80.37  ? 353  GLN A C   1 
ATOM   1468 O O   . GLN A 1 208 ? -4.955  98.595  -79.284 1.00   81.47  ? 353  GLN A O   1 
ATOM   1469 C CB  . GLN A 1 208 ? -4.138  101.181 -80.214 1.00   79.48  ? 353  GLN A CB  1 
ATOM   1470 C CG  . GLN A 1 208 ? -3.791  102.453 -80.928 1.00   81.42  ? 353  GLN A CG  1 
ATOM   1471 C CD  . GLN A 1 208 ? -2.917  103.373 -80.080 1.00   83.95  ? 353  GLN A CD  1 
ATOM   1472 O OE1 . GLN A 1 208 ? -1.705  103.155 -79.938 1.00   83.86  ? 353  GLN A OE1 1 
ATOM   1473 N NE2 . GLN A 1 208 ? -3.532  104.409 -79.504 1.00   85.02  ? 353  GLN A NE2 1 
ATOM   1474 N N   . ASP A 1 209 ? -3.731  97.759  -80.975 1.00   81.46  ? 354  ASP A N   1 
ATOM   1475 C CA  . ASP A 1 209 ? -3.535  96.419  -80.425 1.00   82.70  ? 354  ASP A CA  1 
ATOM   1476 C C   . ASP A 1 209 ? -4.435  96.085  -79.245 1.00   82.56  ? 354  ASP A C   1 
ATOM   1477 O O   . ASP A 1 209 ? -5.651  96.059  -79.382 1.00   83.62  ? 354  ASP A O   1 
ATOM   1478 C CB  . ASP A 1 209 ? -2.072  96.216  -80.021 1.00   84.01  ? 354  ASP A CB  1 
ATOM   1479 C CG  . ASP A 1 209 ? -1.620  94.761  -80.163 1.00   84.86  ? 354  ASP A CG  1 
ATOM   1480 O OD1 . ASP A 1 209 ? -2.355  93.845  -79.711 1.00   85.64  ? 354  ASP A OD1 1 
ATOM   1481 O OD2 . ASP A 1 209 ? -0.521  94.541  -80.724 1.00   84.92  ? 354  ASP A OD2 1 
ATOM   1482 N N   . HIS A 1 210 ? -3.844  95.817  -78.087 1.00   81.61  ? 355  HIS A N   1 
ATOM   1483 C CA  . HIS A 1 210 ? -4.647  95.488  -76.932 1.00   80.51  ? 355  HIS A CA  1 
ATOM   1484 C C   . HIS A 1 210 ? -3.888  95.245  -75.646 1.00   79.01  ? 355  HIS A C   1 
ATOM   1485 O O   . HIS A 1 210 ? -4.410  95.489  -74.563 1.00   78.82  ? 355  HIS A O   1 
ATOM   1486 C CB  . HIS A 1 210 ? -5.509  94.276  -77.203 1.00   82.92  ? 355  HIS A CB  1 
ATOM   1487 C CG  . HIS A 1 210 ? -6.167  93.758  -75.972 1.00   86.03  ? 355  HIS A CG  1 
ATOM   1488 N ND1 . HIS A 1 210 ? -6.697  94.598  -75.016 1.00   88.02  ? 355  HIS A ND1 1 
ATOM   1489 C CD2 . HIS A 1 210 ? -6.344  92.499  -75.508 1.00   88.00  ? 355  HIS A CD2 1 
ATOM   1490 C CE1 . HIS A 1 210 ? -7.169  93.879  -74.012 1.00   88.99  ? 355  HIS A CE1 1 
ATOM   1491 N NE2 . HIS A 1 210 ? -6.969  92.602  -74.286 1.00   89.43  ? 355  HIS A NE2 1 
ATOM   1492 N N   . GLU A 1 211 ? -2.679  94.720  -75.737 1.00   76.97  ? 356  GLU A N   1 
ATOM   1493 C CA  . GLU A 1 211 ? -1.902  94.521  -74.528 1.00   75.62  ? 356  GLU A CA  1 
ATOM   1494 C C   . GLU A 1 211 ? -1.269  95.885  -74.273 1.00   73.01  ? 356  GLU A C   1 
ATOM   1495 O O   . GLU A 1 211 ? -0.444  96.054  -73.380 1.00   72.53  ? 356  GLU A O   1 
ATOM   1496 C CB  . GLU A 1 211 ? -0.824  93.465  -74.746 1.00   78.80  ? 356  GLU A CB  1 
ATOM   1497 C CG  . GLU A 1 211 ? -1.344  92.153  -75.279 1.00   81.59  ? 356  GLU A CG  1 
ATOM   1498 C CD  . GLU A 1 211 ? -0.286  91.416  -76.074 1.00   84.46  ? 356  GLU A CD  1 
ATOM   1499 O OE1 . GLU A 1 211 ? 0.244   92.008  -77.048 1.00   85.31  ? 356  GLU A OE1 1 
ATOM   1500 O OE2 . GLU A 1 211 ? 0.020   90.250  -75.729 1.00   86.23  ? 356  GLU A OE2 1 
ATOM   1501 N N   . ARG A 1 212 ? -1.669  96.849  -75.096 1.00   69.85  ? 357  ARG A N   1 
ATOM   1502 C CA  . ARG A 1 212 ? -1.210  98.218  -74.993 1.00   66.83  ? 357  ARG A CA  1 
ATOM   1503 C C   . ARG A 1 212 ? -2.098  99.024  -74.067 1.00   64.35  ? 357  ARG A C   1 
ATOM   1504 O O   . ARG A 1 212 ? -1.708  100.091 -73.577 1.00   63.10  ? 357  ARG A O   1 
ATOM   1505 C CB  . ARG A 1 212 ? -1.218  98.860  -76.364 1.00   68.37  ? 357  ARG A CB  1 
ATOM   1506 C CG  . ARG A 1 212 ? 0.027   98.563  -77.104 1.00   72.12  ? 357  ARG A CG  1 
ATOM   1507 C CD  . ARG A 1 212 ? -0.092  98.764  -78.586 1.00   74.77  ? 357  ARG A CD  1 
ATOM   1508 N NE  . ARG A 1 212 ? 0.973   98.003  -79.231 1.00   77.49  ? 357  ARG A NE  1 
ATOM   1509 C CZ  . ARG A 1 212 ? 1.165   97.951  -80.539 1.00   79.35  ? 357  ARG A CZ  1 
ATOM   1510 N NH1 . ARG A 1 212 ? 0.356   98.634  -81.347 1.00   79.41  ? 357  ARG A NH1 1 
ATOM   1511 N NH2 . ARG A 1 212 ? 2.148   97.197  -81.034 1.00   79.46  ? 357  ARG A NH2 1 
ATOM   1512 N N   . LEU A 1 213 ? -3.294  98.500  -73.827 1.00   60.93  ? 358  LEU A N   1 
ATOM   1513 C CA  . LEU A 1 213 ? -4.265  99.175  -72.987 1.00   57.43  ? 358  LEU A CA  1 
ATOM   1514 C C   . LEU A 1 213 ? -3.710  99.735  -71.720 1.00   55.13  ? 358  LEU A C   1 
ATOM   1515 O O   . LEU A 1 213 ? -4.062  100.839 -71.352 1.00   54.01  ? 358  LEU A O   1 
ATOM   1516 C CB  . LEU A 1 213 ? -5.433  98.261  -72.662 1.00   56.22  ? 358  LEU A CB  1 
ATOM   1517 C CG  . LEU A 1 213 ? -6.450  98.321  -73.791 1.00   55.37  ? 358  LEU A CG  1 
ATOM   1518 C CD1 . LEU A 1 213 ? -7.638  97.440  -73.446 1.00   54.70  ? 358  LEU A CD1 1 
ATOM   1519 C CD2 . LEU A 1 213 ? -6.868  99.776  -74.013 1.00   53.74  ? 358  LEU A CD2 1 
ATOM   1520 N N   . PHE A 1 214 ? -2.824  98.995  -71.065 1.00   53.99  ? 359  PHE A N   1 
ATOM   1521 C CA  . PHE A 1 214 ? -2.251  99.473  -69.809 1.00   53.47  ? 359  PHE A CA  1 
ATOM   1522 C C   . PHE A 1 214 ? -1.583  100.837 -69.977 1.00   53.31  ? 359  PHE A C   1 
ATOM   1523 O O   . PHE A 1 214 ? -1.894  101.766 -69.220 1.00   54.92  ? 359  PHE A O   1 
ATOM   1524 C CB  . PHE A 1 214 ? -1.242  98.474  -69.226 1.00   49.80  ? 359  PHE A CB  1 
ATOM   1525 C CG  . PHE A 1 214 ? -0.694  98.886  -67.882 1.00   49.16  ? 359  PHE A CG  1 
ATOM   1526 C CD1 . PHE A 1 214 ? -1.410  98.651  -66.719 1.00   46.62  ? 359  PHE A CD1 1 
ATOM   1527 C CD2 . PHE A 1 214 ? 0.529   99.533  -67.787 1.00   48.60  ? 359  PHE A CD2 1 
ATOM   1528 C CE1 . PHE A 1 214 ? -0.918  99.055  -65.487 1.00   47.35  ? 359  PHE A CE1 1 
ATOM   1529 C CE2 . PHE A 1 214 ? 1.030   99.940  -66.561 1.00   47.39  ? 359  PHE A CE2 1 
ATOM   1530 C CZ  . PHE A 1 214 ? 0.305   99.703  -65.403 1.00   48.61  ? 359  PHE A CZ  1 
ATOM   1531 N N   . GLU A 1 215 ? -0.700  100.969 -70.970 1.00   51.55  ? 360  GLU A N   1 
ATOM   1532 C CA  . GLU A 1 215 ? -0.004  102.236 -71.181 1.00   51.27  ? 360  GLU A CA  1 
ATOM   1533 C C   . GLU A 1 215 ? -0.868  103.276 -71.878 1.00   49.45  ? 360  GLU A C   1 
ATOM   1534 O O   . GLU A 1 215 ? -0.636  104.474 -71.730 1.00   47.18  ? 360  GLU A O   1 
ATOM   1535 C CB  . GLU A 1 215 ? 1.271   102.077 -72.020 1.00   52.43  ? 360  GLU A CB  1 
ATOM   1536 C CG  . GLU A 1 215 ? 2.103   100.829 -71.800 1.00   56.91  ? 360  GLU A CG  1 
ATOM   1537 C CD  . GLU A 1 215 ? 1.525   99.607  -72.509 1.00   56.80  ? 360  GLU A CD  1 
ATOM   1538 O OE1 . GLU A 1 215 ? 0.940   98.759  -71.806 1.00   55.92  ? 360  GLU A OE1 1 
ATOM   1539 O OE2 . GLU A 1 215 ? 1.652   99.504  -73.758 1.00   57.19  ? 360  GLU A OE2 1 
ATOM   1540 N N   . LEU A 1 216 ? -1.837  102.824 -72.662 1.00   47.90  ? 361  LEU A N   1 
ATOM   1541 C CA  . LEU A 1 216 ? -2.688  103.756 -73.362 1.00   48.58  ? 361  LEU A CA  1 
ATOM   1542 C C   . LEU A 1 216 ? -3.618  104.473 -72.365 1.00   49.20  ? 361  LEU A C   1 
ATOM   1543 O O   . LEU A 1 216 ? -3.674  105.707 -72.334 1.00   50.59  ? 361  LEU A O   1 
ATOM   1544 C CB  . LEU A 1 216 ? -3.472  103.036 -74.468 1.00   48.02  ? 361  LEU A CB  1 
ATOM   1545 C CG  . LEU A 1 216 ? -2.581  102.519 -75.616 1.00   49.28  ? 361  LEU A CG  1 
ATOM   1546 C CD1 . LEU A 1 216 ? -3.472  101.858 -76.635 1.00   47.18  ? 361  LEU A CD1 1 
ATOM   1547 C CD2 . LEU A 1 216 ? -1.758  103.689 -76.275 1.00   47.50  ? 361  LEU A CD2 1 
ATOM   1548 N N   . ILE A 1 217 ? -4.312  103.703 -71.537 1.00   47.29  ? 362  ILE A N   1 
ATOM   1549 C CA  . ILE A 1 217 ? -5.203  104.263 -70.548 1.00   44.83  ? 362  ILE A CA  1 
ATOM   1550 C C   . ILE A 1 217 ? -4.424  105.171 -69.636 1.00   45.53  ? 362  ILE A C   1 
ATOM   1551 O O   . ILE A 1 217 ? -4.852  106.292 -69.323 1.00   47.14  ? 362  ILE A O   1 
ATOM   1552 C CB  . ILE A 1 217 ? -5.861  103.147 -69.733 1.00   43.76  ? 362  ILE A CB  1 
ATOM   1553 C CG1 . ILE A 1 217 ? -6.875  102.422 -70.626 1.00   40.38  ? 362  ILE A CG1 1 
ATOM   1554 C CG2 . ILE A 1 217 ? -6.453  103.706 -68.434 1.00   40.16  ? 362  ILE A CG2 1 
ATOM   1555 C CD1 . ILE A 1 217 ? -7.409  101.146 -70.000 1.00   39.81  ? 362  ILE A CD1 1 
ATOM   1556 N N   . LEU A 1 218 ? -3.261  104.712 -69.210 1.00   44.17  ? 363  LEU A N   1 
ATOM   1557 C CA  . LEU A 1 218 ? -2.502  105.547 -68.336 1.00   44.56  ? 363  LEU A CA  1 
ATOM   1558 C C   . LEU A 1 218 ? -1.848  106.739 -68.976 1.00   46.19  ? 363  LEU A C   1 
ATOM   1559 O O   . LEU A 1 218 ? -1.730  107.767 -68.325 1.00   47.37  ? 363  LEU A O   1 
ATOM   1560 C CB  . LEU A 1 218 ? -1.445  104.747 -67.621 1.00   44.72  ? 363  LEU A CB  1 
ATOM   1561 C CG  . LEU A 1 218 ? -2.082  103.855 -66.574 1.00   47.65  ? 363  LEU A CG  1 
ATOM   1562 C CD1 . LEU A 1 218 ? -1.041  102.847 -66.088 1.00   46.26  ? 363  LEU A CD1 1 
ATOM   1563 C CD2 . LEU A 1 218 ? -2.670  104.736 -65.420 1.00   44.22  ? 363  LEU A CD2 1 
ATOM   1564 N N   . MET A 1 219 ? -1.441  106.641 -70.237 1.00   46.56  ? 364  MET A N   1 
ATOM   1565 C CA  . MET A 1 219 ? -0.722  107.763 -70.812 1.00   48.87  ? 364  MET A CA  1 
ATOM   1566 C C   . MET A 1 219 ? -1.070  108.208 -72.195 1.00   49.89  ? 364  MET A C   1 
ATOM   1567 O O   . MET A 1 219 ? -0.427  109.085 -72.720 1.00   51.59  ? 364  MET A O   1 
ATOM   1568 C CB  . MET A 1 219 ? 0.787   107.501 -70.746 1.00   49.12  ? 364  MET A CB  1 
ATOM   1569 C CG  . MET A 1 219 ? 1.289   107.239 -69.343 1.00   52.82  ? 364  MET A CG  1 
ATOM   1570 S SD  . MET A 1 219 ? 3.005   106.637 -69.246 1.00   58.43  ? 364  MET A SD  1 
ATOM   1571 C CE  . MET A 1 219 ? 2.756   104.953 -69.419 1.00   56.33  ? 364  MET A CE  1 
ATOM   1572 N N   . GLU A 1 220 ? -2.076  107.627 -72.802 1.00   51.10  ? 365  GLU A N   1 
ATOM   1573 C CA  . GLU A 1 220 ? -2.416  108.064 -74.136 1.00   55.71  ? 365  GLU A CA  1 
ATOM   1574 C C   . GLU A 1 220 ? -3.600  109.028 -74.112 1.00   57.09  ? 365  GLU A C   1 
ATOM   1575 O O   . GLU A 1 220 ? -4.541  108.850 -73.348 1.00   54.83  ? 365  GLU A O   1 
ATOM   1576 C CB  . GLU A 1 220 ? -2.750  106.856 -74.998 1.00   59.25  ? 365  GLU A CB  1 
ATOM   1577 C CG  . GLU A 1 220 ? -3.235  107.214 -76.361 1.00   63.18  ? 365  GLU A CG  1 
ATOM   1578 C CD  . GLU A 1 220 ? -2.135  107.748 -77.230 1.00   68.30  ? 365  GLU A CD  1 
ATOM   1579 O OE1 . GLU A 1 220 ? -1.504  108.764 -76.849 1.00   70.10  ? 365  GLU A OE1 1 
ATOM   1580 O OE2 . GLU A 1 220 ? -1.903  107.144 -78.305 1.00   72.44  ? 365  GLU A OE2 1 
ATOM   1581 N N   . GLU A 1 221 ? -3.564  110.053 -74.953 1.00   58.87  ? 366  GLU A N   1 
ATOM   1582 C CA  . GLU A 1 221 ? -4.667  110.992 -74.979 1.00   60.14  ? 366  GLU A CA  1 
ATOM   1583 C C   . GLU A 1 221 ? -5.792  110.393 -75.783 1.00   59.05  ? 366  GLU A C   1 
ATOM   1584 O O   . GLU A 1 221 ? -5.577  109.870 -76.872 1.00   59.19  ? 366  GLU A O   1 
ATOM   1585 C CB  . GLU A 1 221 ? -4.240  112.288 -75.624 1.00   64.11  ? 366  GLU A CB  1 
ATOM   1586 C CG  . GLU A 1 221 ? -3.665  112.096 -77.010 1.00   70.33  ? 366  GLU A CG  1 
ATOM   1587 C CD  . GLU A 1 221 ? -3.516  113.421 -77.758 1.00   74.11  ? 366  GLU A CD  1 
ATOM   1588 O OE1 . GLU A 1 221 ? -4.560  114.093 -78.012 1.00   75.16  ? 366  GLU A OE1 1 
ATOM   1589 O OE2 . GLU A 1 221 ? -2.353  113.790 -78.075 1.00   75.60  ? 366  GLU A OE2 1 
ATOM   1590 N N   . ILE A 1 222 ? -6.995  110.441 -75.243 1.00   57.37  ? 367  ILE A N   1 
ATOM   1591 C CA  . ILE A 1 222 ? -8.114  109.909 -75.978 1.00   57.63  ? 367  ILE A CA  1 
ATOM   1592 C C   . ILE A 1 222 ? -8.540  110.976 -76.976 1.00   60.49  ? 367  ILE A C   1 
ATOM   1593 O O   . ILE A 1 222 ? -8.686  112.151 -76.620 1.00   63.29  ? 367  ILE A O   1 
ATOM   1594 C CB  . ILE A 1 222 ? -9.253  109.567 -75.044 1.00   54.96  ? 367  ILE A CB  1 
ATOM   1595 C CG1 . ILE A 1 222 ? -8.776  108.500 -74.046 1.00   54.08  ? 367  ILE A CG1 1 
ATOM   1596 C CG2 . ILE A 1 222 ? -10.438 109.118 -75.836 1.00   51.56  ? 367  ILE A CG2 1 
ATOM   1597 C CD1 . ILE A 1 222 ? -9.775  108.161 -72.941 1.00   51.14  ? 367  ILE A CD1 1 
ATOM   1598 N N   . ARG A 1 223 ? -8.731  110.560 -78.224 1.00   62.00  ? 368  ARG A N   1 
ATOM   1599 C CA  . ARG A 1 223 ? -9.115  111.437 -79.313 1.00   63.00  ? 368  ARG A CA  1 
ATOM   1600 C C   . ARG A 1 223 ? -10.595 111.238 -79.637 1.00   61.85  ? 368  ARG A C   1 
ATOM   1601 O O   . ARG A 1 223 ? -11.098 110.124 -79.574 1.00   61.59  ? 368  ARG A O   1 
ATOM   1602 C CB  . ARG A 1 223 ? -8.224  111.138 -80.538 1.00   67.41  ? 368  ARG A CB  1 
ATOM   1603 C CG  . ARG A 1 223 ? -8.661  111.845 -81.821 1.00   75.75  ? 368  ARG A CG  1 
ATOM   1604 C CD  . ARG A 1 223 ? -7.497  112.549 -82.589 1.00   80.28  ? 368  ARG A CD  1 
ATOM   1605 N NE  . ARG A 1 223 ? -6.912  113.703 -81.889 1.00   83.33  ? 368  ARG A NE  1 
ATOM   1606 C CZ  . ARG A 1 223 ? -6.098  114.592 -82.464 1.00   85.04  ? 368  ARG A CZ  1 
ATOM   1607 N NH1 . ARG A 1 223 ? -5.773  114.477 -83.751 1.00   86.11  ? 368  ARG A NH1 1 
ATOM   1608 N NH2 . ARG A 1 223 ? -5.592  115.591 -81.750 1.00   85.79  ? 368  ARG A NH2 1 
ATOM   1609 N N   . PHE A 1 224 ? -11.289 112.314 -80.000 1.00   59.53  ? 369  PHE A N   1 
ATOM   1610 C CA  . PHE A 1 224 ? -12.714 112.221 -80.276 1.00   57.83  ? 369  PHE A CA  1 
ATOM   1611 C C   . PHE A 1 224 ? -13.061 112.494 -81.705 1.00   57.46  ? 369  PHE A C   1 
ATOM   1612 O O   . PHE A 1 224 ? -12.501 113.377 -82.333 1.00   57.56  ? 369  PHE A O   1 
ATOM   1613 C CB  . PHE A 1 224 ? -13.499 113.221 -79.410 1.00   57.12  ? 369  PHE A CB  1 
ATOM   1614 C CG  . PHE A 1 224 ? -13.047 113.271 -77.977 1.00   53.16  ? 369  PHE A CG  1 
ATOM   1615 C CD1 . PHE A 1 224 ? -13.455 112.299 -77.071 1.00   52.10  ? 369  PHE A CD1 1 
ATOM   1616 C CD2 . PHE A 1 224 ? -12.145 114.237 -77.560 1.00   52.84  ? 369  PHE A CD2 1 
ATOM   1617 C CE1 . PHE A 1 224 ? -12.974 112.286 -75.783 1.00   48.95  ? 369  PHE A CE1 1 
ATOM   1618 C CE2 . PHE A 1 224 ? -11.653 114.228 -76.268 1.00   51.93  ? 369  PHE A CE2 1 
ATOM   1619 C CZ  . PHE A 1 224 ? -12.070 113.243 -75.375 1.00   48.85  ? 369  PHE A CZ  1 
ATOM   1620 N N   . PRO A 1 225 ? -14.003 111.741 -82.240 1.00   57.30  ? 370  PRO A N   1 
ATOM   1621 C CA  . PRO A 1 225 ? -14.389 111.977 -83.625 1.00   59.84  ? 370  PRO A CA  1 
ATOM   1622 C C   . PRO A 1 225 ? -14.750 113.463 -83.803 1.00   62.04  ? 370  PRO A C   1 
ATOM   1623 O O   . PRO A 1 225 ? -15.023 114.166 -82.826 1.00   62.56  ? 370  PRO A O   1 
ATOM   1624 C CB  . PRO A 1 225 ? -15.579 111.044 -83.805 1.00   58.80  ? 370  PRO A CB  1 
ATOM   1625 C CG  . PRO A 1 225 ? -15.254 109.919 -82.864 1.00   58.70  ? 370  PRO A CG  1 
ATOM   1626 C CD  . PRO A 1 225 ? -14.745 110.620 -81.657 1.00   57.44  ? 370  PRO A CD  1 
ATOM   1627 N N   . ARG A 1 226 ? -14.743 113.939 -85.046 1.00   64.34  ? 371  ARG A N   1 
ATOM   1628 C CA  . ARG A 1 226 ? -15.051 115.333 -85.337 1.00   64.72  ? 371  ARG A CA  1 
ATOM   1629 C C   . ARG A 1 226 ? -16.553 115.536 -85.372 1.00   63.73  ? 371  ARG A C   1 
ATOM   1630 O O   . ARG A 1 226 ? -17.051 116.611 -85.074 1.00   63.84  ? 371  ARG A O   1 
ATOM   1631 C CB  . ARG A 1 226 ? -14.461 115.734 -86.689 1.00   68.08  ? 371  ARG A CB  1 
ATOM   1632 C CG  . ARG A 1 226 ? -12.936 115.537 -86.834 1.00   71.09  ? 371  ARG A CG  1 
ATOM   1633 C CD  . ARG A 1 226 ? -12.442 115.920 -88.256 1.00   73.53  ? 371  ARG A CD  1 
ATOM   1634 N NE  . ARG A 1 226 ? -13.103 115.148 -89.320 1.00   75.31  ? 371  ARG A NE  1 
ATOM   1635 C CZ  . ARG A 1 226 ? -12.687 113.966 -89.773 1.00   76.91  ? 371  ARG A CZ  1 
ATOM   1636 N NH1 . ARG A 1 226 ? -11.591 113.394 -89.272 1.00   77.15  ? 371  ARG A NH1 1 
ATOM   1637 N NH2 . ARG A 1 226 ? -13.385 113.342 -90.717 1.00   77.53  ? 371  ARG A NH2 1 
ATOM   1638 N N   . THR A 1 227 ? -17.261 114.477 -85.724 1.00   62.41  ? 372  THR A N   1 
ATOM   1639 C CA  . THR A 1 227 ? -18.719 114.460 -85.830 1.00   63.11  ? 372  THR A CA  1 
ATOM   1640 C C   . THR A 1 227 ? -19.500 114.624 -84.480 1.00   63.39  ? 372  THR A C   1 
ATOM   1641 O O   . THR A 1 227 ? -20.724 114.447 -84.404 1.00   62.39  ? 372  THR A O   1 
ATOM   1642 C CB  . THR A 1 227 ? -19.101 113.127 -86.540 1.00   62.90  ? 372  THR A CB  1 
ATOM   1643 O OG1 . THR A 1 227 ? -20.151 113.358 -87.482 1.00   65.88  ? 372  THR A OG1 1 
ATOM   1644 C CG2 . THR A 1 227 ? -19.518 112.052 -85.541 1.00   63.99  ? 372  THR A CG2 1 
ATOM   1645 N N   . LEU A 1 228 ? -18.784 114.975 -83.417 1.00   64.37  ? 373  LEU A N   1 
ATOM   1646 C CA  . LEU A 1 228 ? -19.388 115.120 -82.087 1.00   63.85  ? 373  LEU A CA  1 
ATOM   1647 C C   . LEU A 1 228 ? -19.618 116.547 -81.708 1.00   63.97  ? 373  LEU A C   1 
ATOM   1648 O O   . LEU A 1 228 ? -18.708 117.371 -81.785 1.00   62.47  ? 373  LEU A O   1 
ATOM   1649 C CB  . LEU A 1 228 ? -18.490 114.511 -81.011 1.00   63.16  ? 373  LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 228 ? -18.891 113.266 -80.205 1.00   62.67  ? 373  LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 228 ? -19.613 112.242 -81.049 1.00   62.27  ? 373  LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 228 ? -17.630 112.682 -79.617 1.00   61.45  ? 373  LEU A CD2 1 
ATOM   1653 N N   . SER A 1 229 ? -20.843 116.827 -81.281 1.00   64.88  ? 374  SER A N   1 
ATOM   1654 C CA  . SER A 1 229 ? -21.193 118.163 -80.830 1.00   64.27  ? 374  SER A CA  1 
ATOM   1655 C C   . SER A 1 229 ? -20.092 118.496 -79.826 1.00   62.98  ? 374  SER A C   1 
ATOM   1656 O O   . SER A 1 229 ? -19.602 117.611 -79.136 1.00   65.01  ? 374  SER A O   1 
ATOM   1657 C CB  . SER A 1 229 ? -22.556 118.134 -80.127 1.00   63.33  ? 374  SER A CB  1 
ATOM   1658 O OG  . SER A 1 229 ? -22.449 117.473 -78.877 1.00   62.41  ? 374  SER A OG  1 
ATOM   1659 N N   . PRO A 1 230 ? -19.685 119.765 -79.737 1.00   62.58  ? 375  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 230 ? -18.630 120.174 -78.804 1.00   60.73  ? 375  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 230 ? -19.008 120.057 -77.324 1.00   60.13  ? 375  PRO A C   1 
ATOM   1662 O O   . PRO A 1 230 ? -18.141 120.039 -76.455 1.00   58.57  ? 375  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 230 ? -18.335 121.602 -79.236 1.00   61.06  ? 375  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 230 ? -19.673 122.071 -79.709 1.00   61.29  ? 375  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 230 ? -20.187 120.915 -80.507 1.00   62.11  ? 375  PRO A CD  1 
ATOM   1666 N N   . GLU A 1 231 ? -20.296 119.997 -77.014 1.00   59.22  ? 376  GLU A N   1 
ATOM   1667 C CA  . GLU A 1 231 ? -20.651 119.826 -75.608 1.00   59.93  ? 376  GLU A CA  1 
ATOM   1668 C C   . GLU A 1 231 ? -20.313 118.354 -75.275 1.00   59.29  ? 376  GLU A C   1 
ATOM   1669 O O   . GLU A 1 231 ? -19.559 118.074 -74.323 1.00   58.59  ? 376  GLU A O   1 
ATOM   1670 C CB  . GLU A 1 231 ? -22.132 120.112 -75.378 1.00   60.26  ? 376  GLU A CB  1 
ATOM   1671 C CG  . GLU A 1 231 ? -23.056 119.507 -76.408 1.00   63.06  ? 376  GLU A CG  1 
ATOM   1672 C CD  . GLU A 1 231 ? -23.321 120.443 -77.594 1.00   64.54  ? 376  GLU A CD  1 
ATOM   1673 O OE1 . GLU A 1 231 ? -22.381 121.137 -78.067 1.00   65.59  ? 376  GLU A OE1 1 
ATOM   1674 O OE2 . GLU A 1 231 ? -24.478 120.462 -78.055 1.00   63.14  ? 376  GLU A OE2 1 
ATOM   1675 N N   . ALA A 1 232 ? -20.856 117.434 -76.090 1.00   58.27  ? 377  ALA A N   1 
ATOM   1676 C CA  . ALA A 1 232 ? -20.608 115.989 -75.963 1.00   56.25  ? 377  ALA A CA  1 
ATOM   1677 C C   . ALA A 1 232 ? -19.108 115.752 -75.940 1.00   54.25  ? 377  ALA A C   1 
ATOM   1678 O O   . ALA A 1 232 ? -18.606 114.956 -75.168 1.00   51.26  ? 377  ALA A O   1 
ATOM   1679 C CB  . ALA A 1 232 ? -21.218 115.244 -77.121 1.00   56.14  ? 377  ALA A CB  1 
ATOM   1680 N N   . LYS A 1 233 ? -18.390 116.464 -76.786 1.00   54.51  ? 378  LYS A N   1 
ATOM   1681 C CA  . LYS A 1 233 ? -16.959 116.305 -76.785 1.00   56.16  ? 378  LYS A CA  1 
ATOM   1682 C C   . LYS A 1 233 ? -16.411 116.788 -75.452 1.00   54.30  ? 378  LYS A C   1 
ATOM   1683 O O   . LYS A 1 233 ? -15.430 116.245 -74.937 1.00   56.54  ? 378  LYS A O   1 
ATOM   1684 C CB  . LYS A 1 233 ? -16.318 117.080 -77.943 1.00   58.21  ? 378  LYS A CB  1 
ATOM   1685 C CG  . LYS A 1 233 ? -14.772 116.989 -77.934 1.00   61.99  ? 378  LYS A CG  1 
ATOM   1686 C CD  . LYS A 1 233 ? -14.119 117.942 -78.937 1.00   64.54  ? 378  LYS A CD  1 
ATOM   1687 C CE  . LYS A 1 233 ? -12.581 117.804 -78.959 1.00   67.17  ? 378  LYS A CE  1 
ATOM   1688 N NZ  . LYS A 1 233 ? -11.864 118.918 -79.709 1.00   67.62  ? 378  LYS A NZ  1 
ATOM   1689 N N   . SER A 1 234 ? -17.045 117.800 -74.874 1.00   53.79  ? 379  SER A N   1 
ATOM   1690 C CA  . SER A 1 234 ? -16.567 118.337 -73.598 1.00   51.96  ? 379  SER A CA  1 
ATOM   1691 C C   . SER A 1 234 ? -16.806 117.361 -72.441 1.00   50.30  ? 379  SER A C   1 
ATOM   1692 O O   . SER A 1 234 ? -15.956 117.181 -71.552 1.00   48.06  ? 379  SER A O   1 
ATOM   1693 C CB  . SER A 1 234 ? -17.253 119.678 -73.280 1.00   53.12  ? 379  SER A CB  1 
ATOM   1694 O OG  . SER A 1 234 ? -16.556 120.370 -72.230 1.00   53.39  ? 379  SER A OG  1 
ATOM   1695 N N   . LEU A 1 235 ? -17.980 116.744 -72.450 1.00   47.82  ? 380  LEU A N   1 
ATOM   1696 C CA  . LEU A 1 235 ? -18.319 115.796 -71.413 1.00   46.31  ? 380  LEU A CA  1 
ATOM   1697 C C   . LEU A 1 235 ? -17.290 114.652 -71.382 1.00   46.33  ? 380  LEU A C   1 
ATOM   1698 O O   . LEU A 1 235 ? -16.656 114.374 -70.343 1.00   44.04  ? 380  LEU A O   1 
ATOM   1699 C CB  . LEU A 1 235 ? -19.718 115.269 -71.686 1.00   45.67  ? 380  LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 235 ? -20.290 114.290 -70.684 1.00   44.33  ? 380  LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 235 ? -20.560 114.980 -69.366 1.00   42.86  ? 380  LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 235 ? -21.536 113.692 -71.271 1.00   42.07  ? 380  LEU A CD2 1 
ATOM   1703 N N   . LEU A 1 236 ? -17.111 114.007 -72.533 1.00   46.08  ? 381  LEU A N   1 
ATOM   1704 C CA  . LEU A 1 236 ? -16.173 112.896 -72.635 1.00   44.77  ? 381  LEU A CA  1 
ATOM   1705 C C   . LEU A 1 236 ? -14.788 113.318 -72.209 1.00   44.82  ? 381  LEU A C   1 
ATOM   1706 O O   . LEU A 1 236 ? -14.124 112.643 -71.429 1.00   45.78  ? 381  LEU A O   1 
ATOM   1707 C CB  . LEU A 1 236 ? -16.146 112.394 -74.056 1.00   44.84  ? 381  LEU A CB  1 
ATOM   1708 C CG  . LEU A 1 236 ? -17.532 111.956 -74.483 1.00   46.35  ? 381  LEU A CG  1 
ATOM   1709 C CD1 . LEU A 1 236 ? -17.552 111.558 -75.943 1.00   45.76  ? 381  LEU A CD1 1 
ATOM   1710 C CD2 . LEU A 1 236 ? -17.982 110.814 -73.593 1.00   47.14  ? 381  LEU A CD2 1 
ATOM   1711 N N   . ALA A 1 237 ? -14.335 114.457 -72.690 1.00   45.78  ? 382  ALA A N   1 
ATOM   1712 C CA  . ALA A 1 237 ? -12.994 114.855 -72.304 1.00   46.47  ? 382  ALA A CA  1 
ATOM   1713 C C   . ALA A 1 237 ? -12.964 114.986 -70.807 1.00   45.53  ? 382  ALA A C   1 
ATOM   1714 O O   . ALA A 1 237 ? -11.954 114.717 -70.188 1.00   46.21  ? 382  ALA A O   1 
ATOM   1715 C CB  . ALA A 1 237 ? -12.599 116.160 -72.961 1.00   47.28  ? 382  ALA A CB  1 
ATOM   1716 N N   . GLY A 1 238 ? -14.096 115.367 -70.215 1.00   46.98  ? 383  GLY A N   1 
ATOM   1717 C CA  . GLY A 1 238 ? -14.123 115.526 -68.764 1.00   44.77  ? 383  GLY A CA  1 
ATOM   1718 C C   . GLY A 1 238 ? -14.231 114.237 -67.952 1.00   44.81  ? 383  GLY A C   1 
ATOM   1719 O O   . GLY A 1 238 ? -13.567 114.053 -66.910 1.00   42.42  ? 383  GLY A O   1 
ATOM   1720 N N   . LEU A 1 239 ? -15.098 113.349 -68.413 1.00   43.73  ? 384  LEU A N   1 
ATOM   1721 C CA  . LEU A 1 239 ? -15.268 112.093 -67.725 1.00   45.36  ? 384  LEU A CA  1 
ATOM   1722 C C   . LEU A 1 239 ? -13.992 111.257 -67.885 1.00   47.77  ? 384  LEU A C   1 
ATOM   1723 O O   . LEU A 1 239 ? -13.645 110.450 -67.020 1.00   49.87  ? 384  LEU A O   1 
ATOM   1724 C CB  . LEU A 1 239 ? -16.455 111.341 -68.321 1.00   42.11  ? 384  LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 239 ? -17.818 112.001 -68.128 1.00   38.37  ? 384  LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 239 ? -18.863 111.219 -68.901 1.00   37.91  ? 384  LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 239 ? -18.160 112.054 -66.641 1.00   40.07  ? 384  LEU A CD2 1 
ATOM   1728 N N   . LEU A 1 240 ? -13.277 111.452 -68.981 1.00   49.15  ? 385  LEU A N   1 
ATOM   1729 C CA  . LEU A 1 240 ? -12.095 110.648 -69.190 1.00   49.93  ? 385  LEU A CA  1 
ATOM   1730 C C   . LEU A 1 240 ? -10.797 111.252 -68.738 1.00   50.52  ? 385  LEU A C   1 
ATOM   1731 O O   . LEU A 1 240 ? -9.771  110.836 -69.193 1.00   52.32  ? 385  LEU A O   1 
ATOM   1732 C CB  . LEU A 1 240 ? -11.992 110.226 -70.643 1.00   49.39  ? 385  LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 240 ? -13.216 109.454 -71.134 1.00   50.36  ? 385  LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 240 ? -13.106 109.280 -72.644 1.00   52.76  ? 385  LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 240 ? -13.320 108.105 -70.446 1.00   50.25  ? 385  LEU A CD2 1 
ATOM   1736 N N   . LYS A 1 241 ? -10.830 112.223 -67.839 1.00   51.75  ? 386  LYS A N   1 
ATOM   1737 C CA  . LYS A 1 241 ? -9.592  112.788 -67.315 1.00   52.99  ? 386  LYS A CA  1 
ATOM   1738 C C   . LYS A 1 241 ? -8.819  111.662 -66.576 1.00   54.38  ? 386  LYS A C   1 
ATOM   1739 O O   . LYS A 1 241 ? -9.394  110.898 -65.797 1.00   54.40  ? 386  LYS A O   1 
ATOM   1740 C CB  . LYS A 1 241 ? -9.913  113.928 -66.341 1.00   53.86  ? 386  LYS A CB  1 
ATOM   1741 C CG  . LYS A 1 241 ? -9.969  115.325 -66.936 1.00   57.36  ? 386  LYS A CG  1 
ATOM   1742 C CD  . LYS A 1 241 ? -8.571  115.833 -67.294 1.00   60.18  ? 386  LYS A CD  1 
ATOM   1743 C CE  . LYS A 1 241 ? -8.509  117.339 -67.604 1.00   59.87  ? 386  LYS A CE  1 
ATOM   1744 N NZ  . LYS A 1 241 ? -8.010  118.205 -66.447 1.00   61.71  ? 386  LYS A NZ  1 
ATOM   1745 N N   . LYS A 1 242 ? -7.517  111.567 -66.808 1.00   55.38  ? 387  LYS A N   1 
ATOM   1746 C CA  . LYS A 1 242 ? -6.708  110.528 -66.179 1.00   56.45  ? 387  LYS A CA  1 
ATOM   1747 C C   . LYS A 1 242 ? -6.460  110.769 -64.705 1.00   57.28  ? 387  LYS A C   1 
ATOM   1748 O O   . LYS A 1 242 ? -6.151  109.852 -63.964 1.00   57.04  ? 387  LYS A O   1 
ATOM   1749 C CB  . LYS A 1 242 ? -5.374  110.371 -66.930 1.00   56.33  ? 387  LYS A CB  1 
ATOM   1750 C CG  . LYS A 1 242 ? -5.423  109.418 -68.113 1.00   53.49  ? 387  LYS A CG  1 
ATOM   1751 C CD  . LYS A 1 242 ? -4.679  109.942 -69.320 1.00   55.97  ? 387  LYS A CD  1 
ATOM   1752 C CE  . LYS A 1 242 ? -4.530  108.895 -70.428 1.00   54.64  ? 387  LYS A CE  1 
ATOM   1753 N NZ  . LYS A 1 242 ? -5.805  108.360 -70.981 1.00   53.58  ? 387  LYS A NZ  1 
ATOM   1754 N N   . ASP A 1 243 ? -6.596  112.014 -64.275 1.00   60.28  ? 388  ASP A N   1 
ATOM   1755 C CA  . ASP A 1 243 ? -6.393  112.357 -62.862 1.00   60.37  ? 388  ASP A CA  1 
ATOM   1756 C C   . ASP A 1 243 ? -7.753  112.307 -62.181 1.00   61.29  ? 388  ASP A C   1 
ATOM   1757 O O   . ASP A 1 243 ? -8.631  113.116 -62.505 1.00   60.62  ? 388  ASP A O   1 
ATOM   1758 C CB  . ASP A 1 243 ? -5.851  113.775 -62.720 1.00   60.41  ? 388  ASP A CB  1 
ATOM   1759 C CG  . ASP A 1 243 ? -5.110  113.986 -61.417 1.00   60.73  ? 388  ASP A CG  1 
ATOM   1760 O OD1 . ASP A 1 243 ? -5.420  113.321 -60.408 1.00   59.21  ? 388  ASP A OD1 1 
ATOM   1761 O OD2 . ASP A 1 243 ? -4.209  114.845 -61.405 1.00   64.48  ? 388  ASP A OD2 1 
ATOM   1762 N N   . PRO A 1 244 ? -7.956  111.361 -61.236 1.00   62.15  ? 389  PRO A N   1 
ATOM   1763 C CA  . PRO A 1 244 ? -9.288  111.378 -60.629 1.00   62.78  ? 389  PRO A CA  1 
ATOM   1764 C C   . PRO A 1 244 ? -9.532  112.786 -60.110 1.00   63.39  ? 389  PRO A C   1 
ATOM   1765 O O   . PRO A 1 244 ? -10.559 113.390 -60.401 1.00   63.96  ? 389  PRO A O   1 
ATOM   1766 C CB  . PRO A 1 244 ? -9.190  110.317 -59.525 1.00   61.35  ? 389  PRO A CB  1 
ATOM   1767 C CG  . PRO A 1 244 ? -7.754  110.283 -59.195 1.00   61.23  ? 389  PRO A CG  1 
ATOM   1768 C CD  . PRO A 1 244 ? -7.067  110.422 -60.526 1.00   61.63  ? 389  PRO A CD  1 
ATOM   1769 N N   . LYS A 1 245 ? -8.551  113.337 -59.408 1.00   62.80  ? 390  LYS A N   1 
ATOM   1770 C CA  . LYS A 1 245 ? -8.714  114.672 -58.880 1.00   63.79  ? 390  LYS A CA  1 
ATOM   1771 C C   . LYS A 1 245 ? -9.125  115.733 -59.870 1.00   62.83  ? 390  LYS A C   1 
ATOM   1772 O O   . LYS A 1 245 ? -9.406  116.860 -59.473 1.00   62.97  ? 390  LYS A O   1 
ATOM   1773 C CB  . LYS A 1 245 ? -7.462  115.120 -58.148 1.00   65.60  ? 390  LYS A CB  1 
ATOM   1774 C CG  . LYS A 1 245 ? -7.455  114.611 -56.744 1.00   68.39  ? 390  LYS A CG  1 
ATOM   1775 C CD  . LYS A 1 245 ? -6.581  115.433 -55.824 1.00   72.97  ? 390  LYS A CD  1 
ATOM   1776 C CE  . LYS A 1 245 ? -6.875  115.044 -54.374 1.00   75.60  ? 390  LYS A CE  1 
ATOM   1777 N NZ  . LYS A 1 245 ? -6.882  113.547 -54.181 1.00   77.14  ? 390  LYS A NZ  1 
ATOM   1778 N N   . GLN A 1 246 ? -9.171  115.405 -61.155 1.00   60.91  ? 391  GLN A N   1 
ATOM   1779 C CA  . GLN A 1 246 ? -9.593  116.414 -62.122 1.00   59.36  ? 391  GLN A CA  1 
ATOM   1780 C C   . GLN A 1 246 ? -10.714 115.940 -63.011 1.00   57.12  ? 391  GLN A C   1 
ATOM   1781 O O   . GLN A 1 246 ? -11.135 116.651 -63.923 1.00   57.63  ? 391  GLN A O   1 
ATOM   1782 C CB  . GLN A 1 246 ? -8.456  116.830 -63.020 1.00   60.83  ? 391  GLN A CB  1 
ATOM   1783 C CG  . GLN A 1 246 ? -7.269  117.341 -62.318 1.00   66.00  ? 391  GLN A CG  1 
ATOM   1784 C CD  . GLN A 1 246 ? -6.149  117.509 -63.307 1.00   71.24  ? 391  GLN A CD  1 
ATOM   1785 O OE1 . GLN A 1 246 ? -6.291  118.269 -64.290 1.00   73.06  ? 391  GLN A OE1 1 
ATOM   1786 N NE2 . GLN A 1 246 ? -5.028  116.788 -63.086 1.00   71.71  ? 391  GLN A NE2 1 
ATOM   1787 N N   . ARG A 1 247 ? -11.213 114.744 -62.763 1.00   53.60  ? 392  ARG A N   1 
ATOM   1788 C CA  . ARG A 1 247 ? -12.270 114.254 -63.613 1.00   51.12  ? 392  ARG A CA  1 
ATOM   1789 C C   . ARG A 1 247 ? -13.618 114.927 -63.329 1.00   49.09  ? 392  ARG A C   1 
ATOM   1790 O O   . ARG A 1 247 ? -13.913 115.352 -62.235 1.00   50.68  ? 392  ARG A O   1 
ATOM   1791 C CB  . ARG A 1 247 ? -12.365 112.745 -63.453 1.00   47.85  ? 392  ARG A CB  1 
ATOM   1792 C CG  . ARG A 1 247 ? -13.285 112.023 -64.418 1.00   46.56  ? 392  ARG A CG  1 
ATOM   1793 C CD  . ARG A 1 247 ? -13.058 110.505 -64.224 1.00   45.35  ? 392  ARG A CD  1 
ATOM   1794 N NE  . ARG A 1 247 ? -11.620 110.215 -64.182 1.00   44.51  ? 392  ARG A NE  1 
ATOM   1795 C CZ  . ARG A 1 247 ? -11.053 109.284 -63.426 1.00   41.92  ? 392  ARG A CZ  1 
ATOM   1796 N NH1 . ARG A 1 247 ? -11.802 108.527 -62.636 1.00   42.95  ? 392  ARG A NH1 1 
ATOM   1797 N NH2 . ARG A 1 247 ? -9.737  109.146 -63.430 1.00   39.62  ? 392  ARG A NH2 1 
ATOM   1798 N N   . LEU A 1 248 ? -14.412 115.052 -64.363 1.00   48.72  ? 393  LEU A N   1 
ATOM   1799 C CA  . LEU A 1 248 ? -15.727 115.598 -64.241 1.00   48.84  ? 393  LEU A CA  1 
ATOM   1800 C C   . LEU A 1 248 ? -16.431 114.667 -63.261 1.00   51.18  ? 393  LEU A C   1 
ATOM   1801 O O   . LEU A 1 248 ? -16.813 113.552 -63.634 1.00   51.89  ? 393  LEU A O   1 
ATOM   1802 C CB  . LEU A 1 248 ? -16.433 115.507 -65.587 1.00   47.34  ? 393  LEU A CB  1 
ATOM   1803 C CG  . LEU A 1 248 ? -17.601 116.420 -65.885 1.00   46.56  ? 393  LEU A CG  1 
ATOM   1804 C CD1 . LEU A 1 248 ? -18.563 115.718 -66.808 1.00   46.06  ? 393  LEU A CD1 1 
ATOM   1805 C CD2 . LEU A 1 248 ? -18.276 116.768 -64.602 1.00   47.98  ? 393  LEU A CD2 1 
ATOM   1806 N N   . GLY A 1 249 ? -16.601 115.106 -62.015 1.00   52.40  ? 394  GLY A N   1 
ATOM   1807 C CA  . GLY A 1 249 ? -17.300 114.282 -61.057 1.00   51.90  ? 394  GLY A CA  1 
ATOM   1808 C C   . GLY A 1 249 ? -16.366 113.816 -59.985 1.00   52.77  ? 394  GLY A C   1 
ATOM   1809 O O   . GLY A 1 249 ? -16.798 113.238 -58.985 1.00   51.49  ? 394  GLY A O   1 
ATOM   1810 N N   . GLY A 1 250 ? -15.083 114.076 -60.205 1.00   53.41  ? 395  GLY A N   1 
ATOM   1811 C CA  . GLY A 1 250 ? -14.064 113.681 -59.258 1.00   54.58  ? 395  GLY A CA  1 
ATOM   1812 C C   . GLY A 1 250 ? -13.891 114.758 -58.207 1.00   57.30  ? 395  GLY A C   1 
ATOM   1813 O O   . GLY A 1 250 ? -13.075 114.624 -57.279 1.00   58.03  ? 395  GLY A O   1 
ATOM   1814 N N   . GLY A 1 251 ? -14.637 115.847 -58.360 1.00   58.27  ? 396  GLY A N   1 
ATOM   1815 C CA  . GLY A 1 251 ? -14.566 116.925 -57.384 1.00   58.70  ? 396  GLY A CA  1 
ATOM   1816 C C   . GLY A 1 251 ? -15.553 116.672 -56.252 1.00   58.84  ? 396  GLY A C   1 
ATOM   1817 O O   . GLY A 1 251 ? -16.526 115.942 -56.454 1.00   57.65  ? 396  GLY A O   1 
ATOM   1818 N N   . PRO A 1 252 ? -15.343 117.266 -55.053 1.00   59.17  ? 397  PRO A N   1 
ATOM   1819 C CA  . PRO A 1 252 ? -16.216 117.100 -53.878 1.00   58.46  ? 397  PRO A CA  1 
ATOM   1820 C C   . PRO A 1 252 ? -17.710 117.194 -54.116 1.00   58.19  ? 397  PRO A C   1 
ATOM   1821 O O   . PRO A 1 252 ? -18.506 116.670 -53.328 1.00   58.83  ? 397  PRO A O   1 
ATOM   1822 C CB  . PRO A 1 252 ? -15.715 118.168 -52.907 1.00   58.88  ? 397  PRO A CB  1 
ATOM   1823 C CG  . PRO A 1 252 ? -15.002 119.159 -53.790 1.00   58.98  ? 397  PRO A CG  1 
ATOM   1824 C CD  . PRO A 1 252 ? -14.310 118.277 -54.783 1.00   59.19  ? 397  PRO A CD  1 
ATOM   1825 N N   . SER A 1 253 ? -18.095 117.842 -55.205 1.00   57.16  ? 398  SER A N   1 
ATOM   1826 C CA  . SER A 1 253 ? -19.495 117.991 -55.532 1.00   57.21  ? 398  SER A CA  1 
ATOM   1827 C C   . SER A 1 253 ? -20.036 116.764 -56.242 1.00   55.77  ? 398  SER A C   1 
ATOM   1828 O O   . SER A 1 253 ? -21.204 116.736 -56.633 1.00   54.35  ? 398  SER A O   1 
ATOM   1829 C CB  . SER A 1 253 ? -19.686 119.207 -56.425 1.00   60.61  ? 398  SER A CB  1 
ATOM   1830 O OG  . SER A 1 253 ? -21.059 119.372 -56.761 1.00   64.62  ? 398  SER A OG  1 
ATOM   1831 N N   . ASP A 1 254 ? -19.168 115.769 -56.436 1.00   54.99  ? 399  ASP A N   1 
ATOM   1832 C CA  . ASP A 1 254 ? -19.526 114.505 -57.093 1.00   52.65  ? 399  ASP A CA  1 
ATOM   1833 C C   . ASP A 1 254 ? -20.494 114.672 -58.267 1.00   51.51  ? 399  ASP A C   1 
ATOM   1834 O O   . ASP A 1 254 ? -20.254 115.478 -59.160 1.00   51.58  ? 399  ASP A O   1 
ATOM   1835 C CB  . ASP A 1 254 ? -20.108 113.521 -56.052 1.00   52.48  ? 399  ASP A CB  1 
ATOM   1836 C CG  . ASP A 1 254 ? -20.204 112.094 -56.568 1.00   52.55  ? 399  ASP A CG  1 
ATOM   1837 O OD1 . ASP A 1 254 ? -21.334 111.626 -56.769 1.00   54.35  ? 399  ASP A OD1 1 
ATOM   1838 O OD2 . ASP A 1 254 ? -19.163 111.436 -56.776 1.00   50.78  ? 399  ASP A OD2 1 
ATOM   1839 N N   . ALA A 1 255 ? -21.587 113.916 -58.272 1.00   49.16  ? 400  ALA A N   1 
ATOM   1840 C CA  . ALA A 1 255 ? -22.534 114.010 -59.368 1.00   49.33  ? 400  ALA A CA  1 
ATOM   1841 C C   . ALA A 1 255 ? -22.863 115.440 -59.836 1.00   49.36  ? 400  ALA A C   1 
ATOM   1842 O O   . ALA A 1 255 ? -22.950 115.699 -61.028 1.00   47.75  ? 400  ALA A O   1 
ATOM   1843 C CB  . ALA A 1 255 ? -23.814 113.272 -59.018 1.00   47.38  ? 400  ALA A CB  1 
ATOM   1844 N N   . LYS A 1 256 ? -23.046 116.376 -58.923 1.00   50.40  ? 401  LYS A N   1 
ATOM   1845 C CA  . LYS A 1 256 ? -23.380 117.726 -59.361 1.00   52.77  ? 401  LYS A CA  1 
ATOM   1846 C C   . LYS A 1 256 ? -22.524 118.269 -60.524 1.00   51.86  ? 401  LYS A C   1 
ATOM   1847 O O   . LYS A 1 256 ? -23.066 118.757 -61.501 1.00   51.60  ? 401  LYS A O   1 
ATOM   1848 C CB  . LYS A 1 256 ? -23.362 118.666 -58.163 1.00   54.82  ? 401  LYS A CB  1 
ATOM   1849 C CG  . LYS A 1 256 ? -24.556 118.466 -57.245 1.00   56.90  ? 401  LYS A CG  1 
ATOM   1850 C CD  . LYS A 1 256 ? -24.105 118.536 -55.772 1.00   60.09  ? 401  LYS A CD  1 
ATOM   1851 C CE  . LYS A 1 256 ? -25.238 118.877 -54.811 1.00   58.71  ? 401  LYS A CE  1 
ATOM   1852 N NZ  . LYS A 1 256 ? -24.655 119.343 -53.523 1.00   58.14  ? 401  LYS A NZ  1 
ATOM   1853 N N   . GLU A 1 257 ? -21.204 118.181 -60.451 1.00   52.41  ? 402  GLU A N   1 
ATOM   1854 C CA  . GLU A 1 257 ? -20.418 118.651 -61.584 1.00   54.41  ? 402  GLU A CA  1 
ATOM   1855 C C   . GLU A 1 257 ? -20.938 118.062 -62.911 1.00   53.99  ? 402  GLU A C   1 
ATOM   1856 O O   . GLU A 1 257 ? -20.983 118.730 -63.932 1.00   56.47  ? 402  GLU A O   1 
ATOM   1857 C CB  . GLU A 1 257 ? -18.961 118.262 -61.418 1.00   55.33  ? 402  GLU A CB  1 
ATOM   1858 C CG  . GLU A 1 257 ? -18.208 118.983 -60.331 1.00   60.11  ? 402  GLU A CG  1 
ATOM   1859 C CD  . GLU A 1 257 ? -16.755 118.485 -60.220 1.00   66.28  ? 402  GLU A CD  1 
ATOM   1860 O OE1 . GLU A 1 257 ? -16.118 118.198 -61.273 1.00   70.89  ? 402  GLU A OE1 1 
ATOM   1861 O OE2 . GLU A 1 257 ? -16.226 118.381 -59.090 1.00   68.69  ? 402  GLU A OE2 1 
ATOM   1862 N N   . VAL A 1 258 ? -21.358 116.811 -62.884 1.00   52.84  ? 403  VAL A N   1 
ATOM   1863 C CA  . VAL A 1 258 ? -21.839 116.120 -64.070 1.00   51.77  ? 403  VAL A CA  1 
ATOM   1864 C C   . VAL A 1 258 ? -23.273 116.483 -64.448 1.00   53.26  ? 403  VAL A C   1 
ATOM   1865 O O   . VAL A 1 258 ? -23.625 116.566 -65.634 1.00   52.62  ? 403  VAL A O   1 
ATOM   1866 C CB  . VAL A 1 258 ? -21.744 114.564 -63.848 1.00   49.59  ? 403  VAL A CB  1 
ATOM   1867 C CG1 . VAL A 1 258 ? -22.296 113.765 -65.057 1.00   45.76  ? 403  VAL A CG1 1 
ATOM   1868 C CG2 . VAL A 1 258 ? -20.336 114.206 -63.554 1.00   45.54  ? 403  VAL A CG2 1 
ATOM   1869 N N   . MET A 1 259 ? -24.117 116.666 -63.444 1.00   53.51  ? 404  MET A N   1 
ATOM   1870 C CA  . MET A 1 259 ? -25.508 116.999 -63.725 1.00   54.42  ? 404  MET A CA  1 
ATOM   1871 C C   . MET A 1 259 ? -25.631 118.390 -64.348 1.00   53.99  ? 404  MET A C   1 
ATOM   1872 O O   . MET A 1 259 ? -26.553 118.660 -65.105 1.00   52.40  ? 404  MET A O   1 
ATOM   1873 C CB  . MET A 1 259 ? -26.329 116.943 -62.438 1.00   53.49  ? 404  MET A CB  1 
ATOM   1874 C CG  . MET A 1 259 ? -26.888 115.575 -62.094 1.00   53.91  ? 404  MET A CG  1 
ATOM   1875 S SD  . MET A 1 259 ? -27.366 115.590 -60.404 1.00   51.67  ? 404  MET A SD  1 
ATOM   1876 C CE  . MET A 1 259 ? -25.773 115.761 -59.697 1.00   51.63  ? 404  MET A CE  1 
ATOM   1877 N N   . GLU A 1 260 ? -24.677 119.248 -64.011 1.00   54.45  ? 405  GLU A N   1 
ATOM   1878 C CA  . GLU A 1 260 ? -24.650 120.609 -64.473 1.00   57.02  ? 405  GLU A CA  1 
ATOM   1879 C C   . GLU A 1 260 ? -23.699 120.854 -65.636 1.00   58.62  ? 405  GLU A C   1 
ATOM   1880 O O   . GLU A 1 260 ? -23.258 122.007 -65.845 1.00   59.21  ? 405  GLU A O   1 
ATOM   1881 C CB  . GLU A 1 260 ? -24.216 121.507 -63.328 1.00   59.24  ? 405  GLU A CB  1 
ATOM   1882 C CG  . GLU A 1 260 ? -25.058 121.372 -62.102 1.00   63.49  ? 405  GLU A CG  1 
ATOM   1883 C CD  . GLU A 1 260 ? -24.448 122.126 -60.948 1.00   66.80  ? 405  GLU A CD  1 
ATOM   1884 O OE1 . GLU A 1 260 ? -23.290 122.593 -61.114 1.00   67.19  ? 405  GLU A OE1 1 
ATOM   1885 O OE2 . GLU A 1 260 ? -25.116 122.245 -59.887 1.00   68.89  ? 405  GLU A OE2 1 
ATOM   1886 N N   . HIS A 1 261 ? -23.350 119.807 -66.387 1.00   56.90  ? 406  HIS A N   1 
ATOM   1887 C CA  . HIS A 1 261 ? -22.419 120.023 -67.476 1.00   51.43  ? 406  HIS A CA  1 
ATOM   1888 C C   . HIS A 1 261 ? -23.200 120.467 -68.660 1.00   53.10  ? 406  HIS A C   1 
ATOM   1889 O O   . HIS A 1 261 ? -24.369 120.089 -68.856 1.00   51.13  ? 406  HIS A O   1 
ATOM   1890 C CB  . HIS A 1 261 ? -21.609 118.755 -67.823 1.00   47.15  ? 406  HIS A CB  1 
ATOM   1891 C CG  . HIS A 1 261 ? -20.587 118.965 -68.903 1.00   40.07  ? 406  HIS A CG  1 
ATOM   1892 N ND1 . HIS A 1 261 ? -20.896 118.905 -70.250 1.00   39.36  ? 406  HIS A ND1 1 
ATOM   1893 C CD2 . HIS A 1 261 ? -19.272 119.278 -68.836 1.00   36.22  ? 406  HIS A CD2 1 
ATOM   1894 C CE1 . HIS A 1 261 ? -19.816 119.168 -70.961 1.00   33.24  ? 406  HIS A CE1 1 
ATOM   1895 N NE2 . HIS A 1 261 ? -18.819 119.401 -70.128 1.00   34.81  ? 406  HIS A NE2 1 
ATOM   1896 N N   . ARG A 1 262 ? -22.525 121.303 -69.437 1.00   54.11  ? 407  ARG A N   1 
ATOM   1897 C CA  . ARG A 1 262 ? -23.045 121.852 -70.661 1.00   56.89  ? 407  ARG A CA  1 
ATOM   1898 C C   . ARG A 1 262 ? -23.862 120.773 -71.316 1.00   56.63  ? 407  ARG A C   1 
ATOM   1899 O O   . ARG A 1 262 ? -25.056 120.947 -71.567 1.00   57.04  ? 407  ARG A O   1 
ATOM   1900 C CB  . ARG A 1 262 ? -21.863 122.219 -71.543 1.00   60.83  ? 407  ARG A CB  1 
ATOM   1901 C CG  . ARG A 1 262 ? -22.178 122.713 -72.923 1.00   64.70  ? 407  ARG A CG  1 
ATOM   1902 C CD  . ARG A 1 262 ? -20.841 122.961 -73.587 1.00   68.99  ? 407  ARG A CD  1 
ATOM   1903 N NE  . ARG A 1 262 ? -20.938 123.403 -74.972 1.00   74.76  ? 407  ARG A NE  1 
ATOM   1904 C CZ  . ARG A 1 262 ? -19.884 123.704 -75.733 1.00   76.23  ? 407  ARG A CZ  1 
ATOM   1905 N NH1 . ARG A 1 262 ? -18.650 123.614 -75.235 1.00   76.10  ? 407  ARG A NH1 1 
ATOM   1906 N NH2 . ARG A 1 262 ? -20.065 124.073 -77.000 1.00   76.63  ? 407  ARG A NH2 1 
ATOM   1907 N N   . PHE A 1 263 ? -23.223 119.632 -71.561 1.00   55.46  ? 408  PHE A N   1 
ATOM   1908 C CA  . PHE A 1 263 ? -23.925 118.538 -72.214 1.00   54.63  ? 408  PHE A CA  1 
ATOM   1909 C C   . PHE A 1 263 ? -25.260 118.214 -71.545 1.00   53.57  ? 408  PHE A C   1 
ATOM   1910 O O   . PHE A 1 263 ? -26.181 117.714 -72.183 1.00   51.28  ? 408  PHE A O   1 
ATOM   1911 C CB  . PHE A 1 263 ? -23.049 117.285 -72.244 1.00   55.14  ? 408  PHE A CB  1 
ATOM   1912 C CG  . PHE A 1 263 ? -23.678 116.158 -72.983 1.00   53.36  ? 408  PHE A CG  1 
ATOM   1913 C CD1 . PHE A 1 263 ? -23.598 116.101 -74.360 1.00   52.96  ? 408  PHE A CD1 1 
ATOM   1914 C CD2 . PHE A 1 263 ? -24.411 115.197 -72.301 1.00   52.13  ? 408  PHE A CD2 1 
ATOM   1915 C CE1 . PHE A 1 263 ? -24.230 115.116 -75.048 1.00   54.10  ? 408  PHE A CE1 1 
ATOM   1916 C CE2 . PHE A 1 263 ? -25.060 114.203 -72.978 1.00   52.29  ? 408  PHE A CE2 1 
ATOM   1917 C CZ  . PHE A 1 263 ? -24.972 114.154 -74.360 1.00   55.96  ? 408  PHE A CZ  1 
ATOM   1918 N N   . PHE A 1 264 ? -25.348 118.504 -70.249 1.00   53.71  ? 409  PHE A N   1 
ATOM   1919 C CA  . PHE A 1 264 ? -26.557 118.253 -69.496 1.00   53.50  ? 409  PHE A CA  1 
ATOM   1920 C C   . PHE A 1 264 ? -27.289 119.568 -69.099 1.00   57.22  ? 409  PHE A C   1 
ATOM   1921 O O   . PHE A 1 264 ? -27.113 120.111 -67.989 1.00   57.36  ? 409  PHE A O   1 
ATOM   1922 C CB  . PHE A 1 264 ? -26.243 117.390 -68.235 1.00   51.14  ? 409  PHE A CB  1 
ATOM   1923 C CG  . PHE A 1 264 ? -25.885 115.918 -68.531 1.00   44.56  ? 409  PHE A CG  1 
ATOM   1924 C CD1 . PHE A 1 264 ? -26.814 115.048 -69.111 1.00   42.65  ? 409  PHE A CD1 1 
ATOM   1925 C CD2 . PHE A 1 264 ? -24.629 115.425 -68.230 1.00   42.12  ? 409  PHE A CD2 1 
ATOM   1926 C CE1 . PHE A 1 264 ? -26.485 113.729 -69.383 1.00   42.64  ? 409  PHE A CE1 1 
ATOM   1927 C CE2 . PHE A 1 264 ? -24.276 114.074 -68.500 1.00   42.42  ? 409  PHE A CE2 1 
ATOM   1928 C CZ  . PHE A 1 264 ? -25.201 113.233 -69.077 1.00   40.30  ? 409  PHE A CZ  1 
ATOM   1929 N N   . LEU A 1 265 ? -28.129 120.072 -70.013 1.00   59.22  ? 410  LEU A N   1 
ATOM   1930 C CA  . LEU A 1 265 ? -28.935 121.265 -69.750 1.00   60.37  ? 410  LEU A CA  1 
ATOM   1931 C C   . LEU A 1 265 ? -30.401 120.908 -69.852 1.00   60.31  ? 410  LEU A C   1 
ATOM   1932 O O   . LEU A 1 265 ? -31.172 121.109 -68.937 1.00   61.42  ? 410  LEU A O   1 
ATOM   1933 C CB  . LEU A 1 265 ? -28.623 122.377 -70.743 1.00   61.34  ? 410  LEU A CB  1 
ATOM   1934 C CG  . LEU A 1 265 ? -29.743 123.409 -70.914 1.00   60.32  ? 410  LEU A CG  1 
ATOM   1935 C CD1 . LEU A 1 265 ? -29.184 124.801 -71.071 1.00   59.13  ? 410  LEU A CD1 1 
ATOM   1936 C CD2 . LEU A 1 265 ? -30.561 123.022 -72.122 1.00   58.72  ? 410  LEU A CD2 1 
ATOM   1937 N N   . SER A 1 266 ? -30.772 120.374 -70.989 1.00   60.61  ? 411  SER A N   1 
ATOM   1938 C CA  . SER A 1 266 ? -32.136 119.975 -71.242 1.00   61.28  ? 411  SER A CA  1 
ATOM   1939 C C   . SER A 1 266 ? -32.735 119.078 -70.162 1.00   61.66  ? 411  SER A C   1 
ATOM   1940 O O   . SER A 1 266 ? -33.957 118.897 -70.104 1.00   63.81  ? 411  SER A O   1 
ATOM   1941 C CB  . SER A 1 266 ? -32.167 119.216 -72.564 1.00   63.00  ? 411  SER A CB  1 
ATOM   1942 O OG  . SER A 1 266 ? -31.144 118.210 -72.598 1.00   62.68  ? 411  SER A OG  1 
ATOM   1943 N N   . ILE A 1 267 ? -31.881 118.514 -69.309 1.00   60.97  ? 412  ILE A N   1 
ATOM   1944 C CA  . ILE A 1 267 ? -32.335 117.567 -68.293 1.00   57.72  ? 412  ILE A CA  1 
ATOM   1945 C C   . ILE A 1 267 ? -33.035 118.017 -67.049 1.00   55.70  ? 412  ILE A C   1 
ATOM   1946 O O   . ILE A 1 267 ? -32.648 118.945 -66.366 1.00   54.91  ? 412  ILE A O   1 
ATOM   1947 C CB  . ILE A 1 267 ? -31.198 116.631 -67.774 1.00   57.42  ? 412  ILE A CB  1 
ATOM   1948 C CG1 . ILE A 1 267 ? -30.440 115.975 -68.929 1.00   56.38  ? 412  ILE A CG1 1 
ATOM   1949 C CG2 . ILE A 1 267 ? -31.824 115.502 -66.961 1.00   57.80  ? 412  ILE A CG2 1 
ATOM   1950 C CD1 . ILE A 1 267 ? -31.320 115.182 -69.849 1.00   55.25  ? 412  ILE A CD1 1 
ATOM   1951 N N   . ASN A 1 268 ? -34.056 117.257 -66.722 1.00   54.49  ? 413  ASN A N   1 
ATOM   1952 C CA  . ASN A 1 268 ? -34.788 117.497 -65.525 1.00   52.69  ? 413  ASN A CA  1 
ATOM   1953 C C   . ASN A 1 268 ? -34.543 116.286 -64.619 1.00   49.09  ? 413  ASN A C   1 
ATOM   1954 O O   . ASN A 1 268 ? -35.241 115.276 -64.705 1.00   44.97  ? 413  ASN A O   1 
ATOM   1955 C CB  . ASN A 1 268 ? -36.251 117.644 -65.870 1.00   56.60  ? 413  ASN A CB  1 
ATOM   1956 C CG  . ASN A 1 268 ? -36.934 118.585 -64.944 1.00   61.52  ? 413  ASN A CG  1 
ATOM   1957 O OD1 . ASN A 1 268 ? -37.554 118.167 -63.947 1.00   61.21  ? 413  ASN A OD1 1 
ATOM   1958 N ND2 . ASN A 1 268 ? -36.795 119.894 -65.233 1.00   63.85  ? 413  ASN A ND2 1 
ATOM   1959 N N   . TRP A 1 269 ? -33.554 116.423 -63.742 1.00   48.18  ? 414  TRP A N   1 
ATOM   1960 C CA  . TRP A 1 269 ? -33.131 115.349 -62.840 1.00   48.61  ? 414  TRP A CA  1 
ATOM   1961 C C   . TRP A 1 269 ? -34.195 114.701 -62.013 1.00   50.28  ? 414  TRP A C   1 
ATOM   1962 O O   . TRP A 1 269 ? -34.097 113.514 -61.682 1.00   51.73  ? 414  TRP A O   1 
ATOM   1963 C CB  . TRP A 1 269 ? -31.982 115.826 -61.973 1.00   48.35  ? 414  TRP A CB  1 
ATOM   1964 C CG  . TRP A 1 269 ? -30.839 116.274 -62.827 1.00   52.77  ? 414  TRP A CG  1 
ATOM   1965 C CD1 . TRP A 1 269 ? -30.501 117.554 -63.134 1.00   53.49  ? 414  TRP A CD1 1 
ATOM   1966 C CD2 . TRP A 1 269 ? -29.937 115.429 -63.598 1.00   55.67  ? 414  TRP A CD2 1 
ATOM   1967 N NE1 . TRP A 1 269 ? -29.453 117.575 -64.056 1.00   55.77  ? 414  TRP A NE1 1 
ATOM   1968 C CE2 . TRP A 1 269 ? -29.090 116.287 -64.350 1.00   55.09  ? 414  TRP A CE2 1 
ATOM   1969 C CE3 . TRP A 1 269 ? -29.767 114.039 -63.722 1.00   56.61  ? 414  TRP A CE3 1 
ATOM   1970 C CZ2 . TRP A 1 269 ? -28.093 115.802 -65.203 1.00   55.79  ? 414  TRP A CZ2 1 
ATOM   1971 C CZ3 . TRP A 1 269 ? -28.761 113.550 -64.586 1.00   56.07  ? 414  TRP A CZ3 1 
ATOM   1972 C CH2 . TRP A 1 269 ? -27.943 114.436 -65.309 1.00   55.91  ? 414  TRP A CH2 1 
ATOM   1973 N N   . GLN A 1 270 ? -35.239 115.459 -61.691 1.00   51.08  ? 415  GLN A N   1 
ATOM   1974 C CA  . GLN A 1 270 ? -36.331 114.914 -60.917 1.00   49.80  ? 415  GLN A CA  1 
ATOM   1975 C C   . GLN A 1 270 ? -37.061 114.021 -61.870 1.00   51.37  ? 415  GLN A C   1 
ATOM   1976 O O   . GLN A 1 270 ? -37.562 112.944 -61.522 1.00   51.41  ? 415  GLN A O   1 
ATOM   1977 C CB  . GLN A 1 270 ? -37.256 116.029 -60.453 1.00   49.40  ? 415  GLN A CB  1 
ATOM   1978 C CG  . GLN A 1 270 ? -37.092 116.378 -59.009 1.00   47.09  ? 415  GLN A CG  1 
ATOM   1979 C CD  . GLN A 1 270 ? -38.251 117.210 -58.496 1.00   43.44  ? 415  GLN A CD  1 
ATOM   1980 O OE1 . GLN A 1 270 ? -39.398 116.800 -58.563 1.00   43.69  ? 415  GLN A OE1 1 
ATOM   1981 N NE2 . GLN A 1 270 ? -37.945 118.379 -57.984 1.00   40.23  ? 415  GLN A NE2 1 
ATOM   1982 N N   . ASP A 1 271 ? -37.116 114.501 -63.099 1.00   52.70  ? 416  ASP A N   1 
ATOM   1983 C CA  . ASP A 1 271 ? -37.781 113.783 -64.163 1.00   54.40  ? 416  ASP A CA  1 
ATOM   1984 C C   . ASP A 1 271 ? -37.058 112.477 -64.369 1.00   51.98  ? 416  ASP A C   1 
ATOM   1985 O O   . ASP A 1 271 ? -37.661 111.420 -64.483 1.00   51.19  ? 416  ASP A O   1 
ATOM   1986 C CB  . ASP A 1 271 ? -37.738 114.622 -65.447 1.00   58.89  ? 416  ASP A CB  1 
ATOM   1987 C CG  . ASP A 1 271 ? -38.965 115.517 -65.592 1.00   64.06  ? 416  ASP A CG  1 
ATOM   1988 O OD1 . ASP A 1 271 ? -40.098 114.964 -65.649 1.00   64.85  ? 416  ASP A OD1 1 
ATOM   1989 O OD2 . ASP A 1 271 ? -38.791 116.759 -65.638 1.00   64.43  ? 416  ASP A OD2 1 
ATOM   1990 N N   . VAL A 1 272 ? -35.744 112.596 -64.419 1.00   51.24  ? 417  VAL A N   1 
ATOM   1991 C CA  . VAL A 1 272 ? -34.841 111.473 -64.600 1.00   51.13  ? 417  VAL A CA  1 
ATOM   1992 C C   . VAL A 1 272 ? -35.151 110.364 -63.611 1.00   49.66  ? 417  VAL A C   1 
ATOM   1993 O O   . VAL A 1 272 ? -35.589 109.284 -64.017 1.00   49.14  ? 417  VAL A O   1 
ATOM   1994 C CB  . VAL A 1 272 ? -33.399 111.951 -64.440 1.00   49.92  ? 417  VAL A CB  1 
ATOM   1995 C CG1 . VAL A 1 272 ? -32.436 110.764 -64.499 1.00   51.47  ? 417  VAL A CG1 1 
ATOM   1996 C CG2 . VAL A 1 272 ? -33.110 112.937 -65.545 1.00   46.24  ? 417  VAL A CG2 1 
ATOM   1997 N N   . VAL A 1 273 ? -35.002 110.652 -62.319 1.00   48.68  ? 418  VAL A N   1 
ATOM   1998 C CA  . VAL A 1 273 ? -35.280 109.645 -61.308 1.00   49.21  ? 418  VAL A CA  1 
ATOM   1999 C C   . VAL A 1 273 ? -36.750 109.307 -61.220 1.00   50.48  ? 418  VAL A C   1 
ATOM   2000 O O   . VAL A 1 273 ? -37.127 108.284 -60.649 1.00   50.72  ? 418  VAL A O   1 
ATOM   2001 C CB  . VAL A 1 273 ? -34.756 110.072 -59.926 1.00   50.82  ? 418  VAL A CB  1 
ATOM   2002 C CG1 . VAL A 1 273 ? -33.491 110.854 -60.112 1.00   51.85  ? 418  VAL A CG1 1 
ATOM   2003 C CG2 . VAL A 1 273 ? -35.788 110.892 -59.175 1.00   50.51  ? 418  VAL A CG2 1 
ATOM   2004 N N   . GLN A 1 274 ? -37.604 110.143 -61.784 1.00   52.07  ? 419  GLN A N   1 
ATOM   2005 C CA  . GLN A 1 274 ? -39.009 109.808 -61.731 1.00   54.75  ? 419  GLN A CA  1 
ATOM   2006 C C   . GLN A 1 274 ? -39.426 108.878 -62.867 1.00   56.02  ? 419  GLN A C   1 
ATOM   2007 O O   . GLN A 1 274 ? -40.567 108.416 -62.887 1.00   57.27  ? 419  GLN A O   1 
ATOM   2008 C CB  . GLN A 1 274 ? -39.876 111.068 -61.739 1.00   57.76  ? 419  GLN A CB  1 
ATOM   2009 C CG  . GLN A 1 274 ? -39.868 111.880 -60.426 1.00   59.90  ? 419  GLN A CG  1 
ATOM   2010 C CD  . GLN A 1 274 ? -40.397 111.097 -59.252 1.00   63.33  ? 419  GLN A CD  1 
ATOM   2011 O OE1 . GLN A 1 274 ? -41.564 110.694 -59.228 1.00   66.25  ? 419  GLN A OE1 1 
ATOM   2012 N NE2 . GLN A 1 274 ? -39.536 110.860 -58.264 1.00   66.17  ? 419  GLN A NE2 1 
ATOM   2013 N N   . LYS A 1 275 ? -38.507 108.562 -63.787 1.00   56.23  ? 420  LYS A N   1 
ATOM   2014 C CA  . LYS A 1 275 ? -38.837 107.690 -64.927 1.00   55.89  ? 420  LYS A CA  1 
ATOM   2015 C C   . LYS A 1 275 ? -39.958 108.383 -65.735 1.00   57.73  ? 420  LYS A C   1 
ATOM   2016 O O   . LYS A 1 275 ? -40.785 107.730 -66.402 1.00   56.78  ? 420  LYS A O   1 
ATOM   2017 C CB  . LYS A 1 275 ? -39.342 106.325 -64.454 1.00   54.81  ? 420  LYS A CB  1 
ATOM   2018 C CG  . LYS A 1 275 ? -38.289 105.293 -64.074 1.00   55.56  ? 420  LYS A CG  1 
ATOM   2019 C CD  . LYS A 1 275 ? -38.858 103.858 -64.035 1.00   54.25  ? 420  LYS A CD  1 
ATOM   2020 C CE  . LYS A 1 275 ? -37.703 102.831 -63.814 1.00   58.54  ? 420  LYS A CE  1 
ATOM   2021 N NZ  . LYS A 1 275 ? -38.037 101.364 -63.610 1.00   56.23  ? 420  LYS A NZ  1 
ATOM   2022 N N   . LYS A 1 276 ? -39.979 109.711 -65.654 1.00   58.50  ? 421  LYS A N   1 
ATOM   2023 C CA  . LYS A 1 276 ? -40.986 110.508 -66.321 1.00   60.53  ? 421  LYS A CA  1 
ATOM   2024 C C   . LYS A 1 276 ? -40.566 110.841 -67.757 1.00   61.48  ? 421  LYS A C   1 
ATOM   2025 O O   . LYS A 1 276 ? -41.371 111.283 -68.575 1.00   61.00  ? 421  LYS A O   1 
ATOM   2026 C CB  . LYS A 1 276 ? -41.221 111.787 -65.513 1.00   63.12  ? 421  LYS A CB  1 
ATOM   2027 C CG  . LYS A 1 276 ? -42.656 112.003 -65.087 1.00   67.41  ? 421  LYS A CG  1 
ATOM   2028 C CD  . LYS A 1 276 ? -43.213 110.860 -64.245 1.00   68.99  ? 421  LYS A CD  1 
ATOM   2029 C CE  . LYS A 1 276 ? -44.657 111.175 -63.843 1.00   71.84  ? 421  LYS A CE  1 
ATOM   2030 N NZ  . LYS A 1 276 ? -44.753 112.462 -63.091 1.00   72.53  ? 421  LYS A NZ  1 
ATOM   2031 N N   . LEU A 1 277 ? -39.291 110.632 -68.059 1.00   61.75  ? 422  LEU A N   1 
ATOM   2032 C CA  . LEU A 1 277 ? -38.801 110.897 -69.399 1.00   60.93  ? 422  LEU A CA  1 
ATOM   2033 C C   . LEU A 1 277 ? -39.247 109.737 -70.259 1.00   61.00  ? 422  LEU A C   1 
ATOM   2034 O O   . LEU A 1 277 ? -39.404 108.631 -69.767 1.00   61.70  ? 422  LEU A O   1 
ATOM   2035 C CB  . LEU A 1 277 ? -37.272 111.002 -69.405 1.00   57.86  ? 422  LEU A CB  1 
ATOM   2036 C CG  . LEU A 1 277 ? -36.808 112.188 -68.562 1.00   56.18  ? 422  LEU A CG  1 
ATOM   2037 C CD1 . LEU A 1 277 ? -35.367 112.501 -68.807 1.00   54.08  ? 422  LEU A CD1 1 
ATOM   2038 C CD2 . LEU A 1 277 ? -37.659 113.392 -68.921 1.00   57.73  ? 422  LEU A CD2 1 
ATOM   2039 N N   . LEU A 1 278 ? -39.497 109.991 -71.533 1.00   61.84  ? 423  LEU A N   1 
ATOM   2040 C CA  . LEU A 1 278 ? -39.894 108.918 -72.432 1.00   61.61  ? 423  LEU A CA  1 
ATOM   2041 C C   . LEU A 1 278 ? -38.608 108.302 -73.055 1.00   60.00  ? 423  LEU A C   1 
ATOM   2042 O O   . LEU A 1 278 ? -37.655 108.993 -73.435 1.00   59.26  ? 423  LEU A O   1 
ATOM   2043 C CB  . LEU A 1 278 ? -40.859 109.465 -73.502 1.00   61.33  ? 423  LEU A CB  1 
ATOM   2044 C CG  . LEU A 1 278 ? -41.611 108.473 -74.401 1.00   63.12  ? 423  LEU A CG  1 
ATOM   2045 C CD1 . LEU A 1 278 ? -42.560 107.627 -73.562 1.00   60.58  ? 423  LEU A CD1 1 
ATOM   2046 C CD2 . LEU A 1 278 ? -42.375 109.236 -75.496 1.00   62.07  ? 423  LEU A CD2 1 
ATOM   2047 N N   . PRO A 1 279 ? -38.545 106.982 -73.108 1.00   60.55  ? 424  PRO A N   1 
ATOM   2048 C CA  . PRO A 1 279 ? -37.323 106.431 -73.701 1.00   60.24  ? 424  PRO A CA  1 
ATOM   2049 C C   . PRO A 1 279 ? -37.309 106.535 -75.231 1.00   59.74  ? 424  PRO A C   1 
ATOM   2050 O O   . PRO A 1 279 ? -38.261 106.118 -75.902 1.00   59.38  ? 424  PRO A O   1 
ATOM   2051 C CB  . PRO A 1 279 ? -37.317 104.988 -73.193 1.00   60.56  ? 424  PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 279 ? -38.769 104.665 -73.017 1.00   60.40  ? 424  PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 279 ? -39.354 105.944 -72.445 1.00   60.98  ? 424  PRO A CD  1 
ATOM   2054 N N   . PRO A 1 280 ? -36.227 107.105 -75.799 1.00   58.58  ? 425  PRO A N   1 
ATOM   2055 C CA  . PRO A 1 280 ? -36.030 107.291 -77.238 1.00   58.36  ? 425  PRO A CA  1 
ATOM   2056 C C   . PRO A 1 280 ? -36.106 106.000 -78.047 1.00   59.43  ? 425  PRO A C   1 
ATOM   2057 O O   . PRO A 1 280 ? -35.922 106.015 -79.275 1.00   59.56  ? 425  PRO A O   1 
ATOM   2058 C CB  . PRO A 1 280 ? -34.656 107.928 -77.315 1.00   57.08  ? 425  PRO A CB  1 
ATOM   2059 C CG  . PRO A 1 280 ? -33.989 107.363 -76.162 1.00   57.46  ? 425  PRO A CG  1 
ATOM   2060 C CD  . PRO A 1 280 ? -35.012 107.507 -75.083 1.00   57.81  ? 425  PRO A CD  1 
ATOM   2061 N N   . PHE A 1 281 ? -36.377 104.891 -77.358 1.00   58.30  ? 426  PHE A N   1 
ATOM   2062 C CA  . PHE A 1 281 ? -36.506 103.591 -77.992 1.00   57.55  ? 426  PHE A CA  1 
ATOM   2063 C C   . PHE A 1 281 ? -37.250 102.616 -77.124 1.00   57.91  ? 426  PHE A C   1 
ATOM   2064 O O   . PHE A 1 281 ? -36.899 102.393 -75.975 1.00   58.60  ? 426  PHE A O   1 
ATOM   2065 C CB  . PHE A 1 281 ? -35.149 102.984 -78.310 1.00   57.85  ? 426  PHE A CB  1 
ATOM   2066 C CG  . PHE A 1 281 ? -35.218 101.516 -78.625 1.00   58.27  ? 426  PHE A CG  1 
ATOM   2067 C CD1 . PHE A 1 281 ? -35.930 101.061 -79.720 1.00   59.18  ? 426  PHE A CD1 1 
ATOM   2068 C CD2 . PHE A 1 281 ? -34.590 100.587 -77.811 1.00   57.08  ? 426  PHE A CD2 1 
ATOM   2069 C CE1 . PHE A 1 281 ? -36.010 99.696  -79.993 1.00   58.67  ? 426  PHE A CE1 1 
ATOM   2070 C CE2 . PHE A 1 281 ? -34.667 99.239  -78.078 1.00   56.49  ? 426  PHE A CE2 1 
ATOM   2071 C CZ  . PHE A 1 281 ? -35.375 98.790  -79.166 1.00   57.08  ? 426  PHE A CZ  1 
ATOM   2072 N N   . LYS A 1 282 ? -38.267 101.994 -77.671 1.00   59.30  ? 427  LYS A N   1 
ATOM   2073 C CA  . LYS A 1 282 ? -38.975 101.053 -76.855 1.00   62.29  ? 427  LYS A CA  1 
ATOM   2074 C C   . LYS A 1 282 ? -38.711 99.655  -77.338 1.00   63.09  ? 427  LYS A C   1 
ATOM   2075 O O   . LYS A 1 282 ? -38.971 99.325  -78.480 1.00   62.14  ? 427  LYS A O   1 
ATOM   2076 C CB  . LYS A 1 282 ? -40.472 101.340 -76.860 1.00   65.23  ? 427  LYS A CB  1 
ATOM   2077 C CG  . LYS A 1 282 ? -41.269 100.410 -75.951 1.00   67.68  ? 427  LYS A CG  1 
ATOM   2078 C CD  . LYS A 1 282 ? -42.558 101.057 -75.530 1.00   71.81  ? 427  LYS A CD  1 
ATOM   2079 C CE  . LYS A 1 282 ? -43.359 100.179 -74.588 1.00   74.25  ? 427  LYS A CE  1 
ATOM   2080 N NZ  . LYS A 1 282 ? -44.672 100.852 -74.273 1.00   78.05  ? 427  LYS A NZ  1 
ATOM   2081 N N   . PRO A 1 283 ? -38.154 98.816  -76.467 1.00   65.55  ? 428  PRO A N   1 
ATOM   2082 C CA  . PRO A 1 283 ? -37.840 97.419  -76.784 1.00   67.04  ? 428  PRO A CA  1 
ATOM   2083 C C   . PRO A 1 283 ? -39.136 96.741  -77.224 1.00   69.31  ? 428  PRO A C   1 
ATOM   2084 O O   . PRO A 1 283 ? -40.222 97.122  -76.775 1.00   68.63  ? 428  PRO A O   1 
ATOM   2085 C CB  . PRO A 1 283 ? -37.318 96.892  -75.464 1.00   66.75  ? 428  PRO A CB  1 
ATOM   2086 C CG  . PRO A 1 283 ? -36.644 98.123  -74.872 1.00   66.18  ? 428  PRO A CG  1 
ATOM   2087 C CD  . PRO A 1 283 ? -37.677 99.178  -75.123 1.00   65.12  ? 428  PRO A CD  1 
ATOM   2088 N N   . GLN A 1 284 ? -39.027 95.729  -78.070 1.00   71.33  ? 429  GLN A N   1 
ATOM   2089 C CA  . GLN A 1 284 ? -40.215 95.087  -78.588 1.00   76.43  ? 429  GLN A CA  1 
ATOM   2090 C C   . GLN A 1 284 ? -40.847 93.943  -77.778 1.00   78.40  ? 429  GLN A C   1 
ATOM   2091 O O   . GLN A 1 284 ? -41.287 92.945  -78.350 1.00   78.63  ? 429  GLN A O   1 
ATOM   2092 C CB  . GLN A 1 284 ? -39.924 94.664  -80.038 1.00   78.89  ? 429  GLN A CB  1 
ATOM   2093 C CG  . GLN A 1 284 ? -39.594 95.884  -80.947 1.00   81.57  ? 429  GLN A CG  1 
ATOM   2094 C CD  . GLN A 1 284 ? -38.390 95.683  -81.895 1.00   83.07  ? 429  GLN A CD  1 
ATOM   2095 O OE1 . GLN A 1 284 ? -37.449 94.942  -81.591 1.00   83.89  ? 429  GLN A OE1 1 
ATOM   2096 N NE2 . GLN A 1 284 ? -38.415 96.377  -83.035 1.00   83.38  ? 429  GLN A NE2 1 
ATOM   2097 N N   . VAL A 1 285 ? -40.941 94.108  -76.456 1.00   80.93  ? 430  VAL A N   1 
ATOM   2098 C CA  . VAL A 1 285 ? -41.526 93.075  -75.582 1.00   82.93  ? 430  VAL A CA  1 
ATOM   2099 C C   . VAL A 1 285 ? -42.987 93.327  -75.158 1.00   85.70  ? 430  VAL A C   1 
ATOM   2100 O O   . VAL A 1 285 ? -43.412 94.481  -74.984 1.00   86.78  ? 430  VAL A O   1 
ATOM   2101 C CB  . VAL A 1 285 ? -40.667 92.876  -74.312 1.00   81.56  ? 430  VAL A CB  1 
ATOM   2102 C CG1 . VAL A 1 285 ? -39.425 92.105  -74.659 1.00   80.42  ? 430  VAL A CG1 1 
ATOM   2103 C CG2 . VAL A 1 285 ? -40.285 94.218  -73.721 1.00   80.49  ? 430  VAL A CG2 1 
ATOM   2104 N N   . THR A 1 286 ? -43.753 92.244  -74.995 1.00   86.85  ? 431  THR A N   1 
ATOM   2105 C CA  . THR A 1 286 ? -45.169 92.338  -74.609 1.00   88.26  ? 431  THR A CA  1 
ATOM   2106 C C   . THR A 1 286 ? -45.307 92.855  -73.183 1.00   88.54  ? 431  THR A C   1 
ATOM   2107 O O   . THR A 1 286 ? -45.897 93.904  -72.909 1.00   88.01  ? 431  THR A O   1 
ATOM   2108 C CB  . THR A 1 286 ? -45.866 90.953  -74.637 1.00   88.59  ? 431  THR A CB  1 
ATOM   2109 O OG1 . THR A 1 286 ? -45.692 90.338  -75.921 1.00   90.07  ? 431  THR A OG1 1 
ATOM   2110 C CG2 . THR A 1 286 ? -47.348 91.104  -74.346 1.00   88.73  ? 431  THR A CG2 1 
ATOM   2111 N N   . SER A 1 287 ? -44.747 92.071  -72.280 1.00   88.94  ? 432  SER A N   1 
ATOM   2112 C CA  . SER A 1 287 ? -44.774 92.358  -70.868 1.00   89.27  ? 432  SER A CA  1 
ATOM   2113 C C   . SER A 1 287 ? -43.480 91.784  -70.334 1.00   89.03  ? 432  SER A C   1 
ATOM   2114 O O   . SER A 1 287 ? -42.785 91.053  -71.047 1.00   88.99  ? 432  SER A O   1 
ATOM   2115 C CB  . SER A 1 287 ? -45.947 91.625  -70.246 1.00   90.50  ? 432  SER A CB  1 
ATOM   2116 O OG  . SER A 1 287 ? -45.912 90.261  -70.642 1.00   91.47  ? 432  SER A OG  1 
ATOM   2117 N N   . GLU A 1 288 ? -43.153 92.103  -69.087 1.00   88.54  ? 433  GLU A N   1 
ATOM   2118 C CA  . GLU A 1 288 ? -41.936 91.569  -68.506 1.00   88.63  ? 433  GLU A CA  1 
ATOM   2119 C C   . GLU A 1 288 ? -41.911 90.051  -68.687 1.00   87.61  ? 433  GLU A C   1 
ATOM   2120 O O   . GLU A 1 288 ? -40.856 89.425  -68.667 1.00   87.68  ? 433  GLU A O   1 
ATOM   2121 C CB  . GLU A 1 288 ? -41.848 91.968  -67.035 1.00   89.57  ? 433  GLU A CB  1 
ATOM   2122 C CG  . GLU A 1 288 ? -43.186 92.203  -66.397 1.00   91.86  ? 433  GLU A CG  1 
ATOM   2123 C CD  . GLU A 1 288 ? -43.141 93.280  -65.325 1.00   93.96  ? 433  GLU A CD  1 
ATOM   2124 O OE1 . GLU A 1 288 ? -42.185 93.279  -64.511 1.00   93.46  ? 433  GLU A OE1 1 
ATOM   2125 O OE2 . GLU A 1 288 ? -44.073 94.125  -65.296 1.00   95.40  ? 433  GLU A OE2 1 
ATOM   2126 N N   . VAL A 1 289 ? -43.090 89.482  -68.909 1.00   86.69  ? 434  VAL A N   1 
ATOM   2127 C CA  . VAL A 1 289 ? -43.260 88.050  -69.115 1.00   85.44  ? 434  VAL A CA  1 
ATOM   2128 C C   . VAL A 1 289 ? -42.692 87.672  -70.470 1.00   84.81  ? 434  VAL A C   1 
ATOM   2129 O O   . VAL A 1 289 ? -42.234 86.550  -70.670 1.00   84.31  ? 434  VAL A O   1 
ATOM   2130 C CB  . VAL A 1 289 ? -44.760 87.670  -69.092 1.00   85.61  ? 434  VAL A CB  1 
ATOM   2131 C CG1 . VAL A 1 289 ? -44.934 86.191  -68.772 1.00   84.34  ? 434  VAL A CG1 1 
ATOM   2132 C CG2 . VAL A 1 289 ? -45.505 88.552  -68.092 1.00   85.10  ? 434  VAL A CG2 1 
ATOM   2133 N N   . ASP A 1 290 ? -42.731 88.615  -71.403 0.0000 84.85  ? 435  ASP A N   1 
ATOM   2134 C CA  . ASP A 1 290 ? -42.216 88.360  -72.735 1.00   84.98  ? 435  ASP A CA  1 
ATOM   2135 C C   . ASP A 1 290 ? -40.769 87.892  -72.646 1.00   84.33  ? 435  ASP A C   1 
ATOM   2136 O O   . ASP A 1 290 ? -39.894 88.618  -72.170 1.00   83.47  ? 435  ASP A O   1 
ATOM   2137 C CB  . ASP A 1 290 ? -42.311 89.613  -73.605 1.00   85.05  ? 435  ASP A CB  1 
ATOM   2138 C CG  . ASP A 1 290 ? -41.909 89.342  -75.044 1.00   86.50  ? 435  ASP A CG  1 
ATOM   2139 O OD1 . ASP A 1 290 ? -42.451 88.391  -75.648 1.00   86.75  ? 435  ASP A OD1 1 
ATOM   2140 O OD2 . ASP A 1 290 ? -41.045 90.072  -75.573 1.00   87.74  ? 435  ASP A OD2 1 
ATOM   2141 N N   . THR A 1 291 ? -40.527 86.676  -73.123 1.00   84.42  ? 436  THR A N   1 
ATOM   2142 C CA  . THR A 1 291 ? -39.194 86.075  -73.076 1.00   84.69  ? 436  THR A CA  1 
ATOM   2143 C C   . THR A 1 291 ? -38.427 86.175  -74.391 1.00   84.89  ? 436  THR A C   1 
ATOM   2144 O O   . THR A 1 291 ? -37.449 85.449  -74.608 1.00   84.31  ? 436  THR A O   1 
ATOM   2145 C CB  . THR A 1 291 ? -39.289 84.584  -72.719 1.00   84.13  ? 436  THR A CB  1 
ATOM   2146 O OG1 . THR A 1 291 ? -39.774 83.865  -73.858 1.00   83.92  ? 436  THR A OG1 1 
ATOM   2147 C CG2 . THR A 1 291 ? -40.235 84.373  -71.541 1.00   82.01  ? 436  THR A CG2 1 
ATOM   2148 N N   . ARG A 1 292 ? -38.845 87.085  -75.258 1.00   85.79  ? 437  ARG A N   1 
ATOM   2149 C CA  . ARG A 1 292 ? -38.187 87.200  -76.547 1.00   87.50  ? 437  ARG A CA  1 
ATOM   2150 C C   . ARG A 1 292 ? -36.762 87.753  -76.609 1.00   87.70  ? 437  ARG A C   1 
ATOM   2151 O O   . ARG A 1 292 ? -36.077 87.496  -77.589 1.00   88.58  ? 437  ARG A O   1 
ATOM   2152 C CB  . ARG A 1 292 ? -39.079 87.956  -77.535 1.00   87.94  ? 437  ARG A CB  1 
ATOM   2153 C CG  . ARG A 1 292 ? -38.871 89.445  -77.605 1.00   89.48  ? 437  ARG A CG  1 
ATOM   2154 C CD  . ARG A 1 292 ? -39.529 89.967  -78.879 1.00   91.70  ? 437  ARG A CD  1 
ATOM   2155 N NE  . ARG A 1 292 ? -40.921 89.516  -78.993 1.00   92.53  ? 437  ARG A NE  1 
ATOM   2156 C CZ  . ARG A 1 292 ? -41.643 89.581  -80.109 1.00   92.81  ? 437  ARG A CZ  1 
ATOM   2157 N NH1 . ARG A 1 292 ? -41.117 90.081  -81.224 1.00   93.30  ? 437  ARG A NH1 1 
ATOM   2158 N NH2 . ARG A 1 292 ? -42.890 89.131  -80.115 1.00   93.04  ? 437  ARG A NH2 1 
ATOM   2159 N N   . TYR A 1 293 ? -36.295 88.501  -75.609 1.00   87.93  ? 438  TYR A N   1 
ATOM   2160 C CA  . TYR A 1 293 ? -34.918 89.001  -75.666 1.00   88.22  ? 438  TYR A CA  1 
ATOM   2161 C C   . TYR A 1 293 ? -33.962 88.023  -75.000 1.00   88.65  ? 438  TYR A C   1 
ATOM   2162 O O   . TYR A 1 293 ? -32.758 88.257  -74.932 1.00   89.17  ? 438  TYR A O   1 
ATOM   2163 C CB  . TYR A 1 293 ? -34.783 90.385  -75.010 1.00   88.14  ? 438  TYR A CB  1 
ATOM   2164 C CG  . TYR A 1 293 ? -35.155 91.529  -75.937 1.00   89.31  ? 438  TYR A CG  1 
ATOM   2165 C CD1 . TYR A 1 293 ? -36.371 92.204  -75.799 1.00   89.37  ? 438  TYR A CD1 1 
ATOM   2166 C CD2 . TYR A 1 293 ? -34.311 91.904  -76.991 1.00   89.37  ? 438  TYR A CD2 1 
ATOM   2167 C CE1 . TYR A 1 293 ? -36.747 93.220  -76.688 1.00   89.16  ? 438  TYR A CE1 1 
ATOM   2168 C CE2 . TYR A 1 293 ? -34.671 92.922  -77.887 1.00   88.90  ? 438  TYR A CE2 1 
ATOM   2169 C CZ  . TYR A 1 293 ? -35.894 93.574  -77.730 1.00   89.57  ? 438  TYR A CZ  1 
ATOM   2170 O OH  . TYR A 1 293 ? -36.272 94.568  -78.615 1.00   89.99  ? 438  TYR A OH  1 
ATOM   2171 N N   . PHE A 1 294 ? -34.501 86.906  -74.536 1.00   89.41  ? 439  PHE A N   1 
ATOM   2172 C CA  . PHE A 1 294 ? -33.692 85.907  -73.858 1.00   90.99  ? 439  PHE A CA  1 
ATOM   2173 C C   . PHE A 1 294 ? -32.874 84.987  -74.773 1.00   92.78  ? 439  PHE A C   1 
ATOM   2174 O O   . PHE A 1 294 ? -32.632 83.835  -74.434 1.00   93.20  ? 439  PHE A O   1 
ATOM   2175 C CB  . PHE A 1 294 ? -34.591 85.094  -72.923 1.00   89.13  ? 439  PHE A CB  1 
ATOM   2176 C CG  . PHE A 1 294 ? -35.223 85.917  -71.822 1.00   88.13  ? 439  PHE A CG  1 
ATOM   2177 C CD1 . PHE A 1 294 ? -36.225 85.378  -71.019 1.00   87.72  ? 439  PHE A CD1 1 
ATOM   2178 C CD2 . PHE A 1 294 ? -34.821 87.236  -71.590 1.00   87.87  ? 439  PHE A CD2 1 
ATOM   2179 C CE1 . PHE A 1 294 ? -36.819 86.131  -70.007 1.00   87.47  ? 439  PHE A CE1 1 
ATOM   2180 C CE2 . PHE A 1 294 ? -35.409 87.996  -70.583 1.00   87.43  ? 439  PHE A CE2 1 
ATOM   2181 C CZ  . PHE A 1 294 ? -36.409 87.445  -69.789 1.00   87.63  ? 439  PHE A CZ  1 
ATOM   2182 N N   . ASP A 1 295 ? -32.445 85.512  -75.922 1.00   95.58  ? 440  ASP A N   1 
ATOM   2183 C CA  . ASP A 1 295 ? -31.620 84.786  -76.910 1.00   97.94  ? 440  ASP A CA  1 
ATOM   2184 C C   . ASP A 1 295 ? -30.555 85.785  -77.395 1.00   99.11  ? 440  ASP A C   1 
ATOM   2185 O O   . ASP A 1 295 ? -30.126 86.651  -76.617 1.00   99.91  ? 440  ASP A O   1 
ATOM   2186 C CB  . ASP A 1 295 ? -32.460 84.339  -78.114 1.00   99.05  ? 440  ASP A CB  1 
ATOM   2187 C CG  . ASP A 1 295 ? -33.621 83.442  -77.722 1.00   100.34 ? 440  ASP A CG  1 
ATOM   2188 O OD1 . ASP A 1 295 ? -34.475 83.880  -76.916 1.00   101.18 ? 440  ASP A OD1 1 
ATOM   2189 O OD2 . ASP A 1 295 ? -33.684 82.298  -78.227 1.00   100.75 ? 440  ASP A OD2 1 
ATOM   2190 N N   . ASP A 1 296 ? -30.132 85.674  -78.661 1.00   99.52  ? 441  ASP A N   1 
ATOM   2191 C CA  . ASP A 1 296 ? -29.141 86.608  -79.230 1.00   100.00 ? 441  ASP A CA  1 
ATOM   2192 C C   . ASP A 1 296 ? -29.795 87.558  -80.235 1.00   100.07 ? 441  ASP A C   1 
ATOM   2193 O O   . ASP A 1 296 ? -29.505 87.511  -81.435 1.00   100.05 ? 441  ASP A O   1 
ATOM   2194 C CB  . ASP A 1 296 ? -27.987 85.869  -79.934 1.00   100.80 ? 441  ASP A CB  1 
ATOM   2195 C CG  . ASP A 1 296 ? -26.984 85.249  -78.958 1.00   102.11 ? 441  ASP A CG  1 
ATOM   2196 O OD1 . ASP A 1 296 ? -27.311 84.182  -78.365 1.00   102.27 ? 441  ASP A OD1 1 
ATOM   2197 O OD2 . ASP A 1 296 ? -25.875 85.836  -78.789 1.00   101.10 ? 441  ASP A OD2 1 
HETATM 2198 O O   . HOH B 2 .   ? -39.620 76.952  -44.795 1.00   65.06  ? 2001 HOH A O   1 
HETATM 2199 O O   . HOH B 2 .   ? -40.364 85.119  -48.794 1.00   65.79  ? 2002 HOH A O   1 
HETATM 2200 O O   . HOH B 2 .   ? -38.012 71.287  -58.934 1.00   106.95 ? 2003 HOH A O   1 
HETATM 2201 O O   . HOH B 2 .   ? -25.877 76.732  -67.138 1.00   76.88  ? 2004 HOH A O   1 
HETATM 2202 O O   . HOH B 2 .   ? -35.889 75.230  -68.768 1.00   64.70  ? 2005 HOH A O   1 
HETATM 2203 O O   . HOH B 2 .   ? -27.740 77.452  -70.824 1.00   64.18  ? 2006 HOH A O   1 
HETATM 2204 O O   . HOH B 2 .   ? -24.842 84.786  -70.919 1.00   83.14  ? 2007 HOH A O   1 
HETATM 2205 O O   . HOH B 2 .   ? -19.754 76.436  -64.791 1.00   65.72  ? 2008 HOH A O   1 
HETATM 2206 O O   . HOH B 2 .   ? -14.490 86.856  -62.601 1.00   72.73  ? 2009 HOH A O   1 
HETATM 2207 O O   . HOH B 2 .   ? -13.317 80.562  -60.559 1.00   95.98  ? 2010 HOH A O   1 
HETATM 2208 O O   . HOH B 2 .   ? -29.412 78.893  -61.081 1.00   94.89  ? 2011 HOH A O   1 
HETATM 2209 O O   . HOH B 2 .   ? -35.278 83.038  -66.082 1.00   140.46 ? 2012 HOH A O   1 
HETATM 2210 O O   . HOH B 2 .   ? -41.297 81.415  -55.388 1.00   58.72  ? 2013 HOH A O   1 
HETATM 2211 O O   . HOH B 2 .   ? -42.100 79.401  -57.088 1.00   59.30  ? 2014 HOH A O   1 
HETATM 2212 O O   . HOH B 2 .   ? -43.030 87.140  -66.440 1.00   86.41  ? 2015 HOH A O   1 
HETATM 2213 O O   . HOH B 2 .   ? -46.817 91.506  -66.702 1.00   76.01  ? 2016 HOH A O   1 
HETATM 2214 O O   . HOH B 2 .   ? -40.402 89.050  -65.470 1.00   66.71  ? 2017 HOH A O   1 
HETATM 2215 O O   . HOH B 2 .   ? -42.162 87.748  -57.060 1.00   64.14  ? 2018 HOH A O   1 
HETATM 2216 O O   . HOH B 2 .   ? -40.257 91.774  -57.876 1.00   52.33  ? 2019 HOH A O   1 
HETATM 2217 O O   . HOH B 2 .   ? -22.663 89.988  -55.574 1.00   75.14  ? 2020 HOH A O   1 
HETATM 2218 O O   . HOH B 2 .   ? -18.201 75.016  -57.656 1.00   91.72  ? 2021 HOH A O   1 
HETATM 2219 O O   . HOH B 2 .   ? -17.394 75.439  -54.772 1.00   64.78  ? 2022 HOH A O   1 
HETATM 2220 O O   . HOH B 2 .   ? -11.642 73.495  -55.298 1.00   83.70  ? 2023 HOH A O   1 
HETATM 2221 O O   . HOH B 2 .   ? -13.653 79.090  -53.596 1.00   94.61  ? 2024 HOH A O   1 
HETATM 2222 O O   . HOH B 2 .   ? -15.999 89.372  -50.383 1.00   68.67  ? 2025 HOH A O   1 
HETATM 2223 O O   . HOH B 2 .   ? -15.572 92.427  -50.584 1.00   61.74  ? 2026 HOH A O   1 
HETATM 2224 O O   . HOH B 2 .   ? -20.856 89.240  -49.325 1.00   68.76  ? 2027 HOH A O   1 
HETATM 2225 O O   . HOH B 2 .   ? -17.967 92.996  -52.448 1.00   122.83 ? 2028 HOH A O   1 
HETATM 2226 O O   . HOH B 2 .   ? -23.421 95.483  -52.371 1.00   81.87  ? 2029 HOH A O   1 
HETATM 2227 O O   . HOH B 2 .   ? -22.835 92.343  -47.020 1.00   115.13 ? 2030 HOH A O   1 
HETATM 2228 O O   . HOH B 2 .   ? -27.678 90.802  -49.769 1.00   97.30  ? 2031 HOH A O   1 
HETATM 2229 O O   . HOH B 2 .   ? -24.979 97.901  -53.866 1.00   69.47  ? 2032 HOH A O   1 
HETATM 2230 O O   . HOH B 2 .   ? -29.791 102.601 -51.819 1.00   77.52  ? 2033 HOH A O   1 
HETATM 2231 O O   . HOH B 2 .   ? -34.459 105.336 -55.184 1.00   67.46  ? 2034 HOH A O   1 
HETATM 2232 O O   . HOH B 2 .   ? -40.011 96.725  -50.728 1.00   87.25  ? 2035 HOH A O   1 
HETATM 2233 O O   . HOH B 2 .   ? -42.123 87.249  -47.169 1.00   85.55  ? 2036 HOH A O   1 
HETATM 2234 O O   . HOH B 2 .   ? -21.474 79.449  -64.467 1.00   129.98 ? 2037 HOH A O   1 
HETATM 2235 O O   . HOH B 2 .   ? -16.453 89.262  -62.208 1.00   92.34  ? 2038 HOH A O   1 
HETATM 2236 O O   . HOH B 2 .   ? -33.619 86.138  -45.734 1.00   110.05 ? 2039 HOH A O   1 
HETATM 2237 O O   . HOH B 2 .   ? -24.948 75.030  -52.684 1.00   97.18  ? 2040 HOH A O   1 
HETATM 2238 O O   . HOH B 2 .   ? -50.936 93.863  -66.484 1.00   75.85  ? 2041 HOH A O   1 
HETATM 2239 O O   . HOH B 2 .   ? -20.109 74.745  -45.533 1.00   57.02  ? 2042 HOH A O   1 
HETATM 2240 O O   . HOH B 2 .   ? -24.858 72.589  -43.881 1.00   75.70  ? 2043 HOH A O   1 
HETATM 2241 O O   . HOH B 2 .   ? -46.349 88.688  -57.235 1.00   65.53  ? 2044 HOH A O   1 
HETATM 2242 O O   . HOH B 2 .   ? -43.095 94.932  -57.169 1.00   73.14  ? 2045 HOH A O   1 
HETATM 2243 O O   . HOH B 2 .   ? -20.373 74.592  -48.507 1.00   139.24 ? 2046 HOH A O   1 
HETATM 2244 O O   . HOH B 2 .   ? -19.013 72.299  -58.794 1.00   68.14  ? 2047 HOH A O   1 
HETATM 2245 O O   . HOH B 2 .   ? -20.689 74.956  -59.279 1.00   62.52  ? 2048 HOH A O   1 
HETATM 2246 O O   . HOH B 2 .   ? -13.173 89.938  -52.051 1.00   69.90  ? 2049 HOH A O   1 
HETATM 2247 O O   . HOH B 2 .   ? -30.940 89.343  -60.950 1.00   81.04  ? 2050 HOH A O   1 
HETATM 2248 O O   . HOH B 2 .   ? -30.029 91.062  -63.260 1.00   64.72  ? 2051 HOH A O   1 
HETATM 2249 O O   . HOH B 2 .   ? -36.821 95.744  -64.611 1.00   68.12  ? 2052 HOH A O   1 
HETATM 2250 O O   . HOH B 2 .   ? -24.439 91.541  -44.661 1.00   56.54  ? 2053 HOH A O   1 
HETATM 2251 O O   . HOH B 2 .   ? -34.591 94.049  -63.951 1.00   77.13  ? 2054 HOH A O   1 
HETATM 2252 O O   . HOH B 2 .   ? -38.222 94.369  -68.110 1.00   58.02  ? 2055 HOH A O   1 
HETATM 2253 O O   . HOH B 2 .   ? -33.666 91.087  -71.774 1.00   43.20  ? 2056 HOH A O   1 
HETATM 2254 O O   . HOH B 2 .   ? -13.693 91.629  -61.961 1.00   78.83  ? 2057 HOH A O   1 
HETATM 2255 O O   . HOH B 2 .   ? -31.533 89.827  -72.782 1.00   63.67  ? 2058 HOH A O   1 
HETATM 2256 O O   . HOH B 2 .   ? -51.174 97.578  -68.616 1.00   65.93  ? 2059 HOH A O   1 
HETATM 2257 O O   . HOH B 2 .   ? -18.738 76.670  -47.269 1.00   78.14  ? 2060 HOH A O   1 
HETATM 2258 O O   . HOH B 2 .   ? -21.567 70.663  -57.108 1.00   60.15  ? 2061 HOH A O   1 
HETATM 2259 O O   . HOH B 2 .   ? -17.995 70.966  -56.162 1.00   76.24  ? 2062 HOH A O   1 
HETATM 2260 O O   . HOH B 2 .   ? -46.393 91.952  -56.353 1.00   65.03  ? 2063 HOH A O   1 
HETATM 2261 O O   . HOH B 2 .   ? -46.862 97.084  -55.716 1.00   65.11  ? 2064 HOH A O   1 
HETATM 2262 O O   . HOH B 2 .   ? -26.101 90.877  -78.083 1.00   70.14  ? 2065 HOH A O   1 
HETATM 2263 O O   . HOH B 2 .   ? -22.370 97.409  -85.179 1.00   63.07  ? 2066 HOH A O   1 
HETATM 2264 O O   . HOH B 2 .   ? -31.913 98.107  -84.507 1.00   86.25  ? 2067 HOH A O   1 
HETATM 2265 O O   . HOH B 2 .   ? -36.184 93.285  -86.090 1.00   74.32  ? 2068 HOH A O   1 
HETATM 2266 O O   . HOH B 2 .   ? -30.074 91.462  -86.010 1.00   67.48  ? 2069 HOH A O   1 
HETATM 2267 O O   . HOH B 2 .   ? -17.184 98.290  -85.354 1.00   78.80  ? 2070 HOH A O   1 
HETATM 2268 O O   . HOH B 2 .   ? -14.864 100.246 -85.541 1.00   68.28  ? 2071 HOH A O   1 
HETATM 2269 O O   . HOH B 2 .   ? -24.127 99.590  -87.349 1.00   66.43  ? 2072 HOH A O   1 
HETATM 2270 O O   . HOH B 2 .   ? -18.511 98.156  -91.255 1.00   101.58 ? 2073 HOH A O   1 
HETATM 2271 O O   . HOH B 2 .   ? -17.833 101.170 -90.635 1.00   59.47  ? 2074 HOH A O   1 
HETATM 2272 O O   . HOH B 2 .   ? -16.529 98.267  -88.938 1.00   75.90  ? 2075 HOH A O   1 
HETATM 2273 O O   . HOH B 2 .   ? -32.433 106.936 -81.907 1.00   80.36  ? 2076 HOH A O   1 
HETATM 2274 O O   . HOH B 2 .   ? -24.382 106.870 -84.849 1.00   44.99  ? 2077 HOH A O   1 
HETATM 2275 O O   . HOH B 2 .   ? -23.663 112.140 -71.614 1.00   148.71 ? 2078 HOH A O   1 
HETATM 2276 O O   . HOH B 2 .   ? -16.316 81.850  -77.610 1.00   76.77  ? 2079 HOH A O   1 
HETATM 2277 O O   . HOH B 2 .   ? -23.896 109.899 -81.328 1.00   47.26  ? 2080 HOH A O   1 
HETATM 2278 O O   . HOH B 2 .   ? -29.722 105.887 -81.664 1.00   52.74  ? 2081 HOH A O   1 
HETATM 2279 O O   . HOH B 2 .   ? -32.007 109.523 -80.974 1.00   61.52  ? 2082 HOH A O   1 
HETATM 2280 O O   . HOH B 2 .   ? -26.284 112.474 -82.613 1.00   59.02  ? 2083 HOH A O   1 
HETATM 2281 O O   . HOH B 2 .   ? -26.196 115.869 -80.534 1.00   124.46 ? 2084 HOH A O   1 
HETATM 2282 O O   . HOH B 2 .   ? -26.045 114.455 -76.988 1.00   148.16 ? 2085 HOH A O   1 
HETATM 2283 O O   . HOH B 2 .   ? -26.005 117.192 -78.038 1.00   45.00  ? 2086 HOH A O   1 
HETATM 2284 O O   . HOH B 2 .   ? -30.136 114.692 -73.499 1.00   69.41  ? 2087 HOH A O   1 
HETATM 2285 O O   . HOH B 2 .   ? -28.724 116.890 -78.646 1.00   71.80  ? 2088 HOH A O   1 
HETATM 2286 O O   . HOH B 2 .   ? -32.370 116.436 -73.778 1.00   47.57  ? 2089 HOH A O   1 
HETATM 2287 O O   . HOH B 2 .   ? -27.652 116.357 -75.638 1.00   37.04  ? 2090 HOH A O   1 
HETATM 2288 O O   . HOH B 2 .   ? -31.151 113.530 -80.879 1.00   108.97 ? 2091 HOH A O   1 
HETATM 2289 O O   . HOH B 2 .   ? -34.684 103.314 -48.034 1.00   68.34  ? 2092 HOH A O   1 
HETATM 2290 O O   . HOH B 2 .   ? -33.263 104.298 -82.257 1.00   70.47  ? 2093 HOH A O   1 
HETATM 2291 O O   . HOH B 2 .   ? -19.946 112.177 -52.595 1.00   75.90  ? 2094 HOH A O   1 
HETATM 2292 O O   . HOH B 2 .   ? -16.027 109.450 -51.048 1.00   88.20  ? 2095 HOH A O   1 
HETATM 2293 O O   . HOH B 2 .   ? -47.104 106.438 -64.958 1.00   63.37  ? 2096 HOH A O   1 
HETATM 2294 O O   . HOH B 2 .   ? -18.873 85.936  -78.074 1.00   66.40  ? 2097 HOH A O   1 
HETATM 2295 O O   . HOH B 2 .   ? -25.139 109.781 -72.683 1.00   61.62  ? 2098 HOH A O   1 
HETATM 2296 O O   . HOH B 2 .   ? -28.708 113.603 -71.015 1.00   142.60 ? 2099 HOH A O   1 
HETATM 2297 O O   . HOH B 2 .   ? -26.843 111.179 -70.366 1.00   163.82 ? 2100 HOH A O   1 
HETATM 2298 O O   . HOH B 2 .   ? -17.444 96.006  -54.780 1.00   94.11  ? 2101 HOH A O   1 
HETATM 2299 O O   . HOH B 2 .   ? -13.502 99.263  -64.959 1.00   73.36  ? 2102 HOH A O   1 
HETATM 2300 O O   . HOH B 2 .   ? -10.403 92.503  -58.575 1.00   62.08  ? 2103 HOH A O   1 
HETATM 2301 O O   . HOH B 2 .   ? -30.276 105.290 -68.974 1.00   136.11 ? 2104 HOH A O   1 
HETATM 2302 O O   . HOH B 2 .   ? -24.309 110.034 -68.125 1.00   138.75 ? 2105 HOH A O   1 
HETATM 2303 O O   . HOH B 2 .   ? -23.357 108.395 -64.462 1.00   187.85 ? 2106 HOH A O   1 
HETATM 2304 O O   . HOH B 2 .   ? -19.758 89.506  -73.192 1.00   53.30  ? 2107 HOH A O   1 
HETATM 2305 O O   . HOH B 2 .   ? -28.804 113.171 -60.433 1.00   66.32  ? 2108 HOH A O   1 
HETATM 2306 O O   . HOH B 2 .   ? -23.770 111.385 -54.509 1.00   45.45  ? 2109 HOH A O   1 
HETATM 2307 O O   . HOH B 2 .   ? -26.597 116.775 -56.221 1.00   59.48  ? 2110 HOH A O   1 
HETATM 2308 O O   . HOH B 2 .   ? -31.741 114.297 -58.301 1.00   55.55  ? 2111 HOH A O   1 
HETATM 2309 O O   . HOH B 2 .   ? -34.289 105.933 -52.190 1.00   82.50  ? 2112 HOH A O   1 
HETATM 2310 O O   . HOH B 2 .   ? -30.870 103.448 -49.156 1.00   79.06  ? 2113 HOH A O   1 
HETATM 2311 O O   . HOH B 2 .   ? -18.841 109.325 -51.901 1.00   50.71  ? 2114 HOH A O   1 
HETATM 2312 O O   . HOH B 2 .   ? -20.234 107.998 -60.799 1.00   87.86  ? 2115 HOH A O   1 
HETATM 2313 O O   . HOH B 2 .   ? -26.425 109.073 -46.804 1.00   40.11  ? 2116 HOH A O   1 
HETATM 2314 O O   . HOH B 2 .   ? -15.745 87.913  -78.971 1.00   82.57  ? 2117 HOH A O   1 
HETATM 2315 O O   . HOH B 2 .   ? -9.882  90.805  -69.884 1.00   77.67  ? 2118 HOH A O   1 
HETATM 2316 O O   . HOH B 2 .   ? -25.689 128.085 -67.171 1.00   67.98  ? 2119 HOH A O   1 
HETATM 2317 O O   . HOH B 2 .   ? -16.763 106.062 -51.588 1.00   61.79  ? 2120 HOH A O   1 
HETATM 2318 O O   . HOH B 2 .   ? -45.920 105.710 -62.215 1.00   64.29  ? 2121 HOH A O   1 
HETATM 2319 O O   . HOH B 2 .   ? -1.332  98.403  -49.661 1.00   62.60  ? 2122 HOH A O   1 
HETATM 2320 O O   . HOH B 2 .   ? -40.875 77.011  -74.142 1.00   85.95  ? 2123 HOH A O   1 
HETATM 2321 O O   . HOH B 2 .   ? -21.101 96.807  -57.971 1.00   51.72  ? 2124 HOH A O   1 
HETATM 2322 O O   . HOH B 2 .   ? -15.148 95.673  -52.664 1.00   94.23  ? 2125 HOH A O   1 
HETATM 2323 O O   . HOH B 2 .   ? -13.126 95.546  -57.790 1.00   59.68  ? 2126 HOH A O   1 
HETATM 2324 O O   . HOH B 2 .   ? -15.950 99.464  -53.880 1.00   89.42  ? 2127 HOH A O   1 
HETATM 2325 O O   . HOH B 2 .   ? -15.755 97.325  -64.655 1.00   141.30 ? 2128 HOH A O   1 
HETATM 2326 O O   . HOH B 2 .   ? -16.088 100.749 -65.314 1.00   40.00  ? 2129 HOH A O   1 
HETATM 2327 O O   . HOH B 2 .   ? -16.735 101.498 -68.745 1.00   55.84  ? 2130 HOH A O   1 
HETATM 2328 O O   . HOH B 2 .   ? -25.067 95.437  -72.647 1.00   40.50  ? 2131 HOH A O   1 
HETATM 2329 O O   . HOH B 2 .   ? -17.871 100.287 -70.836 1.00   47.10  ? 2132 HOH A O   1 
HETATM 2330 O O   . HOH B 2 .   ? -17.545 97.389  -74.111 1.00   48.51  ? 2133 HOH A O   1 
HETATM 2331 O O   . HOH B 2 .   ? -18.802 98.111  -71.830 1.00   91.54  ? 2134 HOH A O   1 
HETATM 2332 O O   . HOH B 2 .   ? -15.488 94.615  -70.428 1.00   78.70  ? 2135 HOH A O   1 
HETATM 2333 O O   . HOH B 2 .   ? -15.767 97.526  -71.404 1.00   92.23  ? 2136 HOH A O   1 
HETATM 2334 O O   . HOH B 2 .   ? -11.950 106.850 -87.643 1.00   91.85  ? 2137 HOH A O   1 
HETATM 2335 O O   . HOH B 2 .   ? -9.346  110.181 -84.099 1.00   89.36  ? 2138 HOH A O   1 
HETATM 2336 O O   . HOH B 2 .   ? -22.419 96.589  -62.976 1.00   150.84 ? 2139 HOH A O   1 
HETATM 2337 O O   . HOH B 2 .   ? -1.920  92.149  -72.312 1.00   84.20  ? 2140 HOH A O   1 
HETATM 2338 O O   . HOH B 2 .   ? -38.446 97.978  -64.937 1.00   45.97  ? 2141 HOH A O   1 
HETATM 2339 O O   . HOH B 2 .   ? -39.892 100.608 -66.205 1.00   58.26  ? 2142 HOH A O   1 
HETATM 2340 O O   . HOH B 2 .   ? -5.293  109.012 -82.805 1.00   96.19  ? 2143 HOH A O   1 
HETATM 2341 O O   . HOH B 2 .   ? -17.609 119.506 -88.286 1.00   68.99  ? 2144 HOH A O   1 
HETATM 2342 O O   . HOH B 2 .   ? -33.361 103.806 -70.653 1.00   140.12 ? 2145 HOH A O   1 
HETATM 2343 O O   . HOH B 2 .   ? -14.480 122.664 -69.723 1.00   92.80  ? 2146 HOH A O   1 
HETATM 2344 O O   . HOH B 2 .   ? -6.723  115.472 -70.610 1.00   90.64  ? 2147 HOH A O   1 
HETATM 2345 O O   . HOH B 2 .   ? -27.637 95.948  -59.825 1.00   94.44  ? 2148 HOH A O   1 
HETATM 2346 O O   . HOH B 2 .   ? -4.557  114.306 -68.990 1.00   54.97  ? 2149 HOH A O   1 
HETATM 2347 O O   . HOH B 2 .   ? -4.585  113.142 -71.602 1.00   68.69  ? 2150 HOH A O   1 
HETATM 2348 O O   . HOH B 2 .   ? -27.961 92.454  -61.518 1.00   58.44  ? 2151 HOH A O   1 
HETATM 2349 O O   . HOH B 2 .   ? -25.592 91.916  -67.854 1.00   63.56  ? 2152 HOH A O   1 
HETATM 2350 O O   . HOH B 2 .   ? -20.712 90.314  -70.805 1.00   68.37  ? 2153 HOH A O   1 
HETATM 2351 O O   . HOH B 2 .   ? -18.644 88.147  -71.297 1.00   86.11  ? 2154 HOH A O   1 
HETATM 2352 O O   . HOH B 2 .   ? -20.105 84.343  -72.117 1.00   79.82  ? 2155 HOH A O   1 
HETATM 2353 O O   . HOH B 2 .   ? -24.469 90.392  -70.010 1.00   91.87  ? 2156 HOH A O   1 
HETATM 2354 O O   . HOH B 2 .   ? -13.270 89.200  -73.956 1.00   75.93  ? 2157 HOH A O   1 
HETATM 2355 O O   . HOH B 2 .   ? -17.239 90.691  -76.969 1.00   87.34  ? 2158 HOH A O   1 
HETATM 2356 O O   . HOH B 2 .   ? -15.108 95.707  -76.755 1.00   71.18  ? 2159 HOH A O   1 
HETATM 2357 O O   . HOH B 2 .   ? -9.098  93.363  -70.879 1.00   74.09  ? 2160 HOH A O   1 
HETATM 2358 O O   . HOH B 2 .   ? -10.180 98.745  -77.420 1.00   58.80  ? 2161 HOH A O   1 
HETATM 2359 O O   . HOH B 2 .   ? -14.576 98.146  -68.739 1.00   55.58  ? 2162 HOH A O   1 
HETATM 2360 O O   . HOH B 2 .   ? -26.509 125.280 -70.232 1.00   59.27  ? 2163 HOH A O   1 
HETATM 2361 O O   . HOH B 2 .   ? -33.023 112.928 -70.388 1.00   84.12  ? 2164 HOH A O   1 
HETATM 2362 O O   . HOH B 2 .   ? -35.900 115.147 -71.878 1.00   60.98  ? 2165 HOH A O   1 
HETATM 2363 O O   . HOH B 2 .   ? -12.357 100.852 -62.896 1.00   39.88  ? 2166 HOH A O   1 
HETATM 2364 O O   . HOH B 2 .   ? -10.846 107.239 -57.586 1.00   55.69  ? 2167 HOH A O   1 
HETATM 2365 O O   . HOH B 2 .   ? -46.590 108.427 -61.061 1.00   70.86  ? 2168 HOH A O   1 
HETATM 2366 O O   . HOH B 2 .   ? -49.968 109.707 -67.125 1.00   60.67  ? 2169 HOH A O   1 
HETATM 2367 O O   . HOH B 2 .   ? 2.843   106.112 -59.088 1.00   58.71  ? 2170 HOH A O   1 
HETATM 2368 O O   . HOH B 2 .   ? -4.530  96.387  -52.851 1.00   66.78  ? 2171 HOH A O   1 
HETATM 2369 O O   . HOH B 2 .   ? -5.084  107.622 -56.494 1.00   61.95  ? 2172 HOH A O   1 
HETATM 2370 O O   . HOH B 2 .   ? -38.075 78.311  -75.036 1.00   67.85  ? 2173 HOH A O   1 
HETATM 2371 O O   . HOH B 2 .   ? -27.833 85.493  -84.819 1.00   63.80  ? 2174 HOH A O   1 
HETATM 2372 O O   . HOH B 2 .   ? -24.922 86.615  -84.769 1.00   73.87  ? 2175 HOH A O   1 
HETATM 2373 O O   . HOH B 2 .   ? -14.225 107.986 -52.791 1.00   59.47  ? 2176 HOH A O   1 
HETATM 2374 O O   . HOH B 2 .   ? -12.623 109.434 -56.449 1.00   39.48  ? 2177 HOH A O   1 
HETATM 2375 O O   . HOH B 2 .   ? -14.824 102.211 -63.550 1.00   35.62  ? 2178 HOH A O   1 
HETATM 2376 O O   . HOH B 2 .   ? -17.602 102.175 -62.318 1.00   35.40  ? 2179 HOH A O   1 
HETATM 2377 O O   . HOH B 2 .   ? -17.739 105.605 -56.951 1.00   103.39 ? 2180 HOH A O   1 
HETATM 2378 O O   . HOH B 2 .   ? -15.587 109.414 -73.846 1.00   109.54 ? 2181 HOH A O   1 
HETATM 2379 O O   . HOH B 2 .   ? -20.752 101.299 -74.571 1.00   145.94 ? 2182 HOH A O   1 
HETATM 2380 O O   . HOH B 2 .   ? -21.048 96.895  -78.804 1.00   73.04  ? 2183 HOH A O   1 
HETATM 2381 O O   . HOH B 2 .   ? -18.006 101.376 -73.437 1.00   49.10  ? 2184 HOH A O   1 
HETATM 2382 O O   . HOH B 2 .   ? -11.567 105.598 -81.452 1.00   68.13  ? 2185 HOH A O   1 
HETATM 2383 O O   . HOH B 2 .   ? -12.070 109.272 -85.240 1.00   66.63  ? 2186 HOH A O   1 
HETATM 2384 O O   . HOH B 2 .   ? 0.322   101.859 -79.280 1.00   74.74  ? 2187 HOH A O   1 
HETATM 2385 O O   . HOH B 2 .   ? -7.631  97.464  -77.344 1.00   72.89  ? 2188 HOH A O   1 
HETATM 2386 O O   . HOH B 2 .   ? 1.567   92.231  -82.507 1.00   64.79  ? 2189 HOH A O   1 
HETATM 2387 O O   . HOH B 2 .   ? 1.932   94.228  -79.576 1.00   86.73  ? 2190 HOH A O   1 
HETATM 2388 O O   . HOH B 2 .   ? -8.684  94.162  -77.505 1.00   54.75  ? 2191 HOH A O   1 
HETATM 2389 O O   . HOH B 2 .   ? -4.053  94.460  -72.145 1.00   102.57 ? 2192 HOH A O   1 
HETATM 2390 O O   . HOH B 2 .   ? -0.980  95.753  -77.339 1.00   130.02 ? 2193 HOH A O   1 
HETATM 2391 O O   . HOH B 2 .   ? -1.700  95.602  -70.617 1.00   100.61 ? 2194 HOH A O   1 
HETATM 2392 O O   . HOH B 2 .   ? 2.350   96.310  -77.625 1.00   77.25  ? 2195 HOH A O   1 
HETATM 2393 O O   . HOH B 2 .   ? 2.169   95.561  -82.913 1.00   70.33  ? 2196 HOH A O   1 
HETATM 2394 O O   . HOH B 2 .   ? 3.575   98.813  -79.494 1.00   129.94 ? 2197 HOH A O   1 
HETATM 2395 O O   . HOH B 2 .   ? 2.564   96.910  -74.687 1.00   71.23  ? 2198 HOH A O   1 
HETATM 2396 O O   . HOH B 2 .   ? 0.964   101.692 -74.729 1.00   79.44  ? 2199 HOH A O   1 
HETATM 2397 O O   . HOH B 2 .   ? -0.555  110.279 -68.104 1.00   65.58  ? 2200 HOH A O   1 
HETATM 2398 O O   . HOH B 2 .   ? -0.970  111.306 -71.035 1.00   78.80  ? 2201 HOH A O   1 
HETATM 2399 O O   . HOH B 2 .   ? -3.186  109.673 -79.915 1.00   82.21  ? 2202 HOH A O   1 
HETATM 2400 O O   . HOH B 2 .   ? -1.905  111.387 -73.751 1.00   102.38 ? 2203 HOH A O   1 
HETATM 2401 O O   . HOH B 2 .   ? -1.188  111.705 -79.544 1.00   65.56  ? 2204 HOH A O   1 
HETATM 2402 O O   . HOH B 2 .   ? -6.214  111.470 -78.525 1.00   138.69 ? 2205 HOH A O   1 
HETATM 2403 O O   . HOH B 2 .   ? -8.126  114.143 -78.063 1.00   80.43  ? 2206 HOH A O   1 
HETATM 2404 O O   . HOH B 2 .   ? -5.550  113.913 -87.293 1.00   65.42  ? 2207 HOH A O   1 
HETATM 2405 O O   . HOH B 2 .   ? -4.614  111.929 -80.974 1.00   75.66  ? 2208 HOH A O   1 
HETATM 2406 O O   . HOH B 2 .   ? -9.959  114.418 -80.715 1.00   78.99  ? 2209 HOH A O   1 
HETATM 2407 O O   . HOH B 2 .   ? -15.102 112.417 -88.534 1.00   73.00  ? 2210 HOH A O   1 
HETATM 2408 O O   . HOH B 2 .   ? -14.936 117.546 -88.862 1.00   72.67  ? 2211 HOH A O   1 
HETATM 2409 O O   . HOH B 2 .   ? -12.694 112.111 -86.883 1.00   59.78  ? 2212 HOH A O   1 
HETATM 2410 O O   . HOH B 2 .   ? -10.757 110.526 -88.440 1.00   59.21  ? 2213 HOH A O   1 
HETATM 2411 O O   . HOH B 2 .   ? -13.450 110.758 -90.484 1.00   87.58  ? 2214 HOH A O   1 
HETATM 2412 O O   . HOH B 2 .   ? -21.737 115.077 -88.287 1.00   65.75  ? 2215 HOH A O   1 
HETATM 2413 O O   . HOH B 2 .   ? -17.677 111.047 -87.708 1.00   79.68  ? 2216 HOH A O   1 
HETATM 2414 O O   . HOH B 2 .   ? -17.400 112.801 -83.731 1.00   67.54  ? 2217 HOH A O   1 
HETATM 2415 O O   . HOH B 2 .   ? -15.981 117.206 -81.437 1.00   86.58  ? 2218 HOH A O   1 
HETATM 2416 O O   . HOH B 2 .   ? -15.930 120.678 -76.265 1.00   58.01  ? 2219 HOH A O   1 
HETATM 2417 O O   . HOH B 2 .   ? -13.768 118.988 -74.782 1.00   118.95 ? 2220 HOH A O   1 
HETATM 2418 O O   . HOH B 2 .   ? -17.796 123.005 -70.166 1.00   74.65  ? 2221 HOH A O   1 
HETATM 2419 O O   . HOH B 2 .   ? -15.038 122.846 -72.436 1.00   60.42  ? 2222 HOH A O   1 
HETATM 2420 O O   . HOH B 2 .   ? -9.663  114.210 -70.894 1.00   47.74  ? 2223 HOH A O   1 
HETATM 2421 O O   . HOH B 2 .   ? -7.956  109.597 -68.694 1.00   135.05 ? 2224 HOH A O   1 
HETATM 2422 O O   . HOH B 2 .   ? -6.814  112.757 -69.456 1.00   63.49  ? 2225 HOH A O   1 
HETATM 2423 O O   . HOH B 2 .   ? -5.567  113.217 -66.726 1.00   92.54  ? 2226 HOH A O   1 
HETATM 2424 O O   . HOH B 2 .   ? -9.412  112.803 -55.642 1.00   55.86  ? 2227 HOH A O   1 
HETATM 2425 O O   . HOH B 2 .   ? -6.490  117.393 -52.560 1.00   75.91  ? 2228 HOH A O   1 
HETATM 2426 O O   . HOH B 2 .   ? -5.079  115.639 -65.642 1.00   88.33  ? 2229 HOH A O   1 
HETATM 2427 O O   . HOH B 2 .   ? -21.565 114.920 -52.497 1.00   60.47  ? 2230 HOH A O   1 
HETATM 2428 O O   . HOH B 2 .   ? -16.915 120.060 -56.225 1.00   127.37 ? 2231 HOH A O   1 
HETATM 2429 O O   . HOH B 2 .   ? -23.436 115.842 -54.379 1.00   70.41  ? 2232 HOH A O   1 
HETATM 2430 O O   . HOH B 2 .   ? -18.928 109.993 -54.850 1.00   105.38 ? 2233 HOH A O   1 
HETATM 2431 O O   . HOH B 2 .   ? -27.942 120.690 -64.879 1.00   101.16 ? 2234 HOH A O   1 
HETATM 2432 O O   . HOH B 2 .   ? -21.218 122.779 -62.566 1.00   79.00  ? 2235 HOH A O   1 
HETATM 2433 O O   . HOH B 2 .   ? -21.687 124.335 -65.032 1.00   58.83  ? 2236 HOH A O   1 
HETATM 2434 O O   . HOH B 2 .   ? -20.838 121.133 -65.358 1.00   91.67  ? 2237 HOH A O   1 
HETATM 2435 O O   . HOH B 2 .   ? -26.349 123.106 -65.957 1.00   102.48 ? 2238 HOH A O   1 
HETATM 2436 O O   . HOH B 2 .   ? -27.600 120.913 -60.584 1.00   65.56  ? 2239 HOH A O   1 
HETATM 2437 O O   . HOH B 2 .   ? -22.718 126.723 -60.320 1.00   66.32  ? 2240 HOH A O   1 
HETATM 2438 O O   . HOH B 2 .   ? -18.073 123.315 -72.768 1.00   54.72  ? 2241 HOH A O   1 
HETATM 2439 O O   . HOH B 2 .   ? -20.481 122.210 -68.928 1.00   54.41  ? 2242 HOH A O   1 
HETATM 2440 O O   . HOH B 2 .   ? -27.638 116.012 -73.108 1.00   63.89  ? 2243 HOH A O   1 
HETATM 2441 O O   . HOH B 2 .   ? -25.751 118.523 -74.731 1.00   142.15 ? 2244 HOH A O   1 
HETATM 2442 O O   . HOH B 2 .   ? -28.665 117.242 -70.830 1.00   129.31 ? 2245 HOH A O   1 
HETATM 2443 O O   . HOH B 2 .   ? -26.551 122.538 -69.009 1.00   59.67  ? 2246 HOH A O   1 
HETATM 2444 O O   . HOH B 2 .   ? -28.632 119.946 -72.545 1.00   94.38  ? 2247 HOH A O   1 
HETATM 2445 O O   . HOH B 2 .   ? -29.076 122.648 -67.159 1.00   78.74  ? 2248 HOH A O   1 
HETATM 2446 O O   . HOH B 2 .   ? -33.721 116.319 -70.645 1.00   108.55 ? 2249 HOH A O   1 
HETATM 2447 O O   . HOH B 2 .   ? -34.595 120.206 -73.638 1.00   133.84 ? 2250 HOH A O   1 
HETATM 2448 O O   . HOH B 2 .   ? -30.509 119.858 -66.107 1.00   52.25  ? 2251 HOH A O   1 
HETATM 2449 O O   . HOH B 2 .   ? -32.939 119.154 -63.586 1.00   59.61  ? 2252 HOH A O   1 
HETATM 2450 O O   . HOH B 2 .   ? -29.498 118.610 -68.326 1.00   57.84  ? 2253 HOH A O   1 
HETATM 2451 O O   . HOH B 2 .   ? -36.373 116.396 -69.043 1.00   69.44  ? 2254 HOH A O   1 
HETATM 2452 O O   . HOH B 2 .   ? -38.142 119.775 -67.475 1.00   51.42  ? 2255 HOH A O   1 
HETATM 2453 O O   . HOH B 2 .   ? -38.900 116.579 -62.999 1.00   83.00  ? 2256 HOH A O   1 
HETATM 2454 O O   . HOH B 2 .   ? -35.952 119.733 -62.076 1.00   70.39  ? 2257 HOH A O   1 
HETATM 2455 O O   . HOH B 2 .   ? -31.431 112.360 -60.675 1.00   57.66  ? 2258 HOH A O   1 
HETATM 2456 O O   . HOH B 2 .   ? -34.723 117.346 -60.331 1.00   56.30  ? 2259 HOH A O   1 
HETATM 2457 O O   . HOH B 2 .   ? -40.747 115.376 -61.124 1.00   53.25  ? 2260 HOH A O   1 
HETATM 2458 O O   . HOH B 2 .   ? -39.111 114.242 -58.942 1.00   130.44 ? 2261 HOH A O   1 
HETATM 2459 O O   . HOH B 2 .   ? -39.104 106.182 -60.075 1.00   46.91  ? 2262 HOH A O   1 
HETATM 2460 O O   . HOH B 2 .   ? -35.610 107.901 -58.730 1.00   101.29 ? 2263 HOH A O   1 
HETATM 2461 O O   . HOH B 2 .   ? -43.920 108.885 -62.256 1.00   60.32  ? 2264 HOH A O   1 
HETATM 2462 O O   . HOH B 2 .   ? -44.143 109.594 -57.861 1.00   85.71  ? 2265 HOH A O   1 
HETATM 2463 O O   . HOH B 2 .   ? -38.802 102.248 -60.342 1.00   63.84  ? 2266 HOH A O   1 
HETATM 2464 O O   . HOH B 2 .   ? -40.370 113.729 -69.928 1.00   89.68  ? 2267 HOH A O   1 
HETATM 2465 O O   . HOH B 2 .   ? -47.396 111.305 -65.468 1.00   59.10  ? 2268 HOH A O   1 
HETATM 2466 O O   . HOH B 2 .   ? -38.939 112.542 -66.633 1.00   79.92  ? 2269 HOH A O   1 
HETATM 2467 O O   . HOH B 2 .   ? -36.834 111.008 -72.217 1.00   109.78 ? 2270 HOH A O   1 
HETATM 2468 O O   . HOH B 2 .   ? -35.667 110.398 -74.879 1.00   87.44  ? 2271 HOH A O   1 
HETATM 2469 O O   . HOH B 2 .   ? -41.081 105.174 -75.717 1.00   56.73  ? 2272 HOH A O   1 
HETATM 2470 O O   . HOH B 2 .   ? -34.771 103.084 -74.733 1.00   56.65  ? 2273 HOH A O   1 
HETATM 2471 O O   . HOH B 2 .   ? -40.587 99.957  -84.834 1.00   77.40  ? 2274 HOH A O   1 
HETATM 2472 O O   . HOH B 2 .   ? -36.761 81.556  -74.486 1.00   78.60  ? 2275 HOH A O   1 
HETATM 2473 O O   . HOH B 2 .   ? -40.679 92.562  -83.941 1.00   66.80  ? 2276 HOH A O   1 
HETATM 2474 O O   . HOH B 2 .   ? -37.469 89.559  -73.368 1.00   55.78  ? 2277 HOH A O   1 
HETATM 2475 O O   . HOH B 2 .   ? -34.968 81.768  -72.341 1.00   83.58  ? 2278 HOH A O   1 
HETATM 2476 O O   . HOH B 2 .   ? -33.544 79.684  -82.138 1.00   64.10  ? 2279 HOH A O   1 
HETATM 2477 O O   . HOH B 2 .   ? -32.452 88.968  -82.375 1.00   67.95  ? 2280 HOH A O   1 
HETATM 2478 O O   . HOH B 2 .   ? -29.619 87.741  -84.504 1.00   82.66  ? 2281 HOH A O   1 
HETATM 2479 O O   . HOH B 2 .   ? -26.477 88.989  -82.630 1.00   80.21  ? 2282 HOH A O   1 
HETATM 2480 O O   . HOH B 2 .   ? -29.326 84.678  -82.389 1.00   81.03  ? 2283 HOH A O   1 
HETATM 2481 O O   . HOH B 2 .   ? -26.872 80.538  -78.813 1.00   63.28  ? 2284 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   146 146 LYS LYS A . n 
A 1 2   VAL 2   147 147 VAL VAL A . n 
A 1 3   THR 3   148 148 THR THR A . n 
A 1 4   MET 4   149 149 MET MET A . n 
A 1 5   ASN 5   150 150 ASN ASN A . n 
A 1 6   ASP 6   151 151 ASP ASP A . n 
A 1 7   PHE 7   152 152 PHE PHE A . n 
A 1 8   ASP 8   153 153 ASP ASP A . n 
A 1 9   TYR 9   154 154 TYR TYR A . n 
A 1 10  LEU 10  155 155 LEU LEU A . n 
A 1 11  LYS 11  156 156 LYS LYS A . n 
A 1 12  LEU 12  157 157 LEU LEU A . n 
A 1 13  LEU 13  158 158 LEU LEU A . n 
A 1 14  GLY 14  159 159 GLY GLY A . n 
A 1 15  LYS 15  160 160 LYS LYS A . n 
A 1 16  GLY 16  161 161 GLY GLY A . n 
A 1 17  THR 17  162 162 THR THR A . n 
A 1 18  PHE 18  163 163 PHE PHE A . n 
A 1 19  GLY 19  164 164 GLY GLY A . n 
A 1 20  LYS 20  165 165 LYS LYS A . n 
A 1 21  VAL 21  166 166 VAL VAL A . n 
A 1 22  ILE 22  167 167 ILE ILE A . n 
A 1 23  LEU 23  168 168 LEU LEU A . n 
A 1 24  VAL 24  169 169 VAL VAL A . n 
A 1 25  ARG 25  170 170 ARG ARG A . n 
A 1 26  GLU 26  171 171 GLU GLU A . n 
A 1 27  LYS 27  172 172 LYS LYS A . n 
A 1 28  ALA 28  173 173 ALA ALA A . n 
A 1 29  THR 29  174 174 THR THR A . n 
A 1 30  GLY 30  175 175 GLY GLY A . n 
A 1 31  ARG 31  176 176 ARG ARG A . n 
A 1 32  TYR 32  177 177 TYR TYR A . n 
A 1 33  TYR 33  178 178 TYR TYR A . n 
A 1 34  ALA 34  179 179 ALA ALA A . n 
A 1 35  MET 35  180 180 MET MET A . n 
A 1 36  LYS 36  181 181 LYS LYS A . n 
A 1 37  ILE 37  182 182 ILE ILE A . n 
A 1 38  LEU 38  183 183 LEU LEU A . n 
A 1 39  ARG 39  184 184 ARG ARG A . n 
A 1 40  LYS 40  185 185 LYS LYS A . n 
A 1 41  GLU 41  186 186 GLU GLU A . n 
A 1 42  VAL 42  187 187 VAL VAL A . n 
A 1 43  ILE 43  188 188 ILE ILE A . n 
A 1 44  ILE 44  189 ?   ?   ?   A . n 
A 1 45  ALA 45  190 ?   ?   ?   A . n 
A 1 46  LYS 46  191 ?   ?   ?   A . n 
A 1 47  ASP 47  192 ?   ?   ?   A . n 
A 1 48  GLU 48  193 ?   ?   ?   A . n 
A 1 49  VAL 49  194 ?   ?   ?   A . n 
A 1 50  ALA 50  195 ?   ?   ?   A . n 
A 1 51  HIS 51  196 ?   ?   ?   A . n 
A 1 52  THR 52  197 ?   ?   ?   A . n 
A 1 53  VAL 53  198 198 VAL VAL A . n 
A 1 54  THR 54  199 199 THR THR A . n 
A 1 55  GLU 55  200 200 GLU GLU A . n 
A 1 56  SER 56  201 201 SER SER A . n 
A 1 57  ARG 57  202 202 ARG ARG A . n 
A 1 58  VAL 58  203 203 VAL VAL A . n 
A 1 59  LEU 59  204 204 LEU LEU A . n 
A 1 60  GLN 60  205 205 GLN GLN A . n 
A 1 61  ASN 61  206 206 ASN ASN A . n 
A 1 62  THR 62  207 207 THR THR A . n 
A 1 63  ARG 63  208 208 ARG ARG A . n 
A 1 64  HIS 64  209 209 HIS HIS A . n 
A 1 65  PRO 65  210 210 PRO PRO A . n 
A 1 66  PHE 66  211 211 PHE PHE A . n 
A 1 67  LEU 67  212 212 LEU LEU A . n 
A 1 68  THR 68  213 213 THR THR A . n 
A 1 69  ALA 69  214 214 ALA ALA A . n 
A 1 70  LEU 70  215 215 LEU LEU A . n 
A 1 71  LYS 71  216 216 LYS LYS A . n 
A 1 72  TYR 72  217 217 TYR TYR A . n 
A 1 73  ALA 73  218 218 ALA ALA A . n 
A 1 74  PHE 74  219 219 PHE PHE A . n 
A 1 75  GLN 75  220 220 GLN GLN A . n 
A 1 76  THR 76  221 221 THR THR A . n 
A 1 77  HIS 77  222 222 HIS HIS A . n 
A 1 78  ASP 78  223 223 ASP ASP A . n 
A 1 79  ARG 79  224 224 ARG ARG A . n 
A 1 80  LEU 80  225 225 LEU LEU A . n 
A 1 81  CYS 81  226 226 CYS CYS A . n 
A 1 82  PHE 82  227 227 PHE PHE A . n 
A 1 83  VAL 83  228 228 VAL VAL A . n 
A 1 84  MET 84  229 229 MET MET A . n 
A 1 85  GLU 85  230 230 GLU GLU A . n 
A 1 86  TYR 86  231 231 TYR TYR A . n 
A 1 87  ALA 87  232 232 ALA ALA A . n 
A 1 88  ASN 88  233 233 ASN ASN A . n 
A 1 89  GLY 89  234 234 GLY GLY A . n 
A 1 90  GLY 90  235 235 GLY GLY A . n 
A 1 91  GLU 91  236 236 GLU GLU A . n 
A 1 92  LEU 92  237 237 LEU LEU A . n 
A 1 93  PHE 93  238 238 PHE PHE A . n 
A 1 94  PHE 94  239 239 PHE PHE A . n 
A 1 95  HIS 95  240 240 HIS HIS A . n 
A 1 96  LEU 96  241 241 LEU LEU A . n 
A 1 97  SER 97  242 242 SER SER A . n 
A 1 98  ARG 98  243 243 ARG ARG A . n 
A 1 99  GLU 99  244 244 GLU GLU A . n 
A 1 100 ARG 100 245 245 ARG ARG A . n 
A 1 101 VAL 101 246 246 VAL VAL A . n 
A 1 102 PHE 102 247 247 PHE PHE A . n 
A 1 103 THR 103 248 248 THR THR A . n 
A 1 104 GLU 104 249 249 GLU GLU A . n 
A 1 105 GLU 105 250 250 GLU GLU A . n 
A 1 106 ARG 106 251 251 ARG ARG A . n 
A 1 107 ALA 107 252 252 ALA ALA A . n 
A 1 108 ARG 108 253 253 ARG ARG A . n 
A 1 109 PHE 109 254 254 PHE PHE A . n 
A 1 110 TYR 110 255 255 TYR TYR A . n 
A 1 111 GLY 111 256 256 GLY GLY A . n 
A 1 112 ALA 112 257 257 ALA ALA A . n 
A 1 113 GLU 113 258 258 GLU GLU A . n 
A 1 114 ILE 114 259 259 ILE ILE A . n 
A 1 115 VAL 115 260 260 VAL VAL A . n 
A 1 116 SER 116 261 261 SER SER A . n 
A 1 117 ALA 117 262 262 ALA ALA A . n 
A 1 118 LEU 118 263 263 LEU LEU A . n 
A 1 119 GLU 119 264 264 GLU GLU A . n 
A 1 120 TYR 120 265 265 TYR TYR A . n 
A 1 121 LEU 121 266 266 LEU LEU A . n 
A 1 122 HIS 122 267 267 HIS HIS A . n 
A 1 123 SER 123 268 268 SER SER A . n 
A 1 124 ARG 124 269 269 ARG ARG A . n 
A 1 125 ASP 125 270 270 ASP ASP A . n 
A 1 126 VAL 126 271 271 VAL VAL A . n 
A 1 127 VAL 127 272 272 VAL VAL A . n 
A 1 128 TYR 128 273 273 TYR TYR A . n 
A 1 129 ARG 129 274 274 ARG ARG A . n 
A 1 130 ASP 130 275 275 ASP ASP A . n 
A 1 131 ILE 131 276 276 ILE ILE A . n 
A 1 132 LYS 132 277 277 LYS LYS A . n 
A 1 133 LEU 133 278 278 LEU LEU A . n 
A 1 134 GLU 134 279 279 GLU GLU A . n 
A 1 135 ASN 135 280 280 ASN ASN A . n 
A 1 136 LEU 136 281 281 LEU LEU A . n 
A 1 137 MET 137 282 282 MET MET A . n 
A 1 138 LEU 138 283 283 LEU LEU A . n 
A 1 139 ASP 139 284 284 ASP ASP A . n 
A 1 140 LYS 140 285 285 LYS LYS A . n 
A 1 141 ASP 141 286 286 ASP ASP A . n 
A 1 142 GLY 142 287 287 GLY GLY A . n 
A 1 143 HIS 143 288 288 HIS HIS A . n 
A 1 144 ILE 144 289 289 ILE ILE A . n 
A 1 145 LYS 145 290 290 LYS LYS A . n 
A 1 146 ILE 146 291 291 ILE ILE A . n 
A 1 147 THR 147 292 292 THR THR A . n 
A 1 148 ASP 148 293 293 ASP ASP A . n 
A 1 149 PHE 149 294 294 PHE PHE A . n 
A 1 150 GLY 150 295 295 GLY GLY A . n 
A 1 151 LEU 151 296 296 LEU LEU A . n 
A 1 152 CYS 152 297 ?   ?   ?   A . n 
A 1 153 LYS 153 298 ?   ?   ?   A . n 
A 1 154 GLU 154 299 ?   ?   ?   A . n 
A 1 155 GLY 155 300 ?   ?   ?   A . n 
A 1 156 ILE 156 301 ?   ?   ?   A . n 
A 1 157 SER 157 302 ?   ?   ?   A . n 
A 1 158 ASP 158 303 ?   ?   ?   A . n 
A 1 159 GLY 159 304 ?   ?   ?   A . n 
A 1 160 ALA 160 305 ?   ?   ?   A . n 
A 1 161 THR 161 306 ?   ?   ?   A . n 
A 1 162 MET 162 307 ?   ?   ?   A . n 
A 1 163 LYS 163 308 ?   ?   ?   A . n 
A 1 164 THR 164 309 ?   ?   ?   A . n 
A 1 165 PHE 165 310 ?   ?   ?   A . n 
A 1 166 CYS 166 311 ?   ?   ?   A . n 
A 1 167 GLY 167 312 ?   ?   ?   A . n 
A 1 168 THR 168 313 313 THR THR A . n 
A 1 169 PRO 169 314 314 PRO PRO A . n 
A 1 170 GLU 170 315 315 GLU GLU A . n 
A 1 171 TYR 171 316 316 TYR TYR A . n 
A 1 172 LEU 172 317 317 LEU LEU A . n 
A 1 173 ALA 173 318 318 ALA ALA A . n 
A 1 174 PRO 174 319 319 PRO PRO A . n 
A 1 175 GLU 175 320 320 GLU GLU A . n 
A 1 176 VAL 176 321 321 VAL VAL A . n 
A 1 177 LEU 177 322 322 LEU LEU A . n 
A 1 178 GLU 178 323 323 GLU GLU A . n 
A 1 179 ASP 179 324 324 ASP ASP A . n 
A 1 180 ASN 180 325 325 ASN ASN A . n 
A 1 181 ASP 181 326 326 ASP ASP A . n 
A 1 182 TYR 182 327 327 TYR TYR A . n 
A 1 183 GLY 183 328 328 GLY GLY A . n 
A 1 184 ARG 184 329 329 ARG ARG A . n 
A 1 185 ALA 185 330 330 ALA ALA A . n 
A 1 186 VAL 186 331 331 VAL VAL A . n 
A 1 187 ASP 187 332 332 ASP ASP A . n 
A 1 188 TRP 188 333 333 TRP TRP A . n 
A 1 189 TRP 189 334 334 TRP TRP A . n 
A 1 190 GLY 190 335 335 GLY GLY A . n 
A 1 191 LEU 191 336 336 LEU LEU A . n 
A 1 192 GLY 192 337 337 GLY GLY A . n 
A 1 193 VAL 193 338 338 VAL VAL A . n 
A 1 194 VAL 194 339 339 VAL VAL A . n 
A 1 195 MET 195 340 340 MET MET A . n 
A 1 196 TYR 196 341 341 TYR TYR A . n 
A 1 197 GLU 197 342 342 GLU GLU A . n 
A 1 198 MET 198 343 343 MET MET A . n 
A 1 199 MET 199 344 344 MET MET A . n 
A 1 200 CYS 200 345 345 CYS CYS A . n 
A 1 201 GLY 201 346 346 GLY GLY A . n 
A 1 202 ARG 202 347 347 ARG ARG A . n 
A 1 203 LEU 203 348 348 LEU LEU A . n 
A 1 204 PRO 204 349 349 PRO PRO A . n 
A 1 205 PHE 205 350 350 PHE PHE A . n 
A 1 206 TYR 206 351 351 TYR TYR A . n 
A 1 207 ASN 207 352 352 ASN ASN A . n 
A 1 208 GLN 208 353 353 GLN GLN A . n 
A 1 209 ASP 209 354 354 ASP ASP A . n 
A 1 210 HIS 210 355 355 HIS HIS A . n 
A 1 211 GLU 211 356 356 GLU GLU A . n 
A 1 212 ARG 212 357 357 ARG ARG A . n 
A 1 213 LEU 213 358 358 LEU LEU A . n 
A 1 214 PHE 214 359 359 PHE PHE A . n 
A 1 215 GLU 215 360 360 GLU GLU A . n 
A 1 216 LEU 216 361 361 LEU LEU A . n 
A 1 217 ILE 217 362 362 ILE ILE A . n 
A 1 218 LEU 218 363 363 LEU LEU A . n 
A 1 219 MET 219 364 364 MET MET A . n 
A 1 220 GLU 220 365 365 GLU GLU A . n 
A 1 221 GLU 221 366 366 GLU GLU A . n 
A 1 222 ILE 222 367 367 ILE ILE A . n 
A 1 223 ARG 223 368 368 ARG ARG A . n 
A 1 224 PHE 224 369 369 PHE PHE A . n 
A 1 225 PRO 225 370 370 PRO PRO A . n 
A 1 226 ARG 226 371 371 ARG ARG A . n 
A 1 227 THR 227 372 372 THR THR A . n 
A 1 228 LEU 228 373 373 LEU LEU A . n 
A 1 229 SER 229 374 374 SER SER A . n 
A 1 230 PRO 230 375 375 PRO PRO A . n 
A 1 231 GLU 231 376 376 GLU GLU A . n 
A 1 232 ALA 232 377 377 ALA ALA A . n 
A 1 233 LYS 233 378 378 LYS LYS A . n 
A 1 234 SER 234 379 379 SER SER A . n 
A 1 235 LEU 235 380 380 LEU LEU A . n 
A 1 236 LEU 236 381 381 LEU LEU A . n 
A 1 237 ALA 237 382 382 ALA ALA A . n 
A 1 238 GLY 238 383 383 GLY GLY A . n 
A 1 239 LEU 239 384 384 LEU LEU A . n 
A 1 240 LEU 240 385 385 LEU LEU A . n 
A 1 241 LYS 241 386 386 LYS LYS A . n 
A 1 242 LYS 242 387 387 LYS LYS A . n 
A 1 243 ASP 243 388 388 ASP ASP A . n 
A 1 244 PRO 244 389 389 PRO PRO A . n 
A 1 245 LYS 245 390 390 LYS LYS A . n 
A 1 246 GLN 246 391 391 GLN GLN A . n 
A 1 247 ARG 247 392 392 ARG ARG A . n 
A 1 248 LEU 248 393 393 LEU LEU A . n 
A 1 249 GLY 249 394 394 GLY GLY A . n 
A 1 250 GLY 250 395 395 GLY GLY A . n 
A 1 251 GLY 251 396 396 GLY GLY A . n 
A 1 252 PRO 252 397 397 PRO PRO A . n 
A 1 253 SER 253 398 398 SER SER A . n 
A 1 254 ASP 254 399 399 ASP ASP A . n 
A 1 255 ALA 255 400 400 ALA ALA A . n 
A 1 256 LYS 256 401 401 LYS LYS A . n 
A 1 257 GLU 257 402 402 GLU GLU A . n 
A 1 258 VAL 258 403 403 VAL VAL A . n 
A 1 259 MET 259 404 404 MET MET A . n 
A 1 260 GLU 260 405 405 GLU GLU A . n 
A 1 261 HIS 261 406 406 HIS HIS A . n 
A 1 262 ARG 262 407 407 ARG ARG A . n 
A 1 263 PHE 263 408 408 PHE PHE A . n 
A 1 264 PHE 264 409 409 PHE PHE A . n 
A 1 265 LEU 265 410 410 LEU LEU A . n 
A 1 266 SER 266 411 411 SER SER A . n 
A 1 267 ILE 267 412 412 ILE ILE A . n 
A 1 268 ASN 268 413 413 ASN ASN A . n 
A 1 269 TRP 269 414 414 TRP TRP A . n 
A 1 270 GLN 270 415 415 GLN GLN A . n 
A 1 271 ASP 271 416 416 ASP ASP A . n 
A 1 272 VAL 272 417 417 VAL VAL A . n 
A 1 273 VAL 273 418 418 VAL VAL A . n 
A 1 274 GLN 274 419 419 GLN GLN A . n 
A 1 275 LYS 275 420 420 LYS LYS A . n 
A 1 276 LYS 276 421 421 LYS LYS A . n 
A 1 277 LEU 277 422 422 LEU LEU A . n 
A 1 278 LEU 278 423 423 LEU LEU A . n 
A 1 279 PRO 279 424 424 PRO PRO A . n 
A 1 280 PRO 280 425 425 PRO PRO A . n 
A 1 281 PHE 281 426 426 PHE PHE A . n 
A 1 282 LYS 282 427 427 LYS LYS A . n 
A 1 283 PRO 283 428 428 PRO PRO A . n 
A 1 284 GLN 284 429 429 GLN GLN A . n 
A 1 285 VAL 285 430 430 VAL VAL A . n 
A 1 286 THR 286 431 431 THR THR A . n 
A 1 287 SER 287 432 432 SER SER A . n 
A 1 288 GLU 288 433 433 GLU GLU A . n 
A 1 289 VAL 289 434 434 VAL VAL A . n 
A 1 290 ASP 290 435 435 ASP ASP A . n 
A 1 291 THR 291 436 436 THR THR A . n 
A 1 292 ARG 292 437 437 ARG ARG A . n 
A 1 293 TYR 293 438 438 TYR TYR A . n 
A 1 294 PHE 294 439 439 PHE PHE A . n 
A 1 295 ASP 295 440 440 ASP ASP A . n 
A 1 296 ASP 296 441 441 ASP ASP A . n 
A 1 297 GLU 297 442 ?   ?   ?   A . n 
A 1 298 PHE 298 443 ?   ?   ?   A . n 
A 1 299 THR 299 444 ?   ?   ?   A . n 
A 1 300 ALA 300 445 ?   ?   ?   A . n 
A 1 301 GLN 301 446 ?   ?   ?   A . n 
A 1 302 SER 302 447 ?   ?   ?   A . n 
A 1 303 ILE 303 448 ?   ?   ?   A . n 
A 1 304 THR 304 449 ?   ?   ?   A . n 
A 1 305 ILE 305 450 ?   ?   ?   A . n 
A 1 306 THR 306 451 ?   ?   ?   A . n 
A 1 307 PRO 307 452 ?   ?   ?   A . n 
A 1 308 PRO 308 453 ?   ?   ?   A . n 
A 1 309 ASP 309 454 ?   ?   ?   A . n 
A 1 310 ARG 310 455 ?   ?   ?   A . n 
A 1 311 TYR 311 456 ?   ?   ?   A . n 
A 1 312 ASP 312 457 ?   ?   ?   A . n 
A 1 313 SER 313 458 ?   ?   ?   A . n 
A 1 314 LEU 314 459 ?   ?   ?   A . n 
A 1 315 GLY 315 460 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   2001 2001 HOH HOH A . 
B 2 HOH 2   2002 2002 HOH HOH A . 
B 2 HOH 3   2003 2003 HOH HOH A . 
B 2 HOH 4   2004 2004 HOH HOH A . 
B 2 HOH 5   2005 2005 HOH HOH A . 
B 2 HOH 6   2006 2006 HOH HOH A . 
B 2 HOH 7   2007 2007 HOH HOH A . 
B 2 HOH 8   2008 2008 HOH HOH A . 
B 2 HOH 9   2009 2009 HOH HOH A . 
B 2 HOH 10  2010 2010 HOH HOH A . 
B 2 HOH 11  2011 2011 HOH HOH A . 
B 2 HOH 12  2012 2012 HOH HOH A . 
B 2 HOH 13  2013 2013 HOH HOH A . 
B 2 HOH 14  2014 2014 HOH HOH A . 
B 2 HOH 15  2015 2015 HOH HOH A . 
B 2 HOH 16  2016 2016 HOH HOH A . 
B 2 HOH 17  2017 2017 HOH HOH A . 
B 2 HOH 18  2018 2018 HOH HOH A . 
B 2 HOH 19  2019 2019 HOH HOH A . 
B 2 HOH 20  2020 2020 HOH HOH A . 
B 2 HOH 21  2021 2021 HOH HOH A . 
B 2 HOH 22  2022 2022 HOH HOH A . 
B 2 HOH 23  2023 2023 HOH HOH A . 
B 2 HOH 24  2024 2024 HOH HOH A . 
B 2 HOH 25  2025 2025 HOH HOH A . 
B 2 HOH 26  2026 2026 HOH HOH A . 
B 2 HOH 27  2027 2027 HOH HOH A . 
B 2 HOH 28  2028 2028 HOH HOH A . 
B 2 HOH 29  2029 2029 HOH HOH A . 
B 2 HOH 30  2030 2030 HOH HOH A . 
B 2 HOH 31  2031 2031 HOH HOH A . 
B 2 HOH 32  2032 2032 HOH HOH A . 
B 2 HOH 33  2033 2033 HOH HOH A . 
B 2 HOH 34  2034 2034 HOH HOH A . 
B 2 HOH 35  2035 2035 HOH HOH A . 
B 2 HOH 36  2036 2036 HOH HOH A . 
B 2 HOH 37  2037 2037 HOH HOH A . 
B 2 HOH 38  2038 2038 HOH HOH A . 
B 2 HOH 39  2039 2039 HOH HOH A . 
B 2 HOH 40  2040 2040 HOH HOH A . 
B 2 HOH 41  2041 2041 HOH HOH A . 
B 2 HOH 42  2042 2042 HOH HOH A . 
B 2 HOH 43  2043 2043 HOH HOH A . 
B 2 HOH 44  2044 2044 HOH HOH A . 
B 2 HOH 45  2045 2045 HOH HOH A . 
B 2 HOH 46  2046 2046 HOH HOH A . 
B 2 HOH 47  2047 2047 HOH HOH A . 
B 2 HOH 48  2048 2048 HOH HOH A . 
B 2 HOH 49  2049 2049 HOH HOH A . 
B 2 HOH 50  2050 2050 HOH HOH A . 
B 2 HOH 51  2051 2051 HOH HOH A . 
B 2 HOH 52  2052 2052 HOH HOH A . 
B 2 HOH 53  2053 2053 HOH HOH A . 
B 2 HOH 54  2054 2054 HOH HOH A . 
B 2 HOH 55  2055 2055 HOH HOH A . 
B 2 HOH 56  2056 2056 HOH HOH A . 
B 2 HOH 57  2057 2057 HOH HOH A . 
B 2 HOH 58  2058 2058 HOH HOH A . 
B 2 HOH 59  2059 2059 HOH HOH A . 
B 2 HOH 60  2060 2060 HOH HOH A . 
B 2 HOH 61  2061 2061 HOH HOH A . 
B 2 HOH 62  2062 2062 HOH HOH A . 
B 2 HOH 63  2063 2063 HOH HOH A . 
B 2 HOH 64  2064 2064 HOH HOH A . 
B 2 HOH 65  2065 2065 HOH HOH A . 
B 2 HOH 66  2066 2066 HOH HOH A . 
B 2 HOH 67  2067 2067 HOH HOH A . 
B 2 HOH 68  2068 2068 HOH HOH A . 
B 2 HOH 69  2069 2069 HOH HOH A . 
B 2 HOH 70  2070 2070 HOH HOH A . 
B 2 HOH 71  2071 2071 HOH HOH A . 
B 2 HOH 72  2072 2072 HOH HOH A . 
B 2 HOH 73  2073 2073 HOH HOH A . 
B 2 HOH 74  2074 2074 HOH HOH A . 
B 2 HOH 75  2075 2075 HOH HOH A . 
B 2 HOH 76  2076 2076 HOH HOH A . 
B 2 HOH 77  2077 2077 HOH HOH A . 
B 2 HOH 78  2078 2078 HOH HOH A . 
B 2 HOH 79  2079 2079 HOH HOH A . 
B 2 HOH 80  2080 2080 HOH HOH A . 
B 2 HOH 81  2081 2081 HOH HOH A . 
B 2 HOH 82  2082 2082 HOH HOH A . 
B 2 HOH 83  2083 2083 HOH HOH A . 
B 2 HOH 84  2084 2084 HOH HOH A . 
B 2 HOH 85  2085 2085 HOH HOH A . 
B 2 HOH 86  2086 2086 HOH HOH A . 
B 2 HOH 87  2087 2087 HOH HOH A . 
B 2 HOH 88  2088 2088 HOH HOH A . 
B 2 HOH 89  2089 2089 HOH HOH A . 
B 2 HOH 90  2090 2090 HOH HOH A . 
B 2 HOH 91  2091 2091 HOH HOH A . 
B 2 HOH 92  2092 2092 HOH HOH A . 
B 2 HOH 93  2093 2093 HOH HOH A . 
B 2 HOH 94  2094 2094 HOH HOH A . 
B 2 HOH 95  2095 2095 HOH HOH A . 
B 2 HOH 96  2096 2096 HOH HOH A . 
B 2 HOH 97  2097 2097 HOH HOH A . 
B 2 HOH 98  2098 2098 HOH HOH A . 
B 2 HOH 99  2099 2099 HOH HOH A . 
B 2 HOH 100 2100 2100 HOH HOH A . 
B 2 HOH 101 2101 2101 HOH HOH A . 
B 2 HOH 102 2102 2102 HOH HOH A . 
B 2 HOH 103 2103 2103 HOH HOH A . 
B 2 HOH 104 2104 2104 HOH HOH A . 
B 2 HOH 105 2105 2105 HOH HOH A . 
B 2 HOH 106 2106 2106 HOH HOH A . 
B 2 HOH 107 2107 2107 HOH HOH A . 
B 2 HOH 108 2108 2108 HOH HOH A . 
B 2 HOH 109 2109 2109 HOH HOH A . 
B 2 HOH 110 2110 2110 HOH HOH A . 
B 2 HOH 111 2111 2111 HOH HOH A . 
B 2 HOH 112 2112 2112 HOH HOH A . 
B 2 HOH 113 2113 2113 HOH HOH A . 
B 2 HOH 114 2114 2114 HOH HOH A . 
B 2 HOH 115 2115 2115 HOH HOH A . 
B 2 HOH 116 2116 2116 HOH HOH A . 
B 2 HOH 117 2117 2117 HOH HOH A . 
B 2 HOH 118 2118 2118 HOH HOH A . 
B 2 HOH 119 2119 2119 HOH HOH A . 
B 2 HOH 120 2120 2120 HOH HOH A . 
B 2 HOH 121 2121 2121 HOH HOH A . 
B 2 HOH 122 2122 2122 HOH HOH A . 
B 2 HOH 123 2123 2123 HOH HOH A . 
B 2 HOH 124 2124 2124 HOH HOH A . 
B 2 HOH 125 2125 2125 HOH HOH A . 
B 2 HOH 126 2126 2126 HOH HOH A . 
B 2 HOH 127 2127 2127 HOH HOH A . 
B 2 HOH 128 2128 2128 HOH HOH A . 
B 2 HOH 129 2129 2129 HOH HOH A . 
B 2 HOH 130 2130 2130 HOH HOH A . 
B 2 HOH 131 2131 2131 HOH HOH A . 
B 2 HOH 132 2132 2132 HOH HOH A . 
B 2 HOH 133 2133 2133 HOH HOH A . 
B 2 HOH 134 2134 2134 HOH HOH A . 
B 2 HOH 135 2135 2135 HOH HOH A . 
B 2 HOH 136 2136 2136 HOH HOH A . 
B 2 HOH 137 2137 2137 HOH HOH A . 
B 2 HOH 138 2138 2138 HOH HOH A . 
B 2 HOH 139 2139 2139 HOH HOH A . 
B 2 HOH 140 2140 2140 HOH HOH A . 
B 2 HOH 141 2141 2141 HOH HOH A . 
B 2 HOH 142 2142 2142 HOH HOH A . 
B 2 HOH 143 2143 2143 HOH HOH A . 
B 2 HOH 144 2144 2144 HOH HOH A . 
B 2 HOH 145 2145 2145 HOH HOH A . 
B 2 HOH 146 2146 2146 HOH HOH A . 
B 2 HOH 147 2147 2147 HOH HOH A . 
B 2 HOH 148 2148 2148 HOH HOH A . 
B 2 HOH 149 2149 2149 HOH HOH A . 
B 2 HOH 150 2150 2150 HOH HOH A . 
B 2 HOH 151 2151 2151 HOH HOH A . 
B 2 HOH 152 2152 2152 HOH HOH A . 
B 2 HOH 153 2153 2153 HOH HOH A . 
B 2 HOH 154 2154 2154 HOH HOH A . 
B 2 HOH 155 2155 2155 HOH HOH A . 
B 2 HOH 156 2156 2156 HOH HOH A . 
B 2 HOH 157 2157 2157 HOH HOH A . 
B 2 HOH 158 2158 2158 HOH HOH A . 
B 2 HOH 159 2159 2159 HOH HOH A . 
B 2 HOH 160 2160 2160 HOH HOH A . 
B 2 HOH 161 2161 2161 HOH HOH A . 
B 2 HOH 162 2162 2162 HOH HOH A . 
B 2 HOH 163 2163 2163 HOH HOH A . 
B 2 HOH 164 2164 2164 HOH HOH A . 
B 2 HOH 165 2165 2165 HOH HOH A . 
B 2 HOH 166 2166 2166 HOH HOH A . 
B 2 HOH 167 2167 2167 HOH HOH A . 
B 2 HOH 168 2168 2168 HOH HOH A . 
B 2 HOH 169 2169 2169 HOH HOH A . 
B 2 HOH 170 2170 2170 HOH HOH A . 
B 2 HOH 171 2171 2171 HOH HOH A . 
B 2 HOH 172 2172 2172 HOH HOH A . 
B 2 HOH 173 2173 2173 HOH HOH A . 
B 2 HOH 174 2174 2174 HOH HOH A . 
B 2 HOH 175 2175 2175 HOH HOH A . 
B 2 HOH 176 2176 2176 HOH HOH A . 
B 2 HOH 177 2177 2177 HOH HOH A . 
B 2 HOH 178 2178 2178 HOH HOH A . 
B 2 HOH 179 2179 2179 HOH HOH A . 
B 2 HOH 180 2180 2180 HOH HOH A . 
B 2 HOH 181 2181 2181 HOH HOH A . 
B 2 HOH 182 2182 2182 HOH HOH A . 
B 2 HOH 183 2183 2183 HOH HOH A . 
B 2 HOH 184 2184 2184 HOH HOH A . 
B 2 HOH 185 2185 2185 HOH HOH A . 
B 2 HOH 186 2186 2186 HOH HOH A . 
B 2 HOH 187 2187 2187 HOH HOH A . 
B 2 HOH 188 2188 2188 HOH HOH A . 
B 2 HOH 189 2189 2189 HOH HOH A . 
B 2 HOH 190 2190 2190 HOH HOH A . 
B 2 HOH 191 2191 2191 HOH HOH A . 
B 2 HOH 192 2192 2192 HOH HOH A . 
B 2 HOH 193 2193 2193 HOH HOH A . 
B 2 HOH 194 2194 2194 HOH HOH A . 
B 2 HOH 195 2195 2195 HOH HOH A . 
B 2 HOH 196 2196 2196 HOH HOH A . 
B 2 HOH 197 2197 2197 HOH HOH A . 
B 2 HOH 198 2198 2198 HOH HOH A . 
B 2 HOH 199 2199 2199 HOH HOH A . 
B 2 HOH 200 2200 2200 HOH HOH A . 
B 2 HOH 201 2201 2201 HOH HOH A . 
B 2 HOH 202 2202 2202 HOH HOH A . 
B 2 HOH 203 2203 2203 HOH HOH A . 
B 2 HOH 204 2204 2204 HOH HOH A . 
B 2 HOH 205 2205 2205 HOH HOH A . 
B 2 HOH 206 2206 2206 HOH HOH A . 
B 2 HOH 207 2207 2207 HOH HOH A . 
B 2 HOH 208 2208 2208 HOH HOH A . 
B 2 HOH 209 2209 2209 HOH HOH A . 
B 2 HOH 210 2210 2210 HOH HOH A . 
B 2 HOH 211 2211 2211 HOH HOH A . 
B 2 HOH 212 2212 2212 HOH HOH A . 
B 2 HOH 213 2213 2213 HOH HOH A . 
B 2 HOH 214 2214 2214 HOH HOH A . 
B 2 HOH 215 2215 2215 HOH HOH A . 
B 2 HOH 216 2216 2216 HOH HOH A . 
B 2 HOH 217 2217 2217 HOH HOH A . 
B 2 HOH 218 2218 2218 HOH HOH A . 
B 2 HOH 219 2219 2219 HOH HOH A . 
B 2 HOH 220 2220 2220 HOH HOH A . 
B 2 HOH 221 2221 2221 HOH HOH A . 
B 2 HOH 222 2222 2222 HOH HOH A . 
B 2 HOH 223 2223 2223 HOH HOH A . 
B 2 HOH 224 2224 2224 HOH HOH A . 
B 2 HOH 225 2225 2225 HOH HOH A . 
B 2 HOH 226 2226 2226 HOH HOH A . 
B 2 HOH 227 2227 2227 HOH HOH A . 
B 2 HOH 228 2228 2228 HOH HOH A . 
B 2 HOH 229 2229 2229 HOH HOH A . 
B 2 HOH 230 2230 2230 HOH HOH A . 
B 2 HOH 231 2231 2231 HOH HOH A . 
B 2 HOH 232 2232 2232 HOH HOH A . 
B 2 HOH 233 2233 2233 HOH HOH A . 
B 2 HOH 234 2234 2234 HOH HOH A . 
B 2 HOH 235 2235 2235 HOH HOH A . 
B 2 HOH 236 2236 2236 HOH HOH A . 
B 2 HOH 237 2237 2237 HOH HOH A . 
B 2 HOH 238 2238 2238 HOH HOH A . 
B 2 HOH 239 2239 2239 HOH HOH A . 
B 2 HOH 240 2240 2240 HOH HOH A . 
B 2 HOH 241 2241 2241 HOH HOH A . 
B 2 HOH 242 2242 2242 HOH HOH A . 
B 2 HOH 243 2243 2243 HOH HOH A . 
B 2 HOH 244 2244 2244 HOH HOH A . 
B 2 HOH 245 2245 2245 HOH HOH A . 
B 2 HOH 246 2246 2246 HOH HOH A . 
B 2 HOH 247 2247 2247 HOH HOH A . 
B 2 HOH 248 2248 2248 HOH HOH A . 
B 2 HOH 249 2249 2249 HOH HOH A . 
B 2 HOH 250 2250 2250 HOH HOH A . 
B 2 HOH 251 2251 2251 HOH HOH A . 
B 2 HOH 252 2252 2252 HOH HOH A . 
B 2 HOH 253 2253 2253 HOH HOH A . 
B 2 HOH 254 2254 2254 HOH HOH A . 
B 2 HOH 255 2255 2255 HOH HOH A . 
B 2 HOH 256 2256 2256 HOH HOH A . 
B 2 HOH 257 2257 2257 HOH HOH A . 
B 2 HOH 258 2258 2258 HOH HOH A . 
B 2 HOH 259 2259 2259 HOH HOH A . 
B 2 HOH 260 2260 2260 HOH HOH A . 
B 2 HOH 261 2261 2261 HOH HOH A . 
B 2 HOH 262 2262 2262 HOH HOH A . 
B 2 HOH 263 2263 2263 HOH HOH A . 
B 2 HOH 264 2264 2264 HOH HOH A . 
B 2 HOH 265 2265 2265 HOH HOH A . 
B 2 HOH 266 2266 2266 HOH HOH A . 
B 2 HOH 267 2267 2267 HOH HOH A . 
B 2 HOH 268 2268 2268 HOH HOH A . 
B 2 HOH 269 2269 2269 HOH HOH A . 
B 2 HOH 270 2270 2270 HOH HOH A . 
B 2 HOH 271 2271 2271 HOH HOH A . 
B 2 HOH 272 2272 2272 HOH HOH A . 
B 2 HOH 273 2273 2273 HOH HOH A . 
B 2 HOH 274 2274 2274 HOH HOH A . 
B 2 HOH 275 2275 2275 HOH HOH A . 
B 2 HOH 276 2276 2276 HOH HOH A . 
B 2 HOH 277 2277 2277 HOH HOH A . 
B 2 HOH 278 2278 2278 HOH HOH A . 
B 2 HOH 279 2279 2279 HOH HOH A . 
B 2 HOH 280 2280 2280 HOH HOH A . 
B 2 HOH 281 2281 2281 HOH HOH A . 
B 2 HOH 282 2282 2282 HOH HOH A . 
B 2 HOH 283 2283 2283 HOH HOH A . 
B 2 HOH 284 2284 2284 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-05-22 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 199 ? ? -54.28  -4.82   
2  1 ARG A 202 ? ? 56.82   -57.55  
3  1 THR A 207 ? ? -58.42  108.62  
4  1 GLU A 244 ? ? -149.68 -8.43   
5  1 ARG A 245 ? ? 69.86   -44.89  
6  1 ARG A 274 ? ? 63.45   -21.27  
7  1 PHE A 294 ? ? 159.26  151.54  
8  1 GLN A 353 ? ? -43.37  105.74  
9  1 ASP A 354 ? ? 12.68   -118.29 
10 1 HIS A 355 ? ? -177.96 -31.89  
11 1 THR A 372 ? ? -67.09  10.51   
12 1 LYS A 390 ? ? -52.56  -6.83   
13 1 LEU A 393 ? ? -59.68  104.12  
14 1 ASP A 399 ? ? 38.12   -128.52 
15 1 PRO A 425 ? ? -56.84  1.89    
16 1 GLN A 429 ? ? -86.86  42.92   
17 1 PHE A 439 ? ? -79.35  31.58   
18 1 ASP A 440 ? ? -138.30 -147.76 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2036 ? 6.48 . 
2  1 O ? A HOH 2041 ? 6.30 . 
3  1 O ? A HOH 2049 ? 5.95 . 
4  1 O ? A HOH 2059 ? 7.73 . 
5  1 O ? A HOH 2063 ? 7.07 . 
6  1 O ? A HOH 2064 ? 7.72 . 
7  1 O ? A HOH 2079 ? 9.55 . 
8  1 O ? A HOH 2096 ? 6.61 . 
9  1 O ? A HOH 2097 ? 7.04 . 
10 1 O ? A HOH 2119 ? 6.68 . 
11 1 O ? A HOH 2121 ? 6.04 . 
12 1 O ? A HOH 2122 ? 6.63 . 
13 1 O ? A HOH 2123 ? 6.74 . 
14 1 O ? A HOH 2169 ? 7.15 . 
15 1 O ? A HOH 2173 ? 5.93 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 146 ? CG  ? A LYS 1   CG  
2  1 Y 1 A LYS 146 ? CD  ? A LYS 1   CD  
3  1 Y 1 A LYS 146 ? CE  ? A LYS 1   CE  
4  1 Y 1 A LYS 146 ? NZ  ? A LYS 1   NZ  
5  1 Y 1 A VAL 147 ? CG1 ? A VAL 2   CG1 
6  1 Y 1 A VAL 147 ? CG2 ? A VAL 2   CG2 
7  1 Y 1 A VAL 198 ? CG1 ? A VAL 53  CG1 
8  1 Y 1 A VAL 198 ? CG2 ? A VAL 53  CG2 
9  1 Y 1 A THR 199 ? OG1 ? A THR 54  OG1 
10 1 Y 1 A THR 199 ? CG2 ? A THR 54  CG2 
11 1 Y 1 A GLU 200 ? CG  ? A GLU 55  CG  
12 1 Y 1 A GLU 200 ? CD  ? A GLU 55  CD  
13 1 Y 1 A GLU 200 ? OE1 ? A GLU 55  OE1 
14 1 Y 1 A GLU 200 ? OE2 ? A GLU 55  OE2 
15 1 Y 1 A SER 201 ? OG  ? A SER 56  OG  
16 1 Y 1 A ARG 202 ? CG  ? A ARG 57  CG  
17 1 Y 1 A ARG 202 ? CD  ? A ARG 57  CD  
18 1 Y 1 A ARG 202 ? NE  ? A ARG 57  NE  
19 1 Y 1 A ARG 202 ? CZ  ? A ARG 57  CZ  
20 1 Y 1 A ARG 202 ? NH1 ? A ARG 57  NH1 
21 1 Y 1 A ARG 202 ? NH2 ? A ARG 57  NH2 
22 1 Y 1 A VAL 203 ? CG1 ? A VAL 58  CG1 
23 1 Y 1 A VAL 203 ? CG2 ? A VAL 58  CG2 
24 1 Y 1 A LEU 204 ? CG  ? A LEU 59  CG  
25 1 Y 1 A LEU 204 ? CD1 ? A LEU 59  CD1 
26 1 Y 1 A LEU 204 ? CD2 ? A LEU 59  CD2 
27 1 Y 1 A GLN 205 ? CG  ? A GLN 60  CG  
28 1 Y 1 A GLN 205 ? CD  ? A GLN 60  CD  
29 1 Y 1 A GLN 205 ? OE1 ? A GLN 60  OE1 
30 1 Y 1 A GLN 205 ? NE2 ? A GLN 60  NE2 
31 1 Y 1 A ASN 206 ? CG  ? A ASN 61  CG  
32 1 Y 1 A ASN 206 ? OD1 ? A ASN 61  OD1 
33 1 Y 1 A ASN 206 ? ND2 ? A ASN 61  ND2 
34 1 Y 1 A ARG 253 ? CG  ? A ARG 108 CG  
35 1 Y 1 A ARG 253 ? CD  ? A ARG 108 CD  
36 1 Y 1 A ARG 253 ? NE  ? A ARG 108 NE  
37 1 Y 1 A ARG 253 ? CZ  ? A ARG 108 CZ  
38 1 Y 1 A ARG 253 ? NH1 ? A ARG 108 NH1 
39 1 Y 1 A ARG 253 ? NH2 ? A ARG 108 NH2 
40 1 Y 1 A LEU 296 ? CG  ? A LEU 151 CG  
41 1 Y 1 A LEU 296 ? CD1 ? A LEU 151 CD1 
42 1 Y 1 A LEU 296 ? CD2 ? A LEU 151 CD2 
43 1 Y 0 A ASP 435 ? N   ? A ASP 290 N   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 189 ? A ILE 44  
2  1 Y 1 A ALA 190 ? A ALA 45  
3  1 Y 1 A LYS 191 ? A LYS 46  
4  1 Y 1 A ASP 192 ? A ASP 47  
5  1 Y 1 A GLU 193 ? A GLU 48  
6  1 Y 1 A VAL 194 ? A VAL 49  
7  1 Y 1 A ALA 195 ? A ALA 50  
8  1 Y 1 A HIS 196 ? A HIS 51  
9  1 Y 1 A THR 197 ? A THR 52  
10 1 Y 1 A CYS 297 ? A CYS 152 
11 1 Y 1 A LYS 298 ? A LYS 153 
12 1 Y 1 A GLU 299 ? A GLU 154 
13 1 Y 1 A GLY 300 ? A GLY 155 
14 1 Y 1 A ILE 301 ? A ILE 156 
15 1 Y 1 A SER 302 ? A SER 157 
16 1 Y 1 A ASP 303 ? A ASP 158 
17 1 Y 1 A GLY 304 ? A GLY 159 
18 1 Y 1 A ALA 305 ? A ALA 160 
19 1 Y 1 A THR 306 ? A THR 161 
20 1 Y 1 A MET 307 ? A MET 162 
21 1 Y 1 A LYS 308 ? A LYS 163 
22 1 Y 1 A THR 309 ? A THR 164 
23 1 Y 1 A PHE 310 ? A PHE 165 
24 1 Y 1 A CYS 311 ? A CYS 166 
25 1 Y 1 A GLY 312 ? A GLY 167 
26 1 Y 1 A GLU 442 ? A GLU 297 
27 1 Y 1 A PHE 443 ? A PHE 298 
28 1 Y 1 A THR 444 ? A THR 299 
29 1 Y 1 A ALA 445 ? A ALA 300 
30 1 Y 1 A GLN 446 ? A GLN 301 
31 1 Y 1 A SER 447 ? A SER 302 
32 1 Y 1 A ILE 448 ? A ILE 303 
33 1 Y 1 A THR 449 ? A THR 304 
34 1 Y 1 A ILE 450 ? A ILE 305 
35 1 Y 1 A THR 451 ? A THR 306 
36 1 Y 1 A PRO 452 ? A PRO 307 
37 1 Y 1 A PRO 453 ? A PRO 308 
38 1 Y 1 A ASP 454 ? A ASP 309 
39 1 Y 1 A ARG 455 ? A ARG 310 
40 1 Y 1 A TYR 456 ? A TYR 311 
41 1 Y 1 A ASP 457 ? A ASP 312 
42 1 Y 1 A SER 458 ? A SER 313 
43 1 Y 1 A LEU 459 ? A LEU 314 
44 1 Y 1 A GLY 460 ? A GLY 315 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#