data_1GZY
# 
_entry.id   1GZY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GZY         
PDBE  EBI-9962     
WWPDB D_1290009962 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GZR unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; ESRF DATA'                 
PDB 1GZZ unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; HAMBURG DATA'              
PDB 1H02 unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; DARESBURY DATA'            
PDB 1H59 unspecified 'COMPLEX OF IGFBP-5 WITH IGF-I'                               
PDB 1IMX unspecified '1.8 ANGSTROM CRYSTAL STRUCTURE OF IGF-1'                     
PDB 2GF1 unspecified 'INSULIN-LIKE GROWTH FACTOR (NMR, MINIMUM AVERAGE STRUCTURE)' 
PDB 3GF1 unspecified 'INSULIN-LIKE GROWTH FACTOR (NMR, 10 STRUCTURES)'             
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GZY 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brzozowski, A.M.' 1 
'Dodson, E.J.'     2 
'Dodson, G.G.'     3 
'Murshudov, G.'    4 
'Verma, C.'        5 
'Turkenburg, J.P.' 6 
'De Bree, F.M.'    7 
'Dauter, Z.'       8 
# 
_citation.id                        primary 
_citation.title                     
'Structural Origins of the Functional Divergence of Human Insulin-Like Growth Factor-I and Insulin' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                9389 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12135360 
_citation.pdbx_database_id_DOI      10.1021/BI020084J 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Brzozowski, A.M.' 1 ? 
primary 'Dodson, E.J.'     2 ? 
primary 'Dodson, G.G.'     3 ? 
primary 'Murshudov, G.'    4 ? 
primary 'Verma, C.'        5 ? 
primary 'Turkenburg, J.P.' 6 ? 
primary 'De Bree, F.M.'    7 ? 
primary 'Dauter, Z.'       8 ? 
# 
_cell.entry_id           1GZY 
_cell.length_a           30.723 
_cell.length_b           69.282 
_cell.length_c           64.528 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GZY 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INSULIN-LIKE GROWTH FACTOR I'                      7663.752 1  ? ? ? ? 
2 non-polymer syn N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE 336.554  1  ? ? ? ? 
3 water       nat water                                               18.015   15 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SOMATOMEDIN C, IGF1, IBP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
_entity_poly.pdbx_seq_one_letter_code_can   GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  GLU n 
1 4  THR n 
1 5  LEU n 
1 6  CYS n 
1 7  GLY n 
1 8  ALA n 
1 9  GLU n 
1 10 LEU n 
1 11 VAL n 
1 12 ASP n 
1 13 ALA n 
1 14 LEU n 
1 15 GLN n 
1 16 PHE n 
1 17 VAL n 
1 18 CYS n 
1 19 GLY n 
1 20 ASP n 
1 21 ARG n 
1 22 GLY n 
1 23 PHE n 
1 24 TYR n 
1 25 PHE n 
1 26 ASN n 
1 27 LYS n 
1 28 PRO n 
1 29 THR n 
1 30 GLY n 
1 31 TYR n 
1 32 GLY n 
1 33 SER n 
1 34 SER n 
1 35 SER n 
1 36 ARG n 
1 37 ARG n 
1 38 ALA n 
1 39 PRO n 
1 40 GLN n 
1 41 THR n 
1 42 GLY n 
1 43 ILE n 
1 44 VAL n 
1 45 ASP n 
1 46 GLU n 
1 47 CYS n 
1 48 CYS n 
1 49 PHE n 
1 50 ARG n 
1 51 SER n 
1 52 CYS n 
1 53 ASP n 
1 54 LEU n 
1 55 ARG n 
1 56 ARG n 
1 57 LEU n 
1 58 GLU n 
1 59 MET n 
1 60 TYR n 
1 61 CYS n 
1 62 ALA n 
1 63 PRO n 
1 64 LEU n 
1 65 LYS n 
1 66 PRO n 
1 67 ALA n 
1 68 LYS n 
1 69 SER n 
1 70 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IGFA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P01343 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GZY 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 70 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01343 
_struct_ref_seq.db_align_beg                  49 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  118 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       70 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                             ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                            ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                          ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                     ? 'C4 H7 N O4'       133.103 
C15 non-polymer         . N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE ? 'C17 H38 N O3 S 1' 336.554 
CYS 'L-peptide linking' y CYSTEINE                                            ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                           ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                     ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                             ? 'C2 H5 N O2'       75.067  
HOH non-polymer         . WATER                                               ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                          ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                             ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                              ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                          ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                       ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                             ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                              ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                           ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                            ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                              ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1GZY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE PROTEIN WAS CRYSTALLIZED BY THE HANGING DROP METHOD IN WHICH DROPS WERE COMPOSED OF VARIOUS RATIOS OF HIGF-I AT 7MG/ML (IN H2O) WITH RESERVOIR SOLUTION CONSISTING OF 0.1M TRIS.HCL PH 7.5, 12-15% (W/V) PEG 2K AND 5MM SB12 DETERGENT.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                OSMICS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GZY 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   4839 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.03700 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.500 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   95.8 
_reflns_shell.Rmerge_I_obs           0.20300 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    12.000 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GZY 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     1952 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.54 
_refine.ls_percent_reflns_obs                    88.2 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.200 
_refine.ls_number_reflns_R_free                  198 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.893 
_refine.B_iso_mean                               30.68 
_refine.aniso_B[1][1]                            -3.75000 
_refine.aniso_B[2][2]                            1.92000 
_refine.aniso_B[3][3]                            1.84000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4INS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.344 
_refine.pdbx_overall_ESU_R_Free                  0.354 
_refine.overall_SU_ML                            0.128 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.528 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        447 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             15 
_refine_hist.number_atoms_total               482 
_refine_hist.d_res_high                       2.54 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.021 ? 462 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.419  2.026 ? 622 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_chiral_restr               10.673 5.000 ? 55  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020 ? 339 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.310  0.200 ? 222 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.172  0.200 ? 20  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.255  0.200 ? 35  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.311  0.200 ? 4   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.302  1.500 ? 282 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.208  2.000 ? 448 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.722  3.000 ? 180 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.564  4.500 ? 174 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?     ? ?   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.54 
_refine_ls_shell.d_res_low                        2.68 
_refine_ls_shell.number_reflns_R_work             143 
_refine_ls_shell.R_factor_R_work                  0.3110 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3730 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             14 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1GZY 
_struct.title                     'Human Insulin-like growth factor; In-house data' 
_struct.pdbx_descriptor           'INSULIN-LIKE GROWTH FACTOR I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GZY 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR' 
_struct_keywords.text            'GROWTH FACTOR, INSULIN FAMILY, IGF-1, PLASMA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 6  ? GLY A 19 ? CYS B 6  GLY B 19 1 ? 14 
HELX_P HELX_P2 2 ASP A 20 ? GLY A 22 ? ASP B 20 GLY B 22 5 ? 3  
HELX_P HELX_P3 3 GLY A 42 ? CYS A 48 ? GLY B 42 CYS B 48 1 ? 7  
HELX_P HELX_P4 4 ASP A 53 ? MET A 59 ? ASP B 53 MET B 59 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 48 SG ? ? B CYS 6  B CYS 48 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 61 SG ? ? B CYS 18 B CYS 61 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf3 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 52 SG ? ? B CYS 47 B CYS 52 1_555 ? ? ? ? ? ? ? 1.987 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE C15 B1067' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 TYR A 24 ? TYR B 24   . ? 1_555 ? 
2 AC1 8 PHE A 25 ? PHE B 25   . ? 1_555 ? 
3 AC1 8 ASN A 26 ? ASN B 26   . ? 1_555 ? 
4 AC1 8 TYR A 31 ? TYR B 31   . ? 1_555 ? 
5 AC1 8 CYS A 52 ? CYS B 52   . ? 1_555 ? 
6 AC1 8 ASP A 53 ? ASP B 53   . ? 1_555 ? 
7 AC1 8 LEU A 54 ? LEU B 54   . ? 1_555 ? 
8 AC1 8 HOH C .  ? HOH B 2015 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GZY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GZY 
_atom_sites.fract_transf_matrix[1][1]   0.032549 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014434 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015497 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLU A 1 3  ? 3.938  19.836  22.578 1.00   47.47 ? 3    GLU B N   1 
ATOM   2   C CA  . GLU A 1 3  ? 4.035  18.737  21.581 1.00   46.29 ? 3    GLU B CA  1 
ATOM   3   C C   . GLU A 1 3  ? 5.477  18.260  21.486 1.00   44.00 ? 3    GLU B C   1 
ATOM   4   O O   . GLU A 1 3  ? 5.780  17.080  21.710 1.00   44.89 ? 3    GLU B O   1 
ATOM   5   C CB  . GLU A 1 3  ? 3.537  19.214  20.214 1.00   47.56 ? 3    GLU B CB  1 
ATOM   6   C CG  . GLU A 1 3  ? 4.150  20.530  19.753 1.00   50.80 ? 3    GLU B CG  1 
ATOM   7   C CD  . GLU A 1 3  ? 4.155  20.672  18.241 1.00   55.31 ? 3    GLU B CD  1 
ATOM   8   O OE1 . GLU A 1 3  ? 3.241  20.117  17.586 1.00   56.97 ? 3    GLU B OE1 1 
ATOM   9   O OE2 . GLU A 1 3  ? 5.070  21.338  17.706 1.00   56.41 ? 3    GLU B OE2 1 
ATOM   10  N N   . THR A 1 4  ? 6.365  19.195  21.169 1.00   40.90 ? 4    THR B N   1 
ATOM   11  C CA  . THR A 1 4  ? 7.801  18.934  21.148 1.00   35.34 ? 4    THR B CA  1 
ATOM   12  C C   . THR A 1 4  ? 8.372  19.440  22.453 1.00   34.29 ? 4    THR B C   1 
ATOM   13  O O   . THR A 1 4  ? 8.163  20.589  22.828 1.00   34.79 ? 4    THR B O   1 
ATOM   14  C CB  . THR A 1 4  ? 8.462  19.664  19.940 1.00   34.95 ? 4    THR B CB  1 
ATOM   15  O OG1 . THR A 1 4  ? 8.529  18.775  18.816 1.00   29.77 ? 4    THR B OG1 1 
ATOM   16  C CG2 . THR A 1 4  ? 9.928  19.991  20.224 1.00   31.55 ? 4    THR B CG2 1 
ATOM   17  N N   . LEU A 1 5  ? 9.090  18.570  23.148 1.00   32.14 ? 5    LEU B N   1 
ATOM   18  C CA  . LEU A 1 5  ? 9.564  18.862  24.483 1.00   30.65 ? 5    LEU B CA  1 
ATOM   19  C C   . LEU A 1 5  ? 10.982 18.412  24.488 1.00   30.56 ? 5    LEU B C   1 
ATOM   20  O O   . LEU A 1 5  ? 11.234 17.198  24.375 1.00   31.43 ? 5    LEU B O   1 
ATOM   21  C CB  . LEU A 1 5  ? 8.793  18.051  25.530 1.00   30.48 ? 5    LEU B CB  1 
ATOM   22  C CG  . LEU A 1 5  ? 7.377  18.531  25.750 1.00   26.38 ? 5    LEU B CG  1 
ATOM   23  C CD1 . LEU A 1 5  ? 6.700  17.729  26.814 1.00   31.27 ? 5    LEU B CD1 1 
ATOM   24  C CD2 . LEU A 1 5  ? 7.450  19.980  26.166 1.00   29.59 ? 5    LEU B CD2 1 
ATOM   25  N N   . CYS A 1 6  ? 11.885 19.392  24.621 1.00   26.57 ? 6    CYS B N   1 
ATOM   26  C CA  . CYS A 1 6  ? 13.317 19.195  24.490 1.00   25.82 ? 6    CYS B CA  1 
ATOM   27  C C   . CYS A 1 6  ? 14.020 19.766  25.729 1.00   25.88 ? 6    CYS B C   1 
ATOM   28  O O   . CYS A 1 6  ? 13.457 20.620  26.425 1.00   25.77 ? 6    CYS B O   1 
ATOM   29  C CB  . CYS A 1 6  ? 13.839 19.918  23.237 1.00   26.81 ? 6    CYS B CB  1 
ATOM   30  S SG  . CYS A 1 6  ? 13.441 19.103  21.679 1.00   24.28 ? 6    CYS B SG  1 
ATOM   31  N N   . GLY A 1 7  ? 15.236 19.290  25.995 1.00   21.88 ? 7    GLY B N   1 
ATOM   32  C CA  . GLY A 1 7  ? 16.056 19.847  27.048 1.00   22.62 ? 7    GLY B CA  1 
ATOM   33  C C   . GLY A 1 7  ? 15.323 20.055  28.356 1.00   22.63 ? 7    GLY B C   1 
ATOM   34  O O   . GLY A 1 7  ? 14.701 19.144  28.867 1.00   24.93 ? 7    GLY B O   1 
ATOM   35  N N   . ALA A 1 8  ? 15.392 21.260  28.905 1.00   22.61 ? 8    ALA B N   1 
ATOM   36  C CA  . ALA A 1 8  ? 14.783 21.523  30.202 1.00   24.18 ? 8    ALA B CA  1 
ATOM   37  C C   . ALA A 1 8  ? 13.303 21.222  30.122 1.00   24.19 ? 8    ALA B C   1 
ATOM   38  O O   . ALA A 1 8  ? 12.704 20.747  31.046 1.00   27.46 ? 8    ALA B O   1 
ATOM   39  C CB  . ALA A 1 8  ? 15.013 22.984  30.620 1.00   22.33 ? 8    ALA B CB  1 
ATOM   40  N N   . GLU A 1 9  ? 12.692 21.527  29.001 1.00   27.03 ? 9    GLU B N   1 
ATOM   41  C CA  . GLU A 1 9  ? 11.253 21.525  28.973 1.00   27.86 ? 9    GLU B CA  1 
ATOM   42  C C   . GLU A 1 9  ? 10.816 20.068  29.050 1.00   27.37 ? 9    GLU B C   1 
ATOM   43  O O   . GLU A 1 9  ? 9.860  19.714  29.727 1.00   27.50 ? 9    GLU B O   1 
ATOM   44  C CB  . GLU A 1 9  ? 10.773 22.199  27.703 1.00   27.16 ? 9    GLU B CB  1 
ATOM   45  C CG  . GLU A 1 9  ? 10.483 23.674  27.892 1.00   36.20 ? 9    GLU B CG  1 
ATOM   46  C CD  . GLU A 1 9  ? 9.725  24.272  26.714 1.00   46.35 ? 9    GLU B CD  1 
ATOM   47  O OE1 . GLU A 1 9  ? 9.850  23.720  25.594 1.00   48.11 ? 9    GLU B OE1 1 
ATOM   48  O OE2 . GLU A 1 9  ? 9.007  25.288  26.901 1.00   49.15 ? 9    GLU B OE2 1 
ATOM   49  N N   . LEU A 1 10 ? 11.556 19.213  28.365 1.00   27.20 ? 10   LEU B N   1 
ATOM   50  C CA  . LEU A 1 10 ? 11.323 17.803  28.478 1.00   25.84 ? 10   LEU B CA  1 
ATOM   51  C C   . LEU A 1 10 ? 11.425 17.400  29.954 1.00   25.02 ? 10   LEU B C   1 
ATOM   52  O O   . LEU A 1 10 ? 10.519 16.781  30.487 1.00   27.14 ? 10   LEU B O   1 
ATOM   53  C CB  . LEU A 1 10 ? 12.298 17.049  27.589 1.00   25.70 ? 10   LEU B CB  1 
ATOM   54  C CG  . LEU A 1 10 ? 12.121 15.538  27.636 1.00   30.59 ? 10   LEU B CG  1 
ATOM   55  C CD1 . LEU A 1 10 ? 10.710 15.117  27.198 1.00   28.21 ? 10   LEU B CD1 1 
ATOM   56  C CD2 . LEU A 1 10 ? 13.190 14.888  26.798 1.00   30.22 ? 10   LEU B CD2 1 
ATOM   57  N N   . VAL A 1 11 ? 12.503 17.777  30.628 1.00   24.60 ? 11   VAL B N   1 
ATOM   58  C CA  . VAL A 1 11 ? 12.706 17.348  32.008 1.00   25.10 ? 11   VAL B CA  1 
ATOM   59  C C   . VAL A 1 11 ? 11.599 17.839  32.957 1.00   26.26 ? 11   VAL B C   1 
ATOM   60  O O   . VAL A 1 11 ? 11.069 17.073  33.747 1.00   26.32 ? 11   VAL B O   1 
ATOM   61  C CB  . VAL A 1 11 ? 14.114 17.692  32.521 1.00   24.16 ? 11   VAL B CB  1 
ATOM   62  C CG1 . VAL A 1 11 ? 14.234 17.417  34.025 1.00   22.71 ? 11   VAL B CG1 1 
ATOM   63  C CG2 . VAL A 1 11 ? 15.156 16.869  31.760 1.00   23.27 ? 11   VAL B CG2 1 
ATOM   64  N N   . ASP A 1 12 ? 11.243 19.114  32.851 1.00   27.27 ? 12   ASP B N   1 
ATOM   65  C CA  . ASP A 1 12 ? 10.049 19.658  33.490 1.00   26.91 ? 12   ASP B CA  1 
ATOM   66  C C   . ASP A 1 12 ? 8.819  18.780  33.313 1.00   26.95 ? 12   ASP B C   1 
ATOM   67  O O   . ASP A 1 12 ? 8.230  18.344  34.285 1.00   26.65 ? 12   ASP B O   1 
ATOM   68  C CB  . ASP A 1 12 ? 9.747  21.011  32.875 1.00   27.18 ? 12   ASP B CB  1 
ATOM   69  C CG  . ASP A 1 12 ? 9.952  22.130  33.827 1.00   29.83 ? 12   ASP B CG  1 
ATOM   70  O OD1 . ASP A 1 12 ? 10.188 21.870  35.033 1.00   25.99 ? 12   ASP B OD1 1 
ATOM   71  O OD2 . ASP A 1 12 ? 9.893  23.315  33.442 1.00   34.70 ? 12   ASP B OD2 1 
ATOM   72  N N   . ALA A 1 13 ? 8.419  18.563  32.062 1.00   25.89 ? 13   ALA B N   1 
ATOM   73  C CA  . ALA A 1 13 ? 7.361  17.631  31.747 1.00   29.05 ? 13   ALA B CA  1 
ATOM   74  C C   . ALA A 1 13 ? 7.474  16.327  32.539 1.00   29.72 ? 13   ALA B C   1 
ATOM   75  O O   . ALA A 1 13 ? 6.508  15.908  33.184 1.00   29.44 ? 13   ALA B O   1 
ATOM   76  C CB  . ALA A 1 13 ? 7.312  17.335  30.216 1.00   28.89 ? 13   ALA B CB  1 
ATOM   77  N N   . LEU A 1 14 ? 8.638  15.677  32.478 1.00   29.40 ? 14   LEU B N   1 
ATOM   78  C CA  . LEU A 1 14 ? 8.778  14.377  33.119 1.00   28.93 ? 14   LEU B CA  1 
ATOM   79  C C   . LEU A 1 14 ? 8.674  14.502  34.629 1.00   29.30 ? 14   LEU B C   1 
ATOM   80  O O   . LEU A 1 14 ? 7.994  13.711  35.274 1.00   33.19 ? 14   LEU B O   1 
ATOM   81  C CB  . LEU A 1 14 ? 10.088 13.714  32.734 1.00   29.39 ? 14   LEU B CB  1 
ATOM   82  C CG  . LEU A 1 14 ? 10.148 13.081  31.347 1.00   29.49 ? 14   LEU B CG  1 
ATOM   83  C CD1 . LEU A 1 14 ? 11.620 12.914  30.940 1.00   26.58 ? 14   LEU B CD1 1 
ATOM   84  C CD2 . LEU A 1 14 ? 9.372  11.766  31.316 1.00   17.48 ? 14   LEU B CD2 1 
ATOM   85  N N   . GLN A 1 15 ? 9.332  15.503  35.193 1.00   27.42 ? 15   GLN B N   1 
ATOM   86  C CA  . GLN A 1 15 ? 9.213  15.783  36.613 1.00   26.82 ? 15   GLN B CA  1 
ATOM   87  C C   . GLN A 1 15 ? 7.742  15.955  36.977 1.00   26.53 ? 15   GLN B C   1 
ATOM   88  O O   . GLN A 1 15 ? 7.261  15.403  37.989 1.00   28.17 ? 15   GLN B O   1 
ATOM   89  C CB  . GLN A 1 15 ? 10.008 17.044  37.014 1.00   25.97 ? 15   GLN B CB  1 
ATOM   90  C CG  . GLN A 1 15 ? 11.523 16.916  36.889 1.00   25.97 ? 15   GLN B CG  1 
ATOM   91  C CD  . GLN A 1 15 ? 12.312 18.051  37.629 1.00   32.63 ? 15   GLN B CD  1 
ATOM   92  O OE1 . GLN A 1 15 ? 13.206 17.763  38.441 1.00   30.68 ? 15   GLN B OE1 1 
ATOM   93  N NE2 . GLN A 1 15 ? 11.987 19.319  37.335 1.00   26.31 ? 15   GLN B NE2 1 
ATOM   94  N N   . PHE A 1 16 ? 7.020  16.719  36.167 1.00   24.21 ? 16   PHE B N   1 
ATOM   95  C CA  . PHE A 1 16 ? 5.665  17.046  36.532 1.00   23.28 ? 16   PHE B CA  1 
ATOM   96  C C   . PHE A 1 16 ? 4.801  15.794  36.417 1.00   25.14 ? 16   PHE B C   1 
ATOM   97  O O   . PHE A 1 16 ? 4.062  15.443  37.327 1.00   25.09 ? 16   PHE B O   1 
ATOM   98  C CB  . PHE A 1 16 ? 5.094  18.168  35.672 1.00   23.20 ? 16   PHE B CB  1 
ATOM   99  C CG  . PHE A 1 16 ? 3.705  18.566  36.081 1.00   24.42 ? 16   PHE B CG  1 
ATOM   100 C CD1 . PHE A 1 16 ? 3.506  19.542  37.045 1.00   24.08 ? 16   PHE B CD1 1 
ATOM   101 C CD2 . PHE A 1 16 ? 2.605  17.910  35.566 1.00   18.64 ? 16   PHE B CD2 1 
ATOM   102 C CE1 . PHE A 1 16 ? 2.245  19.873  37.443 1.00   25.23 ? 16   PHE B CE1 1 
ATOM   103 C CE2 . PHE A 1 16 ? 1.350  18.227  35.977 1.00   18.59 ? 16   PHE B CE2 1 
ATOM   104 C CZ  . PHE A 1 16 ? 1.168  19.223  36.914 1.00   23.84 ? 16   PHE B CZ  1 
ATOM   105 N N   . VAL A 1 17 ? 4.899  15.124  35.285 1.00   26.18 ? 17   VAL B N   1 
ATOM   106 C CA  . VAL A 1 17 ? 4.095  13.946  35.022 1.00   27.80 ? 17   VAL B CA  1 
ATOM   107 C C   . VAL A 1 17 ? 4.469  12.782  35.947 1.00   28.74 ? 17   VAL B C   1 
ATOM   108 O O   . VAL A 1 17 ? 3.611  12.033  36.429 1.00   28.72 ? 17   VAL B O   1 
ATOM   109 C CB  . VAL A 1 17 ? 4.313  13.515  33.580 1.00   26.99 ? 17   VAL B CB  1 
ATOM   110 C CG1 . VAL A 1 17 ? 3.850  12.102  33.382 1.00   28.92 ? 17   VAL B CG1 1 
ATOM   111 C CG2 . VAL A 1 17 ? 3.594  14.488  32.655 1.00   29.88 ? 17   VAL B CG2 1 
ATOM   112 N N   . CYS A 1 18 ? 5.761  12.618  36.189 1.00   28.83 ? 18   CYS B N   1 
ATOM   113 C CA  . CYS A 1 18 ? 6.197  11.457  36.937 1.00   30.12 ? 18   CYS B CA  1 
ATOM   114 C C   . CYS A 1 18 ? 6.224  11.730  38.445 1.00   30.75 ? 18   CYS B C   1 
ATOM   115 O O   . CYS A 1 18 ? 6.315  10.801  39.247 1.00   30.56 ? 18   CYS B O   1 
ATOM   116 C CB  . CYS A 1 18 ? 7.546  10.974  36.425 1.00   29.33 ? 18   CYS B CB  1 
ATOM   117 S SG  . CYS A 1 18 ? 7.501  10.557  34.673 1.00   27.19 ? 18   CYS B SG  1 
ATOM   118 N N   . GLY A 1 19 ? 6.129  13.001  38.823 1.00   29.30 ? 19   GLY B N   1 
ATOM   119 C CA  . GLY A 1 19 ? 6.113  13.352  40.230 1.00   33.08 ? 19   GLY B CA  1 
ATOM   120 C C   . GLY A 1 19 ? 7.192  12.590  40.971 1.00   33.69 ? 19   GLY B C   1 
ATOM   121 O O   . GLY A 1 19 ? 8.363  12.648  40.615 1.00   35.19 ? 19   GLY B O   1 
ATOM   122 N N   . ASP A 1 20 ? 6.805  11.841  41.988 1.00   34.33 ? 20   ASP B N   1 
ATOM   123 C CA  . ASP A 1 20 ? 7.800  11.289  42.893 1.00   35.08 ? 20   ASP B CA  1 
ATOM   124 C C   . ASP A 1 20 ? 8.559  10.107  42.290 1.00   33.89 ? 20   ASP B C   1 
ATOM   125 O O   . ASP A 1 20 ? 9.634  9.746   42.766 1.00   34.78 ? 20   ASP B O   1 
ATOM   126 C CB  . ASP A 1 20 ? 7.188  10.942  44.261 1.00   34.90 ? 20   ASP B CB  1 
ATOM   127 C CG  . ASP A 1 20 ? 5.947  10.070  44.152 1.00   36.54 ? 20   ASP B CG  1 
ATOM   128 O OD1 . ASP A 1 20 ? 5.863  9.238   43.223 1.00   41.49 ? 20   ASP B OD1 1 
ATOM   129 O OD2 . ASP A 1 20 ? 5.000  10.142  44.961 1.00   43.48 ? 20   ASP B OD2 1 
ATOM   130 N N   . ARG A 1 21 ? 8.003  9.515   41.241 1.00   32.61 ? 21   ARG B N   1 
ATOM   131 C CA  . ARG A 1 21 ? 8.483  8.225   40.750 1.00   32.29 ? 21   ARG B CA  1 
ATOM   132 C C   . ARG A 1 21 ? 9.831  8.343   40.074 1.00   31.57 ? 21   ARG B C   1 
ATOM   133 O O   . ARG A 1 21 ? 10.633 7.418   40.113 1.00   33.92 ? 21   ARG B O   1 
ATOM   134 C CB  . ARG A 1 21 ? 7.475  7.607   39.787 1.00   31.23 ? 21   ARG B CB  1 
ATOM   135 C CG  . ARG A 1 21 ? 6.046  7.814   40.263 1.00   35.32 ? 21   ARG B CG  1 
ATOM   136 C CD  . ARG A 1 21 ? 5.032  6.945   39.582 1.00   36.28 ? 21   ARG B CD  1 
ATOM   137 N NE  . ARG A 1 21 ? 4.459  7.608   38.420 1.00   39.01 ? 21   ARG B NE  1 
ATOM   138 C CZ  . ARG A 1 21 ? 4.296  7.014   37.258 1.00   40.02 ? 21   ARG B CZ  1 
ATOM   139 N NH1 . ARG A 1 21 ? 4.667  5.746   37.112 1.00   37.35 ? 21   ARG B NH1 1 
ATOM   140 N NH2 . ARG A 1 21 ? 3.767  7.684   36.243 1.00   43.06 ? 21   ARG B NH2 1 
ATOM   141 N N   . GLY A 1 22 ? 10.078 9.483   39.446 1.00   31.05 ? 22   GLY B N   1 
ATOM   142 C CA  . GLY A 1 22 ? 11.218 9.616   38.574 1.00   28.82 ? 22   GLY B CA  1 
ATOM   143 C C   . GLY A 1 22 ? 10.975 9.087   37.171 1.00   29.10 ? 22   GLY B C   1 
ATOM   144 O O   . GLY A 1 22 ? 9.944  8.481   36.860 1.00   26.27 ? 22   GLY B O   1 
ATOM   145 N N   . PHE A 1 23 ? 11.949 9.340   36.312 1.00   27.53 ? 23   PHE B N   1 
ATOM   146 C CA  . PHE A 1 23 ? 11.815 9.033   34.918 1.00   30.27 ? 23   PHE B CA  1 
ATOM   147 C C   . PHE A 1 23 ? 13.153 8.476   34.480 1.00   29.96 ? 23   PHE B C   1 
ATOM   148 O O   . PHE A 1 23 ? 14.126 8.492   35.239 1.00   27.16 ? 23   PHE B O   1 
ATOM   149 C CB  . PHE A 1 23 ? 11.488 10.306  34.124 1.00   32.59 ? 23   PHE B CB  1 
ATOM   150 C CG  . PHE A 1 23 ? 12.322 11.504  34.530 1.00   36.83 ? 23   PHE B CG  1 
ATOM   151 C CD1 . PHE A 1 23 ? 11.945 12.302  35.598 1.00   36.08 ? 23   PHE B CD1 1 
ATOM   152 C CD2 . PHE A 1 23 ? 13.492 11.806  33.862 1.00   36.62 ? 23   PHE B CD2 1 
ATOM   153 C CE1 . PHE A 1 23 ? 12.727 13.382  35.986 1.00   38.97 ? 23   PHE B CE1 1 
ATOM   154 C CE2 . PHE A 1 23 ? 14.275 12.884  34.245 1.00   39.17 ? 23   PHE B CE2 1 
ATOM   155 C CZ  . PHE A 1 23 ? 13.891 13.670  35.309 1.00   40.43 ? 23   PHE B CZ  1 
ATOM   156 N N   . TYR A 1 24 ? 13.196 7.986   33.247 1.00   28.45 ? 24   TYR B N   1 
ATOM   157 C CA  . TYR A 1 24 ? 14.448 7.666   32.622 1.00   27.00 ? 24   TYR B CA  1 
ATOM   158 C C   . TYR A 1 24 ? 14.262 7.982   31.183 1.00   26.71 ? 24   TYR B C   1 
ATOM   159 O O   . TYR A 1 24 ? 13.160 8.291   30.755 1.00   25.89 ? 24   TYR B O   1 
ATOM   160 C CB  . TYR A 1 24 ? 14.768 6.196   32.788 1.00   29.12 ? 24   TYR B CB  1 
ATOM   161 C CG  . TYR A 1 24 ? 13.577 5.303   32.596 1.00   32.29 ? 24   TYR B CG  1 
ATOM   162 C CD1 . TYR A 1 24 ? 13.136 4.979   31.323 1.00   35.70 ? 24   TYR B CD1 1 
ATOM   163 C CD2 . TYR A 1 24 ? 12.898 4.784   33.680 1.00   33.85 ? 24   TYR B CD2 1 
ATOM   164 C CE1 . TYR A 1 24 ? 12.058 4.172   31.137 1.00   39.70 ? 24   TYR B CE1 1 
ATOM   165 C CE2 . TYR A 1 24 ? 11.812 3.962   33.501 1.00   38.86 ? 24   TYR B CE2 1 
ATOM   166 C CZ  . TYR A 1 24 ? 11.394 3.663   32.224 1.00   38.71 ? 24   TYR B CZ  1 
ATOM   167 O OH  . TYR A 1 24 ? 10.314 2.842   32.019 1.00   41.81 ? 24   TYR B OH  1 
ATOM   168 N N   . PHE A 1 25 ? 15.343 7.916   30.421 1.00   27.73 ? 25   PHE B N   1 
ATOM   169 C CA  . PHE A 1 25 ? 15.337 8.549   29.117 1.00   28.39 ? 25   PHE B CA  1 
ATOM   170 C C   . PHE A 1 25 ? 15.304 7.474   28.035 1.00   27.94 ? 25   PHE B C   1 
ATOM   171 O O   . PHE A 1 25 ? 14.744 7.660   26.966 1.00   28.59 ? 25   PHE B O   1 
ATOM   172 C CB  . PHE A 1 25 ? 16.508 9.538   28.991 1.00   27.57 ? 25   PHE B CB  1 
ATOM   173 C CG  . PHE A 1 25 ? 16.357 10.739  29.877 1.00   28.29 ? 25   PHE B CG  1 
ATOM   174 C CD1 . PHE A 1 25 ? 16.739 10.687  31.209 1.00   31.37 ? 25   PHE B CD1 1 
ATOM   175 C CD2 . PHE A 1 25 ? 15.794 11.915  29.391 1.00   31.37 ? 25   PHE B CD2 1 
ATOM   176 C CE1 . PHE A 1 25 ? 16.580 11.794  32.041 1.00   33.19 ? 25   PHE B CE1 1 
ATOM   177 C CE2 . PHE A 1 25 ? 15.628 13.029  30.218 1.00   31.23 ? 25   PHE B CE2 1 
ATOM   178 C CZ  . PHE A 1 25 ? 16.016 12.967  31.540 1.00   34.95 ? 25   PHE B CZ  1 
ATOM   179 N N   . ASN A 1 26 ? 15.858 6.321   28.348 1.00   27.30 ? 26   ASN B N   1 
ATOM   180 C CA  . ASN A 1 26 ? 15.822 5.214   27.417 1.00   27.66 ? 26   ASN B CA  1 
ATOM   181 C C   . ASN A 1 26 ? 14.989 4.117   28.028 1.00   26.44 ? 26   ASN B C   1 
ATOM   182 O O   . ASN A 1 26 ? 15.159 3.797   29.199 1.00   27.34 ? 26   ASN B O   1 
ATOM   183 C CB  . ASN A 1 26 ? 17.244 4.739   27.149 1.00   27.18 ? 26   ASN B CB  1 
ATOM   184 C CG  . ASN A 1 26 ? 18.164 5.887   26.806 1.00   28.90 ? 26   ASN B CG  1 
ATOM   185 O OD1 . ASN A 1 26 ? 17.833 6.707   25.955 1.00   30.31 ? 26   ASN B OD1 1 
ATOM   186 N ND2 . ASN A 1 26 ? 19.316 5.964   27.474 1.00   30.94 ? 26   ASN B ND2 1 
ATOM   187 N N   . LYS A 1 27 ? 14.062 3.563   27.258 1.00   24.63 ? 27   LYS B N   1 
ATOM   188 C CA  . LYS A 1 27 ? 13.335 2.407   27.746 1.00   23.60 ? 27   LYS B CA  1 
ATOM   189 C C   . LYS A 1 27 ? 14.263 1.196   27.772 1.00   23.19 ? 27   LYS B C   1 
ATOM   190 O O   . LYS A 1 27 ? 15.132 1.052   26.913 1.00   21.30 ? 27   LYS B O   1 
ATOM   191 C CB  . LYS A 1 27 ? 12.050 2.154   26.949 1.00   23.14 ? 27   LYS B CB  1 
ATOM   192 C CG  . LYS A 1 27 ? 12.217 2.091   25.442 1.00   25.25 ? 27   LYS B CG  1 
ATOM   193 C CD  . LYS A 1 27 ? 10.799 1.876   24.541 0.0000 40.00 ? 27   LYS B CD  1 
ATOM   194 C CE  . LYS A 1 27 ? 10.777 2.032   23.017 0.0000 40.00 ? 27   LYS B CE  1 
ATOM   195 N NZ  . LYS A 1 27 ? 9.609  1.510   22.310 0.0000 40.00 ? 27   LYS B NZ  1 
ATOM   196 N N   . PRO A 1 28 ? 14.090 0.342   28.775 1.00   23.47 ? 28   PRO B N   1 
ATOM   197 C CA  . PRO A 1 28 ? 14.923 -0.854  28.925 1.00   23.71 ? 28   PRO B CA  1 
ATOM   198 C C   . PRO A 1 28 ? 14.584 -1.876  27.847 1.00   23.57 ? 28   PRO B C   1 
ATOM   199 O O   . PRO A 1 28 ? 13.610 -1.710  27.108 1.00   22.81 ? 28   PRO B O   1 
ATOM   200 C CB  . PRO A 1 28 ? 14.500 -1.398  30.292 1.00   24.20 ? 28   PRO B CB  1 
ATOM   201 C CG  . PRO A 1 28 ? 13.092 -0.967  30.425 1.00   23.93 ? 28   PRO B CG  1 
ATOM   202 C CD  . PRO A 1 28 ? 13.066 0.438   29.830 1.00   23.69 ? 28   PRO B CD  1 
ATOM   203 N N   . THR A 1 29 ? 15.380 -2.935  27.777 1.00   23.77 ? 29   THR B N   1 
ATOM   204 C CA  . THR A 1 29 ? 15.187 -3.973  26.778 1.00   23.87 ? 29   THR B CA  1 
ATOM   205 C C   . THR A 1 29 ? 15.605 -5.310  27.388 1.00   24.65 ? 29   THR B C   1 
ATOM   206 O O   . THR A 1 29 ? 16.068 -5.364  28.535 1.00   24.67 ? 29   THR B O   1 
ATOM   207 C CB  . THR A 1 29 ? 16.056 -3.666  25.528 1.00   24.21 ? 29   THR B CB  1 
ATOM   208 O OG1 . THR A 1 29 ? 17.394 -4.185  25.722 1.00   22.80 ? 29   THR B OG1 1 
ATOM   209 C CG2 . THR A 1 29 ? 16.304 -2.158  25.401 1.00   23.17 ? 29   THR B CG2 1 
ATOM   210 N N   . GLY A 1 30 ? 15.436 -6.387  26.619 1.00   25.52 ? 30   GLY B N   1 
ATOM   211 C CA  . GLY A 1 30 ? 16.485 -7.379  26.489 1.00   26.52 ? 30   GLY B CA  1 
ATOM   212 C C   . GLY A 1 30 ? 16.152 -8.727  27.090 1.00   27.79 ? 30   GLY B C   1 
ATOM   213 O O   . GLY A 1 30 ? 15.265 -9.439  26.596 1.00   29.08 ? 30   GLY B O   1 
ATOM   214 N N   . TYR A 1 31 ? 16.886 -9.087  28.160 1.00   28.18 ? 31   TYR B N   1 
ATOM   215 C CA  . TYR A 1 31 ? 17.049 -10.500 28.558 1.00   27.77 ? 31   TYR B CA  1 
ATOM   216 C C   . TYR A 1 31 ? 17.648 -10.557 29.997 1.00   27.94 ? 31   TYR B C   1 
ATOM   217 O O   . TYR A 1 31 ? 18.316 -9.582  30.446 1.00   28.00 ? 31   TYR B O   1 
ATOM   218 C CB  . TYR A 1 31 ? 17.975 -11.223 27.552 1.00   27.89 ? 31   TYR B CB  1 
ATOM   219 C CG  . TYR A 1 31 ? 19.416 -11.372 28.184 1.00   28.71 ? 31   TYR B CG  1 
ATOM   220 C CD1 . TYR A 1 31 ? 20.136 -10.209 28.716 1.00   29.85 ? 31   TYR B CD1 1 
ATOM   221 C CD2 . TYR A 1 31 ? 20.055 -12.673 28.264 1.00   27.26 ? 31   TYR B CD2 1 
ATOM   222 C CE1 . TYR A 1 31 ? 21.452 -10.338 29.306 1.00   30.33 ? 31   TYR B CE1 1 
ATOM   223 C CE2 . TYR A 1 31 ? 21.371 -12.809 28.853 1.00   28.78 ? 31   TYR B CE2 1 
ATOM   224 C CZ  . TYR A 1 31 ? 22.065 -11.636 29.372 1.00   28.91 ? 31   TYR B CZ  1 
ATOM   225 O OH  . TYR A 1 31 ? 23.385 -11.758 29.969 1.00   32.41 ? 31   TYR B OH  1 
ATOM   226 N N   . PRO A 1 39 ? 20.914 -0.071  18.735 1.00   46.41 ? 39   PRO B N   1 
ATOM   227 C CA  . PRO A 1 39 ? 21.055 1.377   18.557 1.00   46.20 ? 39   PRO B CA  1 
ATOM   228 C C   . PRO A 1 39 ? 20.025 2.137   19.385 1.00   46.31 ? 39   PRO B C   1 
ATOM   229 O O   . PRO A 1 39 ? 18.841 2.142   19.043 1.00   46.78 ? 39   PRO B O   1 
ATOM   230 C CB  . PRO A 1 39 ? 20.780 1.562   17.064 1.00   46.44 ? 39   PRO B CB  1 
ATOM   231 C CG  . PRO A 1 39 ? 21.259 0.270   16.429 1.00   46.25 ? 39   PRO B CG  1 
ATOM   232 C CD  . PRO A 1 39 ? 21.211 -0.809  17.492 1.00   46.29 ? 39   PRO B CD  1 
ATOM   233 N N   . GLN A 1 40 ? 20.482 2.776   20.459 1.00   45.93 ? 40   GLN B N   1 
ATOM   234 C CA  . GLN A 1 40 ? 19.606 3.234   21.534 1.00   44.93 ? 40   GLN B CA  1 
ATOM   235 C C   . GLN A 1 40 ? 18.554 4.238   21.052 1.00   44.90 ? 40   GLN B C   1 
ATOM   236 O O   . GLN A 1 40 ? 18.480 4.547   19.861 1.00   45.16 ? 40   GLN B O   1 
ATOM   237 C CB  . GLN A 1 40 ? 20.434 3.824   22.676 1.00   45.00 ? 40   GLN B CB  1 
ATOM   238 C CG  . GLN A 1 40 ? 20.782 2.440   24.328 0.0000 40.00 ? 40   GLN B CG  1 
ATOM   239 C CD  . GLN A 1 40 ? 20.143 1.788   25.532 0.0000 40.00 ? 40   GLN B CD  1 
ATOM   240 O OE1 . GLN A 1 40 ? 19.028 1.930   26.006 0.0000 40.00 ? 40   GLN B OE1 1 
ATOM   241 N NE2 . GLN A 1 40 ? 21.135 1.129   26.163 0.0000 40.00 ? 40   GLN B NE2 1 
ATOM   242 N N   . THR A 1 41 ? 17.740 4.737   21.982 1.00   43.64 ? 41   THR B N   1 
ATOM   243 C CA  . THR A 1 41 ? 16.494 5.428   21.642 1.00   43.04 ? 41   THR B CA  1 
ATOM   244 C C   . THR A 1 41 ? 15.583 5.526   22.860 1.00   42.10 ? 41   THR B C   1 
ATOM   245 O O   . THR A 1 41 ? 15.577 4.643   23.724 1.00   43.49 ? 41   THR B O   1 
ATOM   246 C CB  . THR A 1 41 ? 15.748 4.712   20.480 1.00   43.67 ? 41   THR B CB  1 
ATOM   247 O OG1 . THR A 1 41 ? 14.520 5.397   20.202 1.00   45.06 ? 41   THR B OG1 1 
ATOM   248 C CG2 . THR A 1 41 ? 15.285 3.315   20.899 1.00   42.56 ? 41   THR B CG2 1 
ATOM   249 N N   . GLY A 1 42 ? 14.812 6.600   22.941 1.00   40.11 ? 42   GLY B N   1 
ATOM   250 C CA  . GLY A 1 42 ? 14.089 6.871   24.165 1.00   36.56 ? 42   GLY B CA  1 
ATOM   251 C C   . GLY A 1 42 ? 13.208 8.085   24.063 1.00   34.05 ? 42   GLY B C   1 
ATOM   252 O O   . GLY A 1 42 ? 12.681 8.395   22.997 1.00   35.78 ? 42   GLY B O   1 
ATOM   253 N N   . ILE A 1 43 ? 13.048 8.778   25.179 1.00   31.66 ? 43   ILE B N   1 
ATOM   254 C CA  . ILE A 1 43 ? 12.163 9.919   25.226 1.00   30.73 ? 43   ILE B CA  1 
ATOM   255 C C   . ILE A 1 43 ? 12.531 11.053  24.280 1.00   29.06 ? 43   ILE B C   1 
ATOM   256 O O   . ILE A 1 43 ? 11.660 11.582  23.590 1.00   30.73 ? 43   ILE B O   1 
ATOM   257 C CB  . ILE A 1 43 ? 11.945 10.419  26.665 1.00   32.20 ? 43   ILE B CB  1 
ATOM   258 C CG1 . ILE A 1 43 ? 10.662 11.234  26.736 1.00   31.96 ? 43   ILE B CG1 1 
ATOM   259 C CG2 . ILE A 1 43 ? 13.157 11.184  27.201 1.00   27.66 ? 43   ILE B CG2 1 
ATOM   260 C CD1 . ILE A 1 43 ? 9.888  10.989  28.012 1.00   38.94 ? 43   ILE B CD1 1 
ATOM   261 N N   . VAL A 1 44 ? 13.807 11.410  24.218 1.00   26.10 ? 44   VAL B N   1 
ATOM   262 C CA  . VAL A 1 44 ? 14.233 12.448  23.285 1.00   25.28 ? 44   VAL B CA  1 
ATOM   263 C C   . VAL A 1 44 ? 13.697 12.204  21.864 1.00   26.17 ? 44   VAL B C   1 
ATOM   264 O O   . VAL A 1 44 ? 13.131 13.107  21.227 1.00   23.89 ? 44   VAL B O   1 
ATOM   265 C CB  . VAL A 1 44 ? 15.759 12.641  23.293 1.00   25.34 ? 44   VAL B CB  1 
ATOM   266 C CG1 . VAL A 1 44 ? 16.252 13.285  21.983 1.00   21.29 ? 44   VAL B CG1 1 
ATOM   267 C CG2 . VAL A 1 44 ? 16.191 13.443  24.538 1.00   17.87 ? 44   VAL B CG2 1 
ATOM   268 N N   . ASP A 1 45 ? 13.855 10.976  21.382 1.00   27.13 ? 45   ASP B N   1 
ATOM   269 C CA  . ASP A 1 45 ? 13.456 10.640  20.018 1.00   27.44 ? 45   ASP B CA  1 
ATOM   270 C C   . ASP A 1 45 ? 11.949 10.861  19.858 1.00   27.48 ? 45   ASP B C   1 
ATOM   271 O O   . ASP A 1 45 ? 11.511 11.581  18.955 1.00   27.77 ? 45   ASP B O   1 
ATOM   272 C CB  . ASP A 1 45 ? 13.846 9.195   19.687 1.00   27.65 ? 45   ASP B CB  1 
ATOM   273 C CG  . ASP A 1 45 ? 15.346 8.953   19.799 1.00   29.05 ? 45   ASP B CG  1 
ATOM   274 O OD1 . ASP A 1 45 ? 15.843 8.675   20.919 1.00   29.84 ? 45   ASP B OD1 1 
ATOM   275 O OD2 . ASP A 1 45 ? 16.109 9.018   18.814 1.00   30.38 ? 45   ASP B OD2 1 
ATOM   276 N N   . GLU A 1 46 ? 11.167 10.277  20.762 1.00   26.28 ? 46   GLU B N   1 
ATOM   277 C CA  . GLU A 1 46 ? 9.706  10.289  20.664 1.00   25.94 ? 46   GLU B CA  1 
ATOM   278 C C   . GLU A 1 46 ? 9.040  11.583  21.112 1.00   25.11 ? 46   GLU B C   1 
ATOM   279 O O   . GLU A 1 46 ? 7.946  11.866  20.687 1.00   25.26 ? 46   GLU B O   1 
ATOM   280 C CB  . GLU A 1 46 ? 9.114  9.156   21.485 1.00   27.35 ? 46   GLU B CB  1 
ATOM   281 C CG  . GLU A 1 46 ? 9.737  7.798   21.214 1.00   33.74 ? 46   GLU B CG  1 
ATOM   282 C CD  . GLU A 1 46 ? 9.002  6.693   21.941 1.00   39.61 ? 46   GLU B CD  1 
ATOM   283 O OE1 . GLU A 1 46 ? 8.223  7.017   22.857 1.00   37.68 ? 46   GLU B OE1 1 
ATOM   284 O OE2 . GLU A 1 46 ? 9.194  5.510   21.585 1.00   45.98 ? 46   GLU B OE2 1 
ATOM   285 N N   . CYS A 1 47 ? 9.687  12.363  21.973 1.00   24.77 ? 47   CYS B N   1 
ATOM   286 C CA  . CYS A 1 47 ? 9.078  13.585  22.484 1.00   25.78 ? 47   CYS B CA  1 
ATOM   287 C C   . CYS A 1 47 ? 9.795  14.874  22.122 1.00   25.93 ? 47   CYS B C   1 
ATOM   288 O O   . CYS A 1 47 ? 9.266  15.952  22.374 1.00   26.76 ? 47   CYS B O   1 
ATOM   289 C CB  . CYS A 1 47 ? 8.904  13.508  24.014 1.00   25.96 ? 47   CYS B CB  1 
ATOM   290 S SG  . CYS A 1 47 ? 7.827  12.158  24.473 1.00   32.99 ? 47   CYS B SG  1 
ATOM   291 N N   . CYS A 1 48 ? 11.000 14.783  21.556 1.00   26.83 ? 48   CYS B N   1 
ATOM   292 C CA  . CYS A 1 48 ? 11.765 15.989  21.218 1.00   24.91 ? 48   CYS B CA  1 
ATOM   293 C C   . CYS A 1 48 ? 11.956 16.138  19.724 1.00   25.85 ? 48   CYS B C   1 
ATOM   294 O O   . CYS A 1 48 ? 11.655 17.186  19.156 1.00   28.25 ? 48   CYS B O   1 
ATOM   295 C CB  . CYS A 1 48 ? 13.109 15.990  21.959 1.00   24.01 ? 48   CYS B CB  1 
ATOM   296 S SG  . CYS A 1 48 ? 14.286 17.254  21.472 1.00   27.23 ? 48   CYS B SG  1 
ATOM   297 N N   . PHE A 1 49 ? 12.489 15.105  19.083 1.00   26.71 ? 49   PHE B N   1 
ATOM   298 C CA  . PHE A 1 49 ? 12.577 15.087  17.627 1.00   27.33 ? 49   PHE B CA  1 
ATOM   299 C C   . PHE A 1 49 ? 11.193 14.892  17.048 1.00   27.55 ? 49   PHE B C   1 
ATOM   300 O O   . PHE A 1 49 ? 10.949 15.230  15.903 1.00   29.10 ? 49   PHE B O   1 
ATOM   301 C CB  . PHE A 1 49 ? 13.449 13.931  17.139 1.00   26.80 ? 49   PHE B CB  1 
ATOM   302 C CG  . PHE A 1 49 ? 14.836 13.954  17.714 1.00   27.42 ? 49   PHE B CG  1 
ATOM   303 C CD1 . PHE A 1 49 ? 15.445 15.155  18.078 1.00   27.90 ? 49   PHE B CD1 1 
ATOM   304 C CD2 . PHE A 1 49 ? 15.539 12.772  17.887 1.00   27.02 ? 49   PHE B CD2 1 
ATOM   305 C CE1 . PHE A 1 49 ? 16.723 15.170  18.624 1.00   31.21 ? 49   PHE B CE1 1 
ATOM   306 C CE2 . PHE A 1 49 ? 16.820 12.779  18.416 1.00   30.29 ? 49   PHE B CE2 1 
ATOM   307 C CZ  . PHE A 1 49 ? 17.412 13.981  18.792 1.00   32.84 ? 49   PHE B CZ  1 
ATOM   308 N N   . ARG A 1 50 ? 10.305 14.308  17.844 1.00   27.13 ? 50   ARG B N   1 
ATOM   309 C CA  . ARG A 1 50 ? 8.924  14.154  17.443 1.00   28.78 ? 50   ARG B CA  1 
ATOM   310 C C   . ARG A 1 50 ? 8.043  14.738  18.532 1.00   30.05 ? 50   ARG B C   1 
ATOM   311 O O   . ARG A 1 50 ? 8.413  14.762  19.712 1.00   32.41 ? 50   ARG B O   1 
ATOM   312 C CB  . ARG A 1 50 ? 8.601  12.673  17.201 1.00   29.47 ? 50   ARG B CB  1 
ATOM   313 C CG  . ARG A 1 50 ? 9.578  12.011  16.210 1.00   30.37 ? 50   ARG B CG  1 
ATOM   314 C CD  . ARG A 1 50 ? 8.989  10.916  15.350 1.00   36.42 ? 50   ARG B CD  1 
ATOM   315 N NE  . ARG A 1 50 ? 9.904  10.505  14.282 1.00   37.35 ? 50   ARG B NE  1 
ATOM   316 C CZ  . ARG A 1 50 ? 11.176 10.167  14.472 1.00   38.28 ? 50   ARG B CZ  1 
ATOM   317 N NH1 . ARG A 1 50 ? 11.699 10.189  15.701 1.00   38.77 ? 50   ARG B NH1 1 
ATOM   318 N NH2 . ARG A 1 50 ? 11.926 9.805   13.436 1.00   31.55 ? 50   ARG B NH2 1 
ATOM   319 N N   . SER A 1 51 ? 6.897  15.259  18.132 1.00   30.02 ? 51   SER B N   1 
ATOM   320 C CA  . SER A 1 51 ? 5.881  15.622  19.083 1.00   30.09 ? 51   SER B CA  1 
ATOM   321 C C   . SER A 1 51 ? 5.515  14.315  19.736 1.00   30.47 ? 51   SER B C   1 
ATOM   322 O O   . SER A 1 51 ? 5.461  13.275  19.079 1.00   28.28 ? 51   SER B O   1 
ATOM   323 C CB  . SER A 1 51 ? 4.674  16.175  18.345 1.00   31.72 ? 51   SER B CB  1 
ATOM   324 O OG  . SER A 1 51 ? 4.840  15.983  16.947 1.00   35.05 ? 51   SER B OG  1 
ATOM   325 N N   . CYS A 1 52 ? 5.275  14.348  21.037 1.00   30.89 ? 52   CYS B N   1 
ATOM   326 C CA  . CYS A 1 52 ? 4.618  13.207  21.630 1.00   32.64 ? 52   CYS B CA  1 
ATOM   327 C C   . CYS A 1 52 ? 3.486  13.552  22.593 1.00   31.46 ? 52   CYS B C   1 
ATOM   328 O O   . CYS A 1 52 ? 3.354  14.681  23.070 1.00   32.65 ? 52   CYS B O   1 
ATOM   329 C CB  . CYS A 1 52 ? 5.635  12.284  22.268 1.00   32.31 ? 52   CYS B CB  1 
ATOM   330 S SG  . CYS A 1 52 ? 6.066  12.864  23.881 1.00   35.06 ? 52   CYS B SG  1 
ATOM   331 N N   . ASP A 1 53 ? 2.641  12.574  22.855 1.00   30.12 ? 53   ASP B N   1 
ATOM   332 C CA  . ASP A 1 53 ? 1.497  12.858  23.688 1.00   28.67 ? 53   ASP B CA  1 
ATOM   333 C C   . ASP A 1 53 ? 1.782  12.462  25.141 1.00   26.84 ? 53   ASP B C   1 
ATOM   334 O O   . ASP A 1 53 ? 2.864  11.967  25.467 1.00   25.50 ? 53   ASP B O   1 
ATOM   335 C CB  . ASP A 1 53 ? 0.248  12.209  23.115 1.00   26.15 ? 53   ASP B CB  1 
ATOM   336 C CG  . ASP A 1 53 ? 0.267  10.734  23.256 1.00   28.34 ? 53   ASP B CG  1 
ATOM   337 O OD1 . ASP A 1 53 ? 1.079  10.268  24.073 1.00   19.55 ? 53   ASP B OD1 1 
ATOM   338 O OD2 . ASP A 1 53 ? -0.496 9.962   22.617 1.00   35.52 ? 53   ASP B OD2 1 
ATOM   339 N N   . LEU A 1 54 ? 0.828  12.716  26.016 1.00   25.59 ? 54   LEU B N   1 
ATOM   340 C CA  . LEU A 1 54 ? 1.095  12.611  27.434 1.00   26.01 ? 54   LEU B CA  1 
ATOM   341 C C   . LEU A 1 54 ? 1.292  11.131  27.791 1.00   26.40 ? 54   LEU B C   1 
ATOM   342 O O   . LEU A 1 54 ? 2.100  10.797  28.642 1.00   22.48 ? 54   LEU B O   1 
ATOM   343 C CB  . LEU A 1 54 ? -0.057 13.265  28.224 1.00   26.92 ? 54   LEU B CB  1 
ATOM   344 C CG  . LEU A 1 54 ? -0.406 12.828  29.642 1.00   20.72 ? 54   LEU B CG  1 
ATOM   345 C CD1 . LEU A 1 54 ? 0.682  13.247  30.560 1.00   18.79 ? 54   LEU B CD1 1 
ATOM   346 C CD2 . LEU A 1 54 ? -1.735 13.432  30.063 1.00   20.70 ? 54   LEU B CD2 1 
ATOM   347 N N   . ARG A 1 55 ? 0.564  10.244  27.115 1.00   27.67 ? 55   ARG B N   1 
ATOM   348 C CA  . ARG A 1 55 ? 0.663  8.823   27.426 1.00   29.25 ? 55   ARG B CA  1 
ATOM   349 C C   . ARG A 1 55 ? 2.006  8.234   27.045 1.00   29.94 ? 55   ARG B C   1 
ATOM   350 O O   . ARG A 1 55 ? 2.557  7.395   27.752 1.00   29.63 ? 55   ARG B O   1 
ATOM   351 C CB  . ARG A 1 55 ? -0.505 8.013   26.842 1.00   31.11 ? 55   ARG B CB  1 
ATOM   352 C CG  . ARG A 1 55 ? -1.527 7.620   27.912 1.00   29.24 ? 55   ARG B CG  1 
ATOM   353 C CD  . ARG A 1 55 ? -1.380 8.460   29.210 1.00   37.04 ? 55   ARG B CD  1 
ATOM   354 N NE  . ARG A 1 55 ? -2.647 9.057   29.628 1.00   44.72 ? 55   ARG B NE  1 
ATOM   355 C CZ  . ARG A 1 55 ? -3.464 9.741   28.829 1.00   50.59 ? 55   ARG B CZ  1 
ATOM   356 N NH1 . ARG A 1 55 ? -3.150 9.958   27.557 1.00   53.52 ? 55   ARG B NH1 1 
ATOM   357 N NH2 . ARG A 1 55 ? -4.609 10.210  29.304 1.00   54.89 ? 55   ARG B NH2 1 
ATOM   358 N N   . ARG A 1 56 ? 2.553  8.702   25.937 1.00   31.60 ? 56   ARG B N   1 
ATOM   359 C CA  . ARG A 1 56 ? 3.915  8.350   25.580 1.00   31.55 ? 56   ARG B CA  1 
ATOM   360 C C   . ARG A 1 56 ? 4.842  8.912   26.647 1.00   31.97 ? 56   ARG B C   1 
ATOM   361 O O   . ARG A 1 56 ? 5.589  8.182   27.299 1.00   33.15 ? 56   ARG B O   1 
ATOM   362 C CB  . ARG A 1 56 ? 4.262  8.907   24.201 1.00   31.28 ? 56   ARG B CB  1 
ATOM   363 C CG  . ARG A 1 56 ? 5.596  9.648   24.159 1.00   36.56 ? 56   ARG B CG  1 
ATOM   364 C CD  . ARG A 1 56 ? 6.099  9.488   22.337 0.0000 40.00 ? 56   ARG B CD  1 
ATOM   365 N NE  . ARG A 1 56 ? 6.151  8.444   21.310 0.0000 40.00 ? 56   ARG B NE  1 
ATOM   366 C CZ  . ARG A 1 56 ? 6.463  8.657   20.018 0.0000 40.00 ? 56   ARG B CZ  1 
ATOM   367 N NH1 . ARG A 1 56 ? 6.819  9.798   19.453 0.0000 40.00 ? 56   ARG B NH1 1 
ATOM   368 N NH2 . ARG A 1 56 ? 6.186  7.591   19.262 0.0000 40.00 ? 56   ARG B NH2 1 
ATOM   369 N N   . LEU A 1 57 ? 4.788  10.218  26.853 1.00   32.33 ? 57   LEU B N   1 
ATOM   370 C CA  . LEU A 1 57 ? 5.585  10.791  27.920 1.00   31.57 ? 57   LEU B CA  1 
ATOM   371 C C   . LEU A 1 57 ? 5.515  9.937   29.193 1.00   29.91 ? 57   LEU B C   1 
ATOM   372 O O   . LEU A 1 57 ? 6.536  9.568   29.750 1.00   31.68 ? 57   LEU B O   1 
ATOM   373 C CB  . LEU A 1 57 ? 5.183  12.233  28.185 1.00   31.70 ? 57   LEU B CB  1 
ATOM   374 C CG  . LEU A 1 57 ? 6.264  12.988  28.934 1.00   31.89 ? 57   LEU B CG  1 
ATOM   375 C CD1 . LEU A 1 57 ? 6.792  14.083  28.044 1.00   36.63 ? 57   LEU B CD1 1 
ATOM   376 C CD2 . LEU A 1 57 ? 5.684  13.538  30.163 1.00   29.98 ? 57   LEU B CD2 1 
ATOM   377 N N   . GLU A 1 58 ? 4.315  9.582   29.619 1.00   28.67 ? 58   GLU B N   1 
ATOM   378 C CA  . GLU A 1 58 ? 4.131  8.739   30.808 1.00   29.41 ? 58   GLU B CA  1 
ATOM   379 C C   . GLU A 1 58 ? 4.904  7.412   30.854 1.00   27.98 ? 58   GLU B C   1 
ATOM   380 O O   . GLU A 1 58 ? 5.172  6.884   31.924 1.00   27.02 ? 58   GLU B O   1 
ATOM   381 C CB  . GLU A 1 58 ? 2.645  8.473   31.046 1.00   29.34 ? 58   GLU B CB  1 
ATOM   382 C CG  . GLU A 1 58 ? 2.376  7.983   32.445 1.00   33.13 ? 58   GLU B CG  1 
ATOM   383 C CD  . GLU A 1 58 ? 1.040  8.418   32.982 1.00   37.81 ? 58   GLU B CD  1 
ATOM   384 O OE1 . GLU A 1 58 ? 0.045  8.472   32.208 1.00   40.53 ? 58   GLU B OE1 1 
ATOM   385 O OE2 . GLU A 1 58 ? 0.999  8.688   34.198 1.00   38.49 ? 58   GLU B OE2 1 
ATOM   386 N N   . MET A 1 59 ? 5.259  6.878   29.691 1.00   28.28 ? 59   MET B N   1 
ATOM   387 C CA  . MET A 1 59 ? 5.992  5.620   29.608 1.00   28.90 ? 59   MET B CA  1 
ATOM   388 C C   . MET A 1 59 ? 7.431  5.652   30.134 1.00   28.81 ? 59   MET B C   1 
ATOM   389 O O   . MET A 1 59 ? 8.034  4.604   30.373 1.00   29.12 ? 59   MET B O   1 
ATOM   390 C CB  . MET A 1 59 ? 5.946  5.076   28.183 1.00   28.24 ? 59   MET B CB  1 
ATOM   391 C CG  . MET A 1 59 ? 4.772  4.137   27.975 1.00   35.77 ? 59   MET B CG  1 
ATOM   392 S SD  . MET A 1 59 ? 4.372  3.873   26.261 1.00   45.32 ? 59   MET B SD  1 
ATOM   393 C CE  . MET A 1 59 ? 6.027  3.373   25.580 1.00   43.67 ? 59   MET B CE  1 
ATOM   394 N N   . TYR A 1 60 ? 7.982  6.848   30.299 1.00   28.28 ? 60   TYR B N   1 
ATOM   395 C CA  . TYR A 1 60 ? 9.321  6.998   30.832 1.00   29.09 ? 60   TYR B CA  1 
ATOM   396 C C   . TYR A 1 60 ? 9.308  7.349   32.321 1.00   30.24 ? 60   TYR B C   1 
ATOM   397 O O   . TYR A 1 60 ? 10.319 7.777   32.874 1.00   31.81 ? 60   TYR B O   1 
ATOM   398 C CB  . TYR A 1 60 ? 10.110 8.017   30.003 1.00   28.39 ? 60   TYR B CB  1 
ATOM   399 C CG  . TYR A 1 60 ? 10.259 7.586   28.545 1.00   30.95 ? 60   TYR B CG  1 
ATOM   400 C CD1 . TYR A 1 60 ? 9.334  7.969   27.588 1.00   30.21 ? 60   TYR B CD1 1 
ATOM   401 C CD2 . TYR A 1 60 ? 11.307 6.770   28.141 1.00   26.76 ? 60   TYR B CD2 1 
ATOM   402 C CE1 . TYR A 1 60 ? 9.456  7.574   26.282 1.00   26.20 ? 60   TYR B CE1 1 
ATOM   403 C CE2 . TYR A 1 60 ? 11.433 6.372   26.844 1.00   23.11 ? 60   TYR B CE2 1 
ATOM   404 C CZ  . TYR A 1 60 ? 10.511 6.771   25.908 1.00   26.81 ? 60   TYR B CZ  1 
ATOM   405 O OH  . TYR A 1 60 ? 10.631 6.356   24.585 1.00   23.02 ? 60   TYR B OH  1 
ATOM   406 N N   . CYS A 1 61 ? 8.168  7.147   32.977 1.00   29.92 ? 61   CYS B N   1 
ATOM   407 C CA  . CYS A 1 61 ? 8.122  7.217   34.431 1.00   28.96 ? 61   CYS B CA  1 
ATOM   408 C C   . CYS A 1 61 ? 8.587  5.896   34.993 1.00   29.04 ? 61   CYS B C   1 
ATOM   409 O O   . CYS A 1 61 ? 8.216  4.833   34.493 1.00   28.43 ? 61   CYS B O   1 
ATOM   410 C CB  . CYS A 1 61 ? 6.712  7.541   34.936 1.00   29.35 ? 61   CYS B CB  1 
ATOM   411 S SG  . CYS A 1 61 ? 6.072  9.157   34.420 1.00   27.78 ? 61   CYS B SG  1 
ATOM   412 N N   . ALA A 1 62 ? 9.417  5.961   36.028 1.00   29.33 ? 62   ALA B N   1 
ATOM   413 C CA  . ALA A 1 62 ? 9.924  4.750   36.667 1.00   28.26 ? 62   ALA B CA  1 
ATOM   414 C C   . ALA A 1 62 ? 8.752  3.961   37.216 1.00   27.66 ? 62   ALA B C   1 
ATOM   415 O O   . ALA A 1 62 ? 7.681  4.511   37.439 1.00   26.97 ? 62   ALA B O   1 
ATOM   416 C CB  . ALA A 1 62 ? 10.912 5.101   37.783 1.00   27.21 ? 62   ALA B CB  1 
ATOM   417 N N   . PRO A 1 63 ? 8.953  2.670   37.439 1.00   28.70 ? 63   PRO B N   1 
ATOM   418 C CA  . PRO A 1 63 ? 7.981  1.878   38.189 1.00   29.15 ? 63   PRO B CA  1 
ATOM   419 C C   . PRO A 1 63 ? 7.670  2.569   39.509 1.00   29.66 ? 63   PRO B C   1 
ATOM   420 O O   . PRO A 1 63 ? 8.534  3.258   40.074 1.00   28.96 ? 63   PRO B O   1 
ATOM   421 C CB  . PRO A 1 63 ? 8.726  0.568   38.437 1.00   28.03 ? 63   PRO B CB  1 
ATOM   422 C CG  . PRO A 1 63 ? 9.657  0.464   37.294 1.00   27.84 ? 63   PRO B CG  1 
ATOM   423 C CD  . PRO A 1 63 ? 10.119 1.867   37.026 1.00   29.20 ? 63   PRO B CD  1 
ATOM   424 N N   . LEU A 1 64 ? 6.434  2.399   39.969 1.00   30.71 ? 64   LEU B N   1 
ATOM   425 C CA  . LEU A 1 64 ? 6.031  2.769   41.323 1.00   31.72 ? 64   LEU B CA  1 
ATOM   426 C C   . LEU A 1 64 ? 6.786  1.979   42.400 1.00   31.42 ? 64   LEU B C   1 
ATOM   427 O O   . LEU A 1 64 ? 7.911  2.337   42.773 1.00   30.09 ? 64   LEU B O   1 
ATOM   428 C CB  . LEU A 1 64 ? 4.521  2.559   41.488 1.00   32.34 ? 64   LEU B CB  1 
ATOM   429 C CG  . LEU A 1 64 ? 3.672  3.768   41.912 1.00   32.92 ? 64   LEU B CG  1 
ATOM   430 C CD1 . LEU A 1 64 ? 2.818  3.382   43.148 1.00   28.28 ? 64   LEU B CD1 1 
ATOM   431 C CD2 . LEU A 1 64 ? 4.552  5.000   42.206 1.00   29.63 ? 64   LEU B CD2 1 
ATOM   432 N N   . LYS A 1 65 ? 6.141  0.925   42.906 1.00   32.22 ? 65   LYS B N   1 
ATOM   433 C CA  . LYS A 1 65 ? 6.760  -0.029  43.841 1.00   33.60 ? 65   LYS B CA  1 
ATOM   434 C C   . LYS A 1 65 ? 6.244  0.021   45.282 1.00   33.86 ? 65   LYS B C   1 
ATOM   435 O O   . LYS A 1 65 ? 6.076  -1.024  45.905 1.00   34.66 ? 65   LYS B O   1 
ATOM   436 C CB  . LYS A 1 65 ? 8.290  0.049   43.820 1.00   34.15 ? 65   LYS B CB  1 
ATOM   437 C CG  . LYS A 1 65 ? 9.324  1.516   44.016 0.0000 40.00 ? 65   LYS B CG  1 
ATOM   438 C CD  . LYS A 1 65 ? 10.020 2.835   44.367 0.0000 40.00 ? 65   LYS B CD  1 
ATOM   439 C CE  . LYS A 1 65 ? 10.678 2.814   45.750 0.0000 40.00 ? 65   LYS B CE  1 
ATOM   440 N NZ  . LYS A 1 65 ? 11.704 3.847   45.801 0.0000 40.00 ? 65   LYS B NZ  1 
ATOM   441 N N   . PRO A 1 66 ? 5.994  1.219   45.811 1.00   34.35 ? 66   PRO B N   1 
ATOM   442 C CA  . PRO A 1 66 ? 5.694  1.384   47.244 1.00   34.16 ? 66   PRO B CA  1 
ATOM   443 C C   . PRO A 1 66 ? 4.807  0.252   47.801 1.00   34.89 ? 66   PRO B C   1 
ATOM   444 O O   . PRO A 1 66 ? 3.748  -0.070  47.167 1.00   35.32 ? 66   PRO B O   1 
ATOM   445 C CB  . PRO A 1 66 ? 4.929  2.711   47.279 1.00   34.64 ? 66   PRO B CB  1 
ATOM   446 C CG  . PRO A 1 66 ? 5.480  3.507   46.103 1.00   33.74 ? 66   PRO B CG  1 
ATOM   447 C CD  . PRO A 1 66 ? 5.959  2.506   45.085 1.00   33.67 ? 66   PRO B CD  1 
HETATM 448 C C1  . C15 B 2 .  ? 20.117 6.810   31.325 1.00   58.31 ? 1067 C15 B C1  1 
HETATM 449 C C2  . C15 B 2 .  ? 20.133 8.285   30.934 1.00   56.70 ? 1067 C15 B C2  1 
HETATM 450 C C3  . C15 B 2 .  ? 21.113 8.546   29.791 1.00   57.46 ? 1067 C15 B C3  1 
HETATM 451 C C5  . C15 B 2 .  ? 18.230 19.244  38.137 1.00   40.49 ? 1067 C15 B C5  1 
HETATM 452 C C6  . C15 B 2 .  ? 18.298 17.740  37.999 1.00   41.90 ? 1067 C15 B C6  1 
HETATM 453 C C7  . C15 B 2 .  ? 17.310 17.221  36.954 1.00   35.12 ? 1067 C15 B C7  1 
HETATM 454 C C8  . C15 B 2 .  ? 17.889 16.011  36.222 1.00   32.59 ? 1067 C15 B C8  1 
HETATM 455 N N1  . C15 B 2 .  ? 21.517 9.938   29.707 1.00   52.56 ? 1067 C15 B N1  1 
HETATM 456 C C9  . C15 B 2 .  ? 18.283 16.353  34.791 1.00   36.07 ? 1067 C15 B C9  1 
HETATM 457 C C10 . C15 B 2 .  ? 18.433 15.074  33.970 1.00   37.19 ? 1067 C15 B C10 1 
HETATM 458 C C11 . C15 B 2 .  ? 19.487 15.218  32.886 1.00   40.54 ? 1067 C15 B C11 1 
HETATM 459 C C12 . C15 B 2 .  ? 20.213 13.905  32.599 1.00   37.91 ? 1067 C15 B C12 1 
HETATM 460 C C13 . C15 B 2 .  ? 19.844 13.385  31.215 1.00   36.55 ? 1067 C15 B C13 1 
HETATM 461 C C14 . C15 B 2 .  ? 20.791 12.291  30.755 1.00   38.11 ? 1067 C15 B C14 1 
HETATM 462 C C15 . C15 B 2 .  ? 20.824 12.239  29.234 1.00   45.17 ? 1067 C15 B C15 1 
HETATM 463 C C16 . C15 B 2 .  ? 20.919 10.810  28.719 1.00   48.49 ? 1067 C15 B C16 1 
HETATM 464 S S1  . C15 B 2 .  ? 18.459 6.330   31.801 1.00   61.40 ? 1067 C15 B S1  1 
HETATM 465 O O1S . C15 B 2 .  ? 18.538 5.294   32.796 1.00   56.21 ? 1067 C15 B O1S 1 
HETATM 466 O O2S . C15 B 2 .  ? 17.756 7.477   32.336 1.00   58.04 ? 1067 C15 B O2S 1 
HETATM 467 O O3S . C15 B 2 .  ? 17.605 5.688   30.400 1.00   58.19 ? 1067 C15 B O3S 1 
HETATM 468 O O   . HOH C 3 .  ? 5.927  23.343  20.651 1.00   31.77 ? 2001 HOH B O   1 
HETATM 469 O O   . HOH C 3 .  ? 11.791 22.918  21.278 1.00   45.51 ? 2002 HOH B O   1 
HETATM 470 O O   . HOH C 3 .  ? 7.005  19.199  39.272 1.00   32.97 ? 2003 HOH B O   1 
HETATM 471 O O   . HOH C 3 .  ? 16.412 22.926  27.193 1.00   35.26 ? 2004 HOH B O   1 
HETATM 472 O O   . HOH C 3 .  ? 11.247 22.372  24.004 1.00   37.28 ? 2005 HOH B O   1 
HETATM 473 O O   . HOH C 3 .  ? 8.026  20.065  36.265 1.00   39.27 ? 2006 HOH B O   1 
HETATM 474 O O   . HOH C 3 .  ? 11.880 24.690  31.866 1.00   32.22 ? 2007 HOH B O   1 
HETATM 475 O O   . HOH C 3 .  ? 12.593 21.029  41.243 1.00   43.88 ? 2008 HOH B O   1 
HETATM 476 O O   . HOH C 3 .  ? 3.996  10.636  40.200 1.00   52.46 ? 2009 HOH B O   1 
HETATM 477 O O   . HOH C 3 .  ? 10.309 13.085  39.181 1.00   31.88 ? 2010 HOH B O   1 
HETATM 478 O O   . HOH C 3 .  ? 11.571 10.444  44.649 1.00   38.95 ? 2011 HOH B O   1 
HETATM 479 O O   . HOH C 3 .  ? 15.369 2.548   31.117 1.00   11.87 ? 2012 HOH B O   1 
HETATM 480 O O   . HOH C 3 .  ? 0.879  6.072   29.823 1.00   26.73 ? 2013 HOH B O   1 
HETATM 481 O O   . HOH C 3 .  ? -7.278 10.193  25.110 1.00   47.62 ? 2014 HOH B O   1 
HETATM 482 O O   . HOH C 3 .  ? 17.709 3.310   34.023 1.00   25.14 ? 2015 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  ?  ?   ?   B . n 
A 1 2  PRO 2  2  ?  ?   ?   B . n 
A 1 3  GLU 3  3  3  GLU GLU B . n 
A 1 4  THR 4  4  4  THR THR B . n 
A 1 5  LEU 5  5  5  LEU LEU B . n 
A 1 6  CYS 6  6  6  CYS CYS B . n 
A 1 7  GLY 7  7  7  GLY GLY B . n 
A 1 8  ALA 8  8  8  ALA ALA B . n 
A 1 9  GLU 9  9  9  GLU GLU B . n 
A 1 10 LEU 10 10 10 LEU LEU B . n 
A 1 11 VAL 11 11 11 VAL VAL B . n 
A 1 12 ASP 12 12 12 ASP ASP B . n 
A 1 13 ALA 13 13 13 ALA ALA B . n 
A 1 14 LEU 14 14 14 LEU LEU B . n 
A 1 15 GLN 15 15 15 GLN GLN B . n 
A 1 16 PHE 16 16 16 PHE PHE B . n 
A 1 17 VAL 17 17 17 VAL VAL B . n 
A 1 18 CYS 18 18 18 CYS CYS B . n 
A 1 19 GLY 19 19 19 GLY GLY B . n 
A 1 20 ASP 20 20 20 ASP ASP B . n 
A 1 21 ARG 21 21 21 ARG ARG B . n 
A 1 22 GLY 22 22 22 GLY GLY B . n 
A 1 23 PHE 23 23 23 PHE PHE B . n 
A 1 24 TYR 24 24 24 TYR TYR B . n 
A 1 25 PHE 25 25 25 PHE PHE B . n 
A 1 26 ASN 26 26 26 ASN ASN B . n 
A 1 27 LYS 27 27 27 LYS LYS B . n 
A 1 28 PRO 28 28 28 PRO PRO B . n 
A 1 29 THR 29 29 29 THR THR B . n 
A 1 30 GLY 30 30 30 GLY GLY B . n 
A 1 31 TYR 31 31 31 TYR TYR B . n 
A 1 32 GLY 32 32 ?  ?   ?   B . n 
A 1 33 SER 33 33 ?  ?   ?   B . n 
A 1 34 SER 34 34 ?  ?   ?   B . n 
A 1 35 SER 35 35 ?  ?   ?   B . n 
A 1 36 ARG 36 36 ?  ?   ?   B . n 
A 1 37 ARG 37 37 ?  ?   ?   B . n 
A 1 38 ALA 38 38 ?  ?   ?   B . n 
A 1 39 PRO 39 39 39 PRO PRO B . n 
A 1 40 GLN 40 40 40 GLN GLN B . n 
A 1 41 THR 41 41 41 THR THR B . n 
A 1 42 GLY 42 42 42 GLY GLY B . n 
A 1 43 ILE 43 43 43 ILE ILE B . n 
A 1 44 VAL 44 44 44 VAL VAL B . n 
A 1 45 ASP 45 45 45 ASP ASP B . n 
A 1 46 GLU 46 46 46 GLU GLU B . n 
A 1 47 CYS 47 47 47 CYS CYS B . n 
A 1 48 CYS 48 48 48 CYS CYS B . n 
A 1 49 PHE 49 49 49 PHE PHE B . n 
A 1 50 ARG 50 50 50 ARG ARG B . n 
A 1 51 SER 51 51 51 SER SER B . n 
A 1 52 CYS 52 52 52 CYS CYS B . n 
A 1 53 ASP 53 53 53 ASP ASP B . n 
A 1 54 LEU 54 54 54 LEU LEU B . n 
A 1 55 ARG 55 55 55 ARG ARG B . n 
A 1 56 ARG 56 56 56 ARG ARG B . n 
A 1 57 LEU 57 57 57 LEU LEU B . n 
A 1 58 GLU 58 58 58 GLU GLU B . n 
A 1 59 MET 59 59 59 MET MET B . n 
A 1 60 TYR 60 60 60 TYR TYR B . n 
A 1 61 CYS 61 61 61 CYS CYS B . n 
A 1 62 ALA 62 62 62 ALA ALA B . n 
A 1 63 PRO 63 63 63 PRO PRO B . n 
A 1 64 LEU 64 64 64 LEU LEU B . n 
A 1 65 LYS 65 65 65 LYS LYS B . n 
A 1 66 PRO 66 66 66 PRO PRO B . n 
A 1 67 ALA 67 67 ?  ?   ?   B . n 
A 1 68 LYS 68 68 ?  ?   ?   B . n 
A 1 69 SER 69 69 ?  ?   ?   B . n 
A 1 70 ALA 70 70 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 C15 1  1067 1067 C15 C15 B . 
C 3 HOH 1  2001 2001 HOH HOH B . 
C 3 HOH 2  2002 2002 HOH HOH B . 
C 3 HOH 3  2003 2003 HOH HOH B . 
C 3 HOH 4  2004 2004 HOH HOH B . 
C 3 HOH 5  2005 2005 HOH HOH B . 
C 3 HOH 6  2006 2006 HOH HOH B . 
C 3 HOH 7  2007 2007 HOH HOH B . 
C 3 HOH 8  2008 2008 HOH HOH B . 
C 3 HOH 9  2009 2009 HOH HOH B . 
C 3 HOH 10 2010 2010 HOH HOH B . 
C 3 HOH 11 2011 2011 HOH HOH B . 
C 3 HOH 12 2012 2012 HOH HOH B . 
C 3 HOH 13 2013 2013 HOH HOH B . 
C 3 HOH 14 2014 2014 HOH HOH B . 
C 3 HOH 15 2015 2015 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-25 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_PDB_rev             
2 4 'Structure model' database_PDB_rev_record      
3 4 'Structure model' exptl_crystal_grow           
4 4 'Structure model' pdbx_database_proc           
5 4 'Structure model' pdbx_database_status         
6 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         10.2011 
_pdbx_refine_tls.origin_y         10.2744 
_pdbx_refine_tls.origin_z         29.3898 
_pdbx_refine_tls.T[1][1]          0.0692 
_pdbx_refine_tls.T[2][2]          0.0224 
_pdbx_refine_tls.T[3][3]          0.0707 
_pdbx_refine_tls.T[1][2]          -0.0384 
_pdbx_refine_tls.T[1][3]          0.0555 
_pdbx_refine_tls.T[2][3]          -0.0255 
_pdbx_refine_tls.L[1][1]          17.2111 
_pdbx_refine_tls.L[2][2]          10.5768 
_pdbx_refine_tls.L[3][3]          10.0880 
_pdbx_refine_tls.L[1][2]          1.0050 
_pdbx_refine_tls.L[1][3]          -4.9461 
_pdbx_refine_tls.L[2][3]          0.3103 
_pdbx_refine_tls.S[1][1]          -0.5984 
_pdbx_refine_tls.S[1][2]          0.4717 
_pdbx_refine_tls.S[1][3]          -1.3821 
_pdbx_refine_tls.S[2][1]          -0.0235 
_pdbx_refine_tls.S[2][2]          -0.1347 
_pdbx_refine_tls.S[2][3]          -0.3547 
_pdbx_refine_tls.S[3][1]          1.2472 
_pdbx_refine_tls.S[3][2]          -0.1393 
_pdbx_refine_tls.S[3][3]          0.7331 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    B 
_pdbx_refine_tls_group.beg_auth_seq_id     3 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    B 
_pdbx_refine_tls_group.end_auth_seq_id     66 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.19 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             1GZY 
_pdbx_entry_details.compound_details     
;INSULIN-LIKE GROWTH FACTORS,ARE FUNCTIONALLY AND
 STRUCTURALLY RELATED TO INSULIN WITH HIGHER GROWTH-PROMOTING
 ACTIVITY.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG B TYR 31 ? ? CD1 B TYR 31 ? ? 1.468 1.387 0.081 0.013 N 
2 1 CB B GLN 40 ? ? CG  B GLN 40 ? ? 2.183 1.521 0.662 0.027 N 
3 1 CG B ARG 56 ? ? CD  B ARG 56 ? ? 1.897 1.515 0.382 0.025 N 
4 1 CB B LYS 65 ? ? CG  B LYS 65 ? ? 1.805 1.521 0.284 0.027 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B GLN 40 ? ? CG B GLN 40 ? ? CD  B GLN 40 ? ? 144.01 111.60 32.41 2.60 N 
2 1 CG B ARG 56 ? ? CD B ARG 56 ? ? NE  B ARG 56 ? ? 137.96 111.80 26.16 2.10 N 
3 1 NE B ARG 56 ? ? CZ B ARG 56 ? ? NH1 B ARG 56 ? ? 127.53 120.30 7.23  0.50 N 
4 1 NE B ARG 56 ? ? CZ B ARG 56 ? ? NH2 B ARG 56 ? ? 111.64 120.30 -8.66 0.50 N 
5 1 CA B LYS 65 ? ? CB B LYS 65 ? ? CG  B LYS 65 ? ? 127.72 113.40 14.32 2.20 N 
6 1 CB B LYS 65 ? ? CG B LYS 65 ? ? CD  B LYS 65 ? ? 169.92 111.60 58.32 2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN B 40 ? ? -60.49 -177.99 
2 1 THR B 41 ? ? 163.42 147.48  
3 1 LEU B 64 ? ? -62.43 -98.12  
4 1 LYS B 65 ? ? 109.79 -39.86  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   THR 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    29 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    30 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            133.95 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 B C15 1067 ? C1N ? B C15 1 C1N 
2 1 N 1 B C15 1067 ? C2N ? B C15 1 C2N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 1  ? A GLY 1  
2  1 Y 1 B PRO 2  ? A PRO 2  
3  1 Y 1 B GLY 32 ? A GLY 32 
4  1 Y 1 B SER 33 ? A SER 33 
5  1 Y 1 B SER 34 ? A SER 34 
6  1 Y 1 B SER 35 ? A SER 35 
7  1 Y 1 B ARG 36 ? A ARG 36 
8  1 Y 1 B ARG 37 ? A ARG 37 
9  1 Y 1 B ALA 38 ? A ALA 38 
10 1 Y 1 B ALA 67 ? A ALA 67 
11 1 Y 1 B LYS 68 ? A LYS 68 
12 1 Y 1 B SER 69 ? A SER 69 
13 1 Y 1 B ALA 70 ? A ALA 70 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE C15 
3 water                                               HOH 
#