data_1GZZ
# 
_entry.id   1GZZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1GZZ         
PDBE  EBI-9910     
WWPDB D_1290009910 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GZR unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; ESRF DATA'                 
PDB 1GZY unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; IN-HOUSE DATA'             
PDB 1H02 unspecified 'HUMAN INSULIN-LIKE GROWTH FACTOR; DARESBURY DATA'            
PDB 1H59 unspecified 'COMPLEX OF IGFBP-5 WITH IGF-I'                               
PDB 1IMX unspecified '1.8 ANGSTROM CRYSTAL STRUCTURE OF IGF-1'                     
PDB 2GF1 unspecified 'INSULIN-LIKE GROWTH FACTOR (NMR, MINIMUM AVERAGE STRUCTURE)' 
PDB 3GF1 unspecified 'INSULIN-LIKE GROWTH FACTOR (NMR, 10 STRUCTURES)'             
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1GZZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brzozowski, A.M.' 1 
'Dodson, E.J.'     2 
'Dodson, G.G.'     3 
'Murshudov, G.'    4 
'Verma, C.'        5 
'Turkenburg, J.P.' 6 
'De Bree, F.M.'    7 
'Dauter, Z.'       8 
# 
_citation.id                        primary 
_citation.title                     
'Structural Origins of the Functional Divergence of Human Insulin-Like Growth Factor-I and Insulin' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                9389 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12135360 
_citation.pdbx_database_id_DOI      10.1021/BI020084J 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Brzozowski, A.M.' 1 ? 
primary 'Dodson, E.J.'     2 ? 
primary 'Dodson, G.G.'     3 ? 
primary 'Murshudov, G.'    4 ? 
primary 'Verma, C.'        5 ? 
primary 'Turkenburg, J.P.' 6 ? 
primary 'De Bree, F.M.'    7 ? 
primary 'Dauter, Z.'       8 ? 
# 
_cell.entry_id           1GZZ 
_cell.length_a           30.723 
_cell.length_b           69.282 
_cell.length_c           64.528 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1GZZ 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INSULIN-LIKE GROWTH FACTOR I'                      7663.752 1  ? ? ? ? 
2 non-polymer syn N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE 336.554  1  ? ? ? ? 
3 water       nat water                                               18.015   13 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SOMATOMEDIN C, IGF1, IBP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
_entity_poly.pdbx_seq_one_letter_code_can   GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  GLU n 
1 4  THR n 
1 5  LEU n 
1 6  CYS n 
1 7  GLY n 
1 8  ALA n 
1 9  GLU n 
1 10 LEU n 
1 11 VAL n 
1 12 ASP n 
1 13 ALA n 
1 14 LEU n 
1 15 GLN n 
1 16 PHE n 
1 17 VAL n 
1 18 CYS n 
1 19 GLY n 
1 20 ASP n 
1 21 ARG n 
1 22 GLY n 
1 23 PHE n 
1 24 TYR n 
1 25 PHE n 
1 26 ASN n 
1 27 LYS n 
1 28 PRO n 
1 29 THR n 
1 30 GLY n 
1 31 TYR n 
1 32 GLY n 
1 33 SER n 
1 34 SER n 
1 35 SER n 
1 36 ARG n 
1 37 ARG n 
1 38 ALA n 
1 39 PRO n 
1 40 GLN n 
1 41 THR n 
1 42 GLY n 
1 43 ILE n 
1 44 VAL n 
1 45 ASP n 
1 46 GLU n 
1 47 CYS n 
1 48 CYS n 
1 49 PHE n 
1 50 ARG n 
1 51 SER n 
1 52 CYS n 
1 53 ASP n 
1 54 LEU n 
1 55 ARG n 
1 56 ARG n 
1 57 LEU n 
1 58 GLU n 
1 59 MET n 
1 60 TYR n 
1 61 CYS n 
1 62 ALA n 
1 63 PRO n 
1 64 LEU n 
1 65 LYS n 
1 66 PRO n 
1 67 ALA n 
1 68 LYS n 
1 69 SER n 
1 70 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IGFA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P01343 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1GZZ 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 70 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01343 
_struct_ref_seq.db_align_beg                  49 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  118 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       70 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                             ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                            ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                          ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                     ? 'C4 H7 N O4'       133.103 
C15 non-polymer         . N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE ? 'C17 H38 N O3 S 1' 336.554 
CYS 'L-peptide linking' y CYSTEINE                                            ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                           ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                     ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                             ? 'C2 H5 N O2'       75.067  
HOH non-polymer         . WATER                                               ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                          ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                             ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                              ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                          ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                       ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                             ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                              ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                           ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                            ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                              ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1GZZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE PROTEIN WAS CRYSTALLIZED BY THE HANGING DROP METHOD IN WHICH DROPS WERE COMPOSED OF VARIOUS RATIOS OF HIGF-I AT 7MG/ML (IN H2O) WITH RESERVOIR SOLUTION CONSISTING OF 0.1M TRIS.HCL PH 7.5, 12-15% (W/V) PEG 2K AND 5MM SB12 DETERGENT.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.83 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.83 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1GZZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   3285 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            0.07400 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.45400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1GZZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     2840 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.600 
_refine.ls_number_reflns_R_free                  301 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.919 
_refine.correlation_coeff_Fo_to_Fc_free          0.903 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE GEOMETRY OF THE N- AND CREMARK 3 T BREAK IN THE MAIN CHAIN, IS DIFFICULT TO DETERMINE FORM THE LOCAL ELECTRON DENSITY. THEY HAVE INTENTIONALLY NOT BEEN REGULARISED.
;
_refine.pdbx_starting_model                      'PDB ENTRY 4INS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.428 
_refine.pdbx_overall_ESU_R_Free                  0.276 
_refine.overall_SU_ML                            0.128 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.137 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        463 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               496 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011 0.021 ? 493 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_angle_other_deg            3.259 2.027 ? 663 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_chiral_restr               9.596 5.000 ? 58  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004 0.020 ? 368 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.297 0.200 ? 191 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.150 0.200 ? 16  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.348 0.200 ? 28  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.481 0.200 ? 6   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.215 1.500 ? 297 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.912 2.000 ? 474 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.357 3.000 ? 196 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.989 4.500 ? 189 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.36 
_refine_ls_shell.number_reflns_R_work             190 
_refine_ls_shell.R_factor_R_work                  0.3810 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.5050 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             24 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1GZZ 
_struct.title                     'Human Insulin-like growth factor; Hamburg data' 
_struct.pdbx_descriptor           'INSULIN-LIKE GROWTH FACTOR I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1GZZ 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR' 
_struct_keywords.text            'GROWTH FACTOR, INSULIN FAMILY, IGF-1, PLASMA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 6  ? GLY A 19 ? CYS B 6  GLY B 19 1 ? 14 
HELX_P HELX_P2 2 ASP A 20 ? GLY A 22 ? ASP B 20 GLY B 22 5 ? 3  
HELX_P HELX_P3 3 GLY A 42 ? CYS A 48 ? GLY B 42 CYS B 48 1 ? 7  
HELX_P HELX_P4 4 ASP A 53 ? MET A 59 ? ASP B 53 MET B 59 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 48 SG ? ? B CYS 6  B CYS 48 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 61 SG ? ? B CYS 18 B CYS 61 1_555 ? ? ? ? ? ? ? 1.993 ? 
disulf3 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 52 SG ? ? B CYS 47 B CYS 52 1_555 ? ? ? ? ? ? ? 2.013 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           30 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            30 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   TYR 
_struct_mon_prot_cis.pdbx_label_seq_id_2    31 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    TYR 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     31 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       13.75 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE C15 B1067' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 PHE A 16 ? PHE B 16 . ? 1_555 ? 
2 AC1 4 PHE A 25 ? PHE B 25 . ? 1_555 ? 
3 AC1 4 ASN A 26 ? ASN B 26 . ? 1_555 ? 
4 AC1 4 TYR A 31 ? TYR B 31 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1GZZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1GZZ 
_atom_sites.fract_transf_matrix[1][1]   0.032549 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014434 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015497 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 1  ? 3.721  20.774  12.962 1.00   43.85 ? 1    GLY B N   1 
ATOM   2   C CA  . GLY A 1 1  ? 2.634  20.605  13.967 1.00   43.27 ? 1    GLY B CA  1 
ATOM   3   C C   . GLY A 1 1  ? 3.195  20.059  15.258 1.00   44.10 ? 1    GLY B C   1 
ATOM   4   O O   . GLY A 1 1  ? 2.664  19.101  15.826 1.00   44.38 ? 1    GLY B O   1 
ATOM   5   N N   . PRO A 1 2  ? 4.283  20.677  15.715 1.00   44.17 ? 2    PRO B N   1 
ATOM   6   C CA  . PRO A 1 2  ? 5.080  20.180  16.840 1.00   42.89 ? 2    PRO B CA  1 
ATOM   7   C C   . PRO A 1 2  ? 4.283  19.766  18.087 1.00   43.09 ? 2    PRO B C   1 
ATOM   8   O O   . PRO A 1 2  ? 3.252  19.091  17.990 1.00   41.79 ? 2    PRO B O   1 
ATOM   9   C CB  . PRO A 1 2  ? 5.977  21.377  17.169 1.00   42.82 ? 2    PRO B CB  1 
ATOM   10  C CG  . PRO A 1 2  ? 6.155  22.067  15.880 1.00   42.96 ? 2    PRO B CG  1 
ATOM   11  C CD  . PRO A 1 2  ? 4.839  21.923  15.151 1.00   44.49 ? 2    PRO B CD  1 
ATOM   12  N N   . GLU A 1 3  ? 4.782  20.194  19.248 1.00   42.38 ? 3    GLU B N   1 
ATOM   13  C CA  . GLU A 1 3  ? 4.460  19.617  20.551 1.00   42.01 ? 3    GLU B CA  1 
ATOM   14  C C   . GLU A 1 3  ? 5.539  18.639  20.928 1.00   40.50 ? 3    GLU B C   1 
ATOM   15  O O   . GLU A 1 3  ? 5.360  17.807  21.806 1.00   42.17 ? 3    GLU B O   1 
ATOM   16  C CB  . GLU A 1 3  ? 3.114  18.904  20.571 1.00   43.96 ? 3    GLU B CB  1 
ATOM   17  C CG  . GLU A 1 3  ? 2.492  18.890  21.957 1.00   46.78 ? 3    GLU B CG  1 
ATOM   18  C CD  . GLU A 1 3  ? 1.830  20.218  22.294 1.00   48.36 ? 3    GLU B CD  1 
ATOM   19  O OE1 . GLU A 1 3  ? 2.335  20.906  23.213 1.00   48.01 ? 3    GLU B OE1 1 
ATOM   20  O OE2 . GLU A 1 3  ? 0.819  20.572  21.631 1.00   40.69 ? 3    GLU B OE2 1 
ATOM   21  N N   . THR A 1 4  ? 6.666  18.742  20.243 1.00   37.74 ? 4    THR B N   1 
ATOM   22  C CA  . THR A 1 4  ? 7.891  18.191  20.751 1.00   34.45 ? 4    THR B CA  1 
ATOM   23  C C   . THR A 1 4  ? 8.237  18.886  22.077 1.00   33.76 ? 4    THR B C   1 
ATOM   24  O O   . THR A 1 4  ? 7.958  20.073  22.268 1.00   32.68 ? 4    THR B O   1 
ATOM   25  C CB  . THR A 1 4  ? 9.015  18.367  19.725 1.00   33.70 ? 4    THR B CB  1 
ATOM   26  O OG1 . THR A 1 4  ? 9.402  19.740  19.693 1.00   35.16 ? 4    THR B OG1 1 
ATOM   27  C CG2 . THR A 1 4  ? 8.504  18.108  18.310 1.00   31.76 ? 4    THR B CG2 1 
ATOM   28  N N   . LEU A 1 5  ? 8.839  18.129  22.983 1.00   29.36 ? 5    LEU B N   1 
ATOM   29  C CA  . LEU A 1 5  ? 9.413  18.677  24.194 1.00   29.60 ? 5    LEU B CA  1 
ATOM   30  C C   . LEU A 1 5  ? 10.835 18.234  24.144 1.00   27.69 ? 5    LEU B C   1 
ATOM   31  O O   . LEU A 1 5  ? 11.112 17.061  23.951 1.00   27.77 ? 5    LEU B O   1 
ATOM   32  C CB  . LEU A 1 5  ? 8.745  18.072  25.456 1.00   29.59 ? 5    LEU B CB  1 
ATOM   33  C CG  . LEU A 1 5  ? 7.249  18.319  25.631 1.00   32.90 ? 5    LEU B CG  1 
ATOM   34  C CD1 . LEU A 1 5  ? 6.578  17.250  26.445 1.00   37.53 ? 5    LEU B CD1 1 
ATOM   35  C CD2 . LEU A 1 5  ? 6.995  19.698  26.237 1.00   35.59 ? 5    LEU B CD2 1 
ATOM   36  N N   . CYS A 1 6  ? 11.749 19.170  24.342 1.00   29.31 ? 6    CYS B N   1 
ATOM   37  C CA  . CYS A 1 6  ? 13.168 18.882  24.262 1.00   25.61 ? 6    CYS B CA  1 
ATOM   38  C C   . CYS A 1 6  ? 13.861 19.529  25.458 1.00   28.73 ? 6    CYS B C   1 
ATOM   39  O O   . CYS A 1 6  ? 13.381 20.537  25.998 1.00   28.69 ? 6    CYS B O   1 
ATOM   40  C CB  . CYS A 1 6  ? 13.738 19.460  22.968 1.00   26.10 ? 6    CYS B CB  1 
ATOM   41  S SG  . CYS A 1 6  ? 13.161 18.668  21.445 1.00   24.21 ? 6    CYS B SG  1 
ATOM   42  N N   . GLY A 1 7  ? 15.001 18.966  25.860 1.00   27.71 ? 7    GLY B N   1 
ATOM   43  C CA  . GLY A 1 7  ? 15.846 19.628  26.819 1.00   27.61 ? 7    GLY B CA  1 
ATOM   44  C C   . GLY A 1 7  ? 15.092 19.875  28.111 1.00   25.62 ? 7    GLY B C   1 
ATOM   45  O O   . GLY A 1 7  ? 14.525 18.954  28.671 1.00   25.26 ? 7    GLY B O   1 
ATOM   46  N N   . ALA A 1 8  ? 15.102 21.123  28.565 1.00   24.45 ? 8    ALA B N   1 
ATOM   47  C CA  . ALA A 1 8  ? 14.625 21.511  29.887 1.00   24.37 ? 8    ALA B CA  1 
ATOM   48  C C   . ALA A 1 8  ? 13.142 21.275  29.956 1.00   23.12 ? 8    ALA B C   1 
ATOM   49  O O   . ALA A 1 8  ? 12.630 20.774  30.944 1.00   23.59 ? 8    ALA B O   1 
ATOM   50  C CB  . ALA A 1 8  ? 14.954 23.025  30.155 1.00   23.18 ? 8    ALA B CB  1 
ATOM   51  N N   . GLU A 1 9  ? 12.459 21.631  28.870 1.00   25.34 ? 9    GLU B N   1 
ATOM   52  C CA  . GLU A 1 9  ? 11.020 21.464  28.749 1.00   25.66 ? 9    GLU B CA  1 
ATOM   53  C C   . GLU A 1 9  ? 10.596 20.000  28.925 1.00   26.92 ? 9    GLU B C   1 
ATOM   54  O O   . GLU A 1 9  ? 9.677  19.713  29.697 1.00   26.93 ? 9    GLU B O   1 
ATOM   55  C CB  . GLU A 1 9  ? 10.534 22.037  27.416 1.00   26.67 ? 9    GLU B CB  1 
ATOM   56  C CG  . GLU A 1 9  ? 10.507 23.560  27.422 1.00   28.15 ? 9    GLU B CG  1 
ATOM   57  C CD  . GLU A 1 9  ? 9.840  24.178  26.204 1.00   37.21 ? 9    GLU B CD  1 
ATOM   58  O OE1 . GLU A 1 9  ? 9.542  23.456  25.222 1.00   39.13 ? 9    GLU B OE1 1 
ATOM   59  O OE2 . GLU A 1 9  ? 9.609  25.412  26.227 1.00   42.44 ? 9    GLU B OE2 1 
ATOM   60  N N   . LEU A 1 10 ? 11.277 19.081  28.234 1.00   26.54 ? 10   LEU B N   1 
ATOM   61  C CA  . LEU A 1 10 ? 11.066 17.641  28.425 1.00   28.50 ? 10   LEU B CA  1 
ATOM   62  C C   . LEU A 1 10 ? 11.231 17.226  29.899 1.00   27.87 ? 10   LEU B C   1 
ATOM   63  O O   . LEU A 1 10 ? 10.399 16.522  30.439 1.00   29.60 ? 10   LEU B O   1 
ATOM   64  C CB  . LEU A 1 10 ? 12.042 16.830  27.562 1.00   28.13 ? 10   LEU B CB  1 
ATOM   65  C CG  . LEU A 1 10 ? 11.808 15.319  27.454 1.00   30.44 ? 10   LEU B CG  1 
ATOM   66  C CD1 . LEU A 1 10 ? 10.327 14.981  27.238 1.00   25.40 ? 10   LEU B CD1 1 
ATOM   67  C CD2 . LEU A 1 10 ? 12.690 14.745  26.314 1.00   29.07 ? 10   LEU B CD2 1 
ATOM   68  N N   . VAL A 1 11 ? 12.273 17.701  30.560 1.00   26.15 ? 11   VAL B N   1 
ATOM   69  C CA  . VAL A 1 11 ? 12.481 17.325  31.953 1.00   27.37 ? 11   VAL B CA  1 
ATOM   70  C C   . VAL A 1 11 ? 11.410 17.924  32.879 1.00   27.56 ? 11   VAL B C   1 
ATOM   71  O O   . VAL A 1 11 ? 10.896 17.253  33.780 1.00   25.34 ? 11   VAL B O   1 
ATOM   72  C CB  . VAL A 1 11 ? 13.842 17.820  32.446 1.00   28.09 ? 11   VAL B CB  1 
ATOM   73  C CG1 . VAL A 1 11 ? 14.021 17.498  33.967 1.00   30.59 ? 11   VAL B CG1 1 
ATOM   74  C CG2 . VAL A 1 11 ? 14.970 17.225  31.596 1.00   28.68 ? 11   VAL B CG2 1 
ATOM   75  N N   . ASP A 1 12 ? 11.110 19.205  32.669 1.00   27.18 ? 12   ASP B N   1 
ATOM   76  C CA  . ASP A 1 12 ? 9.992  19.839  33.354 1.00   29.39 ? 12   ASP B CA  1 
ATOM   77  C C   . ASP A 1 12 ? 8.752  18.974  33.237 1.00   27.45 ? 12   ASP B C   1 
ATOM   78  O O   . ASP A 1 12 ? 8.038  18.768  34.216 1.00   28.41 ? 12   ASP B O   1 
ATOM   79  C CB  . ASP A 1 12 ? 9.678  21.187  32.708 1.00   28.09 ? 12   ASP B CB  1 
ATOM   80  C CG  . ASP A 1 12 ? 9.785  22.319  33.670 1.00   34.62 ? 12   ASP B CG  1 
ATOM   81  O OD1 . ASP A 1 12 ? 9.963  22.066  34.891 1.00   35.52 ? 12   ASP B OD1 1 
ATOM   82  O OD2 . ASP A 1 12 ? 9.725  23.510  33.291 1.00   40.92 ? 12   ASP B OD2 1 
ATOM   83  N N   . ALA A 1 13 ? 8.488  18.497  32.028 1.00   26.32 ? 13   ALA B N   1 
ATOM   84  C CA  . ALA A 1 13 ? 7.263  17.728  31.778 1.00   27.46 ? 13   ALA B CA  1 
ATOM   85  C C   . ALA A 1 13 ? 7.309  16.419  32.542 1.00   26.50 ? 13   ALA B C   1 
ATOM   86  O O   . ALA A 1 13 ? 6.299  15.989  33.128 1.00   26.74 ? 13   ALA B O   1 
ATOM   87  C CB  . ALA A 1 13 ? 7.077  17.472  30.252 1.00   25.16 ? 13   ALA B CB  1 
ATOM   88  N N   . LEU A 1 14 ? 8.483  15.787  32.533 1.00   25.80 ? 14   LEU B N   1 
ATOM   89  C CA  . LEU A 1 14 ? 8.680  14.518  33.235 1.00   28.61 ? 14   LEU B CA  1 
ATOM   90  C C   . LEU A 1 14 ? 8.549  14.680  34.755 1.00   28.85 ? 14   LEU B C   1 
ATOM   91  O O   . LEU A 1 14 ? 7.906  13.854  35.420 1.00   27.16 ? 14   LEU B O   1 
ATOM   92  C CB  . LEU A 1 14 ? 10.051 13.913  32.882 1.00   27.79 ? 14   LEU B CB  1 
ATOM   93  C CG  . LEU A 1 14 ? 10.093 13.110  31.570 1.00   29.29 ? 14   LEU B CG  1 
ATOM   94  C CD1 . LEU A 1 14 ? 11.563 12.668  31.235 1.00   26.20 ? 14   LEU B CD1 1 
ATOM   95  C CD2 . LEU A 1 14 ? 9.109  11.895  31.657 1.00   24.32 ? 14   LEU B CD2 1 
ATOM   96  N N   . GLN A 1 15 ? 9.157  15.742  35.293 1.00   27.60 ? 15   GLN B N   1 
ATOM   97  C CA  . GLN A 1 15 ? 9.043  16.045  36.725 1.00   28.00 ? 15   GLN B CA  1 
ATOM   98  C C   . GLN A 1 15 ? 7.581  16.246  37.069 1.00   28.08 ? 15   GLN B C   1 
ATOM   99  O O   . GLN A 1 15 ? 7.102  15.826  38.124 1.00   28.55 ? 15   GLN B O   1 
ATOM   100 C CB  . GLN A 1 15 ? 9.842  17.309  37.109 1.00   25.54 ? 15   GLN B CB  1 
ATOM   101 C CG  . GLN A 1 15 ? 11.371 17.142  36.939 1.00   29.78 ? 15   GLN B CG  1 
ATOM   102 C CD  . GLN A 1 15 ? 12.183 18.190  37.690 1.00   30.28 ? 15   GLN B CD  1 
ATOM   103 O OE1 . GLN A 1 15 ? 13.211 17.857  38.285 1.00   34.66 ? 15   GLN B OE1 1 
ATOM   104 N NE2 . GLN A 1 15 ? 11.731 19.453  37.663 1.00   28.67 ? 15   GLN B NE2 1 
ATOM   105 N N   . PHE A 1 16 ? 6.859  16.916  36.188 1.00   27.83 ? 16   PHE B N   1 
ATOM   106 C CA  . PHE A 1 16 ? 5.486  17.259  36.537 1.00   28.39 ? 16   PHE B CA  1 
ATOM   107 C C   . PHE A 1 16 ? 4.627  16.002  36.472 1.00   26.01 ? 16   PHE B C   1 
ATOM   108 O O   . PHE A 1 16 ? 3.925  15.663  37.395 1.00   26.11 ? 16   PHE B O   1 
ATOM   109 C CB  . PHE A 1 16 ? 4.931  18.324  35.604 1.00   27.10 ? 16   PHE B CB  1 
ATOM   110 C CG  . PHE A 1 16 ? 3.637  18.884  36.058 1.00   28.77 ? 16   PHE B CG  1 
ATOM   111 C CD1 . PHE A 1 16 ? 3.610  19.935  36.956 1.00   27.20 ? 16   PHE B CD1 1 
ATOM   112 C CD2 . PHE A 1 16 ? 2.435  18.337  35.610 1.00   26.31 ? 16   PHE B CD2 1 
ATOM   113 C CE1 . PHE A 1 16 ? 2.404  20.447  37.402 1.00   27.76 ? 16   PHE B CE1 1 
ATOM   114 C CE2 . PHE A 1 16 ? 1.245  18.843  36.042 1.00   25.49 ? 16   PHE B CE2 1 
ATOM   115 C CZ  . PHE A 1 16 ? 1.217  19.905  36.930 1.00   26.72 ? 16   PHE B CZ  1 
ATOM   116 N N   . VAL A 1 17 ? 4.700  15.304  35.365 1.00   25.58 ? 17   VAL B N   1 
ATOM   117 C CA  . VAL A 1 17 ? 3.901  14.101  35.211 1.00   28.04 ? 17   VAL B CA  1 
ATOM   118 C C   . VAL A 1 17 ? 4.292  12.988  36.220 1.00   27.63 ? 17   VAL B C   1 
ATOM   119 O O   . VAL A 1 17 ? 3.441  12.316  36.786 1.00   27.37 ? 17   VAL B O   1 
ATOM   120 C CB  . VAL A 1 17 ? 4.002  13.601  33.743 1.00   29.00 ? 17   VAL B CB  1 
ATOM   121 C CG1 . VAL A 1 17 ? 3.468  12.184  33.617 1.00   28.53 ? 17   VAL B CG1 1 
ATOM   122 C CG2 . VAL A 1 17 ? 3.248  14.593  32.817 1.00   27.38 ? 17   VAL B CG2 1 
ATOM   123 N N   . CYS A 1 18 ? 5.585  12.773  36.420 1.00   27.98 ? 18   CYS B N   1 
ATOM   124 C CA  . CYS A 1 18 ? 6.014  11.649  37.243 1.00   29.35 ? 18   CYS B CA  1 
ATOM   125 C C   . CYS A 1 18 ? 5.935  11.927  38.747 1.00   29.42 ? 18   CYS B C   1 
ATOM   126 O O   . CYS A 1 18 ? 5.772  11.002  39.547 1.00   28.67 ? 18   CYS B O   1 
ATOM   127 C CB  . CYS A 1 18 ? 7.405  11.166  36.813 1.00   29.35 ? 18   CYS B CB  1 
ATOM   128 S SG  . CYS A 1 18 ? 7.355  10.685  35.074 1.00   28.56 ? 18   CYS B SG  1 
ATOM   129 N N   . GLY A 1 19 ? 6.026  13.198  39.127 1.00   28.77 ? 19   GLY B N   1 
ATOM   130 C CA  . GLY A 1 19 ? 5.964  13.560  40.533 1.00   27.91 ? 19   GLY B CA  1 
ATOM   131 C C   . GLY A 1 19 ? 7.076  12.877  41.299 1.00   28.55 ? 19   GLY B C   1 
ATOM   132 O O   . GLY A 1 19 ? 8.242  12.933  40.890 1.00   29.34 ? 19   GLY B O   1 
ATOM   133 N N   . ASP A 1 20 ? 6.727  12.200  42.386 1.00   29.10 ? 20   ASP B N   1 
ATOM   134 C CA  . ASP A 1 20 ? 7.744  11.648  43.276 1.00   30.93 ? 20   ASP B CA  1 
ATOM   135 C C   . ASP A 1 20 ? 8.315  10.302  42.812 1.00   31.55 ? 20   ASP B C   1 
ATOM   136 O O   . ASP A 1 20 ? 9.235  9.778   43.416 1.00   32.16 ? 20   ASP B O   1 
ATOM   137 C CB  . ASP A 1 20 ? 7.256  11.587  44.735 1.00   31.52 ? 20   ASP B CB  1 
ATOM   138 C CG  . ASP A 1 20 ? 5.997  10.747  44.909 1.00   32.06 ? 20   ASP B CG  1 
ATOM   139 O OD1 . ASP A 1 20 ? 5.614  10.018  43.969 1.00   37.98 ? 20   ASP B OD1 1 
ATOM   140 O OD2 . ASP A 1 20 ? 5.326  10.746  45.962 1.00   35.83 ? 20   ASP B OD2 1 
ATOM   141 N N   . ARG A 1 21 ? 7.791  9.755   41.724 1.00   32.75 ? 21   ARG B N   1 
ATOM   142 C CA  . ARG A 1 21 ? 8.275  8.459   41.249 1.00   32.22 ? 21   ARG B CA  1 
ATOM   143 C C   . ARG A 1 21 ? 9.630  8.576   40.574 1.00   31.33 ? 21   ARG B C   1 
ATOM   144 O O   . ARG A 1 21 ? 10.344 7.586   40.437 1.00   33.12 ? 21   ARG B O   1 
ATOM   145 C CB  . ARG A 1 21 ? 7.301  7.852   40.249 1.00   32.38 ? 21   ARG B CB  1 
ATOM   146 C CG  . ARG A 1 21 ? 5.888  7.836   40.714 1.00   30.63 ? 21   ARG B CG  1 
ATOM   147 C CD  . ARG A 1 21 ? 5.032  6.942   39.891 1.00   33.28 ? 21   ARG B CD  1 
ATOM   148 N NE  . ARG A 1 21 ? 4.375  7.663   38.819 1.00   36.20 ? 21   ARG B NE  1 
ATOM   149 C CZ  . ARG A 1 21 ? 3.917  7.082   37.722 1.00   38.10 ? 21   ARG B CZ  1 
ATOM   150 N NH1 . ARG A 1 21 ? 4.060  5.772   37.565 1.00   32.39 ? 21   ARG B NH1 1 
ATOM   151 N NH2 . ARG A 1 21 ? 3.324  7.812   36.778 1.00   35.93 ? 21   ARG B NH2 1 
ATOM   152 N N   . GLY A 1 22 ? 9.973  9.775   40.125 1.00   29.50 ? 22   GLY B N   1 
ATOM   153 C CA  . GLY A 1 22 ? 11.049 9.918   39.164 1.00   28.61 ? 22   GLY B CA  1 
ATOM   154 C C   . GLY A 1 22 ? 10.762 9.334   37.781 1.00   28.13 ? 22   GLY B C   1 
ATOM   155 O O   . GLY A 1 22 ? 9.707  8.773   37.530 1.00   28.73 ? 22   GLY B O   1 
ATOM   156 N N   . PHE A 1 23 ? 11.734 9.463   36.886 1.00   27.78 ? 23   PHE B N   1 
ATOM   157 C CA  . PHE A 1 23 ? 11.561 9.186   35.476 1.00   28.01 ? 23   PHE B CA  1 
ATOM   158 C C   . PHE A 1 23 ? 12.904 8.741   34.910 1.00   28.87 ? 23   PHE B C   1 
ATOM   159 O O   . PHE A 1 23 ? 13.965 8.922   35.516 1.00   26.24 ? 23   PHE B O   1 
ATOM   160 C CB  . PHE A 1 23 ? 11.163 10.466  34.756 1.00   30.64 ? 23   PHE B CB  1 
ATOM   161 C CG  . PHE A 1 23 ? 12.045 11.612  35.080 1.00   30.67 ? 23   PHE B CG  1 
ATOM   162 C CD1 . PHE A 1 23 ? 11.739 12.464  36.138 1.00   32.66 ? 23   PHE B CD1 1 
ATOM   163 C CD2 . PHE A 1 23 ? 13.194 11.835  34.349 1.00   31.08 ? 23   PHE B CD2 1 
ATOM   164 C CE1 . PHE A 1 23 ? 12.585 13.550  36.451 1.00   35.48 ? 23   PHE B CE1 1 
ATOM   165 C CE2 . PHE A 1 23 ? 14.036 12.898  34.648 1.00   37.90 ? 23   PHE B CE2 1 
ATOM   166 C CZ  . PHE A 1 23 ? 13.732 13.760  35.704 1.00   39.16 ? 23   PHE B CZ  1 
ATOM   167 N N   . TYR A 1 24 ? 12.862 8.149   33.733 1.00   28.87 ? 24   TYR B N   1 
ATOM   168 C CA  . TYR A 1 24 ? 14.088 7.675   33.130 1.00   28.66 ? 24   TYR B CA  1 
ATOM   169 C C   . TYR A 1 24 ? 14.035 7.987   31.645 1.00   27.82 ? 24   TYR B C   1 
ATOM   170 O O   . TYR A 1 24 ? 13.000 8.381   31.129 1.00   28.12 ? 24   TYR B O   1 
ATOM   171 C CB  . TYR A 1 24 ? 14.315 6.174   33.428 1.00   29.61 ? 24   TYR B CB  1 
ATOM   172 C CG  . TYR A 1 24 ? 13.191 5.248   33.008 1.00   30.39 ? 24   TYR B CG  1 
ATOM   173 C CD1 . TYR A 1 24 ? 13.191 4.662   31.755 1.00   36.51 ? 24   TYR B CD1 1 
ATOM   174 C CD2 . TYR A 1 24 ? 12.144 4.950   33.863 1.00   35.36 ? 24   TYR B CD2 1 
ATOM   175 C CE1 . TYR A 1 24 ? 12.181 3.821   31.354 1.00   33.01 ? 24   TYR B CE1 1 
ATOM   176 C CE2 . TYR A 1 24 ? 11.119 4.098   33.471 1.00   33.97 ? 24   TYR B CE2 1 
ATOM   177 C CZ  . TYR A 1 24 ? 11.145 3.545   32.207 1.00   36.01 ? 24   TYR B CZ  1 
ATOM   178 O OH  . TYR A 1 24 ? 10.151 2.685   31.785 1.00   41.21 ? 24   TYR B OH  1 
ATOM   179 N N   . PHE A 1 25 ? 15.147 7.831   30.953 1.00   28.60 ? 25   PHE B N   1 
ATOM   180 C CA  . PHE A 1 25 ? 15.205 8.332   29.589 1.00   29.18 ? 25   PHE B CA  1 
ATOM   181 C C   . PHE A 1 25 ? 15.185 7.198   28.559 1.00   30.28 ? 25   PHE B C   1 
ATOM   182 O O   . PHE A 1 25 ? 14.625 7.355   27.474 1.00   29.82 ? 25   PHE B O   1 
ATOM   183 C CB  . PHE A 1 25 ? 16.408 9.277   29.423 1.00   28.84 ? 25   PHE B CB  1 
ATOM   184 C CG  . PHE A 1 25 ? 16.269 10.557  30.208 1.00   26.10 ? 25   PHE B CG  1 
ATOM   185 C CD1 . PHE A 1 25 ? 16.733 10.647  31.521 1.00   29.84 ? 25   PHE B CD1 1 
ATOM   186 C CD2 . PHE A 1 25 ? 15.645 11.658  29.648 1.00   29.56 ? 25   PHE B CD2 1 
ATOM   187 C CE1 . PHE A 1 25 ? 16.586 11.825  32.255 1.00   32.21 ? 25   PHE B CE1 1 
ATOM   188 C CE2 . PHE A 1 25 ? 15.500 12.849  30.376 1.00   31.46 ? 25   PHE B CE2 1 
ATOM   189 C CZ  . PHE A 1 25 ? 15.958 12.934  31.671 1.00   26.85 ? 25   PHE B CZ  1 
ATOM   190 N N   . ASN A 1 26 ? 15.758 6.053   28.920 1.00   29.99 ? 26   ASN B N   1 
ATOM   191 C CA  . ASN A 1 26 ? 15.896 4.942   27.987 1.00   32.89 ? 26   ASN B CA  1 
ATOM   192 C C   . ASN A 1 26 ? 14.980 3.768   28.332 1.00   33.43 ? 26   ASN B C   1 
ATOM   193 O O   . ASN A 1 26 ? 15.130 3.139   29.386 1.00   33.25 ? 26   ASN B O   1 
ATOM   194 C CB  . ASN A 1 26 ? 17.353 4.448   27.922 1.00   32.58 ? 26   ASN B CB  1 
ATOM   195 C CG  . ASN A 1 26 ? 18.293 5.450   27.257 1.00   33.39 ? 26   ASN B CG  1 
ATOM   196 O OD1 . ASN A 1 26 ? 17.863 6.330   26.516 1.00   32.56 ? 26   ASN B OD1 1 
ATOM   197 N ND2 . ASN A 1 26 ? 19.591 5.310   27.521 1.00   37.59 ? 26   ASN B ND2 1 
ATOM   198 N N   . LYS A 1 27 ? 14.052 3.475   27.421 1.00   33.96 ? 27   LYS B N   1 
ATOM   199 C CA  . LYS A 1 27 ? 13.328 2.196   27.395 1.00   32.76 ? 27   LYS B CA  1 
ATOM   200 C C   . LYS A 1 27 ? 14.225 0.988   27.601 1.00   32.67 ? 27   LYS B C   1 
ATOM   201 O O   . LYS A 1 27 ? 15.225 0.818   26.912 1.00   32.64 ? 27   LYS B O   1 
ATOM   202 C CB  . LYS A 1 27 ? 12.542 2.030   26.091 1.00   32.04 ? 27   LYS B CB  1 
ATOM   203 C CG  . LYS A 1 27 ? 12.939 3.004   24.993 1.00   33.08 ? 27   LYS B CG  1 
ATOM   204 C CD  . LYS A 1 27 ? 12.853 2.357   23.617 1.00   34.37 ? 27   LYS B CD  1 
ATOM   205 C CE  . LYS A 1 27 ? 12.843 2.772   23.239 0.0000 40.00 ? 27   LYS B CE  1 
ATOM   206 N NZ  . LYS A 1 27 ? 11.881 2.406   22.201 0.0000 40.00 ? 27   LYS B NZ  1 
ATOM   207 N N   . PRO A 1 28 ? 13.839 0.136   28.541 1.00   33.27 ? 28   PRO B N   1 
ATOM   208 C CA  . PRO A 1 28 ? 14.555 -1.116  28.793 1.00   33.51 ? 28   PRO B CA  1 
ATOM   209 C C   . PRO A 1 28 ? 14.622 -1.974  27.533 1.00   32.94 ? 28   PRO B C   1 
ATOM   210 O O   . PRO A 1 28 ? 13.797 -1.821  26.633 1.00   34.10 ? 28   PRO B O   1 
ATOM   211 C CB  . PRO A 1 28 ? 13.690 -1.819  29.845 1.00   33.64 ? 28   PRO B CB  1 
ATOM   212 C CG  . PRO A 1 28 ? 12.855 -0.771  30.441 1.00   33.62 ? 28   PRO B CG  1 
ATOM   213 C CD  . PRO A 1 28 ? 12.667 0.308   29.416 1.00   33.06 ? 28   PRO B CD  1 
ATOM   214 N N   . THR A 1 29 ? 15.590 -2.873  27.474 1.00   30.89 ? 29   THR B N   1 
ATOM   215 C CA  . THR A 1 29 ? 15.652 -3.821  26.373 1.00   31.13 ? 29   THR B CA  1 
ATOM   216 C C   . THR A 1 29 ? 16.071 -5.220  26.836 1.00   29.34 ? 29   THR B C   1 
ATOM   217 O O   . THR A 1 29 ? 16.520 -5.398  27.968 1.00   28.07 ? 29   THR B O   1 
ATOM   218 C CB  . THR A 1 29 ? 16.590 -3.290  25.256 1.00   31.05 ? 29   THR B CB  1 
ATOM   219 O OG1 . THR A 1 29 ? 16.947 -4.363  24.379 1.00   30.42 ? 29   THR B OG1 1 
ATOM   220 C CG2 . THR A 1 29 ? 17.929 -2.849  25.829 1.00   31.02 ? 29   THR B CG2 1 
ATOM   221 N N   . GLY A 1 30 ? 15.904 -6.204  25.957 1.00   30.35 ? 30   GLY B N   1 
ATOM   222 C CA  . GLY A 1 30 ? 16.585 -7.491  26.075 1.00   29.63 ? 30   GLY B CA  1 
ATOM   223 C C   . GLY A 1 30 ? 16.101 -8.330  27.246 1.00   29.97 ? 30   GLY B C   1 
ATOM   224 O O   . GLY A 1 30 ? 15.648 -7.797  28.253 1.00   30.42 ? 30   GLY B O   1 
ATOM   225 N N   . TYR A 1 31 ? 16.206 -9.648  27.130 1.00   30.91 ? 31   TYR B N   1 
ATOM   226 C CA  . TYR A 1 31 ? 17.008 -10.275 26.096 1.00   31.57 ? 31   TYR B CA  1 
ATOM   227 C C   . TYR A 1 31 ? 16.151 -10.631 24.887 1.00   31.93 ? 31   TYR B C   1 
ATOM   228 O O   . TYR A 1 31 ? 15.101 -11.287 25.031 1.00   32.67 ? 31   TYR B O   1 
ATOM   229 C CB  . TYR A 1 31 ? 17.668 -11.533 26.647 1.00   32.23 ? 31   TYR B CB  1 
ATOM   230 C CG  . TYR A 1 31 ? 18.556 -11.305 27.850 1.00   32.70 ? 31   TYR B CG  1 
ATOM   231 C CD1 . TYR A 1 31 ? 18.308 -10.269 28.745 1.00   32.37 ? 31   TYR B CD1 1 
ATOM   232 C CD2 . TYR A 1 31 ? 19.639 -12.145 28.095 1.00   35.34 ? 31   TYR B CD2 1 
ATOM   233 C CE1 . TYR A 1 31 ? 19.121 -10.069 29.844 1.00   34.19 ? 31   TYR B CE1 1 
ATOM   234 C CE2 . TYR A 1 31 ? 20.456 -11.954 29.188 1.00   36.20 ? 31   TYR B CE2 1 
ATOM   235 C CZ  . TYR A 1 31 ? 20.195 -10.917 30.059 1.00   35.66 ? 31   TYR B CZ  1 
ATOM   236 O OH  . TYR A 1 31 ? 21.017 -10.739 31.146 1.00   38.79 ? 31   TYR B OH  1 
ATOM   237 N N   . ALA A 1 38 ? 19.458 -1.940  17.902 1.00   38.83 ? 38   ALA B N   1 
ATOM   238 C CA  . ALA A 1 38 ? 18.933 -0.733  17.280 1.00   38.37 ? 38   ALA B CA  1 
ATOM   239 C C   . ALA A 1 38 ? 19.261 0.488   18.131 1.00   38.56 ? 38   ALA B C   1 
ATOM   240 O O   . ALA A 1 38 ? 18.356 1.182   18.582 1.00   39.07 ? 38   ALA B O   1 
ATOM   241 C CB  . ALA A 1 38 ? 17.426 -0.856  17.085 1.00   37.89 ? 38   ALA B CB  1 
ATOM   242 N N   . PRO A 1 39 ? 20.551 0.766   18.314 1.00   38.78 ? 39   PRO B N   1 
ATOM   243 C CA  . PRO A 1 39 ? 21.070 1.447   19.505 1.00   38.79 ? 39   PRO B CA  1 
ATOM   244 C C   . PRO A 1 39 ? 20.059 2.233   20.346 1.00   40.78 ? 39   PRO B C   1 
ATOM   245 O O   . PRO A 1 39 ? 18.998 2.651   19.867 1.00   41.10 ? 39   PRO B O   1 
ATOM   246 C CB  . PRO A 1 39 ? 22.119 2.380   18.914 1.00   38.83 ? 39   PRO B CB  1 
ATOM   247 C CG  . PRO A 1 39 ? 22.674 1.566   17.685 1.00   38.88 ? 39   PRO B CG  1 
ATOM   248 C CD  . PRO A 1 39 ? 21.633 0.491   17.347 1.00   38.67 ? 39   PRO B CD  1 
ATOM   249 N N   . GLN A 1 40 ? 20.402 2.435   21.615 1.00   40.97 ? 40   GLN B N   1 
ATOM   250 C CA  . GLN A 1 40 ? 19.424 2.868   22.590 1.00   40.71 ? 40   GLN B CA  1 
ATOM   251 C C   . GLN A 1 40 ? 18.612 4.017   22.026 1.00   40.65 ? 40   GLN B C   1 
ATOM   252 O O   . GLN A 1 40 ? 19.163 4.988   21.508 1.00   41.68 ? 40   GLN B O   1 
ATOM   253 C CB  . GLN A 1 40 ? 20.094 3.253   23.912 1.00   40.91 ? 40   GLN B CB  1 
ATOM   254 C CG  . GLN A 1 40 ? 20.887 2.104   24.548 1.00   44.56 ? 40   GLN B CG  1 
ATOM   255 C CD  . GLN A 1 40 ? 19.997 0.948   24.988 1.00   46.63 ? 40   GLN B CD  1 
ATOM   256 O OE1 . GLN A 1 40 ? 19.237 1.072   25.961 1.00   49.93 ? 40   GLN B OE1 1 
ATOM   257 N NE2 . GLN A 1 40 ? 20.075 -0.167  24.270 1.00   38.74 ? 40   GLN B NE2 1 
ATOM   258 N N   . THR A 1 41 ? 17.295 3.870   22.102 1.00   39.62 ? 41   THR B N   1 
ATOM   259 C CA  . THR A 1 41 ? 16.364 4.942   21.803 1.00   38.60 ? 41   THR B CA  1 
ATOM   260 C C   . THR A 1 41 ? 15.404 5.047   22.980 1.00   37.08 ? 41   THR B C   1 
ATOM   261 O O   . THR A 1 41 ? 15.327 4.141   23.807 1.00   38.43 ? 41   THR B O   1 
ATOM   262 C CB  . THR A 1 41 ? 15.580 4.617   20.521 1.00   38.76 ? 41   THR B CB  1 
ATOM   263 O OG1 . THR A 1 41 ? 14.499 5.545   20.382 1.00   40.45 ? 41   THR B OG1 1 
ATOM   264 C CG2 . THR A 1 41 ? 14.869 3.283   20.660 1.00   39.31 ? 41   THR B CG2 1 
ATOM   265 N N   . GLY A 1 42 ? 14.677 6.151   23.060 1.00   33.68 ? 42   GLY B N   1 
ATOM   266 C CA  . GLY A 1 42 ? 13.792 6.368   24.184 1.00   30.39 ? 42   GLY B CA  1 
ATOM   267 C C   . GLY A 1 42 ? 13.038 7.669   24.058 1.00   29.12 ? 42   GLY B C   1 
ATOM   268 O O   . GLY A 1 42 ? 12.536 7.997   22.988 1.00   28.53 ? 42   GLY B O   1 
ATOM   269 N N   . ILE A 1 43 ? 12.958 8.419   25.149 1.00   28.98 ? 43   ILE B N   1 
ATOM   270 C CA  . ILE A 1 43 ? 12.021 9.527   25.212 1.00   29.22 ? 43   ILE B CA  1 
ATOM   271 C C   . ILE A 1 43 ? 12.400 10.690  24.310 1.00   30.16 ? 43   ILE B C   1 
ATOM   272 O O   . ILE A 1 43 ? 11.518 11.367  23.779 1.00   31.14 ? 43   ILE B O   1 
ATOM   273 C CB  . ILE A 1 43 ? 11.780 10.005  26.669 1.00   27.98 ? 43   ILE B CB  1 
ATOM   274 C CG1 . ILE A 1 43 ? 10.568 10.939  26.729 1.00   29.18 ? 43   ILE B CG1 1 
ATOM   275 C CG2 . ILE A 1 43 ? 13.008 10.681  27.235 1.00   26.80 ? 43   ILE B CG2 1 
ATOM   276 C CD1 . ILE A 1 43 ? 10.163 11.346  28.162 1.00   32.57 ? 43   ILE B CD1 1 
ATOM   277 N N   . VAL A 1 44 ? 13.692 10.958  24.150 1.00   28.40 ? 44   VAL B N   1 
ATOM   278 C CA  . VAL A 1 44 ? 14.083 12.002  23.219 1.00   29.57 ? 44   VAL B CA  1 
ATOM   279 C C   . VAL A 1 44 ? 13.562 11.663  21.817 1.00   29.26 ? 44   VAL B C   1 
ATOM   280 O O   . VAL A 1 44 ? 12.989 12.514  21.139 1.00   30.01 ? 44   VAL B O   1 
ATOM   281 C CB  . VAL A 1 44 ? 15.622 12.232  23.185 1.00   28.98 ? 44   VAL B CB  1 
ATOM   282 C CG1 . VAL A 1 44 ? 15.968 13.213  22.127 1.00   27.58 ? 44   VAL B CG1 1 
ATOM   283 C CG2 . VAL A 1 44 ? 16.090 12.762  24.520 1.00   32.70 ? 44   VAL B CG2 1 
ATOM   284 N N   . ASP A 1 45 ? 13.751 10.414  21.402 1.00   27.27 ? 45   ASP B N   1 
ATOM   285 C CA  . ASP A 1 45 ? 13.304 9.964   20.095 1.00   27.54 ? 45   ASP B CA  1 
ATOM   286 C C   . ASP A 1 45 ? 11.780 10.052  19.903 1.00   27.25 ? 45   ASP B C   1 
ATOM   287 O O   . ASP A 1 45 ? 11.310 10.393  18.816 1.00   25.50 ? 45   ASP B O   1 
ATOM   288 C CB  . ASP A 1 45 ? 13.799 8.542   19.826 1.00   27.04 ? 45   ASP B CB  1 
ATOM   289 C CG  . ASP A 1 45 ? 15.290 8.403   20.041 1.00   29.42 ? 45   ASP B CG  1 
ATOM   290 O OD1 . ASP A 1 45 ? 15.713 8.212   21.206 1.00   36.20 ? 45   ASP B OD1 1 
ATOM   291 O OD2 . ASP A 1 45 ? 16.115 8.480   19.108 1.00   27.55 ? 45   ASP B OD2 1 
ATOM   292 N N   . GLU A 1 46 ? 11.019 9.745   20.950 1.00   25.59 ? 46   GLU B N   1 
ATOM   293 C CA  . GLU A 1 46 ? 9.568  9.650   20.826 1.00   25.77 ? 46   GLU B CA  1 
ATOM   294 C C   . GLU A 1 46 ? 8.884  10.992  21.099 1.00   26.55 ? 46   GLU B C   1 
ATOM   295 O O   . GLU A 1 46 ? 7.810  11.254  20.562 1.00   25.86 ? 46   GLU B O   1 
ATOM   296 C CB  . GLU A 1 46 ? 8.997  8.525   21.706 1.00   25.14 ? 46   GLU B CB  1 
ATOM   297 C CG  . GLU A 1 46 ? 9.598  7.152   21.406 1.00   27.72 ? 46   GLU B CG  1 
ATOM   298 C CD  . GLU A 1 46 ? 9.165  6.053   22.375 1.00   32.55 ? 46   GLU B CD  1 
ATOM   299 O OE1 . GLU A 1 46 ? 8.764  6.360   23.501 1.00   29.32 ? 46   GLU B OE1 1 
ATOM   300 O OE2 . GLU A 1 46 ? 9.236  4.856   22.012 1.00   41.68 ? 46   GLU B OE2 1 
ATOM   301 N N   . CYS A 1 47 ? 9.535  11.847  21.891 1.00   26.11 ? 47   CYS B N   1 
ATOM   302 C CA  . CYS A 1 47 ? 8.937  13.095  22.359 1.00   28.65 ? 47   CYS B CA  1 
ATOM   303 C C   . CYS A 1 47 ? 9.636  14.374  21.870 1.00   29.82 ? 47   CYS B C   1 
ATOM   304 O O   . CYS A 1 47 ? 9.010  15.434  21.791 1.00   29.60 ? 47   CYS B O   1 
ATOM   305 C CB  . CYS A 1 47 ? 8.869  13.105  23.891 1.00   29.31 ? 47   CYS B CB  1 
ATOM   306 S SG  . CYS A 1 47 ? 7.705  11.874  24.536 1.00   33.30 ? 47   CYS B SG  1 
ATOM   307 N N   . CYS A 1 48 ? 10.927 14.286  21.545 1.00   28.52 ? 48   CYS B N   1 
ATOM   308 C CA  . CYS A 1 48 ? 11.667 15.475  21.130 1.00   28.02 ? 48   CYS B CA  1 
ATOM   309 C C   . CYS A 1 48 ? 11.865 15.518  19.625 1.00   28.03 ? 48   CYS B C   1 
ATOM   310 O O   . CYS A 1 48 ? 11.550 16.519  18.982 1.00   30.04 ? 48   CYS B O   1 
ATOM   311 C CB  . CYS A 1 48 ? 13.006 15.568  21.860 1.00   29.00 ? 48   CYS B CB  1 
ATOM   312 S SG  . CYS A 1 48 ? 14.075 16.884  21.242 1.00   23.31 ? 48   CYS B SG  1 
ATOM   313 N N   . PHE A 1 49 ? 12.355 14.427  19.046 1.00   27.24 ? 49   PHE B N   1 
ATOM   314 C CA  . PHE A 1 49 ? 12.513 14.377  17.597 1.00   27.45 ? 49   PHE B CA  1 
ATOM   315 C C   . PHE A 1 49 ? 11.176 14.261  16.866 1.00   28.12 ? 49   PHE B C   1 
ATOM   316 O O   . PHE A 1 49 ? 11.060 14.675  15.715 1.00   26.97 ? 49   PHE B O   1 
ATOM   317 C CB  . PHE A 1 49 ? 13.466 13.254  17.193 1.00   27.58 ? 49   PHE B CB  1 
ATOM   318 C CG  . PHE A 1 49 ? 14.821 13.351  17.841 1.00   27.80 ? 49   PHE B CG  1 
ATOM   319 C CD1 . PHE A 1 49 ? 15.319 14.579  18.267 1.00   25.50 ? 49   PHE B CD1 1 
ATOM   320 C CD2 . PHE A 1 49 ? 15.594 12.219  18.026 1.00   26.01 ? 49   PHE B CD2 1 
ATOM   321 C CE1 . PHE A 1 49 ? 16.559 14.668  18.858 1.00   24.39 ? 49   PHE B CE1 1 
ATOM   322 C CE2 . PHE A 1 49 ? 16.836 12.305  18.613 1.00   25.44 ? 49   PHE B CE2 1 
ATOM   323 C CZ  . PHE A 1 49 ? 17.319 13.532  19.030 1.00   25.26 ? 49   PHE B CZ  1 
ATOM   324 N N   . ARG A 1 50 ? 10.175 13.695  17.540 1.00   28.30 ? 50   ARG B N   1 
ATOM   325 C CA  . ARG A 1 50 ? 8.803  13.724  17.052 1.00   30.17 ? 50   ARG B CA  1 
ATOM   326 C C   . ARG A 1 50 ? 7.876  13.946  18.227 1.00   30.56 ? 50   ARG B C   1 
ATOM   327 O O   . ARG A 1 50 ? 8.294  13.847  19.373 1.00   31.25 ? 50   ARG B O   1 
ATOM   328 C CB  . ARG A 1 50 ? 8.418  12.433  16.313 1.00   30.04 ? 50   ARG B CB  1 
ATOM   329 C CG  . ARG A 1 50 ? 9.484  11.362  16.262 1.00   32.25 ? 50   ARG B CG  1 
ATOM   330 C CD  . ARG A 1 50 ? 9.715  10.737  14.880 1.00   39.97 ? 50   ARG B CD  1 
ATOM   331 N NE  . ARG A 1 50 ? 11.026 10.091  14.827 1.00   45.55 ? 50   ARG B NE  1 
ATOM   332 C CZ  . ARG A 1 50 ? 11.517 9.336   15.811 1.00   46.58 ? 50   ARG B CZ  1 
ATOM   333 N NH1 . ARG A 1 50 ? 10.795 9.109   16.904 1.00   44.98 ? 50   ARG B NH1 1 
ATOM   334 N NH2 . ARG A 1 50 ? 12.722 8.795   15.704 1.00   47.80 ? 50   ARG B NH2 1 
ATOM   335 N N   . SER A 1 51 ? 6.619  14.267  17.954 1.00   30.51 ? 51   SER B N   1 
ATOM   336 C CA  . SER A 1 51 ? 5.702  14.562  19.044 1.00   30.72 ? 51   SER B CA  1 
ATOM   337 C C   . SER A 1 51 ? 5.257  13.265  19.672 1.00   30.12 ? 51   SER B C   1 
ATOM   338 O O   . SER A 1 51 ? 5.157  12.241  19.002 1.00   28.86 ? 51   SER B O   1 
ATOM   339 C CB  . SER A 1 51 ? 4.498  15.353  18.552 1.00   29.05 ? 51   SER B CB  1 
ATOM   340 O OG  . SER A 1 51 ? 4.590  15.534  17.160 1.00   31.53 ? 51   SER B OG  1 
ATOM   341 N N   . CYS A 1 52 ? 5.015  13.317  20.971 1.00   31.47 ? 52   CYS B N   1 
ATOM   342 C CA  . CYS A 1 52 ? 4.356  12.226  21.663 1.00   33.08 ? 52   CYS B CA  1 
ATOM   343 C C   . CYS A 1 52 ? 3.231  12.825  22.465 1.00   32.94 ? 52   CYS B C   1 
ATOM   344 O O   . CYS A 1 52 ? 3.237  14.019  22.746 1.00   33.01 ? 52   CYS B O   1 
ATOM   345 C CB  . CYS A 1 52 ? 5.327  11.520  22.603 1.00   33.08 ? 52   CYS B CB  1 
ATOM   346 S SG  . CYS A 1 52 ? 5.879  12.527  23.996 1.00   36.94 ? 52   CYS B SG  1 
ATOM   347 N N   . ASP A 1 53 ? 2.261  11.992  22.825 1.00   33.25 ? 53   ASP B N   1 
ATOM   348 C CA  . ASP A 1 53 ? 1.188  12.432  23.697 1.00   32.93 ? 53   ASP B CA  1 
ATOM   349 C C   . ASP A 1 53 ? 1.509  12.121  25.156 1.00   32.06 ? 53   ASP B C   1 
ATOM   350 O O   . ASP A 1 53 ? 2.567  11.562  25.474 1.00   33.65 ? 53   ASP B O   1 
ATOM   351 C CB  . ASP A 1 53 ? -0.126 11.789  23.280 1.00   31.47 ? 53   ASP B CB  1 
ATOM   352 C CG  . ASP A 1 53 ? -0.057 10.292  23.307 1.00   33.06 ? 53   ASP B CG  1 
ATOM   353 O OD1 . ASP A 1 53 ? 0.914  9.783   23.885 1.00   32.77 ? 53   ASP B OD1 1 
ATOM   354 O OD2 . ASP A 1 53 ? -0.906 9.539   22.764 1.00   39.84 ? 53   ASP B OD2 1 
ATOM   355 N N   . LEU A 1 54 ? 0.588  12.488  26.036 1.00   30.44 ? 54   LEU B N   1 
ATOM   356 C CA  . LEU A 1 54 ? 0.792  12.366  27.469 1.00   30.32 ? 54   LEU B CA  1 
ATOM   357 C C   . LEU A 1 54 ? 1.065  10.903  27.837 1.00   29.60 ? 54   LEU B C   1 
ATOM   358 O O   . LEU A 1 54 ? 1.857  10.609  28.706 1.00   30.17 ? 54   LEU B O   1 
ATOM   359 C CB  . LEU A 1 54 ? -0.453 12.891  28.216 1.00   27.61 ? 54   LEU B CB  1 
ATOM   360 C CG  . LEU A 1 54 ? -0.569 12.682  29.723 1.00   24.88 ? 54   LEU B CG  1 
ATOM   361 C CD1 . LEU A 1 54 ? 0.641  13.293  30.435 1.00   27.13 ? 54   LEU B CD1 1 
ATOM   362 C CD2 . LEU A 1 54 ? -1.852 13.275  30.247 1.00   25.26 ? 54   LEU B CD2 1 
ATOM   363 N N   . ARG A 1 55 ? 0.387  9.987   27.182 1.00   31.49 ? 55   ARG B N   1 
ATOM   364 C CA  . ARG A 1 55 ? 0.534  8.578   27.523 1.00   32.72 ? 55   ARG B CA  1 
ATOM   365 C C   . ARG A 1 55 ? 1.891  7.965   27.172 1.00   31.98 ? 55   ARG B C   1 
ATOM   366 O O   . ARG A 1 55 ? 2.400  7.126   27.913 1.00   32.53 ? 55   ARG B O   1 
ATOM   367 C CB  . ARG A 1 55 ? -0.616 7.760   26.950 1.00   33.14 ? 55   ARG B CB  1 
ATOM   368 C CG  . ARG A 1 55 ? -1.739 7.587   27.969 1.00   37.45 ? 55   ARG B CG  1 
ATOM   369 C CD  . ARG A 1 55 ? -1.672 8.609   29.129 1.00   34.07 ? 55   ARG B CD  1 
ATOM   370 N NE  . ARG A 1 55 ? -3.016 9.039   29.487 1.00   41.01 ? 55   ARG B NE  1 
ATOM   371 C CZ  . ARG A 1 55 ? -3.745 9.907   28.792 1.00   42.23 ? 55   ARG B CZ  1 
ATOM   372 N NH1 . ARG A 1 55 ? -3.255 10.491  27.704 1.00   43.70 ? 55   ARG B NH1 1 
ATOM   373 N NH2 . ARG A 1 55 ? -4.969 10.200  29.196 1.00   42.43 ? 55   ARG B NH2 1 
ATOM   374 N N   . ARG A 1 56 ? 2.487  8.387   26.063 1.00   30.26 ? 56   ARG B N   1 
ATOM   375 C CA  . ARG A 1 56 ? 3.859  7.982   25.782 1.00   31.30 ? 56   ARG B CA  1 
ATOM   376 C C   . ARG A 1 56 ? 4.741  8.463   26.918 1.00   29.79 ? 56   ARG B C   1 
ATOM   377 O O   . ARG A 1 56 ? 5.466  7.682   27.554 1.00   29.34 ? 56   ARG B O   1 
ATOM   378 C CB  . ARG A 1 56 ? 4.366  8.570   24.459 1.00   29.96 ? 56   ARG B CB  1 
ATOM   379 C CG  . ARG A 1 56 ? 4.029  7.727   23.252 1.00   37.59 ? 56   ARG B CG  1 
ATOM   380 C CD  . ARG A 1 56 ? 4.931  8.006   22.064 1.00   41.63 ? 56   ARG B CD  1 
ATOM   381 N NE  . ARG A 1 56 ? 4.251  7.863   20.784 1.00   32.57 ? 56   ARG B NE  1 
ATOM   382 C CZ  . ARG A 1 56 ? 4.790  8.238   19.630 1.00   37.48 ? 56   ARG B CZ  1 
ATOM   383 N NH1 . ARG A 1 56 ? 4.125  8.070   18.490 1.00   36.67 ? 56   ARG B NH1 1 
ATOM   384 N NH2 . ARG A 1 56 ? 6.003  8.790   19.615 1.00   31.52 ? 56   ARG B NH2 1 
ATOM   385 N N   . LEU A 1 57 ? 4.661  9.764   27.165 1.00   28.65 ? 57   LEU B N   1 
ATOM   386 C CA  . LEU A 1 57 ? 5.503  10.409  28.145 1.00   29.56 ? 57   LEU B CA  1 
ATOM   387 C C   . LEU A 1 57 ? 5.450  9.686   29.485 1.00   29.18 ? 57   LEU B C   1 
ATOM   388 O O   . LEU A 1 57 ? 6.467  9.512   30.162 1.00   28.64 ? 57   LEU B O   1 
ATOM   389 C CB  . LEU A 1 57 ? 5.050  11.865  28.330 1.00   31.23 ? 57   LEU B CB  1 
ATOM   390 C CG  . LEU A 1 57 ? 6.126  12.666  29.021 1.00   37.24 ? 57   LEU B CG  1 
ATOM   391 C CD1 . LEU A 1 57 ? 6.587  13.848  28.190 1.00   36.88 ? 57   LEU B CD1 1 
ATOM   392 C CD2 . LEU A 1 57 ? 5.661  13.035  30.398 1.00   38.08 ? 57   LEU B CD2 1 
ATOM   393 N N   . GLU A 1 58 ? 4.249  9.294   29.887 1.00   28.70 ? 58   GLU B N   1 
ATOM   394 C CA  . GLU A 1 58 ? 4.051  8.705   31.207 1.00   29.05 ? 58   GLU B CA  1 
ATOM   395 C C   . GLU A 1 58 ? 4.689  7.301   31.282 1.00   26.89 ? 58   GLU B C   1 
ATOM   396 O O   . GLU A 1 58 ? 4.914  6.765   32.351 1.00   24.70 ? 58   GLU B O   1 
ATOM   397 C CB  . GLU A 1 58 ? 2.562  8.655   31.490 1.00   31.41 ? 58   GLU B CB  1 
ATOM   398 C CG  . GLU A 1 58 ? 2.119  7.822   32.673 1.00   33.81 ? 58   GLU B CG  1 
ATOM   399 C CD  . GLU A 1 58 ? 0.726  8.220   33.081 1.00   36.41 ? 58   GLU B CD  1 
ATOM   400 O OE1 . GLU A 1 58 ? -0.068 8.469   32.142 1.00   33.60 ? 58   GLU B OE1 1 
ATOM   401 O OE2 . GLU A 1 58 ? 0.440  8.291   34.309 1.00   34.12 ? 58   GLU B OE2 1 
ATOM   402 N N   . MET A 1 59 ? 5.026  6.736   30.137 1.00   27.09 ? 59   MET B N   1 
ATOM   403 C CA  . MET A 1 59 ? 5.755  5.467   30.113 1.00   28.24 ? 59   MET B CA  1 
ATOM   404 C C   . MET A 1 59 ? 7.195  5.596   30.646 1.00   27.82 ? 59   MET B C   1 
ATOM   405 O O   . MET A 1 59 ? 7.828  4.586   30.967 1.00   29.00 ? 59   MET B O   1 
ATOM   406 C CB  . MET A 1 59 ? 5.724  4.830   28.716 1.00   27.05 ? 59   MET B CB  1 
ATOM   407 C CG  . MET A 1 59 ? 4.377  4.208   28.343 1.00   33.33 ? 59   MET B CG  1 
ATOM   408 S SD  . MET A 1 59 ? 4.422  3.329   26.751 1.00   45.34 ? 59   MET B SD  1 
ATOM   409 C CE  . MET A 1 59 ? 4.573  4.681   25.590 1.00   46.37 ? 59   MET B CE  1 
ATOM   410 N N   . TYR A 1 60 ? 7.689  6.828   30.776 1.00   25.24 ? 60   TYR B N   1 
ATOM   411 C CA  . TYR A 1 60 ? 9.037  7.059   31.298 1.00   24.77 ? 60   TYR B CA  1 
ATOM   412 C C   . TYR A 1 60 ? 9.119  7.413   32.797 1.00   25.46 ? 60   TYR B C   1 
ATOM   413 O O   . TYR A 1 60 ? 10.200 7.693   33.312 1.00   26.08 ? 60   TYR B O   1 
ATOM   414 C CB  . TYR A 1 60 ? 9.807  8.050   30.412 1.00   23.53 ? 60   TYR B CB  1 
ATOM   415 C CG  . TYR A 1 60 ? 10.075 7.476   29.045 1.00   26.44 ? 60   TYR B CG  1 
ATOM   416 C CD1 . TYR A 1 60 ? 9.124  7.572   28.028 1.00   28.61 ? 60   TYR B CD1 1 
ATOM   417 C CD2 . TYR A 1 60 ? 11.256 6.792   28.780 1.00   22.33 ? 60   TYR B CD2 1 
ATOM   418 C CE1 . TYR A 1 60 ? 9.353  7.020   26.790 1.00   31.47 ? 60   TYR B CE1 1 
ATOM   419 C CE2 . TYR A 1 60 ? 11.487 6.237   27.552 1.00   29.46 ? 60   TYR B CE2 1 
ATOM   420 C CZ  . TYR A 1 60 ? 10.540 6.356   26.556 1.00   30.76 ? 60   TYR B CZ  1 
ATOM   421 O OH  . TYR A 1 60 ? 10.787 5.792   25.325 1.00   34.53 ? 60   TYR B OH  1 
ATOM   422 N N   . CYS A 1 61 ? 7.986  7.368   33.498 1.00   25.59 ? 61   CYS B N   1 
ATOM   423 C CA  . CYS A 1 61 ? 7.997  7.423   34.969 1.00   28.89 ? 61   CYS B CA  1 
ATOM   424 C C   . CYS A 1 61 ? 8.495  6.100   35.582 1.00   28.80 ? 61   CYS B C   1 
ATOM   425 O O   . CYS A 1 61 ? 8.085  5.042   35.145 1.00   27.77 ? 61   CYS B O   1 
ATOM   426 C CB  . CYS A 1 61 ? 6.600  7.779   35.527 1.00   26.67 ? 61   CYS B CB  1 
ATOM   427 S SG  . CYS A 1 61 ? 5.919  9.321   34.853 1.00   27.45 ? 61   CYS B SG  1 
ATOM   428 N N   . ALA A 1 62 ? 9.371  6.167   36.588 1.00   29.38 ? 62   ALA B N   1 
ATOM   429 C CA  . ALA A 1 62 ? 9.794  4.967   37.317 1.00   30.77 ? 62   ALA B CA  1 
ATOM   430 C C   . ALA A 1 62 ? 8.588  4.288   37.939 1.00   32.95 ? 62   ALA B C   1 
ATOM   431 O O   . ALA A 1 62 ? 7.612  4.951   38.263 1.00   34.05 ? 62   ALA B O   1 
ATOM   432 C CB  . ALA A 1 62 ? 10.824 5.319   38.406 1.00   29.18 ? 62   ALA B CB  1 
ATOM   433 N N   . PRO A 1 63 ? 8.650  2.969   38.102 1.00   35.44 ? 63   PRO B N   1 
ATOM   434 C CA  . PRO A 1 63 ? 7.560  2.202   38.711 1.00   36.12 ? 63   PRO B CA  1 
ATOM   435 C C   . PRO A 1 63 ? 7.160  2.661   40.115 1.00   38.42 ? 63   PRO B C   1 
ATOM   436 O O   . PRO A 1 63 ? 8.001  3.094   40.905 1.00   38.96 ? 63   PRO B O   1 
ATOM   437 C CB  . PRO A 1 63 ? 8.137  0.785   38.778 1.00   36.54 ? 63   PRO B CB  1 
ATOM   438 C CG  . PRO A 1 63 ? 9.102  0.749   37.651 1.00   37.07 ? 63   PRO B CG  1 
ATOM   439 C CD  . PRO A 1 63 ? 9.759  2.098   37.666 1.00   35.05 ? 63   PRO B CD  1 
ATOM   440 N N   . LEU A 1 64 ? 5.867  2.534   40.411 1.00   39.73 ? 64   LEU B N   1 
ATOM   441 C CA  . LEU A 1 64 ? 5.327  2.713   41.756 1.00   39.80 ? 64   LEU B CA  1 
ATOM   442 C C   . LEU A 1 64 ? 5.848  1.663   42.724 1.00   39.87 ? 64   LEU B C   1 
ATOM   443 O O   . LEU A 1 64 ? 5.579  0.467   42.561 1.00   40.66 ? 64   LEU B O   1 
ATOM   444 C CB  . LEU A 1 64 ? 3.801  2.628   41.719 1.00   39.57 ? 64   LEU B CB  1 
ATOM   445 C CG  . LEU A 1 64 ? 3.067  3.819   42.329 1.00   40.85 ? 64   LEU B CG  1 
ATOM   446 C CD1 . LEU A 1 64 ? 2.400  4.654   41.245 1.00   39.65 ? 64   LEU B CD1 1 
ATOM   447 C CD2 . LEU A 1 64 ? 2.054  3.337   43.358 1.00   39.28 ? 64   LEU B CD2 1 
ATOM   448 N N   . LYS A 1 65 ? 6.581  2.104   43.744 1.00   39.54 ? 65   LYS B N   1 
ATOM   449 C CA  . LYS A 1 65 ? 6.992  1.194   44.812 1.00   39.32 ? 65   LYS B CA  1 
ATOM   450 C C   . LYS A 1 65 ? 6.084  1.295   46.036 1.00   38.56 ? 65   LYS B C   1 
ATOM   451 O O   . LYS A 1 65 ? 5.710  2.398   46.452 1.00   38.39 ? 65   LYS B O   1 
ATOM   452 C CB  . LYS A 1 65 ? 8.457  1.422   45.202 1.00   39.82 ? 65   LYS B CB  1 
ATOM   453 C CG  . LYS A 1 65 ? 9.351  0.199   45.017 1.00   37.56 ? 65   LYS B CG  1 
ATOM   454 C CD  . LYS A 1 65 ? 8.956  -0.931  45.954 1.00   33.73 ? 65   LYS B CD  1 
ATOM   455 C CE  . LYS A 1 65 ? 9.096  -2.288  45.284 1.00   30.98 ? 65   LYS B CE  1 
ATOM   456 N NZ  . LYS A 1 65 ? 9.171  -3.393  46.295 1.00   31.42 ? 65   LYS B NZ  1 
ATOM   457 N N   . PRO A 1 66 ? 5.721  0.128   46.572 1.00   37.92 ? 66   PRO B N   1 
ATOM   458 C CA  . PRO A 1 66 ? 5.133  -0.643  47.674 1.00   37.44 ? 66   PRO B CA  1 
ATOM   459 C C   . PRO A 1 66 ? 4.881  -2.086  47.256 1.00   37.27 ? 66   PRO B C   1 
ATOM   460 O O   . PRO A 1 66 ? 5.357  -2.991  47.941 1.00   37.65 ? 66   PRO B O   1 
ATOM   461 C CB  . PRO A 1 66 ? 3.807  0.064   47.926 1.00   37.16 ? 66   PRO B CB  1 
ATOM   462 C CG  . PRO A 1 66 ? 4.150  1.456   47.801 1.00   37.52 ? 66   PRO B CG  1 
ATOM   463 C CD  . PRO A 1 66 ? 5.553  1.451   47.205 1.00   38.26 ? 66   PRO B CD  1 
HETATM 464 C C1  . C15 B 2 .  ? 20.059 6.473   31.375 1.00   43.78 ? 1067 C15 B C1  1 
HETATM 465 C C2  . C15 B 2 .  ? 20.555 7.911   31.478 1.00   43.79 ? 1067 C15 B C2  1 
HETATM 466 C C3  . C15 B 2 .  ? 20.332 8.662   30.170 1.00   45.62 ? 1067 C15 B C3  1 
HETATM 467 C C5  . C15 B 2 .  ? 18.380 19.014  37.684 1.00   38.11 ? 1067 C15 B C5  1 
HETATM 468 C C6  . C15 B 2 .  ? 17.409 17.876  37.902 1.00   36.82 ? 1067 C15 B C6  1 
HETATM 469 C C7  . C15 B 2 .  ? 17.140 17.086  36.621 1.00   36.67 ? 1067 C15 B C7  1 
HETATM 470 C C8  . C15 B 2 .  ? 18.420 16.540  36.003 1.00   38.53 ? 1067 C15 B C8  1 
HETATM 471 N N1  . C15 B 2 .  ? 21.347 9.684   29.971 1.00   47.10 ? 1067 C15 B N1  1 
HETATM 472 C C9  . C15 B 2 .  ? 18.341 16.659  34.486 1.00   38.13 ? 1067 C15 B C9  1 
HETATM 473 C C10 . C15 B 2 .  ? 18.245 15.273  33.873 1.00   37.15 ? 1067 C15 B C10 1 
HETATM 474 C C11 . C15 B 2 .  ? 19.087 15.193  32.622 1.00   35.77 ? 1067 C15 B C11 1 
HETATM 475 C C12 . C15 B 2 .  ? 19.948 13.935  32.611 1.00   37.31 ? 1067 C15 B C12 1 
HETATM 476 C C13 . C15 B 2 .  ? 19.670 13.229  31.293 1.00   39.39 ? 1067 C15 B C13 1 
HETATM 477 C C14 . C15 B 2 .  ? 20.793 12.315  30.835 1.00   39.17 ? 1067 C15 B C14 1 
HETATM 478 C C15 . C15 B 2 .  ? 20.464 11.930  29.399 1.00   43.17 ? 1067 C15 B C15 1 
HETATM 479 C C16 . C15 B 2 .  ? 21.192 10.681  28.928 1.00   45.32 ? 1067 C15 B C16 1 
HETATM 480 S S1  . C15 B 2 .  ? 18.463 6.337   32.178 1.00   44.00 ? 1067 C15 B S1  1 
HETATM 481 O O1S . C15 B 2 .  ? 18.627 5.452   33.301 1.00   44.87 ? 1067 C15 B O1S 1 
HETATM 482 O O2S . C15 B 2 .  ? 17.946 7.620   32.600 1.00   40.00 ? 1067 C15 B O2S 1 
HETATM 483 O O3S . C15 B 2 .  ? 17.294 5.667   31.044 1.00   46.07 ? 1067 C15 B O3S 1 
HETATM 484 O O   . HOH C 3 .  ? 10.818 21.853  21.079 1.00   42.42 ? 2001 HOH B O   1 
HETATM 485 O O   . HOH C 3 .  ? 6.743  19.644  39.388 1.00   36.64 ? 2002 HOH B O   1 
HETATM 486 O O   . HOH C 3 .  ? 16.083 22.911  27.208 1.00   36.99 ? 2003 HOH B O   1 
HETATM 487 O O   . HOH C 3 .  ? 10.993 21.934  23.740 1.00   27.80 ? 2004 HOH B O   1 
HETATM 488 O O   . HOH C 3 .  ? 7.701  20.602  36.323 1.00   30.26 ? 2005 HOH B O   1 
HETATM 489 O O   . HOH C 3 .  ? 12.069 21.350  41.698 1.00   27.59 ? 2006 HOH B O   1 
HETATM 490 O O   . HOH C 3 .  ? 10.217 14.001  39.580 1.00   47.04 ? 2007 HOH B O   1 
HETATM 491 O O   . HOH C 3 .  ? 20.622 3.178   30.110 1.00   53.77 ? 2008 HOH B O   1 
HETATM 492 O O   . HOH C 3 .  ? 17.239 -2.237  28.845 1.00   35.86 ? 2009 HOH B O   1 
HETATM 493 O O   . HOH C 3 .  ? 6.526  14.656  14.663 1.00   32.42 ? 2010 HOH B O   1 
HETATM 494 O O   . HOH C 3 .  ? -6.051 9.030   26.017 1.00   47.98 ? 2011 HOH B O   1 
HETATM 495 O O   . HOH C 3 .  ? 1.247  5.105   29.693 1.00   34.24 ? 2012 HOH B O   1 
HETATM 496 O O   . HOH C 3 .  ? -2.349 9.457   31.428 1.00   33.61 ? 2013 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY B . n 
A 1 2  PRO 2  2  2  PRO PRO B . n 
A 1 3  GLU 3  3  3  GLU GLU B . n 
A 1 4  THR 4  4  4  THR THR B . n 
A 1 5  LEU 5  5  5  LEU LEU B . n 
A 1 6  CYS 6  6  6  CYS CYS B . n 
A 1 7  GLY 7  7  7  GLY GLY B . n 
A 1 8  ALA 8  8  8  ALA ALA B . n 
A 1 9  GLU 9  9  9  GLU GLU B . n 
A 1 10 LEU 10 10 10 LEU LEU B . n 
A 1 11 VAL 11 11 11 VAL VAL B . n 
A 1 12 ASP 12 12 12 ASP ASP B . n 
A 1 13 ALA 13 13 13 ALA ALA B . n 
A 1 14 LEU 14 14 14 LEU LEU B . n 
A 1 15 GLN 15 15 15 GLN GLN B . n 
A 1 16 PHE 16 16 16 PHE PHE B . n 
A 1 17 VAL 17 17 17 VAL VAL B . n 
A 1 18 CYS 18 18 18 CYS CYS B . n 
A 1 19 GLY 19 19 19 GLY GLY B . n 
A 1 20 ASP 20 20 20 ASP ASP B . n 
A 1 21 ARG 21 21 21 ARG ARG B . n 
A 1 22 GLY 22 22 22 GLY GLY B . n 
A 1 23 PHE 23 23 23 PHE PHE B . n 
A 1 24 TYR 24 24 24 TYR TYR B . n 
A 1 25 PHE 25 25 25 PHE PHE B . n 
A 1 26 ASN 26 26 26 ASN ASN B . n 
A 1 27 LYS 27 27 27 LYS LYS B . n 
A 1 28 PRO 28 28 28 PRO PRO B . n 
A 1 29 THR 29 29 29 THR THR B . n 
A 1 30 GLY 30 30 30 GLY GLY B . n 
A 1 31 TYR 31 31 31 TYR TYR B . n 
A 1 32 GLY 32 32 ?  ?   ?   B . n 
A 1 33 SER 33 33 ?  ?   ?   B . n 
A 1 34 SER 34 34 ?  ?   ?   B . n 
A 1 35 SER 35 35 ?  ?   ?   B . n 
A 1 36 ARG 36 36 ?  ?   ?   B . n 
A 1 37 ARG 37 37 ?  ?   ?   B . n 
A 1 38 ALA 38 38 38 ALA ALA B . n 
A 1 39 PRO 39 39 39 PRO PRO B . n 
A 1 40 GLN 40 40 40 GLN GLN B . n 
A 1 41 THR 41 41 41 THR THR B . n 
A 1 42 GLY 42 42 42 GLY GLY B . n 
A 1 43 ILE 43 43 43 ILE ILE B . n 
A 1 44 VAL 44 44 44 VAL VAL B . n 
A 1 45 ASP 45 45 45 ASP ASP B . n 
A 1 46 GLU 46 46 46 GLU GLU B . n 
A 1 47 CYS 47 47 47 CYS CYS B . n 
A 1 48 CYS 48 48 48 CYS CYS B . n 
A 1 49 PHE 49 49 49 PHE PHE B . n 
A 1 50 ARG 50 50 50 ARG ARG B . n 
A 1 51 SER 51 51 51 SER SER B . n 
A 1 52 CYS 52 52 52 CYS CYS B . n 
A 1 53 ASP 53 53 53 ASP ASP B . n 
A 1 54 LEU 54 54 54 LEU LEU B . n 
A 1 55 ARG 55 55 55 ARG ARG B . n 
A 1 56 ARG 56 56 56 ARG ARG B . n 
A 1 57 LEU 57 57 57 LEU LEU B . n 
A 1 58 GLU 58 58 58 GLU GLU B . n 
A 1 59 MET 59 59 59 MET MET B . n 
A 1 60 TYR 60 60 60 TYR TYR B . n 
A 1 61 CYS 61 61 61 CYS CYS B . n 
A 1 62 ALA 62 62 62 ALA ALA B . n 
A 1 63 PRO 63 63 63 PRO PRO B . n 
A 1 64 LEU 64 64 64 LEU LEU B . n 
A 1 65 LYS 65 65 65 LYS LYS B . n 
A 1 66 PRO 66 66 66 PRO PRO B . n 
A 1 67 ALA 67 67 ?  ?   ?   B . n 
A 1 68 LYS 68 68 ?  ?   ?   B . n 
A 1 69 SER 69 69 ?  ?   ?   B . n 
A 1 70 ALA 70 70 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 C15 1  1067 1067 C15 C15 B . 
C 3 HOH 1  2001 2001 HOH HOH B . 
C 3 HOH 2  2002 2002 HOH HOH B . 
C 3 HOH 3  2003 2003 HOH HOH B . 
C 3 HOH 4  2004 2004 HOH HOH B . 
C 3 HOH 5  2005 2005 HOH HOH B . 
C 3 HOH 6  2006 2006 HOH HOH B . 
C 3 HOH 7  2007 2007 HOH HOH B . 
C 3 HOH 8  2008 2008 HOH HOH B . 
C 3 HOH 9  2009 2009 HOH HOH B . 
C 3 HOH 10 2010 2010 HOH HOH B . 
C 3 HOH 11 2011 2011 HOH HOH B . 
C 3 HOH 12 2012 2012 HOH HOH B . 
C 3 HOH 13 2013 2013 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-25 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2019-05-08 
4 'Structure model' 1 3 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' Advisory                    
4 3 'Structure model' 'Data collection'           
5 3 'Structure model' 'Experimental preparation'  
6 3 'Structure model' Other                       
7 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_PDB_rev             
2 3 'Structure model' database_PDB_rev_record      
3 3 'Structure model' exptl_crystal_grow           
4 3 'Structure model' pdbx_database_proc           
5 3 'Structure model' pdbx_database_status         
6 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
7 4 'Structure model' diffrn_source                
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                  
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         9.9897 
_pdbx_refine_tls.origin_y         10.0758 
_pdbx_refine_tls.origin_z         29.0018 
_pdbx_refine_tls.T[1][1]          0.0188 
_pdbx_refine_tls.T[2][2]          0.0470 
_pdbx_refine_tls.T[3][3]          0.1165 
_pdbx_refine_tls.T[1][2]          -0.0060 
_pdbx_refine_tls.T[1][3]          0.0446 
_pdbx_refine_tls.T[2][3]          -0.0364 
_pdbx_refine_tls.L[1][1]          14.5499 
_pdbx_refine_tls.L[2][2]          10.8206 
_pdbx_refine_tls.L[3][3]          11.1099 
_pdbx_refine_tls.L[1][2]          1.3143 
_pdbx_refine_tls.L[1][3]          -3.4405 
_pdbx_refine_tls.L[2][3]          0.2277 
_pdbx_refine_tls.S[1][1]          -0.5918 
_pdbx_refine_tls.S[1][2]          0.5956 
_pdbx_refine_tls.S[1][3]          -0.8524 
_pdbx_refine_tls.S[2][1]          -0.2139 
_pdbx_refine_tls.S[2][2]          -0.1223 
_pdbx_refine_tls.S[2][3]          -0.2143 
_pdbx_refine_tls.S[3][1]          1.0330 
_pdbx_refine_tls.S[3][2]          -0.0782 
_pdbx_refine_tls.S[3][3]          0.7141 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    B 
_pdbx_refine_tls_group.beg_auth_seq_id     1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    B 
_pdbx_refine_tls_group.end_auth_seq_id     66 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.19 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             1GZZ 
_pdbx_entry_details.compound_details     
;INSULIN-LIKE GROWTH FACTORS,ARE FUNCTIONALLY AND
 STRUCTURALLY RELATED TO INSULIN WITH HIGHER GROWTH-PROMOTING
 ACTIVITY.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  B LYS 65 ? ? CD B PRO 66   ? ? 1.22 
2 1 C  B LYS 65 ? ? CD B PRO 66   ? ? 1.29 
3 1 NE B ARG 55 ? ? O  B HOH 2013 ? ? 2.09 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    PHE 
_pdbx_validate_symm_contact.auth_seq_id_1     23 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    GLY 
_pdbx_validate_symm_contact.auth_seq_id_2     30 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              2.16 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            LYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             27 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            LYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             27 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                0.561 
_pdbx_validate_rmsd_bond.bond_target_value         1.508 
_pdbx_validate_rmsd_bond.bond_deviation            -0.947 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.025 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B ASP 53 ? ? CG B ASP 53 ? ? OD2 B ASP 53 ? ? 123.99 118.30 5.69   0.90 N 
2 1 C  B LYS 65 ? ? N  B PRO 66 ? ? CA  B PRO 66 ? ? 150.44 119.30 31.14  1.50 Y 
3 1 C  B LYS 65 ? ? N  B PRO 66 ? ? CD  B PRO 66 ? ? 54.51  128.40 -73.89 2.10 Y 
4 1 CA B PRO 66 ? ? N  B PRO 66 ? ? CD  B PRO 66 ? ? 95.93  111.70 -15.77 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO B 2  ? ? -47.58 -135.16 
2 1 GLU B 3  ? ? 97.01  16.52   
3 1 PRO B 39 ? ? -18.95 157.14  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 B C15 1067 ? C1N ? B C15 1 C1N 
2 1 N 1 B C15 1067 ? C2N ? B C15 1 C2N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 32 ? A GLY 32 
2  1 Y 1 B SER 33 ? A SER 33 
3  1 Y 1 B SER 34 ? A SER 34 
4  1 Y 1 B SER 35 ? A SER 35 
5  1 Y 1 B ARG 36 ? A ARG 36 
6  1 Y 1 B ARG 37 ? A ARG 37 
7  1 Y 1 B ALA 67 ? A ALA 67 
8  1 Y 1 B LYS 68 ? A LYS 68 
9  1 Y 1 B SER 69 ? A SER 69 
10 1 Y 1 B ALA 70 ? A ALA 70 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-DODECYL-N,N-DIMETHYL-3-AMMONIO-1-PROPANESULFONATE C15 
3 water                                               HOH 
#