data_1H22
# 
_entry.id   1H22 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H22         
PDBE  EBI-11176    
WWPDB D_1290011176 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)-HUPYRIDONE AT 2.15A RESOLUTION' 
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H22 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wong, D.M.'       1 
'Greenblatt, H.M.' 2 
'Carlier, P.R.'    3 
'Han, Y.-F.'       4 
'Pang, Y.-P.'      5 
'Silman, I.'       6 
'Sussman, J.L.'    7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Acetylcholinesterase Complexed with Bivalent Ligands Related to Huperzine A: Experimental Evidence for Species-Dependent Protein-Ligand Complementarity
;
J.Am.Chem.Soc.               125 363  ? 2003 JACSAT US 0002-7863 0004 ? 12517147 10.1021/JA021111W 
1       'Dimerization of an Inactive Fragment of Huperzine a Produces a Drug with Twice the Potency of the Natural Product' 
Angew.Chem.Int.Ed.Engl.      39  1775 ? 2000 ?      GE 1433-7851 9999 ? 10934357 
'10.1002/(SICI)1521-3773(20000515)39:10<1775::AID-ANIE1775>3.0.CO;2-Q' 
2       'Structure of Acetylcholinesterase Complexed with the Nootropic Alkaloid, (-)-Huperzine A' Nat.Struct.Biol.             4 
57   ? 1997 NSBIEW US 1072-8368 2024 ? 8989325  10.1038/NSB0197-57                                                     
3       'Prediction of the Binding Sites of Huperzine a in Acetylcholinesterase by Docking Studies' 'J. Comput. Aided Mol. Des.' 8 
669  ? 1994 ?      NE 0920-654X ?    ? 7738603  10.1007/BF00124014                                                     
4       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ? 1991 SCIEAS US 0036-8075 0038 ? 1678899  10.1126/SCIENCE.1678899                                                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wong, D.M.'       1  ? 
primary 'Greenblatt, H.M.' 2  ? 
primary 'Dvir, H.'         3  ? 
primary 'Carlier, P.R.'    4  ? 
primary 'Han, Y.-F.'       5  ? 
primary 'Pang, Y.-P.'      6  ? 
primary 'Silman, I.'       7  ? 
primary 'Sussman, J.L.'    8  ? 
1       'Carlier, P.R.'    9  ? 
1       'Du, D.-M.'        10 ? 
1       'Han, Y.-F.'       11 ? 
1       'Liu, J.'          12 ? 
1       'Perola, E.'       13 ? 
1       'Williams, I.D.'   14 ? 
1       'Pang, Y.-P.'      15 ? 
2       'Raves, M.L.'      16 ? 
2       'Harel, M.'        17 ? 
2       'Pang, Y.-P.'      18 ? 
2       'Silman, I.'       19 ? 
2       'Kozikowski, A.P.' 20 ? 
2       'Sussman, J.L.'    21 ? 
3       'Pang, Y.-P.'      22 ? 
3       'Kozikowski, A.P.' 23 ? 
4       'Sussman, J.L.'    24 ? 
4       'Harel, M.'        25 ? 
4       'Frolow, F.'       26 ? 
4       'Oefner, C.'       27 ? 
4       'Goldman, A.'      28 ? 
4       'Toker, L.'        29 ? 
4       'Silman, I.'       30 ? 
# 
_cell.entry_id           1H22 
_cell.length_a           111.460 
_cell.length_b           111.460 
_cell.length_c           137.337 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H22 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                                   61325.090 
1   3.1.1.7 ? ? 'INTER-MONOMER DISULFIDE BRIDGE' 
2 non-polymer syn 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,10-DIAMINODECANE DIHYDROCHLORIDE
;
466.659   1   ?       ? ? ?                                
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                               221.208   
2   ?       ? ? ?                                
4 water       nat water                                                                                                  18.015    
222 ?       ? ? ?                                
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    
;SYNTHETIC BIVALENT HUPA-LIKE DIMER, (S, S)-(-)-BIS(10)-HUPYRIDONE ((S, S)-(-)-N, N'-DI-5'- -[5', 6', 7', 8'-TETRAHYDRO-2'(1'H)-QUINOLINONYL] -1, 10-DIAMINODECANE) DIHYDROCHLORIDE, WITH ONE MONOMER UNIT BOUND TO THE 'ANIONIC' SUBSITE, NEAR THE BOTTOM OF THE ACTIVE SITE GORGE, AND THE SECOND MONOMER UNIT BOUND TO THE 'PERIPHERAL' ANIONIC SITE AT THE TOP OF THE GORGE, THUS SPANNING THE ACTIVE SITE GORGE
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1H22 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
E10 non-polymer                  . 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,10-DIAMINODECANE DIHYDROCHLORIDE
;
? 'C28 H42 N4 O2'  466.659 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H22 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.06 
_exptl_crystal.density_percent_sol   69.37 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLISED FROM 28-30% V/V PEG 200 0.5M MES PH 5.8 AT 4 DEG. CELSIUS; THEN SOAKED IN MOTHER LIQUOR (40% V/V PEG 200 IN 0.1 M MES BUFFER, PH 5.8) CONTAINING 2MM (S,S)-(-)-BIS(10)-HUPYRIDONE DIHYDROCHLORIDE FOR ONE DAY.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2001-01-07 
_diffrn_detector.details                'OSMIC BLUE CONFOCAL MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H22 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.400 
_reflns.d_resolution_high            2.150 
_reflns.number_obs                   53982 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            0.04900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.22800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        10.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H22 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     51401 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.4 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    95.0 
_refine.ls_R_factor_obs                          0.1900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900 
_refine.ls_R_factor_R_free                       0.2214 
_refine.ls_R_factor_R_free_error                 0.004385 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  2549 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               34.244 
_refine.aniso_B[1][1]                            -7.141 
_refine.aniso_B[2][2]                            -7.141 
_refine.aniso_B[3][3]                            14.283 
_refine.aniso_B[1][2]                            -5.601 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.383 
_refine.solvent_model_param_bsol                 56.6 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;SEVERAL RESIDUES ARE NOT SEEN IN THE CRYSTAL STRUCTURE, DUE TO DISORDER. THESE INCLUDE ASP A1, ASP A2, HIS A3 AND THE C-TERMINAL RESIDUES AFTER THR A535. SEVERAL RESIDUES MISSING IN CHAIN BREAK, FROM HIS A486 - GLU A489 (INCLUSIVE). TWO ALTERNATE SIDE CHAIN CONFORMATIONS WERE FITTED FOR THE RESIDUES LEU A143 (SET TO 50% OCCUPANCY EACH), AND ARG A243 (SET TO 80% AND 20% OCCUPANCY).
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4172 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             222 
_refine_hist.number_atoms_total               4456 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        26.4 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.022286 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.94916  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.253    1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.819    2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.209    2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.030    2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.25 
_refine_ls_shell.number_reflns_R_work             5934 
_refine_ls_shell.R_factor_R_work                  0.2232 
_refine_ls_shell.percent_reflns_obs               94.98 
_refine_ls_shell.R_factor_R_free                  0.2503 
_refine_ls_shell.R_factor_R_free_error            0.0144 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             303 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 E10.PAR            E10-1.TOP        
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
# 
_struct.entry_id                  1H22 
_struct.title                     
'Structure of acetylcholinesterase (E.C. 3.1.1.7) complexed with (S,S)-(-)-bis(10)-hupyridone at 2.15A resolution' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H22 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE HYDROLASE, ACETYLCHOLINESTERASE, NEUROTRANSMITTER CLEAVAGE, ALZHEIMER'S DISEASE, BIVALENT LIGAND, DUAL-SITE BINDING, INHIBITOR, HUPERZINE A, HYDROLASE, SERINE ESTERASE SYNAPSE, MEMBRANE, NERVE, MUSCLE, GPI-ANCHOR NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, BIS(10)-HUPYRID
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? GLU A 268 ? SER A 258 GLU A 268 1 ? 11 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.078 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 1537 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 1538 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          1H22 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H22 
_atom_sites.fract_transf_matrix[1][1]   0.008972 
_atom_sites.fract_transf_matrix[1][2]   0.005180 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010360 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007281 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.192 88.028 35.091 1.00 49.78 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.520 88.272 36.412 1.00 49.86 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.535 87.157 36.747 1.00 48.85 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.792 85.966 36.530 1.00 47.86 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.515 88.350 37.564 1.00 49.73 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.824 88.292 38.833 1.00 52.26 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.421 87.592 37.307 1.00 47.74 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.330  86.745 37.732 1.00 47.16 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.789  85.723 38.786 1.00 44.36 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -9.207  84.657 38.901 1.00 43.46 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.252  87.644 38.331 1.00 49.16 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.845  87.085 38.314 1.00 53.83 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.843  88.132 38.748 1.00 54.44 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -6.273  89.275 38.918 1.00 55.78 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.640  87.828 38.906 1.00 57.12 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.845 86.049 39.525 1.00 41.07 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.281 85.179 40.598 1.00 38.66 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.299 84.140 40.208 1.00 37.73 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.759 83.373 41.054 1.00 37.55 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.794 86.021 41.783 1.00 35.28 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.781 87.016 42.343 1.00 35.65 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.489 87.934 43.383 1.00 34.44 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.620  86.276 43.046 1.00 35.50 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.640 84.086 38.931 1.00 38.35 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.602 83.098 38.478 1.00 38.74 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.860 82.104 37.586 1.00 37.51 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.217 82.474 36.614 1.00 37.15 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.744 83.744 37.684 1.00 41.25 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.718 82.633 37.252 1.00 45.64 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.721 82.357 38.391 1.00 46.18 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.426 82.996 35.969 1.00 46.07 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.938 80.831 37.929 1.00 36.00 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.249 79.841 37.125 1.00 34.02 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.232 78.714 36.864 1.00 35.06 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.947 78.263 37.754 1.00 34.88 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -11.003 79.238 37.863 1.00 34.44 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.391 78.076 37.006 1.00 34.70 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.958  80.302 38.128 1.00 31.39 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.247 78.256 35.634 1.00 36.20 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -14.095 77.167 35.245 1.00 37.96 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.347 75.870 35.242 1.00 36.75 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.326 75.782 34.592 1.00 37.15 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.641 77.401 33.864 1.00 41.64 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -16.111 77.318 33.882 1.00 50.04 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.676 76.270 34.318 1.00 52.94 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.785 78.431 33.500 1.00 51.55 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.847 74.846 35.935 1.00 36.28 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -13.114 73.599 35.964 1.00 34.55 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -14.011 72.480 35.456 1.00 36.12 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -15.221 72.678 35.234 1.00 34.08 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.658 73.217 37.413 1.00 35.44 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.779 72.700 38.134 1.00 31.49 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -12.061 74.452 38.192 1.00 32.22 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.419 71.292 35.291 1.00 35.29 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -14.179 70.133 34.837 1.00 34.06 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.200 69.761 35.887 1.00 34.99 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -16.123 69.015 35.595 1.00 34.89 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -13.244 68.934 34.562 1.00 33.03 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.325 69.193 33.343 1.00 32.90 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.011 68.385 33.408 1.00 30.60 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.339 68.450 32.047 1.00 27.30 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.060  67.747 32.067 1.00 25.83 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -15.040 70.224 37.117 1.00 34.25 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -16.060 69.890 38.135 1.00 37.31 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.105 71.022 38.251 1.00 38.04 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.140 70.855 38.924 1.00 37.92 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.442 69.707 39.534 1.00 38.01 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.403 68.753 39.511 1.00 42.22 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.824 72.169 37.622 1.00 38.83 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.752 73.301 37.692 1.00 38.14 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.989 74.579 37.948 1.00 37.80 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.754 74.528 38.016 1.00 37.04 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.698 75.707 38.093 1.00 36.96 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -17.048 77.021 38.316 1.00 37.63 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.756 77.245 39.766 1.00 35.55 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.506 76.863 40.648 1.00 35.12 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.905 78.236 37.878 1.00 39.15 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.363 78.237 36.431 1.00 46.68 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -19.009 79.601 36.049 1.00 51.42 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.152 79.790 34.506 1.00 53.95 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -19.536 81.202 34.093 1.00 57.08 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.694 77.970 39.997 1.00 35.57 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.289 78.223 41.339 1.00 38.20 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.938 79.700 41.395 1.00 37.30 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.375 80.232 40.446 1.00 36.09 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -14.059 77.295 41.678 1.00 38.72 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.819 77.758 40.911 1.00 39.61 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.799 77.323 43.095 1.00 42.26 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.289 80.349 42.505 1.00 37.60 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.993 81.762 42.690 1.00 37.33 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -14.052 81.926 43.878 1.00 35.64 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.397 81.582 45.030 1.00 33.35 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.296 82.563 42.972 1.00 40.79 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.131 84.095 43.159 1.00 45.19 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.066 84.972 41.540 1.00 55.09 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.554 85.486 41.542 1.00 53.56 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.880 82.485 43.592 1.00 34.48 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.928 82.714 44.650 1.00 36.77 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.997 84.060 45.372 1.00 38.30 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.977 84.777 45.310 1.00 37.23 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.919 84.403 46.069 1.00 40.00 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.873 85.651 46.814 1.00 40.66 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.497  86.250 46.650 1.00 40.75 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.524  85.545 46.397 1.00 41.67 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.219 85.406 48.322 1.00 41.19 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -11.232 86.653 49.003 1.00 41.18 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.177 84.481 49.022 1.00 40.21 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.419  87.562 46.733 1.00 42.20 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -8.151  88.250 46.596 1.00 43.53 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.515  88.418 47.980 1.00 43.22 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.144  88.884 48.906 1.00 42.88 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.335  89.617 45.930 1.00 48.02 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.988  90.361 45.860 1.00 53.64 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.873  91.364 44.708 1.00 59.71 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.529  91.256 44.101 1.00 65.79 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.874  92.246 43.491 1.00 66.98 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.431  93.458 43.391 1.00 67.69 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.649  92.025 43.005 1.00 67.20 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.269  88.004 48.137 1.00 42.07 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.675  88.137 49.436 1.00 41.16 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.422  88.960 49.392 1.00 38.53 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.632  88.870 48.474 1.00 37.94 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.335  86.758 50.093 1.00 42.10 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.525  85.855 50.006 1.00 42.99 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.147  86.127 49.416 1.00 44.02 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -4.250  89.811 50.391 1.00 38.94 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -3.067  90.676 50.485 1.00 38.61 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.861  89.835 50.902 1.00 38.16 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -2.003  88.867 51.672 1.00 37.27 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.476  91.703 51.542 1.00 38.66 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.334  90.872 52.485 1.00 40.44 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -5.206  90.057 51.485 1.00 38.47 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.684  90.182 50.373 1.00 37.75 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.551   89.478 50.712 1.00 36.46 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 1.783   90.373 50.438 1.00 37.90 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.001   90.786 49.313 1.00 36.42 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 0.669   88.103 49.891 1.00 35.91 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.333   88.353 48.418 1.00 32.68 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.099   87.486 50.040 1.00 32.69 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.562   90.663 51.492 1.00 39.19 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 3.784   91.459 51.420 1.00 40.68 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.551   92.787 50.630 1.00 41.82 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.278   93.129 49.679 1.00 41.09 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 4.879   90.580 50.780 1.00 40.18 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.185   89.315 51.631 1.00 41.10 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.301   88.509 50.971 1.00 36.96 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.606   89.718 53.070 1.00 39.13 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.511   93.500 51.048 1.00 43.02 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.098   94.752 50.432 1.00 44.98 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 1.713   94.603 48.941 1.00 45.19 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 1.807   95.557 48.161 1.00 45.98 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.171   95.821 50.624 1.00 46.22 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.154   95.649 49.628 1.00 51.79 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.297   93.394 48.540 1.00 42.82 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.787   93.171 47.197 1.00 40.48 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.457  92.264 47.321 1.00 39.92 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -1.097  92.214 48.371 1.00 38.87 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 1.849   92.577 46.276 1.00 40.40 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.273   92.398 44.993 1.00 40.70 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.812  91.526 46.281 1.00 40.76 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.999  90.697 46.372 1.00 41.62 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.871  89.495 45.458 1.00 41.43 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -1.102  89.522 44.498 1.00 40.92 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.249  91.490 45.915 1.00 45.90 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.599  92.689 46.773 1.00 52.69 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.066  93.953 46.567 1.00 53.93 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.493  92.827 47.793 1.00 54.06 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.621  94.809 47.414 1.00 54.85 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.489  94.153 48.168 1.00 53.85 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.623  88.438 45.760 1.00 39.72 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.688  87.278 44.899 1.00 38.81 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -4.074  86.679 45.053 1.00 37.30 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.848  87.083 45.933 1.00 37.93 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.615  86.197 45.174 1.00 39.38 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.543  85.885 46.640 1.00 43.18 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.313  86.611 44.565 1.00 43.34 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -2.677  85.013 47.063 1.00 47.37 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.386  85.707 44.213 1.00 34.49 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.696  85.080 44.245 1.00 34.07 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.638  83.795 45.081 1.00 34.81 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.597  83.105 45.062 1.00 35.33 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.118  84.679 42.828 1.00 33.47 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -6.206  85.779 41.930 1.00 33.10 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.731  83.462 45.772 1.00 33.35 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.793  82.212 46.545 1.00 32.55 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -8.121  81.542 46.301 1.00 32.74 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -9.164  82.192 46.252 1.00 33.47 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.591  82.451 48.083 1.00 30.72 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -8.084  80.236 46.102 1.00 32.71 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.292  79.463 45.887 1.00 32.67 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.260  78.446 47.000 1.00 32.85 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.576  77.421 46.915 1.00 31.26 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.269  78.802 44.507 1.00 33.23 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.185  79.810 43.351 1.00 34.18 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.959  80.382 43.003 1.00 31.74 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.358 80.203 42.654 1.00 32.24 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.863  81.361 41.960 1.00 33.95 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.308 81.154 41.622 1.00 31.50 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -9.039  81.755 41.264 1.00 33.23 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -10.000 78.750 48.049 1.00 31.22 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -10.010 77.925 49.239 1.00 33.52 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.209 77.037 49.347 1.00 34.02 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.318 77.439 48.994 1.00 34.62 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.974  78.807 50.485 1.00 30.53 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.978  79.964 50.385 1.00 31.92 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -9.128  80.836 51.609 1.00 30.13 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.517  79.411 50.220 1.00 32.14 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.977 75.842 49.886 1.00 32.98 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -12.059 74.899 50.081 1.00 31.95 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.727 74.329 48.836 1.00 30.84 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.928 74.224 48.824 1.00 32.13 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.979 73.952 47.806 1.00 31.30 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.569 73.365 46.591 1.00 30.14 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.689 71.860 46.873 1.00 30.99 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.695 71.209 47.204 1.00 30.99 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.635 73.562 45.386 1.00 32.30 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.490 75.052 45.058 1.00 32.46 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.183 72.782 44.142 1.00 33.30 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.426 75.301 43.985 1.00 29.31 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.893 71.282 46.728 1.00 32.40 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -14.088 69.834 47.002 1.00 31.80 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.504 68.947 45.901 1.00 32.20 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.605 69.290 44.711 1.00 31.85 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.611 69.710 47.109 1.00 31.17 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -16.058 70.714 46.002 1.00 31.75 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -15.143 71.913 46.226 1.00 30.41 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.881 67.821 46.263 1.00 29.72 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.315 66.982 45.206 1.00 29.60 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.830 65.554 45.339 1.00 31.76 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.493 64.689 44.542 1.00 33.27 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.758 67.030 45.194 1.00 29.80 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -10.099 66.512 46.474 1.00 28.36 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.009 65.137 46.712 1.00 28.35 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.647  67.413 47.462 1.00 27.41 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.480  64.624 47.941 1.00 27.24 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -9.118  66.937 48.690 1.00 28.31 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -9.040  65.529 48.930 1.00 28.43 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.711 65.337 46.308 1.00 32.21 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.296 64.027 46.540 1.00 32.84 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.653 64.245 47.206 1.00 33.49 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.919 65.302 47.751 1.00 32.84 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.417 63.207 47.504 1.00 31.80 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.520 63.239 47.147 1.00 34.35 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.790 63.327 47.826 1.00 35.21 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.440 63.198 49.332 1.00 35.92 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.469 62.525 49.697 1.00 33.78 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.669 62.132 47.403 1.00 36.72 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.159 62.245 45.933 1.00 40.55 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.152 63.401 45.811 1.00 42.22 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.082 63.386 46.618 1.00 44.67 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -20.007 64.310 44.970 1.00 44.84 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.245 63.815 50.211 1.00 35.99 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.986 63.716 51.652 1.00 35.93 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.943 62.219 52.067 1.00 36.75 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.829 61.449 51.739 1.00 35.14 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.165 64.480 52.264 1.00 36.22 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.418 65.590 51.168 1.00 36.36 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.336 64.777 49.901 1.00 35.14 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.892 61.787 52.803 1.00 36.34 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.845 60.373 53.177 1.00 35.97 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.538 60.106 54.516 1.00 38.05 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.931 59.623 55.476 1.00 38.08 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.354 60.081 53.191 1.00 36.57 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.759 61.369 53.709 1.00 35.58 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.628 62.480 53.103 1.00 35.83 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.831 60.398 54.537 1.00 37.99 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.661 60.269 55.715 1.00 38.76 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.657 59.096 55.652 1.00 38.96 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.875 58.515 54.600 1.00 38.29 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.401 61.585 55.906 1.00 39.00 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.399 62.746 55.724 1.00 37.13 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.490 61.729 54.804 1.00 39.93 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.228 58.760 56.812 1.00 39.67 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.196 57.672 56.928 1.00 39.29 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.619 56.338 56.515 1.00 40.57 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.579 55.885 57.038 1.00 40.18 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.301 55.669 55.598 1.00 40.01 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.803 54.390 55.076 1.00 41.20 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.505 54.537 54.281 1.00 38.77 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.886 53.569 53.936 1.00 37.52 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.860 53.749 54.187 1.00 47.00 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.832 52.913 54.990 1.00 52.65 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.553 53.433 55.866 1.00 55.86 ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -23.846 51.601 54.721 1.00 55.25 ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.099 55.755 53.985 1.00 37.57 ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.844 55.952 53.265 1.00 38.21 ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.623 56.022 54.200 1.00 35.39 ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.498 55.982 53.729 1.00 34.97 ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.945 57.214 52.442 1.00 40.19 ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -20.173 57.139 51.551 1.00 47.68 ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.692 56.122 50.199 1.00 55.26 ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -18.876 57.636 49.268 1.00 53.54 ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.840 56.123 55.507 1.00 33.69 ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.706 56.155 56.478 1.00 32.61 ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.899 54.877 56.275 1.00 34.10 ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.489 53.784 56.166 1.00 35.88 ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.209 56.226 57.939 1.00 31.47 ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.063 56.148 58.989 1.00 31.37 ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.613 56.133 60.423 1.00 31.06 ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.266 57.380 60.818 1.00 30.19 ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.925 57.494 61.959 1.00 32.64 ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.015 56.433 62.763 1.00 32.88 ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.406 58.666 62.347 1.00 28.73 ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.575 55.015 56.192 1.00 32.17 ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.616 53.926 55.967 1.00 32.01 ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.447 53.457 54.517 1.00 32.88 ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.457 52.784 54.190 1.00 32.43 ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.900 52.678 56.835 1.00 33.58 ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.037 52.960 58.322 1.00 32.51 ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.123 53.782 58.995 1.00 32.57 ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.105 52.423 59.028 1.00 32.63 ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.283 54.077 60.378 1.00 33.45 ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.296 52.702 60.411 1.00 33.83 ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.387 53.534 61.093 1.00 33.37 ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.364 53.835 53.633 1.00 33.07 ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.260 53.412 52.247 1.00 35.81 ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.378 54.322 51.386 1.00 34.16 ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.126 55.477 51.728 1.00 31.18 ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.646 53.395 51.535 1.00 40.50 ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.615 52.335 51.941 1.00 45.94 ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.817 52.382 51.010 1.00 50.68 ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.758 51.360 51.436 1.00 57.97 ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -20.058 51.573 51.647 1.00 60.56 ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.844 50.576 52.049 1.00 62.84 ? 46   ARG A NH1 1 
ATOM   325  N N   . ARG A 1 47  ? -12.961 53.767 50.249 1.00 33.56 ? 47   ARG A N   1 
ATOM   326  C CA  . ARG A 1 47  ? -12.214 54.514 49.248 1.00 34.79 ? 47   ARG A CA  1 
ATOM   327  C C   . ARG A 1 47  ? -13.008 55.820 48.875 1.00 34.25 ? 47   ARG A C   1 
ATOM   328  O O   . ARG A 1 47  ? -14.234 55.840 48.872 1.00 32.94 ? 47   ARG A O   1 
ATOM   329  C CB  . ARG A 1 47  ? -12.030 53.623 48.023 1.00 37.57 ? 47   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 47  ? -11.363 52.291 48.396 1.00 41.54 ? 47   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 47  ? -10.630 51.637 47.233 1.00 47.45 ? 47   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 47  ? -9.984  50.400 47.686 1.00 53.77 ? 47   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 47  ? -8.961  49.793 47.087 1.00 57.45 ? 47   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 47  ? -8.416  50.314 45.974 1.00 59.99 ? 47   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 47  ? -8.503  48.634 47.576 1.00 58.53 ? 47   ARG A NH2 1 
ATOM   336  N N   . PRO A 1 48  ? -12.300 56.931 48.598 1.00 32.79 ? 48   PRO A N   1 
ATOM   337  C CA  . PRO A 1 48  ? -13.034 58.144 48.246 1.00 32.33 ? 48   PRO A CA  1 
ATOM   338  C C   . PRO A 1 48  ? -13.747 58.022 46.897 1.00 33.71 ? 48   PRO A C   1 
ATOM   339  O O   . PRO A 1 48  ? -13.350 57.257 46.055 1.00 31.61 ? 48   PRO A O   1 
ATOM   340  C CB  . PRO A 1 48  ? -11.925 59.205 48.158 1.00 30.49 ? 48   PRO A CB  1 
ATOM   341  C CG  . PRO A 1 48  ? -10.725 58.371 47.675 1.00 28.38 ? 48   PRO A CG  1 
ATOM   342  C CD  . PRO A 1 48  ? -10.834 57.143 48.524 1.00 31.03 ? 48   PRO A CD  1 
ATOM   343  N N   . GLU A 1 49  ? -14.777 58.822 46.710 1.00 35.83 ? 49   GLU A N   1 
ATOM   344  C CA  . GLU A 1 49  ? -15.488 58.870 45.442 1.00 38.77 ? 49   GLU A CA  1 
ATOM   345  C C   . GLU A 1 49  ? -15.258 60.280 44.848 1.00 36.72 ? 49   GLU A C   1 
ATOM   346  O O   . GLU A 1 49  ? -15.295 61.287 45.572 1.00 35.81 ? 49   GLU A O   1 
ATOM   347  C CB  . GLU A 1 49  ? -17.002 58.666 45.653 1.00 41.76 ? 49   GLU A CB  1 
ATOM   348  C CG  . GLU A 1 49  ? -17.401 57.237 46.041 1.00 49.59 ? 49   GLU A CG  1 
ATOM   349  C CD  . GLU A 1 49  ? -16.967 56.184 45.005 1.00 53.36 ? 49   GLU A CD  1 
ATOM   350  O OE1 . GLU A 1 49  ? -17.021 56.470 43.773 1.00 57.92 ? 49   GLU A OE1 1 
ATOM   351  O OE2 . GLU A 1 49  ? -16.582 55.060 45.412 1.00 55.47 ? 49   GLU A OE2 1 
ATOM   352  N N   . PRO A 1 50  ? -15.047 60.358 43.529 1.00 35.76 ? 50   PRO A N   1 
ATOM   353  C CA  . PRO A 1 50  ? -14.821 61.649 42.861 1.00 35.66 ? 50   PRO A CA  1 
ATOM   354  C C   . PRO A 1 50  ? -15.995 62.616 43.124 1.00 36.04 ? 50   PRO A C   1 
ATOM   355  O O   . PRO A 1 50  ? -17.127 62.194 43.251 1.00 35.14 ? 50   PRO A O   1 
ATOM   356  C CB  . PRO A 1 50  ? -14.644 61.261 41.394 1.00 36.54 ? 50   PRO A CB  1 
ATOM   357  C CG  . PRO A 1 50  ? -15.318 59.889 41.272 1.00 37.85 ? 50   PRO A CG  1 
ATOM   358  C CD  . PRO A 1 50  ? -15.099 59.220 42.576 1.00 35.66 ? 50   PRO A CD  1 
ATOM   359  N N   . LYS A 1 51  ? -15.722 63.904 43.281 1.00 35.77 ? 51   LYS A N   1 
ATOM   360  C CA  . LYS A 1 51  ? -16.792 64.849 43.584 1.00 36.93 ? 51   LYS A CA  1 
ATOM   361  C C   . LYS A 1 51  ? -17.758 64.981 42.359 1.00 38.12 ? 51   LYS A C   1 
ATOM   362  O O   . LYS A 1 51  ? -17.303 65.029 41.213 1.00 35.58 ? 51   LYS A O   1 
ATOM   363  C CB  . LYS A 1 51  ? -16.154 66.199 43.925 1.00 38.06 ? 51   LYS A CB  1 
ATOM   364  C CG  . LYS A 1 51  ? -17.108 67.370 44.098 1.00 36.70 ? 51   LYS A CG  1 
ATOM   365  C CD  . LYS A 1 51  ? -18.026 67.180 45.273 1.00 39.67 ? 51   LYS A CD  1 
ATOM   366  C CE  . LYS A 1 51  ? -18.910 68.392 45.461 1.00 38.43 ? 51   LYS A CE  1 
ATOM   367  N NZ  . LYS A 1 51  ? -19.720 68.264 46.721 1.00 42.62 ? 51   LYS A NZ  1 
ATOM   368  N N   . LYS A 1 52  ? -19.077 64.982 42.592 1.00 38.30 ? 52   LYS A N   1 
ATOM   369  C CA  . LYS A 1 52  ? -20.019 65.154 41.470 1.00 38.19 ? 52   LYS A CA  1 
ATOM   370  C C   . LYS A 1 52  ? -19.953 66.593 40.963 1.00 37.64 ? 52   LYS A C   1 
ATOM   371  O O   . LYS A 1 52  ? -19.982 67.538 41.751 1.00 36.95 ? 52   LYS A O   1 
ATOM   372  C CB  . LYS A 1 52  ? -21.451 64.877 41.916 1.00 39.54 ? 52   LYS A CB  1 
ATOM   373  C CG  . LYS A 1 52  ? -21.726 63.417 42.301 1.00 41.70 ? 52   LYS A CG  1 
ATOM   374  N N   . PRO A 1 53  ? -19.837 66.781 39.644 1.00 38.03 ? 53   PRO A N   1 
ATOM   375  C CA  . PRO A 1 53  ? -19.789 68.173 39.201 1.00 39.07 ? 53   PRO A CA  1 
ATOM   376  C C   . PRO A 1 53  ? -21.040 68.941 39.680 1.00 39.25 ? 53   PRO A C   1 
ATOM   377  O O   . PRO A 1 53  ? -22.113 68.358 39.907 1.00 36.37 ? 53   PRO A O   1 
ATOM   378  C CB  . PRO A 1 53  ? -19.720 68.054 37.674 1.00 39.14 ? 53   PRO A CB  1 
ATOM   379  C CG  . PRO A 1 53  ? -19.022 66.705 37.486 1.00 40.30 ? 53   PRO A CG  1 
ATOM   380  C CD  . PRO A 1 53  ? -19.719 65.849 38.502 1.00 37.54 ? 53   PRO A CD  1 
ATOM   381  N N   . TRP A 1 54  ? -20.876 70.249 39.838 1.00 39.70 ? 54   TRP A N   1 
ATOM   382  C CA  . TRP A 1 54  ? -21.968 71.105 40.286 1.00 41.03 ? 54   TRP A CA  1 
ATOM   383  C C   . TRP A 1 54  ? -22.224 72.197 39.259 1.00 43.56 ? 54   TRP A C   1 
ATOM   384  O O   . TRP A 1 54  ? -21.307 72.619 38.511 1.00 42.87 ? 54   TRP A O   1 
ATOM   385  C CB  . TRP A 1 54  ? -21.614 71.754 41.617 1.00 39.86 ? 54   TRP A CB  1 
ATOM   386  C CG  . TRP A 1 54  ? -20.392 72.586 41.518 1.00 38.27 ? 54   TRP A CG  1 
ATOM   387  C CD1 . TRP A 1 54  ? -20.313 73.870 41.095 1.00 38.55 ? 54   TRP A CD1 1 
ATOM   388  C CD2 . TRP A 1 54  ? -19.061 72.172 41.805 1.00 37.18 ? 54   TRP A CD2 1 
ATOM   389  N NE1 . TRP A 1 54  ? -19.013 74.296 41.097 1.00 37.95 ? 54   TRP A NE1 1 
ATOM   390  C CE2 . TRP A 1 54  ? -18.219 73.264 41.530 1.00 38.98 ? 54   TRP A CE2 1 
ATOM   391  C CE3 . TRP A 1 54  ? -18.493 70.979 42.269 1.00 38.56 ? 54   TRP A CE3 1 
ATOM   392  C CZ2 . TRP A 1 54  ? -16.835 73.202 41.706 1.00 36.90 ? 54   TRP A CZ2 1 
ATOM   393  C CZ3 . TRP A 1 54  ? -17.123 70.916 42.441 1.00 36.26 ? 54   TRP A CZ3 1 
ATOM   394  C CH2 . TRP A 1 54  ? -16.312 72.023 42.160 1.00 36.56 ? 54   TRP A CH2 1 
ATOM   395  N N   . SER A 1 55  ? -23.483 72.632 39.194 1.00 43.83 ? 55   SER A N   1 
ATOM   396  C CA  . SER A 1 55  ? -23.832 73.726 38.306 1.00 45.76 ? 55   SER A CA  1 
ATOM   397  C C   . SER A 1 55  ? -23.756 74.971 39.213 1.00 44.99 ? 55   SER A C   1 
ATOM   398  O O   . SER A 1 55  ? -23.715 74.860 40.441 1.00 45.86 ? 55   SER A O   1 
ATOM   399  C CB  . SER A 1 55  ? -25.249 73.517 37.728 1.00 47.26 ? 55   SER A CB  1 
ATOM   400  O OG  . SER A 1 55  ? -26.207 73.441 38.774 1.00 51.01 ? 55   SER A OG  1 
ATOM   401  N N   . GLY A 1 56  ? -23.721 76.165 38.652 1.00 45.21 ? 56   GLY A N   1 
ATOM   402  C CA  . GLY A 1 56  ? -23.615 77.313 39.553 1.00 43.36 ? 56   GLY A CA  1 
ATOM   403  C C   . GLY A 1 56  ? -22.164 77.555 39.969 1.00 42.25 ? 56   GLY A C   1 
ATOM   404  O O   . GLY A 1 56  ? -21.247 76.854 39.508 1.00 40.51 ? 56   GLY A O   1 
ATOM   405  N N   . VAL A 1 57  ? -21.959 78.506 40.867 1.00 40.46 ? 57   VAL A N   1 
ATOM   406  C CA  . VAL A 1 57  ? -20.618 78.883 41.275 1.00 40.88 ? 57   VAL A CA  1 
ATOM   407  C C   . VAL A 1 57  ? -20.207 78.456 42.683 1.00 40.84 ? 57   VAL A C   1 
ATOM   408  O O   . VAL A 1 57  ? -20.901 78.750 43.657 1.00 39.67 ? 57   VAL A O   1 
ATOM   409  C CB  . VAL A 1 57  ? -20.458 80.391 41.100 1.00 41.37 ? 57   VAL A CB  1 
ATOM   410  C CG1 . VAL A 1 57  ? -19.089 80.852 41.563 1.00 41.50 ? 57   VAL A CG1 1 
ATOM   411  C CG2 . VAL A 1 57  ? -20.658 80.714 39.604 1.00 42.11 ? 57   VAL A CG2 1 
ATOM   412  N N   . TRP A 1 58  ? -19.078 77.727 42.785 1.00 39.93 ? 58   TRP A N   1 
ATOM   413  C CA  . TRP A 1 58  ? -18.624 77.267 44.101 1.00 37.87 ? 58   TRP A CA  1 
ATOM   414  C C   . TRP A 1 58  ? -17.884 78.404 44.753 1.00 36.66 ? 58   TRP A C   1 
ATOM   415  O O   . TRP A 1 58  ? -16.943 78.964 44.203 1.00 36.59 ? 58   TRP A O   1 
ATOM   416  C CB  . TRP A 1 58  ? -17.729 76.037 43.992 1.00 37.46 ? 58   TRP A CB  1 
ATOM   417  C CG  . TRP A 1 58  ? -17.447 75.462 45.331 1.00 37.87 ? 58   TRP A CG  1 
ATOM   418  C CD1 . TRP A 1 58  ? -16.557 75.934 46.245 1.00 37.24 ? 58   TRP A CD1 1 
ATOM   419  C CD2 . TRP A 1 58  ? -18.116 74.360 45.949 1.00 36.59 ? 58   TRP A CD2 1 
ATOM   420  N NE1 . TRP A 1 58  ? -16.630 75.205 47.397 1.00 37.17 ? 58   TRP A NE1 1 
ATOM   421  C CE2 . TRP A 1 58  ? -17.581 74.230 47.252 1.00 37.12 ? 58   TRP A CE2 1 
ATOM   422  C CE3 . TRP A 1 58  ? -19.113 73.465 45.527 1.00 37.58 ? 58   TRP A CE3 1 
ATOM   423  C CZ2 . TRP A 1 58  ? -18.012 73.243 48.158 1.00 35.63 ? 58   TRP A CZ2 1 
ATOM   424  C CZ3 . TRP A 1 58  ? -19.548 72.474 46.420 1.00 37.85 ? 58   TRP A CZ3 1 
ATOM   425  C CH2 . TRP A 1 58  ? -18.992 72.378 47.727 1.00 37.24 ? 58   TRP A CH2 1 
ATOM   426  N N   . ASN A 1 59  ? -18.357 78.771 45.925 1.00 37.15 ? 59   ASN A N   1 
ATOM   427  C CA  . ASN A 1 59  ? -17.755 79.856 46.662 1.00 38.10 ? 59   ASN A CA  1 
ATOM   428  C C   . ASN A 1 59  ? -16.501 79.287 47.361 1.00 37.13 ? 59   ASN A C   1 
ATOM   429  O O   . ASN A 1 59  ? -16.634 78.510 48.312 1.00 34.46 ? 59   ASN A O   1 
ATOM   430  C CB  . ASN A 1 59  ? -18.732 80.357 47.721 1.00 41.38 ? 59   ASN A CB  1 
ATOM   431  C CG  . ASN A 1 59  ? -18.173 81.531 48.497 1.00 47.03 ? 59   ASN A CG  1 
ATOM   432  O OD1 . ASN A 1 59  ? -16.964 81.678 48.683 1.00 46.89 ? 59   ASN A OD1 1 
ATOM   433  N ND2 . ASN A 1 59  ? -19.067 82.377 48.974 1.00 53.57 ? 59   ASN A ND2 1 
ATOM   434  N N   . ALA A 1 60  ? -15.318 79.677 46.884 1.00 36.39 ? 60   ALA A N   1 
ATOM   435  C CA  . ALA A 1 60  ? -14.026 79.208 47.421 1.00 35.24 ? 60   ALA A CA  1 
ATOM   436  C C   . ALA A 1 60  ? -13.332 80.404 48.021 1.00 36.14 ? 60   ALA A C   1 
ATOM   437  O O   . ALA A 1 60  ? -12.173 80.687 47.705 1.00 34.52 ? 60   ALA A O   1 
ATOM   438  C CB  . ALA A 1 60  ? -13.179 78.676 46.310 1.00 34.05 ? 60   ALA A CB  1 
ATOM   439  N N   . SER A 1 61  ? -14.044 81.137 48.866 1.00 35.31 ? 61   SER A N   1 
ATOM   440  C CA  . SER A 1 61  ? -13.431 82.306 49.429 1.00 36.52 ? 61   SER A CA  1 
ATOM   441  C C   . SER A 1 61  ? -12.955 82.005 50.832 1.00 35.24 ? 61   SER A C   1 
ATOM   442  O O   . SER A 1 61  ? -12.244 82.800 51.397 1.00 35.06 ? 61   SER A O   1 
ATOM   443  C CB  . SER A 1 61  ? -14.460 83.455 49.473 1.00 36.81 ? 61   SER A CB  1 
ATOM   444  O OG  . SER A 1 61  ? -15.464 83.099 50.425 1.00 37.24 ? 61   SER A OG  1 
ATOM   445  N N   . THR A 1 62  ? -13.344 80.864 51.398 1.00 35.30 ? 62   THR A N   1 
ATOM   446  C CA  . THR A 1 62  ? -12.963 80.584 52.784 1.00 36.60 ? 62   THR A CA  1 
ATOM   447  C C   . THR A 1 62  ? -12.417 79.181 53.052 1.00 35.48 ? 62   THR A C   1 
ATOM   448  O O   . THR A 1 62  ? -12.805 78.230 52.393 1.00 35.62 ? 62   THR A O   1 
ATOM   449  C CB  . THR A 1 62  ? -14.175 80.766 53.697 1.00 38.43 ? 62   THR A CB  1 
ATOM   450  O OG1 . THR A 1 62  ? -15.175 79.827 53.306 1.00 40.23 ? 62   THR A OG1 1 
ATOM   451  C CG2 . THR A 1 62  ? -14.800 82.157 53.526 1.00 39.54 ? 62   THR A CG2 1 
ATOM   452  N N   . TYR A 1 63  ? -11.520 79.057 54.025 1.00 34.35 ? 63   TYR A N   1 
ATOM   453  C CA  . TYR A 1 63  ? -10.975 77.740 54.382 1.00 33.30 ? 63   TYR A CA  1 
ATOM   454  C C   . TYR A 1 63  ? -12.089 76.730 54.709 1.00 32.88 ? 63   TYR A C   1 
ATOM   455  O O   . TYR A 1 63  ? -13.143 77.082 55.210 1.00 31.77 ? 63   TYR A O   1 
ATOM   456  C CB  . TYR A 1 63  ? -10.031 77.823 55.579 1.00 30.09 ? 63   TYR A CB  1 
ATOM   457  C CG  . TYR A 1 63  ? -8.630  78.259 55.230 1.00 29.96 ? 63   TYR A CG  1 
ATOM   458  C CD1 . TYR A 1 63  ? -7.993  77.743 54.092 1.00 31.94 ? 63   TYR A CD1 1 
ATOM   459  C CD2 . TYR A 1 63  ? -7.877  79.059 56.109 1.00 31.20 ? 63   TYR A CD2 1 
ATOM   460  C CE1 . TYR A 1 63  ? -6.656  77.993 53.822 1.00 29.02 ? 63   TYR A CE1 1 
ATOM   461  C CE2 . TYR A 1 63  ? -6.509  79.316 55.872 1.00 29.55 ? 63   TYR A CE2 1 
ATOM   462  C CZ  . TYR A 1 63  ? -5.921  78.772 54.720 1.00 31.70 ? 63   TYR A CZ  1 
ATOM   463  O OH  . TYR A 1 63  ? -4.609  78.969 54.446 1.00 32.10 ? 63   TYR A OH  1 
ATOM   464  N N   . PRO A 1 64  ? -11.861 75.453 54.371 1.00 31.59 ? 64   PRO A N   1 
ATOM   465  C CA  . PRO A 1 64  ? -12.781 74.335 54.604 1.00 30.87 ? 64   PRO A CA  1 
ATOM   466  C C   . PRO A 1 64  ? -12.606 73.837 56.064 1.00 31.71 ? 64   PRO A C   1 
ATOM   467  O O   . PRO A 1 64  ? -11.730 74.329 56.771 1.00 29.89 ? 64   PRO A O   1 
ATOM   468  C CB  . PRO A 1 64  ? -12.275 73.283 53.603 1.00 30.21 ? 64   PRO A CB  1 
ATOM   469  C CG  . PRO A 1 64  ? -10.742 73.508 53.693 1.00 30.24 ? 64   PRO A CG  1 
ATOM   470  C CD  . PRO A 1 64  ? -10.709 75.038 53.541 1.00 30.17 ? 64   PRO A CD  1 
ATOM   471  N N   . ASN A 1 65  ? -13.467 72.904 56.483 1.00 29.08 ? 65   ASN A N   1 
ATOM   472  C CA  . ASN A 1 65  ? -13.352 72.250 57.751 1.00 30.74 ? 65   ASN A CA  1 
ATOM   473  C C   . ASN A 1 65  ? -12.030 71.385 57.699 1.00 30.99 ? 65   ASN A C   1 
ATOM   474  O O   . ASN A 1 65  ? -11.497 71.047 56.628 1.00 29.41 ? 65   ASN A O   1 
ATOM   475  C CB  . ASN A 1 65  ? -14.509 71.243 57.971 1.00 33.02 ? 65   ASN A CB  1 
ATOM   476  C CG  . ASN A 1 65  ? -15.933 71.902 57.917 1.00 36.77 ? 65   ASN A CG  1 
ATOM   477  O OD1 . ASN A 1 65  ? -16.186 72.893 58.584 1.00 36.16 ? 65   ASN A OD1 1 
ATOM   478  N ND2 . ASN A 1 65  ? -16.843 71.321 57.121 1.00 37.76 ? 65   ASN A ND2 1 
ATOM   479  N N   . ASN A 1 66  ? -11.577 70.955 58.865 1.00 29.93 ? 66   ASN A N   1 
ATOM   480  C CA  . ASN A 1 66  ? -10.395 70.102 58.966 1.00 30.46 ? 66   ASN A CA  1 
ATOM   481  C C   . ASN A 1 66  ? -10.952 68.712 59.255 1.00 29.89 ? 66   ASN A C   1 
ATOM   482  O O   . ASN A 1 66  ? -12.026 68.607 59.832 1.00 29.53 ? 66   ASN A O   1 
ATOM   483  C CB  . ASN A 1 66  ? -9.528  70.541 60.156 1.00 28.03 ? 66   ASN A CB  1 
ATOM   484  C CG  . ASN A 1 66  ? -8.978  71.984 60.009 1.00 31.90 ? 66   ASN A CG  1 
ATOM   485  O OD1 . ASN A 1 66  ? -8.800  72.691 61.002 1.00 33.41 ? 66   ASN A OD1 1 
ATOM   486  N ND2 . ASN A 1 66  ? -8.683  72.407 58.768 1.00 31.59 ? 66   ASN A ND2 1 
ATOM   487  N N   . CYS A 1 67  ? -10.234 67.655 58.874 1.00 28.74 ? 67   CYS A N   1 
ATOM   488  C CA  . CYS A 1 67  ? -10.707 66.308 59.176 1.00 29.93 ? 67   CYS A CA  1 
ATOM   489  C C   . CYS A 1 67  ? -10.699 66.034 60.682 1.00 31.34 ? 67   CYS A C   1 
ATOM   490  O O   . CYS A 1 67  ? -9.953  66.671 61.463 1.00 29.66 ? 67   CYS A O   1 
ATOM   491  C CB  . CYS A 1 67  ? -9.813  65.276 58.450 1.00 29.04 ? 67   CYS A CB  1 
ATOM   492  S SG  . CYS A 1 67  ? -9.877  65.465 56.627 1.00 33.63 ? 67   CYS A SG  1 
ATOM   493  N N   . GLN A 1 68  ? -11.511 65.063 61.090 1.00 31.62 ? 68   GLN A N   1 
ATOM   494  C CA  . GLN A 1 68  ? -11.606 64.678 62.489 1.00 31.65 ? 68   GLN A CA  1 
ATOM   495  C C   . GLN A 1 68  ? -10.259 64.094 62.931 1.00 31.51 ? 68   GLN A C   1 
ATOM   496  O O   . GLN A 1 68  ? -9.745  63.148 62.292 1.00 30.24 ? 68   GLN A O   1 
ATOM   497  C CB  . GLN A 1 68  ? -12.699 63.626 62.675 1.00 32.55 ? 68   GLN A CB  1 
ATOM   498  C CG  . GLN A 1 68  ? -14.121 64.173 62.447 1.00 32.61 ? 68   GLN A CG  1 
ATOM   499  C CD  . GLN A 1 68  ? -14.677 64.938 63.672 1.00 35.32 ? 68   GLN A CD  1 
ATOM   500  O OE1 . GLN A 1 68  ? -15.816 65.377 63.657 1.00 37.58 ? 68   GLN A OE1 1 
ATOM   501  N NE2 . GLN A 1 68  ? -13.874 65.108 64.704 1.00 31.81 ? 68   GLN A NE2 1 
ATOM   502  N N   . GLN A 1 69  ? -9.730  64.624 64.042 1.00 29.31 ? 69   GLN A N   1 
ATOM   503  C CA  . GLN A 1 69  ? -8.429  64.181 64.553 1.00 29.02 ? 69   GLN A CA  1 
ATOM   504  C C   . GLN A 1 69  ? -8.243  64.474 66.054 1.00 28.47 ? 69   GLN A C   1 
ATOM   505  O O   . GLN A 1 69  ? -8.994  65.274 66.654 1.00 25.49 ? 69   GLN A O   1 
ATOM   506  C CB  . GLN A 1 69  ? -7.304  64.921 63.777 1.00 27.84 ? 69   GLN A CB  1 
ATOM   507  C CG  . GLN A 1 69  ? -7.437  66.458 63.847 1.00 27.00 ? 69   GLN A CG  1 
ATOM   508  C CD  . GLN A 1 69  ? -6.521  67.187 62.871 1.00 28.47 ? 69   GLN A CD  1 
ATOM   509  O OE1 . GLN A 1 69  ? -5.353  67.505 63.182 1.00 28.31 ? 69   GLN A OE1 1 
ATOM   510  N NE2 . GLN A 1 69  ? -7.035  67.437 61.667 1.00 25.51 ? 69   GLN A NE2 1 
ATOM   511  N N   . TYR A 1 70  ? -7.240  63.813 66.640 1.00 27.58 ? 70   TYR A N   1 
ATOM   512  C CA  . TYR A 1 70  ? -6.817  64.060 68.038 1.00 27.75 ? 70   TYR A CA  1 
ATOM   513  C C   . TYR A 1 70  ? -6.390  65.547 68.074 1.00 29.67 ? 70   TYR A C   1 
ATOM   514  O O   . TYR A 1 70  ? -5.776  66.056 67.085 1.00 27.62 ? 70   TYR A O   1 
ATOM   515  C CB  . TYR A 1 70  ? -5.611  63.213 68.359 1.00 27.90 ? 70   TYR A CB  1 
ATOM   516  C CG  . TYR A 1 70  ? -4.997  63.456 69.715 1.00 31.58 ? 70   TYR A CG  1 
ATOM   517  C CD1 . TYR A 1 70  ? -5.510  62.846 70.873 1.00 30.01 ? 70   TYR A CD1 1 
ATOM   518  C CD2 . TYR A 1 70  ? -3.877  64.279 69.839 1.00 32.05 ? 70   TYR A CD2 1 
ATOM   519  C CE1 . TYR A 1 70  ? -4.903  63.056 72.113 1.00 34.40 ? 70   TYR A CE1 1 
ATOM   520  C CE2 . TYR A 1 70  ? -3.262  64.499 71.112 1.00 34.44 ? 70   TYR A CE2 1 
ATOM   521  C CZ  . TYR A 1 70  ? -3.773  63.896 72.223 1.00 32.92 ? 70   TYR A CZ  1 
ATOM   522  O OH  . TYR A 1 70  ? -3.178  64.154 73.463 1.00 35.90 ? 70   TYR A OH  1 
ATOM   523  N N   . VAL A 1 71  ? -6.727  66.232 69.177 1.00 29.15 ? 71   VAL A N   1 
ATOM   524  C CA  . VAL A 1 71  ? -6.420  67.645 69.359 1.00 29.95 ? 71   VAL A CA  1 
ATOM   525  C C   . VAL A 1 71  ? -5.442  67.719 70.526 1.00 33.05 ? 71   VAL A C   1 
ATOM   526  O O   . VAL A 1 71  ? -5.721  67.213 71.627 1.00 33.67 ? 71   VAL A O   1 
ATOM   527  C CB  . VAL A 1 71  ? -7.719  68.444 69.678 1.00 29.12 ? 71   VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 71  ? -7.420  69.871 70.182 1.00 27.91 ? 71   VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 71  ? -8.566  68.546 68.362 1.00 28.96 ? 71   VAL A CG2 1 
ATOM   530  N N   . ASP A 1 72  ? -4.293  68.344 70.299 1.00 33.45 ? 72   ASP A N   1 
ATOM   531  C CA  . ASP A 1 72  ? -3.279  68.449 71.361 1.00 33.70 ? 72   ASP A CA  1 
ATOM   532  C C   . ASP A 1 72  ? -3.736  69.468 72.432 1.00 33.96 ? 72   ASP A C   1 
ATOM   533  O O   . ASP A 1 72  ? -3.952  70.639 72.136 1.00 35.10 ? 72   ASP A O   1 
ATOM   534  C CB  . ASP A 1 72  ? -1.948  68.893 70.718 1.00 33.85 ? 72   ASP A CB  1 
ATOM   535  C CG  . ASP A 1 72  ? -0.838  69.127 71.733 1.00 35.44 ? 72   ASP A CG  1 
ATOM   536  O OD1 . ASP A 1 72  ? -1.083  69.019 72.950 1.00 35.74 ? 72   ASP A OD1 1 
ATOM   537  O OD2 . ASP A 1 72  ? 0.288   69.412 71.306 1.00 31.87 ? 72   ASP A OD2 1 
ATOM   538  N N   . GLU A 1 73  ? -3.899  69.017 73.667 1.00 34.77 ? 73   GLU A N   1 
ATOM   539  C CA  . GLU A 1 73  ? -4.303  69.895 74.773 1.00 37.81 ? 73   GLU A CA  1 
ATOM   540  C C   . GLU A 1 73  ? -3.190  69.905 75.851 1.00 37.60 ? 73   GLU A C   1 
ATOM   541  O O   . GLU A 1 73  ? -3.452  70.246 77.013 1.00 38.44 ? 73   GLU A O   1 
ATOM   542  C CB  . GLU A 1 73  ? -5.576  69.354 75.463 1.00 39.39 ? 73   GLU A CB  1 
ATOM   543  C CG  . GLU A 1 73  ? -6.874  69.449 74.730 1.00 42.64 ? 73   GLU A CG  1 
ATOM   544  C CD  . GLU A 1 73  ? -8.023  68.821 75.557 1.00 45.19 ? 73   GLU A CD  1 
ATOM   545  O OE1 . GLU A 1 73  ? -8.224  69.185 76.741 1.00 43.83 ? 73   GLU A OE1 1 
ATOM   546  O OE2 . GLU A 1 73  ? -8.738  67.956 75.017 1.00 47.46 ? 73   GLU A OE2 1 
ATOM   547  N N   . GLN A 1 74  ? -1.982  69.489 75.513 1.00 37.58 ? 74   GLN A N   1 
ATOM   548  C CA  . GLN A 1 74  ? -0.923  69.449 76.537 1.00 38.80 ? 74   GLN A CA  1 
ATOM   549  C C   . GLN A 1 74  ? -0.513  70.816 77.122 1.00 36.85 ? 74   GLN A C   1 
ATOM   550  O O   . GLN A 1 74  ? -0.269  70.914 78.306 1.00 34.21 ? 74   GLN A O   1 
ATOM   551  C CB  . GLN A 1 74  ? 0.342   68.742 75.991 1.00 40.40 ? 74   GLN A CB  1 
ATOM   552  C CG  . GLN A 1 74  ? 0.492   67.293 76.447 1.00 47.52 ? 74   GLN A CG  1 
ATOM   553  C CD  . GLN A 1 74  ? 1.020   67.102 77.905 1.00 48.28 ? 74   GLN A CD  1 
ATOM   554  O OE1 . GLN A 1 74  ? 1.832   66.207 78.148 1.00 54.12 ? 74   GLN A OE1 1 
ATOM   555  N NE2 . GLN A 1 74  ? 0.568   67.915 78.842 1.00 48.39 ? 74   GLN A NE2 1 
ATOM   556  N N   . PHE A 1 75  ? -0.472  71.846 76.281 1.00 35.08 ? 75   PHE A N   1 
ATOM   557  C CA  . PHE A 1 75  ? -0.067  73.213 76.669 1.00 34.97 ? 75   PHE A CA  1 
ATOM   558  C C   . PHE A 1 75  ? -1.107  74.196 76.126 1.00 35.81 ? 75   PHE A C   1 
ATOM   559  O O   . PHE A 1 75  ? -0.868  74.911 75.142 1.00 34.24 ? 75   PHE A O   1 
ATOM   560  C CB  . PHE A 1 75  ? 1.339   73.517 76.082 1.00 31.91 ? 75   PHE A CB  1 
ATOM   561  C CG  . PHE A 1 75  ? 2.381   72.453 76.430 1.00 31.47 ? 75   PHE A CG  1 
ATOM   562  C CD1 . PHE A 1 75  ? 2.838   72.302 77.782 1.00 29.22 ? 75   PHE A CD1 1 
ATOM   563  C CD2 . PHE A 1 75  ? 2.891   71.599 75.433 1.00 28.59 ? 75   PHE A CD2 1 
ATOM   564  C CE1 . PHE A 1 75  ? 3.782   71.319 78.116 1.00 29.02 ? 75   PHE A CE1 1 
ATOM   565  C CE2 . PHE A 1 75  ? 3.841   70.610 75.727 1.00 27.51 ? 75   PHE A CE2 1 
ATOM   566  C CZ  . PHE A 1 75  ? 4.306   70.449 77.080 1.00 28.56 ? 75   PHE A CZ  1 
ATOM   567  N N   . PRO A 1 76  ? -2.278  74.252 76.791 1.00 37.59 ? 76   PRO A N   1 
ATOM   568  C CA  . PRO A 1 76  ? -3.394  75.105 76.426 1.00 38.27 ? 76   PRO A CA  1 
ATOM   569  C C   . PRO A 1 76  ? -2.936  76.520 76.167 1.00 39.47 ? 76   PRO A C   1 
ATOM   570  O O   . PRO A 1 76  ? -2.295  77.147 77.005 1.00 39.19 ? 76   PRO A O   1 
ATOM   571  C CB  . PRO A 1 76  ? -4.352  74.944 77.635 1.00 38.44 ? 76   PRO A CB  1 
ATOM   572  C CG  . PRO A 1 76  ? -4.149  73.522 78.002 1.00 37.57 ? 76   PRO A CG  1 
ATOM   573  C CD  . PRO A 1 76  ? -2.601  73.514 78.028 1.00 38.50 ? 76   PRO A CD  1 
ATOM   574  N N   . GLY A 1 77  ? -3.254  77.018 74.981 1.00 40.42 ? 77   GLY A N   1 
ATOM   575  C CA  . GLY A 1 77  ? -2.827  78.355 74.632 1.00 40.79 ? 77   GLY A CA  1 
ATOM   576  C C   . GLY A 1 77  ? -1.337  78.532 74.282 1.00 40.65 ? 77   GLY A C   1 
ATOM   577  O O   . GLY A 1 77  ? -0.932  79.637 73.947 1.00 43.01 ? 77   GLY A O   1 
ATOM   578  N N   . PHE A 1 78  ? -0.507  77.499 74.348 1.00 38.59 ? 78   PHE A N   1 
ATOM   579  C CA  . PHE A 1 78  ? 0.928   77.680 74.032 1.00 35.25 ? 78   PHE A CA  1 
ATOM   580  C C   . PHE A 1 78  ? 1.036   77.688 72.530 1.00 34.85 ? 78   PHE A C   1 
ATOM   581  O O   . PHE A 1 78  ? 0.591   76.763 71.888 1.00 34.45 ? 78   PHE A O   1 
ATOM   582  C CB  . PHE A 1 78  ? 1.722   76.512 74.629 1.00 34.09 ? 78   PHE A CB  1 
ATOM   583  C CG  . PHE A 1 78  ? 3.184   76.559 74.346 1.00 34.71 ? 78   PHE A CG  1 
ATOM   584  C CD1 . PHE A 1 78  ? 3.953   77.667 74.746 1.00 34.74 ? 78   PHE A CD1 1 
ATOM   585  C CD2 . PHE A 1 78  ? 3.809   75.497 73.698 1.00 33.42 ? 78   PHE A CD2 1 
ATOM   586  C CE1 . PHE A 1 78  ? 5.302   77.701 74.496 1.00 34.88 ? 78   PHE A CE1 1 
ATOM   587  C CE2 . PHE A 1 78  ? 5.146   75.515 73.445 1.00 33.68 ? 78   PHE A CE2 1 
ATOM   588  C CZ  . PHE A 1 78  ? 5.910   76.614 73.839 1.00 34.13 ? 78   PHE A CZ  1 
ATOM   589  N N   . SER A 1 79  ? 1.611   78.713 71.922 1.00 35.49 ? 79   SER A N   1 
ATOM   590  C CA  . SER A 1 79  ? 1.641   78.681 70.448 1.00 34.83 ? 79   SER A CA  1 
ATOM   591  C C   . SER A 1 79  ? 2.497   77.552 69.831 1.00 33.46 ? 79   SER A C   1 
ATOM   592  O O   . SER A 1 79  ? 2.249   77.160 68.695 1.00 32.89 ? 79   SER A O   1 
ATOM   593  C CB  . SER A 1 79  ? 2.137   80.015 69.872 1.00 33.81 ? 79   SER A CB  1 
ATOM   594  O OG  . SER A 1 79  ? 3.488   80.172 70.263 1.00 37.60 ? 79   SER A OG  1 
ATOM   595  N N   . GLY A 1 80  ? 3.509   77.056 70.544 1.00 32.49 ? 80   GLY A N   1 
ATOM   596  C CA  . GLY A 1 80  ? 4.353   75.991 69.988 1.00 31.80 ? 80   GLY A CA  1 
ATOM   597  C C   . GLY A 1 80  ? 3.578   74.723 69.613 1.00 31.01 ? 80   GLY A C   1 
ATOM   598  O O   . GLY A 1 80  ? 3.883   74.039 68.613 1.00 30.74 ? 80   GLY A O   1 
ATOM   599  N N   . SER A 1 81  ? 2.596   74.391 70.444 1.00 31.24 ? 81   SER A N   1 
ATOM   600  C CA  . SER A 1 81  ? 1.766   73.213 70.224 1.00 32.00 ? 81   SER A CA  1 
ATOM   601  C C   . SER A 1 81  ? 0.487   73.521 69.444 1.00 31.61 ? 81   SER A C   1 
ATOM   602  O O   . SER A 1 81  ? 0.077   72.736 68.581 1.00 29.36 ? 81   SER A O   1 
ATOM   603  C CB  . SER A 1 81  ? 1.374   72.574 71.568 1.00 31.26 ? 81   SER A CB  1 
ATOM   604  O OG  . SER A 1 81  ? 0.879   73.536 72.475 1.00 36.01 ? 81   SER A OG  1 
ATOM   605  N N   . GLU A 1 82  ? -0.147  74.655 69.759 1.00 31.12 ? 82   GLU A N   1 
ATOM   606  C CA  . GLU A 1 82  ? -1.406  75.005 69.107 1.00 32.65 ? 82   GLU A CA  1 
ATOM   607  C C   . GLU A 1 82  ? -1.330  75.325 67.633 1.00 32.17 ? 82   GLU A C   1 
ATOM   608  O O   . GLU A 1 82  ? -2.329  75.196 66.923 1.00 30.82 ? 82   GLU A O   1 
ATOM   609  C CB  . GLU A 1 82  ? -2.087  76.141 69.878 1.00 36.67 ? 82   GLU A CB  1 
ATOM   610  C CG  . GLU A 1 82  ? -2.136  75.719 71.309 1.00 42.95 ? 82   GLU A CG  1 
ATOM   611  C CD  . GLU A 1 82  ? -3.277  76.266 72.051 1.00 47.75 ? 82   GLU A CD  1 
ATOM   612  O OE1 . GLU A 1 82  ? -3.472  77.495 71.949 1.00 49.61 ? 82   GLU A OE1 1 
ATOM   613  O OE2 . GLU A 1 82  ? -3.955  75.471 72.755 1.00 49.10 ? 82   GLU A OE2 1 
ATOM   614  N N   . MET A 1 83  ? -0.133  75.706 67.180 1.00 30.65 ? 83   MET A N   1 
ATOM   615  C CA  . MET A 1 83  ? 0.091   76.013 65.785 1.00 28.96 ? 83   MET A CA  1 
ATOM   616  C C   . MET A 1 83  ? -0.077  74.748 64.903 1.00 28.33 ? 83   MET A C   1 
ATOM   617  O O   . MET A 1 83  ? -0.115  74.879 63.701 1.00 26.04 ? 83   MET A O   1 
ATOM   618  C CB  . MET A 1 83  ? 1.501   76.546 65.584 1.00 30.36 ? 83   MET A CB  1 
ATOM   619  C CG  . MET A 1 83  ? 2.596   75.490 65.788 1.00 30.42 ? 83   MET A CG  1 
ATOM   620  S SD  . MET A 1 83  ? 4.257   76.236 65.657 1.00 32.46 ? 83   MET A SD  1 
ATOM   621  C CE  . MET A 1 83  ? 4.510   76.213 63.857 1.00 32.68 ? 83   MET A CE  1 
ATOM   622  N N   . TRP A 1 84  ? -0.191  73.563 65.517 1.00 27.29 ? 84   TRP A N   1 
ATOM   623  C CA  . TRP A 1 84  ? -0.371  72.302 64.785 1.00 28.49 ? 84   TRP A CA  1 
ATOM   624  C C   . TRP A 1 84  ? -1.795  71.743 64.881 1.00 29.02 ? 84   TRP A C   1 
ATOM   625  O O   . TRP A 1 84  ? -2.163  70.804 64.145 1.00 29.42 ? 84   TRP A O   1 
ATOM   626  C CB  . TRP A 1 84  ? 0.619   71.224 65.287 1.00 28.00 ? 84   TRP A CB  1 
ATOM   627  C CG  . TRP A 1 84  ? 2.079   71.654 65.187 1.00 26.74 ? 84   TRP A CG  1 
ATOM   628  C CD1 . TRP A 1 84  ? 2.907   71.996 66.217 1.00 25.90 ? 84   TRP A CD1 1 
ATOM   629  C CD2 . TRP A 1 84  ? 2.830   71.846 63.986 1.00 27.31 ? 84   TRP A CD2 1 
ATOM   630  N NE1 . TRP A 1 84  ? 4.152   72.396 65.726 1.00 27.00 ? 84   TRP A NE1 1 
ATOM   631  C CE2 . TRP A 1 84  ? 4.125   72.317 64.363 1.00 27.85 ? 84   TRP A CE2 1 
ATOM   632  C CE3 . TRP A 1 84  ? 2.537   71.678 62.618 1.00 26.84 ? 84   TRP A CE3 1 
ATOM   633  C CZ2 . TRP A 1 84  ? 5.126   72.619 63.421 1.00 29.24 ? 84   TRP A CZ2 1 
ATOM   634  C CZ3 . TRP A 1 84  ? 3.546   71.983 61.675 1.00 29.50 ? 84   TRP A CZ3 1 
ATOM   635  C CH2 . TRP A 1 84  ? 4.822   72.449 62.093 1.00 28.39 ? 84   TRP A CH2 1 
ATOM   636  N N   . ASN A 1 85  ? -2.596  72.332 65.756 1.00 28.47 ? 85   ASN A N   1 
ATOM   637  C CA  . ASN A 1 85  ? -3.974  71.888 65.952 1.00 29.42 ? 85   ASN A CA  1 
ATOM   638  C C   . ASN A 1 85  ? -4.923  72.398 64.881 1.00 30.00 ? 85   ASN A C   1 
ATOM   639  O O   . ASN A 1 85  ? -4.673  73.408 64.240 1.00 30.32 ? 85   ASN A O   1 
ATOM   640  C CB  . ASN A 1 85  ? -4.525  72.377 67.300 1.00 29.79 ? 85   ASN A CB  1 
ATOM   641  C CG  . ASN A 1 85  ? -4.140  71.464 68.478 1.00 32.05 ? 85   ASN A CG  1 
ATOM   642  O OD1 . ASN A 1 85  ? -3.939  70.247 68.315 1.00 31.37 ? 85   ASN A OD1 1 
ATOM   643  N ND2 . ASN A 1 85  ? -4.087  72.052 69.688 1.00 30.98 ? 85   ASN A ND2 1 
ATOM   644  N N   . PRO A 1 86  ? -6.019  71.667 64.649 1.00 29.57 ? 86   PRO A N   1 
ATOM   645  C CA  . PRO A 1 86  ? -6.966  72.139 63.643 1.00 28.63 ? 86   PRO A CA  1 
ATOM   646  C C   . PRO A 1 86  ? -7.362  73.589 64.061 1.00 30.84 ? 86   PRO A C   1 
ATOM   647  O O   . PRO A 1 86  ? -7.631  73.824 65.234 1.00 28.52 ? 86   PRO A O   1 
ATOM   648  C CB  . PRO A 1 86  ? -8.187  71.233 63.829 1.00 28.52 ? 86   PRO A CB  1 
ATOM   649  C CG  . PRO A 1 86  ? -7.695  70.045 64.598 1.00 28.36 ? 86   PRO A CG  1 
ATOM   650  C CD  . PRO A 1 86  ? -6.541  70.530 65.435 1.00 27.06 ? 86   PRO A CD  1 
ATOM   651  N N   . ASN A 1 87  ? -7.429  74.525 63.115 1.00 29.41 ? 87   ASN A N   1 
ATOM   652  C CA  . ASN A 1 87  ? -7.824  75.866 63.441 1.00 33.12 ? 87   ASN A CA  1 
ATOM   653  C C   . ASN A 1 87  ? -9.177  76.160 62.771 1.00 35.69 ? 87   ASN A C   1 
ATOM   654  O O   . ASN A 1 87  ? -9.605  77.318 62.757 1.00 35.27 ? 87   ASN A O   1 
ATOM   655  C CB  . ASN A 1 87  ? -6.788  76.876 62.953 1.00 32.79 ? 87   ASN A CB  1 
ATOM   656  C CG  . ASN A 1 87  ? -6.574  76.783 61.457 1.00 33.41 ? 87   ASN A CG  1 
ATOM   657  O OD1 . ASN A 1 87  ? -6.971  75.807 60.816 1.00 33.34 ? 87   ASN A OD1 1 
ATOM   658  N ND2 . ASN A 1 87  ? -5.954  77.801 60.891 1.00 33.22 ? 87   ASN A ND2 1 
ATOM   659  N N   . ARG A 1 88  ? -9.825  75.135 62.211 1.00 34.53 ? 88   ARG A N   1 
ATOM   660  C CA  . ARG A 1 88  ? -11.179 75.303 61.637 1.00 36.13 ? 88   ARG A CA  1 
ATOM   661  C C   . ARG A 1 88  ? -12.012 74.248 62.340 1.00 36.13 ? 88   ARG A C   1 
ATOM   662  O O   . ARG A 1 88  ? -11.462 73.422 63.017 1.00 36.14 ? 88   ARG A O   1 
ATOM   663  C CB  . ARG A 1 88  ? -11.193 75.019 60.125 1.00 36.68 ? 88   ARG A CB  1 
ATOM   664  C CG  . ARG A 1 88  ? -10.462 76.075 59.372 1.00 40.52 ? 88   ARG A CG  1 
ATOM   665  C CD  . ARG A 1 88  ? -11.457 77.156 59.188 1.00 45.06 ? 88   ARG A CD  1 
ATOM   666  N NE  . ARG A 1 88  ? -10.847 78.430 59.367 1.00 49.88 ? 88   ARG A NE  1 
ATOM   667  C CZ  . ARG A 1 88  ? -11.370 79.537 58.899 1.00 52.02 ? 88   ARG A CZ  1 
ATOM   668  N NH1 . ARG A 1 88  ? -12.538 79.490 58.238 1.00 54.06 ? 88   ARG A NH1 1 
ATOM   669  N NH2 . ARG A 1 88  ? -10.672 80.655 59.009 1.00 53.35 ? 88   ARG A NH2 1 
ATOM   670  N N   . GLU A 1 89  ? -13.321 74.250 62.185 1.00 36.79 ? 89   GLU A N   1 
ATOM   671  C CA  . GLU A 1 89  ? -14.118 73.217 62.822 1.00 37.59 ? 89   GLU A CA  1 
ATOM   672  C C   . GLU A 1 89  ? -13.795 71.832 62.200 1.00 34.73 ? 89   GLU A C   1 
ATOM   673  O O   . GLU A 1 89  ? -13.524 71.719 60.998 1.00 33.99 ? 89   GLU A O   1 
ATOM   674  C CB  . GLU A 1 89  ? -15.601 73.526 62.627 1.00 42.39 ? 89   GLU A CB  1 
ATOM   675  C CG  . GLU A 1 89  ? -16.502 72.506 63.325 1.00 50.00 ? 89   GLU A CG  1 
ATOM   676  C CD  . GLU A 1 89  ? -17.991 72.707 62.989 1.00 55.86 ? 89   GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 89  ? -18.678 71.682 62.670 1.00 57.50 ? 89   GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 89  ? -18.463 73.891 63.055 1.00 58.40 ? 89   GLU A OE2 1 
ATOM   679  N N   . MET A 1 90  ? -13.793 70.790 63.011 1.00 31.61 ? 90   MET A N   1 
ATOM   680  C CA  . MET A 1 90  ? -13.535 69.455 62.474 1.00 34.50 ? 90   MET A CA  1 
ATOM   681  C C   . MET A 1 90  ? -14.823 68.854 61.954 1.00 34.26 ? 90   MET A C   1 
ATOM   682  O O   . MET A 1 90  ? -15.895 69.083 62.526 1.00 34.24 ? 90   MET A O   1 
ATOM   683  C CB  . MET A 1 90  ? -12.955 68.523 63.558 1.00 33.62 ? 90   MET A CB  1 
ATOM   684  C CG  . MET A 1 90  ? -11.514 68.924 63.963 1.00 34.45 ? 90   MET A CG  1 
ATOM   685  S SD  . MET A 1 90  ? -10.762 67.776 65.087 1.00 33.32 ? 90   MET A SD  1 
ATOM   686  C CE  . MET A 1 90  ? -11.790 68.046 66.575 1.00 33.77 ? 90   MET A CE  1 
ATOM   687  N N   . SER A 1 91  ? -14.708 68.087 60.877 1.00 33.43 ? 91   SER A N   1 
ATOM   688  C CA  . SER A 1 91  ? -15.851 67.401 60.275 1.00 31.54 ? 91   SER A CA  1 
ATOM   689  C C   . SER A 1 91  ? -15.380 66.225 59.417 1.00 31.35 ? 91   SER A C   1 
ATOM   690  O O   . SER A 1 91  ? -14.309 66.313 58.814 1.00 30.48 ? 91   SER A O   1 
ATOM   691  C CB  . SER A 1 91  ? -16.615 68.350 59.358 1.00 31.70 ? 91   SER A CB  1 
ATOM   692  O OG  . SER A 1 91  ? -17.675 67.667 58.720 1.00 31.72 ? 91   SER A OG  1 
ATOM   693  N N   . GLU A 1 92  ? -16.154 65.139 59.345 1.00 29.03 ? 92   GLU A N   1 
ATOM   694  C CA  . GLU A 1 92  ? -15.762 64.089 58.408 1.00 31.33 ? 92   GLU A CA  1 
ATOM   695  C C   . GLU A 1 92  ? -15.915 64.600 56.978 1.00 32.29 ? 92   GLU A C   1 
ATOM   696  O O   . GLU A 1 92  ? -15.369 64.010 56.022 1.00 32.14 ? 92   GLU A O   1 
ATOM   697  C CB  . GLU A 1 92  ? -16.607 62.833 58.573 1.00 31.48 ? 92   GLU A CB  1 
ATOM   698  C CG  . GLU A 1 92  ? -16.291 62.068 59.868 1.00 31.33 ? 92   GLU A CG  1 
ATOM   699  C CD  . GLU A 1 92  ? -17.033 60.738 59.925 1.00 32.77 ? 92   GLU A CD  1 
ATOM   700  O OE1 . GLU A 1 92  ? -18.120 60.722 60.531 1.00 35.57 ? 92   GLU A OE1 1 
ATOM   701  O OE2 . GLU A 1 92  ? -16.545 59.736 59.335 1.00 32.24 ? 92   GLU A OE2 1 
ATOM   702  N N   . ASP A 1 93  ? -16.659 65.699 56.809 1.00 31.49 ? 93   ASP A N   1 
ATOM   703  C CA  . ASP A 1 93  ? -16.810 66.256 55.471 1.00 32.68 ? 93   ASP A CA  1 
ATOM   704  C C   . ASP A 1 93  ? -15.612 67.177 55.405 1.00 33.26 ? 93   ASP A C   1 
ATOM   705  O O   . ASP A 1 93  ? -15.724 68.355 55.774 1.00 33.88 ? 93   ASP A O   1 
ATOM   706  C CB  . ASP A 1 93  ? -18.116 67.047 55.379 1.00 32.65 ? 93   ASP A CB  1 
ATOM   707  C CG  . ASP A 1 93  ? -18.324 67.712 54.016 1.00 36.04 ? 93   ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 93  ? -17.438 67.685 53.115 1.00 34.64 ? 93   ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 93  ? -19.411 68.301 53.856 1.00 36.99 ? 93   ASP A OD2 1 
ATOM   710  N N   . CYS A 1 94  ? -14.470 66.657 54.931 1.00 32.17 ? 94   CYS A N   1 
ATOM   711  C CA  . CYS A 1 94  ? -13.247 67.481 54.931 1.00 32.16 ? 94   CYS A CA  1 
ATOM   712  C C   . CYS A 1 94  ? -12.372 67.302 53.721 1.00 32.38 ? 94   CYS A C   1 
ATOM   713  O O   . CYS A 1 94  ? -11.198 67.756 53.719 1.00 30.72 ? 94   CYS A O   1 
ATOM   714  C CB  . CYS A 1 94  ? -12.395 67.121 56.185 1.00 31.02 ? 94   CYS A CB  1 
ATOM   715  S SG  . CYS A 1 94  ? -11.913 65.361 56.222 1.00 30.76 ? 94   CYS A SG  1 
ATOM   716  N N   . LEU A 1 95  ? -12.887 66.641 52.684 1.00 30.69 ? 95   LEU A N   1 
ATOM   717  C CA  . LEU A 1 95  ? -11.992 66.433 51.562 1.00 30.70 ? 95   LEU A CA  1 
ATOM   718  C C   . LEU A 1 95  ? -12.015 67.596 50.568 1.00 30.32 ? 95   LEU A C   1 
ATOM   719  O O   . LEU A 1 95  ? -12.740 67.572 49.574 1.00 31.24 ? 95   LEU A O   1 
ATOM   720  C CB  . LEU A 1 95  ? -12.275 65.076 50.903 1.00 29.30 ? 95   LEU A CB  1 
ATOM   721  C CG  . LEU A 1 95  ? -11.974 63.879 51.815 1.00 31.08 ? 95   LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 95  ? -12.198 62.544 51.077 1.00 31.41 ? 95   LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 95  ? -10.527 63.983 52.295 1.00 31.17 ? 95   LEU A CD2 1 
ATOM   724  N N   . TYR A 1 96  ? -11.173 68.581 50.851 1.00 30.00 ? 96   TYR A N   1 
ATOM   725  C CA  . TYR A 1 96  ? -11.048 69.813 50.064 1.00 29.86 ? 96   TYR A CA  1 
ATOM   726  C C   . TYR A 1 96  ? -9.597  70.169 49.798 1.00 29.33 ? 96   TYR A C   1 
ATOM   727  O O   . TYR A 1 96  ? -8.683  69.656 50.470 1.00 28.81 ? 96   TYR A O   1 
ATOM   728  C CB  . TYR A 1 96  ? -11.687 70.991 50.839 1.00 30.95 ? 96   TYR A CB  1 
ATOM   729  C CG  . TYR A 1 96  ? -13.137 70.773 51.117 1.00 28.59 ? 96   TYR A CG  1 
ATOM   730  C CD1 . TYR A 1 96  ? -13.530 70.005 52.218 1.00 29.05 ? 96   TYR A CD1 1 
ATOM   731  C CD2 . TYR A 1 96  ? -14.120 71.235 50.208 1.00 30.30 ? 96   TYR A CD2 1 
ATOM   732  C CE1 . TYR A 1 96  ? -14.866 69.668 52.434 1.00 29.97 ? 96   TYR A CE1 1 
ATOM   733  C CE2 . TYR A 1 96  ? -15.505 70.900 50.407 1.00 28.29 ? 96   TYR A CE2 1 
ATOM   734  C CZ  . TYR A 1 96  ? -15.852 70.128 51.501 1.00 30.40 ? 96   TYR A CZ  1 
ATOM   735  O OH  . TYR A 1 96  ? -17.152 69.770 51.721 1.00 31.83 ? 96   TYR A OH  1 
ATOM   736  N N   . LEU A 1 97  ? -9.379  71.013 48.799 1.00 28.93 ? 97   LEU A N   1 
ATOM   737  C CA  . LEU A 1 97  ? -8.035  71.466 48.528 1.00 29.50 ? 97   LEU A CA  1 
ATOM   738  C C   . LEU A 1 97  ? -8.018  72.984 48.402 1.00 29.91 ? 97   LEU A C   1 
ATOM   739  O O   . LEU A 1 97  ? -9.056  73.603 48.148 1.00 30.38 ? 97   LEU A O   1 
ATOM   740  C CB  . LEU A 1 97  ? -7.440  70.769 47.289 1.00 27.41 ? 97   LEU A CB  1 
ATOM   741  C CG  . LEU A 1 97  ? -8.128  70.816 45.920 1.00 29.70 ? 97   LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 97  ? -7.892  72.204 45.204 1.00 29.22 ? 97   LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 97  ? -7.528  69.669 45.025 1.00 27.31 ? 97   LEU A CD2 1 
ATOM   744  N N   . ASN A 1 98  ? -6.844  73.582 48.590 1.00 30.62 ? 98   ASN A N   1 
ATOM   745  C CA  . ASN A 1 98  ? -6.687  75.031 48.495 1.00 29.73 ? 98   ASN A CA  1 
ATOM   746  C C   . ASN A 1 98  ? -5.649  75.388 47.414 1.00 31.54 ? 98   ASN A C   1 
ATOM   747  O O   . ASN A 1 98  ? -4.598  74.709 47.289 1.00 29.86 ? 98   ASN A O   1 
ATOM   748  C CB  . ASN A 1 98  ? -6.223  75.611 49.862 1.00 29.79 ? 98   ASN A CB  1 
ATOM   749  C CG  . ASN A 1 98  ? -7.102  75.159 51.003 1.00 30.05 ? 98   ASN A CG  1 
ATOM   750  O OD1 . ASN A 1 98  ? -8.280  75.448 51.002 1.00 31.04 ? 98   ASN A OD1 1 
ATOM   751  N ND2 . ASN A 1 98  ? -6.541  74.411 51.968 1.00 29.26 ? 98   ASN A ND2 1 
ATOM   752  N N   . ILE A 1 99  ? -5.924  76.463 46.651 1.00 30.36 ? 99   ILE A N   1 
ATOM   753  C CA  . ILE A 1 99  ? -4.990  76.939 45.623 1.00 30.69 ? 99   ILE A CA  1 
ATOM   754  C C   . ILE A 1 99  ? -4.634  78.449 45.726 1.00 31.44 ? 99   ILE A C   1 
ATOM   755  O O   . ILE A 1 99  ? -5.524  79.283 45.831 1.00 32.25 ? 99   ILE A O   1 
ATOM   756  C CB  . ILE A 1 99  ? -5.553  76.725 44.201 1.00 29.04 ? 99   ILE A CB  1 
ATOM   757  C CG1 . ILE A 1 99  ? -6.310  75.397 44.113 1.00 30.47 ? 99   ILE A CG1 1 
ATOM   758  C CG2 . ILE A 1 99  ? -4.395  76.704 43.217 1.00 26.99 ? 99   ILE A CG2 1 
ATOM   759  C CD1 . ILE A 1 99  ? -6.766  75.054 42.653 1.00 31.15 ? 99   ILE A CD1 1 
ATOM   760  N N   . TRP A 1 100 ? -3.353  78.781 45.695 1.00 29.35 ? 100  TRP A N   1 
ATOM   761  C CA  . TRP A 1 100 ? -2.895  80.149 45.687 1.00 30.03 ? 100  TRP A CA  1 
ATOM   762  C C   . TRP A 1 100 ? -2.346  80.328 44.283 1.00 30.92 ? 100  TRP A C   1 
ATOM   763  O O   . TRP A 1 100 ? -1.508  79.533 43.827 1.00 30.63 ? 100  TRP A O   1 
ATOM   764  C CB  . TRP A 1 100 ? -1.805  80.374 46.728 1.00 29.84 ? 100  TRP A CB  1 
ATOM   765  C CG  . TRP A 1 100 ? -2.394  80.511 48.095 1.00 30.60 ? 100  TRP A CG  1 
ATOM   766  C CD1 . TRP A 1 100 ? -2.799  81.675 48.714 1.00 31.12 ? 100  TRP A CD1 1 
ATOM   767  C CD2 . TRP A 1 100 ? -2.582  79.468 49.046 1.00 30.12 ? 100  TRP A CD2 1 
ATOM   768  N NE1 . TRP A 1 100 ? -3.202  81.419 49.990 1.00 29.41 ? 100  TRP A NE1 1 
ATOM   769  C CE2 . TRP A 1 100 ? -3.079  80.076 50.236 1.00 31.18 ? 100  TRP A CE2 1 
ATOM   770  C CE3 . TRP A 1 100 ? -2.376  78.078 49.019 1.00 29.95 ? 100  TRP A CE3 1 
ATOM   771  C CZ2 . TRP A 1 100 ? -3.365  79.343 51.393 1.00 29.99 ? 100  TRP A CZ2 1 
ATOM   772  C CZ3 . TRP A 1 100 ? -2.654  77.328 50.188 1.00 30.24 ? 100  TRP A CZ3 1 
ATOM   773  C CH2 . TRP A 1 100 ? -3.145  77.971 51.360 1.00 30.01 ? 100  TRP A CH2 1 
ATOM   774  N N   . VAL A 1 101 ? -2.813  81.372 43.606 1.00 31.05 ? 101  VAL A N   1 
ATOM   775  C CA  . VAL A 1 101 ? -2.444  81.654 42.222 1.00 31.50 ? 101  VAL A CA  1 
ATOM   776  C C   . VAL A 1 101 ? -1.898  83.081 42.043 1.00 33.06 ? 101  VAL A C   1 
ATOM   777  O O   . VAL A 1 101 ? -2.571  84.059 42.360 1.00 32.66 ? 101  VAL A O   1 
ATOM   778  C CB  . VAL A 1 101 ? -3.709  81.479 41.312 1.00 32.08 ? 101  VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 101 ? -3.366  81.796 39.814 1.00 30.24 ? 101  VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 101 ? -4.338  80.066 41.513 1.00 29.60 ? 101  VAL A CG2 1 
ATOM   781  N N   . PRO A 1 102 ? -0.655  83.211 41.547 1.00 34.88 ? 102  PRO A N   1 
ATOM   782  C CA  . PRO A 1 102 ? -0.050  84.541 41.326 1.00 35.57 ? 102  PRO A CA  1 
ATOM   783  C C   . PRO A 1 102 ? -1.051  85.413 40.555 1.00 37.75 ? 102  PRO A C   1 
ATOM   784  O O   . PRO A 1 102 ? -1.958  84.898 39.854 1.00 38.73 ? 102  PRO A O   1 
ATOM   785  C CB  . PRO A 1 102 ? 1.173   84.248 40.450 1.00 34.04 ? 102  PRO A CB  1 
ATOM   786  C CG  . PRO A 1 102 ? 1.556   82.849 40.905 1.00 36.64 ? 102  PRO A CG  1 
ATOM   787  C CD  . PRO A 1 102 ? 0.230   82.127 41.088 1.00 33.34 ? 102  PRO A CD  1 
ATOM   788  N N   . SER A 1 103 ? -0.902  86.722 40.718 1.00 37.29 ? 103  SER A N   1 
ATOM   789  C CA  . SER A 1 103 ? -1.741  87.686 40.028 1.00 38.41 ? 103  SER A CA  1 
ATOM   790  C C   . SER A 1 103 ? -0.814  88.621 39.247 1.00 37.59 ? 103  SER A C   1 
ATOM   791  O O   . SER A 1 103 ? 0.096   89.219 39.805 1.00 36.37 ? 103  SER A O   1 
ATOM   792  C CB  . SER A 1 103 ? -2.580  88.503 41.015 1.00 38.80 ? 103  SER A CB  1 
ATOM   793  O OG  . SER A 1 103 ? -3.514  89.309 40.294 1.00 40.15 ? 103  SER A OG  1 
ATOM   794  N N   . PRO A 1 104 ? -1.065  88.781 37.951 1.00 37.72 ? 104  PRO A N   1 
ATOM   795  C CA  . PRO A 1 104 ? -2.162  88.152 37.206 1.00 38.14 ? 104  PRO A CA  1 
ATOM   796  C C   . PRO A 1 104 ? -1.955  86.644 36.931 1.00 38.30 ? 104  PRO A C   1 
ATOM   797  O O   . PRO A 1 104 ? -0.821  86.143 36.925 1.00 37.60 ? 104  PRO A O   1 
ATOM   798  C CB  . PRO A 1 104 ? -2.213  88.974 35.899 1.00 39.44 ? 104  PRO A CB  1 
ATOM   799  C CG  . PRO A 1 104 ? -0.764  89.339 35.679 1.00 40.69 ? 104  PRO A CG  1 
ATOM   800  C CD  . PRO A 1 104 ? -0.306  89.728 37.106 1.00 38.77 ? 104  PRO A CD  1 
ATOM   801  N N   . ARG A 1 105 ? -3.064  85.953 36.667 1.00 37.17 ? 105  ARG A N   1 
ATOM   802  C CA  . ARG A 1 105 ? -3.067  84.531 36.425 1.00 37.47 ? 105  ARG A CA  1 
ATOM   803  C C   . ARG A 1 105 ? -1.999  84.064 35.441 1.00 37.37 ? 105  ARG A C   1 
ATOM   804  O O   . ARG A 1 105 ? -1.945  84.525 34.315 1.00 35.71 ? 105  ARG A O   1 
ATOM   805  C CB  . ARG A 1 105 ? -4.462  84.061 35.949 1.00 36.98 ? 105  ARG A CB  1 
ATOM   806  C CG  . ARG A 1 105 ? -4.615  82.544 35.957 1.00 35.72 ? 105  ARG A CG  1 
ATOM   807  C CD  . ARG A 1 105 ? -5.969  82.112 35.423 1.00 35.10 ? 105  ARG A CD  1 
ATOM   808  N NE  . ARG A 1 105 ? -7.059  82.732 36.195 1.00 36.19 ? 105  ARG A NE  1 
ATOM   809  C CZ  . ARG A 1 105 ? -8.326  82.709 35.806 1.00 35.22 ? 105  ARG A CZ  1 
ATOM   810  N NH1 . ARG A 1 105 ? -8.648  82.110 34.667 1.00 36.07 ? 105  ARG A NH1 1 
ATOM   811  N NH2 . ARG A 1 105 ? -9.266  83.261 36.541 1.00 35.23 ? 105  ARG A NH2 1 
ATOM   812  N N   . PRO A 1 106 ? -1.121  83.136 35.873 1.00 36.96 ? 106  PRO A N   1 
ATOM   813  C CA  . PRO A 1 106 ? -0.069  82.640 34.959 1.00 35.33 ? 106  PRO A CA  1 
ATOM   814  C C   . PRO A 1 106 ? -0.784  81.844 33.871 1.00 34.23 ? 106  PRO A C   1 
ATOM   815  O O   . PRO A 1 106 ? -1.960  81.520 34.030 1.00 33.80 ? 106  PRO A O   1 
ATOM   816  C CB  . PRO A 1 106 ? 0.750   81.674 35.824 1.00 36.05 ? 106  PRO A CB  1 
ATOM   817  C CG  . PRO A 1 106 ? 0.310   81.966 37.240 1.00 36.59 ? 106  PRO A CG  1 
ATOM   818  C CD  . PRO A 1 106 ? -1.126  82.396 37.142 1.00 35.30 ? 106  PRO A CD  1 
ATOM   819  N N   . LYS A 1 107 ? -0.080  81.540 32.791 1.00 32.75 ? 107  LYS A N   1 
ATOM   820  C CA  . LYS A 1 107 ? -0.605  80.712 31.722 1.00 34.10 ? 107  LYS A CA  1 
ATOM   821  C C   . LYS A 1 107 ? -0.197  79.239 31.947 1.00 35.28 ? 107  LYS A C   1 
ATOM   822  O O   . LYS A 1 107 ? -0.974  78.342 31.723 1.00 33.69 ? 107  LYS A O   1 
ATOM   823  C CB  . LYS A 1 107 ? -0.007  81.121 30.378 1.00 36.28 ? 107  LYS A CB  1 
ATOM   824  C CG  . LYS A 1 107 ? -0.179  82.596 30.051 1.00 40.31 ? 107  LYS A CG  1 
ATOM   825  C CD  . LYS A 1 107 ? -1.637  82.947 30.238 1.00 42.70 ? 107  LYS A CD  1 
ATOM   826  C CE  . LYS A 1 107 ? -1.827  84.465 30.233 1.00 43.93 ? 107  LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 107 ? -3.272  84.767 30.363 1.00 43.57 ? 107  LYS A NZ  1 
ATOM   828  N N   . SER A 1 108 ? 1.038   78.999 32.389 1.00 35.08 ? 108  SER A N   1 
ATOM   829  C CA  . SER A 1 108 ? 1.498   77.629 32.530 1.00 36.91 ? 108  SER A CA  1 
ATOM   830  C C   . SER A 1 108 ? 2.707   77.632 33.417 1.00 36.34 ? 108  SER A C   1 
ATOM   831  O O   . SER A 1 108 ? 3.842   77.525 32.939 1.00 36.64 ? 108  SER A O   1 
ATOM   832  C CB  . SER A 1 108 ? 1.909   77.074 31.168 1.00 38.04 ? 108  SER A CB  1 
ATOM   833  O OG  . SER A 1 108 ? 2.151   75.678 31.279 1.00 38.55 ? 108  SER A OG  1 
ATOM   834  N N   . THR A 1 109 ? 2.490   77.722 34.707 1.00 34.18 ? 109  THR A N   1 
ATOM   835  C CA  . THR A 1 109 ? 3.652   77.801 35.546 1.00 35.24 ? 109  THR A CA  1 
ATOM   836  C C   . THR A 1 109 ? 3.784   76.597 36.485 1.00 33.98 ? 109  THR A C   1 
ATOM   837  O O   . THR A 1 109 ? 2.842   75.801 36.613 1.00 33.85 ? 109  THR A O   1 
ATOM   838  C CB  . THR A 1 109 ? 3.646   79.083 36.361 1.00 34.50 ? 109  THR A CB  1 
ATOM   839  O OG1 . THR A 1 109 ? 4.932   79.197 37.017 1.00 34.97 ? 109  THR A OG1 1 
ATOM   840  C CG2 . THR A 1 109 ? 2.522   79.029 37.423 1.00 30.37 ? 109  THR A CG2 1 
ATOM   841  N N   . THR A 1 110 ? 4.966   76.458 37.083 1.00 34.00 ? 110  THR A N   1 
ATOM   842  C CA  . THR A 1 110 ? 5.269   75.361 38.034 1.00 31.98 ? 110  THR A CA  1 
ATOM   843  C C   . THR A 1 110 ? 4.229   75.255 39.175 1.00 30.94 ? 110  THR A C   1 
ATOM   844  O O   . THR A 1 110 ? 3.804   76.276 39.782 1.00 29.75 ? 110  THR A O   1 
ATOM   845  C CB  . THR A 1 110 ? 6.656   75.586 38.667 1.00 35.10 ? 110  THR A CB  1 
ATOM   846  O OG1 . THR A 1 110 ? 7.632   75.666 37.631 1.00 34.10 ? 110  THR A OG1 1 
ATOM   847  C CG2 . THR A 1 110 ? 7.029   74.447 39.663 1.00 33.50 ? 110  THR A CG2 1 
ATOM   848  N N   . VAL A 1 111 ? 3.810   74.022 39.446 1.00 28.67 ? 111  VAL A N   1 
ATOM   849  C CA  . VAL A 1 111 ? 2.834   73.729 40.501 1.00 25.91 ? 111  VAL A CA  1 
ATOM   850  C C   . VAL A 1 111 ? 3.533   72.916 41.651 1.00 26.41 ? 111  VAL A C   1 
ATOM   851  O O   . VAL A 1 111 ? 4.359   71.985 41.390 1.00 27.76 ? 111  VAL A O   1 
ATOM   852  C CB  . VAL A 1 111 ? 1.664   72.847 39.932 1.00 26.69 ? 111  VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 111 ? 0.639   72.562 41.038 1.00 22.09 ? 111  VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 111 ? 0.992   73.514 38.682 1.00 24.32 ? 111  VAL A CG2 1 
ATOM   855  N N   . MET A 1 112 ? 3.208   73.257 42.898 1.00 26.79 ? 112  MET A N   1 
ATOM   856  C CA  . MET A 1 112 ? 3.738   72.570 44.096 1.00 26.65 ? 112  MET A CA  1 
ATOM   857  C C   . MET A 1 112 ? 2.499   72.237 44.894 1.00 27.39 ? 112  MET A C   1 
ATOM   858  O O   . MET A 1 112 ? 1.591   73.089 45.044 1.00 28.54 ? 112  MET A O   1 
ATOM   859  C CB  . MET A 1 112 ? 4.684   73.485 44.894 1.00 26.10 ? 112  MET A CB  1 
ATOM   860  C CG  . MET A 1 112 ? 5.954   73.868 44.063 1.00 27.12 ? 112  MET A CG  1 
ATOM   861  S SD  . MET A 1 112 ? 7.103   74.869 45.006 1.00 30.97 ? 112  MET A SD  1 
ATOM   862  C CE  . MET A 1 112 ? 7.615   73.728 46.357 1.00 28.56 ? 112  MET A CE  1 
ATOM   863  N N   . VAL A 1 113 ? 2.438   70.984 45.358 1.00 25.11 ? 113  VAL A N   1 
ATOM   864  C CA  . VAL A 1 113 ? 1.309   70.460 46.102 1.00 25.24 ? 113  VAL A CA  1 
ATOM   865  C C   . VAL A 1 113 ? 1.809   69.930 47.437 1.00 25.87 ? 113  VAL A C   1 
ATOM   866  O O   . VAL A 1 113 ? 2.551   68.947 47.488 1.00 25.97 ? 113  VAL A O   1 
ATOM   867  C CB  . VAL A 1 113 ? 0.624   69.280 45.326 1.00 25.52 ? 113  VAL A CB  1 
ATOM   868  C CG1 . VAL A 1 113 ? -0.580  68.731 46.153 1.00 23.21 ? 113  VAL A CG1 1 
ATOM   869  C CG2 . VAL A 1 113 ? 0.232   69.718 43.924 1.00 24.25 ? 113  VAL A CG2 1 
ATOM   870  N N   . TRP A 1 114 ? 1.314   70.554 48.489 1.00 25.43 ? 114  TRP A N   1 
ATOM   871  C CA  . TRP A 1 114 ? 1.680   70.292 49.858 1.00 26.67 ? 114  TRP A CA  1 
ATOM   872  C C   . TRP A 1 114 ? 0.796   69.264 50.531 1.00 26.84 ? 114  TRP A C   1 
ATOM   873  O O   . TRP A 1 114 ? -0.439  69.341 50.488 1.00 26.49 ? 114  TRP A O   1 
ATOM   874  C CB  . TRP A 1 114 ? 1.663   71.615 50.659 1.00 24.77 ? 114  TRP A CB  1 
ATOM   875  C CG  . TRP A 1 114 ? 1.973   71.424 52.152 1.00 24.22 ? 114  TRP A CG  1 
ATOM   876  C CD1 . TRP A 1 114 ? 1.096   71.546 53.206 1.00 24.72 ? 114  TRP A CD1 1 
ATOM   877  C CD2 . TRP A 1 114 ? 3.246   71.142 52.726 1.00 22.45 ? 114  TRP A CD2 1 
ATOM   878  N NE1 . TRP A 1 114 ? 1.752   71.373 54.411 1.00 25.95 ? 114  TRP A NE1 1 
ATOM   879  C CE2 . TRP A 1 114 ? 3.077   71.134 54.148 1.00 25.49 ? 114  TRP A CE2 1 
ATOM   880  C CE3 . TRP A 1 114 ? 4.521   70.907 52.186 1.00 22.55 ? 114  TRP A CE3 1 
ATOM   881  C CZ2 . TRP A 1 114 ? 4.144   70.912 55.036 1.00 23.37 ? 114  TRP A CZ2 1 
ATOM   882  C CZ3 . TRP A 1 114 ? 5.595   70.690 53.075 1.00 23.53 ? 114  TRP A CZ3 1 
ATOM   883  C CH2 . TRP A 1 114 ? 5.396   70.700 54.477 1.00 23.70 ? 114  TRP A CH2 1 
ATOM   884  N N   . ILE A 1 115 ? 1.451   68.285 51.140 1.00 26.75 ? 115  ILE A N   1 
ATOM   885  C CA  . ILE A 1 115 ? 0.757   67.198 51.881 1.00 25.88 ? 115  ILE A CA  1 
ATOM   886  C C   . ILE A 1 115 ? 1.107   67.315 53.383 1.00 26.15 ? 115  ILE A C   1 
ATOM   887  O O   . ILE A 1 115 ? 2.270   67.112 53.748 1.00 24.51 ? 115  ILE A O   1 
ATOM   888  C CB  . ILE A 1 115 ? 1.224   65.809 51.348 1.00 25.02 ? 115  ILE A CB  1 
ATOM   889  C CG1 . ILE A 1 115 ? 0.907   65.728 49.848 1.00 25.79 ? 115  ILE A CG1 1 
ATOM   890  C CG2 . ILE A 1 115 ? 0.459   64.652 52.061 1.00 24.20 ? 115  ILE A CG2 1 
ATOM   891  C CD1 . ILE A 1 115 ? 1.396   64.390 49.149 1.00 27.98 ? 115  ILE A CD1 1 
ATOM   892  N N   . TYR A 1 116 ? 0.129   67.643 54.244 1.00 25.66 ? 116  TYR A N   1 
ATOM   893  C CA  . TYR A 1 116 ? 0.412   67.767 55.673 1.00 25.10 ? 116  TYR A CA  1 
ATOM   894  C C   . TYR A 1 116 ? 0.826   66.406 56.313 1.00 27.16 ? 116  TYR A C   1 
ATOM   895  O O   . TYR A 1 116 ? 0.562   65.303 55.767 1.00 25.85 ? 116  TYR A O   1 
ATOM   896  C CB  . TYR A 1 116 ? -0.768  68.437 56.434 1.00 25.90 ? 116  TYR A CB  1 
ATOM   897  C CG  . TYR A 1 116 ? -2.148  67.767 56.333 1.00 25.33 ? 116  TYR A CG  1 
ATOM   898  C CD1 . TYR A 1 116 ? -2.394  66.509 56.890 1.00 23.73 ? 116  TYR A CD1 1 
ATOM   899  C CD2 . TYR A 1 116 ? -3.217  68.447 55.758 1.00 24.76 ? 116  TYR A CD2 1 
ATOM   900  C CE1 . TYR A 1 116 ? -3.669  65.954 56.870 1.00 25.06 ? 116  TYR A CE1 1 
ATOM   901  C CE2 . TYR A 1 116 ? -4.487  67.929 55.718 1.00 24.97 ? 116  TYR A CE2 1 
ATOM   902  C CZ  . TYR A 1 116 ? -4.731  66.676 56.267 1.00 26.59 ? 116  TYR A CZ  1 
ATOM   903  O OH  . TYR A 1 116 ? -6.018  66.172 56.202 1.00 26.26 ? 116  TYR A OH  1 
ATOM   904  N N   . GLY A 1 117 ? 1.469   66.481 57.472 1.00 28.06 ? 117  GLY A N   1 
ATOM   905  C CA  . GLY A 1 117 ? 2.023   65.264 58.034 1.00 29.63 ? 117  GLY A CA  1 
ATOM   906  C C   . GLY A 1 117 ? 2.130   64.894 59.493 1.00 28.73 ? 117  GLY A C   1 
ATOM   907  O O   . GLY A 1 117 ? 3.159   64.310 59.920 1.00 30.38 ? 117  GLY A O   1 
ATOM   908  N N   . GLY A 1 118 ? 1.085   65.174 60.254 1.00 27.57 ? 118  GLY A N   1 
ATOM   909  C CA  . GLY A 1 118 ? 1.112   64.779 61.651 1.00 25.57 ? 118  GLY A CA  1 
ATOM   910  C C   . GLY A 1 118 ? 0.935   63.270 61.953 1.00 27.43 ? 118  GLY A C   1 
ATOM   911  O O   . GLY A 1 118 ? -0.113  62.855 62.464 1.00 26.18 ? 118  GLY A O   1 
ATOM   912  N N   . GLY A 1 119 ? 1.950   62.445 61.652 1.00 26.47 ? 119  GLY A N   1 
ATOM   913  C CA  . GLY A 1 119 ? 1.888   61.016 61.997 1.00 26.15 ? 119  GLY A CA  1 
ATOM   914  C C   . GLY A 1 119 ? 0.734   60.167 61.460 1.00 27.93 ? 119  GLY A C   1 
ATOM   915  O O   . GLY A 1 119 ? 0.454   59.069 61.983 1.00 25.48 ? 119  GLY A O   1 
ATOM   916  N N   . PHE A 1 120 ? 0.108   60.649 60.386 1.00 26.67 ? 120  PHE A N   1 
ATOM   917  C CA  . PHE A 1 120 ? -1.061  60.012 59.794 1.00 27.66 ? 120  PHE A CA  1 
ATOM   918  C C   . PHE A 1 120 ? -2.285  60.060 60.739 1.00 27.71 ? 120  PHE A C   1 
ATOM   919  O O   . PHE A 1 120 ? -3.348  59.518 60.394 1.00 26.76 ? 120  PHE A O   1 
ATOM   920  C CB  . PHE A 1 120 ? -0.782  58.558 59.347 1.00 24.55 ? 120  PHE A CB  1 
ATOM   921  C CG  . PHE A 1 120 ? 0.174   58.459 58.164 1.00 25.60 ? 120  PHE A CG  1 
ATOM   922  C CD1 . PHE A 1 120 ? -0.227  58.877 56.885 1.00 22.67 ? 120  PHE A CD1 1 
ATOM   923  C CD2 . PHE A 1 120 ? 1.458   57.902 58.326 1.00 23.10 ? 120  PHE A CD2 1 
ATOM   924  C CE1 . PHE A 1 120 ? 0.637   58.734 55.777 1.00 23.47 ? 120  PHE A CE1 1 
ATOM   925  C CE2 . PHE A 1 120 ? 2.337   57.753 57.234 1.00 23.35 ? 120  PHE A CE2 1 
ATOM   926  C CZ  . PHE A 1 120 ? 1.919   58.174 55.935 1.00 22.60 ? 120  PHE A CZ  1 
ATOM   927  N N   . TYR A 1 121 ? -2.173  60.712 61.904 1.00 26.68 ? 121  TYR A N   1 
ATOM   928  C CA  . TYR A 1 121 ? -3.361  60.798 62.773 1.00 26.20 ? 121  TYR A CA  1 
ATOM   929  C C   . TYR A 1 121 ? -3.811  62.247 62.947 1.00 27.96 ? 121  TYR A C   1 
ATOM   930  O O   . TYR A 1 121 ? -4.820  62.505 63.639 1.00 26.80 ? 121  TYR A O   1 
ATOM   931  C CB  . TYR A 1 121 ? -3.107  60.208 64.175 1.00 27.24 ? 121  TYR A CB  1 
ATOM   932  C CG  . TYR A 1 121 ? -2.165  61.045 65.027 1.00 25.49 ? 121  TYR A CG  1 
ATOM   933  C CD1 . TYR A 1 121 ? -2.648  62.078 65.840 1.00 25.87 ? 121  TYR A CD1 1 
ATOM   934  C CD2 . TYR A 1 121 ? -0.771  60.852 64.951 1.00 25.55 ? 121  TYR A CD2 1 
ATOM   935  C CE1 . TYR A 1 121 ? -1.724  62.936 66.576 1.00 26.83 ? 121  TYR A CE1 1 
ATOM   936  C CE2 . TYR A 1 121 ? 0.125   61.670 65.660 1.00 24.62 ? 121  TYR A CE2 1 
ATOM   937  C CZ  . TYR A 1 121 ? -0.359  62.714 66.470 1.00 25.42 ? 121  TYR A CZ  1 
ATOM   938  O OH  . TYR A 1 121 ? 0.551   63.536 67.169 1.00 28.99 ? 121  TYR A OH  1 
ATOM   939  N N   . SER A 1 122 ? -3.055  63.202 62.378 1.00 26.45 ? 122  SER A N   1 
ATOM   940  C CA  . SER A 1 122 ? -3.446  64.569 62.542 1.00 27.24 ? 122  SER A CA  1 
ATOM   941  C C   . SER A 1 122 ? -2.905  65.399 61.390 1.00 28.60 ? 122  SER A C   1 
ATOM   942  O O   . SER A 1 122 ? -2.115  64.893 60.546 1.00 27.26 ? 122  SER A O   1 
ATOM   943  C CB  . SER A 1 122 ? -2.956  65.120 63.919 1.00 28.34 ? 122  SER A CB  1 
ATOM   944  O OG  . SER A 1 122 ? -1.589  65.474 63.873 1.00 29.35 ? 122  SER A OG  1 
ATOM   945  N N   . GLY A 1 123 ? -3.353  66.667 61.339 1.00 27.85 ? 123  GLY A N   1 
ATOM   946  C CA  . GLY A 1 123 ? -2.932  67.558 60.253 1.00 26.86 ? 123  GLY A CA  1 
ATOM   947  C C   . GLY A 1 123 ? -4.127  68.255 59.604 1.00 27.30 ? 123  GLY A C   1 
ATOM   948  O O   . GLY A 1 123 ? -5.231  67.702 59.600 1.00 25.88 ? 123  GLY A O   1 
ATOM   949  N N   . SER A 1 124 ? -3.892  69.471 59.114 1.00 25.62 ? 124  SER A N   1 
ATOM   950  C CA  . SER A 1 124 ? -4.885  70.329 58.476 1.00 27.75 ? 124  SER A CA  1 
ATOM   951  C C   . SER A 1 124 ? -4.183  71.116 57.383 1.00 28.34 ? 124  SER A C   1 
ATOM   952  O O   . SER A 1 124 ? -3.002  71.492 57.489 1.00 28.25 ? 124  SER A O   1 
ATOM   953  C CB  . SER A 1 124 ? -5.482  71.355 59.480 1.00 27.89 ? 124  SER A CB  1 
ATOM   954  O OG  . SER A 1 124 ? -6.063  70.709 60.623 1.00 28.56 ? 124  SER A OG  1 
ATOM   955  N N   . SER A 1 125 ? -4.895  71.374 56.316 1.00 28.90 ? 125  SER A N   1 
ATOM   956  C CA  . SER A 1 125 ? -4.303  72.137 55.217 1.00 31.13 ? 125  SER A CA  1 
ATOM   957  C C   . SER A 1 125 ? -4.403  73.653 55.498 1.00 32.32 ? 125  SER A C   1 
ATOM   958  O O   . SER A 1 125 ? -3.850  74.460 54.740 1.00 35.84 ? 125  SER A O   1 
ATOM   959  C CB  . SER A 1 125 ? -5.076  71.867 53.923 1.00 30.47 ? 125  SER A CB  1 
ATOM   960  O OG  . SER A 1 125 ? -6.438  72.286 54.078 1.00 31.24 ? 125  SER A OG  1 
ATOM   961  N N   . THR A 1 126 ? -5.049  74.020 56.600 1.00 30.97 ? 126  THR A N   1 
ATOM   962  C CA  . THR A 1 126 ? -5.359  75.409 56.883 1.00 30.66 ? 126  THR A CA  1 
ATOM   963  C C   . THR A 1 126 ? -4.539  76.099 57.956 1.00 31.94 ? 126  THR A C   1 
ATOM   964  O O   . THR A 1 126 ? -4.835  77.232 58.320 1.00 31.77 ? 126  THR A O   1 
ATOM   965  C CB  . THR A 1 126 ? -6.867  75.509 57.312 1.00 30.74 ? 126  THR A CB  1 
ATOM   966  O OG1 . THR A 1 126 ? -7.050  74.809 58.560 1.00 28.83 ? 126  THR A OG1 1 
ATOM   967  C CG2 . THR A 1 126 ? -7.802  74.868 56.275 1.00 30.08 ? 126  THR A CG2 1 
ATOM   968  N N   . LEU A 1 127 ? -3.528  75.435 58.487 1.00 31.27 ? 127  LEU A N   1 
ATOM   969  C CA  . LEU A 1 127 ? -2.709  76.037 59.528 1.00 32.85 ? 127  LEU A CA  1 
ATOM   970  C C   . LEU A 1 127 ? -2.023  77.340 59.078 1.00 32.13 ? 127  LEU A C   1 
ATOM   971  O O   . LEU A 1 127 ? -1.590  77.454 57.929 1.00 29.38 ? 127  LEU A O   1 
ATOM   972  C CB  . LEU A 1 127 ? -1.601  75.050 59.952 1.00 30.25 ? 127  LEU A CB  1 
ATOM   973  C CG  . LEU A 1 127 ? -2.046  73.637 60.352 1.00 30.22 ? 127  LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 127 ? -0.791  72.844 60.824 1.00 26.76 ? 127  LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 127 ? -3.094  73.702 61.471 1.00 27.44 ? 127  LEU A CD2 1 
ATOM   976  N N   . ASP A 1 128 ? -1.862  78.288 59.997 1.00 32.87 ? 128  ASP A N   1 
ATOM   977  C CA  . ASP A 1 128 ? -1.134  79.531 59.644 1.00 33.31 ? 128  ASP A CA  1 
ATOM   978  C C   . ASP A 1 128 ? 0.259   79.190 59.070 1.00 32.34 ? 128  ASP A C   1 
ATOM   979  O O   . ASP A 1 128 ? 0.699   79.853 58.130 1.00 33.85 ? 128  ASP A O   1 
ATOM   980  C CB  . ASP A 1 128 ? -0.974  80.450 60.883 1.00 34.55 ? 128  ASP A CB  1 
ATOM   981  C CG  . ASP A 1 128 ? -2.317  80.956 61.399 1.00 35.85 ? 128  ASP A CG  1 
ATOM   982  O OD1 . ASP A 1 128 ? -3.255  81.090 60.596 1.00 37.95 ? 128  ASP A OD1 1 
ATOM   983  O OD2 . ASP A 1 128 ? -2.455  81.201 62.609 1.00 40.70 ? 128  ASP A OD2 1 
ATOM   984  N N   . VAL A 1 129 ? 0.956   78.165 59.594 1.00 30.92 ? 129  VAL A N   1 
ATOM   985  C CA  . VAL A 1 129 ? 2.287   77.866 59.034 1.00 29.40 ? 129  VAL A CA  1 
ATOM   986  C C   . VAL A 1 129 ? 2.180   77.303 57.633 1.00 29.04 ? 129  VAL A C   1 
ATOM   987  O O   . VAL A 1 129 ? 3.209   77.169 57.000 1.00 28.03 ? 129  VAL A O   1 
ATOM   988  C CB  . VAL A 1 129 ? 3.154   76.699 59.698 1.00 31.61 ? 129  VAL A CB  1 
ATOM   989  C CG1 . VAL A 1 129 ? 4.248   77.246 60.458 1.00 29.72 ? 129  VAL A CG1 1 
ATOM   990  C CG2 . VAL A 1 129 ? 2.296   75.687 60.382 1.00 27.80 ? 129  VAL A CG2 1 
ATOM   991  N N   . TYR A 1 130 ? 0.992   76.911 57.161 1.00 28.76 ? 130  TYR A N   1 
ATOM   992  C CA  . TYR A 1 130 ? 0.901   76.360 55.783 1.00 29.27 ? 130  TYR A CA  1 
ATOM   993  C C   . TYR A 1 130 ? 0.300   77.387 54.805 1.00 30.63 ? 130  TYR A C   1 
ATOM   994  O O   . TYR A 1 130 ? -0.062  77.029 53.672 1.00 29.81 ? 130  TYR A O   1 
ATOM   995  C CB  . TYR A 1 130 ? 0.029   75.071 55.735 1.00 28.34 ? 130  TYR A CB  1 
ATOM   996  C CG  . TYR A 1 130 ? 0.570   73.870 56.545 1.00 26.93 ? 130  TYR A CG  1 
ATOM   997  C CD1 . TYR A 1 130 ? 1.935   73.756 56.865 1.00 23.66 ? 130  TYR A CD1 1 
ATOM   998  C CD2 . TYR A 1 130 ? -0.297  72.861 56.976 1.00 26.87 ? 130  TYR A CD2 1 
ATOM   999  C CE1 . TYR A 1 130 ? 2.419   72.639 57.619 1.00 26.27 ? 130  TYR A CE1 1 
ATOM   1000 C CE2 . TYR A 1 130 ? 0.147   71.764 57.705 1.00 25.43 ? 130  TYR A CE2 1 
ATOM   1001 C CZ  . TYR A 1 130 ? 1.520   71.649 58.026 1.00 27.24 ? 130  TYR A CZ  1 
ATOM   1002 O OH  . TYR A 1 130 ? 1.958   70.517 58.676 1.00 27.33 ? 130  TYR A OH  1 
ATOM   1003 N N   . ASN A 1 131 ? 0.165   78.642 55.253 1.00 30.58 ? 131  ASN A N   1 
ATOM   1004 C CA  . ASN A 1 131 ? -0.402  79.696 54.389 1.00 31.09 ? 131  ASN A CA  1 
ATOM   1005 C C   . ASN A 1 131 ? 0.462   79.761 53.118 1.00 30.16 ? 131  ASN A C   1 
ATOM   1006 O O   . ASN A 1 131 ? 1.620   80.180 53.176 1.00 31.81 ? 131  ASN A O   1 
ATOM   1007 C CB  . ASN A 1 131 ? -0.372  81.035 55.110 1.00 29.78 ? 131  ASN A CB  1 
ATOM   1008 C CG  . ASN A 1 131 ? -1.241  82.085 54.420 1.00 34.78 ? 131  ASN A CG  1 
ATOM   1009 O OD1 . ASN A 1 131 ? -1.497  82.005 53.202 1.00 32.96 ? 131  ASN A OD1 1 
ATOM   1010 N ND2 . ASN A 1 131 ? -1.697  83.097 55.208 1.00 34.05 ? 131  ASN A ND2 1 
ATOM   1011 N N   . GLY A 1 132 ? -0.080  79.347 51.975 1.00 29.64 ? 132  GLY A N   1 
ATOM   1012 C CA  . GLY A 1 132 ? 0.761   79.306 50.785 1.00 29.82 ? 132  GLY A CA  1 
ATOM   1013 C C   . GLY A 1 132 ? 0.964   80.582 49.992 1.00 30.71 ? 132  GLY A C   1 
ATOM   1014 O O   . GLY A 1 132 ? 1.619   80.571 48.942 1.00 29.20 ? 132  GLY A O   1 
ATOM   1015 N N   . LYS A 1 133 ? 0.446   81.696 50.510 1.00 32.21 ? 133  LYS A N   1 
ATOM   1016 C CA  . LYS A 1 133 ? 0.522   82.951 49.759 1.00 33.02 ? 133  LYS A CA  1 
ATOM   1017 C C   . LYS A 1 133 ? 1.954   83.460 49.617 1.00 33.57 ? 133  LYS A C   1 
ATOM   1018 O O   . LYS A 1 133 ? 2.314   83.933 48.543 1.00 32.77 ? 133  LYS A O   1 
ATOM   1019 C CB  . LYS A 1 133 ? -0.429  84.013 50.391 1.00 32.27 ? 133  LYS A CB  1 
ATOM   1020 C CG  . LYS A 1 133 ? 0.073   84.687 51.678 1.00 33.55 ? 133  LYS A CG  1 
ATOM   1021 C CD  . LYS A 1 133 ? -1.091  85.432 52.385 1.00 34.67 ? 133  LYS A CD  1 
ATOM   1022 C CE  . LYS A 1 133 ? -0.535  86.484 53.353 1.00 37.27 ? 133  LYS A CE  1 
ATOM   1023 N NZ  . LYS A 1 133 ? -1.648  87.206 54.045 1.00 38.22 ? 133  LYS A NZ  1 
ATOM   1024 N N   . TYR A 1 134 ? 2.798   83.294 50.639 1.00 34.04 ? 134  TYR A N   1 
ATOM   1025 C CA  . TYR A 1 134 ? 4.171   83.824 50.534 1.00 35.02 ? 134  TYR A CA  1 
ATOM   1026 C C   . TYR A 1 134 ? 5.029   83.123 49.496 1.00 36.50 ? 134  TYR A C   1 
ATOM   1027 O O   . TYR A 1 134 ? 5.774   83.767 48.747 1.00 36.38 ? 134  TYR A O   1 
ATOM   1028 C CB  . TYR A 1 134 ? 4.883   83.759 51.886 1.00 35.77 ? 134  TYR A CB  1 
ATOM   1029 C CG  . TYR A 1 134 ? 4.057   84.370 52.956 1.00 36.25 ? 134  TYR A CG  1 
ATOM   1030 C CD1 . TYR A 1 134 ? 3.446   83.564 53.907 1.00 36.22 ? 134  TYR A CD1 1 
ATOM   1031 C CD2 . TYR A 1 134 ? 3.864   85.761 53.023 1.00 36.46 ? 134  TYR A CD2 1 
ATOM   1032 C CE1 . TYR A 1 134 ? 2.669   84.090 54.908 1.00 35.67 ? 134  TYR A CE1 1 
ATOM   1033 C CE2 . TYR A 1 134 ? 3.064   86.321 54.050 1.00 36.39 ? 134  TYR A CE2 1 
ATOM   1034 C CZ  . TYR A 1 134 ? 2.478   85.453 54.980 1.00 36.79 ? 134  TYR A CZ  1 
ATOM   1035 O OH  . TYR A 1 134 ? 1.669   85.911 55.975 1.00 38.68 ? 134  TYR A OH  1 
ATOM   1036 N N   . LEU A 1 135 ? 4.911   81.799 49.442 1.00 36.24 ? 135  LEU A N   1 
ATOM   1037 C CA  . LEU A 1 135 ? 5.682   81.024 48.497 1.00 35.42 ? 135  LEU A CA  1 
ATOM   1038 C C   . LEU A 1 135 ? 5.108   81.246 47.097 1.00 35.93 ? 135  LEU A C   1 
ATOM   1039 O O   . LEU A 1 135 ? 5.849   81.513 46.145 1.00 36.16 ? 135  LEU A O   1 
ATOM   1040 C CB  . LEU A 1 135 ? 5.619   79.533 48.886 1.00 36.33 ? 135  LEU A CB  1 
ATOM   1041 C CG  . LEU A 1 135 ? 6.392   78.495 48.058 1.00 35.35 ? 135  LEU A CG  1 
ATOM   1042 C CD1 . LEU A 1 135 ? 7.892   78.851 47.992 1.00 32.04 ? 135  LEU A CD1 1 
ATOM   1043 C CD2 . LEU A 1 135 ? 6.198   77.119 48.777 1.00 34.69 ? 135  LEU A CD2 1 
ATOM   1044 N N   . ALA A 1 136 ? 3.792   81.124 46.955 1.00 35.46 ? 136  ALA A N   1 
ATOM   1045 C CA  . ALA A 1 136 ? 3.185   81.328 45.639 1.00 35.55 ? 136  ALA A CA  1 
ATOM   1046 C C   . ALA A 1 136 ? 3.550   82.739 45.109 1.00 35.02 ? 136  ALA A C   1 
ATOM   1047 O O   . ALA A 1 136 ? 3.973   82.912 43.959 1.00 35.13 ? 136  ALA A O   1 
ATOM   1048 C CB  . ALA A 1 136 ? 1.662   81.162 45.724 1.00 33.14 ? 136  ALA A CB  1 
ATOM   1049 N N   . TYR A 1 137 ? 3.447   83.745 45.968 1.00 35.30 ? 137  TYR A N   1 
ATOM   1050 C CA  . TYR A 1 137 ? 3.770   85.088 45.525 1.00 35.87 ? 137  TYR A CA  1 
ATOM   1051 C C   . TYR A 1 137 ? 5.258   85.258 45.223 1.00 36.04 ? 137  TYR A C   1 
ATOM   1052 O O   . TYR A 1 137 ? 5.628   85.683 44.123 1.00 35.64 ? 137  TYR A O   1 
ATOM   1053 C CB  . TYR A 1 137 ? 3.322   86.109 46.576 1.00 36.17 ? 137  TYR A CB  1 
ATOM   1054 C CG  . TYR A 1 137 ? 3.771   87.516 46.287 1.00 39.05 ? 137  TYR A CG  1 
ATOM   1055 C CD1 . TYR A 1 137 ? 4.813   88.101 47.029 1.00 41.96 ? 137  TYR A CD1 1 
ATOM   1056 C CD2 . TYR A 1 137 ? 3.162   88.273 45.278 1.00 40.14 ? 137  TYR A CD2 1 
ATOM   1057 C CE1 . TYR A 1 137 ? 5.253   89.414 46.777 1.00 41.87 ? 137  TYR A CE1 1 
ATOM   1058 C CE2 . TYR A 1 137 ? 3.575   89.574 45.008 1.00 42.36 ? 137  TYR A CE2 1 
ATOM   1059 C CZ  . TYR A 1 137 ? 4.628   90.138 45.762 1.00 43.72 ? 137  TYR A CZ  1 
ATOM   1060 O OH  . TYR A 1 137 ? 5.036   91.415 45.513 1.00 44.96 ? 137  TYR A OH  1 
ATOM   1061 N N   . THR A 1 138 ? 6.114   84.882 46.167 1.00 35.03 ? 138  THR A N   1 
ATOM   1062 C CA  . THR A 1 138 ? 7.555   85.101 45.971 1.00 35.13 ? 138  THR A CA  1 
ATOM   1063 C C   . THR A 1 138 ? 8.203   84.289 44.855 1.00 34.80 ? 138  THR A C   1 
ATOM   1064 O O   . THR A 1 138 ? 9.065   84.797 44.184 1.00 34.07 ? 138  THR A O   1 
ATOM   1065 C CB  . THR A 1 138 ? 8.354   84.846 47.256 1.00 34.60 ? 138  THR A CB  1 
ATOM   1066 O OG1 . THR A 1 138 ? 7.747   85.562 48.342 1.00 33.06 ? 138  THR A OG1 1 
ATOM   1067 C CG2 . THR A 1 138 ? 9.775   85.324 47.084 1.00 34.40 ? 138  THR A CG2 1 
ATOM   1068 N N   . GLU A 1 139 ? 7.762   83.051 44.625 1.00 34.00 ? 139  GLU A N   1 
ATOM   1069 C CA  . GLU A 1 139 ? 8.402   82.270 43.592 1.00 34.33 ? 139  GLU A CA  1 
ATOM   1070 C C   . GLU A 1 139 ? 7.569   82.143 42.329 1.00 34.63 ? 139  GLU A C   1 
ATOM   1071 O O   . GLU A 1 139 ? 7.989   81.519 41.357 1.00 33.74 ? 139  GLU A O   1 
ATOM   1072 C CB  . GLU A 1 139 ? 8.829   80.890 44.135 1.00 34.00 ? 139  GLU A CB  1 
ATOM   1073 C CG  . GLU A 1 139 ? 9.867   80.983 45.280 1.00 32.34 ? 139  GLU A CG  1 
ATOM   1074 C CD  . GLU A 1 139 ? 11.191  81.513 44.788 1.00 32.93 ? 139  GLU A CD  1 
ATOM   1075 O OE1 . GLU A 1 139 ? 11.599  81.158 43.669 1.00 29.96 ? 139  GLU A OE1 1 
ATOM   1076 O OE2 . GLU A 1 139 ? 11.860  82.270 45.521 1.00 35.14 ? 139  GLU A OE2 1 
ATOM   1077 N N   . GLU A 1 140 ? 6.400   82.754 42.348 1.00 36.12 ? 140  GLU A N   1 
ATOM   1078 C CA  . GLU A 1 140 ? 5.516   82.734 41.190 1.00 38.81 ? 140  GLU A CA  1 
ATOM   1079 C C   . GLU A 1 140 ? 5.157   81.339 40.790 1.00 36.69 ? 140  GLU A C   1 
ATOM   1080 O O   . GLU A 1 140 ? 5.343   80.949 39.651 1.00 36.12 ? 140  GLU A O   1 
ATOM   1081 C CB  . GLU A 1 140 ? 6.147   83.483 39.999 1.00 43.46 ? 140  GLU A CB  1 
ATOM   1082 C CG  . GLU A 1 140 ? 5.500   84.849 39.762 1.00 52.08 ? 140  GLU A CG  1 
ATOM   1083 C CD  . GLU A 1 140 ? 6.472   85.948 39.240 1.00 55.99 ? 140  GLU A CD  1 
ATOM   1084 O OE1 . GLU A 1 140 ? 7.117   85.739 38.183 1.00 56.61 ? 140  GLU A OE1 1 
ATOM   1085 O OE2 . GLU A 1 140 ? 6.569   87.030 39.892 1.00 57.85 ? 140  GLU A OE2 1 
ATOM   1086 N N   . VAL A 1 141 ? 4.632   80.574 41.750 1.00 35.79 ? 141  VAL A N   1 
ATOM   1087 C CA  . VAL A 1 141 ? 4.201   79.225 41.459 1.00 32.09 ? 141  VAL A CA  1 
ATOM   1088 C C   . VAL A 1 141 ? 2.760   79.129 41.889 1.00 31.85 ? 141  VAL A C   1 
ATOM   1089 O O   . VAL A 1 141 ? 2.277   79.956 42.666 1.00 29.50 ? 141  VAL A O   1 
ATOM   1090 C CB  . VAL A 1 141 ? 5.048   78.134 42.244 1.00 32.93 ? 141  VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 141 ? 6.524   78.298 41.927 1.00 33.72 ? 141  VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 141 ? 4.856   78.253 43.727 1.00 30.71 ? 141  VAL A CG2 1 
ATOM   1093 N N   . VAL A 1 142 ? 2.065   78.134 41.340 1.00 30.51 ? 142  VAL A N   1 
ATOM   1094 C CA  . VAL A 1 142 ? 0.698   77.860 41.741 1.00 29.89 ? 142  VAL A CA  1 
ATOM   1095 C C   . VAL A 1 142 ? 0.879   76.874 42.920 1.00 30.31 ? 142  VAL A C   1 
ATOM   1096 O O   . VAL A 1 142 ? 1.431   75.780 42.750 1.00 29.15 ? 142  VAL A O   1 
ATOM   1097 C CB  . VAL A 1 142 ? -0.091  77.272 40.571 1.00 28.42 ? 142  VAL A CB  1 
ATOM   1098 C CG1 . VAL A 1 142 ? -1.346  76.584 41.060 1.00 28.02 ? 142  VAL A CG1 1 
ATOM   1099 C CG2 . VAL A 1 142 ? -0.434  78.428 39.583 1.00 27.44 ? 142  VAL A CG2 1 
ATOM   1100 N N   A LEU A 1 143 ? 0.439   77.287 44.102 0.50 29.27 ? 143  LEU A N   1 
ATOM   1101 N N   B LEU A 1 143 ? 0.491   77.281 44.129 0.50 29.64 ? 143  LEU A N   1 
ATOM   1102 C CA  A LEU A 1 143 ? 0.590   76.435 45.269 0.50 29.27 ? 143  LEU A CA  1 
ATOM   1103 C CA  B LEU A 1 143 ? 0.667   76.391 45.286 0.50 29.77 ? 143  LEU A CA  1 
ATOM   1104 C C   A LEU A 1 143 ? -0.709  75.747 45.656 0.50 29.34 ? 143  LEU A C   1 
ATOM   1105 C C   B LEU A 1 143 ? -0.640  75.758 45.753 0.50 29.67 ? 143  LEU A C   1 
ATOM   1106 O O   A LEU A 1 143 ? -1.764  76.394 45.789 0.50 28.75 ? 143  LEU A O   1 
ATOM   1107 O O   B LEU A 1 143 ? -1.623  76.456 46.064 0.50 29.19 ? 143  LEU A O   1 
ATOM   1108 C CB  A LEU A 1 143 ? 1.107   77.253 46.454 0.50 28.67 ? 143  LEU A CB  1 
ATOM   1109 C CB  B LEU A 1 143 ? 1.315   77.130 46.467 0.50 30.09 ? 143  LEU A CB  1 
ATOM   1110 C CG  A LEU A 1 143 ? 1.580   76.398 47.635 0.50 28.01 ? 143  LEU A CG  1 
ATOM   1111 C CG  B LEU A 1 143 ? 1.670   76.208 47.650 0.50 29.96 ? 143  LEU A CG  1 
ATOM   1112 C CD1 A LEU A 1 143 ? 2.712   77.120 48.304 0.50 29.23 ? 143  LEU A CD1 1 
ATOM   1113 C CD1 B LEU A 1 143 ? 2.913   75.395 47.343 0.50 28.39 ? 143  LEU A CD1 1 
ATOM   1114 C CD2 A LEU A 1 143 ? 0.441   76.112 48.614 0.50 25.39 ? 143  LEU A CD2 1 
ATOM   1115 C CD2 B LEU A 1 143 ? 1.902   77.032 48.887 0.50 31.43 ? 143  LEU A CD2 1 
ATOM   1116 N N   . VAL A 1 144 ? -0.637  74.434 45.816 1.00 28.03 ? 144  VAL A N   1 
ATOM   1117 C CA  . VAL A 1 144 ? -1.813  73.692 46.226 1.00 28.04 ? 144  VAL A CA  1 
ATOM   1118 C C   . VAL A 1 144 ? -1.586  72.964 47.564 1.00 28.81 ? 144  VAL A C   1 
ATOM   1119 O O   . VAL A 1 144 ? -0.521  72.348 47.760 1.00 28.43 ? 144  VAL A O   1 
ATOM   1120 C CB  . VAL A 1 144 ? -2.184  72.579 45.169 1.00 29.10 ? 144  VAL A CB  1 
ATOM   1121 C CG1 . VAL A 1 144 ? -3.451  71.780 45.653 1.00 26.98 ? 144  VAL A CG1 1 
ATOM   1122 C CG2 . VAL A 1 144 ? -2.430  73.190 43.752 1.00 27.13 ? 144  VAL A CG2 1 
ATOM   1123 N N   . SER A 1 145 ? -2.544  73.033 48.486 1.00 29.81 ? 145  SER A N   1 
ATOM   1124 C CA  . SER A 1 145 ? -2.447  72.166 49.687 1.00 29.48 ? 145  SER A CA  1 
ATOM   1125 C C   . SER A 1 145 ? -3.689  71.295 49.643 1.00 30.55 ? 145  SER A C   1 
ATOM   1126 O O   . SER A 1 145 ? -4.826  71.772 49.448 1.00 29.14 ? 145  SER A O   1 
ATOM   1127 C CB  . SER A 1 145 ? -2.362  72.934 51.025 1.00 30.11 ? 145  SER A CB  1 
ATOM   1128 O OG  . SER A 1 145 ? -3.343  73.952 51.161 1.00 29.88 ? 145  SER A OG  1 
ATOM   1129 N N   . LEU A 1 146 ? -3.490  69.990 49.788 1.00 30.81 ? 146  LEU A N   1 
ATOM   1130 C CA  . LEU A 1 146 ? -4.640  69.084 49.765 1.00 29.32 ? 146  LEU A CA  1 
ATOM   1131 C C   . LEU A 1 146 ? -4.966  68.643 51.193 1.00 29.38 ? 146  LEU A C   1 
ATOM   1132 O O   . LEU A 1 146 ? -4.393  69.136 52.142 1.00 28.99 ? 146  LEU A O   1 
ATOM   1133 C CB  . LEU A 1 146 ? -4.316  67.873 48.850 1.00 28.88 ? 146  LEU A CB  1 
ATOM   1134 C CG  . LEU A 1 146 ? -3.004  67.120 49.115 1.00 26.61 ? 146  LEU A CG  1 
ATOM   1135 C CD1 . LEU A 1 146 ? -3.116  66.370 50.421 1.00 24.44 ? 146  LEU A CD1 1 
ATOM   1136 C CD2 . LEU A 1 146 ? -2.700  66.137 47.961 1.00 26.63 ? 146  LEU A CD2 1 
ATOM   1137 N N   . SER A 1 147 ? -5.907  67.735 51.353 1.00 28.23 ? 147  SER A N   1 
ATOM   1138 C CA  . SER A 1 147 ? -6.221  67.236 52.680 1.00 29.75 ? 147  SER A CA  1 
ATOM   1139 C C   . SER A 1 147 ? -6.524  65.785 52.424 1.00 28.43 ? 147  SER A C   1 
ATOM   1140 O O   . SER A 1 147 ? -6.634  65.366 51.269 1.00 28.58 ? 147  SER A O   1 
ATOM   1141 C CB  . SER A 1 147 ? -7.447  67.928 53.280 1.00 29.68 ? 147  SER A CB  1 
ATOM   1142 O OG  . SER A 1 147 ? -8.602  67.650 52.495 1.00 35.23 ? 147  SER A OG  1 
ATOM   1143 N N   . TYR A 1 148 ? -6.624  65.021 53.496 1.00 28.91 ? 148  TYR A N   1 
ATOM   1144 C CA  . TYR A 1 148 ? -6.917  63.601 53.429 1.00 26.74 ? 148  TYR A CA  1 
ATOM   1145 C C   . TYR A 1 148 ? -7.315  63.124 54.843 1.00 28.63 ? 148  TYR A C   1 
ATOM   1146 O O   . TYR A 1 148 ? -6.875  63.700 55.894 1.00 27.42 ? 148  TYR A O   1 
ATOM   1147 C CB  . TYR A 1 148 ? -5.692  62.808 52.910 1.00 25.57 ? 148  TYR A CB  1 
ATOM   1148 C CG  . TYR A 1 148 ? -4.413  62.901 53.764 1.00 26.58 ? 148  TYR A CG  1 
ATOM   1149 C CD1 . TYR A 1 148 ? -3.498  63.958 53.594 1.00 25.80 ? 148  TYR A CD1 1 
ATOM   1150 C CD2 . TYR A 1 148 ? -4.121  61.917 54.746 1.00 23.04 ? 148  TYR A CD2 1 
ATOM   1151 C CE1 . TYR A 1 148 ? -2.314  64.053 54.387 1.00 25.13 ? 148  TYR A CE1 1 
ATOM   1152 C CE2 . TYR A 1 148 ? -2.956  61.992 55.521 1.00 24.41 ? 148  TYR A CE2 1 
ATOM   1153 C CZ  . TYR A 1 148 ? -2.049  63.069 55.347 1.00 26.15 ? 148  TYR A CZ  1 
ATOM   1154 O OH  . TYR A 1 148 ? -0.905  63.148 56.159 1.00 25.35 ? 148  TYR A OH  1 
ATOM   1155 N N   . ARG A 1 149 ? -8.138  62.073 54.890 1.00 27.59 ? 149  ARG A N   1 
ATOM   1156 C CA  . ARG A 1 149 ? -8.557  61.549 56.181 1.00 27.51 ? 149  ARG A CA  1 
ATOM   1157 C C   . ARG A 1 149 ? -7.356  60.997 56.975 1.00 26.12 ? 149  ARG A C   1 
ATOM   1158 O O   . ARG A 1 149 ? -6.485  60.316 56.410 1.00 26.80 ? 149  ARG A O   1 
ATOM   1159 C CB  . ARG A 1 149 ? -9.602  60.446 56.012 1.00 26.69 ? 149  ARG A CB  1 
ATOM   1160 C CG  . ARG A 1 149 ? -10.973 60.954 55.555 1.00 30.64 ? 149  ARG A CG  1 
ATOM   1161 C CD  . ARG A 1 149 ? -11.865 59.796 55.064 1.00 29.00 ? 149  ARG A CD  1 
ATOM   1162 N NE  . ARG A 1 149 ? -11.508 59.360 53.714 1.00 30.27 ? 149  ARG A NE  1 
ATOM   1163 C CZ  . ARG A 1 149 ? -12.047 58.296 53.103 1.00 31.52 ? 149  ARG A CZ  1 
ATOM   1164 N NH1 . ARG A 1 149 ? -12.965 57.538 53.747 1.00 28.89 ? 149  ARG A NH1 1 
ATOM   1165 N NH2 . ARG A 1 149 ? -11.716 58.017 51.831 1.00 29.70 ? 149  ARG A NH2 1 
ATOM   1166 N N   . VAL A 1 150 ? -7.333  61.269 58.271 1.00 25.08 ? 150  VAL A N   1 
ATOM   1167 C CA  . VAL A 1 150 ? -6.257  60.764 59.130 1.00 25.89 ? 150  VAL A CA  1 
ATOM   1168 C C   . VAL A 1 150 ? -6.846  59.842 60.218 1.00 27.67 ? 150  VAL A C   1 
ATOM   1169 O O   . VAL A 1 150 ? -8.087  59.681 60.314 1.00 26.36 ? 150  VAL A O   1 
ATOM   1170 C CB  . VAL A 1 150 ? -5.473  61.936 59.795 1.00 25.83 ? 150  VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 150 ? -4.702  62.733 58.703 1.00 24.01 ? 150  VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 150 ? -6.418  62.846 60.561 1.00 25.46 ? 150  VAL A CG2 1 
ATOM   1173 N N   . GLY A 1 151 ? -5.967  59.212 61.024 1.00 28.41 ? 151  GLY A N   1 
ATOM   1174 C CA  . GLY A 1 151 ? -6.453  58.343 62.094 1.00 27.84 ? 151  GLY A CA  1 
ATOM   1175 C C   . GLY A 1 151 ? -7.282  57.158 61.564 1.00 29.14 ? 151  GLY A C   1 
ATOM   1176 O O   . GLY A 1 151 ? -7.103  56.696 60.409 1.00 27.65 ? 151  GLY A O   1 
ATOM   1177 N N   . ALA A 1 152 ? -8.206  56.667 62.384 1.00 29.27 ? 152  ALA A N   1 
ATOM   1178 C CA  . ALA A 1 152 ? -9.033  55.514 61.980 1.00 29.64 ? 152  ALA A CA  1 
ATOM   1179 C C   . ALA A 1 152 ? -9.838  55.831 60.689 1.00 28.97 ? 152  ALA A C   1 
ATOM   1180 O O   . ALA A 1 152 ? -10.005 54.972 59.783 1.00 26.46 ? 152  ALA A O   1 
ATOM   1181 C CB  . ALA A 1 152 ? -10.005 55.090 63.172 1.00 29.23 ? 152  ALA A CB  1 
ATOM   1182 N N   . PHE A 1 153 ? -10.269 57.082 60.572 1.00 28.64 ? 153  PHE A N   1 
ATOM   1183 C CA  . PHE A 1 153 ? -11.046 57.467 59.391 1.00 29.55 ? 153  PHE A CA  1 
ATOM   1184 C C   . PHE A 1 153 ? -10.295 57.281 58.071 1.00 29.20 ? 153  PHE A C   1 
ATOM   1185 O O   . PHE A 1 153 ? -10.899 57.031 57.012 1.00 26.48 ? 153  PHE A O   1 
ATOM   1186 C CB  . PHE A 1 153 ? -11.510 58.902 59.521 1.00 28.63 ? 153  PHE A CB  1 
ATOM   1187 C CG  . PHE A 1 153 ? -12.126 59.204 60.855 1.00 31.91 ? 153  PHE A CG  1 
ATOM   1188 C CD1 . PHE A 1 153 ? -13.509 59.025 61.070 1.00 32.58 ? 153  PHE A CD1 1 
ATOM   1189 C CD2 . PHE A 1 153 ? -11.318 59.641 61.917 1.00 29.14 ? 153  PHE A CD2 1 
ATOM   1190 C CE1 . PHE A 1 153 ? -14.076 59.275 62.342 1.00 34.03 ? 153  PHE A CE1 1 
ATOM   1191 C CE2 . PHE A 1 153 ? -11.861 59.900 63.190 1.00 31.31 ? 153  PHE A CE2 1 
ATOM   1192 C CZ  . PHE A 1 153 ? -13.237 59.717 63.419 1.00 32.27 ? 153  PHE A CZ  1 
ATOM   1193 N N   . GLY A 1 154 ? -8.979  57.432 58.107 1.00 30.02 ? 154  GLY A N   1 
ATOM   1194 C CA  . GLY A 1 154 ? -8.245  57.263 56.868 1.00 28.42 ? 154  GLY A CA  1 
ATOM   1195 C C   . GLY A 1 154 ? -7.423  55.992 56.760 1.00 28.04 ? 154  GLY A C   1 
ATOM   1196 O O   . GLY A 1 154 ? -6.980  55.636 55.653 1.00 28.54 ? 154  GLY A O   1 
ATOM   1197 N N   . PHE A 1 155 ? -7.211  55.298 57.880 1.00 27.44 ? 155  PHE A N   1 
ATOM   1198 C CA  . PHE A 1 155 ? -6.331  54.153 57.814 1.00 27.18 ? 155  PHE A CA  1 
ATOM   1199 C C   . PHE A 1 155 ? -6.762  52.857 58.515 1.00 27.60 ? 155  PHE A C   1 
ATOM   1200 O O   . PHE A 1 155 ? -6.032  51.857 58.553 1.00 26.77 ? 155  PHE A O   1 
ATOM   1201 C CB  . PHE A 1 155 ? -4.950  54.660 58.266 1.00 27.12 ? 155  PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 155 ? -4.386  55.722 57.333 1.00 26.92 ? 155  PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 155 ? -3.827  55.368 56.107 1.00 27.23 ? 155  PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 155 ? -4.492  57.068 57.638 1.00 26.75 ? 155  PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 155 ? -3.371  56.336 55.170 1.00 27.38 ? 155  PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 155 ? -4.045  58.040 56.727 1.00 25.70 ? 155  PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 155 ? -3.478  57.669 55.483 1.00 26.47 ? 155  PHE A CZ  1 
ATOM   1208 N N   . LEU A 1 156 ? -7.957  52.854 59.060 1.00 27.99 ? 156  LEU A N   1 
ATOM   1209 C CA  . LEU A 1 156 ? -8.460  51.611 59.670 1.00 29.84 ? 156  LEU A CA  1 
ATOM   1210 C C   . LEU A 1 156 ? -8.358  50.591 58.532 1.00 29.90 ? 156  LEU A C   1 
ATOM   1211 O O   . LEU A 1 156 ? -8.814  50.856 57.421 1.00 31.31 ? 156  LEU A O   1 
ATOM   1212 C CB  . LEU A 1 156 ? -9.920  51.768 60.064 1.00 31.11 ? 156  LEU A CB  1 
ATOM   1213 C CG  . LEU A 1 156 ? -10.398 50.498 60.775 1.00 33.31 ? 156  LEU A CG  1 
ATOM   1214 C CD1 . LEU A 1 156 ? -10.483 50.763 62.266 1.00 32.83 ? 156  LEU A CD1 1 
ATOM   1215 C CD2 . LEU A 1 156 ? -11.752 50.106 60.232 1.00 31.28 ? 156  LEU A CD2 1 
ATOM   1216 N N   . ALA A 1 157 ? -7.754  49.439 58.779 1.00 29.84 ? 157  ALA A N   1 
ATOM   1217 C CA  . ALA A 1 157 ? -7.567  48.460 57.722 1.00 29.86 ? 157  ALA A CA  1 
ATOM   1218 C C   . ALA A 1 157 ? -8.006  47.007 58.068 1.00 33.05 ? 157  ALA A C   1 
ATOM   1219 O O   . ALA A 1 157 ? -7.430  46.344 58.966 1.00 31.05 ? 157  ALA A O   1 
ATOM   1220 C CB  . ALA A 1 157 ? -6.085  48.433 57.294 1.00 25.96 ? 157  ALA A CB  1 
ATOM   1221 N N   . LEU A 1 158 ? -8.986  46.505 57.320 1.00 33.27 ? 158  LEU A N   1 
ATOM   1222 C CA  . LEU A 1 158 ? -9.437  45.124 57.512 1.00 35.24 ? 158  LEU A CA  1 
ATOM   1223 C C   . LEU A 1 158 ? -9.246  44.510 56.135 1.00 36.04 ? 158  LEU A C   1 
ATOM   1224 O O   . LEU A 1 158 ? -10.181 44.399 55.375 1.00 36.45 ? 158  LEU A O   1 
ATOM   1225 C CB  . LEU A 1 158 ? -10.902 45.117 57.937 1.00 34.48 ? 158  LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 158 ? -11.051 45.557 59.407 1.00 35.30 ? 158  LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 158 ? -12.525 45.817 59.736 1.00 33.97 ? 158  LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 158 ? -10.425 44.463 60.330 1.00 31.86 ? 158  LEU A CD2 1 
ATOM   1229 N N   . HIS A 1 159 ? -8.008  44.156 55.812 1.00 37.75 ? 159  HIS A N   1 
ATOM   1230 C CA  . HIS A 1 159 ? -7.675  43.626 54.493 1.00 39.56 ? 159  HIS A CA  1 
ATOM   1231 C C   . HIS A 1 159 ? -8.602  42.482 54.101 1.00 41.01 ? 159  HIS A C   1 
ATOM   1232 O O   . HIS A 1 159 ? -8.799  41.550 54.890 1.00 39.80 ? 159  HIS A O   1 
ATOM   1233 C CB  . HIS A 1 159 ? -6.227  43.139 54.447 1.00 38.26 ? 159  HIS A CB  1 
ATOM   1234 C CG  . HIS A 1 159 ? -5.765  42.780 53.074 1.00 39.40 ? 159  HIS A CG  1 
ATOM   1235 N ND1 . HIS A 1 159 ? -5.791  43.675 52.018 1.00 38.91 ? 159  HIS A ND1 1 
ATOM   1236 C CD2 . HIS A 1 159 ? -5.285  41.613 52.572 1.00 37.94 ? 159  HIS A CD2 1 
ATOM   1237 C CE1 . HIS A 1 159 ? -5.345  43.070 50.931 1.00 38.11 ? 159  HIS A CE1 1 
ATOM   1238 N NE2 . HIS A 1 159 ? -5.035  41.820 51.243 1.00 38.19 ? 159  HIS A NE2 1 
ATOM   1239 N N   . GLY A 1 160 ? -9.133  42.573 52.868 1.00 42.91 ? 160  GLY A N   1 
ATOM   1240 C CA  . GLY A 1 160 ? -10.060 41.582 52.331 1.00 43.99 ? 160  GLY A CA  1 
ATOM   1241 C C   . GLY A 1 160 ? -11.449 42.191 52.247 1.00 45.00 ? 160  GLY A C   1 
ATOM   1242 O O   . GLY A 1 160 ? -12.273 41.821 51.420 1.00 46.01 ? 160  GLY A O   1 
ATOM   1243 N N   . SER A 1 161 ? -11.722 43.143 53.122 1.00 44.58 ? 161  SER A N   1 
ATOM   1244 C CA  . SER A 1 161 ? -13.001 43.804 53.102 1.00 44.75 ? 161  SER A CA  1 
ATOM   1245 C C   . SER A 1 161 ? -12.921 44.980 52.132 1.00 46.08 ? 161  SER A C   1 
ATOM   1246 O O   . SER A 1 161 ? -11.880 45.646 52.029 1.00 46.19 ? 161  SER A O   1 
ATOM   1247 C CB  . SER A 1 161 ? -13.326 44.328 54.487 1.00 46.37 ? 161  SER A CB  1 
ATOM   1248 O OG  . SER A 1 161 ? -14.336 45.318 54.413 1.00 50.03 ? 161  SER A OG  1 
ATOM   1249 N N   . GLN A 1 162 ? -14.014 45.261 51.438 1.00 43.63 ? 162  GLN A N   1 
ATOM   1250 C CA  . GLN A 1 162 ? -14.020 46.367 50.527 1.00 43.83 ? 162  GLN A CA  1 
ATOM   1251 C C   . GLN A 1 162 ? -14.642 47.551 51.249 1.00 43.27 ? 162  GLN A C   1 
ATOM   1252 O O   . GLN A 1 162 ? -14.646 48.670 50.724 1.00 42.84 ? 162  GLN A O   1 
ATOM   1253 C CB  . GLN A 1 162 ? -14.837 46.043 49.271 1.00 47.88 ? 162  GLN A CB  1 
ATOM   1254 C CG  . GLN A 1 162 ? -14.148 45.103 48.281 1.00 51.40 ? 162  GLN A CG  1 
ATOM   1255 C CD  . GLN A 1 162 ? -12.689 45.524 47.990 1.00 55.64 ? 162  GLN A CD  1 
ATOM   1256 O OE1 . GLN A 1 162 ? -12.376 46.728 47.848 1.00 55.66 ? 162  GLN A OE1 1 
ATOM   1257 N NE2 . GLN A 1 162 ? -11.796 44.526 47.891 1.00 55.79 ? 162  GLN A NE2 1 
ATOM   1258 N N   . GLU A 1 163 ? -15.199 47.299 52.434 1.00 40.77 ? 163  GLU A N   1 
ATOM   1259 C CA  . GLU A 1 163 ? -15.805 48.358 53.204 1.00 40.88 ? 163  GLU A CA  1 
ATOM   1260 C C   . GLU A 1 163 ? -14.766 49.212 53.984 1.00 39.56 ? 163  GLU A C   1 
ATOM   1261 O O   . GLU A 1 163 ? -15.011 50.389 54.231 1.00 37.99 ? 163  GLU A O   1 
ATOM   1262 C CB  . GLU A 1 163 ? -16.848 47.765 54.170 1.00 44.10 ? 163  GLU A CB  1 
ATOM   1263 C CG  . GLU A 1 163 ? -18.077 47.206 53.441 1.00 48.42 ? 163  GLU A CG  1 
ATOM   1264 C CD  . GLU A 1 163 ? -18.665 48.237 52.506 1.00 52.21 ? 163  GLU A CD  1 
ATOM   1265 O OE1 . GLU A 1 163 ? -18.743 47.953 51.284 1.00 56.57 ? 163  GLU A OE1 1 
ATOM   1266 O OE2 . GLU A 1 163 ? -19.032 49.345 52.974 1.00 52.55 ? 163  GLU A OE2 1 
ATOM   1267 N N   . ALA A 1 164 ? -13.636 48.606 54.379 1.00 36.91 ? 164  ALA A N   1 
ATOM   1268 C CA  . ALA A 1 164 ? -12.553 49.311 55.122 1.00 34.89 ? 164  ALA A CA  1 
ATOM   1269 C C   . ALA A 1 164 ? -11.295 48.561 54.692 1.00 33.07 ? 164  ALA A C   1 
ATOM   1270 O O   . ALA A 1 164 ? -10.717 47.802 55.450 1.00 31.60 ? 164  ALA A O   1 
ATOM   1271 C CB  . ALA A 1 164 ? -12.769 49.181 56.664 1.00 33.23 ? 164  ALA A CB  1 
ATOM   1272 N N   . PRO A 1 165 ? -10.863 48.776 53.446 1.00 33.03 ? 165  PRO A N   1 
ATOM   1273 C CA  . PRO A 1 165 ? -9.685  48.092 52.933 1.00 33.04 ? 165  PRO A CA  1 
ATOM   1274 C C   . PRO A 1 165 ? -8.343  48.647 53.427 1.00 34.40 ? 165  PRO A C   1 
ATOM   1275 O O   . PRO A 1 165 ? -7.332  47.969 53.307 1.00 34.58 ? 165  PRO A O   1 
ATOM   1276 C CB  . PRO A 1 165 ? -9.840  48.238 51.431 1.00 32.42 ? 165  PRO A CB  1 
ATOM   1277 C CG  . PRO A 1 165 ? -10.411 49.684 51.293 1.00 33.32 ? 165  PRO A CG  1 
ATOM   1278 C CD  . PRO A 1 165 ? -11.382 49.790 52.497 1.00 32.98 ? 165  PRO A CD  1 
ATOM   1279 N N   . GLY A 1 166 ? -8.353  49.839 54.027 1.00 32.38 ? 166  GLY A N   1 
ATOM   1280 C CA  . GLY A 1 166 ? -7.080  50.444 54.417 1.00 30.88 ? 166  GLY A CA  1 
ATOM   1281 C C   . GLY A 1 166 ? -6.578  51.404 53.305 1.00 30.84 ? 166  GLY A C   1 
ATOM   1282 O O   . GLY A 1 166 ? -7.089  51.397 52.151 1.00 28.25 ? 166  GLY A O   1 
ATOM   1283 N N   . ASN A 1 167 ? -5.623  52.259 53.682 1.00 29.36 ? 167  ASN A N   1 
ATOM   1284 C CA  . ASN A 1 167 ? -4.983  53.191 52.785 1.00 28.14 ? 167  ASN A CA  1 
ATOM   1285 C C   . ASN A 1 167 ? -5.910  54.217 52.161 1.00 27.36 ? 167  ASN A C   1 
ATOM   1286 O O   . ASN A 1 167 ? -5.481  54.909 51.244 1.00 28.27 ? 167  ASN A O   1 
ATOM   1287 C CB  . ASN A 1 167 ? -4.255  52.414 51.644 1.00 28.57 ? 167  ASN A CB  1 
ATOM   1288 C CG  . ASN A 1 167 ? -3.073  51.591 52.161 1.00 30.84 ? 167  ASN A CG  1 
ATOM   1289 O OD1 . ASN A 1 167 ? -2.501  51.903 53.219 1.00 29.21 ? 167  ASN A OD1 1 
ATOM   1290 N ND2 . ASN A 1 167 ? -2.691  50.548 51.417 1.00 29.07 ? 167  ASN A ND2 1 
ATOM   1291 N N   . VAL A 1 168 ? -7.153  54.334 52.627 1.00 27.20 ? 168  VAL A N   1 
ATOM   1292 C CA  . VAL A 1 168 ? -8.051  55.290 51.966 1.00 27.20 ? 168  VAL A CA  1 
ATOM   1293 C C   . VAL A 1 168 ? -7.587  56.762 52.075 1.00 28.30 ? 168  VAL A C   1 
ATOM   1294 O O   . VAL A 1 168 ? -7.835  57.562 51.146 1.00 30.40 ? 168  VAL A O   1 
ATOM   1295 C CB  . VAL A 1 168 ? -9.589  55.024 52.322 1.00 28.31 ? 168  VAL A CB  1 
ATOM   1296 C CG1 . VAL A 1 168 ? -9.884  53.455 52.050 1.00 24.07 ? 168  VAL A CG1 1 
ATOM   1297 C CG2 . VAL A 1 168 ? -10.004 55.466 53.770 1.00 26.97 ? 168  VAL A CG2 1 
ATOM   1298 N N   . GLY A 1 169 ? -6.816  57.078 53.136 1.00 27.18 ? 169  GLY A N   1 
ATOM   1299 C CA  . GLY A 1 169 ? -6.256  58.404 53.291 1.00 25.44 ? 169  GLY A CA  1 
ATOM   1300 C C   . GLY A 1 169 ? -5.237  58.641 52.179 1.00 26.05 ? 169  GLY A C   1 
ATOM   1301 O O   . GLY A 1 169 ? -5.115  59.756 51.658 1.00 26.18 ? 169  GLY A O   1 
ATOM   1302 N N   . LEU A 1 170 ? -4.493  57.605 51.806 1.00 24.54 ? 170  LEU A N   1 
ATOM   1303 C CA  . LEU A 1 170 ? -3.535  57.754 50.709 1.00 25.47 ? 170  LEU A CA  1 
ATOM   1304 C C   . LEU A 1 170 ? -4.330  57.920 49.401 1.00 25.32 ? 170  LEU A C   1 
ATOM   1305 O O   . LEU A 1 170 ? -3.896  58.667 48.517 1.00 25.92 ? 170  LEU A O   1 
ATOM   1306 C CB  . LEU A 1 170 ? -2.613  56.503 50.590 1.00 24.29 ? 170  LEU A CB  1 
ATOM   1307 C CG  . LEU A 1 170 ? -1.535  56.428 51.721 1.00 25.26 ? 170  LEU A CG  1 
ATOM   1308 C CD1 . LEU A 1 170 ? -0.838  55.088 51.714 1.00 22.14 ? 170  LEU A CD1 1 
ATOM   1309 C CD2 . LEU A 1 170 ? -0.489  57.550 51.495 1.00 23.87 ? 170  LEU A CD2 1 
ATOM   1310 N N   . LEU A 1 171 ? -5.473  57.224 49.289 1.00 24.98 ? 171  LEU A N   1 
ATOM   1311 C CA  . LEU A 1 171 ? -6.323  57.302 48.095 1.00 25.67 ? 171  LEU A CA  1 
ATOM   1312 C C   . LEU A 1 171 ? -6.961  58.707 48.060 1.00 25.87 ? 171  LEU A C   1 
ATOM   1313 O O   . LEU A 1 171 ? -7.147  59.261 46.958 1.00 24.73 ? 171  LEU A O   1 
ATOM   1314 C CB  . LEU A 1 171 ? -7.389  56.157 48.098 1.00 27.23 ? 171  LEU A CB  1 
ATOM   1315 C CG  . LEU A 1 171 ? -6.848  54.714 47.840 1.00 26.21 ? 171  LEU A CG  1 
ATOM   1316 C CD1 . LEU A 1 171 ? -8.018  53.719 47.853 1.00 27.83 ? 171  LEU A CD1 1 
ATOM   1317 C CD2 . LEU A 1 171 ? -6.084  54.618 46.455 1.00 24.58 ? 171  LEU A CD2 1 
ATOM   1318 N N   . ASP A 1 172 ? -7.260  59.301 49.239 1.00 26.08 ? 172  ASP A N   1 
ATOM   1319 C CA  . ASP A 1 172 ? -7.738  60.690 49.251 1.00 27.67 ? 172  ASP A CA  1 
ATOM   1320 C C   . ASP A 1 172 ? -6.646  61.580 48.606 1.00 28.25 ? 172  ASP A C   1 
ATOM   1321 O O   . ASP A 1 172 ? -6.910  62.427 47.757 1.00 27.14 ? 172  ASP A O   1 
ATOM   1322 C CB  . ASP A 1 172 ? -7.965  61.217 50.700 1.00 27.11 ? 172  ASP A CB  1 
ATOM   1323 C CG  . ASP A 1 172 ? -9.139  60.554 51.381 1.00 28.87 ? 172  ASP A CG  1 
ATOM   1324 O OD1 . ASP A 1 172 ? -9.946  59.915 50.653 1.00 28.77 ? 172  ASP A OD1 1 
ATOM   1325 O OD2 . ASP A 1 172 ? -9.276  60.662 52.626 1.00 28.06 ? 172  ASP A OD2 1 
ATOM   1326 N N   . GLN A 1 173 ? -5.385  61.345 48.978 1.00 27.78 ? 173  GLN A N   1 
ATOM   1327 C CA  . GLN A 1 173 ? -4.310  62.210 48.449 1.00 27.56 ? 173  GLN A CA  1 
ATOM   1328 C C   . GLN A 1 173 ? -4.238  62.042 46.950 1.00 27.61 ? 173  GLN A C   1 
ATOM   1329 O O   . GLN A 1 173 ? -4.112  63.038 46.160 1.00 27.60 ? 173  GLN A O   1 
ATOM   1330 C CB  . GLN A 1 173 ? -2.934  61.850 49.098 1.00 26.87 ? 173  GLN A CB  1 
ATOM   1331 C CG  . GLN A 1 173 ? -2.845  62.040 50.633 1.00 25.03 ? 173  GLN A CG  1 
ATOM   1332 C CD  . GLN A 1 173 ? -1.509  61.564 51.187 1.00 28.05 ? 173  GLN A CD  1 
ATOM   1333 O OE1 . GLN A 1 173 ? -0.550  61.368 50.415 1.00 25.49 ? 173  GLN A OE1 1 
ATOM   1334 N NE2 . GLN A 1 173 ? -1.425  61.374 52.523 1.00 26.34 ? 173  GLN A NE2 1 
ATOM   1335 N N   . ARG A 1 174 ? -4.309  60.779 46.544 1.00 26.46 ? 174  ARG A N   1 
ATOM   1336 C CA  . ARG A 1 174 ? -4.213  60.473 45.126 1.00 27.94 ? 174  ARG A CA  1 
ATOM   1337 C C   . ARG A 1 174 ? -5.337  61.172 44.330 1.00 28.87 ? 174  ARG A C   1 
ATOM   1338 O O   . ARG A 1 174 ? -5.072  61.698 43.233 1.00 27.53 ? 174  ARG A O   1 
ATOM   1339 C CB  . ARG A 1 174 ? -4.260  58.955 44.861 1.00 26.34 ? 174  ARG A CB  1 
ATOM   1340 C CG  . ARG A 1 174 ? -4.188  58.619 43.367 1.00 29.42 ? 174  ARG A CG  1 
ATOM   1341 C CD  . ARG A 1 174 ? -4.286  57.090 43.069 1.00 28.65 ? 174  ARG A CD  1 
ATOM   1342 N NE  . ARG A 1 174 ? -3.176  56.319 43.618 1.00 28.19 ? 174  ARG A NE  1 
ATOM   1343 C CZ  . ARG A 1 174 ? -3.189  54.984 43.716 1.00 29.80 ? 174  ARG A CZ  1 
ATOM   1344 N NH1 . ARG A 1 174 ? -4.257  54.296 43.316 1.00 29.33 ? 174  ARG A NH1 1 
ATOM   1345 N NH2 . ARG A 1 174 ? -2.118  54.310 44.124 1.00 29.06 ? 174  ARG A NH2 1 
ATOM   1346 N N   . MET A 1 175 ? -6.564  61.141 44.876 1.00 29.25 ? 175  MET A N   1 
ATOM   1347 C CA  . MET A 1 175 ? -7.698  61.793 44.218 1.00 32.07 ? 175  MET A CA  1 
ATOM   1348 C C   . MET A 1 175 ? -7.472  63.296 44.082 1.00 31.59 ? 175  MET A C   1 
ATOM   1349 O O   . MET A 1 175 ? -7.863  63.885 43.073 1.00 31.19 ? 175  MET A O   1 
ATOM   1350 C CB  . MET A 1 175 ? -9.006  61.565 44.975 1.00 30.80 ? 175  MET A CB  1 
ATOM   1351 C CG  . MET A 1 175 ? -10.261 62.005 44.139 1.00 35.25 ? 175  MET A CG  1 
ATOM   1352 S SD  . MET A 1 175 ? -11.611 60.866 44.477 1.00 40.44 ? 175  MET A SD  1 
ATOM   1353 C CE  . MET A 1 175 ? -12.220 61.623 45.412 1.00 36.04 ? 175  MET A CE  1 
ATOM   1354 N N   . ALA A 1 176 ? -6.860  63.911 45.099 1.00 30.59 ? 176  ALA A N   1 
ATOM   1355 C CA  . ALA A 1 176 ? -6.574  65.335 45.031 1.00 29.36 ? 176  ALA A CA  1 
ATOM   1356 C C   . ALA A 1 176 ? -5.495  65.517 43.922 1.00 28.60 ? 176  ALA A C   1 
ATOM   1357 O O   . ALA A 1 176 ? -5.550  66.452 43.103 1.00 28.17 ? 176  ALA A O   1 
ATOM   1358 C CB  . ALA A 1 176 ? -6.096  65.866 46.417 1.00 26.75 ? 176  ALA A CB  1 
ATOM   1359 N N   . LEU A 1 177 ? -4.533  64.613 43.843 1.00 27.76 ? 177  LEU A N   1 
ATOM   1360 C CA  . LEU A 1 177 ? -3.518  64.757 42.784 1.00 26.46 ? 177  LEU A CA  1 
ATOM   1361 C C   . LEU A 1 177 ? -4.146  64.536 41.389 1.00 26.80 ? 177  LEU A C   1 
ATOM   1362 O O   . LEU A 1 177 ? -3.716  65.125 40.395 1.00 26.43 ? 177  LEU A O   1 
ATOM   1363 C CB  . LEU A 1 177 ? -2.374  63.774 42.989 1.00 27.18 ? 177  LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 177 ? -1.533  64.012 44.263 1.00 30.87 ? 177  LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 177 ? -0.556  62.891 44.333 1.00 31.02 ? 177  LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 177 ? -0.804  65.386 44.249 1.00 28.92 ? 177  LEU A CD2 1 
ATOM   1367 N N   . GLN A 1 178 ? -5.168  63.688 41.326 1.00 25.97 ? 178  GLN A N   1 
ATOM   1368 C CA  . GLN A 1 178 ? -5.843  63.420 40.052 1.00 28.28 ? 178  GLN A CA  1 
ATOM   1369 C C   . GLN A 1 178 ? -6.580  64.724 39.674 1.00 28.08 ? 178  GLN A C   1 
ATOM   1370 O O   . GLN A 1 178 ? -6.534  65.162 38.514 1.00 28.68 ? 178  GLN A O   1 
ATOM   1371 C CB  . GLN A 1 178 ? -6.852  62.237 40.193 1.00 28.05 ? 178  GLN A CB  1 
ATOM   1372 C CG  . GLN A 1 178 ? -7.645  61.927 38.879 1.00 29.17 ? 178  GLN A CG  1 
ATOM   1373 C CD  . GLN A 1 178 ? -6.735  61.325 37.824 1.00 28.92 ? 178  GLN A CD  1 
ATOM   1374 O OE1 . GLN A 1 178 ? -6.093  60.315 38.081 1.00 30.34 ? 178  GLN A OE1 1 
ATOM   1375 N NE2 . GLN A 1 178 ? -6.644  61.957 36.655 1.00 27.25 ? 178  GLN A NE2 1 
ATOM   1376 N N   . TRP A 1 179 ? -7.224  65.349 40.655 1.00 26.59 ? 179  TRP A N   1 
ATOM   1377 C CA  . TRP A 1 179 ? -7.960  66.589 40.375 1.00 28.51 ? 179  TRP A CA  1 
ATOM   1378 C C   . TRP A 1 179 ? -7.008  67.700 39.917 1.00 28.52 ? 179  TRP A C   1 
ATOM   1379 O O   . TRP A 1 179 ? -7.322  68.413 38.935 1.00 29.47 ? 179  TRP A O   1 
ATOM   1380 C CB  . TRP A 1 179 ? -8.761  67.029 41.601 1.00 28.20 ? 179  TRP A CB  1 
ATOM   1381 C CG  . TRP A 1 179 ? -9.765  68.022 41.305 1.00 28.57 ? 179  TRP A CG  1 
ATOM   1382 C CD1 . TRP A 1 179 ? -11.081 67.800 41.024 1.00 30.11 ? 179  TRP A CD1 1 
ATOM   1383 C CD2 . TRP A 1 179 ? -9.574  69.439 41.252 1.00 30.39 ? 179  TRP A CD2 1 
ATOM   1384 N NE1 . TRP A 1 179 ? -11.714 68.986 40.807 1.00 29.17 ? 179  TRP A NE1 1 
ATOM   1385 C CE2 . TRP A 1 179 ? -10.818 70.010 40.938 1.00 28.99 ? 179  TRP A CE2 1 
ATOM   1386 C CE3 . TRP A 1 179 ? -8.467  70.283 41.439 1.00 26.87 ? 179  TRP A CE3 1 
ATOM   1387 C CZ2 . TRP A 1 179 ? -10.997 71.392 40.802 1.00 29.00 ? 179  TRP A CZ2 1 
ATOM   1388 C CZ3 . TRP A 1 179 ? -8.652  71.655 41.310 1.00 30.12 ? 179  TRP A CZ3 1 
ATOM   1389 C CH2 . TRP A 1 179 ? -9.905  72.196 40.996 1.00 28.99 ? 179  TRP A CH2 1 
ATOM   1390 N N   . VAL A 1 180 ? -5.857  67.852 40.592 1.00 27.66 ? 180  VAL A N   1 
ATOM   1391 C CA  . VAL A 1 180 ? -4.860  68.856 40.177 1.00 28.33 ? 180  VAL A CA  1 
ATOM   1392 C C   . VAL A 1 180 ? -4.376  68.542 38.732 1.00 31.07 ? 180  VAL A C   1 
ATOM   1393 O O   . VAL A 1 180 ? -4.270  69.417 37.857 1.00 30.80 ? 180  VAL A O   1 
ATOM   1394 C CB  . VAL A 1 180 ? -3.631  68.837 41.144 1.00 28.20 ? 180  VAL A CB  1 
ATOM   1395 C CG1 . VAL A 1 180 ? -2.445  69.558 40.556 1.00 28.17 ? 180  VAL A CG1 1 
ATOM   1396 C CG2 . VAL A 1 180 ? -4.010  69.522 42.444 1.00 29.48 ? 180  VAL A CG2 1 
ATOM   1397 N N   . HIS A 1 181 ? -4.044  67.288 38.482 1.00 30.39 ? 181  HIS A N   1 
ATOM   1398 C CA  . HIS A 1 181 ? -3.614  66.925 37.133 1.00 31.15 ? 181  HIS A CA  1 
ATOM   1399 C C   . HIS A 1 181 ? -4.637  67.313 36.052 1.00 31.39 ? 181  HIS A C   1 
ATOM   1400 O O   . HIS A 1 181 ? -4.284  67.867 35.010 1.00 30.18 ? 181  HIS A O   1 
ATOM   1401 C CB  . HIS A 1 181 ? -3.386  65.425 37.093 1.00 32.19 ? 181  HIS A CB  1 
ATOM   1402 C CG  . HIS A 1 181 ? -3.066  64.916 35.744 1.00 35.83 ? 181  HIS A CG  1 
ATOM   1403 N ND1 . HIS A 1 181 ? -4.038  64.432 34.881 1.00 36.80 ? 181  HIS A ND1 1 
ATOM   1404 C CD2 . HIS A 1 181 ? -1.897  64.881 35.072 1.00 32.25 ? 181  HIS A CD2 1 
ATOM   1405 C CE1 . HIS A 1 181 ? -3.469  64.126 33.733 1.00 37.35 ? 181  HIS A CE1 1 
ATOM   1406 N NE2 . HIS A 1 181 ? -2.176  64.390 33.824 1.00 37.77 ? 181  HIS A NE2 1 
ATOM   1407 N N   . ASP A 1 182 ? -5.905  67.022 36.324 1.00 30.38 ? 182  ASP A N   1 
ATOM   1408 C CA  . ASP A 1 182 ? -6.975  67.291 35.388 1.00 30.92 ? 182  ASP A CA  1 
ATOM   1409 C C   . ASP A 1 182 ? -7.471  68.743 35.296 1.00 30.96 ? 182  ASP A C   1 
ATOM   1410 O O   . ASP A 1 182 ? -8.021  69.119 34.256 1.00 31.42 ? 182  ASP A O   1 
ATOM   1411 C CB  . ASP A 1 182 ? -8.194  66.457 35.713 1.00 29.28 ? 182  ASP A CB  1 
ATOM   1412 C CG  . ASP A 1 182 ? -7.975  64.967 35.516 1.00 30.72 ? 182  ASP A CG  1 
ATOM   1413 O OD1 . ASP A 1 182 ? -7.161  64.538 34.670 1.00 32.65 ? 182  ASP A OD1 1 
ATOM   1414 O OD2 . ASP A 1 182 ? -8.652  64.230 36.221 1.00 29.47 ? 182  ASP A OD2 1 
ATOM   1415 N N   . ASN A 1 183 ? -7.269  69.530 36.343 1.00 28.72 ? 183  ASN A N   1 
ATOM   1416 C CA  . ASN A 1 183 ? -7.796  70.887 36.379 1.00 30.62 ? 183  ASN A CA  1 
ATOM   1417 C C   . ASN A 1 183 ? -6.896  72.079 36.605 1.00 30.54 ? 183  ASN A C   1 
ATOM   1418 O O   . ASN A 1 183 ? -7.305  73.235 36.365 1.00 30.06 ? 183  ASN A O   1 
ATOM   1419 C CB  . ASN A 1 183 ? -8.876  70.951 37.465 1.00 29.31 ? 183  ASN A CB  1 
ATOM   1420 C CG  . ASN A 1 183 ? -10.042 70.068 37.149 1.00 32.99 ? 183  ASN A CG  1 
ATOM   1421 O OD1 . ASN A 1 183 ? -10.854 70.416 36.278 1.00 31.74 ? 183  ASN A OD1 1 
ATOM   1422 N ND2 . ASN A 1 183 ? -10.132 68.888 37.823 1.00 31.00 ? 183  ASN A ND2 1 
ATOM   1423 N N   . ILE A 1 184 ? -5.700  71.838 37.128 1.00 29.94 ? 184  ILE A N   1 
ATOM   1424 C CA  . ILE A 1 184 ? -4.817  72.951 37.438 1.00 28.18 ? 184  ILE A CA  1 
ATOM   1425 C C   . ILE A 1 184 ? -4.482  73.874 36.210 1.00 29.23 ? 184  ILE A C   1 
ATOM   1426 O O   . ILE A 1 184 ? -4.189  75.058 36.390 1.00 28.75 ? 184  ILE A O   1 
ATOM   1427 C CB  . ILE A 1 184 ? -3.514  72.407 38.108 1.00 27.18 ? 184  ILE A CB  1 
ATOM   1428 C CG1 . ILE A 1 184 ? -2.939  73.453 39.080 1.00 25.90 ? 184  ILE A CG1 1 
ATOM   1429 C CG2 . ILE A 1 184 ? -2.469  72.041 37.022 1.00 25.52 ? 184  ILE A CG2 1 
ATOM   1430 C CD1 . ILE A 1 184 ? -3.883  73.830 40.300 1.00 26.11 ? 184  ILE A CD1 1 
ATOM   1431 N N   . GLN A 1 185 ? -4.530  73.349 34.979 1.00 28.69 ? 185  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 185 ? -4.199  74.175 33.804 1.00 29.44 ? 185  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 185 ? -5.173  75.369 33.769 1.00 29.79 ? 185  GLN A C   1 
ATOM   1434 O O   . GLN A 1 185 ? -4.819  76.400 33.246 1.00 30.59 ? 185  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 185 ? -4.356  73.400 32.478 1.00 27.23 ? 185  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 185 ? -5.826  72.995 32.247 1.00 29.94 ? 185  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 185 ? -5.981  71.920 31.177 1.00 33.47 ? 185  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 185 ? -5.832  70.695 31.455 1.00 32.18 ? 185  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 185 ? -6.245  72.358 29.934 1.00 31.27 ? 185  GLN A NE2 1 
ATOM   1440 N N   . PHE A 1 186 ? -6.374  75.217 34.322 1.00 29.58 ? 186  PHE A N   1 
ATOM   1441 C CA  . PHE A 1 186 ? -7.371  76.340 34.293 1.00 31.24 ? 186  PHE A CA  1 
ATOM   1442 C C   . PHE A 1 186 ? -7.028  77.493 35.243 1.00 31.88 ? 186  PHE A C   1 
ATOM   1443 O O   . PHE A 1 186 ? -7.482  78.637 35.043 1.00 31.58 ? 186  PHE A O   1 
ATOM   1444 C CB  . PHE A 1 186 ? -8.772  75.784 34.576 1.00 29.80 ? 186  PHE A CB  1 
ATOM   1445 C CG  . PHE A 1 186 ? -9.171  74.716 33.589 1.00 32.38 ? 186  PHE A CG  1 
ATOM   1446 C CD1 . PHE A 1 186 ? -9.180  75.008 32.192 1.00 29.24 ? 186  PHE A CD1 1 
ATOM   1447 C CD2 . PHE A 1 186 ? -9.430  73.405 34.022 1.00 29.33 ? 186  PHE A CD2 1 
ATOM   1448 C CE1 . PHE A 1 186 ? -9.439  74.000 31.228 1.00 31.62 ? 186  PHE A CE1 1 
ATOM   1449 C CE2 . PHE A 1 186 ? -9.689  72.390 33.076 1.00 32.59 ? 186  PHE A CE2 1 
ATOM   1450 C CZ  . PHE A 1 186 ? -9.697  72.674 31.661 1.00 30.47 ? 186  PHE A CZ  1 
ATOM   1451 N N   . PHE A 1 187 ? -6.203  77.183 36.252 1.00 30.84 ? 187  PHE A N   1 
ATOM   1452 C CA  . PHE A 1 187 ? -5.743  78.149 37.233 1.00 30.18 ? 187  PHE A CA  1 
ATOM   1453 C C   . PHE A 1 187 ? -4.401  78.706 36.832 1.00 29.86 ? 187  PHE A C   1 
ATOM   1454 O O   . PHE A 1 187 ? -3.809  79.496 37.567 1.00 30.87 ? 187  PHE A O   1 
ATOM   1455 C CB  . PHE A 1 187 ? -5.620  77.499 38.613 1.00 29.16 ? 187  PHE A CB  1 
ATOM   1456 C CG  . PHE A 1 187 ? -6.935  77.014 39.152 1.00 29.41 ? 187  PHE A CG  1 
ATOM   1457 C CD1 . PHE A 1 187 ? -7.406  75.743 38.818 1.00 27.59 ? 187  PHE A CD1 1 
ATOM   1458 C CD2 . PHE A 1 187 ? -7.718  77.844 39.980 1.00 28.01 ? 187  PHE A CD2 1 
ATOM   1459 C CE1 . PHE A 1 187 ? -8.631  75.289 39.282 1.00 25.32 ? 187  PHE A CE1 1 
ATOM   1460 C CE2 . PHE A 1 187 ? -8.941  77.409 40.466 1.00 28.27 ? 187  PHE A CE2 1 
ATOM   1461 C CZ  . PHE A 1 187 ? -9.419  76.126 40.119 1.00 27.54 ? 187  PHE A CZ  1 
ATOM   1462 N N   . GLY A 1 188 ? -3.925  78.305 35.660 1.00 29.93 ? 188  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 188 ? -2.629  78.768 35.202 1.00 28.65 ? 188  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 188 ? -1.470  77.810 35.533 1.00 30.73 ? 188  GLY A C   1 
ATOM   1465 O O   . GLY A 1 188 ? -0.296  78.128 35.231 1.00 30.07 ? 188  GLY A O   1 
ATOM   1466 N N   . GLY A 1 189 ? -1.764  76.655 36.158 1.00 30.19 ? 189  GLY A N   1 
ATOM   1467 C CA  . GLY A 1 189 ? -0.685  75.722 36.498 1.00 30.69 ? 189  GLY A CA  1 
ATOM   1468 C C   . GLY A 1 189 ? -0.354  74.793 35.344 1.00 31.31 ? 189  GLY A C   1 
ATOM   1469 O O   . GLY A 1 189 ? -1.200  74.522 34.530 1.00 32.54 ? 189  GLY A O   1 
ATOM   1470 N N   . ASP A 1 190 ? 0.876   74.321 35.279 1.00 31.48 ? 190  ASP A N   1 
ATOM   1471 C CA  . ASP A 1 190 ? 1.332   73.395 34.270 1.00 31.05 ? 190  ASP A CA  1 
ATOM   1472 C C   . ASP A 1 190 ? 1.192   71.948 34.808 1.00 31.37 ? 190  ASP A C   1 
ATOM   1473 O O   . ASP A 1 190 ? 1.978   71.514 35.653 1.00 33.38 ? 190  ASP A O   1 
ATOM   1474 C CB  . ASP A 1 190 ? 2.805   73.701 33.926 1.00 31.29 ? 190  ASP A CB  1 
ATOM   1475 C CG  . ASP A 1 190 ? 3.369   72.769 32.884 1.00 31.46 ? 190  ASP A CG  1 
ATOM   1476 O OD1 . ASP A 1 190 ? 2.566   72.053 32.264 1.00 33.62 ? 190  ASP A OD1 1 
ATOM   1477 O OD2 . ASP A 1 190 ? 4.608   72.749 32.676 1.00 31.97 ? 190  ASP A OD2 1 
ATOM   1478 N N   . PRO A 1 191 ? 0.227   71.170 34.283 1.00 30.06 ? 191  PRO A N   1 
ATOM   1479 C CA  . PRO A 1 191 ? 0.083   69.814 34.790 1.00 29.66 ? 191  PRO A CA  1 
ATOM   1480 C C   . PRO A 1 191 ? 1.321   68.949 34.467 1.00 30.91 ? 191  PRO A C   1 
ATOM   1481 O O   . PRO A 1 191 ? 1.510   67.908 35.094 1.00 29.73 ? 191  PRO A O   1 
ATOM   1482 C CB  . PRO A 1 191 ? -1.225  69.323 34.115 1.00 29.67 ? 191  PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 191 ? -1.187  70.054 32.713 1.00 28.80 ? 191  PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 191 ? -0.720  71.453 33.176 1.00 30.41 ? 191  PRO A CD  1 
ATOM   1485 N N   . LYS A 1 192 ? 2.171   69.386 33.531 1.00 30.48 ? 192  LYS A N   1 
ATOM   1486 C CA  . LYS A 1 192 ? 3.393   68.616 33.181 1.00 30.39 ? 192  LYS A CA  1 
ATOM   1487 C C   . LYS A 1 192 ? 4.509   68.864 34.216 1.00 30.51 ? 192  LYS A C   1 
ATOM   1488 O O   . LYS A 1 192 ? 5.532   68.179 34.199 1.00 28.93 ? 192  LYS A O   1 
ATOM   1489 C CB  . LYS A 1 192 ? 3.982   69.030 31.809 1.00 30.23 ? 192  LYS A CB  1 
ATOM   1490 C CG  . LYS A 1 192 ? 2.996   68.945 30.615 1.00 31.66 ? 192  LYS A CG  1 
ATOM   1491 C CD  . LYS A 1 192 ? 3.630   69.401 29.265 1.00 33.40 ? 192  LYS A CD  1 
ATOM   1492 C CE  . LYS A 1 192 ? 4.071   70.881 29.273 1.00 33.54 ? 192  LYS A CE  1 
ATOM   1493 N NZ  . LYS A 1 192 ? 2.981   71.920 29.572 1.00 35.54 ? 192  LYS A NZ  1 
ATOM   1494 N N   . THR A 1 193 ? 4.308   69.834 35.103 1.00 28.46 ? 193  THR A N   1 
ATOM   1495 C CA  . THR A 1 193 ? 5.345   70.166 36.029 1.00 29.94 ? 193  THR A CA  1 
ATOM   1496 C C   . THR A 1 193 ? 4.844   70.326 37.494 1.00 30.30 ? 193  THR A C   1 
ATOM   1497 O O   . THR A 1 193 ? 4.961   71.403 38.103 1.00 29.48 ? 193  THR A O   1 
ATOM   1498 C CB  . THR A 1 193 ? 6.078   71.462 35.508 1.00 31.28 ? 193  THR A CB  1 
ATOM   1499 O OG1 . THR A 1 193 ? 6.425   71.286 34.103 1.00 31.82 ? 193  THR A OG1 1 
ATOM   1500 C CG2 . THR A 1 193 ? 7.408   71.703 36.277 1.00 28.87 ? 193  THR A CG2 1 
ATOM   1501 N N   . VAL A 1 194 ? 4.292   69.244 38.042 1.00 28.76 ? 194  VAL A N   1 
ATOM   1502 C CA  . VAL A 1 194 ? 3.792   69.289 39.407 1.00 29.80 ? 194  VAL A CA  1 
ATOM   1503 C C   . VAL A 1 194 ? 4.766   68.618 40.380 1.00 29.93 ? 194  VAL A C   1 
ATOM   1504 O O   . VAL A 1 194 ? 5.219   67.499 40.172 1.00 30.00 ? 194  VAL A O   1 
ATOM   1505 C CB  . VAL A 1 194 ? 2.350   68.659 39.531 1.00 31.29 ? 194  VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 194 ? 2.266   67.408 38.834 1.00 36.01 ? 194  VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 194 ? 1.999   68.348 40.968 1.00 30.15 ? 194  VAL A CG2 1 
ATOM   1508 N N   . THR A 1 195 ? 5.121   69.337 41.440 1.00 29.25 ? 195  THR A N   1 
ATOM   1509 C CA  . THR A 1 195 ? 5.990   68.748 42.440 1.00 26.69 ? 195  THR A CA  1 
ATOM   1510 C C   . THR A 1 195 ? 5.148   68.476 43.676 1.00 27.24 ? 195  THR A C   1 
ATOM   1511 O O   . THR A 1 195 ? 4.425   69.403 44.154 1.00 25.18 ? 195  THR A O   1 
ATOM   1512 C CB  . THR A 1 195 ? 7.146   69.708 42.815 1.00 25.72 ? 195  THR A CB  1 
ATOM   1513 O OG1 . THR A 1 195 ? 8.038   69.789 41.714 1.00 27.62 ? 195  THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 195 ? 7.982   69.162 44.030 1.00 26.37 ? 195  THR A CG2 1 
ATOM   1515 N N   . ILE A 1 196 ? 5.197   67.239 44.198 1.00 24.39 ? 196  ILE A N   1 
ATOM   1516 C CA  . ILE A 1 196 ? 4.486   67.003 45.435 1.00 24.72 ? 196  ILE A CA  1 
ATOM   1517 C C   . ILE A 1 196 ? 5.558   67.126 46.550 1.00 25.83 ? 196  ILE A C   1 
ATOM   1518 O O   . ILE A 1 196 ? 6.704   66.693 46.370 1.00 24.82 ? 196  ILE A O   1 
ATOM   1519 C CB  . ILE A 1 196 ? 3.822   65.634 45.453 1.00 26.99 ? 196  ILE A CB  1 
ATOM   1520 C CG1 . ILE A 1 196 ? 4.841   64.546 45.154 1.00 23.97 ? 196  ILE A CG1 1 
ATOM   1521 C CG2 . ILE A 1 196 ? 2.656   65.603 44.405 1.00 26.60 ? 196  ILE A CG2 1 
ATOM   1522 C CD1 . ILE A 1 196 ? 4.252   63.131 45.473 1.00 25.45 ? 196  ILE A CD1 1 
ATOM   1523 N N   . PHE A 1 197 ? 5.219   67.799 47.650 1.00 25.88 ? 197  PHE A N   1 
ATOM   1524 C CA  . PHE A 1 197 ? 6.138   67.946 48.763 1.00 26.01 ? 197  PHE A CA  1 
ATOM   1525 C C   . PHE A 1 197 ? 5.383   67.806 50.074 1.00 27.16 ? 197  PHE A C   1 
ATOM   1526 O O   . PHE A 1 197 ? 4.189   68.103 50.132 1.00 28.04 ? 197  PHE A O   1 
ATOM   1527 C CB  . PHE A 1 197 ? 7.000   69.238 48.675 1.00 24.24 ? 197  PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 197 ? 6.285   70.564 48.928 1.00 25.38 ? 197  PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 197 ? 5.122   70.917 48.249 1.00 26.12 ? 197  PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 197 ? 6.870   71.520 49.786 1.00 26.57 ? 197  PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 197 ? 4.540   72.200 48.416 1.00 27.72 ? 197  PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 197 ? 6.297   72.833 49.977 1.00 29.03 ? 197  PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 197 ? 5.126   73.171 49.289 1.00 27.57 ? 197  PHE A CZ  1 
ATOM   1534 N N   . GLY A 1 198 ? 6.037   67.280 51.104 1.00 26.35 ? 198  GLY A N   1 
ATOM   1535 C CA  . GLY A 1 198 ? 5.351   67.123 52.389 1.00 26.12 ? 198  GLY A CA  1 
ATOM   1536 C C   . GLY A 1 198 ? 6.400   66.860 53.482 1.00 25.04 ? 198  GLY A C   1 
ATOM   1537 O O   . GLY A 1 198 ? 7.529   66.491 53.143 1.00 23.00 ? 198  GLY A O   1 
ATOM   1538 N N   . GLU A 1 199 ? 6.039   67.079 54.753 1.00 23.80 ? 199  GLU A N   1 
ATOM   1539 C CA  . GLU A 1 199 ? 6.957   66.880 55.865 1.00 25.16 ? 199  GLU A CA  1 
ATOM   1540 C C   . GLU A 1 199 ? 6.420   65.786 56.798 1.00 26.27 ? 199  GLU A C   1 
ATOM   1541 O O   . GLU A 1 199 ? 5.217   65.594 56.886 1.00 25.63 ? 199  GLU A O   1 
ATOM   1542 C CB  . GLU A 1 199 ? 7.165   68.214 56.653 1.00 24.87 ? 199  GLU A CB  1 
ATOM   1543 C CG  . GLU A 1 199 ? 8.186   68.127 57.806 1.00 21.86 ? 199  GLU A CG  1 
ATOM   1544 C CD  . GLU A 1 199 ? 7.538   67.791 59.164 1.00 26.89 ? 199  GLU A CD  1 
ATOM   1545 O OE1 . GLU A 1 199 ? 6.294   67.676 59.235 1.00 24.68 ? 199  GLU A OE1 1 
ATOM   1546 O OE2 . GLU A 1 199 ? 8.263   67.620 60.169 1.00 28.11 ? 199  GLU A OE2 1 
ATOM   1547 N N   . SER A 1 200 ? 7.326   65.085 57.484 1.00 25.65 ? 200  SER A N   1 
ATOM   1548 C CA  . SER A 1 200 ? 6.950   64.018 58.415 1.00 26.78 ? 200  SER A CA  1 
ATOM   1549 C C   . SER A 1 200 ? 6.040   62.976 57.696 1.00 24.51 ? 200  SER A C   1 
ATOM   1550 O O   . SER A 1 200 ? 6.456   62.396 56.709 1.00 24.28 ? 200  SER A O   1 
ATOM   1551 C CB  . SER A 1 200 ? 6.260   64.628 59.634 1.00 28.21 ? 200  SER A CB  1 
ATOM   1552 O OG  . SER A 1 200 ? 6.099   63.628 60.636 1.00 32.35 ? 200  SER A OG  1 
ATOM   1553 N N   . ALA A 1 201 ? 4.823   62.733 58.156 1.00 23.17 ? 201  ALA A N   1 
ATOM   1554 C CA  . ALA A 1 201 ? 3.956   61.749 57.423 1.00 24.23 ? 201  ALA A CA  1 
ATOM   1555 C C   . ALA A 1 201 ? 3.660   62.179 55.960 1.00 23.37 ? 201  ALA A C   1 
ATOM   1556 O O   . ALA A 1 201 ? 3.373   61.341 55.077 1.00 24.28 ? 201  ALA A O   1 
ATOM   1557 C CB  . ALA A 1 201 ? 2.635   61.530 58.198 1.00 21.85 ? 201  ALA A CB  1 
ATOM   1558 N N   . GLY A 1 202 ? 3.703   63.496 55.712 1.00 24.01 ? 202  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 202 ? 3.523   64.015 54.346 1.00 22.50 ? 202  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 202 ? 4.760   63.693 53.494 1.00 25.90 ? 202  GLY A C   1 
ATOM   1561 O O   . GLY A 1 202 ? 4.664   63.498 52.240 1.00 25.11 ? 202  GLY A O   1 
ATOM   1562 N N   . GLY A 1 203 ? 5.932   63.653 54.157 1.00 24.90 ? 203  GLY A N   1 
ATOM   1563 C CA  . GLY A 1 203 ? 7.148   63.297 53.452 1.00 25.34 ? 203  GLY A CA  1 
ATOM   1564 C C   . GLY A 1 203 ? 7.067   61.786 53.173 1.00 25.50 ? 203  GLY A C   1 
ATOM   1565 O O   . GLY A 1 203 ? 7.423   61.313 52.093 1.00 27.17 ? 203  GLY A O   1 
ATOM   1566 N N   . ALA A 1 204 ? 6.601   61.008 54.144 1.00 27.23 ? 204  ALA A N   1 
ATOM   1567 C CA  . ALA A 1 204 ? 6.446   59.541 53.926 1.00 28.23 ? 204  ALA A CA  1 
ATOM   1568 C C   . ALA A 1 204 ? 5.425   59.318 52.743 1.00 27.40 ? 204  ALA A C   1 
ATOM   1569 O O   . ALA A 1 204 ? 5.663   58.489 51.849 1.00 26.86 ? 204  ALA A O   1 
ATOM   1570 C CB  . ALA A 1 204 ? 5.886   58.841 55.230 1.00 25.88 ? 204  ALA A CB  1 
ATOM   1571 N N   . SER A 1 205 ? 4.295   60.033 52.799 1.00 25.79 ? 205  SER A N   1 
ATOM   1572 C CA  . SER A 1 205 ? 3.246   59.940 51.759 1.00 26.42 ? 205  SER A CA  1 
ATOM   1573 C C   . SER A 1 205 ? 3.847   60.245 50.382 1.00 26.32 ? 205  SER A C   1 
ATOM   1574 O O   . SER A 1 205 ? 3.566   59.519 49.420 1.00 26.27 ? 205  SER A O   1 
ATOM   1575 C CB  . SER A 1 205 ? 2.092   60.951 52.000 1.00 23.46 ? 205  SER A CB  1 
ATOM   1576 O OG  . SER A 1 205 ? 1.395   60.706 53.214 1.00 25.23 ? 205  SER A OG  1 
ATOM   1577 N N   . VAL A 1 206 ? 4.653   61.326 50.288 1.00 24.93 ? 206  VAL A N   1 
ATOM   1578 C CA  . VAL A 1 206 ? 5.280   61.661 49.018 1.00 24.20 ? 206  VAL A CA  1 
ATOM   1579 C C   . VAL A 1 206 ? 6.048   60.447 48.492 1.00 25.55 ? 206  VAL A C   1 
ATOM   1580 O O   . VAL A 1 206 ? 5.914   60.094 47.324 1.00 27.11 ? 206  VAL A O   1 
ATOM   1581 C CB  . VAL A 1 206 ? 6.269   62.906 49.131 1.00 24.55 ? 206  VAL A CB  1 
ATOM   1582 C CG1 . VAL A 1 206 ? 7.147   63.021 47.840 1.00 22.36 ? 206  VAL A CG1 1 
ATOM   1583 C CG2 . VAL A 1 206 ? 5.462   64.233 49.293 1.00 24.12 ? 206  VAL A CG2 1 
ATOM   1584 N N   . GLY A 1 207 ? 6.841   59.806 49.352 1.00 25.79 ? 207  GLY A N   1 
ATOM   1585 C CA  . GLY A 1 207 ? 7.614   58.642 48.946 1.00 23.97 ? 207  GLY A CA  1 
ATOM   1586 C C   . GLY A 1 207 ? 6.720   57.464 48.588 1.00 26.19 ? 207  GLY A C   1 
ATOM   1587 O O   . GLY A 1 207 ? 7.058   56.624 47.722 1.00 26.24 ? 207  GLY A O   1 
ATOM   1588 N N   . MET A 1 208 ? 5.535   57.431 49.200 1.00 26.23 ? 208  MET A N   1 
ATOM   1589 C CA  . MET A 1 208 ? 4.580   56.361 48.923 1.00 25.54 ? 208  MET A CA  1 
ATOM   1590 C C   . MET A 1 208 ? 3.959   56.513 47.521 1.00 26.39 ? 208  MET A C   1 
ATOM   1591 O O   . MET A 1 208 ? 3.670   55.521 46.864 1.00 27.17 ? 208  MET A O   1 
ATOM   1592 C CB  . MET A 1 208 ? 3.503   56.300 50.031 1.00 23.44 ? 208  MET A CB  1 
ATOM   1593 C CG  . MET A 1 208 ? 4.062   55.632 51.328 1.00 25.38 ? 208  MET A CG  1 
ATOM   1594 S SD  . MET A 1 208 ? 2.983   55.835 52.772 1.00 27.01 ? 208  MET A SD  1 
ATOM   1595 C CE  . MET A 1 208 ? 3.937   54.802 53.978 1.00 25.31 ? 208  MET A CE  1 
ATOM   1596 N N   . HIS A 1 209 ? 3.751   57.739 47.066 1.00 25.26 ? 209  HIS A N   1 
ATOM   1597 C CA  . HIS A 1 209 ? 3.188   57.941 45.714 1.00 25.43 ? 209  HIS A CA  1 
ATOM   1598 C C   . HIS A 1 209 ? 4.306   57.715 44.696 1.00 26.06 ? 209  HIS A C   1 
ATOM   1599 O O   . HIS A 1 209 ? 4.034   57.377 43.535 1.00 25.16 ? 209  HIS A O   1 
ATOM   1600 C CB  . HIS A 1 209 ? 2.651   59.375 45.579 1.00 25.13 ? 209  HIS A CB  1 
ATOM   1601 C CG  . HIS A 1 209 ? 1.459   59.620 46.444 1.00 27.38 ? 209  HIS A CG  1 
ATOM   1602 N ND1 . HIS A 1 209 ? 0.277   58.915 46.290 1.00 26.35 ? 209  HIS A ND1 1 
ATOM   1603 C CD2 . HIS A 1 209 ? 1.262   60.482 47.478 1.00 26.64 ? 209  HIS A CD2 1 
ATOM   1604 C CE1 . HIS A 1 209 ? -0.600  59.337 47.187 1.00 26.98 ? 209  HIS A CE1 1 
ATOM   1605 N NE2 . HIS A 1 209 ? -0.026  60.289 47.922 1.00 27.82 ? 209  HIS A NE2 1 
ATOM   1606 N N   . ILE A 1 210 ? 5.565   57.933 45.119 1.00 26.89 ? 210  ILE A N   1 
ATOM   1607 C CA  . ILE A 1 210 ? 6.691   57.656 44.238 1.00 25.92 ? 210  ILE A CA  1 
ATOM   1608 C C   . ILE A 1 210 ? 6.738   56.116 44.027 1.00 28.75 ? 210  ILE A C   1 
ATOM   1609 O O   . ILE A 1 210 ? 7.036   55.631 42.911 1.00 30.23 ? 210  ILE A O   1 
ATOM   1610 C CB  . ILE A 1 210 ? 8.006   58.131 44.853 1.00 26.59 ? 210  ILE A CB  1 
ATOM   1611 C CG1 . ILE A 1 210 ? 8.157   59.632 44.682 1.00 23.90 ? 210  ILE A CG1 1 
ATOM   1612 C CG2 . ILE A 1 210 ? 9.232   57.441 44.163 1.00 24.97 ? 210  ILE A CG2 1 
ATOM   1613 C CD1 . ILE A 1 210 ? 9.306   60.055 45.464 1.00 25.05 ? 210  ILE A CD1 1 
ATOM   1614 N N   . LEU A 1 211 ? 6.426   55.350 45.080 1.00 27.38 ? 211  LEU A N   1 
ATOM   1615 C CA  . LEU A 1 211 ? 6.448   53.885 44.983 1.00 28.13 ? 211  LEU A CA  1 
ATOM   1616 C C   . LEU A 1 211 ? 5.215   53.282 44.308 1.00 27.92 ? 211  LEU A C   1 
ATOM   1617 O O   . LEU A 1 211 ? 5.328   52.394 43.463 1.00 28.32 ? 211  LEU A O   1 
ATOM   1618 C CB  . LEU A 1 211 ? 6.536   53.253 46.368 1.00 25.87 ? 211  LEU A CB  1 
ATOM   1619 C CG  . LEU A 1 211 ? 7.906   53.372 47.039 1.00 31.15 ? 211  LEU A CG  1 
ATOM   1620 C CD1 . LEU A 1 211 ? 7.699   53.350 48.560 1.00 31.25 ? 211  LEU A CD1 1 
ATOM   1621 C CD2 . LEU A 1 211 ? 8.781   52.207 46.633 1.00 32.92 ? 211  LEU A CD2 1 
ATOM   1622 N N   . SER A 1 212 ? 4.044   53.769 44.686 1.00 27.87 ? 212  SER A N   1 
ATOM   1623 C CA  . SER A 1 212 ? 2.790   53.186 44.191 1.00 29.76 ? 212  SER A CA  1 
ATOM   1624 C C   . SER A 1 212 ? 2.516   53.418 42.708 1.00 29.37 ? 212  SER A C   1 
ATOM   1625 O O   . SER A 1 212 ? 2.394   54.567 42.248 1.00 27.49 ? 212  SER A O   1 
ATOM   1626 C CB  . SER A 1 212 ? 1.620   53.706 45.015 1.00 31.15 ? 212  SER A CB  1 
ATOM   1627 O OG  . SER A 1 212 ? 0.432   53.054 44.628 1.00 33.15 ? 212  SER A OG  1 
ATOM   1628 N N   . PRO A 1 213 ? 2.451   52.330 41.943 1.00 29.26 ? 213  PRO A N   1 
ATOM   1629 C CA  . PRO A 1 213 ? 2.197   52.381 40.495 1.00 30.11 ? 213  PRO A CA  1 
ATOM   1630 C C   . PRO A 1 213 ? 1.031   53.267 40.139 1.00 30.05 ? 213  PRO A C   1 
ATOM   1631 O O   . PRO A 1 213 ? 1.086   53.991 39.148 1.00 29.85 ? 213  PRO A O   1 
ATOM   1632 C CB  . PRO A 1 213 ? 1.896   50.923 40.121 1.00 31.18 ? 213  PRO A CB  1 
ATOM   1633 C CG  . PRO A 1 213 ? 2.847   50.159 41.097 1.00 33.64 ? 213  PRO A CG  1 
ATOM   1634 C CD  . PRO A 1 213 ? 2.604   50.942 42.429 1.00 30.10 ? 213  PRO A CD  1 
ATOM   1635 N N   . GLY A 1 214 ? -0.030  53.192 40.949 1.00 30.35 ? 214  GLY A N   1 
ATOM   1636 C CA  . GLY A 1 214 ? -1.220  53.969 40.665 1.00 31.29 ? 214  GLY A CA  1 
ATOM   1637 C C   . GLY A 1 214 ? -1.106  55.457 40.930 1.00 31.63 ? 214  GLY A C   1 
ATOM   1638 O O   . GLY A 1 214 ? -2.023  56.231 40.623 1.00 31.82 ? 214  GLY A O   1 
ATOM   1639 N N   . SER A 1 215 ? 0.015   55.903 41.473 1.00 29.89 ? 215  SER A N   1 
ATOM   1640 C CA  . SER A 1 215 ? 0.104   57.332 41.731 1.00 29.47 ? 215  SER A CA  1 
ATOM   1641 C C   . SER A 1 215 ? 1.167   57.996 40.887 1.00 29.79 ? 215  SER A C   1 
ATOM   1642 O O   . SER A 1 215 ? 1.111   59.228 40.675 1.00 28.78 ? 215  SER A O   1 
ATOM   1643 C CB  . SER A 1 215 ? 0.462   57.617 43.223 1.00 27.74 ? 215  SER A CB  1 
ATOM   1644 O OG  . SER A 1 215 ? -0.618  57.357 44.110 1.00 31.74 ? 215  SER A OG  1 
ATOM   1645 N N   . ARG A 1 216 ? 2.146   57.193 40.453 1.00 28.63 ? 216  ARG A N   1 
ATOM   1646 C CA  . ARG A 1 216 ? 3.317   57.705 39.747 1.00 29.85 ? 216  ARG A CA  1 
ATOM   1647 C C   . ARG A 1 216 ? 3.124   58.687 38.634 1.00 30.03 ? 216  ARG A C   1 
ATOM   1648 O O   . ARG A 1 216 ? 3.896   59.643 38.518 1.00 30.62 ? 216  ARG A O   1 
ATOM   1649 C CB  . ARG A 1 216 ? 4.161   56.569 39.157 1.00 29.13 ? 216  ARG A CB  1 
ATOM   1650 C CG  . ARG A 1 216 ? 4.704   55.633 40.193 1.00 32.52 ? 216  ARG A CG  1 
ATOM   1651 C CD  . ARG A 1 216 ? 5.522   54.485 39.510 1.00 29.75 ? 216  ARG A CD  1 
ATOM   1652 N NE  . ARG A 1 216 ? 5.760   53.411 40.449 1.00 28.84 ? 216  ARG A NE  1 
ATOM   1653 C CZ  . ARG A 1 216 ? 6.319   52.247 40.112 1.00 30.79 ? 216  ARG A CZ  1 
ATOM   1654 N NH1 . ARG A 1 216 ? 6.496   51.314 41.049 1.00 27.97 ? 216  ARG A NH1 1 
ATOM   1655 N NH2 . ARG A 1 216 ? 6.688   52.020 38.832 1.00 24.81 ? 216  ARG A NH2 1 
ATOM   1656 N N   . ASP A 1 217 ? 2.115   58.449 37.805 1.00 29.19 ? 217  ASP A N   1 
ATOM   1657 C CA  . ASP A 1 217 ? 1.918   59.298 36.634 1.00 29.84 ? 217  ASP A CA  1 
ATOM   1658 C C   . ASP A 1 217 ? 1.220   60.633 36.946 1.00 30.64 ? 217  ASP A C   1 
ATOM   1659 O O   . ASP A 1 217 ? 1.085   61.461 36.047 1.00 31.58 ? 217  ASP A O   1 
ATOM   1660 C CB  . ASP A 1 217 ? 1.098   58.529 35.552 1.00 28.54 ? 217  ASP A CB  1 
ATOM   1661 C CG  . ASP A 1 217 ? 1.732   57.156 35.168 1.00 31.49 ? 217  ASP A CG  1 
ATOM   1662 O OD1 . ASP A 1 217 ? 2.812   56.785 35.692 1.00 31.88 ? 217  ASP A OD1 1 
ATOM   1663 O OD2 . ASP A 1 217 ? 1.150   56.437 34.335 1.00 30.95 ? 217  ASP A OD2 1 
ATOM   1664 N N   . LEU A 1 218 ? 0.768   60.843 38.189 1.00 29.57 ? 218  LEU A N   1 
ATOM   1665 C CA  . LEU A 1 218 ? 0.044   62.073 38.484 1.00 30.46 ? 218  LEU A CA  1 
ATOM   1666 C C   . LEU A 1 218 ? 0.918   63.272 38.815 1.00 31.34 ? 218  LEU A C   1 
ATOM   1667 O O   . LEU A 1 218 ? 0.389   64.353 39.060 1.00 34.74 ? 218  LEU A O   1 
ATOM   1668 C CB  . LEU A 1 218 ? -0.946  61.852 39.644 1.00 29.90 ? 218  LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 218 ? -1.943  60.740 39.299 1.00 33.32 ? 218  LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 218 ? -2.845  60.450 40.464 1.00 32.39 ? 218  LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 218 ? -2.771  61.136 38.052 1.00 33.70 ? 218  LEU A CD2 1 
ATOM   1672 N N   . PHE A 1 219 ? 2.240   63.115 38.830 1.00 29.11 ? 219  PHE A N   1 
ATOM   1673 C CA  . PHE A 1 219 ? 3.102   64.240 39.197 1.00 26.87 ? 219  PHE A CA  1 
ATOM   1674 C C   . PHE A 1 219 ? 4.470   64.045 38.564 1.00 26.98 ? 219  PHE A C   1 
ATOM   1675 O O   . PHE A 1 219 ? 4.831   62.941 38.108 1.00 24.89 ? 219  PHE A O   1 
ATOM   1676 C CB  . PHE A 1 219 ? 3.226   64.353 40.750 1.00 27.41 ? 219  PHE A CB  1 
ATOM   1677 C CG  . PHE A 1 219 ? 3.914   63.167 41.403 1.00 26.79 ? 219  PHE A CG  1 
ATOM   1678 C CD1 . PHE A 1 219 ? 3.201   61.985 41.686 1.00 24.18 ? 219  PHE A CD1 1 
ATOM   1679 C CD2 . PHE A 1 219 ? 5.294   63.205 41.669 1.00 25.10 ? 219  PHE A CD2 1 
ATOM   1680 C CE1 . PHE A 1 219 ? 3.867   60.834 42.237 1.00 26.24 ? 219  PHE A CE1 1 
ATOM   1681 C CE2 . PHE A 1 219 ? 5.974   62.088 42.218 1.00 24.82 ? 219  PHE A CE2 1 
ATOM   1682 C CZ  . PHE A 1 219 ? 5.253   60.883 42.508 1.00 24.93 ? 219  PHE A CZ  1 
ATOM   1683 N N   . ARG A 1 220 ? 5.251   65.107 38.591 1.00 25.27 ? 220  ARG A N   1 
ATOM   1684 C CA  . ARG A 1 220 ? 6.554   65.110 37.977 1.00 26.77 ? 220  ARG A CA  1 
ATOM   1685 C C   . ARG A 1 220 ? 7.798   64.828 38.848 1.00 27.83 ? 220  ARG A C   1 
ATOM   1686 O O   . ARG A 1 220 ? 8.628   64.020 38.480 1.00 27.31 ? 220  ARG A O   1 
ATOM   1687 C CB  . ARG A 1 220 ? 6.743   66.495 37.299 1.00 27.70 ? 220  ARG A CB  1 
ATOM   1688 C CG  . ARG A 1 220 ? 8.056   66.719 36.586 1.00 28.73 ? 220  ARG A CG  1 
ATOM   1689 C CD  . ARG A 1 220 ? 8.252   65.774 35.445 1.00 32.46 ? 220  ARG A CD  1 
ATOM   1690 N NE  . ARG A 1 220 ? 9.402   66.159 34.613 1.00 34.95 ? 220  ARG A NE  1 
ATOM   1691 C CZ  . ARG A 1 220 ? 9.345   67.030 33.586 1.00 35.57 ? 220  ARG A CZ  1 
ATOM   1692 N NH1 . ARG A 1 220 ? 8.192   67.638 33.254 1.00 33.60 ? 220  ARG A NH1 1 
ATOM   1693 N NH2 . ARG A 1 220 ? 10.432  67.243 32.841 1.00 31.32 ? 220  ARG A NH2 1 
ATOM   1694 N N   . ARG A 1 221 ? 7.902   65.521 39.971 1.00 27.65 ? 221  ARG A N   1 
ATOM   1695 C CA  . ARG A 1 221 ? 9.069   65.492 40.880 1.00 30.02 ? 221  ARG A CA  1 
ATOM   1696 C C   . ARG A 1 221 ? 8.568   65.531 42.320 1.00 28.01 ? 221  ARG A C   1 
ATOM   1697 O O   . ARG A 1 221 ? 7.357   65.767 42.560 1.00 27.06 ? 221  ARG A O   1 
ATOM   1698 C CB  . ARG A 1 221 ? 9.985   66.724 40.615 1.00 31.52 ? 221  ARG A CB  1 
ATOM   1699 C CG  . ARG A 1 221 ? 10.753  66.500 39.350 1.00 41.16 ? 221  ARG A CG  1 
ATOM   1700 C CD  . ARG A 1 221 ? 11.905  67.478 39.091 1.00 40.25 ? 221  ARG A CD  1 
ATOM   1701 N NE  . ARG A 1 221 ? 11.378  68.666 38.552 1.00 37.75 ? 221  ARG A NE  1 
ATOM   1702 C CZ  . ARG A 1 221 ? 11.320  68.951 37.269 1.00 36.86 ? 221  ARG A CZ  1 
ATOM   1703 N NH1 . ARG A 1 221 ? 11.799  68.123 36.308 1.00 34.85 ? 221  ARG A NH1 1 
ATOM   1704 N NH2 . ARG A 1 221 ? 10.688  70.067 36.959 1.00 32.45 ? 221  ARG A NH2 1 
ATOM   1705 N N   . ALA A 1 222 ? 9.498   65.379 43.267 1.00 27.34 ? 222  ALA A N   1 
ATOM   1706 C CA  . ALA A 1 222 ? 9.129   65.243 44.680 1.00 27.55 ? 222  ALA A CA  1 
ATOM   1707 C C   . ALA A 1 222 ? 10.138  65.767 45.709 1.00 28.26 ? 222  ALA A C   1 
ATOM   1708 O O   . ALA A 1 222 ? 11.364  65.681 45.498 1.00 27.90 ? 222  ALA A O   1 
ATOM   1709 C CB  . ALA A 1 222 ? 8.813   63.718 44.978 1.00 25.16 ? 222  ALA A CB  1 
ATOM   1710 N N   . ILE A 1 223 ? 9.592   66.313 46.811 1.00 26.53 ? 223  ILE A N   1 
ATOM   1711 C CA  . ILE A 1 223 ? 10.369  66.837 47.908 1.00 26.11 ? 223  ILE A CA  1 
ATOM   1712 C C   . ILE A 1 223 ? 9.878   66.137 49.190 1.00 26.89 ? 223  ILE A C   1 
ATOM   1713 O O   . ILE A 1 223 ? 8.671   66.111 49.453 1.00 26.43 ? 223  ILE A O   1 
ATOM   1714 C CB  . ILE A 1 223 ? 10.135  68.350 48.042 1.00 26.29 ? 223  ILE A CB  1 
ATOM   1715 C CG1 . ILE A 1 223 ? 10.637  69.055 46.783 1.00 25.51 ? 223  ILE A CG1 1 
ATOM   1716 C CG2 . ILE A 1 223 ? 10.853  68.907 49.321 1.00 23.54 ? 223  ILE A CG2 1 
ATOM   1717 C CD1 . ILE A 1 223 ? 10.367  70.603 46.796 1.00 23.08 ? 223  ILE A CD1 1 
ATOM   1718 N N   . LEU A 1 224 ? 10.800  65.554 49.951 1.00 25.27 ? 224  LEU A N   1 
ATOM   1719 C CA  . LEU A 1 224 ? 10.479  64.852 51.188 1.00 26.07 ? 224  LEU A CA  1 
ATOM   1720 C C   . LEU A 1 224 ? 11.234  65.532 52.324 1.00 26.30 ? 224  LEU A C   1 
ATOM   1721 O O   . LEU A 1 224 ? 12.451  65.634 52.301 1.00 27.37 ? 224  LEU A O   1 
ATOM   1722 C CB  . LEU A 1 224 ? 10.884  63.367 51.113 1.00 25.30 ? 224  LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 224 ? 10.222  62.431 50.039 1.00 24.90 ? 224  LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 224 ? 10.796  62.645 48.647 1.00 21.43 ? 224  LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 224 ? 10.477  60.971 50.469 1.00 23.99 ? 224  LEU A CD2 1 
ATOM   1726 N N   . GLN A 1 225 ? 10.490  66.019 53.303 1.00 27.59 ? 225  GLN A N   1 
ATOM   1727 C CA  . GLN A 1 225 ? 11.070  66.729 54.455 1.00 27.36 ? 225  GLN A CA  1 
ATOM   1728 C C   . GLN A 1 225 ? 10.868  65.886 55.742 1.00 27.47 ? 225  GLN A C   1 
ATOM   1729 O O   . GLN A 1 225 ? 9.735   65.629 56.160 1.00 26.68 ? 225  GLN A O   1 
ATOM   1730 C CB  . GLN A 1 225 ? 10.398  68.117 54.590 1.00 24.97 ? 225  GLN A CB  1 
ATOM   1731 C CG  . GLN A 1 225 ? 10.642  69.031 53.358 1.00 25.84 ? 225  GLN A CG  1 
ATOM   1732 C CD  . GLN A 1 225 ? 9.720   70.271 53.307 1.00 27.25 ? 225  GLN A CD  1 
ATOM   1733 O OE1 . GLN A 1 225 ? 9.341   70.696 52.234 1.00 26.75 ? 225  GLN A OE1 1 
ATOM   1734 N NE2 . GLN A 1 225 ? 9.371   70.838 54.460 1.00 27.70 ? 225  GLN A NE2 1 
ATOM   1735 N N   . SER A 1 226 ? 11.979  65.377 56.287 1.00 27.72 ? 226  SER A N   1 
ATOM   1736 C CA  . SER A 1 226 ? 11.953  64.612 57.543 1.00 25.90 ? 226  SER A CA  1 
ATOM   1737 C C   . SER A 1 226 ? 10.936  63.483 57.511 1.00 25.40 ? 226  SER A C   1 
ATOM   1738 O O   . SER A 1 226 ? 10.186  63.316 58.464 1.00 24.38 ? 226  SER A O   1 
ATOM   1739 C CB  . SER A 1 226 ? 11.584  65.531 58.731 1.00 25.93 ? 226  SER A CB  1 
ATOM   1740 O OG  . SER A 1 226 ? 12.387  66.713 58.853 1.00 26.34 ? 226  SER A OG  1 
ATOM   1741 N N   . GLY A 1 227 ? 10.875  62.726 56.430 1.00 26.08 ? 227  GLY A N   1 
ATOM   1742 C CA  . GLY A 1 227 ? 9.930   61.622 56.363 1.00 25.14 ? 227  GLY A CA  1 
ATOM   1743 C C   . GLY A 1 227 ? 10.255  60.831 55.118 1.00 27.25 ? 227  GLY A C   1 
ATOM   1744 O O   . GLY A 1 227 ? 10.719  61.405 54.132 1.00 26.47 ? 227  GLY A O   1 
ATOM   1745 N N   . SER A 1 228 ? 10.057  59.518 55.173 1.00 25.35 ? 228  SER A N   1 
ATOM   1746 C CA  . SER A 1 228 ? 10.341  58.702 54.053 1.00 25.85 ? 228  SER A CA  1 
ATOM   1747 C C   . SER A 1 228 ? 9.388   57.497 54.177 1.00 25.53 ? 228  SER A C   1 
ATOM   1748 O O   . SER A 1 228 ? 8.929   57.146 55.254 1.00 24.19 ? 228  SER A O   1 
ATOM   1749 C CB  . SER A 1 228 ? 11.843  58.386 53.908 1.00 25.86 ? 228  SER A CB  1 
ATOM   1750 O OG  . SER A 1 228 ? 12.281  57.540 54.889 1.00 31.38 ? 228  SER A OG  1 
ATOM   1751 N N   . PRO A 1 229 ? 9.057   56.895 53.041 1.00 25.63 ? 229  PRO A N   1 
ATOM   1752 C CA  . PRO A 1 229 ? 8.099   55.782 53.037 1.00 26.06 ? 229  PRO A CA  1 
ATOM   1753 C C   . PRO A 1 229 ? 8.356   54.567 53.871 1.00 26.78 ? 229  PRO A C   1 
ATOM   1754 O O   . PRO A 1 229 ? 7.406   53.952 54.358 1.00 27.14 ? 229  PRO A O   1 
ATOM   1755 C CB  . PRO A 1 229 ? 7.919   55.484 51.529 1.00 24.78 ? 229  PRO A CB  1 
ATOM   1756 C CG  . PRO A 1 229 ? 9.378   55.763 50.969 1.00 26.38 ? 229  PRO A CG  1 
ATOM   1757 C CD  . PRO A 1 229 ? 9.799   57.022 51.762 1.00 23.63 ? 229  PRO A CD  1 
ATOM   1758 N N   . ASN A 1 230 ? 9.641   54.249 54.045 1.00 26.64 ? 230  ASN A N   1 
ATOM   1759 C CA  . ASN A 1 230 ? 10.080  53.111 54.795 1.00 26.44 ? 230  ASN A CA  1 
ATOM   1760 C C   . ASN A 1 230 ? 10.242  53.443 56.282 1.00 27.93 ? 230  ASN A C   1 
ATOM   1761 O O   . ASN A 1 230 ? 10.818  52.613 56.987 1.00 26.93 ? 230  ASN A O   1 
ATOM   1762 C CB  . ASN A 1 230 ? 11.455  52.621 54.244 1.00 27.28 ? 230  ASN A CB  1 
ATOM   1763 C CG  . ASN A 1 230 ? 12.528  53.750 54.249 1.00 29.06 ? 230  ASN A CG  1 
ATOM   1764 O OD1 . ASN A 1 230 ? 12.265  54.860 53.750 1.00 27.51 ? 230  ASN A OD1 1 
ATOM   1765 N ND2 . ASN A 1 230 ? 13.721  53.474 54.789 1.00 24.31 ? 230  ASN A ND2 1 
ATOM   1766 N N   . CYS A 1 231 ? 9.795   54.618 56.767 1.00 25.57 ? 231  CYS A N   1 
ATOM   1767 C CA  . CYS A 1 231 ? 9.983   54.894 58.211 1.00 27.08 ? 231  CYS A CA  1 
ATOM   1768 C C   . CYS A 1 231 ? 9.312   53.772 59.046 1.00 26.71 ? 231  CYS A C   1 
ATOM   1769 O O   . CYS A 1 231 ? 8.286   53.209 58.630 1.00 28.05 ? 231  CYS A O   1 
ATOM   1770 C CB  . CYS A 1 231 ? 9.418   56.277 58.614 1.00 25.89 ? 231  CYS A CB  1 
ATOM   1771 S SG  . CYS A 1 231 ? 10.501  57.667 58.006 1.00 27.94 ? 231  CYS A SG  1 
ATOM   1772 N N   . PRO A 1 232 ? 9.886   53.435 60.207 1.00 25.29 ? 232  PRO A N   1 
ATOM   1773 C CA  . PRO A 1 232 ? 9.291   52.352 61.016 1.00 26.29 ? 232  PRO A CA  1 
ATOM   1774 C C   . PRO A 1 232 ? 7.861   52.569 61.523 1.00 27.09 ? 232  PRO A C   1 
ATOM   1775 O O   . PRO A 1 232 ? 7.172   51.600 61.846 1.00 27.22 ? 232  PRO A O   1 
ATOM   1776 C CB  . PRO A 1 232 ? 10.321  52.152 62.159 1.00 22.83 ? 232  PRO A CB  1 
ATOM   1777 C CG  . PRO A 1 232 ? 10.901  53.562 62.385 1.00 23.89 ? 232  PRO A CG  1 
ATOM   1778 C CD  . PRO A 1 232 ? 11.068  54.042 60.880 1.00 24.42 ? 232  PRO A CD  1 
ATOM   1779 N N   . TRP A 1 233 ? 7.449   53.836 61.650 1.00 25.31 ? 233  TRP A N   1 
ATOM   1780 C CA  . TRP A 1 233 ? 6.109   54.209 62.090 1.00 24.99 ? 233  TRP A CA  1 
ATOM   1781 C C   . TRP A 1 233 ? 5.131   54.458 60.911 1.00 26.79 ? 233  TRP A C   1 
ATOM   1782 O O   . TRP A 1 233 ? 3.952   54.651 61.161 1.00 27.30 ? 233  TRP A O   1 
ATOM   1783 C CB  . TRP A 1 233 ? 6.156   55.541 62.876 1.00 24.78 ? 233  TRP A CB  1 
ATOM   1784 C CG  . TRP A 1 233 ? 7.010   56.617 62.121 1.00 24.11 ? 233  TRP A CG  1 
ATOM   1785 C CD1 . TRP A 1 233 ? 8.349   56.868 62.299 1.00 23.73 ? 233  TRP A CD1 1 
ATOM   1786 C CD2 . TRP A 1 233 ? 6.572   57.507 61.086 1.00 24.35 ? 233  TRP A CD2 1 
ATOM   1787 N NE1 . TRP A 1 233 ? 8.775   57.863 61.433 1.00 24.91 ? 233  TRP A NE1 1 
ATOM   1788 C CE2 . TRP A 1 233 ? 7.712   58.277 60.679 1.00 24.21 ? 233  TRP A CE2 1 
ATOM   1789 C CE3 . TRP A 1 233 ? 5.318   57.751 60.465 1.00 24.92 ? 233  TRP A CE3 1 
ATOM   1790 C CZ2 . TRP A 1 233 ? 7.646   59.265 59.678 1.00 23.16 ? 233  TRP A CZ2 1 
ATOM   1791 C CZ3 . TRP A 1 233 ? 5.238   58.746 59.471 1.00 23.14 ? 233  TRP A CZ3 1 
ATOM   1792 C CH2 . TRP A 1 233 ? 6.405   59.495 59.083 1.00 27.29 ? 233  TRP A CH2 1 
ATOM   1793 N N   . ALA A 1 234 ? 5.620   54.480 59.665 1.00 25.18 ? 234  ALA A N   1 
ATOM   1794 C CA  . ALA A 1 234 ? 4.794   54.815 58.499 1.00 24.13 ? 234  ALA A CA  1 
ATOM   1795 C C   . ALA A 1 234 ? 3.917   53.737 57.887 1.00 24.92 ? 234  ALA A C   1 
ATOM   1796 O O   . ALA A 1 234 ? 3.080   54.050 57.062 1.00 24.15 ? 234  ALA A O   1 
ATOM   1797 C CB  . ALA A 1 234 ? 5.698   55.447 57.358 1.00 21.29 ? 234  ALA A CB  1 
ATOM   1798 N N   . SER A 1 235 ? 4.115   52.467 58.242 1.00 26.91 ? 235  SER A N   1 
ATOM   1799 C CA  . SER A 1 235 ? 3.244   51.435 57.688 1.00 26.94 ? 235  SER A CA  1 
ATOM   1800 C C   . SER A 1 235 ? 3.233   50.210 58.621 1.00 28.83 ? 235  SER A C   1 
ATOM   1801 O O   . SER A 1 235 ? 4.085   50.104 59.509 1.00 28.75 ? 235  SER A O   1 
ATOM   1802 C CB  . SER A 1 235 ? 3.727   51.049 56.278 1.00 25.11 ? 235  SER A CB  1 
ATOM   1803 O OG  . SER A 1 235 ? 4.969   50.362 56.305 1.00 25.76 ? 235  SER A OG  1 
ATOM   1804 N N   . VAL A 1 236 ? 2.246   49.326 58.448 1.00 28.75 ? 236  VAL A N   1 
ATOM   1805 C CA  . VAL A 1 236 ? 2.146   48.074 59.227 1.00 28.84 ? 236  VAL A CA  1 
ATOM   1806 C C   . VAL A 1 236 ? 1.725   46.977 58.243 1.00 30.38 ? 236  VAL A C   1 
ATOM   1807 O O   . VAL A 1 236 ? 1.332   47.279 57.093 1.00 28.91 ? 236  VAL A O   1 
ATOM   1808 C CB  . VAL A 1 236 ? 1.092   48.184 60.357 1.00 29.57 ? 236  VAL A CB  1 
ATOM   1809 C CG1 . VAL A 1 236 ? 1.586   49.191 61.409 1.00 29.62 ? 236  VAL A CG1 1 
ATOM   1810 C CG2 . VAL A 1 236 ? -0.284  48.664 59.785 1.00 28.50 ? 236  VAL A CG2 1 
ATOM   1811 N N   . SER A 1 237 ? 1.818   45.720 58.661 1.00 29.03 ? 237  SER A N   1 
ATOM   1812 C CA  . SER A 1 237 ? 1.421   44.616 57.805 1.00 30.99 ? 237  SER A CA  1 
ATOM   1813 C C   . SER A 1 237 ? -0.110  44.555 57.846 1.00 30.40 ? 237  SER A C   1 
ATOM   1814 O O   . SER A 1 237 ? -0.745  45.195 58.718 1.00 27.63 ? 237  SER A O   1 
ATOM   1815 C CB  . SER A 1 237 ? 1.961   43.275 58.353 1.00 30.94 ? 237  SER A CB  1 
ATOM   1816 O OG  . SER A 1 237 ? 1.370   43.069 59.648 1.00 33.51 ? 237  SER A OG  1 
ATOM   1817 N N   . VAL A 1 238 ? -0.709  43.766 56.941 1.00 30.39 ? 238  VAL A N   1 
ATOM   1818 C CA  . VAL A 1 238 ? -2.173  43.689 56.987 1.00 31.87 ? 238  VAL A CA  1 
ATOM   1819 C C   . VAL A 1 238 ? -2.619  42.953 58.237 1.00 32.03 ? 238  VAL A C   1 
ATOM   1820 O O   . VAL A 1 238 ? -3.697  43.227 58.772 1.00 34.40 ? 238  VAL A O   1 
ATOM   1821 C CB  . VAL A 1 238 ? -2.805  42.987 55.728 1.00 34.65 ? 238  VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 238 ? -2.692  43.864 54.544 1.00 32.92 ? 238  VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 238 ? -2.111  41.695 55.435 1.00 34.04 ? 238  VAL A CG2 1 
ATOM   1824 N N   . ALA A 1 239 ? -1.811  42.019 58.728 1.00 32.44 ? 239  ALA A N   1 
ATOM   1825 C CA  . ALA A 1 239 ? -2.184  41.314 59.974 1.00 31.46 ? 239  ALA A CA  1 
ATOM   1826 C C   . ALA A 1 239 ? -2.192  42.308 61.176 1.00 30.43 ? 239  ALA A C   1 
ATOM   1827 O O   . ALA A 1 239 ? -3.099  42.312 61.983 1.00 31.21 ? 239  ALA A O   1 
ATOM   1828 C CB  . ALA A 1 239 ? -1.208  40.162 60.221 1.00 29.20 ? 239  ALA A CB  1 
ATOM   1829 N N   . GLU A 1 240 ? -1.211  43.189 61.260 1.00 31.06 ? 240  GLU A N   1 
ATOM   1830 C CA  . GLU A 1 240 ? -1.170  44.165 62.375 1.00 30.76 ? 240  GLU A CA  1 
ATOM   1831 C C   . GLU A 1 240 ? -2.303  45.183 62.233 1.00 30.14 ? 240  GLU A C   1 
ATOM   1832 O O   . GLU A 1 240 ? -2.973  45.519 63.205 1.00 30.42 ? 240  GLU A O   1 
ATOM   1833 C CB  . GLU A 1 240 ? 0.204   44.844 62.405 1.00 30.49 ? 240  GLU A CB  1 
ATOM   1834 C CG  . GLU A 1 240 ? 0.389   45.941 63.492 1.00 34.41 ? 240  GLU A CG  1 
ATOM   1835 C CD  . GLU A 1 240 ? 0.076   45.455 64.907 1.00 34.86 ? 240  GLU A CD  1 
ATOM   1836 O OE1 . GLU A 1 240 ? 0.068   44.236 65.122 1.00 36.84 ? 240  GLU A OE1 1 
ATOM   1837 O OE2 . GLU A 1 240 ? -0.187  46.291 65.791 1.00 35.69 ? 240  GLU A OE2 1 
ATOM   1838 N N   . GLY A 1 241 ? -2.514  45.688 61.011 1.00 31.56 ? 241  GLY A N   1 
ATOM   1839 C CA  . GLY A 1 241 ? -3.617  46.608 60.786 1.00 32.00 ? 241  GLY A CA  1 
ATOM   1840 C C   . GLY A 1 241 ? -4.932  45.951 61.227 1.00 32.24 ? 241  GLY A C   1 
ATOM   1841 O O   . GLY A 1 241 ? -5.769  46.562 61.891 1.00 30.93 ? 241  GLY A O   1 
ATOM   1842 N N   . ARG A 1 242 ? -5.099  44.686 60.862 1.00 33.32 ? 242  ARG A N   1 
ATOM   1843 C CA  . ARG A 1 242 ? -6.296  43.947 61.242 1.00 33.74 ? 242  ARG A CA  1 
ATOM   1844 C C   . ARG A 1 242 ? -6.428  43.880 62.781 1.00 33.37 ? 242  ARG A C   1 
ATOM   1845 O O   . ARG A 1 242 ? -7.488  44.206 63.336 1.00 31.89 ? 242  ARG A O   1 
ATOM   1846 C CB  . ARG A 1 242 ? -6.242  42.529 60.621 1.00 33.45 ? 242  ARG A CB  1 
ATOM   1847 C CG  . ARG A 1 242 ? -7.251  41.548 61.198 1.00 35.40 ? 242  ARG A CG  1 
ATOM   1848 C CD  . ARG A 1 242 ? -7.552  40.335 60.203 1.00 35.28 ? 242  ARG A CD  1 
ATOM   1849 N NE  . ARG A 1 242 ? -8.134  40.791 58.921 1.00 36.97 ? 242  ARG A NE  1 
ATOM   1850 C CZ  . ARG A 1 242 ? -9.433  41.012 58.686 1.00 37.36 ? 242  ARG A CZ  1 
ATOM   1851 N NH1 . ARG A 1 242 ? -9.828  41.442 57.480 1.00 35.70 ? 242  ARG A NH1 1 
ATOM   1852 N NH2 . ARG A 1 242 ? -10.345 40.771 59.632 1.00 36.39 ? 242  ARG A NH2 1 
ATOM   1853 N N   A ARG A 1 243 ? -5.368  43.451 63.471 0.80 33.84 ? 243  ARG A N   1 
ATOM   1854 N N   B ARG A 1 243 ? -5.355  43.464 63.450 0.20 33.17 ? 243  ARG A N   1 
ATOM   1855 C CA  A ARG A 1 243 ? -5.427  43.361 64.949 0.80 34.56 ? 243  ARG A CA  1 
ATOM   1856 C CA  B ARG A 1 243 ? -5.358  43.364 64.910 0.20 33.33 ? 243  ARG A CA  1 
ATOM   1857 C C   A ARG A 1 243 ? -5.803  44.715 65.564 0.80 32.84 ? 243  ARG A C   1 
ATOM   1858 C C   B ARG A 1 243 ? -5.743  44.690 65.562 0.20 32.38 ? 243  ARG A C   1 
ATOM   1859 O O   A ARG A 1 243 ? -6.599  44.788 66.514 0.80 31.31 ? 243  ARG A O   1 
ATOM   1860 O O   B ARG A 1 243 ? -6.492  44.715 66.541 0.20 31.98 ? 243  ARG A O   1 
ATOM   1861 C CB  A ARG A 1 243 ? -4.069  42.953 65.561 0.80 37.24 ? 243  ARG A CB  1 
ATOM   1862 C CB  B ARG A 1 243 ? -3.977  42.937 65.434 0.20 34.49 ? 243  ARG A CB  1 
ATOM   1863 C CG  A ARG A 1 243 ? -3.598  41.508 65.312 0.80 41.88 ? 243  ARG A CG  1 
ATOM   1864 C CG  B ARG A 1 243 ? -3.681  41.440 65.340 0.20 36.51 ? 243  ARG A CG  1 
ATOM   1865 C CD  A ARG A 1 243 ? -2.276  41.218 66.121 0.80 43.68 ? 243  ARG A CD  1 
ATOM   1866 C CD  B ARG A 1 243 ? -2.422  41.072 66.147 0.20 37.49 ? 243  ARG A CD  1 
ATOM   1867 N NE  A ARG A 1 243 ? -1.063  41.638 65.377 0.80 45.55 ? 243  ARG A NE  1 
ATOM   1868 N NE  B ARG A 1 243 ? -1.189  41.539 65.507 0.20 38.80 ? 243  ARG A NE  1 
ATOM   1869 C CZ  A ARG A 1 243 ? -0.527  40.921 64.394 0.80 45.77 ? 243  ARG A CZ  1 
ATOM   1870 C CZ  B ARG A 1 243 ? -0.668  40.996 64.412 0.20 39.02 ? 243  ARG A CZ  1 
ATOM   1871 N NH1 A ARG A 1 243 ? -1.106  39.759 64.069 0.80 46.22 ? 243  ARG A NH1 1 
ATOM   1872 N NH1 B ARG A 1 243 ? -1.275  39.962 63.839 0.20 39.32 ? 243  ARG A NH1 1 
ATOM   1873 N NH2 A ARG A 1 243 ? 0.557   41.358 63.729 0.80 44.78 ? 243  ARG A NH2 1 
ATOM   1874 N NH2 B ARG A 1 243 ? 0.454   41.484 63.890 0.20 38.95 ? 243  ARG A NH2 1 
ATOM   1875 N N   . ARG A 1 244 ? -5.236  45.793 65.018 1.00 31.53 ? 244  ARG A N   1 
ATOM   1876 C CA  . ARG A 1 244 ? -5.547  47.107 65.593 1.00 30.52 ? 244  ARG A CA  1 
ATOM   1877 C C   . ARG A 1 244 ? -6.991  47.501 65.398 1.00 28.90 ? 244  ARG A C   1 
ATOM   1878 O O   . ARG A 1 244 ? -7.609  48.079 66.330 1.00 28.92 ? 244  ARG A O   1 
ATOM   1879 C CB  . ARG A 1 244 ? -4.582  48.198 65.086 1.00 29.33 ? 244  ARG A CB  1 
ATOM   1880 C CG  . ARG A 1 244 ? -3.168  48.053 65.599 1.00 27.29 ? 244  ARG A CG  1 
ATOM   1881 C CD  . ARG A 1 244 ? -2.232  49.125 65.029 1.00 28.30 ? 244  ARG A CD  1 
ATOM   1882 N NE  . ARG A 1 244 ? -0.815  48.783 65.227 1.00 28.40 ? 244  ARG A NE  1 
ATOM   1883 C CZ  . ARG A 1 244 ? 0.202   49.620 65.018 1.00 29.23 ? 244  ARG A CZ  1 
ATOM   1884 N NH1 . ARG A 1 244 ? -0.019  50.885 64.605 1.00 24.56 ? 244  ARG A NH1 1 
ATOM   1885 N NH2 . ARG A 1 244 ? 1.454   49.186 65.206 1.00 25.97 ? 244  ARG A NH2 1 
ATOM   1886 N N   . ALA A 1 245 ? -7.550  47.196 64.225 1.00 29.22 ? 245  ALA A N   1 
ATOM   1887 C CA  . ALA A 1 245 ? -8.956  47.540 63.970 1.00 30.70 ? 245  ALA A CA  1 
ATOM   1888 C C   . ALA A 1 245 ? -9.844  46.729 64.940 1.00 32.47 ? 245  ALA A C   1 
ATOM   1889 O O   . ALA A 1 245 ? -10.791 47.275 65.552 1.00 33.11 ? 245  ALA A O   1 
ATOM   1890 C CB  . ALA A 1 245 ? -9.327  47.221 62.498 1.00 32.11 ? 245  ALA A CB  1 
ATOM   1891 N N   . VAL A 1 246 ? -9.507  45.440 65.102 1.00 32.80 ? 246  VAL A N   1 
ATOM   1892 C CA  . VAL A 1 246 ? -10.236 44.572 66.028 1.00 34.35 ? 246  VAL A CA  1 
ATOM   1893 C C   . VAL A 1 246 ? -10.103 45.112 67.471 1.00 35.12 ? 246  VAL A C   1 
ATOM   1894 O O   . VAL A 1 246 ? -11.091 45.181 68.232 1.00 35.52 ? 246  VAL A O   1 
ATOM   1895 C CB  . VAL A 1 246 ? -9.719  43.111 65.970 1.00 35.69 ? 246  VAL A CB  1 
ATOM   1896 C CG1 . VAL A 1 246 ? -10.293 42.314 67.141 1.00 37.04 ? 246  VAL A CG1 1 
ATOM   1897 C CG2 . VAL A 1 246 ? -10.177 42.415 64.605 1.00 34.78 ? 246  VAL A CG2 1 
ATOM   1898 N N   . GLU A 1 247 ? -8.899  45.527 67.848 1.00 33.01 ? 247  GLU A N   1 
ATOM   1899 C CA  . GLU A 1 247 ? -8.744  46.073 69.195 1.00 33.23 ? 247  GLU A CA  1 
ATOM   1900 C C   . GLU A 1 247 ? -9.540  47.397 69.335 1.00 31.59 ? 247  GLU A C   1 
ATOM   1901 O O   . GLU A 1 247 ? -10.121 47.661 70.390 1.00 31.30 ? 247  GLU A O   1 
ATOM   1902 C CB  . GLU A 1 247 ? -7.233  46.264 69.518 1.00 33.94 ? 247  GLU A CB  1 
ATOM   1903 C CG  . GLU A 1 247 ? -6.944  46.707 70.966 1.00 38.45 ? 247  GLU A CG  1 
ATOM   1904 C CD  . GLU A 1 247 ? -7.396  45.656 72.042 1.00 41.73 ? 247  GLU A CD  1 
ATOM   1905 O OE1 . GLU A 1 247 ? -7.394  46.026 73.241 1.00 41.64 ? 247  GLU A OE1 1 
ATOM   1906 O OE2 . GLU A 1 247 ? -7.748  44.485 71.692 1.00 41.37 ? 247  GLU A OE2 1 
ATOM   1907 N N   . LEU A 1 248 ? -9.582  48.223 68.279 1.00 30.57 ? 248  LEU A N   1 
ATOM   1908 C CA  . LEU A 1 248 ? -10.359 49.478 68.372 1.00 32.32 ? 248  LEU A CA  1 
ATOM   1909 C C   . LEU A 1 248 ? -11.816 49.039 68.617 1.00 33.19 ? 248  LEU A C   1 
ATOM   1910 O O   . LEU A 1 248 ? -12.484 49.582 69.487 1.00 32.64 ? 248  LEU A O   1 
ATOM   1911 C CB  . LEU A 1 248 ? -10.309 50.305 67.067 1.00 30.66 ? 248  LEU A CB  1 
ATOM   1912 C CG  . LEU A 1 248 ? -11.055 51.656 67.124 1.00 31.54 ? 248  LEU A CG  1 
ATOM   1913 C CD1 . LEU A 1 248 ? -10.211 52.679 67.994 1.00 31.71 ? 248  LEU A CD1 1 
ATOM   1914 C CD2 . LEU A 1 248 ? -11.223 52.252 65.743 1.00 30.33 ? 248  LEU A CD2 1 
ATOM   1915 N N   . GLY A 1 249 ? -12.285 48.039 67.852 1.00 34.58 ? 249  GLY A N   1 
ATOM   1916 C CA  . GLY A 1 249 ? -13.644 47.545 68.039 1.00 35.13 ? 249  GLY A CA  1 
ATOM   1917 C C   . GLY A 1 249 ? -13.890 47.106 69.478 1.00 36.05 ? 249  GLY A C   1 
ATOM   1918 O O   . GLY A 1 249 ? -14.931 47.398 70.085 1.00 36.61 ? 249  GLY A O   1 
ATOM   1919 N N   . ARG A 1 250 ? -12.913 46.423 70.044 1.00 36.90 ? 250  ARG A N   1 
ATOM   1920 C CA  . ARG A 1 250 ? -13.029 45.942 71.417 1.00 38.40 ? 250  ARG A CA  1 
ATOM   1921 C C   . ARG A 1 250 ? -13.155 47.099 72.443 1.00 38.87 ? 250  ARG A C   1 
ATOM   1922 O O   . ARG A 1 250 ? -13.930 47.022 73.413 1.00 36.99 ? 250  ARG A O   1 
ATOM   1923 C CB  . ARG A 1 250 ? -11.814 45.061 71.691 1.00 41.03 ? 250  ARG A CB  1 
ATOM   1924 C CG  . ARG A 1 250 ? -11.950 44.156 72.887 1.00 44.91 ? 250  ARG A CG  1 
ATOM   1925 C CD  . ARG A 1 250 ? -10.678 43.382 73.036 1.00 47.19 ? 250  ARG A CD  1 
ATOM   1926 N NE  . ARG A 1 250 ? -10.729 42.121 72.307 1.00 51.24 ? 250  ARG A NE  1 
ATOM   1927 C CZ  . ARG A 1 250 ? -9.968  41.759 71.268 1.00 55.30 ? 250  ARG A CZ  1 
ATOM   1928 N NH1 . ARG A 1 250 ? -9.023  42.580 70.734 1.00 56.04 ? 250  ARG A NH1 1 
ATOM   1929 N NH2 . ARG A 1 250 ? -10.123 40.515 70.786 1.00 53.95 ? 250  ARG A NH2 1 
ATOM   1930 N N   . ASN A 1 251 ? -12.424 48.199 72.207 1.00 37.39 ? 251  ASN A N   1 
ATOM   1931 C CA  . ASN A 1 251 ? -12.493 49.368 73.095 1.00 35.40 ? 251  ASN A CA  1 
ATOM   1932 C C   . ASN A 1 251 ? -13.871 50.044 73.021 1.00 34.52 ? 251  ASN A C   1 
ATOM   1933 O O   . ASN A 1 251 ? -14.260 50.748 73.952 1.00 34.84 ? 251  ASN A O   1 
ATOM   1934 C CB  . ASN A 1 251 ? -11.417 50.425 72.700 1.00 34.28 ? 251  ASN A CB  1 
ATOM   1935 C CG  . ASN A 1 251 ? -10.063 50.162 73.346 1.00 32.65 ? 251  ASN A CG  1 
ATOM   1936 O OD1 . ASN A 1 251 ? -9.738  50.778 74.354 1.00 32.23 ? 251  ASN A OD1 1 
ATOM   1937 N ND2 . ASN A 1 251 ? -9.269  49.254 72.766 1.00 31.11 ? 251  ASN A ND2 1 
ATOM   1938 N N   . LEU A 1 252 ? -14.591 49.891 71.908 1.00 34.29 ? 252  LEU A N   1 
ATOM   1939 C CA  . LEU A 1 252 ? -15.915 50.536 71.816 1.00 36.21 ? 252  LEU A CA  1 
ATOM   1940 C C   . LEU A 1 252 ? -17.089 49.517 71.959 1.00 37.80 ? 252  LEU A C   1 
ATOM   1941 O O   . LEU A 1 252 ? -18.211 49.754 71.507 1.00 35.99 ? 252  LEU A O   1 
ATOM   1942 C CB  . LEU A 1 252 ? -16.033 51.312 70.497 1.00 35.00 ? 252  LEU A CB  1 
ATOM   1943 C CG  . LEU A 1 252 ? -14.963 52.426 70.419 1.00 34.90 ? 252  LEU A CG  1 
ATOM   1944 C CD1 . LEU A 1 252 ? -14.898 52.989 68.986 1.00 32.72 ? 252  LEU A CD1 1 
ATOM   1945 C CD2 . LEU A 1 252 ? -15.266 53.543 71.405 1.00 32.15 ? 252  LEU A CD2 1 
ATOM   1946 N N   . ASN A 1 253 ? -16.784 48.367 72.560 1.00 39.85 ? 253  ASN A N   1 
ATOM   1947 C CA  . ASN A 1 253 ? -17.762 47.307 72.805 1.00 43.13 ? 253  ASN A CA  1 
ATOM   1948 C C   . ASN A 1 253 ? -18.522 46.950 71.533 1.00 42.87 ? 253  ASN A C   1 
ATOM   1949 O O   . ASN A 1 253 ? -19.749 47.010 71.485 1.00 44.08 ? 253  ASN A O   1 
ATOM   1950 C CB  . ASN A 1 253 ? -18.702 47.772 73.916 1.00 44.27 ? 253  ASN A CB  1 
ATOM   1951 C CG  . ASN A 1 253 ? -17.920 48.272 75.164 1.00 48.25 ? 253  ASN A CG  1 
ATOM   1952 O OD1 . ASN A 1 253 ? -17.230 47.482 75.847 1.00 49.84 ? 253  ASN A OD1 1 
ATOM   1953 N ND2 . ASN A 1 253 ? -18.007 49.589 75.447 1.00 47.38 ? 253  ASN A ND2 1 
ATOM   1954 N N   . CYS A 1 254 ? -17.773 46.628 70.492 1.00 41.04 ? 254  CYS A N   1 
ATOM   1955 C CA  . CYS A 1 254 ? -18.369 46.252 69.215 1.00 41.71 ? 254  CYS A CA  1 
ATOM   1956 C C   . CYS A 1 254 ? -18.504 44.746 69.118 1.00 40.94 ? 254  CYS A C   1 
ATOM   1957 O O   . CYS A 1 254 ? -17.734 44.014 69.714 1.00 39.36 ? 254  CYS A O   1 
ATOM   1958 C CB  . CYS A 1 254 ? -17.475 46.697 68.039 1.00 40.87 ? 254  CYS A CB  1 
ATOM   1959 S SG  . CYS A 1 254 ? -17.515 48.480 67.668 1.00 41.27 ? 254  CYS A SG  1 
ATOM   1960 N N   . ASN A 1 255 ? -19.478 44.294 68.338 1.00 41.65 ? 255  ASN A N   1 
ATOM   1961 C CA  . ASN A 1 255 ? -19.635 42.870 68.073 1.00 41.99 ? 255  ASN A CA  1 
ATOM   1962 C C   . ASN A 1 255 ? -18.396 42.582 67.209 1.00 41.86 ? 255  ASN A C   1 
ATOM   1963 O O   . ASN A 1 255 ? -18.155 43.298 66.215 1.00 43.12 ? 255  ASN A O   1 
ATOM   1964 C CB  . ASN A 1 255 ? -20.923 42.637 67.257 1.00 43.15 ? 255  ASN A CB  1 
ATOM   1965 C CG  . ASN A 1 255 ? -21.115 41.178 66.875 1.00 43.41 ? 255  ASN A CG  1 
ATOM   1966 O OD1 . ASN A 1 255 ? -20.240 40.551 66.267 1.00 44.50 ? 255  ASN A OD1 1 
ATOM   1967 N ND2 . ASN A 1 255 ? -22.256 40.628 67.242 1.00 43.79 ? 255  ASN A ND2 1 
ATOM   1968 N N   . LEU A 1 256 ? -17.615 41.565 67.561 1.00 41.78 ? 256  LEU A N   1 
ATOM   1969 C CA  . LEU A 1 256 ? -16.400 41.227 66.815 1.00 42.36 ? 256  LEU A CA  1 
ATOM   1970 C C   . LEU A 1 256 ? -16.494 39.959 65.977 1.00 44.86 ? 256  LEU A C   1 
ATOM   1971 O O   . LEU A 1 256 ? -15.461 39.444 65.528 1.00 45.13 ? 256  LEU A O   1 
ATOM   1972 C CB  . LEU A 1 256 ? -15.217 41.075 67.784 1.00 42.13 ? 256  LEU A CB  1 
ATOM   1973 C CG  . LEU A 1 256 ? -15.053 42.247 68.766 1.00 42.47 ? 256  LEU A CG  1 
ATOM   1974 C CD1 . LEU A 1 256 ? -13.826 42.036 69.689 1.00 43.37 ? 256  LEU A CD1 1 
ATOM   1975 C CD2 . LEU A 1 256 ? -14.856 43.544 67.920 1.00 44.51 ? 256  LEU A CD2 1 
ATOM   1976 N N   . ASN A 1 257 ? -17.714 39.479 65.738 1.00 44.86 ? 257  ASN A N   1 
ATOM   1977 C CA  . ASN A 1 257 ? -17.939 38.250 64.980 1.00 46.71 ? 257  ASN A CA  1 
ATOM   1978 C C   . ASN A 1 257 ? -17.507 38.214 63.517 1.00 46.15 ? 257  ASN A C   1 
ATOM   1979 O O   . ASN A 1 257 ? -17.183 37.143 63.000 1.00 46.42 ? 257  ASN A O   1 
ATOM   1980 C CB  . ASN A 1 257 ? -19.422 37.886 65.056 1.00 48.36 ? 257  ASN A CB  1 
ATOM   1981 C CG  . ASN A 1 257 ? -19.823 37.405 66.441 1.00 52.19 ? 257  ASN A CG  1 
ATOM   1982 O OD1 . ASN A 1 257 ? -21.018 37.411 66.799 1.00 54.64 ? 257  ASN A OD1 1 
ATOM   1983 N ND2 . ASN A 1 257 ? -18.829 36.973 67.234 1.00 51.29 ? 257  ASN A ND2 1 
ATOM   1984 N N   . SER A 1 258 ? -17.525 39.359 62.839 1.00 43.89 ? 258  SER A N   1 
ATOM   1985 C CA  . SER A 1 258 ? -17.122 39.406 61.427 1.00 42.00 ? 258  SER A CA  1 
ATOM   1986 C C   . SER A 1 258 ? -16.715 40.826 61.083 1.00 41.07 ? 258  SER A C   1 
ATOM   1987 O O   . SER A 1 258 ? -17.048 41.766 61.832 1.00 40.91 ? 258  SER A O   1 
ATOM   1988 C CB  . SER A 1 258 ? -18.300 39.062 60.522 1.00 41.83 ? 258  SER A CB  1 
ATOM   1989 O OG  . SER A 1 258 ? -19.357 40.000 60.749 1.00 42.49 ? 258  SER A OG  1 
ATOM   1990 N N   . ASP A 1 259 ? -16.039 40.988 59.942 1.00 40.41 ? 259  ASP A N   1 
ATOM   1991 C CA  . ASP A 1 259 ? -15.639 42.321 59.497 1.00 40.91 ? 259  ASP A CA  1 
ATOM   1992 C C   . ASP A 1 259 ? -16.888 43.179 59.423 1.00 40.80 ? 259  ASP A C   1 
ATOM   1993 O O   . ASP A 1 259 ? -16.911 44.261 59.996 1.00 41.07 ? 259  ASP A O   1 
ATOM   1994 C CB  . ASP A 1 259 ? -14.924 42.281 58.136 1.00 40.49 ? 259  ASP A CB  1 
ATOM   1995 C CG  . ASP A 1 259 ? -13.510 41.761 58.270 1.00 43.22 ? 259  ASP A CG  1 
ATOM   1996 O OD1 . ASP A 1 259 ? -13.090 41.534 59.423 1.00 43.84 ? 259  ASP A OD1 1 
ATOM   1997 O OD2 . ASP A 1 259 ? -12.789 41.581 57.263 1.00 45.48 ? 259  ASP A OD2 1 
ATOM   1998 N N   . GLU A 1 260 ? -17.943 42.656 58.786 1.00 40.64 ? 260  GLU A N   1 
ATOM   1999 C CA  . GLU A 1 260 ? -19.201 43.391 58.604 1.00 39.94 ? 260  GLU A CA  1 
ATOM   2000 C C   . GLU A 1 260 ? -19.752 43.906 59.900 1.00 40.18 ? 260  GLU A C   1 
ATOM   2001 O O   . GLU A 1 260 ? -20.150 45.083 59.984 1.00 40.64 ? 260  GLU A O   1 
ATOM   2002 C CB  . GLU A 1 260 ? -20.278 42.528 57.892 1.00 41.21 ? 260  GLU A CB  1 
ATOM   2003 N N   . GLU A 1 261 ? -19.778 43.044 60.909 1.00 38.63 ? 261  GLU A N   1 
ATOM   2004 C CA  . GLU A 1 261 ? -20.272 43.451 62.216 1.00 40.20 ? 261  GLU A CA  1 
ATOM   2005 C C   . GLU A 1 261 ? -19.378 44.553 62.820 1.00 38.55 ? 261  GLU A C   1 
ATOM   2006 O O   . GLU A 1 261 ? -19.904 45.554 63.312 1.00 35.83 ? 261  GLU A O   1 
ATOM   2007 C CB  . GLU A 1 261 ? -20.295 42.262 63.167 1.00 43.34 ? 261  GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 261 ? -21.085 41.097 62.645 1.00 51.45 ? 261  GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 261 ? -22.405 40.976 63.350 1.00 56.27 ? 261  GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 261 ? -23.023 42.039 63.649 1.00 58.08 ? 261  GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 261 ? -22.815 39.810 63.612 1.00 59.82 ? 261  GLU A OE2 1 
ATOM   2012 N N   . LEU A 1 262 ? -18.045 44.356 62.774 1.00 37.67 ? 262  LEU A N   1 
ATOM   2013 C CA  . LEU A 1 262 ? -17.098 45.339 63.317 1.00 37.39 ? 262  LEU A CA  1 
ATOM   2014 C C   . LEU A 1 262 ? -17.273 46.734 62.663 1.00 37.32 ? 262  LEU A C   1 
ATOM   2015 O O   . LEU A 1 262 ? -17.517 47.740 63.348 1.00 36.16 ? 262  LEU A O   1 
ATOM   2016 C CB  . LEU A 1 262 ? -15.661 44.838 63.123 1.00 36.62 ? 262  LEU A CB  1 
ATOM   2017 C CG  . LEU A 1 262 ? -14.501 45.761 63.559 1.00 36.12 ? 262  LEU A CG  1 
ATOM   2018 C CD1 . LEU A 1 262 ? -14.719 46.179 64.999 1.00 33.16 ? 262  LEU A CD1 1 
ATOM   2019 C CD2 . LEU A 1 262 ? -13.135 45.037 63.397 1.00 33.53 ? 262  LEU A CD2 1 
ATOM   2020 N N   . ILE A 1 263 ? -17.230 46.764 61.334 1.00 38.28 ? 263  ILE A N   1 
ATOM   2021 C CA  . ILE A 1 263 ? -17.349 48.006 60.569 1.00 39.03 ? 263  ILE A CA  1 
ATOM   2022 C C   . ILE A 1 263 ? -18.672 48.715 60.818 1.00 41.39 ? 263  ILE A C   1 
ATOM   2023 O O   . ILE A 1 263 ? -18.713 49.930 61.081 1.00 40.27 ? 263  ILE A O   1 
ATOM   2024 C CB  . ILE A 1 263 ? -17.090 47.709 59.056 1.00 39.35 ? 263  ILE A CB  1 
ATOM   2025 C CG1 . ILE A 1 263 ? -15.620 47.330 58.860 1.00 38.82 ? 263  ILE A CG1 1 
ATOM   2026 C CG2 . ILE A 1 263 ? -17.438 48.899 58.181 1.00 39.78 ? 263  ILE A CG2 1 
ATOM   2027 C CD1 . ILE A 1 263 ? -15.310 46.808 57.455 1.00 39.24 ? 263  ILE A CD1 1 
ATOM   2028 N N   . HIS A 1 264 ? -19.771 47.960 60.782 1.00 43.64 ? 264  HIS A N   1 
ATOM   2029 C CA  . HIS A 1 264 ? -21.068 48.572 61.030 1.00 44.97 ? 264  HIS A CA  1 
ATOM   2030 C C   . HIS A 1 264 ? -21.080 49.189 62.432 1.00 43.59 ? 264  HIS A C   1 
ATOM   2031 O O   . HIS A 1 264 ? -21.576 50.309 62.632 1.00 42.62 ? 264  HIS A O   1 
ATOM   2032 C CB  . HIS A 1 264 ? -22.219 47.555 60.896 1.00 49.53 ? 264  HIS A CB  1 
ATOM   2033 C CG  . HIS A 1 264 ? -23.558 48.148 61.204 1.00 52.89 ? 264  HIS A CG  1 
ATOM   2034 N ND1 . HIS A 1 264 ? -24.132 48.083 62.460 1.00 55.36 ? 264  HIS A ND1 1 
ATOM   2035 C CD2 . HIS A 1 264 ? -24.360 48.957 60.468 1.00 55.33 ? 264  HIS A CD2 1 
ATOM   2036 C CE1 . HIS A 1 264 ? -25.221 48.832 62.488 1.00 55.33 ? 264  HIS A CE1 1 
ATOM   2037 N NE2 . HIS A 1 264 ? -25.381 49.375 61.291 1.00 57.01 ? 264  HIS A NE2 1 
ATOM   2038 N N   . CYS A 1 265 ? -20.546 48.466 63.409 1.00 41.70 ? 265  CYS A N   1 
ATOM   2039 C CA  . CYS A 1 265 ? -20.487 49.023 64.756 1.00 39.91 ? 265  CYS A CA  1 
ATOM   2040 C C   . CYS A 1 265 ? -19.689 50.341 64.734 1.00 39.40 ? 265  CYS A C   1 
ATOM   2041 O O   . CYS A 1 265 ? -20.124 51.347 65.277 1.00 38.22 ? 265  CYS A O   1 
ATOM   2042 C CB  . CYS A 1 265 ? -19.780 48.067 65.714 1.00 39.48 ? 265  CYS A CB  1 
ATOM   2043 S SG  . CYS A 1 265 ? -19.503 48.770 67.402 1.00 42.31 ? 265  CYS A SG  1 
ATOM   2044 N N   . LEU A 1 266 ? -18.511 50.306 64.101 1.00 39.24 ? 266  LEU A N   1 
ATOM   2045 C CA  . LEU A 1 266 ? -17.625 51.484 64.038 1.00 38.09 ? 266  LEU A CA  1 
ATOM   2046 C C   . LEU A 1 266 ? -18.229 52.656 63.285 1.00 38.31 ? 266  LEU A C   1 
ATOM   2047 O O   . LEU A 1 266 ? -17.950 53.816 63.590 1.00 39.04 ? 266  LEU A O   1 
ATOM   2048 C CB  . LEU A 1 266 ? -16.269 51.092 63.422 1.00 35.99 ? 266  LEU A CB  1 
ATOM   2049 C CG  . LEU A 1 266 ? -15.379 50.130 64.223 1.00 36.39 ? 266  LEU A CG  1 
ATOM   2050 C CD1 . LEU A 1 266 ? -14.093 49.830 63.448 1.00 33.46 ? 266  LEU A CD1 1 
ATOM   2051 C CD2 . LEU A 1 266 ? -15.049 50.744 65.582 1.00 35.54 ? 266  LEU A CD2 1 
ATOM   2052 N N   . ARG A 1 267 ? -19.051 52.361 62.286 1.00 38.58 ? 267  ARG A N   1 
ATOM   2053 C CA  . ARG A 1 267 ? -19.701 53.430 61.542 1.00 38.47 ? 267  ARG A CA  1 
ATOM   2054 C C   . ARG A 1 267 ? -20.794 54.130 62.327 1.00 38.36 ? 267  ARG A C   1 
ATOM   2055 O O   . ARG A 1 267 ? -21.151 55.263 62.000 1.00 38.41 ? 267  ARG A O   1 
ATOM   2056 C CB  . ARG A 1 267 ? -20.283 52.893 60.230 1.00 37.73 ? 267  ARG A CB  1 
ATOM   2057 C CG  . ARG A 1 267 ? -19.219 52.577 59.247 1.00 36.07 ? 267  ARG A CG  1 
ATOM   2058 C CD  . ARG A 1 267 ? -19.826 52.255 57.924 1.00 38.53 ? 267  ARG A CD  1 
ATOM   2059 N NE  . ARG A 1 267 ? -18.782 52.081 56.942 1.00 37.62 ? 267  ARG A NE  1 
ATOM   2060 C CZ  . ARG A 1 267 ? -18.867 51.274 55.899 1.00 40.15 ? 267  ARG A CZ  1 
ATOM   2061 N NH1 . ARG A 1 267 ? -19.972 50.549 55.699 1.00 38.77 ? 267  ARG A NH1 1 
ATOM   2062 N NH2 . ARG A 1 267 ? -17.829 51.180 55.067 1.00 40.83 ? 267  ARG A NH2 1 
ATOM   2063 N N   . GLU A 1 268 ? -21.334 53.484 63.356 1.00 38.51 ? 268  GLU A N   1 
ATOM   2064 C CA  . GLU A 1 268 ? -22.390 54.153 64.136 1.00 40.78 ? 268  GLU A CA  1 
ATOM   2065 C C   . GLU A 1 268 ? -21.819 55.020 65.258 1.00 41.15 ? 268  GLU A C   1 
ATOM   2066 O O   . GLU A 1 268 ? -22.578 55.708 65.922 1.00 42.02 ? 268  GLU A O   1 
ATOM   2067 C CB  . GLU A 1 268 ? -23.381 53.133 64.763 1.00 39.58 ? 268  GLU A CB  1 
ATOM   2068 N N   . LYS A 1 269 ? -20.505 54.964 65.503 1.00 40.37 ? 269  LYS A N   1 
ATOM   2069 C CA  . LYS A 1 269 ? -19.910 55.787 66.582 1.00 39.16 ? 269  LYS A CA  1 
ATOM   2070 C C   . LYS A 1 269 ? -19.661 57.236 66.155 1.00 37.88 ? 269  LYS A C   1 
ATOM   2071 O O   . LYS A 1 269 ? -19.309 57.492 65.020 1.00 36.68 ? 269  LYS A O   1 
ATOM   2072 C CB  . LYS A 1 269 ? -18.569 55.187 67.025 1.00 38.61 ? 269  LYS A CB  1 
ATOM   2073 C CG  . LYS A 1 269 ? -18.630 53.752 67.519 1.00 41.18 ? 269  LYS A CG  1 
ATOM   2074 C CD  . LYS A 1 269 ? -19.592 53.673 68.726 1.00 42.45 ? 269  LYS A CD  1 
ATOM   2075 C CE  . LYS A 1 269 ? -19.586 52.292 69.371 1.00 44.40 ? 269  LYS A CE  1 
ATOM   2076 N NZ  . LYS A 1 269 ? -20.623 52.323 70.497 1.00 47.64 ? 269  LYS A NZ  1 
ATOM   2077 N N   . LYS A 1 270 ? -19.838 58.185 67.068 1.00 37.55 ? 270  LYS A N   1 
ATOM   2078 C CA  . LYS A 1 270 ? -19.538 59.571 66.715 1.00 36.57 ? 270  LYS A CA  1 
ATOM   2079 C C   . LYS A 1 270 ? -17.986 59.613 66.485 1.00 33.77 ? 270  LYS A C   1 
ATOM   2080 O O   . LYS A 1 270 ? -17.248 58.785 67.038 1.00 32.54 ? 270  LYS A O   1 
ATOM   2081 C CB  . LYS A 1 270 ? -19.922 60.523 67.867 1.00 37.18 ? 270  LYS A CB  1 
ATOM   2082 C CG  . LYS A 1 270 ? -21.434 60.826 68.011 1.00 40.17 ? 270  LYS A CG  1 
ATOM   2083 N N   . PRO A 1 271 ? -17.508 60.536 65.635 1.00 31.66 ? 271  PRO A N   1 
ATOM   2084 C CA  . PRO A 1 271 ? -16.067 60.688 65.338 1.00 31.27 ? 271  PRO A CA  1 
ATOM   2085 C C   . PRO A 1 271 ? -15.233 60.726 66.643 1.00 32.33 ? 271  PRO A C   1 
ATOM   2086 O O   . PRO A 1 271 ? -14.268 59.967 66.817 1.00 31.06 ? 271  PRO A O   1 
ATOM   2087 C CB  . PRO A 1 271 ? -16.001 62.036 64.605 1.00 30.14 ? 271  PRO A CB  1 
ATOM   2088 C CG  . PRO A 1 271 ? -17.368 62.104 63.906 1.00 30.33 ? 271  PRO A CG  1 
ATOM   2089 C CD  . PRO A 1 271 ? -18.319 61.567 64.947 1.00 27.78 ? 271  PRO A CD  1 
ATOM   2090 N N   . GLN A 1 272 ? -15.625 61.598 67.561 1.00 33.13 ? 272  GLN A N   1 
ATOM   2091 C CA  . GLN A 1 272 ? -14.893 61.713 68.843 1.00 34.58 ? 272  GLN A CA  1 
ATOM   2092 C C   . GLN A 1 272 ? -14.722 60.422 69.680 1.00 34.64 ? 272  GLN A C   1 
ATOM   2093 O O   . GLN A 1 272 ? -13.763 60.323 70.458 1.00 34.37 ? 272  GLN A O   1 
ATOM   2094 C CB  . GLN A 1 272 ? -15.520 62.800 69.751 1.00 33.68 ? 272  GLN A CB  1 
ATOM   2095 C CG  . GLN A 1 272 ? -14.535 63.227 70.904 1.00 34.94 ? 272  GLN A CG  1 
ATOM   2096 C CD  . GLN A 1 272 ? -13.158 63.668 70.307 1.00 34.63 ? 272  GLN A CD  1 
ATOM   2097 O OE1 . GLN A 1 272 ? -13.119 64.387 69.299 1.00 34.95 ? 272  GLN A OE1 1 
ATOM   2098 N NE2 . GLN A 1 272 ? -12.064 63.240 70.924 1.00 32.82 ? 272  GLN A NE2 1 
ATOM   2099 N N   . GLU A 1 273 ? -15.644 59.455 69.549 1.00 34.35 ? 273  GLU A N   1 
ATOM   2100 C CA  . GLU A 1 273 ? -15.541 58.179 70.289 1.00 34.75 ? 273  GLU A CA  1 
ATOM   2101 C C   . GLU A 1 273 ? -14.384 57.358 69.730 1.00 33.27 ? 273  GLU A C   1 
ATOM   2102 O O   . GLU A 1 273 ? -13.728 56.628 70.458 1.00 33.48 ? 273  GLU A O   1 
ATOM   2103 C CB  . GLU A 1 273 ? -16.851 57.334 70.180 1.00 36.54 ? 273  GLU A CB  1 
ATOM   2104 C CG  . GLU A 1 273 ? -18.096 58.040 70.784 1.00 40.28 ? 273  GLU A CG  1 
ATOM   2105 C CD  . GLU A 1 273 ? -19.377 57.222 70.555 1.00 43.19 ? 273  GLU A CD  1 
ATOM   2106 O OE1 . GLU A 1 273 ? -19.578 56.222 71.264 1.00 45.07 ? 273  GLU A OE1 1 
ATOM   2107 O OE2 . GLU A 1 273 ? -20.170 57.555 69.647 1.00 44.49 ? 273  GLU A OE2 1 
ATOM   2108 N N   . LEU A 1 274 ? -14.151 57.446 68.420 1.00 32.42 ? 274  LEU A N   1 
ATOM   2109 C CA  . LEU A 1 274 ? -13.038 56.711 67.857 1.00 32.34 ? 274  LEU A CA  1 
ATOM   2110 C C   . LEU A 1 274 ? -11.735 57.406 68.318 1.00 30.98 ? 274  LEU A C   1 
ATOM   2111 O O   . LEU A 1 274 ? -10.788 56.749 68.786 1.00 30.07 ? 274  LEU A O   1 
ATOM   2112 C CB  . LEU A 1 274 ? -13.108 56.670 66.314 1.00 33.53 ? 274  LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 274 ? -13.788 55.443 65.645 1.00 36.42 ? 274  LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 274 ? -15.040 55.072 66.366 1.00 35.74 ? 274  LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 274 ? -14.106 55.743 64.175 1.00 35.85 ? 274  LEU A CD2 1 
ATOM   2116 N N   . ILE A 1 275 ? -11.694 58.723 68.212 1.00 30.24 ? 275  ILE A N   1 
ATOM   2117 C CA  . ILE A 1 275 ? -10.474 59.432 68.586 1.00 29.64 ? 275  ILE A CA  1 
ATOM   2118 C C   . ILE A 1 275 ? -10.158 59.255 70.079 1.00 29.95 ? 275  ILE A C   1 
ATOM   2119 O O   . ILE A 1 275 ? -9.001  59.152 70.444 1.00 27.96 ? 275  ILE A O   1 
ATOM   2120 C CB  . ILE A 1 275 ? -10.621 60.892 68.276 1.00 28.84 ? 275  ILE A CB  1 
ATOM   2121 C CG1 . ILE A 1 275 ? -10.745 61.060 66.766 1.00 30.30 ? 275  ILE A CG1 1 
ATOM   2122 C CG2 . ILE A 1 275 ? -9.445  61.739 68.880 1.00 28.28 ? 275  ILE A CG2 1 
ATOM   2123 C CD1 . ILE A 1 275 ? -11.169 62.494 66.395 1.00 27.79 ? 275  ILE A CD1 1 
ATOM   2124 N N   . ASP A 1 276 ? -11.176 59.215 70.939 1.00 29.95 ? 276  ASP A N   1 
ATOM   2125 C CA  . ASP A 1 276 ? -10.902 59.068 72.374 1.00 30.82 ? 276  ASP A CA  1 
ATOM   2126 C C   . ASP A 1 276 ? -10.158 57.795 72.759 1.00 30.12 ? 276  ASP A C   1 
ATOM   2127 O O   . ASP A 1 276 ? -9.496  57.778 73.792 1.00 30.68 ? 276  ASP A O   1 
ATOM   2128 C CB  . ASP A 1 276 ? -12.220 59.152 73.206 1.00 32.45 ? 276  ASP A CB  1 
ATOM   2129 C CG  . ASP A 1 276 ? -12.694 60.604 73.388 1.00 33.10 ? 276  ASP A CG  1 
ATOM   2130 O OD1 . ASP A 1 276 ? -11.882 61.529 73.179 1.00 34.37 ? 276  ASP A OD1 1 
ATOM   2131 O OD2 . ASP A 1 276 ? -13.858 60.824 73.720 1.00 34.27 ? 276  ASP A OD2 1 
ATOM   2132 N N   . VAL A 1 277 ? -10.239 56.726 71.963 1.00 28.66 ? 277  VAL A N   1 
ATOM   2133 C CA  . VAL A 1 277 ? -9.554  55.461 72.352 1.00 27.03 ? 277  VAL A CA  1 
ATOM   2134 C C   . VAL A 1 277 ? -8.452  55.077 71.358 1.00 27.59 ? 277  VAL A C   1 
ATOM   2135 O O   . VAL A 1 277 ? -7.784  54.023 71.492 1.00 29.15 ? 277  VAL A O   1 
ATOM   2136 C CB  . VAL A 1 277 ? -10.572 54.271 72.403 1.00 26.41 ? 277  VAL A CB  1 
ATOM   2137 C CG1 . VAL A 1 277 ? -11.641 54.516 73.508 1.00 26.07 ? 277  VAL A CG1 1 
ATOM   2138 C CG2 . VAL A 1 277 ? -11.272 54.144 71.080 1.00 25.85 ? 277  VAL A CG2 1 
ATOM   2139 N N   . GLU A 1 278 ? -8.282  55.914 70.336 1.00 27.13 ? 278  GLU A N   1 
ATOM   2140 C CA  . GLU A 1 278 ? -7.306  55.628 69.281 1.00 27.16 ? 278  GLU A CA  1 
ATOM   2141 C C   . GLU A 1 278 ? -5.922  55.153 69.795 1.00 27.38 ? 278  GLU A C   1 
ATOM   2142 O O   . GLU A 1 278 ? -5.320  54.211 69.264 1.00 25.81 ? 278  GLU A O   1 
ATOM   2143 C CB  . GLU A 1 278 ? -7.116  56.914 68.464 1.00 27.47 ? 278  GLU A CB  1 
ATOM   2144 C CG  . GLU A 1 278 ? -6.031  56.868 67.388 1.00 30.05 ? 278  GLU A CG  1 
ATOM   2145 C CD  . GLU A 1 278 ? -5.839  58.238 66.619 1.00 31.31 ? 278  GLU A CD  1 
ATOM   2146 O OE1 . GLU A 1 278 ? -6.808  59.030 66.485 1.00 29.66 ? 278  GLU A OE1 1 
ATOM   2147 O OE2 . GLU A 1 278 ? -4.719  58.482 66.130 1.00 31.29 ? 278  GLU A OE2 1 
ATOM   2148 N N   . TRP A 1 279 ? -5.401  55.838 70.818 1.00 26.76 ? 279  TRP A N   1 
ATOM   2149 C CA  . TRP A 1 279 ? -4.085  55.524 71.334 1.00 27.68 ? 279  TRP A CA  1 
ATOM   2150 C C   . TRP A 1 279 ? -4.059  54.196 72.089 1.00 28.77 ? 279  TRP A C   1 
ATOM   2151 O O   . TRP A 1 279 ? -2.983  53.654 72.295 1.00 28.67 ? 279  TRP A O   1 
ATOM   2152 C CB  . TRP A 1 279 ? -3.583  56.663 72.231 1.00 26.78 ? 279  TRP A CB  1 
ATOM   2153 C CG  . TRP A 1 279 ? -3.370  57.905 71.483 1.00 28.32 ? 279  TRP A CG  1 
ATOM   2154 C CD1 . TRP A 1 279 ? -4.219  58.994 71.419 1.00 29.70 ? 279  TRP A CD1 1 
ATOM   2155 C CD2 . TRP A 1 279 ? -2.262  58.208 70.619 1.00 26.57 ? 279  TRP A CD2 1 
ATOM   2156 N NE1 . TRP A 1 279 ? -3.698  59.941 70.569 1.00 29.24 ? 279  TRP A NE1 1 
ATOM   2157 C CE2 . TRP A 1 279 ? -2.503  59.483 70.063 1.00 29.36 ? 279  TRP A CE2 1 
ATOM   2158 C CE3 . TRP A 1 279 ? -1.104  57.527 70.263 1.00 27.98 ? 279  TRP A CE3 1 
ATOM   2159 C CZ2 . TRP A 1 279 ? -1.608  60.097 69.150 1.00 28.74 ? 279  TRP A CZ2 1 
ATOM   2160 C CZ3 . TRP A 1 279 ? -0.206  58.134 69.344 1.00 29.52 ? 279  TRP A CZ3 1 
ATOM   2161 C CH2 . TRP A 1 279 ? -0.473  59.406 68.802 1.00 28.11 ? 279  TRP A CH2 1 
ATOM   2162 N N   . ASN A 1 280 ? -5.225  53.649 72.457 1.00 28.98 ? 280  ASN A N   1 
ATOM   2163 C CA  . ASN A 1 280 ? -5.245  52.383 73.198 1.00 32.18 ? 280  ASN A CA  1 
ATOM   2164 C C   . ASN A 1 280 ? -4.888  51.164 72.380 1.00 31.90 ? 280  ASN A C   1 
ATOM   2165 O O   . ASN A 1 280 ? -4.646  50.099 72.932 1.00 34.21 ? 280  ASN A O   1 
ATOM   2166 C CB  . ASN A 1 280 ? -6.632  52.133 73.852 1.00 31.58 ? 280  ASN A CB  1 
ATOM   2167 C CG  . ASN A 1 280 ? -7.023  53.237 74.844 1.00 33.40 ? 280  ASN A CG  1 
ATOM   2168 O OD1 . ASN A 1 280 ? -6.161  54.035 75.290 1.00 32.52 ? 280  ASN A OD1 1 
ATOM   2169 N ND2 . ASN A 1 280 ? -8.317  53.296 75.209 1.00 29.75 ? 280  ASN A ND2 1 
ATOM   2170 N N   . VAL A 1 281 ? -4.817  51.281 71.064 1.00 31.68 ? 281  VAL A N   1 
ATOM   2171 C CA  . VAL A 1 281 ? -4.559  50.068 70.280 1.00 30.71 ? 281  VAL A CA  1 
ATOM   2172 C C   . VAL A 1 281 ? -3.118  49.768 69.892 1.00 31.22 ? 281  VAL A C   1 
ATOM   2173 O O   . VAL A 1 281 ? -2.845  48.728 69.226 1.00 29.17 ? 281  VAL A O   1 
ATOM   2174 C CB  . VAL A 1 281 ? -5.457  50.036 68.981 1.00 32.24 ? 281  VAL A CB  1 
ATOM   2175 C CG1 . VAL A 1 281 ? -6.924  50.275 69.386 1.00 31.27 ? 281  VAL A CG1 1 
ATOM   2176 C CG2 . VAL A 1 281 ? -4.991  51.094 67.909 1.00 30.62 ? 281  VAL A CG2 1 
ATOM   2177 N N   . LEU A 1 282 ? -2.199  50.652 70.295 1.00 28.81 ? 282  LEU A N   1 
ATOM   2178 C CA  . LEU A 1 282 ? -0.774  50.448 69.974 1.00 29.61 ? 282  LEU A CA  1 
ATOM   2179 C C   . LEU A 1 282 ? -0.415  49.122 70.592 1.00 30.17 ? 282  LEU A C   1 
ATOM   2180 O O   . LEU A 1 282 ? -0.833  48.832 71.701 1.00 28.71 ? 282  LEU A O   1 
ATOM   2181 C CB  . LEU A 1 282 ? 0.129   51.561 70.581 1.00 27.69 ? 282  LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 282 ? -0.049  52.870 69.735 1.00 28.56 ? 282  LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 282 ? 0.741   53.989 70.355 1.00 27.66 ? 282  LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 282 ? 0.395   52.624 68.264 1.00 26.38 ? 282  LEU A CD2 1 
ATOM   2185 N N   . PRO A 1 283 ? 0.389   48.316 69.907 1.00 30.57 ? 283  PRO A N   1 
ATOM   2186 C CA  . PRO A 1 283 ? 0.682   47.033 70.571 1.00 32.72 ? 283  PRO A CA  1 
ATOM   2187 C C   . PRO A 1 283 ? 1.753   47.149 71.640 1.00 33.71 ? 283  PRO A C   1 
ATOM   2188 O O   . PRO A 1 283 ? 1.863   46.278 72.464 1.00 35.18 ? 283  PRO A O   1 
ATOM   2189 C CB  . PRO A 1 283 ? 1.135   46.112 69.414 1.00 31.55 ? 283  PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 283 ? 1.894   47.131 68.502 1.00 31.51 ? 283  PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 283 ? 0.947   48.383 68.547 1.00 29.33 ? 283  PRO A CD  1 
ATOM   2192 N N   . PHE A 1 284 ? 2.547   48.201 71.635 1.00 32.94 ? 284  PHE A N   1 
ATOM   2193 C CA  . PHE A 1 284 ? 3.576   48.301 72.665 1.00 32.82 ? 284  PHE A CA  1 
ATOM   2194 C C   . PHE A 1 284 ? 3.596   49.670 73.305 1.00 31.36 ? 284  PHE A C   1 
ATOM   2195 O O   . PHE A 1 284 ? 3.127   50.649 72.717 1.00 31.43 ? 284  PHE A O   1 
ATOM   2196 C CB  . PHE A 1 284 ? 4.956   48.108 72.068 1.00 36.76 ? 284  PHE A CB  1 
ATOM   2197 C CG  . PHE A 1 284 ? 5.081   46.915 71.177 1.00 42.91 ? 284  PHE A CG  1 
ATOM   2198 C CD1 . PHE A 1 284 ? 5.093   45.628 71.718 1.00 45.00 ? 284  PHE A CD1 1 
ATOM   2199 C CD2 . PHE A 1 284 ? 5.222   47.085 69.797 1.00 43.69 ? 284  PHE A CD2 1 
ATOM   2200 C CE1 . PHE A 1 284 ? 5.255   44.507 70.890 1.00 48.36 ? 284  PHE A CE1 1 
ATOM   2201 C CE2 . PHE A 1 284 ? 5.380   45.994 68.957 1.00 46.95 ? 284  PHE A CE2 1 
ATOM   2202 C CZ  . PHE A 1 284 ? 5.400   44.688 69.501 1.00 47.54 ? 284  PHE A CZ  1 
ATOM   2203 N N   . ASP A 1 285 ? 4.215   49.733 74.474 1.00 28.95 ? 285  ASP A N   1 
ATOM   2204 C CA  . ASP A 1 285 ? 4.425   50.978 75.209 1.00 27.15 ? 285  ASP A CA  1 
ATOM   2205 C C   . ASP A 1 285 ? 5.458   51.652 74.275 1.00 28.52 ? 285  ASP A C   1 
ATOM   2206 O O   . ASP A 1 285 ? 6.502   51.085 73.996 1.00 28.71 ? 285  ASP A O   1 
ATOM   2207 C CB  . ASP A 1 285 ? 5.078   50.653 76.554 1.00 27.78 ? 285  ASP A CB  1 
ATOM   2208 C CG  . ASP A 1 285 ? 5.168   51.884 77.446 1.00 28.76 ? 285  ASP A CG  1 
ATOM   2209 O OD1 . ASP A 1 285 ? 4.749   52.951 76.947 1.00 26.93 ? 285  ASP A OD1 1 
ATOM   2210 O OD2 . ASP A 1 285 ? 5.632   51.773 78.605 1.00 29.88 ? 285  ASP A OD2 1 
ATOM   2211 N N   . SER A 1 286 ? 5.219   52.858 73.781 1.00 26.85 ? 286  SER A N   1 
ATOM   2212 C CA  . SER A 1 286 ? 6.181   53.325 72.789 1.00 26.89 ? 286  SER A CA  1 
ATOM   2213 C C   . SER A 1 286 ? 6.117   54.807 72.537 1.00 26.93 ? 286  SER A C   1 
ATOM   2214 O O   . SER A 1 286 ? 5.238   55.494 73.004 1.00 26.81 ? 286  SER A O   1 
ATOM   2215 C CB  . SER A 1 286 ? 5.879   52.632 71.431 1.00 28.41 ? 286  SER A CB  1 
ATOM   2216 O OG  . SER A 1 286 ? 4.605   53.097 70.948 1.00 30.26 ? 286  SER A OG  1 
ATOM   2217 N N   . ILE A 1 287 ? 7.045   55.260 71.721 1.00 27.60 ? 287  ILE A N   1 
ATOM   2218 C CA  . ILE A 1 287 ? 7.099   56.641 71.320 1.00 26.77 ? 287  ILE A CA  1 
ATOM   2219 C C   . ILE A 1 287 ? 7.328   56.601 69.817 1.00 26.52 ? 287  ILE A C   1 
ATOM   2220 O O   . ILE A 1 287 ? 7.916   55.647 69.294 1.00 25.07 ? 287  ILE A O   1 
ATOM   2221 C CB  . ILE A 1 287 ? 8.205   57.257 72.198 1.00 29.21 ? 287  ILE A CB  1 
ATOM   2222 C CG1 . ILE A 1 287 ? 7.577   58.346 72.967 1.00 28.12 ? 287  ILE A CG1 1 
ATOM   2223 C CG2 . ILE A 1 287 ? 9.516   57.442 71.579 1.00 24.84 ? 287  ILE A CG2 1 
ATOM   2224 C CD1 . ILE A 1 287 ? 7.595   57.854 74.282 1.00 27.93 ? 287  ILE A CD1 1 
ATOM   2225 N N   . PHE A 1 288 ? 6.851   57.625 69.129 1.00 25.38 ? 288  PHE A N   1 
ATOM   2226 C CA  . PHE A 1 288 ? 6.984   57.730 67.690 1.00 25.58 ? 288  PHE A CA  1 
ATOM   2227 C C   . PHE A 1 288 ? 6.321   56.527 66.969 1.00 26.04 ? 288  PHE A C   1 
ATOM   2228 O O   . PHE A 1 288 ? 6.877   55.966 66.010 1.00 26.22 ? 288  PHE A O   1 
ATOM   2229 C CB  . PHE A 1 288 ? 8.440   57.850 67.252 1.00 23.13 ? 288  PHE A CB  1 
ATOM   2230 C CG  . PHE A 1 288 ? 8.654   58.897 66.159 1.00 25.28 ? 288  PHE A CG  1 
ATOM   2231 C CD1 . PHE A 1 288 ? 7.877   58.874 64.978 1.00 22.70 ? 288  PHE A CD1 1 
ATOM   2232 C CD2 . PHE A 1 288 ? 9.663   59.864 66.273 1.00 25.01 ? 288  PHE A CD2 1 
ATOM   2233 C CE1 . PHE A 1 288 ? 8.090   59.746 63.953 1.00 23.65 ? 288  PHE A CE1 1 
ATOM   2234 C CE2 . PHE A 1 288 ? 9.893   60.763 65.219 1.00 24.84 ? 288  PHE A CE2 1 
ATOM   2235 C CZ  . PHE A 1 288 ? 9.108   60.702 64.058 1.00 24.87 ? 288  PHE A CZ  1 
ATOM   2236 N N   . ARG A 1 289 ? 5.150   56.148 67.455 1.00 25.66 ? 289  ARG A N   1 
ATOM   2237 C CA  . ARG A 1 289 ? 4.337   55.048 66.847 1.00 26.39 ? 289  ARG A CA  1 
ATOM   2238 C C   . ARG A 1 289 ? 2.863   55.567 66.885 1.00 26.39 ? 289  ARG A C   1 
ATOM   2239 O O   . ARG A 1 289 ? 2.390   56.153 67.889 1.00 26.55 ? 289  ARG A O   1 
ATOM   2240 C CB  . ARG A 1 289 ? 4.471   53.733 67.636 1.00 25.10 ? 289  ARG A CB  1 
ATOM   2241 C CG  . ARG A 1 289 ? 5.808   53.054 67.518 1.00 25.24 ? 289  ARG A CG  1 
ATOM   2242 C CD  . ARG A 1 289 ? 6.181   52.715 66.079 1.00 26.43 ? 289  ARG A CD  1 
ATOM   2243 N NE  . ARG A 1 289 ? 7.472   52.017 66.015 1.00 27.28 ? 289  ARG A NE  1 
ATOM   2244 C CZ  . ARG A 1 289 ? 8.678   52.591 65.894 1.00 28.84 ? 289  ARG A CZ  1 
ATOM   2245 N NH1 . ARG A 1 289 ? 8.793   53.915 65.818 1.00 27.10 ? 289  ARG A NH1 1 
ATOM   2246 N NH2 . ARG A 1 289 ? 9.788   51.832 65.818 1.00 25.25 ? 289  ARG A NH2 1 
ATOM   2247 N N   . PHE A 1 290 ? 2.191   55.396 65.754 1.00 26.75 ? 290  PHE A N   1 
ATOM   2248 C CA  . PHE A 1 290 ? 0.832   55.875 65.551 1.00 26.77 ? 290  PHE A CA  1 
ATOM   2249 C C   . PHE A 1 290 ? -0.091  54.681 65.192 1.00 26.43 ? 290  PHE A C   1 
ATOM   2250 O O   . PHE A 1 290 ? 0.288   53.740 64.509 1.00 25.84 ? 290  PHE A O   1 
ATOM   2251 C CB  . PHE A 1 290 ? 0.891   56.972 64.460 1.00 25.79 ? 290  PHE A CB  1 
ATOM   2252 C CG  . PHE A 1 290 ? 2.049   57.962 64.671 1.00 26.27 ? 290  PHE A CG  1 
ATOM   2253 C CD1 . PHE A 1 290 ? 2.135   58.713 65.825 1.00 25.28 ? 290  PHE A CD1 1 
ATOM   2254 C CD2 . PHE A 1 290 ? 3.078   58.052 63.753 1.00 25.85 ? 290  PHE A CD2 1 
ATOM   2255 C CE1 . PHE A 1 290 ? 3.269   59.571 66.080 1.00 26.98 ? 290  PHE A CE1 1 
ATOM   2256 C CE2 . PHE A 1 290 ? 4.201   58.887 63.977 1.00 28.00 ? 290  PHE A CE2 1 
ATOM   2257 C CZ  . PHE A 1 290 ? 4.298   59.649 65.145 1.00 25.15 ? 290  PHE A CZ  1 
ATOM   2258 N N   . SER A 1 291 ? -1.302  54.732 65.695 1.00 26.81 ? 291  SER A N   1 
ATOM   2259 C CA  . SER A 1 291 ? -2.233  53.615 65.532 1.00 27.18 ? 291  SER A CA  1 
ATOM   2260 C C   . SER A 1 291 ? -2.649  53.209 64.132 1.00 26.98 ? 291  SER A C   1 
ATOM   2261 O O   . SER A 1 291 ? -2.437  52.068 63.723 1.00 27.22 ? 291  SER A O   1 
ATOM   2262 C CB  . SER A 1 291 ? -3.484  53.926 66.338 1.00 26.45 ? 291  SER A CB  1 
ATOM   2263 O OG  . SER A 1 291 ? -3.122  53.912 67.690 1.00 28.92 ? 291  SER A OG  1 
ATOM   2264 N N   . PHE A 1 292 ? -3.213  54.164 63.395 1.00 26.28 ? 292  PHE A N   1 
ATOM   2265 C CA  . PHE A 1 292 ? -3.714  53.878 62.049 1.00 25.94 ? 292  PHE A CA  1 
ATOM   2266 C C   . PHE A 1 292 ? -2.876  54.500 60.969 1.00 25.04 ? 292  PHE A C   1 
ATOM   2267 O O   . PHE A 1 292 ? -2.919  55.722 60.735 1.00 24.74 ? 292  PHE A O   1 
ATOM   2268 C CB  . PHE A 1 292 ? -5.170  54.345 61.984 1.00 25.61 ? 292  PHE A CB  1 
ATOM   2269 C CG  . PHE A 1 292 ? -6.016  53.657 62.980 1.00 28.21 ? 292  PHE A CG  1 
ATOM   2270 C CD1 . PHE A 1 292 ? -6.375  52.307 62.783 1.00 28.68 ? 292  PHE A CD1 1 
ATOM   2271 C CD2 . PHE A 1 292 ? -6.350  54.287 64.189 1.00 26.45 ? 292  PHE A CD2 1 
ATOM   2272 C CE1 . PHE A 1 292 ? -7.048  51.574 63.800 1.00 29.90 ? 292  PHE A CE1 1 
ATOM   2273 C CE2 . PHE A 1 292 ? -7.010  53.578 65.210 1.00 29.42 ? 292  PHE A CE2 1 
ATOM   2274 C CZ  . PHE A 1 292 ? -7.356  52.189 65.005 1.00 29.66 ? 292  PHE A CZ  1 
ATOM   2275 N N   . VAL A 1 293 ? -2.135  53.639 60.284 1.00 23.99 ? 293  VAL A N   1 
ATOM   2276 C CA  . VAL A 1 293 ? -1.229  54.074 59.272 1.00 24.41 ? 293  VAL A CA  1 
ATOM   2277 C C   . VAL A 1 293 ? -1.362  53.196 58.010 1.00 26.15 ? 293  VAL A C   1 
ATOM   2278 O O   . VAL A 1 293 ? -2.066  52.167 57.997 1.00 26.41 ? 293  VAL A O   1 
ATOM   2279 C CB  . VAL A 1 293 ? 0.270   53.993 59.782 1.00 24.65 ? 293  VAL A CB  1 
ATOM   2280 C CG1 . VAL A 1 293 ? 0.526   54.967 60.944 1.00 22.67 ? 293  VAL A CG1 1 
ATOM   2281 C CG2 . VAL A 1 293 ? 0.616   52.529 60.194 1.00 22.97 ? 293  VAL A CG2 1 
ATOM   2282 N N   . PRO A 1 294 ? -0.711  53.620 56.922 1.00 25.42 ? 294  PRO A N   1 
ATOM   2283 C CA  . PRO A 1 294 ? -0.777  52.838 55.686 1.00 27.40 ? 294  PRO A CA  1 
ATOM   2284 C C   . PRO A 1 294 ? -0.478  51.326 55.903 1.00 29.99 ? 294  PRO A C   1 
ATOM   2285 O O   . PRO A 1 294 ? 0.297   50.959 56.820 1.00 28.69 ? 294  PRO A O   1 
ATOM   2286 C CB  . PRO A 1 294 ? 0.276   53.542 54.792 1.00 23.90 ? 294  PRO A CB  1 
ATOM   2287 C CG  . PRO A 1 294 ? -0.041  55.033 55.105 1.00 24.42 ? 294  PRO A CG  1 
ATOM   2288 C CD  . PRO A 1 294 ? -0.181  54.981 56.679 1.00 25.23 ? 294  PRO A CD  1 
ATOM   2289 N N   . VAL A 1 295 ? -1.057  50.455 55.061 1.00 30.63 ? 295  VAL A N   1 
ATOM   2290 C CA  . VAL A 1 295 ? -0.792  48.998 55.163 1.00 31.11 ? 295  VAL A CA  1 
ATOM   2291 C C   . VAL A 1 295 ? -0.183  48.493 53.895 1.00 31.70 ? 295  VAL A C   1 
ATOM   2292 O O   . VAL A 1 295 ? -0.542  48.963 52.807 1.00 30.75 ? 295  VAL A O   1 
ATOM   2293 C CB  . VAL A 1 295 ? -2.051  48.105 55.412 1.00 31.54 ? 295  VAL A CB  1 
ATOM   2294 C CG1 . VAL A 1 295 ? -2.445  48.225 56.827 1.00 32.49 ? 295  VAL A CG1 1 
ATOM   2295 C CG2 . VAL A 1 295 ? -3.235  48.494 54.478 1.00 30.05 ? 295  VAL A CG2 1 
ATOM   2296 N N   . ILE A 1 296 ? 0.763   47.557 54.041 1.00 31.89 ? 296  ILE A N   1 
ATOM   2297 C CA  . ILE A 1 296 ? 1.419   46.953 52.898 1.00 32.48 ? 296  ILE A CA  1 
ATOM   2298 C C   . ILE A 1 296 ? 0.361   45.953 52.411 1.00 34.03 ? 296  ILE A C   1 
ATOM   2299 O O   . ILE A 1 296 ? 0.259   44.823 52.894 1.00 34.93 ? 296  ILE A O   1 
ATOM   2300 C CB  . ILE A 1 296 ? 2.749   46.272 53.330 1.00 32.06 ? 296  ILE A CB  1 
ATOM   2301 C CG1 . ILE A 1 296 ? 3.643   47.312 54.027 1.00 31.51 ? 296  ILE A CG1 1 
ATOM   2302 C CG2 . ILE A 1 296 ? 3.465   45.701 52.096 1.00 31.90 ? 296  ILE A CG2 1 
ATOM   2303 C CD1 . ILE A 1 296 ? 3.872   48.589 53.160 1.00 29.58 ? 296  ILE A CD1 1 
ATOM   2304 N N   . ASP A 1 297 ? -0.439  46.378 51.449 1.00 34.36 ? 297  ASP A N   1 
ATOM   2305 C CA  . ASP A 1 297 ? -1.575  45.557 51.041 1.00 35.93 ? 297  ASP A CA  1 
ATOM   2306 C C   . ASP A 1 297 ? -1.538  44.729 49.792 1.00 36.77 ? 297  ASP A C   1 
ATOM   2307 O O   . ASP A 1 297 ? -2.499  44.012 49.543 1.00 38.39 ? 297  ASP A O   1 
ATOM   2308 C CB  . ASP A 1 297 ? -2.807  46.447 50.918 1.00 34.24 ? 297  ASP A CB  1 
ATOM   2309 C CG  . ASP A 1 297 ? -2.602  47.560 49.899 1.00 34.89 ? 297  ASP A CG  1 
ATOM   2310 O OD1 . ASP A 1 297 ? -1.466  47.750 49.442 1.00 35.67 ? 297  ASP A OD1 1 
ATOM   2311 O OD2 . ASP A 1 297 ? -3.557  48.266 49.560 1.00 38.65 ? 297  ASP A OD2 1 
ATOM   2312 N N   . GLY A 1 298 ? -0.497  44.837 48.980 1.00 37.45 ? 298  GLY A N   1 
ATOM   2313 C CA  . GLY A 1 298 ? -0.504  44.081 47.739 1.00 37.75 ? 298  GLY A CA  1 
ATOM   2314 C C   . GLY A 1 298 ? -1.231  44.851 46.630 1.00 39.44 ? 298  GLY A C   1 
ATOM   2315 O O   . GLY A 1 298 ? -1.283  44.375 45.489 1.00 39.92 ? 298  GLY A O   1 
ATOM   2316 N N   . GLU A 1 299 ? -1.794  46.030 46.932 1.00 37.89 ? 299  GLU A N   1 
ATOM   2317 C CA  . GLU A 1 299 ? -2.497  46.829 45.906 1.00 36.15 ? 299  GLU A CA  1 
ATOM   2318 C C   . GLU A 1 299 ? -1.876  48.250 45.797 1.00 33.92 ? 299  GLU A C   1 
ATOM   2319 O O   . GLU A 1 299 ? -1.194  48.552 44.834 1.00 32.84 ? 299  GLU A O   1 
ATOM   2320 C CB  . GLU A 1 299 ? -3.997  46.907 46.234 1.00 40.68 ? 299  GLU A CB  1 
ATOM   2321 C CG  . GLU A 1 299 ? -4.653  45.528 46.310 1.00 47.68 ? 299  GLU A CG  1 
ATOM   2322 C CD  . GLU A 1 299 ? -6.087  45.575 46.821 1.00 53.56 ? 299  GLU A CD  1 
ATOM   2323 O OE2 . GLU A 1 299 ? -6.407  44.808 47.774 1.00 56.95 ? 299  GLU A OE2 1 
ATOM   2324 N N   . PHE A 1 300 ? -2.105  49.121 46.774 1.00 31.57 ? 300  PHE A N   1 
ATOM   2325 C CA  . PHE A 1 300 ? -1.471  50.423 46.716 1.00 30.50 ? 300  PHE A CA  1 
ATOM   2326 C C   . PHE A 1 300 ? 0.061   50.160 46.696 1.00 31.11 ? 300  PHE A C   1 
ATOM   2327 O O   . PHE A 1 300 ? 0.802   50.811 45.965 1.00 29.84 ? 300  PHE A O   1 
ATOM   2328 C CB  . PHE A 1 300 ? -1.913  51.273 47.917 1.00 29.81 ? 300  PHE A CB  1 
ATOM   2329 C CG  . PHE A 1 300 ? -1.489  52.718 47.820 1.00 31.85 ? 300  PHE A CG  1 
ATOM   2330 C CD1 . PHE A 1 300 ? -0.157  53.087 48.050 1.00 31.41 ? 300  PHE A CD1 1 
ATOM   2331 C CD2 . PHE A 1 300 ? -2.413  53.714 47.475 1.00 30.05 ? 300  PHE A CD2 1 
ATOM   2332 C CE1 . PHE A 1 300 ? 0.250   54.469 47.940 1.00 29.79 ? 300  PHE A CE1 1 
ATOM   2333 C CE2 . PHE A 1 300 ? -2.027  55.047 47.361 1.00 30.49 ? 300  PHE A CE2 1 
ATOM   2334 C CZ  . PHE A 1 300 ? -0.674  55.422 47.603 1.00 28.35 ? 300  PHE A CZ  1 
ATOM   2335 N N   . PHE A 1 301 ? 0.535   49.171 47.470 1.00 31.94 ? 301  PHE A N   1 
ATOM   2336 C CA  . PHE A 1 301 ? 1.983   48.806 47.490 1.00 31.09 ? 301  PHE A CA  1 
ATOM   2337 C C   . PHE A 1 301 ? 2.012   47.363 46.940 1.00 32.51 ? 301  PHE A C   1 
ATOM   2338 O O   . PHE A 1 301 ? 1.550   46.444 47.604 1.00 33.98 ? 301  PHE A O   1 
ATOM   2339 C CB  . PHE A 1 301 ? 2.512   48.868 48.940 1.00 29.05 ? 301  PHE A CB  1 
ATOM   2340 C CG  . PHE A 1 301 ? 2.380   50.244 49.570 1.00 29.70 ? 301  PHE A CG  1 
ATOM   2341 C CD1 . PHE A 1 301 ? 3.240   51.293 49.184 1.00 28.80 ? 301  PHE A CD1 1 
ATOM   2342 C CD2 . PHE A 1 301 ? 1.396   50.498 50.540 1.00 27.28 ? 301  PHE A CD2 1 
ATOM   2343 C CE1 . PHE A 1 301 ? 3.117   52.585 49.777 1.00 30.10 ? 301  PHE A CE1 1 
ATOM   2344 C CE2 . PHE A 1 301 ? 1.264   51.778 51.136 1.00 26.76 ? 301  PHE A CE2 1 
ATOM   2345 C CZ  . PHE A 1 301 ? 2.123   52.827 50.764 1.00 25.56 ? 301  PHE A CZ  1 
ATOM   2346 N N   . PRO A 1 302 ? 2.546   47.146 45.735 1.00 33.14 ? 302  PRO A N   1 
ATOM   2347 C CA  . PRO A 1 302 ? 2.508   45.750 45.278 1.00 34.72 ? 302  PRO A CA  1 
ATOM   2348 C C   . PRO A 1 302 ? 3.257   44.702 46.093 1.00 35.45 ? 302  PRO A C   1 
ATOM   2349 O O   . PRO A 1 302 ? 2.812   43.573 46.167 1.00 36.82 ? 302  PRO A O   1 
ATOM   2350 C CB  . PRO A 1 302 ? 2.955   45.839 43.806 1.00 33.94 ? 302  PRO A CB  1 
ATOM   2351 C CG  . PRO A 1 302 ? 3.691   47.219 43.734 1.00 36.41 ? 302  PRO A CG  1 
ATOM   2352 C CD  . PRO A 1 302 ? 2.897   48.072 44.649 1.00 33.45 ? 302  PRO A CD  1 
ATOM   2353 N N   . THR A 1 303 ? 4.391   45.047 46.681 1.00 34.35 ? 303  THR A N   1 
ATOM   2354 C CA  . THR A 1 303 ? 5.104   44.105 47.525 1.00 35.89 ? 303  THR A CA  1 
ATOM   2355 C C   . THR A 1 303 ? 5.719   44.952 48.640 1.00 34.68 ? 303  THR A C   1 
ATOM   2356 O O   . THR A 1 303 ? 5.459   46.172 48.706 1.00 33.27 ? 303  THR A O   1 
ATOM   2357 C CB  . THR A 1 303 ? 6.194   43.386 46.752 1.00 37.49 ? 303  THR A CB  1 
ATOM   2358 O OG1 . THR A 1 303 ? 7.201   44.315 46.341 1.00 40.82 ? 303  THR A OG1 1 
ATOM   2359 C CG2 . THR A 1 303 ? 5.610   42.814 45.500 1.00 42.59 ? 303  THR A CG2 1 
ATOM   2360 N N   . SER A 1 304 ? 6.533   44.318 49.482 1.00 31.70 ? 304  SER A N   1 
ATOM   2361 C CA  . SER A 1 304 ? 7.175   44.981 50.608 1.00 31.41 ? 304  SER A CA  1 
ATOM   2362 C C   . SER A 1 304 ? 7.944   46.212 50.125 1.00 30.45 ? 304  SER A C   1 
ATOM   2363 O O   . SER A 1 304 ? 8.481   46.243 49.015 1.00 30.03 ? 304  SER A O   1 
ATOM   2364 C CB  . SER A 1 304 ? 8.134   44.004 51.302 1.00 30.97 ? 304  SER A CB  1 
ATOM   2365 O OG  . SER A 1 304 ? 9.208   43.723 50.419 1.00 34.18 ? 304  SER A OG  1 
ATOM   2366 N N   . LEU A 1 305 ? 8.004   47.232 50.957 1.00 31.20 ? 305  LEU A N   1 
ATOM   2367 C CA  . LEU A 1 305 ? 8.680   48.433 50.526 1.00 31.20 ? 305  LEU A CA  1 
ATOM   2368 C C   . LEU A 1 305 ? 10.166  48.169 50.185 1.00 31.91 ? 305  LEU A C   1 
ATOM   2369 O O   . LEU A 1 305 ? 10.686  48.715 49.207 1.00 31.86 ? 305  LEU A O   1 
ATOM   2370 C CB  . LEU A 1 305 ? 8.514   49.501 51.601 1.00 30.15 ? 305  LEU A CB  1 
ATOM   2371 C CG  . LEU A 1 305 ? 7.091   49.862 52.085 1.00 29.77 ? 305  LEU A CG  1 
ATOM   2372 C CD1 . LEU A 1 305 ? 7.232   51.025 53.118 1.00 26.94 ? 305  LEU A CD1 1 
ATOM   2373 C CD2 . LEU A 1 305 ? 6.187   50.272 50.919 1.00 30.20 ? 305  LEU A CD2 1 
ATOM   2374 N N   . GLU A 1 306 ? 10.830  47.317 50.969 1.00 32.03 ? 306  GLU A N   1 
ATOM   2375 C CA  . GLU A 1 306 ? 12.237  47.000 50.737 1.00 32.81 ? 306  GLU A CA  1 
ATOM   2376 C C   . GLU A 1 306 ? 12.472  46.297 49.398 1.00 32.98 ? 306  GLU A C   1 
ATOM   2377 O O   . GLU A 1 306 ? 13.427  46.633 48.711 1.00 32.14 ? 306  GLU A O   1 
ATOM   2378 C CB  . GLU A 1 306 ? 12.797  46.126 51.883 1.00 35.09 ? 306  GLU A CB  1 
ATOM   2379 C CG  . GLU A 1 306 ? 14.262  45.786 51.734 1.00 41.49 ? 306  GLU A CG  1 
ATOM   2380 C CD  . GLU A 1 306 ? 15.210  47.025 51.757 1.00 44.92 ? 306  GLU A CD  1 
ATOM   2381 O OE1 . GLU A 1 306 ? 14.790  48.142 52.174 1.00 45.32 ? 306  GLU A OE1 1 
ATOM   2382 O OE2 . GLU A 1 306 ? 16.387  46.861 51.369 1.00 46.23 ? 306  GLU A OE2 1 
ATOM   2383 N N   . SER A 1 307 ? 11.622  45.345 48.984 1.00 32.27 ? 307  SER A N   1 
ATOM   2384 C CA  . SER A 1 307 ? 11.926  44.731 47.676 1.00 34.32 ? 307  SER A CA  1 
ATOM   2385 C C   . SER A 1 307 ? 11.597  45.737 46.565 1.00 32.87 ? 307  SER A C   1 
ATOM   2386 O O   . SER A 1 307 ? 12.247  45.747 45.536 1.00 33.16 ? 307  SER A O   1 
ATOM   2387 C CB  . SER A 1 307 ? 11.161  43.419 47.435 1.00 34.14 ? 307  SER A CB  1 
ATOM   2388 O OG  . SER A 1 307 ? 9.783   43.578 47.695 1.00 40.08 ? 307  SER A OG  1 
ATOM   2389 N N   . MET A 1 308 ? 10.593  46.580 46.776 1.00 31.41 ? 308  MET A N   1 
ATOM   2390 C CA  . MET A 1 308 ? 10.295  47.584 45.758 1.00 31.38 ? 308  MET A CA  1 
ATOM   2391 C C   . MET A 1 308 ? 11.534  48.506 45.658 1.00 31.02 ? 308  MET A C   1 
ATOM   2392 O O   . MET A 1 308 ? 11.992  48.804 44.572 1.00 30.64 ? 308  MET A O   1 
ATOM   2393 C CB  . MET A 1 308 ? 9.036   48.389 46.155 1.00 31.33 ? 308  MET A CB  1 
ATOM   2394 C CG  . MET A 1 308 ? 7.704   47.637 45.915 1.00 28.78 ? 308  MET A CG  1 
ATOM   2395 S SD  . MET A 1 308 ? 6.242   48.686 46.302 1.00 33.45 ? 308  MET A SD  1 
ATOM   2396 C CE  . MET A 1 308 ? 6.392   49.764 44.768 1.00 27.04 ? 308  MET A CE  1 
ATOM   2397 N N   . LEU A 1 309 ? 12.073  48.958 46.784 1.00 31.01 ? 309  LEU A N   1 
ATOM   2398 C CA  . LEU A 1 309 ? 13.256  49.823 46.732 1.00 33.02 ? 309  LEU A CA  1 
ATOM   2399 C C   . LEU A 1 309 ? 14.484  49.153 46.074 1.00 34.78 ? 309  LEU A C   1 
ATOM   2400 O O   . LEU A 1 309 ? 15.243  49.785 45.290 1.00 33.15 ? 309  LEU A O   1 
ATOM   2401 C CB  . LEU A 1 309 ? 13.635  50.295 48.146 1.00 31.54 ? 309  LEU A CB  1 
ATOM   2402 C CG  . LEU A 1 309 ? 12.720  51.374 48.743 1.00 32.30 ? 309  LEU A CG  1 
ATOM   2403 C CD1 . LEU A 1 309 ? 13.106  51.706 50.190 1.00 32.54 ? 309  LEU A CD1 1 
ATOM   2404 C CD2 . LEU A 1 309 ? 12.834  52.635 47.891 1.00 30.44 ? 309  LEU A CD2 1 
ATOM   2405 N N   . ASN A 1 310 ? 14.691  47.883 46.416 1.00 35.86 ? 310  ASN A N   1 
ATOM   2406 C CA  . ASN A 1 310 ? 15.813  47.123 45.900 1.00 37.13 ? 310  ASN A CA  1 
ATOM   2407 C C   . ASN A 1 310 ? 15.752  46.821 44.433 1.00 37.23 ? 310  ASN A C   1 
ATOM   2408 O O   . ASN A 1 310 ? 16.788  46.774 43.791 1.00 35.35 ? 310  ASN A O   1 
ATOM   2409 C CB  . ASN A 1 310 ? 15.954  45.799 46.647 1.00 41.70 ? 310  ASN A CB  1 
ATOM   2410 C CG  . ASN A 1 310 ? 16.659  45.980 47.953 1.00 45.82 ? 310  ASN A CG  1 
ATOM   2411 O OD1 . ASN A 1 310 ? 17.641  46.755 48.045 1.00 48.04 ? 310  ASN A OD1 1 
ATOM   2412 N ND2 . ASN A 1 310 ? 16.199  45.271 48.978 1.00 48.83 ? 310  ASN A ND2 1 
ATOM   2413 N N   . SER A 1 311 ? 14.546  46.606 43.911 1.00 36.21 ? 311  SER A N   1 
ATOM   2414 C CA  . SER A 1 311 ? 14.392  46.295 42.504 1.00 36.86 ? 311  SER A CA  1 
ATOM   2415 C C   . SER A 1 311 ? 14.159  47.512 41.613 1.00 35.97 ? 311  SER A C   1 
ATOM   2416 O O   . SER A 1 311 ? 13.961  47.351 40.420 1.00 37.87 ? 311  SER A O   1 
ATOM   2417 C CB  . SER A 1 311 ? 13.217  45.306 42.302 1.00 37.31 ? 311  SER A CB  1 
ATOM   2418 O OG  . SER A 1 311 ? 11.945  45.947 42.584 1.00 40.29 ? 311  SER A OG  1 
ATOM   2419 N N   . GLY A 1 312 ? 14.170  48.724 42.152 1.00 35.46 ? 312  GLY A N   1 
ATOM   2420 C CA  . GLY A 1 312 ? 13.891  49.868 41.279 1.00 32.99 ? 312  GLY A CA  1 
ATOM   2421 C C   . GLY A 1 312 ? 12.402  49.952 40.905 1.00 31.72 ? 312  GLY A C   1 
ATOM   2422 O O   . GLY A 1 312 ? 12.030  50.612 39.935 1.00 30.99 ? 312  GLY A O   1 
ATOM   2423 N N   . ASN A 1 313 ? 11.532  49.268 41.644 1.00 29.85 ? 313  ASN A N   1 
ATOM   2424 C CA  . ASN A 1 313 ? 10.112  49.353 41.343 1.00 29.86 ? 313  ASN A CA  1 
ATOM   2425 C C   . ASN A 1 313 ? 9.522   50.689 41.893 1.00 30.07 ? 313  ASN A C   1 
ATOM   2426 O O   . ASN A 1 313 ? 8.815   50.711 42.928 1.00 29.55 ? 313  ASN A O   1 
ATOM   2427 C CB  . ASN A 1 313 ? 9.360   48.174 41.955 1.00 28.86 ? 313  ASN A CB  1 
ATOM   2428 C CG  . ASN A 1 313 ? 7.946   48.083 41.433 1.00 34.30 ? 313  ASN A CG  1 
ATOM   2429 O OD1 . ASN A 1 313 ? 7.533   48.927 40.622 1.00 33.65 ? 313  ASN A OD1 1 
ATOM   2430 N ND2 . ASN A 1 313 ? 7.191   47.074 41.870 1.00 32.11 ? 313  ASN A ND2 1 
ATOM   2431 N N   . PHE A 1 314 ? 9.820   51.796 41.213 1.00 30.18 ? 314  PHE A N   1 
ATOM   2432 C CA  . PHE A 1 314 ? 9.339   53.116 41.644 1.00 29.21 ? 314  PHE A CA  1 
ATOM   2433 C C   . PHE A 1 314 ? 9.547   54.179 40.569 1.00 30.31 ? 314  PHE A C   1 
ATOM   2434 O O   . PHE A 1 314 ? 10.336  53.981 39.617 1.00 26.16 ? 314  PHE A O   1 
ATOM   2435 C CB  . PHE A 1 314 ? 10.003  53.556 42.987 1.00 27.69 ? 314  PHE A CB  1 
ATOM   2436 C CG  . PHE A 1 314 ? 11.511  53.455 43.015 1.00 27.31 ? 314  PHE A CG  1 
ATOM   2437 C CD1 . PHE A 1 314 ? 12.312  54.433 42.404 1.00 28.94 ? 314  PHE A CD1 1 
ATOM   2438 C CD2 . PHE A 1 314 ? 12.134  52.399 43.693 1.00 28.01 ? 314  PHE A CD2 1 
ATOM   2439 C CE1 . PHE A 1 314 ? 13.707  54.358 42.483 1.00 27.97 ? 314  PHE A CE1 1 
ATOM   2440 C CE2 . PHE A 1 314 ? 13.535  52.298 43.789 1.00 26.01 ? 314  PHE A CE2 1 
ATOM   2441 C CZ  . PHE A 1 314 ? 14.326  53.273 43.193 1.00 27.59 ? 314  PHE A CZ  1 
ATOM   2442 N N   . LYS A 1 315 ? 8.835   55.304 40.708 1.00 29.42 ? 315  LYS A N   1 
ATOM   2443 C CA  . LYS A 1 315 ? 8.952   56.359 39.714 1.00 29.00 ? 315  LYS A CA  1 
ATOM   2444 C C   . LYS A 1 315 ? 10.383  56.857 39.700 1.00 30.92 ? 315  LYS A C   1 
ATOM   2445 O O   . LYS A 1 315 ? 10.954  57.142 40.746 1.00 29.52 ? 315  LYS A O   1 
ATOM   2446 C CB  . LYS A 1 315 ? 8.024   57.543 40.048 1.00 28.08 ? 315  LYS A CB  1 
ATOM   2447 C CG  . LYS A 1 315 ? 7.954   58.637 38.924 1.00 28.49 ? 315  LYS A CG  1 
ATOM   2448 C CD  . LYS A 1 315 ? 7.186   59.863 39.506 1.00 28.53 ? 315  LYS A CD  1 
ATOM   2449 C CE  . LYS A 1 315 ? 7.047   60.999 38.502 1.00 30.56 ? 315  LYS A CE  1 
ATOM   2450 N NZ  . LYS A 1 315 ? 6.153   60.627 37.361 1.00 24.25 ? 315  LYS A NZ  1 
ATOM   2451 N N   . LYS A 1 316 ? 10.959  56.967 38.514 1.00 30.75 ? 316  LYS A N   1 
ATOM   2452 C CA  . LYS A 1 316 ? 12.312  57.451 38.387 1.00 32.64 ? 316  LYS A CA  1 
ATOM   2453 C C   . LYS A 1 316 ? 12.211  58.946 38.015 1.00 32.08 ? 316  LYS A C   1 
ATOM   2454 O O   . LYS A 1 316 ? 11.641  59.271 36.977 1.00 30.40 ? 316  LYS A O   1 
ATOM   2455 C CB  . LYS A 1 316 ? 13.039  56.672 37.274 1.00 36.72 ? 316  LYS A CB  1 
ATOM   2456 C CG  . LYS A 1 316 ? 13.566  55.271 37.666 1.00 41.01 ? 316  LYS A CG  1 
ATOM   2457 C CD  . LYS A 1 316 ? 12.492  54.332 38.097 1.00 46.27 ? 316  LYS A CD  1 
ATOM   2458 C CE  . LYS A 1 316 ? 12.958  52.838 38.148 1.00 45.39 ? 316  LYS A CE  1 
ATOM   2459 N NZ  . LYS A 1 316 ? 13.141  52.397 36.756 1.00 50.40 ? 316  LYS A NZ  1 
ATOM   2460 N N   . THR A 1 317 ? 12.729  59.850 38.854 1.00 29.60 ? 317  THR A N   1 
ATOM   2461 C CA  . THR A 1 317 ? 12.653  61.291 38.531 1.00 28.96 ? 317  THR A CA  1 
ATOM   2462 C C   . THR A 1 317 ? 13.640  61.971 39.492 1.00 28.43 ? 317  THR A C   1 
ATOM   2463 O O   . THR A 1 317 ? 14.537  61.292 39.985 1.00 28.10 ? 317  THR A O   1 
ATOM   2464 C CB  . THR A 1 317 ? 11.177  61.827 38.708 1.00 28.67 ? 317  THR A CB  1 
ATOM   2465 O OG1 . THR A 1 317 ? 11.142  63.234 38.404 1.00 29.17 ? 317  THR A OG1 1 
ATOM   2466 C CG2 . THR A 1 317 ? 10.653  61.617 40.148 1.00 26.50 ? 317  THR A CG2 1 
ATOM   2467 N N   . GLN A 1 318 ? 13.493  63.269 39.761 1.00 27.98 ? 318  GLN A N   1 
ATOM   2468 C CA  . GLN A 1 318 ? 14.402  63.954 40.683 1.00 28.36 ? 318  GLN A CA  1 
ATOM   2469 C C   . GLN A 1 318 ? 13.723  64.146 42.041 1.00 29.04 ? 318  GLN A C   1 
ATOM   2470 O O   . GLN A 1 318 ? 12.490  64.295 42.142 1.00 28.13 ? 318  GLN A O   1 
ATOM   2471 C CB  . GLN A 1 318 ? 14.878  65.338 40.150 1.00 27.52 ? 318  GLN A CB  1 
ATOM   2472 C CG  . GLN A 1 318 ? 15.503  65.349 38.740 1.00 30.90 ? 318  GLN A CG  1 
ATOM   2473 C CD  . GLN A 1 318 ? 14.414  65.245 37.617 1.00 34.55 ? 318  GLN A CD  1 
ATOM   2474 O OE1 . GLN A 1 318 ? 13.296  65.722 37.805 1.00 34.03 ? 318  GLN A OE1 1 
ATOM   2475 N NE2 . GLN A 1 318 ? 14.753  64.615 36.453 1.00 32.77 ? 318  GLN A NE2 1 
ATOM   2476 N N   . ILE A 1 319 ? 14.517  64.074 43.109 1.00 28.49 ? 319  ILE A N   1 
ATOM   2477 C CA  . ILE A 1 319 ? 13.959  64.300 44.417 1.00 28.00 ? 319  ILE A CA  1 
ATOM   2478 C C   . ILE A 1 319 ? 14.923  65.204 45.171 1.00 28.66 ? 319  ILE A C   1 
ATOM   2479 O O   . ILE A 1 319 ? 16.136  65.196 44.900 1.00 27.15 ? 319  ILE A O   1 
ATOM   2480 C CB  . ILE A 1 319 ? 13.782  62.968 45.216 1.00 28.90 ? 319  ILE A CB  1 
ATOM   2481 C CG1 . ILE A 1 319 ? 15.134  62.235 45.363 1.00 27.83 ? 319  ILE A CG1 1 
ATOM   2482 C CG2 . ILE A 1 319 ? 12.749  62.084 44.536 1.00 27.99 ? 319  ILE A CG2 1 
ATOM   2483 C CD1 . ILE A 1 319 ? 15.075  60.964 46.264 1.00 28.36 ? 319  ILE A CD1 1 
ATOM   2484 N N   . LEU A 1 320 ? 14.350  65.997 46.078 1.00 27.67 ? 320  LEU A N   1 
ATOM   2485 C CA  . LEU A 1 320 ? 15.065  66.893 46.979 1.00 28.02 ? 320  LEU A CA  1 
ATOM   2486 C C   . LEU A 1 320 ? 14.493  66.508 48.370 1.00 28.54 ? 320  LEU A C   1 
ATOM   2487 O O   . LEU A 1 320 ? 13.254  66.467 48.566 1.00 28.82 ? 320  LEU A O   1 
ATOM   2488 C CB  . LEU A 1 320 ? 14.749  68.334 46.630 1.00 28.41 ? 320  LEU A CB  1 
ATOM   2489 C CG  . LEU A 1 320 ? 15.487  69.328 47.507 1.00 28.94 ? 320  LEU A CG  1 
ATOM   2490 C CD1 . LEU A 1 320 ? 15.792  70.580 46.627 1.00 29.01 ? 320  LEU A CD1 1 
ATOM   2491 C CD2 . LEU A 1 320 ? 14.658  69.683 48.723 1.00 28.73 ? 320  LEU A CD2 1 
ATOM   2492 N N   . LEU A 1 321 ? 15.376  66.244 49.329 1.00 26.88 ? 321  LEU A N   1 
ATOM   2493 C CA  . LEU A 1 321 ? 14.934  65.777 50.612 1.00 26.75 ? 321  LEU A CA  1 
ATOM   2494 C C   . LEU A 1 321 ? 15.972  66.024 51.708 1.00 26.67 ? 321  LEU A C   1 
ATOM   2495 O O   . LEU A 1 321 ? 17.136  66.349 51.428 1.00 28.01 ? 321  LEU A O   1 
ATOM   2496 C CB  . LEU A 1 321 ? 14.596  64.293 50.501 1.00 26.83 ? 321  LEU A CB  1 
ATOM   2497 C CG  . LEU A 1 321 ? 15.755  63.260 50.448 1.00 26.73 ? 321  LEU A CG  1 
ATOM   2498 C CD1 . LEU A 1 321 ? 15.112  61.840 50.425 1.00 24.53 ? 321  LEU A CD1 1 
ATOM   2499 C CD2 . LEU A 1 321 ? 16.609  63.437 49.141 1.00 24.62 ? 321  LEU A CD2 1 
ATOM   2500 N N   . GLY A 1 322 ? 15.556  65.865 52.957 1.00 25.63 ? 322  GLY A N   1 
ATOM   2501 C CA  . GLY A 1 322 ? 16.475  66.142 54.043 1.00 24.89 ? 322  GLY A CA  1 
ATOM   2502 C C   . GLY A 1 322 ? 15.820  65.975 55.377 1.00 25.41 ? 322  GLY A C   1 
ATOM   2503 O O   . GLY A 1 322 ? 14.636  65.613 55.462 1.00 23.54 ? 322  GLY A O   1 
ATOM   2504 N N   . VAL A 1 323 ? 16.586  66.286 56.419 1.00 25.28 ? 323  VAL A N   1 
ATOM   2505 C CA  . VAL A 1 323 ? 16.164  66.100 57.784 1.00 25.46 ? 323  VAL A CA  1 
ATOM   2506 C C   . VAL A 1 323 ? 16.596  67.273 58.656 1.00 27.34 ? 323  VAL A C   1 
ATOM   2507 O O   . VAL A 1 323 ? 17.369  68.108 58.208 1.00 27.52 ? 323  VAL A O   1 
ATOM   2508 C CB  . VAL A 1 323 ? 16.814  64.804 58.340 1.00 24.92 ? 323  VAL A CB  1 
ATOM   2509 C CG1 . VAL A 1 323 ? 16.495  63.635 57.417 1.00 24.22 ? 323  VAL A CG1 1 
ATOM   2510 C CG2 . VAL A 1 323 ? 18.350  64.931 58.337 1.00 23.85 ? 323  VAL A CG2 1 
ATOM   2511 N N   . ASN A 1 324 ? 16.087  67.336 59.886 1.00 26.66 ? 324  ASN A N   1 
ATOM   2512 C CA  . ASN A 1 324 ? 16.483  68.401 60.814 1.00 28.49 ? 324  ASN A CA  1 
ATOM   2513 C C   . ASN A 1 324 ? 17.446  67.800 61.855 1.00 28.28 ? 324  ASN A C   1 
ATOM   2514 O O   . ASN A 1 324 ? 17.474  66.575 62.097 1.00 25.94 ? 324  ASN A O   1 
ATOM   2515 C CB  . ASN A 1 324 ? 15.260  69.012 61.523 1.00 25.46 ? 324  ASN A CB  1 
ATOM   2516 C CG  . ASN A 1 324 ? 14.323  69.747 60.540 1.00 27.80 ? 324  ASN A CG  1 
ATOM   2517 O OD1 . ASN A 1 324 ? 14.611  69.847 59.319 1.00 25.88 ? 324  ASN A OD1 1 
ATOM   2518 N ND2 . ASN A 1 324 ? 13.205  70.267 61.069 1.00 28.07 ? 324  ASN A ND2 1 
ATOM   2519 N N   . LYS A 1 325 ? 18.200  68.670 62.503 1.00 28.14 ? 325  LYS A N   1 
ATOM   2520 C CA  . LYS A 1 325 ? 19.168  68.211 63.484 1.00 27.75 ? 325  LYS A CA  1 
ATOM   2521 C C   . LYS A 1 325 ? 18.593  67.443 64.683 1.00 29.15 ? 325  LYS A C   1 
ATOM   2522 O O   . LYS A 1 325 ? 19.207  66.473 65.097 1.00 28.10 ? 325  LYS A O   1 
ATOM   2523 C CB  . LYS A 1 325 ? 20.026  69.401 63.975 1.00 29.30 ? 325  LYS A CB  1 
ATOM   2524 C CG  . LYS A 1 325 ? 21.178  68.995 65.010 1.00 31.60 ? 325  LYS A CG  1 
ATOM   2525 C CD  . LYS A 1 325 ? 21.994  70.230 65.503 1.00 33.78 ? 325  LYS A CD  1 
ATOM   2526 C CE  . LYS A 1 325 ? 22.401  70.161 66.983 1.00 38.98 ? 325  LYS A CE  1 
ATOM   2527 N NZ  . LYS A 1 325 ? 21.241  70.661 67.972 1.00 42.10 ? 325  LYS A NZ  1 
ATOM   2528 N N   . ASP A 1 326 ? 17.449  67.871 65.258 1.00 27.52 ? 326  ASP A N   1 
ATOM   2529 C CA  . ASP A 1 326 ? 16.909  67.153 66.441 1.00 27.87 ? 326  ASP A CA  1 
ATOM   2530 C C   . ASP A 1 326 ? 15.475  66.641 66.242 1.00 28.53 ? 326  ASP A C   1 
ATOM   2531 O O   . ASP A 1 326 ? 14.499  67.069 66.940 1.00 27.59 ? 326  ASP A O   1 
ATOM   2532 C CB  . ASP A 1 326 ? 16.997  68.088 67.670 1.00 27.46 ? 326  ASP A CB  1 
ATOM   2533 C CG  . ASP A 1 326 ? 18.421  68.673 67.826 1.00 29.26 ? 326  ASP A CG  1 
ATOM   2534 O OD1 . ASP A 1 326 ? 19.309  67.904 68.266 1.00 26.88 ? 326  ASP A OD1 1 
ATOM   2535 O OD2 . ASP A 1 326 ? 18.647  69.867 67.461 1.00 28.76 ? 326  ASP A OD2 1 
ATOM   2536 N N   . GLU A 1 327 ? 15.350  65.704 65.303 1.00 27.01 ? 327  GLU A N   1 
ATOM   2537 C CA  . GLU A 1 327 ? 14.065  65.162 64.966 1.00 27.24 ? 327  GLU A CA  1 
ATOM   2538 C C   . GLU A 1 327 ? 13.372  64.529 66.166 1.00 27.76 ? 327  GLU A C   1 
ATOM   2539 O O   . GLU A 1 327 ? 12.119  64.558 66.244 1.00 28.69 ? 327  GLU A O   1 
ATOM   2540 C CB  . GLU A 1 327 ? 14.193  64.117 63.833 1.00 26.16 ? 327  GLU A CB  1 
ATOM   2541 C CG  . GLU A 1 327 ? 14.808  64.666 62.497 1.00 26.06 ? 327  GLU A CG  1 
ATOM   2542 C CD  . GLU A 1 327 ? 13.819  65.484 61.666 1.00 27.14 ? 327  GLU A CD  1 
ATOM   2543 O OE1 . GLU A 1 327 ? 12.712  65.865 62.169 1.00 29.33 ? 327  GLU A OE1 1 
ATOM   2544 O OE2 . GLU A 1 327 ? 14.129  65.756 60.483 1.00 29.11 ? 327  GLU A OE2 1 
ATOM   2545 N N   . GLY A 1 328 ? 14.135  63.978 67.118 1.00 26.06 ? 328  GLY A N   1 
ATOM   2546 C CA  . GLY A 1 328 ? 13.473  63.295 68.198 1.00 24.84 ? 328  GLY A CA  1 
ATOM   2547 C C   . GLY A 1 328 ? 12.888  64.106 69.353 1.00 26.28 ? 328  GLY A C   1 
ATOM   2548 O O   . GLY A 1 328 ? 12.007  63.613 70.067 1.00 24.80 ? 328  GLY A O   1 
ATOM   2549 N N   . SER A 1 329 ? 13.332  65.345 69.558 1.00 26.93 ? 329  SER A N   1 
ATOM   2550 C CA  . SER A 1 329 ? 12.897  66.041 70.777 1.00 25.44 ? 329  SER A CA  1 
ATOM   2551 C C   . SER A 1 329 ? 11.387  66.178 71.067 1.00 26.55 ? 329  SER A C   1 
ATOM   2552 O O   . SER A 1 329 ? 10.951  66.035 72.238 1.00 24.68 ? 329  SER A O   1 
ATOM   2553 C CB  . SER A 1 329 ? 13.601  67.398 70.861 1.00 26.53 ? 329  SER A CB  1 
ATOM   2554 O OG  . SER A 1 329 ? 13.184  68.287 69.846 1.00 25.13 ? 329  SER A OG  1 
ATOM   2555 N N   . PHE A 1 330 ? 10.598  66.415 70.017 1.00 26.40 ? 330  PHE A N   1 
ATOM   2556 C CA  . PHE A 1 330 ? 9.155   66.597 70.141 1.00 28.94 ? 330  PHE A CA  1 
ATOM   2557 C C   . PHE A 1 330 ? 8.527   65.350 70.771 1.00 29.08 ? 330  PHE A C   1 
ATOM   2558 O O   . PHE A 1 330 ? 7.651   65.436 71.659 1.00 28.30 ? 330  PHE A O   1 
ATOM   2559 C CB  . PHE A 1 330 ? 8.497   66.780 68.754 1.00 30.43 ? 330  PHE A CB  1 
ATOM   2560 C CG  . PHE A 1 330 ? 7.415   67.840 68.697 1.00 31.61 ? 330  PHE A CG  1 
ATOM   2561 C CD1 . PHE A 1 330 ? 6.546   68.024 69.742 1.00 31.83 ? 330  PHE A CD1 1 
ATOM   2562 C CD2 . PHE A 1 330 ? 7.300   68.667 67.566 1.00 31.34 ? 330  PHE A CD2 1 
ATOM   2563 C CE1 . PHE A 1 330 ? 5.580   69.027 69.686 1.00 32.77 ? 330  PHE A CE1 1 
ATOM   2564 C CE2 . PHE A 1 330 ? 6.337   69.658 67.495 1.00 31.71 ? 330  PHE A CE2 1 
ATOM   2565 C CZ  . PHE A 1 330 ? 5.470   69.855 68.554 1.00 31.45 ? 330  PHE A CZ  1 
ATOM   2566 N N   . PHE A 1 331 ? 8.992   64.197 70.316 1.00 27.88 ? 331  PHE A N   1 
ATOM   2567 C CA  . PHE A 1 331 ? 8.404   62.970 70.791 1.00 27.84 ? 331  PHE A CA  1 
ATOM   2568 C C   . PHE A 1 331 ? 8.842   62.610 72.191 1.00 28.52 ? 331  PHE A C   1 
ATOM   2569 O O   . PHE A 1 331 ? 8.036   62.058 72.937 1.00 28.59 ? 331  PHE A O   1 
ATOM   2570 C CB  . PHE A 1 331 ? 8.699   61.850 69.783 1.00 28.94 ? 331  PHE A CB  1 
ATOM   2571 C CG  . PHE A 1 331 ? 8.175   62.162 68.420 1.00 28.68 ? 331  PHE A CG  1 
ATOM   2572 C CD1 . PHE A 1 331 ? 8.945   62.930 67.533 1.00 28.53 ? 331  PHE A CD1 1 
ATOM   2573 C CD2 . PHE A 1 331 ? 6.861   61.809 68.075 1.00 28.04 ? 331  PHE A CD2 1 
ATOM   2574 C CE1 . PHE A 1 331 ? 8.404   63.355 66.291 1.00 27.61 ? 331  PHE A CE1 1 
ATOM   2575 C CE2 . PHE A 1 331 ? 6.298   62.218 66.858 1.00 26.90 ? 331  PHE A CE2 1 
ATOM   2576 C CZ  . PHE A 1 331 ? 7.059   62.985 65.966 1.00 29.01 ? 331  PHE A CZ  1 
ATOM   2577 N N   . LEU A 1 332 ? 10.073  62.956 72.575 1.00 27.23 ? 332  LEU A N   1 
ATOM   2578 C CA  . LEU A 1 332 ? 10.533  62.612 73.938 1.00 27.49 ? 332  LEU A CA  1 
ATOM   2579 C C   . LEU A 1 332 ? 9.795   63.512 74.923 1.00 28.25 ? 332  LEU A C   1 
ATOM   2580 O O   . LEU A 1 332 ? 9.366   63.065 75.979 1.00 28.01 ? 332  LEU A O   1 
ATOM   2581 C CB  . LEU A 1 332 ? 12.067  62.834 74.080 1.00 27.19 ? 332  LEU A CB  1 
ATOM   2582 C CG  . LEU A 1 332 ? 12.911  61.826 73.279 1.00 24.76 ? 332  LEU A CG  1 
ATOM   2583 C CD1 . LEU A 1 332 ? 14.356  62.401 73.035 1.00 22.65 ? 332  LEU A CD1 1 
ATOM   2584 C CD2 . LEU A 1 332 ? 12.927  60.495 74.069 1.00 23.61 ? 332  LEU A CD2 1 
ATOM   2585 N N   . LEU A 1 333 ? 9.624   64.786 74.545 1.00 29.11 ? 333  LEU A N   1 
ATOM   2586 C CA  . LEU A 1 333 ? 8.973   65.751 75.411 1.00 29.77 ? 333  LEU A CA  1 
ATOM   2587 C C   . LEU A 1 333 ? 7.595   65.250 75.751 1.00 31.00 ? 333  LEU A C   1 
ATOM   2588 O O   . LEU A 1 333 ? 7.176   65.278 76.906 1.00 28.87 ? 333  LEU A O   1 
ATOM   2589 C CB  . LEU A 1 333 ? 8.835   67.145 74.732 1.00 27.72 ? 333  LEU A CB  1 
ATOM   2590 C CG  . LEU A 1 333 ? 7.805   68.090 75.397 1.00 29.67 ? 333  LEU A CG  1 
ATOM   2591 C CD1 . LEU A 1 333 ? 8.197   68.326 76.904 1.00 27.89 ? 333  LEU A CD1 1 
ATOM   2592 C CD2 . LEU A 1 333 ? 7.714   69.463 74.629 1.00 28.99 ? 333  LEU A CD2 1 
ATOM   2593 N N   . TYR A 1 334 ? 6.871   64.811 74.716 1.00 32.34 ? 334  TYR A N   1 
ATOM   2594 C CA  . TYR A 1 334 ? 5.492   64.365 74.942 1.00 31.60 ? 334  TYR A CA  1 
ATOM   2595 C C   . TYR A 1 334 ? 5.379   62.959 75.445 1.00 30.87 ? 334  TYR A C   1 
ATOM   2596 O O   . TYR A 1 334 ? 4.376   62.622 76.051 1.00 33.20 ? 334  TYR A O   1 
ATOM   2597 C CB  . TYR A 1 334 ? 4.642   64.460 73.656 1.00 30.22 ? 334  TYR A CB  1 
ATOM   2598 C CG  . TYR A 1 334 ? 4.103   65.838 73.365 1.00 30.11 ? 334  TYR A CG  1 
ATOM   2599 C CD1 . TYR A 1 334 ? 4.970   66.911 73.113 1.00 27.66 ? 334  TYR A CD1 1 
ATOM   2600 C CD2 . TYR A 1 334 ? 2.714   66.077 73.347 1.00 28.28 ? 334  TYR A CD2 1 
ATOM   2601 C CE1 . TYR A 1 334 ? 4.464   68.194 72.856 1.00 29.64 ? 334  TYR A CE1 1 
ATOM   2602 C CE2 . TYR A 1 334 ? 2.212   67.359 73.081 1.00 27.92 ? 334  TYR A CE2 1 
ATOM   2603 C CZ  . TYR A 1 334 ? 3.072   68.411 72.832 1.00 27.72 ? 334  TYR A CZ  1 
ATOM   2604 O OH  . TYR A 1 334 ? 2.568   69.658 72.477 1.00 28.98 ? 334  TYR A OH  1 
ATOM   2605 N N   . GLY A 1 335 ? 6.362   62.112 75.227 1.00 29.52 ? 335  GLY A N   1 
ATOM   2606 C CA  . GLY A 1 335 ? 6.104   60.764 75.683 1.00 29.10 ? 335  GLY A CA  1 
ATOM   2607 C C   . GLY A 1 335 ? 7.085   59.964 76.508 1.00 29.64 ? 335  GLY A C   1 
ATOM   2608 O O   . GLY A 1 335 ? 6.767   58.804 76.749 1.00 27.87 ? 335  GLY A O   1 
ATOM   2609 N N   . ALA A 1 336 ? 8.226   60.541 76.928 1.00 28.23 ? 336  ALA A N   1 
ATOM   2610 C CA  . ALA A 1 336 ? 9.225   59.780 77.693 1.00 29.90 ? 336  ALA A CA  1 
ATOM   2611 C C   . ALA A 1 336 ? 9.420   60.411 79.051 1.00 30.27 ? 336  ALA A C   1 
ATOM   2612 O O   . ALA A 1 336 ? 9.454   61.632 79.165 1.00 28.91 ? 336  ALA A O   1 
ATOM   2613 C CB  . ALA A 1 336 ? 10.526  59.760 76.980 1.00 26.90 ? 336  ALA A CB  1 
ATOM   2614 N N   . PRO A 1 337 ? 9.563   59.587 80.094 1.00 31.94 ? 337  PRO A N   1 
ATOM   2615 C CA  . PRO A 1 337 ? 9.744   60.118 81.457 1.00 33.00 ? 337  PRO A CA  1 
ATOM   2616 C C   . PRO A 1 337 ? 11.050  60.895 81.635 1.00 32.08 ? 337  PRO A C   1 
ATOM   2617 O O   . PRO A 1 337 ? 12.105  60.505 81.109 1.00 32.70 ? 337  PRO A O   1 
ATOM   2618 C CB  . PRO A 1 337 ? 9.674   58.861 82.345 1.00 33.11 ? 337  PRO A CB  1 
ATOM   2619 C CG  . PRO A 1 337 ? 10.295  57.818 81.467 1.00 34.73 ? 337  PRO A CG  1 
ATOM   2620 C CD  . PRO A 1 337 ? 9.664   58.114 80.075 1.00 33.64 ? 337  PRO A CD  1 
ATOM   2621 N N   . GLY A 1 338 ? 10.944  62.014 82.346 1.00 31.56 ? 338  GLY A N   1 
ATOM   2622 C CA  . GLY A 1 338 ? 12.099  62.861 82.628 1.00 30.95 ? 338  GLY A CA  1 
ATOM   2623 C C   . GLY A 1 338 ? 12.235  64.105 81.753 1.00 32.64 ? 338  GLY A C   1 
ATOM   2624 O O   . GLY A 1 338 ? 13.071  64.989 82.050 1.00 32.12 ? 338  GLY A O   1 
ATOM   2625 N N   . PHE A 1 339 ? 11.445  64.174 80.667 1.00 31.13 ? 339  PHE A N   1 
ATOM   2626 C CA  . PHE A 1 339 ? 11.502  65.330 79.770 1.00 31.63 ? 339  PHE A CA  1 
ATOM   2627 C C   . PHE A 1 339 ? 10.326  66.222 80.105 1.00 32.41 ? 339  PHE A C   1 
ATOM   2628 O O   . PHE A 1 339 ? 9.236   65.700 80.288 1.00 34.55 ? 339  PHE A O   1 
ATOM   2629 C CB  . PHE A 1 339 ? 11.389  64.891 78.303 1.00 29.36 ? 339  PHE A CB  1 
ATOM   2630 C CG  . PHE A 1 339 ? 12.583  64.110 77.816 1.00 28.99 ? 339  PHE A CG  1 
ATOM   2631 C CD1 . PHE A 1 339 ? 13.606  64.751 77.164 1.00 27.83 ? 339  PHE A CD1 1 
ATOM   2632 C CD2 . PHE A 1 339 ? 12.671  62.722 78.026 1.00 27.24 ? 339  PHE A CD2 1 
ATOM   2633 C CE1 . PHE A 1 339 ? 14.739  64.031 76.705 1.00 27.50 ? 339  PHE A CE1 1 
ATOM   2634 C CE2 . PHE A 1 339 ? 13.776  61.995 77.577 1.00 28.10 ? 339  PHE A CE2 1 
ATOM   2635 C CZ  . PHE A 1 339 ? 14.814  62.649 76.917 1.00 27.13 ? 339  PHE A CZ  1 
ATOM   2636 N N   . SER A 1 340 ? 10.526  67.539 80.143 1.00 31.31 ? 340  SER A N   1 
ATOM   2637 C CA  . SER A 1 340 ? 9.437   68.492 80.450 1.00 32.67 ? 340  SER A CA  1 
ATOM   2638 C C   . SER A 1 340 ? 9.687   69.740 79.635 1.00 31.30 ? 340  SER A C   1 
ATOM   2639 O O   . SER A 1 340 ? 10.843  70.046 79.328 1.00 31.40 ? 340  SER A O   1 
ATOM   2640 C CB  . SER A 1 340 ? 9.468   68.956 81.919 1.00 32.47 ? 340  SER A CB  1 
ATOM   2641 O OG  . SER A 1 340 ? 9.605   67.877 82.761 1.00 38.33 ? 340  SER A OG  1 
ATOM   2642 N N   . LYS A 1 341 ? 8.628   70.496 79.372 1.00 29.96 ? 341  LYS A N   1 
ATOM   2643 C CA  . LYS A 1 341 ? 8.759   71.672 78.559 1.00 30.60 ? 341  LYS A CA  1 
ATOM   2644 C C   . LYS A 1 341 ? 9.543   72.774 79.250 1.00 31.17 ? 341  LYS A C   1 
ATOM   2645 O O   . LYS A 1 341 ? 10.328  73.471 78.609 1.00 29.35 ? 341  LYS A O   1 
ATOM   2646 C CB  . LYS A 1 341 ? 7.376   72.238 78.154 1.00 31.40 ? 341  LYS A CB  1 
ATOM   2647 C CG  . LYS A 1 341 ? 7.503   73.437 77.158 1.00 30.81 ? 341  LYS A CG  1 
ATOM   2648 C CD  . LYS A 1 341 ? 6.165   74.024 76.655 1.00 31.09 ? 341  LYS A CD  1 
ATOM   2649 C CE  . LYS A 1 341 ? 5.537   75.010 77.679 1.00 29.55 ? 341  LYS A CE  1 
ATOM   2650 N NZ  . LYS A 1 341 ? 6.448   76.196 77.920 1.00 31.34 ? 341  LYS A NZ  1 
ATOM   2651 N N   . ASP A 1 342 ? 9.322   72.933 80.560 1.00 30.71 ? 342  ASP A N   1 
ATOM   2652 C CA  . ASP A 1 342 ? 9.970   74.009 81.284 1.00 32.13 ? 342  ASP A CA  1 
ATOM   2653 C C   . ASP A 1 342 ? 11.259  73.713 82.040 1.00 32.22 ? 342  ASP A C   1 
ATOM   2654 O O   . ASP A 1 342 ? 11.669  74.495 82.899 1.00 31.92 ? 342  ASP A O   1 
ATOM   2655 C CB  . ASP A 1 342 ? 8.951   74.681 82.226 1.00 30.89 ? 342  ASP A CB  1 
ATOM   2656 C CG  . ASP A 1 342 ? 7.721   75.209 81.480 1.00 32.14 ? 342  ASP A CG  1 
ATOM   2657 O OD1 . ASP A 1 342 ? 7.763   75.383 80.222 1.00 29.64 ? 342  ASP A OD1 1 
ATOM   2658 O OD2 . ASP A 1 342 ? 6.711   75.459 82.171 1.00 31.88 ? 342  ASP A OD2 1 
ATOM   2659 N N   . SER A 1 343 ? 11.889  72.587 81.771 1.00 32.59 ? 343  SER A N   1 
ATOM   2660 C CA  . SER A 1 343 ? 13.147  72.350 82.446 1.00 33.16 ? 343  SER A CA  1 
ATOM   2661 C C   . SER A 1 343 ? 14.152  71.961 81.361 1.00 34.49 ? 343  SER A C   1 
ATOM   2662 O O   . SER A 1 343 ? 13.775  71.721 80.184 1.00 32.05 ? 343  SER A O   1 
ATOM   2663 C CB  . SER A 1 343 ? 12.984  71.265 83.484 1.00 35.03 ? 343  SER A CB  1 
ATOM   2664 O OG  . SER A 1 343 ? 13.373  70.020 82.987 1.00 41.27 ? 343  SER A OG  1 
ATOM   2665 N N   . GLU A 1 344 ? 15.429  71.936 81.728 1.00 33.41 ? 344  GLU A N   1 
ATOM   2666 C CA  . GLU A 1 344 ? 16.465  71.580 80.807 1.00 34.78 ? 344  GLU A CA  1 
ATOM   2667 C C   . GLU A 1 344 ? 16.416  70.082 80.502 1.00 34.14 ? 344  GLU A C   1 
ATOM   2668 O O   . GLU A 1 344 ? 17.128  69.618 79.633 1.00 31.29 ? 344  GLU A O   1 
ATOM   2669 C CB  . GLU A 1 344 ? 17.824  71.940 81.374 1.00 38.52 ? 344  GLU A CB  1 
ATOM   2670 C CG  . GLU A 1 344 ? 18.083  73.430 81.321 1.00 46.01 ? 344  GLU A CG  1 
ATOM   2671 C CD  . GLU A 1 344 ? 19.542  73.769 81.626 1.00 50.34 ? 344  GLU A CD  1 
ATOM   2672 O OE1 . GLU A 1 344 ? 20.339  72.854 81.973 1.00 50.30 ? 344  GLU A OE1 1 
ATOM   2673 O OE2 . GLU A 1 344 ? 19.880  74.967 81.505 1.00 55.05 ? 344  GLU A OE2 1 
ATOM   2674 N N   . SER A 1 345 ? 15.614  69.345 81.263 1.00 32.68 ? 345  SER A N   1 
ATOM   2675 C CA  . SER A 1 345 ? 15.425  67.928 81.015 1.00 34.95 ? 345  SER A CA  1 
ATOM   2676 C C   . SER A 1 345 ? 16.699  67.045 80.986 1.00 35.71 ? 345  SER A C   1 
ATOM   2677 O O   . SER A 1 345 ? 16.891  66.225 80.072 1.00 34.38 ? 345  SER A O   1 
ATOM   2678 C CB  . SER A 1 345 ? 14.654  67.732 79.677 1.00 34.48 ? 345  SER A CB  1 
ATOM   2679 O OG  . SER A 1 345 ? 13.355  68.302 79.731 1.00 34.18 ? 345  SER A OG  1 
ATOM   2680 N N   . LYS A 1 346 ? 17.554  67.212 81.977 1.00 36.29 ? 346  LYS A N   1 
ATOM   2681 C CA  . LYS A 1 346 ? 18.735  66.386 82.072 1.00 38.30 ? 346  LYS A CA  1 
ATOM   2682 C C   . LYS A 1 346 ? 18.125  65.066 82.522 1.00 37.33 ? 346  LYS A C   1 
ATOM   2683 O O   . LYS A 1 346 ? 17.259  65.021 83.375 1.00 36.85 ? 346  LYS A O   1 
ATOM   2684 C CB  . LYS A 1 346 ? 19.702  66.962 83.094 1.00 40.82 ? 346  LYS A CB  1 
ATOM   2685 C CG  . LYS A 1 346 ? 20.304  68.306 82.667 1.00 43.49 ? 346  LYS A CG  1 
ATOM   2686 C CD  . LYS A 1 346 ? 21.231  68.790 83.800 1.00 48.58 ? 346  LYS A CD  1 
ATOM   2687 C CE  . LYS A 1 346 ? 21.652  70.269 83.717 1.00 50.25 ? 346  LYS A CE  1 
ATOM   2688 N NZ  . LYS A 1 346 ? 22.301  70.593 85.071 1.00 52.01 ? 346  LYS A NZ  1 
ATOM   2689 N N   . ILE A 1 347 ? 18.582  63.994 81.911 1.00 37.50 ? 347  ILE A N   1 
ATOM   2690 C CA  . ILE A 1 347 ? 18.030  62.669 82.125 1.00 39.63 ? 347  ILE A CA  1 
ATOM   2691 C C   . ILE A 1 347 ? 18.962  61.751 82.930 1.00 40.08 ? 347  ILE A C   1 
ATOM   2692 O O   . ILE A 1 347 ? 20.155  61.643 82.629 1.00 39.87 ? 347  ILE A O   1 
ATOM   2693 C CB  . ILE A 1 347 ? 17.764  62.027 80.685 1.00 39.74 ? 347  ILE A CB  1 
ATOM   2694 C CG1 . ILE A 1 347 ? 16.692  62.835 79.954 1.00 41.29 ? 347  ILE A CG1 1 
ATOM   2695 C CG2 . ILE A 1 347 ? 17.391  60.564 80.771 1.00 41.64 ? 347  ILE A CG2 1 
ATOM   2696 C CD1 . ILE A 1 347 ? 15.389  62.856 80.693 1.00 41.59 ? 347  ILE A CD1 1 
ATOM   2697 N N   . SER A 1 348 ? 18.406  61.062 83.909 1.00 41.54 ? 348  SER A N   1 
ATOM   2698 C CA  . SER A 1 348 ? 19.187  60.095 84.687 1.00 43.96 ? 348  SER A CA  1 
ATOM   2699 C C   . SER A 1 348 ? 19.464  58.865 83.804 1.00 44.76 ? 348  SER A C   1 
ATOM   2700 O O   . SER A 1 348 ? 18.840  58.676 82.749 1.00 44.36 ? 348  SER A O   1 
ATOM   2701 C CB  . SER A 1 348 ? 18.402  59.655 85.922 1.00 43.93 ? 348  SER A CB  1 
ATOM   2702 O OG  . SER A 1 348 ? 17.179  59.030 85.559 1.00 45.75 ? 348  SER A OG  1 
ATOM   2703 N N   . ARG A 1 349 ? 20.425  58.061 84.215 1.00 43.72 ? 349  ARG A N   1 
ATOM   2704 C CA  . ARG A 1 349 ? 20.766  56.854 83.499 1.00 45.05 ? 349  ARG A CA  1 
ATOM   2705 C C   . ARG A 1 349 ? 19.521  55.955 83.422 1.00 45.20 ? 349  ARG A C   1 
ATOM   2706 O O   . ARG A 1 349 ? 19.302  55.225 82.452 1.00 45.21 ? 349  ARG A O   1 
ATOM   2707 C CB  . ARG A 1 349 ? 21.860  56.101 84.271 1.00 46.85 ? 349  ARG A CB  1 
ATOM   2708 C CG  . ARG A 1 349 ? 22.585  55.113 83.454 1.00 46.84 ? 349  ARG A CG  1 
ATOM   2709 C CD  . ARG A 1 349 ? 23.273  55.876 82.375 1.00 48.93 ? 349  ARG A CD  1 
ATOM   2710 N NE  . ARG A 1 349 ? 23.557  54.940 81.332 1.00 49.09 ? 349  ARG A NE  1 
ATOM   2711 C CZ  . ARG A 1 349 ? 23.657  55.233 80.048 1.00 48.61 ? 349  ARG A CZ  1 
ATOM   2712 N NH1 . ARG A 1 349 ? 23.508  56.476 79.605 1.00 50.34 ? 349  ARG A NH1 1 
ATOM   2713 N NH2 . ARG A 1 349 ? 23.876  54.240 79.203 1.00 48.67 ? 349  ARG A NH2 1 
ATOM   2714 N N   . GLU A 1 350 ? 18.709  56.011 84.464 1.00 43.99 ? 350  GLU A N   1 
ATOM   2715 C CA  . GLU A 1 350 ? 17.524  55.181 84.529 1.00 44.13 ? 350  GLU A CA  1 
ATOM   2716 C C   . GLU A 1 350 ? 16.463  55.623 83.494 1.00 44.44 ? 350  GLU A C   1 
ATOM   2717 O O   . GLU A 1 350 ? 15.820  54.775 82.830 1.00 43.23 ? 350  GLU A O   1 
ATOM   2718 C CB  . GLU A 1 350 ? 16.936  55.243 85.935 1.00 43.47 ? 350  GLU A CB  1 
ATOM   2719 C CG  . GLU A 1 350 ? 15.924  54.163 86.268 1.00 44.19 ? 350  GLU A CG  1 
ATOM   2720 N N   . ASP A 1 351 ? 16.275  56.939 83.369 1.00 43.06 ? 351  ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? 15.301  57.461 82.409 1.00 42.37 ? 351  ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? 15.827  57.252 80.997 1.00 40.13 ? 351  ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? 15.073  57.094 80.059 1.00 40.40 ? 351  ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? 14.989  58.928 82.685 1.00 42.79 ? 351  ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? 13.995  59.090 83.830 1.00 44.68 ? 351  ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? 13.302  58.095 84.141 1.00 45.33 ? 351  ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? 13.873  60.208 84.400 1.00 44.08 ? 351  ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? 17.134  57.186 80.865 1.00 38.74 ? 352  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? 17.738  56.967 79.563 1.00 37.92 ? 352  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? 17.311  55.588 79.104 1.00 39.03 ? 352  PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? 16.822  55.384 77.980 1.00 38.26 ? 352  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? 19.248  56.964 79.676 1.00 34.03 ? 352  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? 19.930  56.780 78.400 1.00 33.02 ? 352  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? 20.087  57.851 77.526 1.00 30.01 ? 352  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? 20.394  55.519 78.035 1.00 32.36 ? 352  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? 20.699  57.657 76.301 1.00 31.17 ? 352  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? 21.004  55.310 76.818 1.00 33.04 ? 352  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? 21.165  56.386 75.928 1.00 31.56 ? 352  PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? 17.524  54.634 79.994 1.00 39.58 ? 353  MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? 17.226  53.261 79.681 1.00 40.73 ? 353  MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? 15.763  53.045 79.457 1.00 39.28 ? 353  MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? 15.391  52.287 78.566 1.00 38.44 ? 353  MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? 17.800  52.330 80.768 1.00 43.95 ? 353  MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? 19.343  52.175 80.595 1.00 49.11 ? 353  MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? 20.054  50.908 81.666 1.00 59.41 ? 353  MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? 19.328  51.402 83.264 1.00 54.30 ? 353  MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? 14.924  53.734 80.212 1.00 37.57 ? 354  SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? 13.512  53.545 79.994 1.00 37.49 ? 354  SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? 13.087  54.268 78.629 1.00 36.65 ? 354  SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? 12.235  53.770 77.855 1.00 34.41 ? 354  SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? 12.791  53.944 81.298 1.00 38.37 ? 354  SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? 12.014  55.091 81.150 1.00 44.97 ? 354  SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? 13.802  55.350 78.289 1.00 34.73 ? 355  GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? 13.631  56.032 77.016 1.00 32.00 ? 355  GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? 14.087  55.102 75.879 1.00 32.01 ? 355  GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? 13.404  55.020 74.854 1.00 29.97 ? 355  GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? 15.197  54.354 76.006 1.00 31.32 ? 356  VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? 15.506  53.524 74.857 1.00 30.85 ? 356  VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? 14.486  52.422 74.640 1.00 31.72 ? 356  VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? 14.180  52.102 73.482 1.00 31.32 ? 356  VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? 16.999  52.939 74.774 1.00 33.30 ? 356  VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? 17.940  53.657 75.668 1.00 28.25 ? 356  VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? 17.005  51.467 74.901 1.00 33.01 ? 356  VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? 13.940  51.856 75.724 1.00 32.18 ? 357  LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? 12.884  50.818 75.613 1.00 33.63 ? 357  LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? 11.645  51.381 74.838 1.00 32.09 ? 357  LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? 11.074  50.728 73.958 1.00 32.05 ? 357  LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? 12.470  50.378 77.030 1.00 35.97 ? 357  LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? 11.241  49.480 77.110 1.00 39.60 ? 357  LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? 11.543  48.042 76.685 1.00 39.97 ? 357  LYS A CD  1 
ATOM   2771 N N   . LEU A 1 358 ? 11.270  52.611 75.145 1.00 30.80 ? 358  LEU A N   1 
ATOM   2772 C CA  . LEU A 1 358 ? 10.139  53.267 74.487 1.00 31.59 ? 358  LEU A CA  1 
ATOM   2773 C C   . LEU A 1 358 ? 10.407  53.530 73.007 1.00 31.73 ? 358  LEU A C   1 
ATOM   2774 O O   . LEU A 1 358 ? 9.496   53.390 72.182 1.00 30.89 ? 358  LEU A O   1 
ATOM   2775 C CB  . LEU A 1 358 ? 9.871   54.587 75.163 1.00 31.47 ? 358  LEU A CB  1 
ATOM   2776 C CG  . LEU A 1 358 ? 8.664   54.854 76.047 1.00 35.87 ? 358  LEU A CG  1 
ATOM   2777 C CD1 . LEU A 1 358 ? 7.893   53.593 76.501 1.00 31.44 ? 358  LEU A CD1 1 
ATOM   2778 C CD2 . LEU A 1 358 ? 9.174   55.755 77.188 1.00 28.72 ? 358  LEU A CD2 1 
ATOM   2779 N N   . SER A 1 359 ? 11.669  53.871 72.695 1.00 30.41 ? 359  SER A N   1 
ATOM   2780 C CA  . SER A 1 359 ? 12.114  54.195 71.353 1.00 28.68 ? 359  SER A CA  1 
ATOM   2781 C C   . SER A 1 359 ? 12.245  53.068 70.392 1.00 29.50 ? 359  SER A C   1 
ATOM   2782 O O   . SER A 1 359 ? 12.112  53.297 69.195 1.00 29.38 ? 359  SER A O   1 
ATOM   2783 C CB  . SER A 1 359 ? 13.447  54.919 71.403 1.00 30.34 ? 359  SER A CB  1 
ATOM   2784 O OG  . SER A 1 359 ? 13.331  56.048 72.229 1.00 29.23 ? 359  SER A OG  1 
ATOM   2785 N N   . VAL A 1 360 ? 12.489  51.848 70.867 1.00 28.79 ? 360  VAL A N   1 
ATOM   2786 C CA  . VAL A 1 360 ? 12.620  50.743 69.933 1.00 30.51 ? 360  VAL A CA  1 
ATOM   2787 C C   . VAL A 1 360 ? 11.734  49.675 70.539 1.00 32.71 ? 360  VAL A C   1 
ATOM   2788 O O   . VAL A 1 360 ? 12.216  48.644 71.037 1.00 30.32 ? 360  VAL A O   1 
ATOM   2789 C CB  . VAL A 1 360 ? 14.112  50.284 69.850 1.00 32.74 ? 360  VAL A CB  1 
ATOM   2790 C CG1 . VAL A 1 360 ? 14.291  49.287 68.724 1.00 35.05 ? 360  VAL A CG1 1 
ATOM   2791 C CG2 . VAL A 1 360 ? 15.010  51.480 69.570 1.00 34.11 ? 360  VAL A CG2 1 
ATOM   2792 N N   . PRO A 1 361 ? 10.396  49.897 70.503 1.00 34.52 ? 361  PRO A N   1 
ATOM   2793 C CA  . PRO A 1 361 ? 9.442   48.928 71.098 1.00 36.31 ? 361  PRO A CA  1 
ATOM   2794 C C   . PRO A 1 361 ? 9.509   47.480 70.586 1.00 38.18 ? 361  PRO A C   1 
ATOM   2795 O O   . PRO A 1 361 ? 9.221   46.533 71.314 1.00 37.40 ? 361  PRO A O   1 
ATOM   2796 C CB  . PRO A 1 361 ? 8.075   49.603 70.881 1.00 36.56 ? 361  PRO A CB  1 
ATOM   2797 C CG  . PRO A 1 361 ? 8.303   50.416 69.555 1.00 34.21 ? 361  PRO A CG  1 
ATOM   2798 C CD  . PRO A 1 361 ? 9.716   50.967 69.751 1.00 33.45 ? 361  PRO A CD  1 
ATOM   2799 N N   . HIS A 1 362 ? 9.942   47.322 69.344 1.00 41.04 ? 362  HIS A N   1 
ATOM   2800 C CA  . HIS A 1 362 ? 10.074  46.007 68.725 1.00 45.56 ? 362  HIS A CA  1 
ATOM   2801 C C   . HIS A 1 362 ? 11.387  45.230 69.062 1.00 46.59 ? 362  HIS A C   1 
ATOM   2802 O O   . HIS A 1 362 ? 11.628  44.157 68.495 1.00 46.81 ? 362  HIS A O   1 
ATOM   2803 C CB  . HIS A 1 362 ? 9.950   46.152 67.192 1.00 46.72 ? 362  HIS A CB  1 
ATOM   2804 C CG  . HIS A 1 362 ? 10.975  47.067 66.584 1.00 48.65 ? 362  HIS A CG  1 
ATOM   2805 N ND1 . HIS A 1 362 ? 11.008  48.428 66.830 1.00 47.69 ? 362  HIS A ND1 1 
ATOM   2806 C CD2 . HIS A 1 362 ? 12.009  46.810 65.742 1.00 48.51 ? 362  HIS A CD2 1 
ATOM   2807 C CE1 . HIS A 1 362 ? 12.014  48.965 66.165 1.00 48.00 ? 362  HIS A CE1 1 
ATOM   2808 N NE2 . HIS A 1 362 ? 12.637  48.007 65.494 1.00 47.13 ? 362  HIS A NE2 1 
ATOM   2809 N N   . ALA A 1 363 ? 12.205  45.733 69.996 1.00 46.37 ? 363  ALA A N   1 
ATOM   2810 C CA  . ALA A 1 363 ? 13.482  45.068 70.301 1.00 45.58 ? 363  ALA A CA  1 
ATOM   2811 C C   . ALA A 1 363 ? 13.561  44.161 71.539 1.00 44.90 ? 363  ALA A C   1 
ATOM   2812 O O   . ALA A 1 363 ? 13.022  44.464 72.582 1.00 45.95 ? 363  ALA A O   1 
ATOM   2813 C CB  . ALA A 1 363 ? 14.583  46.123 70.402 1.00 43.57 ? 363  ALA A CB  1 
ATOM   2814 N N   . ASN A 1 364 ? 14.273  43.045 71.428 1.00 44.24 ? 364  ASN A N   1 
ATOM   2815 C CA  . ASN A 1 364 ? 14.456  42.185 72.598 1.00 42.54 ? 364  ASN A CA  1 
ATOM   2816 C C   . ASN A 1 364 ? 15.543  42.872 73.459 1.00 42.22 ? 364  ASN A C   1 
ATOM   2817 O O   . ASN A 1 364 ? 16.060  43.953 73.105 1.00 41.73 ? 364  ASN A O   1 
ATOM   2818 C CB  . ASN A 1 364 ? 14.954  40.809 72.177 1.00 41.80 ? 364  ASN A CB  1 
ATOM   2819 C CG  . ASN A 1 364 ? 16.088  40.887 71.187 1.00 41.50 ? 364  ASN A CG  1 
ATOM   2820 O OD1 . ASN A 1 364 ? 16.830  41.893 71.137 1.00 41.23 ? 364  ASN A OD1 1 
ATOM   2821 N ND2 . ASN A 1 364 ? 16.243  39.841 70.401 1.00 38.47 ? 364  ASN A ND2 1 
ATOM   2822 N N   . ASP A 1 365 ? 15.893  42.244 74.571 1.00 40.27 ? 365  ASP A N   1 
ATOM   2823 C CA  . ASP A 1 365 ? 16.879  42.793 75.475 1.00 40.26 ? 365  ASP A CA  1 
ATOM   2824 C C   . ASP A 1 365 ? 18.271  42.972 74.864 1.00 38.75 ? 365  ASP A C   1 
ATOM   2825 O O   . ASP A 1 365 ? 18.961  43.938 75.172 1.00 36.37 ? 365  ASP A O   1 
ATOM   2826 C CB  . ASP A 1 365 ? 16.959  41.936 76.733 1.00 43.69 ? 365  ASP A CB  1 
ATOM   2827 C CG  . ASP A 1 365 ? 15.925  42.360 77.776 1.00 48.44 ? 365  ASP A CG  1 
ATOM   2828 O OD1 . ASP A 1 365 ? 14.809  42.781 77.337 1.00 51.11 ? 365  ASP A OD1 1 
ATOM   2829 N N   . LEU A 1 366 ? 18.669  42.040 74.008 1.00 37.16 ? 366  LEU A N   1 
ATOM   2830 C CA  . LEU A 1 366 ? 19.957  42.131 73.373 1.00 36.69 ? 366  LEU A CA  1 
ATOM   2831 C C   . LEU A 1 366 ? 19.971  43.377 72.473 1.00 36.06 ? 366  LEU A C   1 
ATOM   2832 O O   . LEU A 1 366 ? 20.944  44.122 72.463 1.00 35.43 ? 366  LEU A O   1 
ATOM   2833 C CB  . LEU A 1 366 ? 20.235  40.864 72.564 1.00 37.15 ? 366  LEU A CB  1 
ATOM   2834 C CG  . LEU A 1 366 ? 21.603  40.954 71.883 1.00 39.77 ? 366  LEU A CG  1 
ATOM   2835 C CD1 . LEU A 1 366 ? 22.725  40.905 72.957 1.00 38.77 ? 366  LEU A CD1 1 
ATOM   2836 C CD2 . LEU A 1 366 ? 21.741  39.820 70.855 1.00 40.16 ? 366  LEU A CD2 1 
ATOM   2837 N N   . GLY A 1 367 ? 18.886  43.620 71.731 1.00 35.02 ? 367  GLY A N   1 
ATOM   2838 C CA  . GLY A 1 367 ? 18.845  44.802 70.875 1.00 33.15 ? 367  GLY A CA  1 
ATOM   2839 C C   . GLY A 1 367 ? 18.834  46.100 71.682 1.00 32.29 ? 367  GLY A C   1 
ATOM   2840 O O   . GLY A 1 367 ? 19.449  47.103 71.296 1.00 32.28 ? 367  GLY A O   1 
ATOM   2841 N N   . LEU A 1 368 ? 18.112  46.108 72.797 1.00 31.11 ? 368  LEU A N   1 
ATOM   2842 C CA  . LEU A 1 368 ? 18.081  47.286 73.644 1.00 32.42 ? 368  LEU A CA  1 
ATOM   2843 C C   . LEU A 1 368 ? 19.510  47.575 74.173 1.00 34.17 ? 368  LEU A C   1 
ATOM   2844 O O   . LEU A 1 368 ? 19.935  48.775 74.289 1.00 32.71 ? 368  LEU A O   1 
ATOM   2845 C CB  . LEU A 1 368 ? 17.121  47.062 74.813 1.00 33.06 ? 368  LEU A CB  1 
ATOM   2846 C CG  . LEU A 1 368 ? 15.629  46.952 74.441 1.00 35.13 ? 368  LEU A CG  1 
ATOM   2847 C CD1 . LEU A 1 368 ? 14.839  46.542 75.692 1.00 33.87 ? 368  LEU A CD1 1 
ATOM   2848 C CD2 . LEU A 1 368 ? 15.131  48.278 73.868 1.00 34.26 ? 368  LEU A CD2 1 
ATOM   2849 N N   . ASP A 1 369 ? 20.240  46.490 74.495 1.00 33.25 ? 369  ASP A N   1 
ATOM   2850 C CA  . ASP A 1 369 ? 21.646  46.610 74.974 1.00 33.86 ? 369  ASP A CA  1 
ATOM   2851 C C   . ASP A 1 369 ? 22.497  47.200 73.845 1.00 31.43 ? 369  ASP A C   1 
ATOM   2852 O O   . ASP A 1 369 ? 23.333  48.065 74.080 1.00 30.84 ? 369  ASP A O   1 
ATOM   2853 C CB  . ASP A 1 369 ? 22.271  45.261 75.315 1.00 36.57 ? 369  ASP A CB  1 
ATOM   2854 C CG  . ASP A 1 369 ? 21.798  44.718 76.629 1.00 40.76 ? 369  ASP A CG  1 
ATOM   2855 O OD1 . ASP A 1 369 ? 21.444  45.518 77.498 1.00 42.30 ? 369  ASP A OD1 1 
ATOM   2856 O OD2 . ASP A 1 369 ? 21.784  43.483 76.797 1.00 44.21 ? 369  ASP A OD2 1 
ATOM   2857 N N   . ALA A 1 370 ? 22.291  46.710 72.634 1.00 29.06 ? 370  ALA A N   1 
ATOM   2858 C CA  . ALA A 1 370 ? 23.058  47.230 71.500 1.00 30.64 ? 370  ALA A CA  1 
ATOM   2859 C C   . ALA A 1 370 ? 22.799  48.779 71.302 1.00 29.84 ? 370  ALA A C   1 
ATOM   2860 O O   . ALA A 1 370 ? 23.745  49.541 71.094 1.00 31.13 ? 370  ALA A O   1 
ATOM   2861 C CB  . ALA A 1 370 ? 22.712  46.434 70.245 1.00 26.47 ? 370  ALA A CB  1 
ATOM   2862 N N   . VAL A 1 371 ? 21.556  49.243 71.402 1.00 29.70 ? 371  VAL A N   1 
ATOM   2863 C CA  . VAL A 1 371 ? 21.271  50.693 71.237 1.00 29.27 ? 371  VAL A CA  1 
ATOM   2864 C C   . VAL A 1 371 ? 21.953  51.470 72.387 1.00 31.03 ? 371  VAL A C   1 
ATOM   2865 O O   . VAL A 1 371 ? 22.654  52.481 72.153 1.00 31.37 ? 371  VAL A O   1 
ATOM   2866 C CB  . VAL A 1 371 ? 19.721  51.000 71.272 1.00 28.90 ? 371  VAL A CB  1 
ATOM   2867 C CG1 . VAL A 1 371 ? 19.487  52.519 71.152 1.00 27.86 ? 371  VAL A CG1 1 
ATOM   2868 C CG2 . VAL A 1 371 ? 18.986  50.259 70.083 1.00 28.68 ? 371  VAL A CG2 1 
ATOM   2869 N N   . THR A 1 372 ? 21.764  50.981 73.609 1.00 31.97 ? 372  THR A N   1 
ATOM   2870 C CA  . THR A 1 372 ? 22.321  51.621 74.799 1.00 34.39 ? 372  THR A CA  1 
ATOM   2871 C C   . THR A 1 372 ? 23.846  51.745 74.692 1.00 35.46 ? 372  THR A C   1 
ATOM   2872 O O   . THR A 1 372 ? 24.399  52.831 74.883 1.00 35.06 ? 372  THR A O   1 
ATOM   2873 C CB  . THR A 1 372 ? 21.912  50.843 76.076 1.00 35.99 ? 372  THR A CB  1 
ATOM   2874 O OG1 . THR A 1 372 ? 20.473  50.796 76.155 1.00 37.21 ? 372  THR A OG1 1 
ATOM   2875 C CG2 . THR A 1 372 ? 22.462  51.518 77.356 1.00 33.84 ? 372  THR A CG2 1 
ATOM   2876 N N   . LEU A 1 373 ? 24.528  50.664 74.328 1.00 34.98 ? 373  LEU A N   1 
ATOM   2877 C CA  . LEU A 1 373 ? 25.975  50.733 74.174 1.00 35.36 ? 373  LEU A CA  1 
ATOM   2878 C C   . LEU A 1 373 ? 26.400  51.765 73.106 1.00 36.56 ? 373  LEU A C   1 
ATOM   2879 O O   . LEU A 1 373 ? 27.380  52.508 73.286 1.00 36.77 ? 373  LEU A O   1 
ATOM   2880 C CB  . LEU A 1 373 ? 26.497  49.374 73.746 1.00 38.31 ? 373  LEU A CB  1 
ATOM   2881 C CG  . LEU A 1 373 ? 28.022  49.311 73.638 1.00 41.90 ? 373  LEU A CG  1 
ATOM   2882 C CD1 . LEU A 1 373 ? 28.547  48.069 74.324 1.00 44.27 ? 373  LEU A CD1 1 
ATOM   2883 C CD2 . LEU A 1 373 ? 28.406  49.283 72.176 1.00 45.65 ? 373  LEU A CD2 1 
ATOM   2884 N N   . GLN A 1 374 ? 25.669  51.782 71.987 1.00 34.54 ? 374  GLN A N   1 
ATOM   2885 C CA  . GLN A 1 374 ? 25.932  52.672 70.854 1.00 35.62 ? 374  GLN A CA  1 
ATOM   2886 C C   . GLN A 1 374 ? 25.779  54.149 71.195 1.00 34.30 ? 374  GLN A C   1 
ATOM   2887 O O   . GLN A 1 374 ? 26.449  54.988 70.626 1.00 33.81 ? 374  GLN A O   1 
ATOM   2888 C CB  . GLN A 1 374 ? 24.954  52.338 69.708 1.00 37.26 ? 374  GLN A CB  1 
ATOM   2889 C CG  . GLN A 1 374 ? 25.274  52.963 68.425 1.00 39.67 ? 374  GLN A CG  1 
ATOM   2890 C CD  . GLN A 1 374 ? 26.472  52.274 67.743 1.00 43.94 ? 374  GLN A CD  1 
ATOM   2891 O OE1 . GLN A 1 374 ? 26.959  52.763 66.719 1.00 45.85 ? 374  GLN A OE1 1 
ATOM   2892 N NE2 . GLN A 1 374 ? 26.942  51.144 68.305 1.00 42.53 ? 374  GLN A NE2 1 
ATOM   2893 N N   . TYR A 1 375 ? 24.883  54.463 72.124 1.00 32.82 ? 375  TYR A N   1 
ATOM   2894 C CA  . TYR A 1 375 ? 24.635  55.848 72.457 1.00 33.56 ? 375  TYR A CA  1 
ATOM   2895 C C   . TYR A 1 375 ? 25.076  56.326 73.863 1.00 35.07 ? 375  TYR A C   1 
ATOM   2896 O O   . TYR A 1 375 ? 24.724  57.417 74.297 1.00 36.58 ? 375  TYR A O   1 
ATOM   2897 C CB  . TYR A 1 375 ? 23.131  56.146 72.203 1.00 30.15 ? 375  TYR A CB  1 
ATOM   2898 C CG  . TYR A 1 375 ? 22.831  56.232 70.696 1.00 30.68 ? 375  TYR A CG  1 
ATOM   2899 C CD1 . TYR A 1 375 ? 22.811  57.474 70.047 1.00 29.54 ? 375  TYR A CD1 1 
ATOM   2900 C CD2 . TYR A 1 375 ? 22.519  55.084 69.938 1.00 27.24 ? 375  TYR A CD2 1 
ATOM   2901 C CE1 . TYR A 1 375 ? 22.472  57.594 68.672 1.00 29.55 ? 375  TYR A CE1 1 
ATOM   2902 C CE2 . TYR A 1 375 ? 22.183  55.189 68.558 1.00 27.64 ? 375  TYR A CE2 1 
ATOM   2903 C CZ  . TYR A 1 375 ? 22.159  56.451 67.933 1.00 28.19 ? 375  TYR A CZ  1 
ATOM   2904 O OH  . TYR A 1 375 ? 21.866  56.610 66.577 1.00 27.02 ? 375  TYR A OH  1 
ATOM   2905 N N   . THR A 1 376 ? 25.884  55.539 74.551 1.00 34.87 ? 376  THR A N   1 
ATOM   2906 C CA  . THR A 1 376 ? 26.327  55.926 75.871 1.00 33.30 ? 376  THR A CA  1 
ATOM   2907 C C   . THR A 1 376 ? 27.814  56.282 75.863 1.00 33.78 ? 376  THR A C   1 
ATOM   2908 O O   . THR A 1 376 ? 28.641  55.566 75.304 1.00 32.69 ? 376  THR A O   1 
ATOM   2909 C CB  . THR A 1 376 ? 26.102  54.776 76.857 1.00 33.55 ? 376  THR A CB  1 
ATOM   2910 O OG1 . THR A 1 376 ? 24.697  54.477 76.917 1.00 34.75 ? 376  THR A OG1 1 
ATOM   2911 C CG2 . THR A 1 376 ? 26.621  55.153 78.285 1.00 33.29 ? 376  THR A CG2 1 
ATOM   2912 N N   . ASP A 1 377 ? 28.154  57.404 76.460 1.00 33.29 ? 377  ASP A N   1 
ATOM   2913 C CA  . ASP A 1 377 ? 29.565  57.757 76.577 1.00 34.66 ? 377  ASP A CA  1 
ATOM   2914 C C   . ASP A 1 377 ? 29.960  57.093 77.938 1.00 35.86 ? 377  ASP A C   1 
ATOM   2915 O O   . ASP A 1 377 ? 29.646  57.655 79.026 1.00 34.91 ? 377  ASP A O   1 
ATOM   2916 C CB  . ASP A 1 377 ? 29.689  59.255 76.683 1.00 35.90 ? 377  ASP A CB  1 
ATOM   2917 C CG  . ASP A 1 377 ? 31.095  59.676 77.059 1.00 39.40 ? 377  ASP A CG  1 
ATOM   2918 O OD1 . ASP A 1 377 ? 31.924  58.783 77.418 1.00 37.60 ? 377  ASP A OD1 1 
ATOM   2919 O OD2 . ASP A 1 377 ? 31.355  60.894 77.003 1.00 38.84 ? 377  ASP A OD2 1 
ATOM   2920 N N   . TRP A 1 378 ? 30.586  55.903 77.901 1.00 35.52 ? 378  TRP A N   1 
ATOM   2921 C CA  . TRP A 1 378 ? 30.913  55.180 79.145 1.00 37.93 ? 378  TRP A CA  1 
ATOM   2922 C C   . TRP A 1 378 ? 31.981  55.832 80.004 1.00 39.29 ? 378  TRP A C   1 
ATOM   2923 O O   . TRP A 1 378 ? 32.250  55.365 81.104 1.00 40.02 ? 378  TRP A O   1 
ATOM   2924 C CB  . TRP A 1 378 ? 31.273  53.684 78.925 1.00 37.47 ? 378  TRP A CB  1 
ATOM   2925 C CG  . TRP A 1 378 ? 30.137  52.890 78.356 1.00 40.40 ? 378  TRP A CG  1 
ATOM   2926 C CD1 . TRP A 1 378 ? 30.037  52.461 77.080 1.00 42.09 ? 378  TRP A CD1 1 
ATOM   2927 C CD2 . TRP A 1 378 ? 28.894  52.536 78.997 1.00 40.61 ? 378  TRP A CD2 1 
ATOM   2928 N NE1 . TRP A 1 378 ? 28.822  51.872 76.866 1.00 44.79 ? 378  TRP A NE1 1 
ATOM   2929 C CE2 . TRP A 1 378 ? 28.094  51.906 78.025 1.00 42.48 ? 378  TRP A CE2 1 
ATOM   2930 C CE3 . TRP A 1 378 ? 28.388  52.693 80.291 1.00 42.08 ? 378  TRP A CE3 1 
ATOM   2931 C CZ2 . TRP A 1 378 ? 26.786  51.426 78.291 1.00 44.65 ? 378  TRP A CZ2 1 
ATOM   2932 C CZ3 . TRP A 1 378 ? 27.083  52.217 80.577 1.00 43.25 ? 378  TRP A CZ3 1 
ATOM   2933 C CH2 . TRP A 1 378 ? 26.299  51.595 79.575 1.00 44.44 ? 378  TRP A CH2 1 
ATOM   2934 N N   . MET A 1 379 ? 32.597  56.887 79.507 1.00 40.17 ? 379  MET A N   1 
ATOM   2935 C CA  . MET A 1 379 ? 33.534  57.622 80.350 1.00 44.09 ? 379  MET A CA  1 
ATOM   2936 C C   . MET A 1 379 ? 32.741  58.601 81.219 1.00 44.00 ? 379  MET A C   1 
ATOM   2937 O O   . MET A 1 379 ? 33.266  59.092 82.229 1.00 45.25 ? 379  MET A O   1 
ATOM   2938 C CB  . MET A 1 379 ? 34.494  58.487 79.533 1.00 45.01 ? 379  MET A CB  1 
ATOM   2939 C CG  . MET A 1 379 ? 35.148  57.787 78.390 1.00 51.18 ? 379  MET A CG  1 
ATOM   2940 S SD  . MET A 1 379 ? 36.801  58.501 78.125 1.00 60.09 ? 379  MET A SD  1 
ATOM   2941 C CE  . MET A 1 379 ? 37.570  57.901 79.845 1.00 53.71 ? 379  MET A CE  1 
ATOM   2942 N N   . ASP A 1 380 ? 31.475  58.867 80.869 1.00 42.88 ? 380  ASP A N   1 
ATOM   2943 C CA  . ASP A 1 380 ? 30.708  59.918 81.584 1.00 40.80 ? 380  ASP A CA  1 
ATOM   2944 C C   . ASP A 1 380 ? 29.214  59.585 81.502 1.00 41.65 ? 380  ASP A C   1 
ATOM   2945 O O   . ASP A 1 380 ? 28.383  60.393 81.089 1.00 40.17 ? 380  ASP A O   1 
ATOM   2946 C CB  . ASP A 1 380 ? 31.076  61.233 80.845 1.00 40.44 ? 380  ASP A CB  1 
ATOM   2947 C CG  . ASP A 1 380 ? 30.544  62.503 81.519 1.00 40.03 ? 380  ASP A CG  1 
ATOM   2948 O OD1 . ASP A 1 380 ? 30.152  62.441 82.701 1.00 39.46 ? 380  ASP A OD1 1 
ATOM   2949 O OD2 . ASP A 1 380 ? 30.532  63.556 80.833 1.00 39.56 ? 380  ASP A OD2 1 
ATOM   2950 N N   . ASP A 1 381 ? 28.877  58.394 81.970 1.00 42.68 ? 381  ASP A N   1 
ATOM   2951 C CA  . ASP A 1 381 ? 27.535  57.879 81.827 1.00 45.01 ? 381  ASP A CA  1 
ATOM   2952 C C   . ASP A 1 381 ? 26.429  58.477 82.680 1.00 46.14 ? 381  ASP A C   1 
ATOM   2953 O O   . ASP A 1 381 ? 25.241  58.164 82.470 1.00 44.54 ? 381  ASP A O   1 
ATOM   2954 C CB  . ASP A 1 381 ? 27.572  56.371 82.031 1.00 46.84 ? 381  ASP A CB  1 
ATOM   2955 C CG  . ASP A 1 381 ? 28.108  56.007 83.396 1.00 49.12 ? 381  ASP A CG  1 
ATOM   2956 O OD1 . ASP A 1 381 ? 29.248  56.425 83.724 1.00 49.77 ? 381  ASP A OD1 1 
ATOM   2957 O OD2 . ASP A 1 381 ? 27.382  55.322 84.128 1.00 50.26 ? 381  ASP A OD2 1 
ATOM   2958 N N   . ASN A 1 382 ? 26.808  59.320 83.636 1.00 45.52 ? 382  ASN A N   1 
ATOM   2959 C CA  . ASN A 1 382 ? 25.818  59.928 84.491 1.00 45.30 ? 382  ASN A CA  1 
ATOM   2960 C C   . ASN A 1 382 ? 25.590  61.371 84.147 1.00 44.09 ? 382  ASN A C   1 
ATOM   2961 O O   . ASN A 1 382 ? 24.973  62.114 84.918 1.00 45.36 ? 382  ASN A O   1 
ATOM   2962 C CB  . ASN A 1 382 ? 26.233  59.782 85.947 1.00 47.54 ? 382  ASN A CB  1 
ATOM   2963 C CG  . ASN A 1 382 ? 25.955  58.398 86.452 1.00 50.95 ? 382  ASN A CG  1 
ATOM   2964 O OD1 . ASN A 1 382 ? 24.810  57.910 86.331 1.00 51.60 ? 382  ASN A OD1 1 
ATOM   2965 N ND2 . ASN A 1 382 ? 26.987  57.727 87.006 1.00 51.14 ? 382  ASN A ND2 1 
ATOM   2966 N N   . ASN A 1 383 ? 26.111  61.767 82.991 1.00 41.58 ? 383  ASN A N   1 
ATOM   2967 C CA  . ASN A 1 383 ? 25.950  63.115 82.497 1.00 39.07 ? 383  ASN A CA  1 
ATOM   2968 C C   . ASN A 1 383 ? 24.494  63.249 81.922 1.00 38.71 ? 383  ASN A C   1 
ATOM   2969 O O   . ASN A 1 383 ? 24.120  62.594 80.921 1.00 35.66 ? 383  ASN A O   1 
ATOM   2970 C CB  . ASN A 1 383 ? 27.021  63.354 81.443 1.00 39.07 ? 383  ASN A CB  1 
ATOM   2971 C CG  . ASN A 1 383 ? 27.039  64.775 80.943 1.00 40.47 ? 383  ASN A CG  1 
ATOM   2972 O OD1 . ASN A 1 383 ? 28.108  65.303 80.628 1.00 40.18 ? 383  ASN A OD1 1 
ATOM   2973 N ND2 . ASN A 1 383 ? 25.864  65.400 80.838 1.00 38.44 ? 383  ASN A ND2 1 
ATOM   2974 N N   . GLY A 1 384 ? 23.704  64.086 82.611 1.00 36.06 ? 384  GLY A N   1 
ATOM   2975 C CA  . GLY A 1 384 ? 22.322  64.349 82.293 1.00 33.96 ? 384  GLY A CA  1 
ATOM   2976 C C   . GLY A 1 384 ? 22.132  64.920 80.904 1.00 33.81 ? 384  GLY A C   1 
ATOM   2977 O O   . GLY A 1 384 ? 21.224  64.487 80.217 1.00 32.07 ? 384  GLY A O   1 
ATOM   2978 N N   . ILE A 1 385 ? 22.986  65.865 80.512 1.00 32.40 ? 385  ILE A N   1 
ATOM   2979 C CA  . ILE A 1 385 ? 22.957  66.480 79.206 1.00 32.88 ? 385  ILE A CA  1 
ATOM   2980 C C   . ILE A 1 385 ? 23.274  65.452 78.101 1.00 33.75 ? 385  ILE A C   1 
ATOM   2981 O O   . ILE A 1 385 ? 22.608  65.449 77.042 1.00 34.02 ? 385  ILE A O   1 
ATOM   2982 C CB  . ILE A 1 385 ? 24.005  67.619 79.074 1.00 33.67 ? 385  ILE A CB  1 
ATOM   2983 C CG1 . ILE A 1 385 ? 23.764  68.705 80.125 1.00 36.23 ? 385  ILE A CG1 1 
ATOM   2984 C CG2 . ILE A 1 385 ? 23.944  68.218 77.722 1.00 31.51 ? 385  ILE A CG2 1 
ATOM   2985 C CD1 . ILE A 1 385 ? 22.351  69.186 80.174 1.00 39.59 ? 385  ILE A CD1 1 
ATOM   2986 N N   . LYS A 1 386 ? 24.293  64.612 78.317 1.00 33.44 ? 386  LYS A N   1 
ATOM   2987 C CA  . LYS A 1 386 ? 24.663  63.605 77.317 1.00 34.26 ? 386  LYS A CA  1 
ATOM   2988 C C   . LYS A 1 386 ? 23.573  62.543 77.246 1.00 33.64 ? 386  LYS A C   1 
ATOM   2989 O O   . LYS A 1 386 ? 23.261  62.063 76.167 1.00 32.65 ? 386  LYS A O   1 
ATOM   2990 C CB  . LYS A 1 386 ? 26.007  62.924 77.634 1.00 36.33 ? 386  LYS A CB  1 
ATOM   2991 C CG  . LYS A 1 386 ? 27.249  63.821 77.480 1.00 38.79 ? 386  LYS A CG  1 
ATOM   2992 C CD  . LYS A 1 386 ? 28.518  63.053 77.915 1.00 42.07 ? 386  LYS A CD  1 
ATOM   2993 C CE  . LYS A 1 386 ? 29.804  63.570 77.214 1.00 44.28 ? 386  LYS A CE  1 
ATOM   2994 N NZ  . LYS A 1 386 ? 31.016  63.438 78.115 1.00 46.73 ? 386  LYS A NZ  1 
ATOM   2995 N N   . ASN A 1 387 ? 22.996  62.189 78.387 1.00 32.49 ? 387  ASN A N   1 
ATOM   2996 C CA  . ASN A 1 387 ? 21.916  61.233 78.378 1.00 33.45 ? 387  ASN A CA  1 
ATOM   2997 C C   . ASN A 1 387 ? 20.686  61.799 77.568 1.00 33.26 ? 387  ASN A C   1 
ATOM   2998 O O   . ASN A 1 387 ? 20.097  61.117 76.722 1.00 32.92 ? 387  ASN A O   1 
ATOM   2999 C CB  . ASN A 1 387 ? 21.497  60.921 79.798 1.00 31.60 ? 387  ASN A CB  1 
ATOM   3000 C CG  . ASN A 1 387 ? 22.509  60.016 80.519 1.00 37.34 ? 387  ASN A CG  1 
ATOM   3001 O OD1 . ASN A 1 387 ? 23.364  59.374 79.881 1.00 36.44 ? 387  ASN A OD1 1 
ATOM   3002 N ND2 . ASN A 1 387 ? 22.406  59.954 81.855 1.00 33.72 ? 387  ASN A ND2 1 
ATOM   3003 N N   . ARG A 1 388 ? 20.305  63.032 77.865 1.00 31.94 ? 388  ARG A N   1 
ATOM   3004 C CA  . ARG A 1 388 ? 19.198  63.676 77.178 1.00 32.01 ? 388  ARG A CA  1 
ATOM   3005 C C   . ARG A 1 388 ? 19.502  63.760 75.666 1.00 32.61 ? 388  ARG A C   1 
ATOM   3006 O O   . ARG A 1 388 ? 18.668  63.368 74.834 1.00 31.70 ? 388  ARG A O   1 
ATOM   3007 C CB  . ARG A 1 388 ? 18.993  65.079 77.723 1.00 30.74 ? 388  ARG A CB  1 
ATOM   3008 C CG  . ARG A 1 388 ? 17.898  65.914 77.030 1.00 29.73 ? 388  ARG A CG  1 
ATOM   3009 C CD  . ARG A 1 388 ? 18.057  67.380 77.362 1.00 28.90 ? 388  ARG A CD  1 
ATOM   3010 N NE  . ARG A 1 388 ? 19.188  67.961 76.618 1.00 32.94 ? 388  ARG A NE  1 
ATOM   3011 C CZ  . ARG A 1 388 ? 19.811  69.098 76.964 1.00 32.00 ? 388  ARG A CZ  1 
ATOM   3012 N NH1 . ARG A 1 388 ? 20.816  69.566 76.242 1.00 31.32 ? 388  ARG A NH1 1 
ATOM   3013 N NH2 . ARG A 1 388 ? 19.428  69.767 78.040 1.00 31.46 ? 388  ARG A NH2 1 
ATOM   3014 N N   . ASP A 1 389 ? 20.681  64.261 75.312 1.00 30.96 ? 389  ASP A N   1 
ATOM   3015 C CA  . ASP A 1 389 ? 21.016  64.380 73.901 1.00 31.44 ? 389  ASP A CA  1 
ATOM   3016 C C   . ASP A 1 389 ? 21.158  63.020 73.151 1.00 30.89 ? 389  ASP A C   1 
ATOM   3017 O O   . ASP A 1 389 ? 20.777  62.894 71.946 1.00 26.87 ? 389  ASP A O   1 
ATOM   3018 C CB  . ASP A 1 389 ? 22.286  65.209 73.723 1.00 30.29 ? 389  ASP A CB  1 
ATOM   3019 C CG  . ASP A 1 389 ? 22.091  66.717 74.091 1.00 33.00 ? 389  ASP A CG  1 
ATOM   3020 O OD1 . ASP A 1 389 ? 20.946  67.223 74.219 1.00 30.67 ? 389  ASP A OD1 1 
ATOM   3021 O OD2 . ASP A 1 389 ? 23.124  67.386 74.252 1.00 33.20 ? 389  ASP A OD2 1 
ATOM   3022 N N   . GLY A 1 390 ? 21.683  62.017 73.863 1.00 30.07 ? 390  GLY A N   1 
ATOM   3023 C CA  . GLY A 1 390 ? 21.859  60.694 73.266 1.00 30.18 ? 390  GLY A CA  1 
ATOM   3024 C C   . GLY A 1 390 ? 20.489  60.087 72.924 1.00 29.88 ? 390  GLY A C   1 
ATOM   3025 O O   . GLY A 1 390 ? 20.309  59.472 71.892 1.00 29.25 ? 390  GLY A O   1 
ATOM   3026 N N   . LEU A 1 391 ? 19.541  60.266 73.827 1.00 29.16 ? 391  LEU A N   1 
ATOM   3027 C CA  . LEU A 1 391 ? 18.180  59.797 73.635 1.00 29.21 ? 391  LEU A CA  1 
ATOM   3028 C C   . LEU A 1 391 ? 17.508  60.536 72.454 1.00 28.74 ? 391  LEU A C   1 
ATOM   3029 O O   . LEU A 1 391 ? 16.824  59.934 71.606 1.00 26.83 ? 391  LEU A O   1 
ATOM   3030 C CB  . LEU A 1 391 ? 17.419  60.026 74.942 1.00 31.53 ? 391  LEU A CB  1 
ATOM   3031 C CG  . LEU A 1 391 ? 16.161  59.188 75.228 1.00 34.15 ? 391  LEU A CG  1 
ATOM   3032 C CD1 . LEU A 1 391 ? 16.361  57.739 74.725 1.00 37.00 ? 391  LEU A CD1 1 
ATOM   3033 C CD2 . LEU A 1 391 ? 15.862  59.220 76.715 1.00 32.94 ? 391  LEU A CD2 1 
ATOM   3034 N N   . ASP A 1 392 ? 17.732  61.847 72.391 1.00 28.22 ? 392  ASP A N   1 
ATOM   3035 C CA  . ASP A 1 392 ? 17.195  62.664 71.322 1.00 28.70 ? 392  ASP A CA  1 
ATOM   3036 C C   . ASP A 1 392 ? 17.754  62.098 69.995 1.00 27.74 ? 392  ASP A C   1 
ATOM   3037 O O   . ASP A 1 392 ? 17.008  61.928 69.002 1.00 25.79 ? 392  ASP A O   1 
ATOM   3038 C CB  . ASP A 1 392 ? 17.636  64.121 71.536 1.00 30.53 ? 392  ASP A CB  1 
ATOM   3039 C CG  . ASP A 1 392 ? 16.823  65.148 70.715 1.00 35.14 ? 392  ASP A CG  1 
ATOM   3040 O OD1 . ASP A 1 392 ? 16.060  64.799 69.774 1.00 35.70 ? 392  ASP A OD1 1 
ATOM   3041 O OD2 . ASP A 1 392 ? 16.982  66.355 71.025 1.00 35.01 ? 392  ASP A OD2 1 
ATOM   3042 N N   . ASP A 1 393 ? 19.057  61.787 69.940 1.00 26.99 ? 393  ASP A N   1 
ATOM   3043 C CA  . ASP A 1 393 ? 19.595  61.251 68.679 1.00 26.34 ? 393  ASP A CA  1 
ATOM   3044 C C   . ASP A 1 393 ? 19.043  59.850 68.385 1.00 26.92 ? 393  ASP A C   1 
ATOM   3045 O O   . ASP A 1 393 ? 18.740  59.515 67.243 1.00 26.93 ? 393  ASP A O   1 
ATOM   3046 C CB  . ASP A 1 393 ? 21.118  61.200 68.732 1.00 28.47 ? 393  ASP A CB  1 
ATOM   3047 C CG  . ASP A 1 393 ? 21.751  62.593 68.568 1.00 33.31 ? 393  ASP A CG  1 
ATOM   3048 O OD1 . ASP A 1 393 ? 21.142  63.466 67.873 1.00 33.40 ? 393  ASP A OD1 1 
ATOM   3049 O OD2 . ASP A 1 393 ? 22.859  62.799 69.118 1.00 33.68 ? 393  ASP A OD2 1 
ATOM   3050 N N   . ILE A 1 394 ? 18.907  59.023 69.407 1.00 25.21 ? 394  ILE A N   1 
ATOM   3051 C CA  . ILE A 1 394 ? 18.351  57.684 69.147 1.00 26.24 ? 394  ILE A CA  1 
ATOM   3052 C C   . ILE A 1 394 ? 16.985  57.821 68.455 1.00 26.04 ? 394  ILE A C   1 
ATOM   3053 O O   . ILE A 1 394 ? 16.750  57.220 67.416 1.00 25.99 ? 394  ILE A O   1 
ATOM   3054 C CB  . ILE A 1 394 ? 18.181  56.895 70.479 1.00 25.52 ? 394  ILE A CB  1 
ATOM   3055 C CG1 . ILE A 1 394 ? 19.571  56.387 70.980 1.00 24.13 ? 394  ILE A CG1 1 
ATOM   3056 C CG2 . ILE A 1 394 ? 17.167  55.695 70.306 1.00 24.29 ? 394  ILE A CG2 1 
ATOM   3057 C CD1 . ILE A 1 394 ? 19.517  56.030 72.498 1.00 23.95 ? 394  ILE A CD1 1 
ATOM   3058 N N   . VAL A 1 395 ? 16.107  58.657 69.012 1.00 26.46 ? 395  VAL A N   1 
ATOM   3059 C CA  . VAL A 1 395 ? 14.773  58.809 68.447 1.00 26.04 ? 395  VAL A CA  1 
ATOM   3060 C C   . VAL A 1 395 ? 14.789  59.350 67.024 1.00 24.59 ? 395  VAL A C   1 
ATOM   3061 O O   . VAL A 1 395 ? 14.156  58.781 66.128 1.00 24.18 ? 395  VAL A O   1 
ATOM   3062 C CB  . VAL A 1 395 ? 13.879  59.698 69.377 1.00 25.08 ? 395  VAL A CB  1 
ATOM   3063 C CG1 . VAL A 1 395 ? 12.463  59.875 68.764 1.00 25.69 ? 395  VAL A CG1 1 
ATOM   3064 C CG2 . VAL A 1 395 ? 13.725  58.998 70.735 1.00 24.38 ? 395  VAL A CG2 1 
ATOM   3065 N N   . GLY A 1 396 ? 15.526  60.440 66.812 1.00 25.14 ? 396  GLY A N   1 
ATOM   3066 C CA  . GLY A 1 396 ? 15.624  60.991 65.463 1.00 24.42 ? 396  GLY A CA  1 
ATOM   3067 C C   . GLY A 1 396 ? 16.318  60.078 64.451 1.00 25.59 ? 396  GLY A C   1 
ATOM   3068 O O   . GLY A 1 396 ? 15.859  59.963 63.287 1.00 26.23 ? 396  GLY A O   1 
ATOM   3069 N N   . ASP A 1 397 ? 17.436  59.449 64.838 1.00 24.92 ? 397  ASP A N   1 
ATOM   3070 C CA  . ASP A 1 397 ? 18.168  58.538 63.916 1.00 25.51 ? 397  ASP A CA  1 
ATOM   3071 C C   . ASP A 1 397 ? 17.284  57.324 63.530 1.00 25.10 ? 397  ASP A C   1 
ATOM   3072 O O   . ASP A 1 397 ? 17.159  56.977 62.367 1.00 25.72 ? 397  ASP A O   1 
ATOM   3073 C CB  . ASP A 1 397 ? 19.455  57.967 64.579 1.00 27.65 ? 397  ASP A CB  1 
ATOM   3074 C CG  . ASP A 1 397 ? 20.565  59.048 64.787 1.00 29.21 ? 397  ASP A CG  1 
ATOM   3075 O OD1 . ASP A 1 397 ? 20.441  60.141 64.196 1.00 28.71 ? 397  ASP A OD1 1 
ATOM   3076 O OD2 . ASP A 1 397 ? 21.558  58.790 65.505 1.00 27.93 ? 397  ASP A OD2 1 
ATOM   3077 N N   . HIS A 1 398 ? 16.670  56.682 64.513 1.00 25.37 ? 398  HIS A N   1 
ATOM   3078 C CA  . HIS A 1 398 ? 15.844  55.507 64.234 1.00 24.64 ? 398  HIS A CA  1 
ATOM   3079 C C   . HIS A 1 398 ? 14.565  55.819 63.461 1.00 25.07 ? 398  HIS A C   1 
ATOM   3080 O O   . HIS A 1 398 ? 14.245  55.139 62.501 1.00 25.31 ? 398  HIS A O   1 
ATOM   3081 C CB  . HIS A 1 398 ? 15.492  54.768 65.535 1.00 23.60 ? 398  HIS A CB  1 
ATOM   3082 C CG  . HIS A 1 398 ? 14.429  53.728 65.377 1.00 24.66 ? 398  HIS A CG  1 
ATOM   3083 N ND1 . HIS A 1 398 ? 14.560  52.644 64.539 1.00 25.29 ? 398  HIS A ND1 1 
ATOM   3084 C CD2 . HIS A 1 398 ? 13.213  53.609 65.960 1.00 24.95 ? 398  HIS A CD2 1 
ATOM   3085 C CE1 . HIS A 1 398 ? 13.478  51.897 64.617 1.00 24.70 ? 398  HIS A CE1 1 
ATOM   3086 N NE2 . HIS A 1 398 ? 12.647  52.459 65.478 1.00 27.81 ? 398  HIS A NE2 1 
ATOM   3087 N N   . ASN A 1 399 ? 13.880  56.899 63.818 1.00 26.77 ? 399  ASN A N   1 
ATOM   3088 C CA  . ASN A 1 399 ? 12.624  57.191 63.181 1.00 25.28 ? 399  ASN A CA  1 
ATOM   3089 C C   . ASN A 1 399 ? 12.618  58.030 61.938 1.00 26.06 ? 399  ASN A C   1 
ATOM   3090 O O   . ASN A 1 399 ? 11.691  57.937 61.094 1.00 24.86 ? 399  ASN A O   1 
ATOM   3091 C CB  . ASN A 1 399 ? 11.740  57.838 64.228 1.00 26.66 ? 399  ASN A CB  1 
ATOM   3092 C CG  . ASN A 1 399 ? 11.270  56.833 65.280 1.00 27.61 ? 399  ASN A CG  1 
ATOM   3093 O OD1 . ASN A 1 399 ? 10.520  55.900 64.943 1.00 26.40 ? 399  ASN A OD1 1 
ATOM   3094 N ND2 . ASN A 1 399 ? 11.689  57.022 66.558 1.00 23.36 ? 399  ASN A ND2 1 
ATOM   3095 N N   . VAL A 1 400 ? 13.647  58.854 61.790 1.00 24.74 ? 400  VAL A N   1 
ATOM   3096 C CA  . VAL A 1 400 ? 13.642  59.794 60.660 1.00 23.08 ? 400  VAL A CA  1 
ATOM   3097 C C   . VAL A 1 400 ? 14.915  59.773 59.845 1.00 24.69 ? 400  VAL A C   1 
ATOM   3098 O O   . VAL A 1 400 ? 14.888  59.461 58.640 1.00 26.20 ? 400  VAL A O   1 
ATOM   3099 C CB  . VAL A 1 400 ? 13.436  61.246 61.167 1.00 22.99 ? 400  VAL A CB  1 
ATOM   3100 C CG1 . VAL A 1 400 ? 13.541  62.278 59.975 1.00 22.84 ? 400  VAL A CG1 1 
ATOM   3101 C CG2 . VAL A 1 400 ? 12.011  61.385 61.848 1.00 21.12 ? 400  VAL A CG2 1 
ATOM   3102 N N   . ILE A 1 401 ? 16.053  60.075 60.473 1.00 24.05 ? 401  ILE A N   1 
ATOM   3103 C CA  . ILE A 1 401 ? 17.286  60.146 59.677 1.00 23.74 ? 401  ILE A CA  1 
ATOM   3104 C C   . ILE A 1 401 ? 17.764  58.871 58.990 1.00 24.57 ? 401  ILE A C   1 
ATOM   3105 O O   . ILE A 1 401 ? 17.965  58.874 57.752 1.00 26.24 ? 401  ILE A O   1 
ATOM   3106 C CB  . ILE A 1 401 ? 18.442  60.737 60.489 1.00 21.77 ? 401  ILE A CB  1 
ATOM   3107 C CG1 . ILE A 1 401 ? 17.981  62.102 61.018 1.00 24.26 ? 401  ILE A CG1 1 
ATOM   3108 C CG2 . ILE A 1 401 ? 19.773  60.828 59.593 1.00 21.12 ? 401  ILE A CG2 1 
ATOM   3109 C CD1 . ILE A 1 401 ? 19.022  62.825 61.824 1.00 26.87 ? 401  ILE A CD1 1 
ATOM   3110 N N   . CYS A 1 402 ? 17.939  57.778 59.735 1.00 22.87 ? 402  CYS A N   1 
ATOM   3111 C CA  . CYS A 1 402 ? 18.463  56.594 59.060 1.00 23.16 ? 402  CYS A CA  1 
ATOM   3112 C C   . CYS A 1 402 ? 17.473  56.007 58.059 1.00 23.76 ? 402  CYS A C   1 
ATOM   3113 O O   . CYS A 1 402 ? 17.888  55.526 57.024 1.00 24.85 ? 402  CYS A O   1 
ATOM   3114 C CB  . CYS A 1 402 ? 18.929  55.587 60.114 1.00 24.02 ? 402  CYS A CB  1 
ATOM   3115 S SG  . CYS A 1 402 ? 20.356  56.330 61.019 1.00 28.07 ? 402  CYS A SG  1 
ATOM   3116 N N   . PRO A 1 403 ? 16.153  56.014 58.357 1.00 22.29 ? 403  PRO A N   1 
ATOM   3117 C CA  . PRO A 1 403 ? 15.278  55.465 57.303 1.00 24.79 ? 403  PRO A CA  1 
ATOM   3118 C C   . PRO A 1 403 ? 15.393  56.377 56.052 1.00 23.97 ? 403  PRO A C   1 
ATOM   3119 O O   . PRO A 1 403 ? 15.344  55.878 54.935 1.00 25.92 ? 403  PRO A O   1 
ATOM   3120 C CB  . PRO A 1 403 ? 13.856  55.583 57.897 1.00 23.61 ? 403  PRO A CB  1 
ATOM   3121 C CG  . PRO A 1 403 ? 14.106  55.444 59.404 1.00 24.68 ? 403  PRO A CG  1 
ATOM   3122 C CD  . PRO A 1 403 ? 15.437  56.140 59.645 1.00 23.40 ? 403  PRO A CD  1 
ATOM   3123 N N   . LEU A 1 404 ? 15.515  57.696 56.228 1.00 24.65 ? 404  LEU A N   1 
ATOM   3124 C CA  . LEU A 1 404 ? 15.600  58.551 55.035 1.00 25.57 ? 404  LEU A CA  1 
ATOM   3125 C C   . LEU A 1 404 ? 16.903  58.273 54.255 1.00 26.59 ? 404  LEU A C   1 
ATOM   3126 O O   . LEU A 1 404 ? 16.909  58.200 52.993 1.00 25.90 ? 404  LEU A O   1 
ATOM   3127 C CB  . LEU A 1 404 ? 15.496  60.033 55.415 1.00 26.58 ? 404  LEU A CB  1 
ATOM   3128 C CG  . LEU A 1 404 ? 15.463  61.014 54.206 1.00 28.46 ? 404  LEU A CG  1 
ATOM   3129 C CD1 . LEU A 1 404 ? 14.499  62.190 54.453 1.00 25.35 ? 404  LEU A CD1 1 
ATOM   3130 C CD2 . LEU A 1 404 ? 16.881  61.507 53.962 1.00 25.92 ? 404  LEU A CD2 1 
ATOM   3131 N N   . MET A 1 405 ? 17.999  58.060 54.987 1.00 26.98 ? 405  MET A N   1 
ATOM   3132 C CA  . MET A 1 405 ? 19.273  57.784 54.317 1.00 27.71 ? 405  MET A CA  1 
ATOM   3133 C C   . MET A 1 405 ? 19.218  56.455 53.571 1.00 28.59 ? 405  MET A C   1 
ATOM   3134 O O   . MET A 1 405 ? 19.786  56.311 52.480 1.00 28.64 ? 405  MET A O   1 
ATOM   3135 C CB  . MET A 1 405 ? 20.461  57.784 55.328 1.00 28.73 ? 405  MET A CB  1 
ATOM   3136 C CG  . MET A 1 405 ? 20.699  59.153 55.914 1.00 27.01 ? 405  MET A CG  1 
ATOM   3137 S SD  . MET A 1 405 ? 20.851  60.475 54.675 1.00 30.19 ? 405  MET A SD  1 
ATOM   3138 C CE  . MET A 1 405 ? 22.295  59.746 53.682 1.00 26.25 ? 405  MET A CE  1 
ATOM   3139 N N   . HIS A 1 406 ? 18.511  55.489 54.126 1.00 28.93 ? 406  HIS A N   1 
ATOM   3140 C CA  . HIS A 1 406 ? 18.407  54.200 53.443 1.00 29.21 ? 406  HIS A CA  1 
ATOM   3141 C C   . HIS A 1 406 ? 17.550  54.458 52.168 1.00 30.27 ? 406  HIS A C   1 
ATOM   3142 O O   . HIS A 1 406 ? 17.860  53.980 51.069 1.00 30.19 ? 406  HIS A O   1 
ATOM   3143 C CB  . HIS A 1 406 ? 17.733  53.173 54.366 1.00 28.76 ? 406  HIS A CB  1 
ATOM   3144 C CG  . HIS A 1 406 ? 17.520  51.838 53.725 1.00 32.48 ? 406  HIS A CG  1 
ATOM   3145 N ND1 . HIS A 1 406 ? 18.553  50.950 53.484 1.00 34.02 ? 406  HIS A ND1 1 
ATOM   3146 C CD2 . HIS A 1 406 ? 16.396  51.253 53.239 1.00 32.60 ? 406  HIS A CD2 1 
ATOM   3147 C CE1 . HIS A 1 406 ? 18.073  49.879 52.880 1.00 33.20 ? 406  HIS A CE1 1 
ATOM   3148 N NE2 . HIS A 1 406 ? 16.768  50.040 52.719 1.00 35.52 ? 406  HIS A NE2 1 
ATOM   3149 N N   . PHE A 1 407 ? 16.471  55.217 52.310 1.00 28.26 ? 407  PHE A N   1 
ATOM   3150 C CA  . PHE A 1 407 ? 15.657  55.521 51.130 1.00 27.85 ? 407  PHE A CA  1 
ATOM   3151 C C   . PHE A 1 407 ? 16.500  56.264 50.070 1.00 27.51 ? 407  PHE A C   1 
ATOM   3152 O O   . PHE A 1 407 ? 16.441  55.925 48.874 1.00 26.43 ? 407  PHE A O   1 
ATOM   3153 C CB  . PHE A 1 407 ? 14.465  56.430 51.491 1.00 27.87 ? 407  PHE A CB  1 
ATOM   3154 C CG  . PHE A 1 407 ? 13.641  56.879 50.287 1.00 26.62 ? 407  PHE A CG  1 
ATOM   3155 C CD1 . PHE A 1 407 ? 12.827  55.984 49.618 1.00 24.70 ? 407  PHE A CD1 1 
ATOM   3156 C CD2 . PHE A 1 407 ? 13.727  58.187 49.819 1.00 26.39 ? 407  PHE A CD2 1 
ATOM   3157 C CE1 . PHE A 1 407 ? 12.084  56.384 48.477 1.00 26.71 ? 407  PHE A CE1 1 
ATOM   3158 C CE2 . PHE A 1 407 ? 13.001  58.605 48.675 1.00 26.99 ? 407  PHE A CE2 1 
ATOM   3159 C CZ  . PHE A 1 407 ? 12.177  57.707 48.015 1.00 26.85 ? 407  PHE A CZ  1 
ATOM   3160 N N   . VAL A 1 408 ? 17.284  57.260 50.498 1.00 27.13 ? 408  VAL A N   1 
ATOM   3161 C CA  . VAL A 1 408 ? 18.015  58.027 49.504 1.00 30.76 ? 408  VAL A CA  1 
ATOM   3162 C C   . VAL A 1 408 ? 19.120  57.244 48.789 1.00 31.68 ? 408  VAL A C   1 
ATOM   3163 O O   . VAL A 1 408 ? 19.371  57.473 47.610 1.00 31.26 ? 408  VAL A O   1 
ATOM   3164 C CB  . VAL A 1 408 ? 18.557  59.381 50.073 1.00 32.91 ? 408  VAL A CB  1 
ATOM   3165 C CG1 . VAL A 1 408 ? 19.750  59.156 50.947 1.00 33.39 ? 408  VAL A CG1 1 
ATOM   3166 C CG2 . VAL A 1 408 ? 18.893  60.353 48.895 1.00 35.98 ? 408  VAL A CG2 1 
ATOM   3167 N N   . ASN A 1 409 ? 19.739  56.279 49.469 1.00 32.56 ? 409  ASN A N   1 
ATOM   3168 C CA  . ASN A 1 409 ? 20.776  55.508 48.798 1.00 32.37 ? 409  ASN A CA  1 
ATOM   3169 C C   . ASN A 1 409 ? 20.084  54.515 47.877 1.00 32.40 ? 409  ASN A C   1 
ATOM   3170 O O   . ASN A 1 409 ? 20.505  54.335 46.755 1.00 32.69 ? 409  ASN A O   1 
ATOM   3171 C CB  . ASN A 1 409 ? 21.712  54.871 49.841 1.00 32.81 ? 409  ASN A CB  1 
ATOM   3172 C CG  . ASN A 1 409 ? 22.801  55.878 50.285 1.00 34.82 ? 409  ASN A CG  1 
ATOM   3173 O OD1 . ASN A 1 409 ? 23.690  56.236 49.491 1.00 36.24 ? 409  ASN A OD1 1 
ATOM   3174 N ND2 . ASN A 1 409 ? 22.723  56.350 51.524 1.00 34.25 ? 409  ASN A ND2 1 
ATOM   3175 N N   . LYS A 1 410 ? 18.993  53.892 48.295 1.00 31.06 ? 410  LYS A N   1 
ATOM   3176 C CA  . LYS A 1 410 ? 18.321  52.997 47.365 1.00 31.25 ? 410  LYS A CA  1 
ATOM   3177 C C   . LYS A 1 410 ? 17.753  53.733 46.140 1.00 30.77 ? 410  LYS A C   1 
ATOM   3178 O O   . LYS A 1 410 ? 17.870  53.258 45.022 1.00 30.06 ? 410  LYS A O   1 
ATOM   3179 C CB  . LYS A 1 410 ? 17.170  52.268 48.041 1.00 32.22 ? 410  LYS A CB  1 
ATOM   3180 C CG  . LYS A 1 410 ? 17.638  51.315 49.068 1.00 36.90 ? 410  LYS A CG  1 
ATOM   3181 C CD  . LYS A 1 410 ? 18.413  50.184 48.429 1.00 40.51 ? 410  LYS A CD  1 
ATOM   3182 C CE  . LYS A 1 410 ? 18.850  49.224 49.508 1.00 44.37 ? 410  LYS A CE  1 
ATOM   3183 N NZ  . LYS A 1 410 ? 19.566  48.079 48.870 1.00 46.45 ? 410  LYS A NZ  1 
ATOM   3184 N N   . TYR A 1 411 ? 17.141  54.899 46.357 1.00 30.01 ? 411  TYR A N   1 
ATOM   3185 C CA  . TYR A 1 411 ? 16.519  55.653 45.271 1.00 28.93 ? 411  TYR A CA  1 
ATOM   3186 C C   . TYR A 1 411 ? 17.492  56.145 44.209 1.00 29.52 ? 411  TYR A C   1 
ATOM   3187 O O   . TYR A 1 411 ? 17.243  56.015 43.001 1.00 29.42 ? 411  TYR A O   1 
ATOM   3188 C CB  . TYR A 1 411 ? 15.766  56.881 45.827 1.00 29.31 ? 411  TYR A CB  1 
ATOM   3189 C CG  . TYR A 1 411 ? 14.934  57.541 44.775 1.00 28.96 ? 411  TYR A CG  1 
ATOM   3190 C CD1 . TYR A 1 411 ? 13.627  57.090 44.523 1.00 29.17 ? 411  TYR A CD1 1 
ATOM   3191 C CD2 . TYR A 1 411 ? 15.486  58.543 43.944 1.00 28.59 ? 411  TYR A CD2 1 
ATOM   3192 C CE1 . TYR A 1 411 ? 12.874  57.594 43.468 1.00 29.21 ? 411  TYR A CE1 1 
ATOM   3193 C CE2 . TYR A 1 411 ? 14.757  59.074 42.882 1.00 27.76 ? 411  TYR A CE2 1 
ATOM   3194 C CZ  . TYR A 1 411 ? 13.452  58.588 42.643 1.00 28.61 ? 411  TYR A CZ  1 
ATOM   3195 O OH  . TYR A 1 411 ? 12.768  58.980 41.529 1.00 29.23 ? 411  TYR A OH  1 
ATOM   3196 N N   . THR A 1 412 ? 18.577  56.730 44.682 1.00 29.86 ? 412  THR A N   1 
ATOM   3197 C CA  . THR A 1 412 ? 19.630  57.317 43.850 1.00 31.81 ? 412  THR A CA  1 
ATOM   3198 C C   . THR A 1 412 ? 20.276  56.346 42.841 1.00 33.92 ? 412  THR A C   1 
ATOM   3199 O O   . THR A 1 412 ? 20.733  56.747 41.799 1.00 34.90 ? 412  THR A O   1 
ATOM   3200 C CB  . THR A 1 412 ? 20.675  57.975 44.785 1.00 30.93 ? 412  THR A CB  1 
ATOM   3201 O OG1 . THR A 1 412 ? 20.015  59.038 45.516 1.00 31.46 ? 412  THR A OG1 1 
ATOM   3202 C CG2 . THR A 1 412 ? 21.896  58.542 43.981 1.00 32.10 ? 412  THR A CG2 1 
ATOM   3203 N N   . LYS A 1 413 ? 20.273  55.070 43.160 1.00 35.15 ? 413  LYS A N   1 
ATOM   3204 C CA  . LYS A 1 413 ? 20.803  54.066 42.270 1.00 37.33 ? 413  LYS A CA  1 
ATOM   3205 C C   . LYS A 1 413 ? 19.994  54.028 40.944 1.00 38.81 ? 413  LYS A C   1 
ATOM   3206 O O   . LYS A 1 413 ? 20.554  53.716 39.882 1.00 37.97 ? 413  LYS A O   1 
ATOM   3207 C CB  . LYS A 1 413 ? 20.708  52.695 42.959 1.00 37.75 ? 413  LYS A CB  1 
ATOM   3208 C CG  . LYS A 1 413 ? 20.911  51.539 42.002 1.00 41.42 ? 413  LYS A CG  1 
ATOM   3209 N N   . PHE A 1 414 ? 18.686  54.316 41.015 1.00 36.77 ? 414  PHE A N   1 
ATOM   3210 C CA  . PHE A 1 414 ? 17.813  54.281 39.839 1.00 35.79 ? 414  PHE A CA  1 
ATOM   3211 C C   . PHE A 1 414 ? 17.222  55.629 39.401 1.00 35.57 ? 414  PHE A C   1 
ATOM   3212 O O   . PHE A 1 414 ? 16.682  55.730 38.289 1.00 34.10 ? 414  PHE A O   1 
ATOM   3213 C CB  . PHE A 1 414 ? 16.622  53.376 40.102 1.00 35.82 ? 414  PHE A CB  1 
ATOM   3214 C CG  . PHE A 1 414 ? 16.980  51.945 40.261 1.00 39.84 ? 414  PHE A CG  1 
ATOM   3215 C CD1 . PHE A 1 414 ? 17.045  51.102 39.151 1.00 41.11 ? 414  PHE A CD1 1 
ATOM   3216 C CD2 . PHE A 1 414 ? 17.230  51.426 41.512 1.00 39.14 ? 414  PHE A CD2 1 
ATOM   3217 C CE1 . PHE A 1 414 ? 17.349  49.750 39.304 1.00 42.16 ? 414  PHE A CE1 1 
ATOM   3218 C CE2 . PHE A 1 414 ? 17.535  50.084 41.682 1.00 42.71 ? 414  PHE A CE2 1 
ATOM   3219 C CZ  . PHE A 1 414 ? 17.592  49.247 40.585 1.00 43.04 ? 414  PHE A CZ  1 
ATOM   3220 N N   . GLY A 1 415 ? 17.305  56.642 40.267 1.00 34.34 ? 415  GLY A N   1 
ATOM   3221 C CA  . GLY A 1 415 ? 16.678  57.928 39.974 1.00 34.52 ? 415  GLY A CA  1 
ATOM   3222 C C   . GLY A 1 415 ? 17.373  58.870 38.999 1.00 34.23 ? 415  GLY A C   1 
ATOM   3223 O O   . GLY A 1 415 ? 18.430  58.580 38.476 1.00 31.39 ? 415  GLY A O   1 
ATOM   3224 N N   . ASN A 1 416 ? 16.781  60.035 38.791 1.00 33.90 ? 416  ASN A N   1 
ATOM   3225 C CA  . ASN A 1 416 ? 17.380  60.951 37.856 1.00 34.31 ? 416  ASN A CA  1 
ATOM   3226 C C   . ASN A 1 416 ? 17.943  62.227 38.467 1.00 34.20 ? 416  ASN A C   1 
ATOM   3227 O O   . ASN A 1 416 ? 18.121  63.223 37.764 1.00 36.18 ? 416  ASN A O   1 
ATOM   3228 C CB  . ASN A 1 416 ? 16.363  61.253 36.724 1.00 37.57 ? 416  ASN A CB  1 
ATOM   3229 C CG  . ASN A 1 416 ? 17.008  62.007 35.545 1.00 40.17 ? 416  ASN A CG  1 
ATOM   3230 O OD1 . ASN A 1 416 ? 16.605  63.124 35.228 1.00 40.00 ? 416  ASN A OD1 1 
ATOM   3231 N ND2 . ASN A 1 416 ? 18.026  61.423 34.914 1.00 40.84 ? 416  ASN A ND2 1 
ATOM   3232 N N   . GLY A 1 417 ? 18.267  62.200 39.767 1.00 32.35 ? 417  GLY A N   1 
ATOM   3233 C CA  . GLY A 1 417 ? 18.848  63.384 40.385 1.00 32.00 ? 417  GLY A CA  1 
ATOM   3234 C C   . GLY A 1 417 ? 18.362  63.556 41.818 1.00 31.53 ? 417  GLY A C   1 
ATOM   3235 O O   . GLY A 1 417 ? 17.152  63.676 42.082 1.00 32.82 ? 417  GLY A O   1 
ATOM   3236 N N   . THR A 1 418 ? 19.298  63.577 42.741 1.00 30.72 ? 418  THR A N   1 
ATOM   3237 C CA  . THR A 1 418 ? 18.964  63.686 44.159 1.00 30.85 ? 418  THR A CA  1 
ATOM   3238 C C   . THR A 1 418 ? 19.726  64.837 44.805 1.00 30.99 ? 418  THR A C   1 
ATOM   3239 O O   . THR A 1 418 ? 20.949  64.962 44.556 1.00 31.54 ? 418  THR A O   1 
ATOM   3240 C CB  . THR A 1 418 ? 19.401  62.411 44.912 1.00 31.06 ? 418  THR A CB  1 
ATOM   3241 O OG1 . THR A 1 418 ? 18.783  61.253 44.322 1.00 32.28 ? 418  THR A OG1 1 
ATOM   3242 C CG2 . THR A 1 418 ? 19.015  62.528 46.415 1.00 29.75 ? 418  THR A CG2 1 
ATOM   3243 N N   . TYR A 1 419 ? 19.023  65.661 45.598 1.00 28.59 ? 419  TYR A N   1 
ATOM   3244 C CA  . TYR A 1 419 ? 19.636  66.744 46.350 1.00 30.45 ? 419  TYR A CA  1 
ATOM   3245 C C   . TYR A 1 419 ? 19.268  66.540 47.828 1.00 30.68 ? 419  TYR A C   1 
ATOM   3246 O O   . TYR A 1 419 ? 18.076  66.458 48.197 1.00 32.60 ? 419  TYR A O   1 
ATOM   3247 C CB  . TYR A 1 419 ? 19.199  68.140 45.853 1.00 29.68 ? 419  TYR A CB  1 
ATOM   3248 C CG  . TYR A 1 419 ? 19.649  68.381 44.406 1.00 29.39 ? 419  TYR A CG  1 
ATOM   3249 C CD1 . TYR A 1 419 ? 18.899  67.875 43.344 1.00 28.67 ? 419  TYR A CD1 1 
ATOM   3250 C CD2 . TYR A 1 419 ? 20.855  69.017 44.122 1.00 28.62 ? 419  TYR A CD2 1 
ATOM   3251 C CE1 . TYR A 1 419 ? 19.313  67.972 42.038 1.00 30.37 ? 419  TYR A CE1 1 
ATOM   3252 C CE2 . TYR A 1 419 ? 21.301  69.137 42.787 1.00 31.56 ? 419  TYR A CE2 1 
ATOM   3253 C CZ  . TYR A 1 419 ? 20.513  68.610 41.756 1.00 31.81 ? 419  TYR A CZ  1 
ATOM   3254 O OH  . TYR A 1 419 ? 20.838  68.759 40.431 1.00 33.96 ? 419  TYR A OH  1 
ATOM   3255 N N   . LEU A 1 420 ? 20.296  66.448 48.668 1.00 29.16 ? 420  LEU A N   1 
ATOM   3256 C CA  . LEU A 1 420 ? 20.104  66.183 50.084 1.00 29.03 ? 420  LEU A CA  1 
ATOM   3257 C C   . LEU A 1 420 ? 20.508  67.306 51.024 1.00 27.63 ? 420  LEU A C   1 
ATOM   3258 O O   . LEU A 1 420 ? 21.576  67.944 50.880 1.00 26.87 ? 420  LEU A O   1 
ATOM   3259 C CB  . LEU A 1 420 ? 20.832  64.874 50.431 1.00 27.38 ? 420  LEU A CB  1 
ATOM   3260 C CG  . LEU A 1 420 ? 20.830  64.382 51.898 1.00 29.93 ? 420  LEU A CG  1 
ATOM   3261 C CD1 . LEU A 1 420 ? 19.413  63.902 52.234 1.00 27.39 ? 420  LEU A CD1 1 
ATOM   3262 C CD2 . LEU A 1 420 ? 21.899  63.231 52.103 1.00 27.46 ? 420  LEU A CD2 1 
ATOM   3263 N N   . TYR A 1 421 ? 19.640  67.600 51.991 1.00 28.43 ? 421  TYR A N   1 
ATOM   3264 C CA  . TYR A 1 421 ? 20.009  68.660 52.952 1.00 28.43 ? 421  TYR A CA  1 
ATOM   3265 C C   . TYR A 1 421 ? 19.938  68.281 54.442 1.00 28.54 ? 421  TYR A C   1 
ATOM   3266 O O   . TYR A 1 421 ? 19.238  67.334 54.823 1.00 28.82 ? 421  TYR A O   1 
ATOM   3267 C CB  . TYR A 1 421 ? 19.141  69.909 52.738 1.00 28.65 ? 421  TYR A CB  1 
ATOM   3268 C CG  . TYR A 1 421 ? 17.702  69.744 53.234 1.00 27.07 ? 421  TYR A CG  1 
ATOM   3269 C CD1 . TYR A 1 421 ? 17.393  69.827 54.597 1.00 25.43 ? 421  TYR A CD1 1 
ATOM   3270 C CD2 . TYR A 1 421 ? 16.669  69.447 52.330 1.00 27.01 ? 421  TYR A CD2 1 
ATOM   3271 C CE1 . TYR A 1 421 ? 16.052  69.584 55.048 1.00 25.89 ? 421  TYR A CE1 1 
ATOM   3272 C CE2 . TYR A 1 421 ? 15.352  69.220 52.769 1.00 25.61 ? 421  TYR A CE2 1 
ATOM   3273 C CZ  . TYR A 1 421 ? 15.055  69.282 54.101 1.00 25.98 ? 421  TYR A CZ  1 
ATOM   3274 O OH  . TYR A 1 421 ? 13.757  69.043 54.504 1.00 27.19 ? 421  TYR A OH  1 
ATOM   3275 N N   . PHE A 1 422 ? 20.637  69.045 55.284 1.00 28.00 ? 422  PHE A N   1 
ATOM   3276 C CA  . PHE A 1 422 ? 20.609  68.824 56.735 1.00 29.82 ? 422  PHE A CA  1 
ATOM   3277 C C   . PHE A 1 422 ? 20.248  70.212 57.296 1.00 30.54 ? 422  PHE A C   1 
ATOM   3278 O O   . PHE A 1 422 ? 21.067  71.139 57.224 1.00 30.68 ? 422  PHE A O   1 
ATOM   3279 C CB  . PHE A 1 422 ? 21.995  68.371 57.227 1.00 30.26 ? 422  PHE A CB  1 
ATOM   3280 C CG  . PHE A 1 422 ? 22.096  68.165 58.740 1.00 30.63 ? 422  PHE A CG  1 
ATOM   3281 C CD1 . PHE A 1 422 ? 21.522  67.059 59.349 1.00 31.53 ? 422  PHE A CD1 1 
ATOM   3282 C CD2 . PHE A 1 422 ? 22.804  69.054 59.522 1.00 31.32 ? 422  PHE A CD2 1 
ATOM   3283 C CE1 . PHE A 1 422 ? 21.659  66.827 60.751 1.00 33.35 ? 422  PHE A CE1 1 
ATOM   3284 C CE2 . PHE A 1 422 ? 22.955  68.848 60.915 1.00 32.84 ? 422  PHE A CE2 1 
ATOM   3285 C CZ  . PHE A 1 422 ? 22.374  67.719 61.528 1.00 33.14 ? 422  PHE A CZ  1 
ATOM   3286 N N   . PHE A 1 423 ? 19.030  70.363 57.826 1.00 30.24 ? 423  PHE A N   1 
ATOM   3287 C CA  . PHE A 1 423 ? 18.575  71.677 58.309 1.00 30.65 ? 423  PHE A CA  1 
ATOM   3288 C C   . PHE A 1 423 ? 18.942  71.817 59.769 1.00 31.12 ? 423  PHE A C   1 
ATOM   3289 O O   . PHE A 1 423 ? 18.471  71.021 60.583 1.00 29.38 ? 423  PHE A O   1 
ATOM   3290 C CB  . PHE A 1 423 ? 17.060  71.819 58.112 1.00 29.74 ? 423  PHE A CB  1 
ATOM   3291 C CG  . PHE A 1 423 ? 16.492  73.132 58.620 1.00 32.79 ? 423  PHE A CG  1 
ATOM   3292 C CD1 . PHE A 1 423 ? 16.530  74.288 57.823 1.00 31.86 ? 423  PHE A CD1 1 
ATOM   3293 C CD2 . PHE A 1 423 ? 15.892  73.200 59.874 1.00 31.34 ? 423  PHE A CD2 1 
ATOM   3294 C CE1 . PHE A 1 423 ? 15.962  75.487 58.281 1.00 31.71 ? 423  PHE A CE1 1 
ATOM   3295 C CE2 . PHE A 1 423 ? 15.324  74.403 60.358 1.00 31.18 ? 423  PHE A CE2 1 
ATOM   3296 C CZ  . PHE A 1 423 ? 15.358  75.540 59.566 1.00 31.60 ? 423  PHE A CZ  1 
ATOM   3297 N N   . ASN A 1 424 ? 19.790  72.807 60.116 1.00 30.58 ? 424  ASN A N   1 
ATOM   3298 C CA  . ASN A 1 424 ? 20.205  72.911 61.508 1.00 31.49 ? 424  ASN A CA  1 
ATOM   3299 C C   . ASN A 1 424 ? 20.204  74.306 62.096 1.00 33.42 ? 424  ASN A C   1 
ATOM   3300 O O   . ASN A 1 424 ? 21.057  74.655 62.925 1.00 32.40 ? 424  ASN A O   1 
ATOM   3301 C CB  . ASN A 1 424 ? 21.582  72.200 61.723 1.00 31.15 ? 424  ASN A CB  1 
ATOM   3302 C CG  . ASN A 1 424 ? 22.728  72.831 60.908 1.00 34.17 ? 424  ASN A CG  1 
ATOM   3303 O OD1 . ASN A 1 424 ? 22.501  73.696 60.048 1.00 35.15 ? 424  ASN A OD1 1 
ATOM   3304 N ND2 . ASN A 1 424 ? 23.968  72.389 61.171 1.00 33.19 ? 424  ASN A ND2 1 
ATOM   3305 N N   . HIS A 1 425 ? 19.223  75.109 61.695 1.00 33.50 ? 425  HIS A N   1 
ATOM   3306 C CA  . HIS A 1 425 ? 19.148  76.433 62.239 1.00 33.71 ? 425  HIS A CA  1 
ATOM   3307 C C   . HIS A 1 425 ? 18.062  76.509 63.316 1.00 34.11 ? 425  HIS A C   1 
ATOM   3308 O O   . HIS A 1 425 ? 16.899  76.189 63.087 1.00 34.44 ? 425  HIS A O   1 
ATOM   3309 C CB  . HIS A 1 425 ? 18.861  77.485 61.139 1.00 34.65 ? 425  HIS A CB  1 
ATOM   3310 C CG  . HIS A 1 425 ? 18.701  78.876 61.692 1.00 35.47 ? 425  HIS A CG  1 
ATOM   3311 N ND1 . HIS A 1 425 ? 19.771  79.633 62.115 1.00 36.25 ? 425  HIS A ND1 1 
ATOM   3312 C CD2 . HIS A 1 425 ? 17.591  79.597 61.999 1.00 37.43 ? 425  HIS A CD2 1 
ATOM   3313 C CE1 . HIS A 1 425 ? 19.336  80.760 62.663 1.00 36.94 ? 425  HIS A CE1 1 
ATOM   3314 N NE2 . HIS A 1 425 ? 18.013  80.765 62.608 1.00 38.68 ? 425  HIS A NE2 1 
ATOM   3315 N N   . ARG A 1 426 ? 18.460  76.953 64.488 1.00 33.59 ? 426  ARG A N   1 
ATOM   3316 C CA  . ARG A 1 426 ? 17.553  77.111 65.617 1.00 34.84 ? 426  ARG A CA  1 
ATOM   3317 C C   . ARG A 1 426 ? 16.949  78.502 65.432 1.00 34.10 ? 426  ARG A C   1 
ATOM   3318 O O   . ARG A 1 426 ? 17.676  79.475 65.486 1.00 32.81 ? 426  ARG A O   1 
ATOM   3319 C CB  . ARG A 1 426 ? 18.356  77.009 66.931 1.00 34.64 ? 426  ARG A CB  1 
ATOM   3320 C CG  . ARG A 1 426 ? 17.657  77.533 68.194 1.00 38.07 ? 426  ARG A CG  1 
ATOM   3321 C CD  . ARG A 1 426 ? 16.510  76.649 68.684 1.00 35.68 ? 426  ARG A CD  1 
ATOM   3322 N NE  . ARG A 1 426 ? 15.956  77.184 69.932 1.00 35.37 ? 426  ARG A NE  1 
ATOM   3323 C CZ  . ARG A 1 426 ? 15.272  76.475 70.832 1.00 33.81 ? 426  ARG A CZ  1 
ATOM   3324 N NH1 . ARG A 1 426 ? 14.817  77.109 71.908 1.00 32.67 ? 426  ARG A NH1 1 
ATOM   3325 N NH2 . ARG A 1 426 ? 15.040  75.141 70.661 1.00 31.41 ? 426  ARG A NH2 1 
ATOM   3326 N N   . ALA A 1 427 ? 15.639  78.599 65.204 1.00 32.86 ? 427  ALA A N   1 
ATOM   3327 C CA  . ALA A 1 427 ? 15.064  79.926 64.958 1.00 35.11 ? 427  ALA A CA  1 
ATOM   3328 C C   . ALA A 1 427 ? 15.200  80.836 66.199 1.00 36.02 ? 427  ALA A C   1 
ATOM   3329 O O   . ALA A 1 427 ? 14.995  80.406 67.351 1.00 36.41 ? 427  ALA A O   1 
ATOM   3330 C CB  . ALA A 1 427 ? 13.566  79.825 64.520 1.00 34.25 ? 427  ALA A CB  1 
ATOM   3331 N N   . SER A 1 428 ? 15.521  82.096 65.942 1.00 36.45 ? 428  SER A N   1 
ATOM   3332 C CA  . SER A 1 428 ? 15.728  83.090 66.997 1.00 37.23 ? 428  SER A CA  1 
ATOM   3333 C C   . SER A 1 428 ? 14.499  83.341 67.856 1.00 37.23 ? 428  SER A C   1 
ATOM   3334 O O   . SER A 1 428 ? 14.634  83.730 68.996 1.00 37.13 ? 428  SER A O   1 
ATOM   3335 C CB  . SER A 1 428 ? 16.187  84.436 66.378 1.00 37.53 ? 428  SER A CB  1 
ATOM   3336 O OG  . SER A 1 428 ? 15.173  84.940 65.508 1.00 37.87 ? 428  SER A OG  1 
ATOM   3337 N N   . ASN A 1 429 ? 13.307  83.121 67.315 1.00 37.18 ? 429  ASN A N   1 
ATOM   3338 C CA  . ASN A 1 429 ? 12.079  83.380 68.072 1.00 37.00 ? 429  ASN A CA  1 
ATOM   3339 C C   . ASN A 1 429 ? 11.371  82.079 68.478 1.00 36.96 ? 429  ASN A C   1 
ATOM   3340 O O   . ASN A 1 429 ? 10.174  82.113 68.768 1.00 36.23 ? 429  ASN A O   1 
ATOM   3341 C CB  . ASN A 1 429 ? 11.108  84.194 67.201 1.00 37.28 ? 429  ASN A CB  1 
ATOM   3342 C CG  . ASN A 1 429 ? 10.830  83.494 65.861 1.00 39.01 ? 429  ASN A CG  1 
ATOM   3343 O OD1 . ASN A 1 429 ? 11.365  82.406 65.605 1.00 38.84 ? 429  ASN A OD1 1 
ATOM   3344 N ND2 . ASN A 1 429 ? 10.033  84.122 64.998 1.00 38.09 ? 429  ASN A ND2 1 
ATOM   3345 N N   . LEU A 1 430 ? 12.079  80.950 68.499 1.00 36.23 ? 430  LEU A N   1 
ATOM   3346 C CA  . LEU A 1 430 ? 11.435  79.662 68.852 1.00 36.07 ? 430  LEU A CA  1 
ATOM   3347 C C   . LEU A 1 430 ? 10.840  79.748 70.257 1.00 35.26 ? 430  LEU A C   1 
ATOM   3348 O O   . LEU A 1 430 ? 11.533  80.206 71.178 1.00 33.48 ? 430  LEU A O   1 
ATOM   3349 C CB  . LEU A 1 430 ? 12.475  78.524 68.835 1.00 37.63 ? 430  LEU A CB  1 
ATOM   3350 C CG  . LEU A 1 430 ? 12.280  77.224 68.023 1.00 41.44 ? 430  LEU A CG  1 
ATOM   3351 C CD1 . LEU A 1 430 ? 12.554  76.118 68.991 1.00 42.40 ? 430  LEU A CD1 1 
ATOM   3352 C CD2 . LEU A 1 430 ? 10.888  76.988 67.442 1.00 42.08 ? 430  LEU A CD2 1 
ATOM   3353 N N   . VAL A 1 431 ? 9.603   79.289 70.465 1.00 32.63 ? 431  VAL A N   1 
ATOM   3354 C CA  . VAL A 1 431 ? 9.023   79.370 71.816 1.00 32.26 ? 431  VAL A CA  1 
ATOM   3355 C C   . VAL A 1 431 ? 9.286   78.103 72.666 1.00 32.00 ? 431  VAL A C   1 
ATOM   3356 O O   . VAL A 1 431 ? 9.035   78.093 73.890 1.00 30.49 ? 431  VAL A O   1 
ATOM   3357 C CB  . VAL A 1 431 ? 7.475   79.635 71.750 1.00 34.11 ? 431  VAL A CB  1 
ATOM   3358 C CG1 . VAL A 1 431 ? 7.198   81.002 71.052 1.00 34.34 ? 431  VAL A CG1 1 
ATOM   3359 C CG2 . VAL A 1 431 ? 6.795   78.519 70.880 1.00 33.60 ? 431  VAL A CG2 1 
ATOM   3360 N N   . TRP A 1 432 ? 9.769   77.034 72.017 1.00 31.28 ? 432  TRP A N   1 
ATOM   3361 C CA  . TRP A 1 432 ? 10.076  75.739 72.689 1.00 29.62 ? 432  TRP A CA  1 
ATOM   3362 C C   . TRP A 1 432 ? 11.442  75.867 73.407 1.00 29.73 ? 432  TRP A C   1 
ATOM   3363 O O   . TRP A 1 432 ? 12.274  76.638 72.969 1.00 31.45 ? 432  TRP A O   1 
ATOM   3364 C CB  . TRP A 1 432 ? 10.172  74.603 71.641 1.00 29.74 ? 432  TRP A CB  1 
ATOM   3365 C CG  . TRP A 1 432 ? 8.810   74.175 71.041 1.00 28.56 ? 432  TRP A CG  1 
ATOM   3366 C CD1 . TRP A 1 432 ? 8.353   74.410 69.754 1.00 27.96 ? 432  TRP A CD1 1 
ATOM   3367 C CD2 . TRP A 1 432 ? 7.784   73.445 71.695 1.00 27.59 ? 432  TRP A CD2 1 
ATOM   3368 N NE1 . TRP A 1 432 ? 7.109   73.860 69.575 1.00 27.38 ? 432  TRP A NE1 1 
ATOM   3369 C CE2 . TRP A 1 432 ? 6.724   73.263 70.747 1.00 28.61 ? 432  TRP A CE2 1 
ATOM   3370 C CE3 . TRP A 1 432 ? 7.638   72.921 72.987 1.00 28.52 ? 432  TRP A CE3 1 
ATOM   3371 C CZ2 . TRP A 1 432 ? 5.541   72.580 71.056 1.00 25.50 ? 432  TRP A CZ2 1 
ATOM   3372 C CZ3 . TRP A 1 432 ? 6.454   72.221 73.299 1.00 29.90 ? 432  TRP A CZ3 1 
ATOM   3373 C CH2 . TRP A 1 432 ? 5.425   72.062 72.318 1.00 29.98 ? 432  TRP A CH2 1 
ATOM   3374 N N   . PRO A 1 433 ? 11.702  75.074 74.462 1.00 29.75 ? 433  PRO A N   1 
ATOM   3375 C CA  . PRO A 1 433 ? 12.979  75.200 75.150 1.00 30.36 ? 433  PRO A CA  1 
ATOM   3376 C C   . PRO A 1 433 ? 14.193  74.855 74.324 1.00 31.83 ? 433  PRO A C   1 
ATOM   3377 O O   . PRO A 1 433 ? 14.136  74.120 73.327 1.00 31.54 ? 433  PRO A O   1 
ATOM   3378 C CB  . PRO A 1 433 ? 12.813  74.270 76.347 1.00 31.00 ? 433  PRO A CB  1 
ATOM   3379 C CG  . PRO A 1 433 ? 11.862  73.181 75.778 1.00 27.30 ? 433  PRO A CG  1 
ATOM   3380 C CD  . PRO A 1 433 ? 10.867  74.026 75.095 1.00 28.17 ? 433  PRO A CD  1 
ATOM   3381 N N   . GLU A 1 434 ? 15.301  75.393 74.779 1.00 32.44 ? 434  GLU A N   1 
ATOM   3382 C CA  . GLU A 1 434 ? 16.603  75.204 74.176 1.00 34.77 ? 434  GLU A CA  1 
ATOM   3383 C C   . GLU A 1 434 ? 17.007  73.738 73.976 1.00 32.18 ? 434  GLU A C   1 
ATOM   3384 O O   . GLU A 1 434 ? 17.574  73.374 72.925 1.00 30.11 ? 434  GLU A O   1 
ATOM   3385 C CB  . GLU A 1 434 ? 17.646  75.864 75.071 1.00 38.58 ? 434  GLU A CB  1 
ATOM   3386 C CG  . GLU A 1 434 ? 18.508  76.868 74.361 1.00 50.85 ? 434  GLU A CG  1 
ATOM   3387 C CD  . GLU A 1 434 ? 17.707  78.016 73.696 1.00 56.79 ? 434  GLU A CD  1 
ATOM   3388 O OE1 . GLU A 1 434 ? 16.727  78.505 74.317 1.00 60.44 ? 434  GLU A OE1 1 
ATOM   3389 O OE2 . GLU A 1 434 ? 18.072  78.440 72.554 1.00 59.72 ? 434  GLU A OE2 1 
ATOM   3390 N N   . TRP A 1 435 ? 16.766  72.913 74.994 1.00 30.41 ? 435  TRP A N   1 
ATOM   3391 C CA  . TRP A 1 435 ? 17.170  71.517 74.908 1.00 30.98 ? 435  TRP A CA  1 
ATOM   3392 C C   . TRP A 1 435 ? 16.572  70.773 73.687 1.00 30.81 ? 435  TRP A C   1 
ATOM   3393 O O   . TRP A 1 435 ? 17.137  69.773 73.236 1.00 27.82 ? 435  TRP A O   1 
ATOM   3394 C CB  . TRP A 1 435 ? 16.833  70.736 76.201 1.00 30.76 ? 435  TRP A CB  1 
ATOM   3395 C CG  . TRP A 1 435 ? 15.350  70.387 76.463 1.00 31.89 ? 435  TRP A CG  1 
ATOM   3396 C CD1 . TRP A 1 435 ? 14.501  71.033 77.321 1.00 32.61 ? 435  TRP A CD1 1 
ATOM   3397 C CD2 . TRP A 1 435 ? 14.592  69.267 75.921 1.00 31.35 ? 435  TRP A CD2 1 
ATOM   3398 N NE1 . TRP A 1 435 ? 13.262  70.381 77.355 1.00 33.96 ? 435  TRP A NE1 1 
ATOM   3399 C CE2 . TRP A 1 435 ? 13.298  69.308 76.498 1.00 31.75 ? 435  TRP A CE2 1 
ATOM   3400 C CE3 . TRP A 1 435 ? 14.886  68.242 74.998 1.00 32.66 ? 435  TRP A CE3 1 
ATOM   3401 C CZ2 . TRP A 1 435 ? 12.290  68.371 76.180 1.00 30.88 ? 435  TRP A CZ2 1 
ATOM   3402 C CZ3 . TRP A 1 435 ? 13.864  67.290 74.674 1.00 32.13 ? 435  TRP A CZ3 1 
ATOM   3403 C CH2 . TRP A 1 435 ? 12.585  67.381 75.273 1.00 31.30 ? 435  TRP A CH2 1 
ATOM   3404 N N   . MET A 1 436 ? 15.463  71.281 73.147 1.00 29.26 ? 436  MET A N   1 
ATOM   3405 C CA  . MET A 1 436 ? 14.830  70.600 72.019 1.00 31.03 ? 436  MET A CA  1 
ATOM   3406 C C   . MET A 1 436 ? 15.514  70.859 70.699 1.00 29.69 ? 436  MET A C   1 
ATOM   3407 O O   . MET A 1 436 ? 15.269  70.128 69.733 1.00 29.40 ? 436  MET A O   1 
ATOM   3408 C CB  . MET A 1 436 ? 13.331  70.941 71.936 1.00 31.01 ? 436  MET A CB  1 
ATOM   3409 C CG  . MET A 1 436 ? 12.551  70.368 73.124 1.00 28.56 ? 436  MET A CG  1 
ATOM   3410 S SD  . MET A 1 436 ? 10.810  70.958 73.161 1.00 29.18 ? 436  MET A SD  1 
ATOM   3411 C CE  . MET A 1 436 ? 10.085  69.684 71.883 1.00 28.53 ? 436  MET A CE  1 
ATOM   3412 N N   . GLY A 1 437 ? 16.393  71.862 70.663 1.00 30.10 ? 437  GLY A N   1 
ATOM   3413 C CA  . GLY A 1 437 ? 17.169  72.130 69.438 1.00 28.26 ? 437  GLY A CA  1 
ATOM   3414 C C   . GLY A 1 437 ? 16.391  72.512 68.175 1.00 29.43 ? 437  GLY A C   1 
ATOM   3415 O O   . GLY A 1 437 ? 15.498  73.352 68.220 1.00 29.17 ? 437  GLY A O   1 
ATOM   3416 N N   . VAL A 1 438 ? 16.767  71.897 67.052 1.00 28.99 ? 438  VAL A N   1 
ATOM   3417 C CA  . VAL A 1 438 ? 16.142  72.110 65.752 1.00 28.61 ? 438  VAL A CA  1 
ATOM   3418 C C   . VAL A 1 438 ? 15.111  70.958 65.607 1.00 28.99 ? 438  VAL A C   1 
ATOM   3419 O O   . VAL A 1 438 ? 15.411  69.809 65.180 1.00 28.28 ? 438  VAL A O   1 
ATOM   3420 C CB  . VAL A 1 438 ? 17.215  72.050 64.661 1.00 29.82 ? 438  VAL A CB  1 
ATOM   3421 C CG1 . VAL A 1 438 ? 16.622  72.431 63.304 1.00 28.75 ? 438  VAL A CG1 1 
ATOM   3422 C CG2 . VAL A 1 438 ? 18.358  73.058 65.021 1.00 27.61 ? 438  VAL A CG2 1 
ATOM   3423 N N   . ILE A 1 439 ? 13.900  71.325 66.008 1.00 27.00 ? 439  ILE A N   1 
ATOM   3424 C CA  . ILE A 1 439 ? 12.750  70.453 66.133 1.00 27.12 ? 439  ILE A CA  1 
ATOM   3425 C C   . ILE A 1 439 ? 12.079  69.947 64.854 1.00 27.08 ? 439  ILE A C   1 
ATOM   3426 O O   . ILE A 1 439 ? 12.094  70.586 63.792 1.00 25.94 ? 439  ILE A O   1 
ATOM   3427 C CB  . ILE A 1 439 ? 11.711  71.165 67.042 1.00 26.28 ? 439  ILE A CB  1 
ATOM   3428 C CG1 . ILE A 1 439 ? 12.412  71.510 68.381 1.00 26.26 ? 439  ILE A CG1 1 
ATOM   3429 C CG2 . ILE A 1 439 ? 10.446  70.309 67.276 1.00 22.77 ? 439  ILE A CG2 1 
ATOM   3430 C CD1 . ILE A 1 439 ? 11.660  72.513 69.210 1.00 22.84 ? 439  ILE A CD1 1 
ATOM   3431 N N   . HIS A 1 440 ? 11.536  68.739 64.990 1.00 24.73 ? 440  HIS A N   1 
ATOM   3432 C CA  . HIS A 1 440 ? 10.782  68.109 63.936 1.00 23.67 ? 440  HIS A CA  1 
ATOM   3433 C C   . HIS A 1 440 ? 9.695   69.098 63.527 1.00 25.13 ? 440  HIS A C   1 
ATOM   3434 O O   . HIS A 1 440 ? 8.857   69.502 64.360 1.00 27.75 ? 440  HIS A O   1 
ATOM   3435 C CB  . HIS A 1 440 ? 10.122  66.861 64.512 1.00 23.08 ? 440  HIS A CB  1 
ATOM   3436 C CG  . HIS A 1 440 ? 9.450   65.995 63.495 1.00 23.96 ? 440  HIS A CG  1 
ATOM   3437 N ND1 . HIS A 1 440 ? 10.141  65.418 62.442 1.00 21.10 ? 440  HIS A ND1 1 
ATOM   3438 C CD2 . HIS A 1 440 ? 8.169   65.541 63.413 1.00 23.31 ? 440  HIS A CD2 1 
ATOM   3439 C CE1 . HIS A 1 440 ? 9.313   64.633 61.757 1.00 23.17 ? 440  HIS A CE1 1 
ATOM   3440 N NE2 . HIS A 1 440 ? 8.111   64.695 62.319 1.00 24.38 ? 440  HIS A NE2 1 
ATOM   3441 N N   . GLY A 1 441 ? 9.711   69.506 62.270 1.00 25.41 ? 441  GLY A N   1 
ATOM   3442 C CA  . GLY A 1 441 ? 8.678   70.380 61.778 1.00 25.33 ? 441  GLY A CA  1 
ATOM   3443 C C   . GLY A 1 441 ? 9.043   71.845 61.678 1.00 28.22 ? 441  GLY A C   1 
ATOM   3444 O O   . GLY A 1 441 ? 8.347   72.606 60.995 1.00 26.45 ? 441  GLY A O   1 
ATOM   3445 N N   . TYR A 1 442 ? 10.142  72.251 62.323 1.00 27.91 ? 442  TYR A N   1 
ATOM   3446 C CA  . TYR A 1 442 ? 10.462  73.646 62.308 1.00 27.39 ? 442  TYR A CA  1 
ATOM   3447 C C   . TYR A 1 442 ? 11.206  74.249 61.137 1.00 28.96 ? 442  TYR A C   1 
ATOM   3448 O O   . TYR A 1 442 ? 11.592  75.444 61.165 1.00 29.02 ? 442  TYR A O   1 
ATOM   3449 C CB  . TYR A 1 442 ? 11.038  74.014 63.676 1.00 28.92 ? 442  TYR A CB  1 
ATOM   3450 C CG  . TYR A 1 442 ? 9.888   74.063 64.660 1.00 27.40 ? 442  TYR A CG  1 
ATOM   3451 C CD1 . TYR A 1 442 ? 9.324   72.868 65.184 1.00 27.82 ? 442  TYR A CD1 1 
ATOM   3452 C CD2 . TYR A 1 442 ? 9.230   75.281 64.925 1.00 28.77 ? 442  TYR A CD2 1 
ATOM   3453 C CE1 . TYR A 1 442 ? 8.128   72.889 65.944 1.00 26.72 ? 442  TYR A CE1 1 
ATOM   3454 C CE2 . TYR A 1 442 ? 8.013   75.325 65.667 1.00 25.63 ? 442  TYR A CE2 1 
ATOM   3455 C CZ  . TYR A 1 442 ? 7.477   74.125 66.168 1.00 27.68 ? 442  TYR A CZ  1 
ATOM   3456 O OH  . TYR A 1 442 ? 6.291   74.160 66.839 1.00 26.32 ? 442  TYR A OH  1 
ATOM   3457 N N   . GLU A 1 443 ? 11.426  73.429 60.097 1.00 29.17 ? 443  GLU A N   1 
ATOM   3458 C CA  . GLU A 1 443 ? 11.978  73.963 58.849 1.00 27.78 ? 443  GLU A CA  1 
ATOM   3459 C C   . GLU A 1 443 ? 10.771  74.431 57.966 1.00 27.72 ? 443  GLU A C   1 
ATOM   3460 O O   . GLU A 1 443 ? 10.905  75.251 57.033 1.00 27.34 ? 443  GLU A O   1 
ATOM   3461 C CB  . GLU A 1 443 ? 12.807  72.904 58.069 1.00 26.04 ? 443  GLU A CB  1 
ATOM   3462 C CG  . GLU A 1 443 ? 11.975  71.992 57.106 1.00 24.57 ? 443  GLU A CG  1 
ATOM   3463 C CD  . GLU A 1 443 ? 10.996  71.026 57.837 1.00 26.27 ? 443  GLU A CD  1 
ATOM   3464 O OE1 . GLU A 1 443 ? 11.079  70.875 59.074 1.00 25.19 ? 443  GLU A OE1 1 
ATOM   3465 O OE2 . GLU A 1 443 ? 10.159  70.399 57.167 1.00 26.27 ? 443  GLU A OE2 1 
ATOM   3466 N N   . ILE A 1 444 ? 9.576   73.967 58.301 1.00 27.40 ? 444  ILE A N   1 
ATOM   3467 C CA  . ILE A 1 444 ? 8.429   74.288 57.478 1.00 27.91 ? 444  ILE A CA  1 
ATOM   3468 C C   . ILE A 1 444 ? 8.206   75.807 57.349 1.00 28.49 ? 444  ILE A C   1 
ATOM   3469 O O   . ILE A 1 444 ? 8.032   76.339 56.224 1.00 28.29 ? 444  ILE A O   1 
ATOM   3470 C CB  . ILE A 1 444 ? 7.113   73.601 58.020 1.00 26.52 ? 444  ILE A CB  1 
ATOM   3471 C CG1 . ILE A 1 444 ? 7.191   72.070 57.850 1.00 25.63 ? 444  ILE A CG1 1 
ATOM   3472 C CG2 . ILE A 1 444 ? 5.875   74.156 57.228 1.00 26.64 ? 444  ILE A CG2 1 
ATOM   3473 C CD1 . ILE A 1 444 ? 6.133   71.333 58.663 1.00 21.83 ? 444  ILE A CD1 1 
ATOM   3474 N N   . GLU A 1 445 ? 8.203   76.486 58.489 1.00 28.28 ? 445  GLU A N   1 
ATOM   3475 C CA  . GLU A 1 445 ? 8.011   77.936 58.487 1.00 30.25 ? 445  GLU A CA  1 
ATOM   3476 C C   . GLU A 1 445 ? 9.024   78.630 57.565 1.00 29.50 ? 445  GLU A C   1 
ATOM   3477 O O   . GLU A 1 445 ? 8.734   79.680 57.024 1.00 29.99 ? 445  GLU A O   1 
ATOM   3478 C CB  . GLU A 1 445 ? 8.076   78.497 59.930 1.00 31.27 ? 445  GLU A CB  1 
ATOM   3479 C CG  . GLU A 1 445 ? 9.386   78.230 60.679 1.00 31.96 ? 445  GLU A CG  1 
ATOM   3480 C CD  . GLU A 1 445 ? 9.184   78.321 62.183 1.00 34.09 ? 445  GLU A CD  1 
ATOM   3481 O OE1 . GLU A 1 445 ? 8.368   77.520 62.707 1.00 32.29 ? 445  GLU A OE1 1 
ATOM   3482 O OE2 . GLU A 1 445 ? 9.834   79.178 62.839 1.00 31.86 ? 445  GLU A OE2 1 
ATOM   3483 N N   . PHE A 1 446 ? 10.200  78.045 57.360 1.00 30.70 ? 446  PHE A N   1 
ATOM   3484 C CA  . PHE A 1 446 ? 11.139  78.677 56.438 1.00 31.10 ? 446  PHE A CA  1 
ATOM   3485 C C   . PHE A 1 446 ? 10.733  78.339 55.008 1.00 31.74 ? 446  PHE A C   1 
ATOM   3486 O O   . PHE A 1 446 ? 10.906  79.147 54.090 1.00 33.40 ? 446  PHE A O   1 
ATOM   3487 C CB  . PHE A 1 446 ? 12.569  78.186 56.677 1.00 31.37 ? 446  PHE A CB  1 
ATOM   3488 C CG  . PHE A 1 446 ? 13.236  78.851 57.873 1.00 31.87 ? 446  PHE A CG  1 
ATOM   3489 C CD1 . PHE A 1 446 ? 12.960  78.417 59.174 1.00 28.01 ? 446  PHE A CD1 1 
ATOM   3490 C CD2 . PHE A 1 446 ? 14.024  80.018 57.681 1.00 31.47 ? 446  PHE A CD2 1 
ATOM   3491 C CE1 . PHE A 1 446 ? 13.426  79.130 60.278 1.00 29.72 ? 446  PHE A CE1 1 
ATOM   3492 C CE2 . PHE A 1 446 ? 14.505  80.755 58.800 1.00 31.40 ? 446  PHE A CE2 1 
ATOM   3493 C CZ  . PHE A 1 446 ? 14.201  80.316 60.094 1.00 30.27 ? 446  PHE A CZ  1 
ATOM   3494 N N   . VAL A 1 447 ? 10.212  77.141 54.801 1.00 29.36 ? 447  VAL A N   1 
ATOM   3495 C CA  . VAL A 1 447 ? 9.827   76.741 53.468 1.00 29.16 ? 447  VAL A CA  1 
ATOM   3496 C C   . VAL A 1 447 ? 8.611   77.549 53.031 1.00 30.09 ? 447  VAL A C   1 
ATOM   3497 O O   . VAL A 1 447 ? 8.493   77.855 51.856 1.00 30.11 ? 447  VAL A O   1 
ATOM   3498 C CB  . VAL A 1 447 ? 9.505   75.231 53.405 1.00 29.19 ? 447  VAL A CB  1 
ATOM   3499 C CG1 . VAL A 1 447 ? 8.709   74.897 52.122 1.00 27.68 ? 447  VAL A CG1 1 
ATOM   3500 C CG2 . VAL A 1 447 ? 10.811  74.432 53.498 1.00 27.11 ? 447  VAL A CG2 1 
ATOM   3501 N N   . PHE A 1 448 ? 7.744   77.927 53.978 1.00 29.70 ? 448  PHE A N   1 
ATOM   3502 C CA  . PHE A 1 448 ? 6.587   78.709 53.618 1.00 31.19 ? 448  PHE A CA  1 
ATOM   3503 C C   . PHE A 1 448 ? 6.826   80.236 53.739 1.00 32.83 ? 448  PHE A C   1 
ATOM   3504 O O   . PHE A 1 448 ? 5.885   81.021 53.610 1.00 32.33 ? 448  PHE A O   1 
ATOM   3505 C CB  . PHE A 1 448 ? 5.345   78.279 54.409 1.00 29.27 ? 448  PHE A CB  1 
ATOM   3506 C CG  . PHE A 1 448 ? 4.701   77.049 53.859 1.00 32.58 ? 448  PHE A CG  1 
ATOM   3507 C CD1 . PHE A 1 448 ? 5.338   75.775 53.992 1.00 30.95 ? 448  PHE A CD1 1 
ATOM   3508 C CD2 . PHE A 1 448 ? 3.507   77.143 53.103 1.00 31.13 ? 448  PHE A CD2 1 
ATOM   3509 C CE1 . PHE A 1 448 ? 4.789   74.626 53.365 1.00 31.99 ? 448  PHE A CE1 1 
ATOM   3510 C CE2 . PHE A 1 448 ? 2.954   76.003 52.482 1.00 29.81 ? 448  PHE A CE2 1 
ATOM   3511 C CZ  . PHE A 1 448 ? 3.578   74.756 52.598 1.00 32.03 ? 448  PHE A CZ  1 
ATOM   3512 N N   . GLY A 1 449 ? 8.082   80.634 53.965 1.00 32.81 ? 449  GLY A N   1 
ATOM   3513 C CA  . GLY A 1 449 ? 8.405   82.046 54.009 1.00 34.36 ? 449  GLY A CA  1 
ATOM   3514 C C   . GLY A 1 449 ? 7.861   82.931 55.121 1.00 34.79 ? 449  GLY A C   1 
ATOM   3515 O O   . GLY A 1 449 ? 7.792   84.148 54.930 1.00 35.72 ? 449  GLY A O   1 
ATOM   3516 N N   . LEU A 1 450 ? 7.488   82.354 56.262 1.00 35.17 ? 450  LEU A N   1 
ATOM   3517 C CA  . LEU A 1 450 ? 7.001   83.122 57.402 1.00 35.32 ? 450  LEU A CA  1 
ATOM   3518 C C   . LEU A 1 450 ? 7.995   84.212 57.864 1.00 36.27 ? 450  LEU A C   1 
ATOM   3519 O O   . LEU A 1 450 ? 7.566   85.254 58.393 1.00 36.54 ? 450  LEU A O   1 
ATOM   3520 C CB  . LEU A 1 450 ? 6.645   82.203 58.577 1.00 35.16 ? 450  LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 450 ? 5.250   81.563 58.476 1.00 36.56 ? 450  LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 450 ? 4.193   82.612 58.386 1.00 38.53 ? 450  LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 450 ? 5.160   80.776 57.218 1.00 37.67 ? 450  LEU A CD2 1 
ATOM   3524 N N   . PRO A 1 451 ? 9.318   83.970 57.723 1.00 35.53 ? 451  PRO A N   1 
ATOM   3525 C CA  . PRO A 1 451 ? 10.281  84.985 58.144 1.00 37.54 ? 451  PRO A CA  1 
ATOM   3526 C C   . PRO A 1 451 ? 10.232  86.270 57.325 1.00 38.20 ? 451  PRO A C   1 
ATOM   3527 O O   . PRO A 1 451 ? 10.808  87.252 57.746 1.00 38.88 ? 451  PRO A O   1 
ATOM   3528 C CB  . PRO A 1 451 ? 11.637  84.290 58.003 1.00 35.99 ? 451  PRO A CB  1 
ATOM   3529 C CG  . PRO A 1 451 ? 11.269  82.871 58.362 1.00 37.42 ? 451  PRO A CG  1 
ATOM   3530 C CD  . PRO A 1 451 ? 9.997   82.677 57.554 1.00 36.05 ? 451  PRO A CD  1 
ATOM   3531 N N   . LEU A 1 452 ? 9.597   86.255 56.152 1.00 38.69 ? 452  LEU A N   1 
ATOM   3532 C CA  . LEU A 1 452 ? 9.496   87.470 55.372 1.00 38.96 ? 452  LEU A CA  1 
ATOM   3533 C C   . LEU A 1 452 ? 8.468   88.417 56.006 1.00 39.25 ? 452  LEU A C   1 
ATOM   3534 O O   . LEU A 1 452 ? 8.409   89.551 55.604 1.00 39.07 ? 452  LEU A O   1 
ATOM   3535 C CB  . LEU A 1 452 ? 9.057   87.242 53.937 1.00 36.37 ? 452  LEU A CB  1 
ATOM   3536 C CG  . LEU A 1 452 ? 9.531   86.141 53.001 1.00 41.58 ? 452  LEU A CG  1 
ATOM   3537 C CD1 . LEU A 1 452 ? 9.406   86.715 51.563 1.00 39.51 ? 452  LEU A CD1 1 
ATOM   3538 C CD2 . LEU A 1 452 ? 10.915  85.558 53.340 1.00 36.73 ? 452  LEU A CD2 1 
ATOM   3539 N N   . VAL A 1 453 ? 7.655   87.971 56.960 1.00 39.83 ? 453  VAL A N   1 
ATOM   3540 C CA  . VAL A 1 453 ? 6.692   88.886 57.564 1.00 41.53 ? 453  VAL A CA  1 
ATOM   3541 C C   . VAL A 1 453 ? 7.259   89.414 58.883 1.00 43.07 ? 453  VAL A C   1 
ATOM   3542 O O   . VAL A 1 453 ? 7.452   88.665 59.882 1.00 42.02 ? 453  VAL A O   1 
ATOM   3543 C CB  . VAL A 1 453 ? 5.283   88.254 57.769 1.00 42.32 ? 453  VAL A CB  1 
ATOM   3544 C CG1 . VAL A 1 453 ? 5.037   87.097 56.790 1.00 40.05 ? 453  VAL A CG1 1 
ATOM   3545 C CG2 . VAL A 1 453 ? 5.088   87.865 59.152 1.00 43.11 ? 453  VAL A CG2 1 
ATOM   3546 N N   . LYS A 1 454 ? 7.537   90.721 58.868 1.00 43.41 ? 454  LYS A N   1 
ATOM   3547 C CA  . LYS A 1 454 ? 8.186   91.438 59.994 1.00 45.10 ? 454  LYS A CA  1 
ATOM   3548 C C   . LYS A 1 454 ? 7.573   91.228 61.365 1.00 45.01 ? 454  LYS A C   1 
ATOM   3549 O O   . LYS A 1 454 ? 8.278   91.010 62.348 1.00 43.03 ? 454  LYS A O   1 
ATOM   3550 C CB  . LYS A 1 454 ? 8.253   92.967 59.691 1.00 46.47 ? 454  LYS A CB  1 
ATOM   3551 N N   . GLU A 1 455 ? 6.250   91.276 61.428 1.00 45.52 ? 455  GLU A N   1 
ATOM   3552 C CA  . GLU A 1 455 ? 5.593   91.104 62.708 1.00 47.75 ? 455  GLU A CA  1 
ATOM   3553 C C   . GLU A 1 455 ? 5.914   89.758 63.363 1.00 47.62 ? 455  GLU A C   1 
ATOM   3554 O O   . GLU A 1 455 ? 5.683   89.595 64.558 1.00 48.04 ? 455  GLU A O   1 
ATOM   3555 C CB  . GLU A 1 455 ? 4.076   91.254 62.559 1.00 49.39 ? 455  GLU A CB  1 
ATOM   3556 C CG  . GLU A 1 455 ? 3.687   92.435 61.682 1.00 54.76 ? 455  GLU A CG  1 
ATOM   3557 C CD  . GLU A 1 455 ? 4.125   92.245 60.219 1.00 56.08 ? 455  GLU A CD  1 
ATOM   3558 O OE1 . GLU A 1 455 ? 3.407   91.542 59.503 1.00 57.58 ? 455  GLU A OE1 1 
ATOM   3559 O OE2 . GLU A 1 455 ? 5.184   92.767 59.787 1.00 59.09 ? 455  GLU A OE2 1 
ATOM   3560 N N   . LEU A 1 456 ? 6.448   88.791 62.620 1.00 46.68 ? 456  LEU A N   1 
ATOM   3561 C CA  . LEU A 1 456 ? 6.717   87.512 63.255 1.00 45.92 ? 456  LEU A CA  1 
ATOM   3562 C C   . LEU A 1 456 ? 8.029   87.520 64.016 1.00 46.73 ? 456  LEU A C   1 
ATOM   3563 O O   . LEU A 1 456 ? 8.361   86.566 64.711 1.00 47.59 ? 456  LEU A O   1 
ATOM   3564 C CB  . LEU A 1 456 ? 6.641   86.373 62.229 1.00 44.49 ? 456  LEU A CB  1 
ATOM   3565 C CG  . LEU A 1 456 ? 5.192   86.275 61.728 1.00 43.93 ? 456  LEU A CG  1 
ATOM   3566 C CD1 . LEU A 1 456 ? 5.038   85.080 60.797 1.00 45.45 ? 456  LEU A CD1 1 
ATOM   3567 C CD2 . LEU A 1 456 ? 4.241   86.171 62.901 1.00 41.32 ? 456  LEU A CD2 1 
ATOM   3568 N N   . ASN A 1 457 ? 8.799   88.596 63.864 1.00 46.79 ? 457  ASN A N   1 
ATOM   3569 C CA  . ASN A 1 457 ? 10.019  88.752 64.643 1.00 45.07 ? 457  ASN A CA  1 
ATOM   3570 C C   . ASN A 1 457 ? 11.203  87.857 64.301 1.00 44.37 ? 457  ASN A C   1 
ATOM   3571 O O   . ASN A 1 457 ? 11.893  87.431 65.223 1.00 43.33 ? 457  ASN A O   1 
ATOM   3572 C CB  . ASN A 1 457 ? 9.718   88.546 66.149 1.00 48.51 ? 457  ASN A CB  1 
ATOM   3573 C CG  . ASN A 1 457 ? 8.687   89.549 66.725 1.00 50.67 ? 457  ASN A CG  1 
ATOM   3574 O OD1 . ASN A 1 457 ? 8.008   89.276 67.742 1.00 52.92 ? 457  ASN A OD1 1 
ATOM   3575 N ND2 . ASN A 1 457 ? 8.575   90.700 66.092 1.00 51.12 ? 457  ASN A ND2 1 
ATOM   3576 N N   . TYR A 1 458 ? 11.444  87.533 63.031 1.00 41.43 ? 458  TYR A N   1 
ATOM   3577 C CA  . TYR A 1 458 ? 12.629  86.758 62.732 1.00 40.02 ? 458  TYR A CA  1 
ATOM   3578 C C   . TYR A 1 458 ? 13.751  87.758 62.455 1.00 41.45 ? 458  TYR A C   1 
ATOM   3579 O O   . TYR A 1 458 ? 13.489  88.949 62.232 1.00 41.69 ? 458  TYR A O   1 
ATOM   3580 C CB  . TYR A 1 458 ? 12.446  85.870 61.486 1.00 38.65 ? 458  TYR A CB  1 
ATOM   3581 C CG  . TYR A 1 458 ? 11.486  84.690 61.673 1.00 38.58 ? 458  TYR A CG  1 
ATOM   3582 C CD1 . TYR A 1 458 ? 10.107  84.844 61.488 1.00 36.80 ? 458  TYR A CD1 1 
ATOM   3583 C CD2 . TYR A 1 458 ? 11.970  83.422 62.001 1.00 36.39 ? 458  TYR A CD2 1 
ATOM   3584 C CE1 . TYR A 1 458 ? 9.220   83.754 61.622 1.00 35.32 ? 458  TYR A CE1 1 
ATOM   3585 C CE2 . TYR A 1 458 ? 11.105  82.324 62.125 1.00 35.68 ? 458  TYR A CE2 1 
ATOM   3586 C CZ  . TYR A 1 458 ? 9.739   82.487 61.928 1.00 36.18 ? 458  TYR A CZ  1 
ATOM   3587 O OH  . TYR A 1 458 ? 8.917   81.369 61.924 1.00 32.51 ? 458  TYR A OH  1 
ATOM   3588 N N   . THR A 1 459 ? 14.999  87.290 62.427 1.00 41.20 ? 459  THR A N   1 
ATOM   3589 C CA  . THR A 1 459 ? 16.111  88.202 62.133 1.00 41.77 ? 459  THR A CA  1 
ATOM   3590 C C   . THR A 1 459 ? 16.207  88.403 60.635 1.00 42.77 ? 459  THR A C   1 
ATOM   3591 O O   . THR A 1 459 ? 15.545  87.689 59.871 1.00 43.11 ? 459  THR A O   1 
ATOM   3592 C CB  . THR A 1 459 ? 17.454  87.626 62.559 1.00 41.90 ? 459  THR A CB  1 
ATOM   3593 O OG1 . THR A 1 459 ? 17.660  86.385 61.867 1.00 40.50 ? 459  THR A OG1 1 
ATOM   3594 C CG2 . THR A 1 459 ? 17.470  87.397 64.114 1.00 41.36 ? 459  THR A CG2 1 
ATOM   3595 N N   . ALA A 1 460 ? 17.038  89.355 60.215 1.00 41.33 ? 460  ALA A N   1 
ATOM   3596 C CA  . ALA A 1 460 ? 17.252  89.622 58.789 1.00 40.82 ? 460  ALA A CA  1 
ATOM   3597 C C   . ALA A 1 460 ? 17.923  88.393 58.147 1.00 39.82 ? 460  ALA A C   1 
ATOM   3598 O O   . ALA A 1 460 ? 17.627  88.018 57.007 1.00 40.02 ? 460  ALA A O   1 
ATOM   3599 C CB  . ALA A 1 460 ? 18.166  90.883 58.603 1.00 40.95 ? 460  ALA A CB  1 
ATOM   3600 N N   . GLU A 1 461 ? 18.843  87.767 58.854 1.00 39.27 ? 461  GLU A N   1 
ATOM   3601 C CA  . GLU A 1 461 ? 19.489  86.598 58.268 1.00 40.89 ? 461  GLU A CA  1 
ATOM   3602 C C   . GLU A 1 461 ? 18.500  85.424 58.141 1.00 39.45 ? 461  GLU A C   1 
ATOM   3603 O O   . GLU A 1 461 ? 18.672  84.579 57.306 1.00 38.18 ? 461  GLU A O   1 
ATOM   3604 C CB  . GLU A 1 461 ? 20.732  86.169 59.075 1.00 43.09 ? 461  GLU A CB  1 
ATOM   3605 C CG  . GLU A 1 461 ? 20.715  86.607 60.509 1.00 48.80 ? 461  GLU A CG  1 
ATOM   3606 C CD  . GLU A 1 461 ? 20.969  88.106 60.640 1.00 50.00 ? 461  GLU A CD  1 
ATOM   3607 O OE1 . GLU A 1 461 ? 22.025  88.553 60.148 1.00 53.49 ? 461  GLU A OE1 1 
ATOM   3608 O OE2 . GLU A 1 461 ? 20.121  88.825 61.215 1.00 50.33 ? 461  GLU A OE2 1 
ATOM   3609 N N   . GLU A 1 462 ? 17.473  85.392 58.984 1.00 38.59 ? 462  GLU A N   1 
ATOM   3610 C CA  . GLU A 1 462 ? 16.489  84.331 58.889 1.00 37.13 ? 462  GLU A CA  1 
ATOM   3611 C C   . GLU A 1 462 ? 15.598  84.574 57.660 1.00 37.93 ? 462  GLU A C   1 
ATOM   3612 O O   . GLU A 1 462 ? 15.229  83.609 56.938 1.00 35.37 ? 462  GLU A O   1 
ATOM   3613 C CB  . GLU A 1 462 ? 15.703  84.251 60.200 1.00 34.79 ? 462  GLU A CB  1 
ATOM   3614 C CG  . GLU A 1 462 ? 16.550  83.494 61.260 1.00 34.93 ? 462  GLU A CG  1 
ATOM   3615 C CD  . GLU A 1 462 ? 15.993  83.522 62.678 1.00 35.58 ? 462  GLU A CD  1 
ATOM   3616 O OE1 . GLU A 1 462 ? 15.148  84.372 62.996 1.00 37.75 ? 462  GLU A OE1 1 
ATOM   3617 O OE2 . GLU A 1 462 ? 16.433  82.704 63.511 1.00 38.47 ? 462  GLU A OE2 1 
ATOM   3618 N N   . GLU A 1 463 ? 15.271  85.853 57.403 1.00 36.76 ? 463  GLU A N   1 
ATOM   3619 C CA  . GLU A 1 463 ? 14.484  86.186 56.241 1.00 37.63 ? 463  GLU A CA  1 
ATOM   3620 C C   . GLU A 1 463 ? 15.324  85.789 55.038 1.00 38.03 ? 463  GLU A C   1 
ATOM   3621 O O   . GLU A 1 463 ? 14.806  85.234 54.052 1.00 39.96 ? 463  GLU A O   1 
ATOM   3622 C CB  . GLU A 1 463 ? 14.155  87.694 56.150 1.00 38.67 ? 463  GLU A CB  1 
ATOM   3623 C CG  . GLU A 1 463 ? 14.119  88.150 54.661 1.00 40.03 ? 463  GLU A CG  1 
ATOM   3624 C CD  . GLU A 1 463 ? 13.393  89.455 54.443 1.00 41.65 ? 463  GLU A CD  1 
ATOM   3625 O OE1 . GLU A 1 463 ? 13.362  90.253 55.397 1.00 43.68 ? 463  GLU A OE1 1 
ATOM   3626 O OE2 . GLU A 1 463 ? 12.862  89.689 53.333 1.00 40.14 ? 463  GLU A OE2 1 
ATOM   3627 N N   . ALA A 1 464 ? 16.622  86.064 55.076 1.00 36.48 ? 464  ALA A N   1 
ATOM   3628 C CA  . ALA A 1 464 ? 17.418  85.653 53.922 1.00 36.47 ? 464  ALA A CA  1 
ATOM   3629 C C   . ALA A 1 464 ? 17.487  84.102 53.764 1.00 34.97 ? 464  ALA A C   1 
ATOM   3630 O O   . ALA A 1 464 ? 17.519  83.565 52.634 1.00 32.99 ? 464  ALA A O   1 
ATOM   3631 C CB  . ALA A 1 464 ? 18.863  86.266 53.993 1.00 35.55 ? 464  ALA A CB  1 
ATOM   3632 N N   . LEU A 1 465 ? 17.560  83.384 54.884 1.00 34.35 ? 465  LEU A N   1 
ATOM   3633 C CA  . LEU A 1 465 ? 17.592  81.914 54.797 1.00 33.45 ? 465  LEU A CA  1 
ATOM   3634 C C   . LEU A 1 465 ? 16.278  81.413 54.142 1.00 31.12 ? 465  LEU A C   1 
ATOM   3635 O O   . LEU A 1 465 ? 16.299  80.559 53.269 1.00 31.53 ? 465  LEU A O   1 
ATOM   3636 C CB  . LEU A 1 465 ? 17.742  81.309 56.199 1.00 33.90 ? 465  LEU A CB  1 
ATOM   3637 C CG  . LEU A 1 465 ? 17.645  79.774 56.296 1.00 31.43 ? 465  LEU A CG  1 
ATOM   3638 C CD1 . LEU A 1 465 ? 18.613  79.080 55.321 1.00 33.27 ? 465  LEU A CD1 1 
ATOM   3639 C CD2 . LEU A 1 465 ? 17.993  79.365 57.738 1.00 31.80 ? 465  LEU A CD2 1 
ATOM   3640 N N   . SER A 1 466 ? 15.153  81.963 54.590 1.00 29.76 ? 466  SER A N   1 
ATOM   3641 C CA  . SER A 1 466 ? 13.851  81.623 54.056 1.00 31.84 ? 466  SER A CA  1 
ATOM   3642 C C   . SER A 1 466 ? 13.804  81.878 52.552 1.00 34.17 ? 466  SER A C   1 
ATOM   3643 O O   . SER A 1 466 ? 13.380  80.984 51.753 1.00 35.43 ? 466  SER A O   1 
ATOM   3644 C CB  . SER A 1 466 ? 12.727  82.422 54.765 1.00 30.43 ? 466  SER A CB  1 
ATOM   3645 O OG  . SER A 1 466 ? 11.420  82.052 54.291 1.00 26.98 ? 466  SER A OG  1 
ATOM   3646 N N   . ARG A 1 467 ? 14.284  83.051 52.126 1.00 33.53 ? 467  ARG A N   1 
ATOM   3647 C CA  . ARG A 1 467 ? 14.231  83.340 50.698 1.00 33.90 ? 467  ARG A CA  1 
ATOM   3648 C C   . ARG A 1 467 ? 15.064  82.347 49.921 1.00 34.47 ? 467  ARG A C   1 
ATOM   3649 O O   . ARG A 1 467 ? 14.659  81.893 48.825 1.00 33.96 ? 467  ARG A O   1 
ATOM   3650 C CB  . ARG A 1 467 ? 14.662  84.793 50.371 1.00 35.79 ? 467  ARG A CB  1 
ATOM   3651 C CG  . ARG A 1 467 ? 13.546  85.848 50.680 1.00 37.85 ? 467  ARG A CG  1 
ATOM   3652 C CD  . ARG A 1 467 ? 14.048  87.319 50.464 1.00 39.61 ? 467  ARG A CD  1 
ATOM   3653 N NE  . ARG A 1 467 ? 13.049  88.272 50.946 1.00 39.36 ? 467  ARG A NE  1 
ATOM   3654 C CZ  . ARG A 1 467 ? 11.930  88.546 50.288 1.00 41.04 ? 467  ARG A CZ  1 
ATOM   3655 N NH1 . ARG A 1 467 ? 11.688  87.952 49.123 1.00 39.45 ? 467  ARG A NH1 1 
ATOM   3656 N NH2 . ARG A 1 467 ? 11.034  89.366 50.817 1.00 40.89 ? 467  ARG A NH2 1 
ATOM   3657 N N   . ARG A 1 468 ? 16.229  81.998 50.453 1.00 34.03 ? 468  ARG A N   1 
ATOM   3658 C CA  . ARG A 1 468 ? 17.053  81.028 49.746 1.00 34.68 ? 468  ARG A CA  1 
ATOM   3659 C C   . ARG A 1 468 ? 16.394  79.590 49.667 1.00 33.48 ? 468  ARG A C   1 
ATOM   3660 O O   . ARG A 1 468 ? 16.485  78.889 48.633 1.00 33.01 ? 468  ARG A O   1 
ATOM   3661 C CB  . ARG A 1 468 ? 18.424  80.935 50.417 1.00 37.66 ? 468  ARG A CB  1 
ATOM   3662 C CG  . ARG A 1 468 ? 19.330  79.856 49.796 1.00 41.09 ? 468  ARG A CG  1 
ATOM   3663 C CD  . ARG A 1 468 ? 20.805  80.323 49.899 1.00 45.00 ? 468  ARG A CD  1 
ATOM   3664 N NE  . ARG A 1 468 ? 21.015  81.019 51.167 1.00 44.50 ? 468  ARG A NE  1 
ATOM   3665 C CZ  . ARG A 1 468 ? 21.347  80.425 52.304 1.00 46.96 ? 468  ARG A CZ  1 
ATOM   3666 N NH1 . ARG A 1 468 ? 21.533  79.091 52.327 1.00 45.34 ? 468  ARG A NH1 1 
ATOM   3667 N NH2 . ARG A 1 468 ? 21.446  81.182 53.422 1.00 47.50 ? 468  ARG A NH2 1 
ATOM   3668 N N   . ILE A 1 469 ? 15.752  79.157 50.753 1.00 32.29 ? 469  ILE A N   1 
ATOM   3669 C CA  . ILE A 1 469 ? 15.120  77.839 50.760 1.00 30.86 ? 469  ILE A CA  1 
ATOM   3670 C C   . ILE A 1 469 ? 13.931  77.825 49.802 1.00 32.09 ? 469  ILE A C   1 
ATOM   3671 O O   . ILE A 1 469 ? 13.810  76.909 48.962 1.00 32.58 ? 469  ILE A O   1 
ATOM   3672 C CB  . ILE A 1 469 ? 14.722  77.457 52.226 1.00 31.21 ? 469  ILE A CB  1 
ATOM   3673 C CG1 . ILE A 1 469 ? 15.991  77.048 52.990 1.00 27.86 ? 469  ILE A CG1 1 
ATOM   3674 C CG2 . ILE A 1 469 ? 13.641  76.328 52.268 1.00 29.69 ? 469  ILE A CG2 1 
ATOM   3675 C CD1 . ILE A 1 469 ? 15.720  76.917 54.519 1.00 27.39 ? 469  ILE A CD1 1 
ATOM   3676 N N   . MET A 1 470 ? 13.058  78.837 49.892 1.00 33.03 ? 470  MET A N   1 
ATOM   3677 C CA  . MET A 1 470 ? 11.909  78.898 48.958 1.00 33.35 ? 470  MET A CA  1 
ATOM   3678 C C   . MET A 1 470 ? 12.366  78.880 47.477 1.00 33.23 ? 470  MET A C   1 
ATOM   3679 O O   . MET A 1 470 ? 11.717  78.226 46.607 1.00 30.94 ? 470  MET A O   1 
ATOM   3680 C CB  . MET A 1 470 ? 11.064  80.151 49.193 1.00 32.64 ? 470  MET A CB  1 
ATOM   3681 C CG  . MET A 1 470 ? 10.349  80.149 50.518 1.00 34.75 ? 470  MET A CG  1 
ATOM   3682 S SD  . MET A 1 470 ? 9.063   81.460 50.464 1.00 38.51 ? 470  MET A SD  1 
ATOM   3683 C CE  . MET A 1 470 ? 10.191  82.953 50.768 1.00 34.99 ? 470  MET A CE  1 
ATOM   3684 N N   . HIS A 1 471 ? 13.481  79.577 47.198 1.00 32.49 ? 471  HIS A N   1 
ATOM   3685 C CA  . HIS A 1 471 ? 13.990  79.631 45.814 1.00 32.40 ? 471  HIS A CA  1 
ATOM   3686 C C   . HIS A 1 471 ? 14.640  78.301 45.432 1.00 31.95 ? 471  HIS A C   1 
ATOM   3687 O O   . HIS A 1 471 ? 14.548  77.881 44.273 1.00 33.31 ? 471  HIS A O   1 
ATOM   3688 C CB  . HIS A 1 471 ? 14.946  80.829 45.568 1.00 32.93 ? 471  HIS A CB  1 
ATOM   3689 C CG  . HIS A 1 471 ? 15.148  81.151 44.110 1.00 34.24 ? 471  HIS A CG  1 
ATOM   3690 N ND1 . HIS A 1 471 ? 14.103  81.447 43.255 1.00 36.16 ? 471  HIS A ND1 1 
ATOM   3691 C CD2 . HIS A 1 471 ? 16.269  81.164 43.340 1.00 35.78 ? 471  HIS A CD2 1 
ATOM   3692 C CE1 . HIS A 1 471 ? 14.563  81.619 42.029 1.00 34.78 ? 471  HIS A CE1 1 
ATOM   3693 N NE2 . HIS A 1 471 ? 15.874  81.456 42.052 1.00 36.20 ? 471  HIS A NE2 1 
ATOM   3694 N N   . TYR A 1 472 ? 15.282  77.623 46.375 1.00 31.02 ? 472  TYR A N   1 
ATOM   3695 C CA  . TYR A 1 472 ? 15.826  76.291 46.056 1.00 31.85 ? 472  TYR A CA  1 
ATOM   3696 C C   . TYR A 1 472 ? 14.613  75.373 45.801 1.00 30.78 ? 472  TYR A C   1 
ATOM   3697 O O   . TYR A 1 472 ? 14.611  74.625 44.843 1.00 30.62 ? 472  TYR A O   1 
ATOM   3698 C CB  . TYR A 1 472 ? 16.556  75.637 47.235 1.00 31.44 ? 472  TYR A CB  1 
ATOM   3699 C CG  . TYR A 1 472 ? 17.885  76.231 47.605 1.00 34.20 ? 472  TYR A CG  1 
ATOM   3700 C CD1 . TYR A 1 472 ? 18.799  76.607 46.619 1.00 34.32 ? 472  TYR A CD1 1 
ATOM   3701 C CD2 . TYR A 1 472 ? 18.295  76.256 48.953 1.00 35.10 ? 472  TYR A CD2 1 
ATOM   3702 C CE1 . TYR A 1 472 ? 20.095  76.975 46.957 1.00 37.04 ? 472  TYR A CE1 1 
ATOM   3703 C CE2 . TYR A 1 472 ? 19.575  76.608 49.322 1.00 34.97 ? 472  TYR A CE2 1 
ATOM   3704 C CZ  . TYR A 1 472 ? 20.478  76.958 48.325 1.00 38.48 ? 472  TYR A CZ  1 
ATOM   3705 O OH  . TYR A 1 472 ? 21.789  77.172 48.677 1.00 39.33 ? 472  TYR A OH  1 
ATOM   3706 N N   . TRP A 1 473 ? 13.607  75.408 46.684 1.00 29.44 ? 473  TRP A N   1 
ATOM   3707 C CA  . TRP A 1 473 ? 12.470  74.484 46.497 1.00 29.83 ? 473  TRP A CA  1 
ATOM   3708 C C   . TRP A 1 473 ? 11.732  74.734 45.147 1.00 30.18 ? 473  TRP A C   1 
ATOM   3709 O O   . TRP A 1 473 ? 11.442  73.789 44.414 1.00 29.80 ? 473  TRP A O   1 
ATOM   3710 C CB  . TRP A 1 473 ? 11.453  74.592 47.654 1.00 27.31 ? 473  TRP A CB  1 
ATOM   3711 C CG  . TRP A 1 473 ? 11.618  73.603 48.855 1.00 28.75 ? 473  TRP A CG  1 
ATOM   3712 C CD1 . TRP A 1 473 ? 10.607  72.948 49.498 1.00 27.99 ? 473  TRP A CD1 1 
ATOM   3713 C CD2 . TRP A 1 473 ? 12.825  73.298 49.614 1.00 27.70 ? 473  TRP A CD2 1 
ATOM   3714 N NE1 . TRP A 1 473 ? 11.090  72.265 50.615 1.00 25.61 ? 473  TRP A NE1 1 
ATOM   3715 C CE2 . TRP A 1 473 ? 12.438  72.459 50.705 1.00 26.77 ? 473  TRP A CE2 1 
ATOM   3716 C CE3 . TRP A 1 473 ? 14.189  73.649 49.476 1.00 28.29 ? 473  TRP A CE3 1 
ATOM   3717 C CZ2 . TRP A 1 473 ? 13.358  71.970 51.652 1.00 25.38 ? 473  TRP A CZ2 1 
ATOM   3718 C CZ3 . TRP A 1 473 ? 15.118  73.154 50.432 1.00 27.36 ? 473  TRP A CZ3 1 
ATOM   3719 C CH2 . TRP A 1 473 ? 14.687  72.325 51.504 1.00 25.11 ? 473  TRP A CH2 1 
ATOM   3720 N N   . ALA A 1 474 ? 11.434  75.998 44.834 1.00 29.92 ? 474  ALA A N   1 
ATOM   3721 C CA  . ALA A 1 474 ? 10.717  76.347 43.594 1.00 30.22 ? 474  ALA A CA  1 
ATOM   3722 C C   . ALA A 1 474 ? 11.564  76.104 42.342 1.00 29.69 ? 474  ALA A C   1 
ATOM   3723 O O   . ALA A 1 474 ? 11.066  75.670 41.322 1.00 30.64 ? 474  ALA A O   1 
ATOM   3724 C CB  . ALA A 1 474 ? 10.269  77.806 43.644 1.00 29.16 ? 474  ALA A CB  1 
ATOM   3725 N N   . THR A 1 475 ? 12.852  76.371 42.413 1.00 31.00 ? 475  THR A N   1 
ATOM   3726 C CA  . THR A 1 475 ? 13.711  76.146 41.244 1.00 30.52 ? 475  THR A CA  1 
ATOM   3727 C C   . THR A 1 475 ? 13.820  74.640 41.022 1.00 30.98 ? 475  THR A C   1 
ATOM   3728 O O   . THR A 1 475 ? 13.807  74.167 39.881 1.00 30.32 ? 475  THR A O   1 
ATOM   3729 C CB  . THR A 1 475 ? 15.082  76.755 41.464 1.00 30.71 ? 475  THR A CB  1 
ATOM   3730 O OG1 . THR A 1 475 ? 14.913  78.155 41.720 1.00 28.27 ? 475  THR A OG1 1 
ATOM   3731 C CG2 . THR A 1 475 ? 15.977  76.541 40.214 1.00 30.53 ? 475  THR A CG2 1 
ATOM   3732 N N   . PHE A 1 476 ? 13.924  73.875 42.105 1.00 29.74 ? 476  PHE A N   1 
ATOM   3733 C CA  . PHE A 1 476 ? 13.951  72.432 41.911 1.00 30.08 ? 476  PHE A CA  1 
ATOM   3734 C C   . PHE A 1 476 ? 12.587  71.957 41.292 1.00 28.96 ? 476  PHE A C   1 
ATOM   3735 O O   . PHE A 1 476 ? 12.560  71.156 40.356 1.00 28.78 ? 476  PHE A O   1 
ATOM   3736 C CB  . PHE A 1 476 ? 14.184  71.708 43.253 1.00 30.48 ? 476  PHE A CB  1 
ATOM   3737 C CG  . PHE A 1 476 ? 13.912  70.221 43.177 1.00 31.23 ? 476  PHE A CG  1 
ATOM   3738 C CD1 . PHE A 1 476 ? 14.905  69.346 42.735 1.00 30.12 ? 476  PHE A CD1 1 
ATOM   3739 C CD2 . PHE A 1 476 ? 12.643  69.710 43.510 1.00 30.67 ? 476  PHE A CD2 1 
ATOM   3740 C CE1 . PHE A 1 476 ? 14.662  67.972 42.634 1.00 30.04 ? 476  PHE A CE1 1 
ATOM   3741 C CE2 . PHE A 1 476 ? 12.383  68.322 43.402 1.00 30.97 ? 476  PHE A CE2 1 
ATOM   3742 C CZ  . PHE A 1 476 ? 13.400  67.449 42.971 1.00 29.07 ? 476  PHE A CZ  1 
ATOM   3743 N N   . ALA A 1 477 ? 11.468  72.486 41.799 1.00 28.87 ? 477  ALA A N   1 
ATOM   3744 C CA  . ALA A 1 477 ? 10.143  72.099 41.320 1.00 28.63 ? 477  ALA A CA  1 
ATOM   3745 C C   . ALA A 1 477 ? 10.021  72.396 39.826 1.00 29.65 ? 477  ALA A C   1 
ATOM   3746 O O   . ALA A 1 477 ? 9.459   71.604 39.047 1.00 29.19 ? 477  ALA A O   1 
ATOM   3747 C CB  . ALA A 1 477 ? 9.063   72.867 42.114 1.00 24.41 ? 477  ALA A CB  1 
ATOM   3748 N N   . LYS A 1 478 ? 10.568  73.545 39.422 1.00 30.84 ? 478  LYS A N   1 
ATOM   3749 C CA  . LYS A 1 478 ? 10.502  73.933 38.039 1.00 31.83 ? 478  LYS A CA  1 
ATOM   3750 C C   . LYS A 1 478 ? 11.475  73.220 37.094 1.00 31.65 ? 478  LYS A C   1 
ATOM   3751 O O   . LYS A 1 478 ? 11.105  72.919 35.969 1.00 30.37 ? 478  LYS A O   1 
ATOM   3752 C CB  . LYS A 1 478 ? 10.705  75.453 37.936 1.00 35.85 ? 478  LYS A CB  1 
ATOM   3753 C CG  . LYS A 1 478 ? 10.684  75.970 36.470 1.00 39.31 ? 478  LYS A CG  1 
ATOM   3754 C CD  . LYS A 1 478 ? 11.103  77.437 36.431 1.00 44.91 ? 478  LYS A CD  1 
ATOM   3755 C CE  . LYS A 1 478 ? 11.184  77.943 35.001 1.00 47.77 ? 478  LYS A CE  1 
ATOM   3756 N NZ  . LYS A 1 478 ? 11.975  79.237 34.912 1.00 51.63 ? 478  LYS A NZ  1 
ATOM   3757 N N   . THR A 1 479 ? 12.693  72.915 37.558 1.00 31.53 ? 479  THR A N   1 
ATOM   3758 C CA  . THR A 1 479 ? 13.710  72.320 36.698 1.00 32.05 ? 479  THR A CA  1 
ATOM   3759 C C   . THR A 1 479 ? 14.305  70.950 37.068 1.00 33.23 ? 479  THR A C   1 
ATOM   3760 O O   . THR A 1 479 ? 14.962  70.325 36.218 1.00 31.16 ? 479  THR A O   1 
ATOM   3761 C CB  . THR A 1 479 ? 14.933  73.230 36.608 1.00 34.05 ? 479  THR A CB  1 
ATOM   3762 O OG1 . THR A 1 479 ? 15.584  73.232 37.883 1.00 32.47 ? 479  THR A OG1 1 
ATOM   3763 C CG2 . THR A 1 479 ? 14.540  74.722 36.234 1.00 34.46 ? 479  THR A CG2 1 
ATOM   3764 N N   . GLY A 1 480 ? 14.104  70.494 38.310 1.00 31.59 ? 480  GLY A N   1 
ATOM   3765 C CA  . GLY A 1 480 ? 14.708  69.257 38.734 1.00 31.43 ? 480  GLY A CA  1 
ATOM   3766 C C   . GLY A 1 480 ? 16.092  69.526 39.341 1.00 31.74 ? 480  GLY A C   1 
ATOM   3767 O O   . GLY A 1 480 ? 16.795  68.578 39.628 1.00 30.68 ? 480  GLY A O   1 
ATOM   3768 N N   . ASN A 1 481 ? 16.448  70.808 39.566 1.00 32.14 ? 481  ASN A N   1 
ATOM   3769 C CA  . ASN A 1 481 ? 17.763  71.214 40.121 1.00 32.87 ? 481  ASN A CA  1 
ATOM   3770 C C   . ASN A 1 481 ? 17.490  72.470 40.942 1.00 32.85 ? 481  ASN A C   1 
ATOM   3771 O O   . ASN A 1 481 ? 16.946  73.434 40.393 1.00 34.64 ? 481  ASN A O   1 
ATOM   3772 C CB  . ASN A 1 481 ? 18.722  71.559 38.946 1.00 34.52 ? 481  ASN A CB  1 
ATOM   3773 C CG  . ASN A 1 481 ? 20.202  71.850 39.392 1.00 34.83 ? 481  ASN A CG  1 
ATOM   3774 O OD1 . ASN A 1 481 ? 20.489  72.351 40.504 1.00 34.65 ? 481  ASN A OD1 1 
ATOM   3775 N ND2 . ASN A 1 481 ? 21.135  71.548 38.488 1.00 34.23 ? 481  ASN A ND2 1 
ATOM   3776 N N   . PRO A 1 482 ? 17.845  72.492 42.262 1.00 32.06 ? 482  PRO A N   1 
ATOM   3777 C CA  . PRO A 1 482 ? 17.602  73.681 43.122 1.00 32.73 ? 482  PRO A CA  1 
ATOM   3778 C C   . PRO A 1 482 ? 18.440  74.907 42.758 1.00 33.95 ? 482  PRO A C   1 
ATOM   3779 O O   . PRO A 1 482 ? 18.131  76.036 43.166 1.00 32.64 ? 482  PRO A O   1 
ATOM   3780 C CB  . PRO A 1 482 ? 17.962  73.192 44.542 1.00 30.53 ? 482  PRO A CB  1 
ATOM   3781 C CG  . PRO A 1 482 ? 19.094  72.181 44.240 1.00 30.86 ? 482  PRO A CG  1 
ATOM   3782 C CD  . PRO A 1 482 ? 18.604  71.450 42.991 1.00 31.55 ? 482  PRO A CD  1 
ATOM   3783 N N   . ASN A 1 483 ? 19.511  74.666 42.014 1.00 35.09 ? 483  ASN A N   1 
ATOM   3784 C CA  . ASN A 1 483 ? 20.422  75.726 41.633 1.00 37.67 ? 483  ASN A CA  1 
ATOM   3785 C C   . ASN A 1 483 ? 19.995  76.487 40.396 1.00 39.68 ? 483  ASN A C   1 
ATOM   3786 O O   . ASN A 1 483 ? 19.502  75.938 39.429 1.00 37.65 ? 483  ASN A O   1 
ATOM   3787 C CB  . ASN A 1 483 ? 21.821  75.153 41.374 1.00 35.85 ? 483  ASN A CB  1 
ATOM   3788 C CG  . ASN A 1 483 ? 22.346  74.368 42.550 1.00 36.17 ? 483  ASN A CG  1 
ATOM   3789 O OD1 . ASN A 1 483 ? 22.633  74.954 43.584 1.00 34.75 ? 483  ASN A OD1 1 
ATOM   3790 N ND2 . ASN A 1 483 ? 22.466  73.020 42.402 1.00 33.80 ? 483  ASN A ND2 1 
ATOM   3791 N N   . GLU A 1 484 ? 20.252  77.769 40.461 1.00 44.06 ? 484  GLU A N   1 
ATOM   3792 C CA  . GLU A 1 484 ? 19.990  78.711 39.389 1.00 50.54 ? 484  GLU A CA  1 
ATOM   3793 C C   . GLU A 1 484 ? 21.186  78.503 38.408 1.00 52.43 ? 484  GLU A C   1 
ATOM   3794 O O   . GLU A 1 484 ? 22.358  78.670 38.773 1.00 51.78 ? 484  GLU A O   1 
ATOM   3795 C CB  . GLU A 1 484 ? 20.012  80.109 40.026 1.00 53.29 ? 484  GLU A CB  1 
ATOM   3796 C CG  . GLU A 1 484 ? 19.533  81.256 39.181 1.00 58.51 ? 484  GLU A CG  1 
ATOM   3797 C CD  . GLU A 1 484 ? 18.058  81.216 38.938 1.00 59.83 ? 484  GLU A CD  1 
ATOM   3798 O OE1 . GLU A 1 484 ? 17.301  81.730 39.785 1.00 60.49 ? 484  GLU A OE1 1 
ATOM   3799 O OE2 . GLU A 1 484 ? 17.668  80.656 37.890 1.00 62.77 ? 484  GLU A OE2 1 
ATOM   3800 N N   . PRO A 1 485 ? 20.909  78.103 37.160 1.00 55.08 ? 485  PRO A N   1 
ATOM   3801 C CA  . PRO A 1 485 ? 22.029  77.904 36.223 1.00 56.86 ? 485  PRO A CA  1 
ATOM   3802 C C   . PRO A 1 485 ? 22.704  79.255 35.924 1.00 57.45 ? 485  PRO A C   1 
ATOM   3803 O O   . PRO A 1 485 ? 22.009  80.289 35.931 1.00 58.23 ? 485  PRO A O   1 
ATOM   3804 C CB  . PRO A 1 485 ? 21.339  77.337 34.993 1.00 57.14 ? 485  PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 485 ? 20.032  78.141 34.981 1.00 56.87 ? 485  PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 485 ? 19.609  78.084 36.453 1.00 56.54 ? 485  PRO A CD  1 
ATOM   3807 N N   . SER A 1 490 ? 27.134  79.806 44.895 1.00 50.60 ? 490  SER A N   1 
ATOM   3808 C CA  . SER A 1 490 ? 27.445  78.635 45.765 1.00 49.80 ? 490  SER A CA  1 
ATOM   3809 C C   . SER A 1 490 ? 26.463  77.494 45.411 1.00 46.92 ? 490  SER A C   1 
ATOM   3810 O O   . SER A 1 490 ? 25.272  77.582 45.710 1.00 45.47 ? 490  SER A O   1 
ATOM   3811 C CB  . SER A 1 490 ? 27.302  79.008 47.253 1.00 52.11 ? 490  SER A CB  1 
ATOM   3812 O OG  . SER A 1 490 ? 28.503  79.577 47.773 1.00 53.94 ? 490  SER A OG  1 
ATOM   3813 N N   . LYS A 1 491 ? 26.980  76.457 44.760 1.00 44.57 ? 491  LYS A N   1 
ATOM   3814 C CA  . LYS A 1 491 ? 26.184  75.335 44.310 1.00 44.61 ? 491  LYS A CA  1 
ATOM   3815 C C   . LYS A 1 491 ? 25.932  74.124 45.247 1.00 43.64 ? 491  LYS A C   1 
ATOM   3816 O O   . LYS A 1 491 ? 26.886  73.460 45.747 1.00 43.01 ? 491  LYS A O   1 
ATOM   3817 C CB  . LYS A 1 491 ? 26.760  74.808 42.996 1.00 45.50 ? 491  LYS A CB  1 
ATOM   3818 N N   . TRP A 1 492 ? 24.634  73.848 45.452 1.00 40.04 ? 492  TRP A N   1 
ATOM   3819 C CA  . TRP A 1 492 ? 24.156  72.685 46.228 1.00 35.42 ? 492  TRP A CA  1 
ATOM   3820 C C   . TRP A 1 492 ? 24.480  71.563 45.257 1.00 35.34 ? 492  TRP A C   1 
ATOM   3821 O O   . TRP A 1 492 ? 23.841  71.451 44.232 1.00 36.63 ? 492  TRP A O   1 
ATOM   3822 C CB  . TRP A 1 492 ? 22.652  72.762 46.381 1.00 33.87 ? 492  TRP A CB  1 
ATOM   3823 C CG  . TRP A 1 492 ? 21.994  71.651 47.177 1.00 32.89 ? 492  TRP A CG  1 
ATOM   3824 C CD1 . TRP A 1 492 ? 22.485  70.401 47.454 1.00 32.27 ? 492  TRP A CD1 1 
ATOM   3825 C CD2 . TRP A 1 492 ? 20.721  71.721 47.776 1.00 29.98 ? 492  TRP A CD2 1 
ATOM   3826 N NE1 . TRP A 1 492 ? 21.584  69.692 48.199 1.00 32.75 ? 492  TRP A NE1 1 
ATOM   3827 C CE2 . TRP A 1 492 ? 20.485  70.481 48.413 1.00 31.22 ? 492  TRP A CE2 1 
ATOM   3828 C CE3 . TRP A 1 492 ? 19.746  72.716 47.840 1.00 30.03 ? 492  TRP A CE3 1 
ATOM   3829 C CZ2 . TRP A 1 492 ? 19.303  70.207 49.111 1.00 29.31 ? 492  TRP A CZ2 1 
ATOM   3830 C CZ3 . TRP A 1 492 ? 18.581  72.457 48.521 1.00 31.21 ? 492  TRP A CZ3 1 
ATOM   3831 C CH2 . TRP A 1 492 ? 18.365  71.198 49.158 1.00 30.37 ? 492  TRP A CH2 1 
ATOM   3832 N N   . PRO A 1 493 ? 25.466  70.707 45.564 1.00 34.40 ? 493  PRO A N   1 
ATOM   3833 C CA  . PRO A 1 493 ? 25.853  69.598 44.664 1.00 34.29 ? 493  PRO A CA  1 
ATOM   3834 C C   . PRO A 1 493 ? 24.907  68.404 44.660 1.00 34.83 ? 493  PRO A C   1 
ATOM   3835 O O   . PRO A 1 493 ? 24.211  68.148 45.638 1.00 34.26 ? 493  PRO A O   1 
ATOM   3836 C CB  . PRO A 1 493 ? 27.246  69.183 45.191 1.00 33.14 ? 493  PRO A CB  1 
ATOM   3837 C CG  . PRO A 1 493 ? 27.085  69.409 46.660 1.00 34.46 ? 493  PRO A CG  1 
ATOM   3838 C CD  . PRO A 1 493 ? 26.305  70.732 46.770 1.00 32.32 ? 493  PRO A CD  1 
ATOM   3839 N N   . LEU A 1 494 ? 24.895  67.687 43.549 1.00 33.44 ? 494  LEU A N   1 
ATOM   3840 C CA  . LEU A 1 494 ? 24.078  66.513 43.398 1.00 35.78 ? 494  LEU A CA  1 
ATOM   3841 C C   . LEU A 1 494 ? 24.534  65.423 44.403 1.00 35.92 ? 494  LEU A C   1 
ATOM   3842 O O   . LEU A 1 494 ? 25.735  65.291 44.679 1.00 34.82 ? 494  LEU A O   1 
ATOM   3843 C CB  . LEU A 1 494 ? 24.247  66.011 41.970 1.00 36.59 ? 494  LEU A CB  1 
ATOM   3844 C CG  . LEU A 1 494 ? 23.251  65.112 41.251 1.00 38.84 ? 494  LEU A CG  1 
ATOM   3845 C CD1 . LEU A 1 494 ? 21.854  65.774 41.083 1.00 36.20 ? 494  LEU A CD1 1 
ATOM   3846 C CD2 . LEU A 1 494 ? 23.882  64.803 39.895 1.00 38.87 ? 494  LEU A CD2 1 
ATOM   3847 N N   . PHE A 1 495 ? 23.577  64.694 44.994 1.00 35.08 ? 495  PHE A N   1 
ATOM   3848 C CA  . PHE A 1 495 ? 23.900  63.583 45.886 1.00 33.35 ? 495  PHE A CA  1 
ATOM   3849 C C   . PHE A 1 495 ? 24.083  62.425 44.899 1.00 34.66 ? 495  PHE A C   1 
ATOM   3850 O O   . PHE A 1 495 ? 23.195  62.148 44.089 1.00 34.14 ? 495  PHE A O   1 
ATOM   3851 C CB  . PHE A 1 495 ? 22.724  63.278 46.865 1.00 32.17 ? 495  PHE A CB  1 
ATOM   3852 C CG  . PHE A 1 495 ? 22.879  61.970 47.643 1.00 30.57 ? 495  PHE A CG  1 
ATOM   3853 C CD1 . PHE A 1 495 ? 22.592  60.738 47.045 1.00 31.11 ? 495  PHE A CD1 1 
ATOM   3854 C CD2 . PHE A 1 495 ? 23.378  61.971 48.947 1.00 29.09 ? 495  PHE A CD2 1 
ATOM   3855 C CE1 . PHE A 1 495 ? 22.822  59.514 47.758 1.00 32.46 ? 495  PHE A CE1 1 
ATOM   3856 C CE2 . PHE A 1 495 ? 23.606  60.771 49.663 1.00 29.80 ? 495  PHE A CE2 1 
ATOM   3857 C CZ  . PHE A 1 495 ? 23.342  59.548 49.088 1.00 29.82 ? 495  PHE A CZ  1 
ATOM   3858 N N   . THR A 1 496 ? 25.230  61.760 44.939 1.00 36.32 ? 496  THR A N   1 
ATOM   3859 C CA  . THR A 1 496 ? 25.475  60.605 44.048 1.00 37.64 ? 496  THR A CA  1 
ATOM   3860 C C   . THR A 1 496 ? 25.810  59.403 44.905 1.00 38.87 ? 496  THR A C   1 
ATOM   3861 O O   . THR A 1 496 ? 26.254  59.534 46.061 1.00 38.07 ? 496  THR A O   1 
ATOM   3862 C CB  . THR A 1 496 ? 26.687  60.819 43.120 1.00 37.67 ? 496  THR A CB  1 
ATOM   3863 O OG1 . THR A 1 496 ? 27.865  60.980 43.939 1.00 35.11 ? 496  THR A OG1 1 
ATOM   3864 C CG2 . THR A 1 496 ? 26.486  62.076 42.240 1.00 33.53 ? 496  THR A CG2 1 
ATOM   3865 N N   . THR A 1 497 ? 25.599  58.229 44.326 1.00 41.22 ? 497  THR A N   1 
ATOM   3866 C CA  . THR A 1 497 ? 25.854  56.951 45.010 1.00 43.48 ? 497  THR A CA  1 
ATOM   3867 C C   . THR A 1 497 ? 27.270  56.885 45.577 1.00 43.55 ? 497  THR A C   1 
ATOM   3868 O O   . THR A 1 497 ? 27.517  56.411 46.693 1.00 44.12 ? 497  THR A O   1 
ATOM   3869 C CB  . THR A 1 497 ? 25.717  55.820 44.002 1.00 44.50 ? 497  THR A CB  1 
ATOM   3870 O OG1 . THR A 1 497 ? 24.397  55.838 43.469 1.00 46.30 ? 497  THR A OG1 1 
ATOM   3871 C CG2 . THR A 1 497 ? 26.002  54.490 44.652 1.00 45.79 ? 497  THR A CG2 1 
ATOM   3872 N N   . LYS A 1 498 ? 28.196  57.380 44.770 1.00 43.42 ? 498  LYS A N   1 
ATOM   3873 C CA  . LYS A 1 498 ? 29.606  57.389 45.088 1.00 43.65 ? 498  LYS A CA  1 
ATOM   3874 C C   . LYS A 1 498 ? 30.034  58.400 46.143 1.00 43.21 ? 498  LYS A C   1 
ATOM   3875 O O   . LYS A 1 498 ? 30.576  58.024 47.182 1.00 44.45 ? 498  LYS A O   1 
ATOM   3876 C CB  . LYS A 1 498 ? 30.388  57.648 43.807 1.00 43.97 ? 498  LYS A CB  1 
ATOM   3877 C CG  . LYS A 1 498 ? 31.874  57.316 43.927 1.00 45.64 ? 498  LYS A CG  1 
ATOM   3878 N N   . GLU A 1 499 ? 29.801  59.683 45.883 1.00 42.05 ? 499  GLU A N   1 
ATOM   3879 C CA  . GLU A 1 499 ? 30.237  60.718 46.814 1.00 41.36 ? 499  GLU A CA  1 
ATOM   3880 C C   . GLU A 1 499 ? 29.284  61.080 47.995 1.00 39.33 ? 499  GLU A C   1 
ATOM   3881 O O   . GLU A 1 499 ? 29.730  61.614 49.003 1.00 37.27 ? 499  GLU A O   1 
ATOM   3882 C CB  . GLU A 1 499 ? 30.606  61.991 46.020 1.00 44.56 ? 499  GLU A CB  1 
ATOM   3883 C CG  . GLU A 1 499 ? 31.658  61.824 44.873 1.00 50.15 ? 499  GLU A CG  1 
ATOM   3884 C CD  . GLU A 1 499 ? 32.846  60.949 45.266 1.00 55.74 ? 499  GLU A CD  1 
ATOM   3885 O OE1 . GLU A 1 499 ? 32.872  59.772 44.824 1.00 58.02 ? 499  GLU A OE1 1 
ATOM   3886 O OE2 . GLU A 1 499 ? 33.742  61.419 46.026 1.00 58.33 ? 499  GLU A OE2 1 
ATOM   3887 N N   . GLN A 1 500 ? 27.982  60.837 47.841 1.00 37.92 ? 500  GLN A N   1 
ATOM   3888 C CA  . GLN A 1 500 ? 26.985  61.086 48.901 1.00 36.70 ? 500  GLN A CA  1 
ATOM   3889 C C   . GLN A 1 500 ? 27.004  62.466 49.566 1.00 34.66 ? 500  GLN A C   1 
ATOM   3890 O O   . GLN A 1 500 ? 26.886  62.596 50.784 1.00 32.96 ? 500  GLN A O   1 
ATOM   3891 C CB  . GLN A 1 500 ? 27.142  59.968 49.936 1.00 37.48 ? 500  GLN A CB  1 
ATOM   3892 C CG  . GLN A 1 500 ? 26.912  58.624 49.254 1.00 38.88 ? 500  GLN A CG  1 
ATOM   3893 C CD  . GLN A 1 500 ? 27.198  57.421 50.144 1.00 42.27 ? 500  GLN A CD  1 
ATOM   3894 O OE1 . GLN A 1 500 ? 26.895  57.425 51.333 1.00 41.35 ? 500  GLN A OE1 1 
ATOM   3895 N NE2 . GLN A 1 500 ? 27.773  56.367 49.550 1.00 42.16 ? 500  GLN A NE2 1 
ATOM   3896 N N   . LYS A 1 501 ? 27.140  63.491 48.744 1.00 33.40 ? 501  LYS A N   1 
ATOM   3897 C CA  . LYS A 1 501 ? 27.208  64.853 49.247 1.00 33.63 ? 501  LYS A CA  1 
ATOM   3898 C C   . LYS A 1 501 ? 25.856  65.415 49.638 1.00 32.59 ? 501  LYS A C   1 
ATOM   3899 O O   . LYS A 1 501 ? 24.792  65.030 49.072 1.00 32.14 ? 501  LYS A O   1 
ATOM   3900 C CB  . LYS A 1 501 ? 27.825  65.778 48.182 1.00 33.72 ? 501  LYS A CB  1 
ATOM   3901 C CG  . LYS A 1 501 ? 29.273  65.386 47.789 1.00 38.14 ? 501  LYS A CG  1 
ATOM   3902 C CD  . LYS A 1 501 ? 29.802  66.273 46.622 1.00 39.60 ? 501  LYS A CD  1 
ATOM   3903 C CE  . LYS A 1 501 ? 31.331  66.103 46.500 1.00 42.76 ? 501  LYS A CE  1 
ATOM   3904 N NZ  . LYS A 1 501 ? 31.855  66.880 45.337 1.00 45.95 ? 501  LYS A NZ  1 
ATOM   3905 N N   . PHE A 1 502 ? 25.916  66.332 50.579 1.00 30.03 ? 502  PHE A N   1 
ATOM   3906 C CA  . PHE A 1 502 ? 24.726  67.040 51.041 1.00 32.41 ? 502  PHE A CA  1 
ATOM   3907 C C   . PHE A 1 502 ? 25.199  68.395 51.566 1.00 32.48 ? 502  PHE A C   1 
ATOM   3908 O O   . PHE A 1 502 ? 26.383  68.598 51.784 1.00 32.82 ? 502  PHE A O   1 
ATOM   3909 C CB  . PHE A 1 502 ? 24.018  66.250 52.149 1.00 30.08 ? 502  PHE A CB  1 
ATOM   3910 C CG  . PHE A 1 502 ? 24.794  66.149 53.479 1.00 32.06 ? 502  PHE A CG  1 
ATOM   3911 C CD1 . PHE A 1 502 ? 24.524  67.014 54.529 1.00 32.31 ? 502  PHE A CD1 1 
ATOM   3912 C CD2 . PHE A 1 502 ? 25.717  65.111 53.692 1.00 33.70 ? 502  PHE A CD2 1 
ATOM   3913 C CE1 . PHE A 1 502 ? 25.136  66.852 55.778 1.00 32.84 ? 502  PHE A CE1 1 
ATOM   3914 C CE2 . PHE A 1 502 ? 26.350  64.924 54.942 1.00 32.47 ? 502  PHE A CE2 1 
ATOM   3915 C CZ  . PHE A 1 502 ? 26.062  65.784 55.991 1.00 33.27 ? 502  PHE A CZ  1 
ATOM   3916 N N   . ILE A 1 503 ? 24.277  69.314 51.779 1.00 33.28 ? 503  ILE A N   1 
ATOM   3917 C CA  . ILE A 1 503 ? 24.643  70.602 52.329 1.00 33.03 ? 503  ILE A CA  1 
ATOM   3918 C C   . ILE A 1 503 ? 23.880  70.859 53.659 1.00 34.02 ? 503  ILE A C   1 
ATOM   3919 O O   . ILE A 1 503 ? 22.833  70.245 53.950 1.00 31.83 ? 503  ILE A O   1 
ATOM   3920 C CB  . ILE A 1 503 ? 24.265  71.759 51.354 1.00 34.64 ? 503  ILE A CB  1 
ATOM   3921 C CG1 . ILE A 1 503 ? 22.740  71.786 51.157 1.00 33.74 ? 503  ILE A CG1 1 
ATOM   3922 C CG2 . ILE A 1 503 ? 24.968  71.588 50.011 1.00 33.30 ? 503  ILE A CG2 1 
ATOM   3923 C CD1 . ILE A 1 503 ? 22.233  73.064 50.589 1.00 36.66 ? 503  ILE A CD1 1 
ATOM   3924 N N   . ASP A 1 504 ? 24.431  71.763 54.458 1.00 32.75 ? 504  ASP A N   1 
ATOM   3925 C CA  . ASP A 1 504 ? 23.793  72.186 55.673 1.00 35.21 ? 504  ASP A CA  1 
ATOM   3926 C C   . ASP A 1 504 ? 22.936  73.336 55.164 1.00 35.53 ? 504  ASP A C   1 
ATOM   3927 O O   . ASP A 1 504 ? 23.290  74.011 54.185 1.00 36.49 ? 504  ASP A O   1 
ATOM   3928 C CB  . ASP A 1 504 ? 24.798  72.742 56.698 1.00 37.17 ? 504  ASP A CB  1 
ATOM   3929 C CG  . ASP A 1 504 ? 25.733  71.675 57.241 1.00 40.38 ? 504  ASP A CG  1 
ATOM   3930 O OD1 . ASP A 1 504 ? 25.300  70.508 57.375 1.00 42.25 ? 504  ASP A OD1 1 
ATOM   3931 O OD2 . ASP A 1 504 ? 26.904  71.987 57.556 1.00 41.75 ? 504  ASP A OD2 1 
ATOM   3932 N N   . LEU A 1 505 ? 21.818  73.559 55.820 1.00 34.46 ? 505  LEU A N   1 
ATOM   3933 C CA  . LEU A 1 505 ? 20.934  74.632 55.451 1.00 34.35 ? 505  LEU A CA  1 
ATOM   3934 C C   . LEU A 1 505 ? 20.808  75.449 56.723 1.00 34.28 ? 505  LEU A C   1 
ATOM   3935 O O   . LEU A 1 505 ? 20.204  74.999 57.725 1.00 33.45 ? 505  LEU A O   1 
ATOM   3936 C CB  . LEU A 1 505 ? 19.590  74.017 55.028 1.00 35.69 ? 505  LEU A CB  1 
ATOM   3937 C CG  . LEU A 1 505 ? 18.713  74.538 53.903 1.00 39.82 ? 505  LEU A CG  1 
ATOM   3938 C CD1 . LEU A 1 505 ? 19.537  75.211 52.767 1.00 35.26 ? 505  LEU A CD1 1 
ATOM   3939 C CD2 . LEU A 1 505 ? 17.883  73.330 53.395 1.00 35.53 ? 505  LEU A CD2 1 
ATOM   3940 N N   . ASN A 1 506 ? 21.406  76.634 56.734 1.00 34.19 ? 506  ASN A N   1 
ATOM   3941 C CA  . ASN A 1 506 ? 21.331  77.491 57.927 1.00 35.87 ? 506  ASN A CA  1 
ATOM   3942 C C   . ASN A 1 506 ? 21.753  78.917 57.542 1.00 37.28 ? 506  ASN A C   1 
ATOM   3943 O O   . ASN A 1 506 ? 21.873  79.210 56.356 1.00 36.54 ? 506  ASN A O   1 
ATOM   3944 C CB  . ASN A 1 506 ? 22.211  76.902 59.050 1.00 36.34 ? 506  ASN A CB  1 
ATOM   3945 C CG  . ASN A 1 506 ? 23.692  76.733 58.620 1.00 37.10 ? 506  ASN A CG  1 
ATOM   3946 O OD1 . ASN A 1 506 ? 24.251  77.610 57.977 1.00 35.47 ? 506  ASN A OD1 1 
ATOM   3947 N ND2 . ASN A 1 506 ? 24.314  75.636 59.020 1.00 33.90 ? 506  ASN A ND2 1 
ATOM   3948 N N   . THR A 1 507 ? 21.969  79.813 58.496 1.00 39.08 ? 507  THR A N   1 
ATOM   3949 C CA  . THR A 1 507 ? 22.320  81.186 58.114 1.00 41.82 ? 507  THR A CA  1 
ATOM   3950 C C   . THR A 1 507 ? 23.785  81.446 57.717 1.00 43.01 ? 507  THR A C   1 
ATOM   3951 O O   . THR A 1 507 ? 24.127  82.526 57.276 1.00 43.86 ? 507  THR A O   1 
ATOM   3952 C CB  . THR A 1 507 ? 21.943  82.153 59.213 1.00 43.12 ? 507  THR A CB  1 
ATOM   3953 O OG1 . THR A 1 507 ? 22.616  81.756 60.418 1.00 44.17 ? 507  THR A OG1 1 
ATOM   3954 C CG2 . THR A 1 507 ? 20.420  82.154 59.431 1.00 41.70 ? 507  THR A CG2 1 
ATOM   3955 N N   . GLU A 1 508 ? 24.658  80.467 57.829 1.00 44.60 ? 508  GLU A N   1 
ATOM   3956 C CA  . GLU A 1 508 ? 26.025  80.733 57.434 1.00 46.69 ? 508  GLU A CA  1 
ATOM   3957 C C   . GLU A 1 508 ? 26.420  80.196 56.078 1.00 46.62 ? 508  GLU A C   1 
ATOM   3958 O O   . GLU A 1 508 ? 25.648  79.495 55.468 1.00 45.11 ? 508  GLU A O   1 
ATOM   3959 C CB  . GLU A 1 508 ? 26.974  80.246 58.489 1.00 50.45 ? 508  GLU A CB  1 
ATOM   3960 C CG  . GLU A 1 508 ? 26.969  78.821 58.782 1.00 54.32 ? 508  GLU A CG  1 
ATOM   3961 C CD  . GLU A 1 508 ? 27.270  78.675 60.247 1.00 59.36 ? 508  GLU A CD  1 
ATOM   3962 O OE1 . GLU A 1 508 ? 27.814  77.625 60.686 1.00 59.82 ? 508  GLU A OE1 1 
ATOM   3963 O OE2 . GLU A 1 508 ? 26.932  79.666 60.951 1.00 61.62 ? 508  GLU A OE2 1 
ATOM   3964 N N   . PRO A 1 509 ? 27.621  80.569 55.567 1.00 47.03 ? 509  PRO A N   1 
ATOM   3965 C CA  . PRO A 1 509 ? 28.088  80.108 54.246 1.00 47.07 ? 509  PRO A CA  1 
ATOM   3966 C C   . PRO A 1 509 ? 27.869  78.617 54.063 1.00 47.07 ? 509  PRO A C   1 
ATOM   3967 O O   . PRO A 1 509 ? 28.220  77.840 54.923 1.00 46.96 ? 509  PRO A O   1 
ATOM   3968 C CB  . PRO A 1 509 ? 29.579  80.466 54.236 1.00 46.93 ? 509  PRO A CB  1 
ATOM   3969 C CG  . PRO A 1 509 ? 29.641  81.724 55.108 1.00 48.47 ? 509  PRO A CG  1 
ATOM   3970 C CD  . PRO A 1 509 ? 28.651  81.380 56.253 1.00 47.72 ? 509  PRO A CD  1 
ATOM   3971 N N   . MET A 1 510 ? 27.303  78.233 52.929 1.00 47.07 ? 510  MET A N   1 
ATOM   3972 C CA  . MET A 1 510 ? 27.004  76.843 52.627 1.00 47.37 ? 510  MET A CA  1 
ATOM   3973 C C   . MET A 1 510 ? 28.181  75.921 52.797 1.00 47.00 ? 510  MET A C   1 
ATOM   3974 O O   . MET A 1 510 ? 29.239  76.193 52.267 1.00 47.94 ? 510  MET A O   1 
ATOM   3975 C CB  . MET A 1 510 ? 26.541  76.735 51.177 1.00 49.17 ? 510  MET A CB  1 
ATOM   3976 C CG  . MET A 1 510 ? 26.105  75.350 50.746 1.00 49.82 ? 510  MET A CG  1 
ATOM   3977 S SD  . MET A 1 510 ? 25.940  75.217 48.944 1.00 51.40 ? 510  MET A SD  1 
ATOM   3978 C CE  . MET A 1 510 ? 24.383  75.962 48.661 1.00 50.91 ? 510  MET A CE  1 
ATOM   3979 N N   . LYS A 1 511 ? 28.020  74.826 53.532 1.00 45.97 ? 511  LYS A N   1 
ATOM   3980 C CA  . LYS A 1 511 ? 29.105  73.850 53.652 1.00 44.91 ? 511  LYS A CA  1 
ATOM   3981 C C   . LYS A 1 511 ? 28.552  72.562 53.051 1.00 44.19 ? 511  LYS A C   1 
ATOM   3982 O O   . LYS A 1 511 ? 27.367  72.232 53.244 1.00 44.59 ? 511  LYS A O   1 
ATOM   3983 C CB  . LYS A 1 511 ? 29.488  73.590 55.112 1.00 44.58 ? 511  LYS A CB  1 
ATOM   3984 C CG  . LYS A 1 511 ? 30.018  74.807 55.812 1.00 47.45 ? 511  LYS A CG  1 
ATOM   3985 N N   . VAL A 1 512 ? 29.412  71.842 52.356 1.00 41.51 ? 512  VAL A N   1 
ATOM   3986 C CA  . VAL A 1 512 ? 29.073  70.588 51.726 1.00 40.84 ? 512  VAL A CA  1 
ATOM   3987 C C   . VAL A 1 512 ? 29.760  69.502 52.562 1.00 41.12 ? 512  VAL A C   1 
ATOM   3988 O O   . VAL A 1 512 ? 30.919  69.678 52.976 1.00 41.17 ? 512  VAL A O   1 
ATOM   3989 C CB  . VAL A 1 512 ? 29.634  70.542 50.276 1.00 40.65 ? 512  VAL A CB  1 
ATOM   3990 C CG1 . VAL A 1 512 ? 29.503  69.154 49.694 1.00 38.55 ? 512  VAL A CG1 1 
ATOM   3991 C CG2 . VAL A 1 512 ? 28.905  71.583 49.387 1.00 41.24 ? 512  VAL A CG2 1 
ATOM   3992 N N   . HIS A 1 513 ? 29.051  68.402 52.841 1.00 39.89 ? 513  HIS A N   1 
ATOM   3993 C CA  . HIS A 1 513 ? 29.635  67.288 53.609 1.00 37.71 ? 513  HIS A CA  1 
ATOM   3994 C C   . HIS A 1 513 ? 29.239  66.027 52.903 1.00 37.20 ? 513  HIS A C   1 
ATOM   3995 O O   . HIS A 1 513 ? 28.491  66.054 51.927 1.00 35.94 ? 513  HIS A O   1 
ATOM   3996 C CB  . HIS A 1 513 ? 29.066  67.179 55.016 1.00 39.99 ? 513  HIS A CB  1 
ATOM   3997 C CG  . HIS A 1 513 ? 29.023  68.464 55.769 1.00 40.80 ? 513  HIS A CG  1 
ATOM   3998 N ND1 . HIS A 1 513 ? 30.140  69.006 56.375 1.00 43.45 ? 513  HIS A ND1 1 
ATOM   3999 C CD2 . HIS A 1 513 ? 27.983  69.262 56.108 1.00 42.53 ? 513  HIS A CD2 1 
ATOM   4000 C CE1 . HIS A 1 513 ? 29.789  70.076 57.067 1.00 41.24 ? 513  HIS A CE1 1 
ATOM   4001 N NE2 . HIS A 1 513 ? 28.486  70.253 56.922 1.00 44.54 ? 513  HIS A NE2 1 
ATOM   4002 N N   . GLN A 1 514 ? 29.681  64.905 53.452 1.00 35.87 ? 514  GLN A N   1 
ATOM   4003 C CA  . GLN A 1 514 ? 29.407  63.628 52.864 1.00 35.56 ? 514  GLN A CA  1 
ATOM   4004 C C   . GLN A 1 514 ? 28.962  62.595 53.891 1.00 34.79 ? 514  GLN A C   1 
ATOM   4005 O O   . GLN A 1 514 ? 29.361  62.655 55.037 1.00 32.88 ? 514  GLN A O   1 
ATOM   4006 C CB  . GLN A 1 514 ? 30.685  63.114 52.180 1.00 37.96 ? 514  GLN A CB  1 
ATOM   4007 C CG  . GLN A 1 514 ? 31.186  63.997 51.094 1.00 41.65 ? 514  GLN A CG  1 
ATOM   4008 C CD  . GLN A 1 514 ? 32.465  63.457 50.453 1.00 44.10 ? 514  GLN A CD  1 
ATOM   4009 O OE1 . GLN A 1 514 ? 33.571  63.740 50.908 1.00 45.33 ? 514  GLN A OE1 1 
ATOM   4010 N NE2 . GLN A 1 514 ? 32.305  62.663 49.407 1.00 43.33 ? 514  GLN A NE2 1 
ATOM   4011 N N   . ARG A 1 515 ? 28.170  61.629 53.431 1.00 34.41 ? 515  ARG A N   1 
ATOM   4012 C CA  . ARG A 1 515 ? 27.690  60.508 54.234 1.00 35.16 ? 515  ARG A CA  1 
ATOM   4013 C C   . ARG A 1 515 ? 27.043  60.884 55.565 1.00 33.77 ? 515  ARG A C   1 
ATOM   4014 O O   . ARG A 1 515 ? 27.549  60.547 56.637 1.00 30.71 ? 515  ARG A O   1 
ATOM   4015 C CB  . ARG A 1 515 ? 28.858  59.574 54.496 1.00 37.09 ? 515  ARG A CB  1 
ATOM   4016 C CG  . ARG A 1 515 ? 29.404  58.902 53.245 1.00 41.73 ? 515  ARG A CG  1 
ATOM   4017 C CD  . ARG A 1 515 ? 30.831  58.604 53.525 1.00 48.69 ? 515  ARG A CD  1 
ATOM   4018 N NE  . ARG A 1 515 ? 31.273  57.329 53.018 1.00 53.16 ? 515  ARG A NE  1 
ATOM   4019 C CZ  . ARG A 1 515 ? 31.459  57.044 51.738 1.00 57.52 ? 515  ARG A CZ  1 
ATOM   4020 N NH1 . ARG A 1 515 ? 31.225  57.967 50.756 1.00 59.06 ? 515  ARG A NH1 1 
ATOM   4021 N NH2 . ARG A 1 515 ? 31.926  55.823 51.445 1.00 58.01 ? 515  ARG A NH2 1 
ATOM   4022 N N   . LEU A 1 516 ? 25.919  61.578 55.449 1.00 33.55 ? 516  LEU A N   1 
ATOM   4023 C CA  . LEU A 1 516 ? 25.123  62.055 56.582 1.00 32.41 ? 516  LEU A CA  1 
ATOM   4024 C C   . LEU A 1 516 ? 24.868  60.940 57.593 1.00 31.26 ? 516  LEU A C   1 
ATOM   4025 O O   . LEU A 1 516 ? 24.253  59.919 57.275 1.00 30.24 ? 516  LEU A O   1 
ATOM   4026 C CB  . LEU A 1 516 ? 23.798  62.648 56.039 1.00 31.47 ? 516  LEU A CB  1 
ATOM   4027 C CG  . LEU A 1 516 ? 22.735  63.252 56.940 1.00 32.23 ? 516  LEU A CG  1 
ATOM   4028 C CD1 . LEU A 1 516 ? 23.373  64.063 58.042 1.00 34.53 ? 516  LEU A CD1 1 
ATOM   4029 C CD2 . LEU A 1 516 ? 21.813  64.152 56.045 1.00 31.79 ? 516  LEU A CD2 1 
ATOM   4030 N N   . ARG A 1 517 ? 25.346  61.164 58.813 1.00 31.18 ? 517  ARG A N   1 
ATOM   4031 C CA  . ARG A 1 517 ? 25.243  60.197 59.908 1.00 32.52 ? 517  ARG A CA  1 
ATOM   4032 C C   . ARG A 1 517 ? 25.518  58.735 59.518 1.00 31.81 ? 517  ARG A C   1 
ATOM   4033 O O   . ARG A 1 517 ? 24.818  57.850 60.010 1.00 31.09 ? 517  ARG A O   1 
ATOM   4034 C CB  . ARG A 1 517 ? 23.879  60.370 60.625 1.00 35.66 ? 517  ARG A CB  1 
ATOM   4035 C CG  . ARG A 1 517 ? 24.008  61.618 61.583 1.00 40.19 ? 517  ARG A CG  1 
ATOM   4036 C CD  . ARG A 1 517 ? 22.872  61.986 62.463 1.00 40.15 ? 517  ARG A CD  1 
ATOM   4037 N NE  . ARG A 1 517 ? 22.832  61.204 63.687 1.00 42.88 ? 517  ARG A NE  1 
ATOM   4038 C CZ  . ARG A 1 517 ? 23.637  61.377 64.745 1.00 43.54 ? 517  ARG A CZ  1 
ATOM   4039 N NH1 . ARG A 1 517 ? 24.572  62.334 64.698 1.00 43.70 ? 517  ARG A NH1 1 
ATOM   4040 N NH2 . ARG A 1 517 ? 23.507  60.607 65.851 1.00 35.01 ? 517  ARG A NH2 1 
ATOM   4041 N N   . VAL A 1 518 ? 26.537  58.470 58.663 1.00 30.61 ? 518  VAL A N   1 
ATOM   4042 C CA  . VAL A 1 518 ? 26.802  57.063 58.247 1.00 31.55 ? 518  VAL A CA  1 
ATOM   4043 C C   . VAL A 1 518 ? 27.052  56.120 59.423 1.00 30.54 ? 518  VAL A C   1 
ATOM   4044 O O   . VAL A 1 518 ? 26.549  55.026 59.446 1.00 31.06 ? 518  VAL A O   1 
ATOM   4045 C CB  . VAL A 1 518 ? 28.108  56.748 57.495 1.00 32.75 ? 518  VAL A CB  1 
ATOM   4046 C CG1 . VAL A 1 518 ? 27.798  56.072 56.241 1.00 30.10 ? 518  VAL A CG1 1 
ATOM   4047 C CG2 . VAL A 1 518 ? 29.061  57.902 57.482 1.00 30.82 ? 518  VAL A CG2 1 
ATOM   4048 N N   . GLN A 1 519 ? 27.882  56.544 60.365 1.00 31.52 ? 519  GLN A N   1 
ATOM   4049 C CA  . GLN A 1 519 ? 28.236  55.683 61.502 1.00 32.65 ? 519  GLN A CA  1 
ATOM   4050 C C   . GLN A 1 519 ? 26.969  55.140 62.200 1.00 31.95 ? 519  GLN A C   1 
ATOM   4051 O O   . GLN A 1 519 ? 26.756  53.928 62.310 1.00 30.00 ? 519  GLN A O   1 
ATOM   4052 C CB  . GLN A 1 519 ? 29.142  56.482 62.469 1.00 34.94 ? 519  GLN A CB  1 
ATOM   4053 C CG  . GLN A 1 519 ? 29.985  55.615 63.413 1.00 35.55 ? 519  GLN A CG  1 
ATOM   4054 C CD  . GLN A 1 519 ? 30.963  54.736 62.631 1.00 38.85 ? 519  GLN A CD  1 
ATOM   4055 O OE1 . GLN A 1 519 ? 31.560  55.188 61.632 1.00 36.97 ? 519  GLN A OE1 1 
ATOM   4056 N NE2 . GLN A 1 519 ? 31.124  53.464 63.067 1.00 37.39 ? 519  GLN A NE2 1 
ATOM   4057 N N   . MET A 1 520 ? 26.089  56.033 62.616 1.00 29.87 ? 520  MET A N   1 
ATOM   4058 C CA  . MET A 1 520 ? 24.880  55.584 63.271 1.00 31.37 ? 520  MET A CA  1 
ATOM   4059 C C   . MET A 1 520 ? 23.896  54.853 62.319 1.00 31.80 ? 520  MET A C   1 
ATOM   4060 O O   . MET A 1 520 ? 23.225  53.880 62.728 1.00 32.83 ? 520  MET A O   1 
ATOM   4061 C CB  . MET A 1 520 ? 24.169  56.771 63.935 1.00 32.96 ? 520  MET A CB  1 
ATOM   4062 C CG  . MET A 1 520 ? 24.935  57.381 65.077 1.00 36.73 ? 520  MET A CG  1 
ATOM   4063 S SD  . MET A 1 520 ? 25.329  56.084 66.343 1.00 42.10 ? 520  MET A SD  1 
ATOM   4064 C CE  . MET A 1 520 ? 27.139  55.924 65.952 1.00 41.31 ? 520  MET A CE  1 
ATOM   4065 N N   . CYS A 1 521 ? 23.789  55.297 61.072 1.00 29.13 ? 521  CYS A N   1 
ATOM   4066 C CA  . CYS A 1 521 ? 22.844  54.629 60.201 1.00 30.30 ? 521  CYS A CA  1 
ATOM   4067 C C   . CYS A 1 521 ? 23.286  53.213 59.804 1.00 29.91 ? 521  CYS A C   1 
ATOM   4068 O O   . CYS A 1 521 ? 22.434  52.383 59.492 1.00 29.40 ? 521  CYS A O   1 
ATOM   4069 C CB  . CYS A 1 521 ? 22.507  55.514 58.989 1.00 30.10 ? 521  CYS A CB  1 
ATOM   4070 S SG  . CYS A 1 521 ? 21.605  57.008 59.547 1.00 31.63 ? 521  CYS A SG  1 
ATOM   4071 N N   . VAL A 1 522 ? 24.588  52.894 59.833 1.00 30.53 ? 522  VAL A N   1 
ATOM   4072 C CA  . VAL A 1 522 ? 24.963  51.493 59.531 1.00 30.60 ? 522  VAL A CA  1 
ATOM   4073 C C   . VAL A 1 522 ? 24.420  50.650 60.687 1.00 29.87 ? 522  VAL A C   1 
ATOM   4074 O O   . VAL A 1 522 ? 23.933  49.519 60.502 1.00 29.53 ? 522  VAL A O   1 
ATOM   4075 C CB  . VAL A 1 522 ? 26.491  51.257 59.415 1.00 32.74 ? 522  VAL A CB  1 
ATOM   4076 C CG1 . VAL A 1 522 ? 26.785  49.695 59.345 1.00 32.27 ? 522  VAL A CG1 1 
ATOM   4077 C CG2 . VAL A 1 522 ? 27.019  51.936 58.113 1.00 30.27 ? 522  VAL A CG2 1 
ATOM   4078 N N   . PHE A 1 523 ? 24.453  51.223 61.878 1.00 28.65 ? 523  PHE A N   1 
ATOM   4079 C CA  . PHE A 1 523 ? 23.913  50.527 63.033 1.00 28.85 ? 523  PHE A CA  1 
ATOM   4080 C C   . PHE A 1 523 ? 22.384  50.279 62.869 1.00 29.87 ? 523  PHE A C   1 
ATOM   4081 O O   . PHE A 1 523 ? 21.909  49.117 62.989 1.00 30.31 ? 523  PHE A O   1 
ATOM   4082 C CB  . PHE A 1 523 ? 24.140  51.339 64.296 1.00 27.63 ? 523  PHE A CB  1 
ATOM   4083 C CG  . PHE A 1 523 ? 23.436  50.791 65.464 1.00 28.49 ? 523  PHE A CG  1 
ATOM   4084 C CD1 . PHE A 1 523 ? 24.015  49.743 66.208 1.00 28.77 ? 523  PHE A CD1 1 
ATOM   4085 C CD2 . PHE A 1 523 ? 22.179  51.304 65.845 1.00 27.56 ? 523  PHE A CD2 1 
ATOM   4086 C CE1 . PHE A 1 523 ? 23.339  49.227 67.330 1.00 29.28 ? 523  PHE A CE1 1 
ATOM   4087 C CE2 . PHE A 1 523 ? 21.493  50.799 66.955 1.00 27.29 ? 523  PHE A CE2 1 
ATOM   4088 C CZ  . PHE A 1 523 ? 22.086  49.749 67.707 1.00 29.08 ? 523  PHE A CZ  1 
ATOM   4089 N N   . TRP A 1 524 ? 21.623  51.341 62.580 1.00 28.11 ? 524  TRP A N   1 
ATOM   4090 C CA  . TRP A 1 524 ? 20.158  51.190 62.428 1.00 28.98 ? 524  TRP A CA  1 
ATOM   4091 C C   . TRP A 1 524 ? 19.670  50.475 61.174 1.00 29.20 ? 524  TRP A C   1 
ATOM   4092 O O   . TRP A 1 524 ? 18.614  49.849 61.212 1.00 28.81 ? 524  TRP A O   1 
ATOM   4093 C CB  . TRP A 1 524 ? 19.435  52.561 62.466 1.00 26.20 ? 524  TRP A CB  1 
ATOM   4094 C CG  . TRP A 1 524 ? 19.595  53.219 63.823 1.00 27.48 ? 524  TRP A CG  1 
ATOM   4095 C CD1 . TRP A 1 524 ? 20.427  54.246 64.136 1.00 24.98 ? 524  TRP A CD1 1 
ATOM   4096 C CD2 . TRP A 1 524 ? 18.883  52.887 65.029 1.00 24.64 ? 524  TRP A CD2 1 
ATOM   4097 N NE1 . TRP A 1 524 ? 20.279  54.588 65.451 1.00 24.80 ? 524  TRP A NE1 1 
ATOM   4098 C CE2 . TRP A 1 524 ? 19.333  53.776 66.029 1.00 24.98 ? 524  TRP A CE2 1 
ATOM   4099 C CE3 . TRP A 1 524 ? 17.911  51.926 65.352 1.00 24.07 ? 524  TRP A CE3 1 
ATOM   4100 C CZ2 . TRP A 1 524 ? 18.835  53.749 67.358 1.00 24.70 ? 524  TRP A CZ2 1 
ATOM   4101 C CZ3 . TRP A 1 524 ? 17.409  51.879 66.659 1.00 23.01 ? 524  TRP A CZ3 1 
ATOM   4102 C CH2 . TRP A 1 524 ? 17.870  52.794 67.652 1.00 23.72 ? 524  TRP A CH2 1 
ATOM   4103 N N   . ASN A 1 525 ? 20.408  50.587 60.069 1.00 30.06 ? 525  ASN A N   1 
ATOM   4104 C CA  . ASN A 1 525 ? 19.955  49.988 58.826 1.00 32.76 ? 525  ASN A CA  1 
ATOM   4105 C C   . ASN A 1 525 ? 20.546  48.631 58.527 1.00 34.49 ? 525  ASN A C   1 
ATOM   4106 O O   . ASN A 1 525 ? 19.928  47.846 57.845 1.00 33.59 ? 525  ASN A O   1 
ATOM   4107 C CB  . ASN A 1 525 ? 20.222  50.899 57.633 1.00 31.71 ? 525  ASN A CB  1 
ATOM   4108 C CG  . ASN A 1 525 ? 19.485  52.211 57.752 1.00 33.81 ? 525  ASN A CG  1 
ATOM   4109 O OD1 . ASN A 1 525 ? 18.457  52.275 58.427 1.00 36.02 ? 525  ASN A OD1 1 
ATOM   4110 N ND2 . ASN A 1 525 ? 20.010  53.271 57.130 1.00 30.86 ? 525  ASN A ND2 1 
ATOM   4111 N N   . GLN A 1 526 ? 21.724  48.345 59.055 1.00 33.95 ? 526  GLN A N   1 
ATOM   4112 C CA  . GLN A 1 526 ? 22.315  47.071 58.771 1.00 35.01 ? 526  GLN A CA  1 
ATOM   4113 C C   . GLN A 1 526 ? 22.515  46.191 59.982 1.00 33.64 ? 526  GLN A C   1 
ATOM   4114 O O   . GLN A 1 526 ? 22.078  45.071 59.967 1.00 34.15 ? 526  GLN A O   1 
ATOM   4115 C CB  . GLN A 1 526 ? 23.648  47.260 58.076 1.00 37.50 ? 526  GLN A CB  1 
ATOM   4116 C CG  . GLN A 1 526 ? 23.588  47.963 56.735 1.00 44.71 ? 526  GLN A CG  1 
ATOM   4117 C CD  . GLN A 1 526 ? 24.963  47.927 56.065 1.00 50.17 ? 526  GLN A CD  1 
ATOM   4118 O OE1 . GLN A 1 526 ? 25.330  48.839 55.305 1.00 53.76 ? 526  GLN A OE1 1 
ATOM   4119 N NE2 . GLN A 1 526 ? 25.755  46.856 56.366 1.00 52.30 ? 526  GLN A NE2 1 
ATOM   4120 N N   . PHE A 1 527 ? 23.152  46.692 61.048 1.00 31.90 ? 527  PHE A N   1 
ATOM   4121 C CA  . PHE A 1 527 ? 23.397  45.821 62.191 1.00 30.96 ? 527  PHE A CA  1 
ATOM   4122 C C   . PHE A 1 527 ? 22.221  45.420 63.073 1.00 30.55 ? 527  PHE A C   1 
ATOM   4123 O O   . PHE A 1 527 ? 22.010  44.217 63.324 1.00 28.20 ? 527  PHE A O   1 
ATOM   4124 C CB  . PHE A 1 527 ? 24.505  46.385 63.126 1.00 29.71 ? 527  PHE A CB  1 
ATOM   4125 C CG  . PHE A 1 527 ? 24.819  45.450 64.298 1.00 31.42 ? 527  PHE A CG  1 
ATOM   4126 C CD1 . PHE A 1 527 ? 25.537  44.244 64.081 1.00 31.36 ? 527  PHE A CD1 1 
ATOM   4127 C CD2 . PHE A 1 527 ? 24.428  45.762 65.591 1.00 32.15 ? 527  PHE A CD2 1 
ATOM   4128 C CE1 . PHE A 1 527 ? 25.855  43.390 65.124 1.00 31.88 ? 527  PHE A CE1 1 
ATOM   4129 C CE2 . PHE A 1 527 ? 24.754  44.887 66.695 1.00 33.66 ? 527  PHE A CE2 1 
ATOM   4130 C CZ  . PHE A 1 527 ? 25.469  43.704 66.440 1.00 32.40 ? 527  PHE A CZ  1 
ATOM   4131 N N   . LEU A 1 528 ? 21.488  46.404 63.585 1.00 29.23 ? 528  LEU A N   1 
ATOM   4132 C CA  . LEU A 1 528 ? 20.379  46.088 64.470 1.00 31.27 ? 528  LEU A CA  1 
ATOM   4133 C C   . LEU A 1 528 ? 19.332  45.113 63.863 1.00 32.82 ? 528  LEU A C   1 
ATOM   4134 O O   . LEU A 1 528 ? 18.906  44.148 64.518 1.00 33.51 ? 528  LEU A O   1 
ATOM   4135 C CB  . LEU A 1 528 ? 19.681  47.380 64.966 1.00 28.45 ? 528  LEU A CB  1 
ATOM   4136 C CG  . LEU A 1 528 ? 18.567  47.116 66.011 1.00 30.99 ? 528  LEU A CG  1 
ATOM   4137 C CD1 . LEU A 1 528 ? 19.123  46.292 67.247 1.00 27.12 ? 528  LEU A CD1 1 
ATOM   4138 C CD2 . LEU A 1 528 ? 17.977  48.476 66.539 1.00 28.82 ? 528  LEU A CD2 1 
ATOM   4139 N N   . PRO A 1 529 ? 18.867  45.385 62.637 1.00 34.45 ? 529  PRO A N   1 
ATOM   4140 C CA  . PRO A 1 529 ? 17.875  44.477 62.017 1.00 36.16 ? 529  PRO A CA  1 
ATOM   4141 C C   . PRO A 1 529 ? 18.451  43.044 61.942 1.00 38.24 ? 529  PRO A C   1 
ATOM   4142 O O   . PRO A 1 529 ? 17.748  42.058 62.214 1.00 38.40 ? 529  PRO A O   1 
ATOM   4143 C CB  . PRO A 1 529 ? 17.651  45.082 60.616 1.00 33.20 ? 529  PRO A CB  1 
ATOM   4144 C CG  . PRO A 1 529 ? 17.939  46.546 60.841 1.00 34.69 ? 529  PRO A CG  1 
ATOM   4145 C CD  . PRO A 1 529 ? 19.158  46.540 61.761 1.00 33.61 ? 529  PRO A CD  1 
ATOM   4146 N N   . LYS A 1 530 ? 19.728  42.923 61.603 1.00 39.60 ? 530  LYS A N   1 
ATOM   4147 C CA  . LYS A 1 530 ? 20.332  41.592 61.552 1.00 41.61 ? 530  LYS A CA  1 
ATOM   4148 C C   . LYS A 1 530 ? 20.274  40.958 62.934 1.00 41.84 ? 530  LYS A C   1 
ATOM   4149 O O   . LYS A 1 530 ? 19.866  39.789 63.082 1.00 41.19 ? 530  LYS A O   1 
ATOM   4150 C CB  . LYS A 1 530 ? 21.772  41.677 61.076 1.00 45.02 ? 530  LYS A CB  1 
ATOM   4151 C CG  . LYS A 1 530 ? 22.423  40.331 60.925 1.00 49.10 ? 530  LYS A CG  1 
ATOM   4152 C CD  . LYS A 1 530 ? 23.610  40.419 59.958 1.00 52.23 ? 530  LYS A CD  1 
ATOM   4153 C CE  . LYS A 1 530 ? 24.340  39.062 59.802 1.00 53.81 ? 530  LYS A CE  1 
ATOM   4154 N NZ  . LYS A 1 530 ? 25.418  39.168 58.752 1.00 55.55 ? 530  LYS A NZ  1 
ATOM   4155 N N   . LEU A 1 531 ? 20.641  41.735 63.953 1.00 40.28 ? 531  LEU A N   1 
ATOM   4156 C CA  . LEU A 1 531 ? 20.612  41.260 65.319 1.00 40.61 ? 531  LEU A CA  1 
ATOM   4157 C C   . LEU A 1 531 ? 19.203  40.817 65.736 1.00 42.83 ? 531  LEU A C   1 
ATOM   4158 O O   . LEU A 1 531 ? 19.020  39.725 66.300 1.00 42.23 ? 531  LEU A O   1 
ATOM   4159 C CB  . LEU A 1 531 ? 21.109  42.365 66.270 1.00 38.40 ? 531  LEU A CB  1 
ATOM   4160 C CG  . LEU A 1 531 ? 21.192  42.028 67.756 1.00 37.56 ? 531  LEU A CG  1 
ATOM   4161 C CD1 . LEU A 1 531 ? 22.154  43.029 68.466 1.00 37.05 ? 531  LEU A CD1 1 
ATOM   4162 C CD2 . LEU A 1 531 ? 19.763  42.101 68.405 1.00 37.04 ? 531  LEU A CD2 1 
ATOM   4163 N N   . LEU A 1 532 ? 18.210  41.671 65.489 1.00 43.67 ? 532  LEU A N   1 
ATOM   4164 C CA  . LEU A 1 532 ? 16.836  41.344 65.884 1.00 45.80 ? 532  LEU A CA  1 
ATOM   4165 C C   . LEU A 1 532 ? 16.332  40.108 65.142 1.00 47.23 ? 532  LEU A C   1 
ATOM   4166 O O   . LEU A 1 532 ? 15.565  39.337 65.686 1.00 45.62 ? 532  LEU A O   1 
ATOM   4167 C CB  . LEU A 1 532 ? 15.871  42.543 65.658 1.00 43.45 ? 532  LEU A CB  1 
ATOM   4168 C CG  . LEU A 1 532 ? 16.099  43.788 66.529 1.00 44.39 ? 532  LEU A CG  1 
ATOM   4169 C CD1 . LEU A 1 532 ? 15.199  44.943 66.093 1.00 41.78 ? 532  LEU A CD1 1 
ATOM   4170 C CD2 . LEU A 1 532 ? 15.866  43.422 67.968 1.00 42.63 ? 532  LEU A CD2 1 
ATOM   4171 N N   . ASN A 1 533 ? 16.797  39.915 63.913 1.00 51.29 ? 533  ASN A N   1 
ATOM   4172 C CA  . ASN A 1 533 ? 16.384  38.765 63.112 1.00 55.54 ? 533  ASN A CA  1 
ATOM   4173 C C   . ASN A 1 533 ? 17.084  37.462 63.492 1.00 57.23 ? 533  ASN A C   1 
ATOM   4174 O O   . ASN A 1 533 ? 16.486  36.398 63.408 1.00 56.61 ? 533  ASN A O   1 
ATOM   4175 C CB  . ASN A 1 533 ? 16.642  39.004 61.625 1.00 57.68 ? 533  ASN A CB  1 
ATOM   4176 C CG  . ASN A 1 533 ? 16.010  37.920 60.755 1.00 62.10 ? 533  ASN A CG  1 
ATOM   4177 O OD1 . ASN A 1 533 ? 14.773  37.782 60.723 1.00 64.50 ? 533  ASN A OD1 1 
ATOM   4178 N ND2 . ASN A 1 533 ? 16.847  37.128 60.059 1.00 63.20 ? 533  ASN A ND2 1 
ATOM   4179 N N   . ALA A 1 534 ? 18.352  37.545 63.886 1.00 59.21 ? 534  ALA A N   1 
ATOM   4180 C CA  . ALA A 1 534 ? 19.118  36.350 64.224 1.00 61.94 ? 534  ALA A CA  1 
ATOM   4181 C C   . ALA A 1 534 ? 18.627  35.826 65.539 1.00 64.21 ? 534  ALA A C   1 
ATOM   4182 O O   . ALA A 1 534 ? 18.355  34.637 65.676 1.00 64.91 ? 534  ALA A O   1 
ATOM   4183 C CB  . ALA A 1 534 ? 20.614  36.662 64.312 1.00 61.12 ? 534  ALA A CB  1 
ATOM   4184 N N   . THR A 1 535 ? 18.500  36.728 66.504 1.00 66.28 ? 535  THR A N   1 
ATOM   4185 C CA  . THR A 1 535 ? 18.021  36.356 67.819 1.00 67.65 ? 535  THR A CA  1 
ATOM   4186 C C   . THR A 1 535 ? 16.492  36.426 67.811 1.00 68.97 ? 535  THR A C   1 
ATOM   4187 O O   . THR A 1 535 ? 15.850  35.376 67.522 1.00 70.63 ? 535  THR A O   1 
ATOM   4188 C CB  . THR A 1 535 ? 18.619  37.309 68.910 1.00 67.94 ? 535  THR A CB  1 
ATOM   4189 O OG1 . THR A 1 535 ? 18.150  38.652 68.719 1.00 66.42 ? 535  THR A OG1 1 
ATOM   4190 C CG2 . THR A 1 535 ? 20.143  37.302 68.822 1.00 67.69 ? 535  THR A CG2 1 
ATOM   4191 N N   . ALA A 1 536 ? 15.952  37.526 68.056 1.00 69.71 ? 536  ALA A N   1 
HETATM 4192 C C1  . E10 B 2 .   ? 4.611   59.535 71.353 1.00 31.92 ? 1536 E10 A C1  1 
HETATM 4193 N N2  . E10 B 2 .   ? 3.767   58.483 71.615 1.00 31.58 ? 1536 E10 A N2  1 
HETATM 4194 C C3  . E10 B 2 .   ? 2.790   58.432 72.535 1.00 31.87 ? 1536 E10 A C3  1 
HETATM 4195 C C4  . E10 B 2 .   ? 2.547   59.535 73.346 1.00 30.77 ? 1536 E10 A C4  1 
HETATM 4196 C C5  . E10 B 2 .   ? 3.402   60.731 73.182 1.00 30.05 ? 1536 E10 A C5  1 
HETATM 4197 C C6  . E10 B 2 .   ? 4.403   60.754 72.230 1.00 33.08 ? 1536 E10 A C6  1 
HETATM 4198 O O7  . E10 B 2 .   ? 5.431   59.461 70.441 1.00 32.01 ? 1536 E10 A O7  1 
HETATM 4199 C C9  . E10 B 2 .   ? 2.009   57.099 72.648 1.00 33.19 ? 1536 E10 A C9  1 
HETATM 4200 C C10 . E10 B 2 .   ? 1.454   59.525 74.434 1.00 32.42 ? 1536 E10 A C10 1 
HETATM 4201 C C13 . E10 B 2 .   ? 0.723   58.145 74.591 1.00 31.80 ? 1536 E10 A C13 1 
HETATM 4202 C C14 . E10 B 2 .   ? 0.617   57.330 73.257 1.00 31.12 ? 1536 E10 A C14 1 
HETATM 4203 N N17 . E10 B 2 .   ? 0.427   60.623 74.093 1.00 30.22 ? 1536 E10 A N17 1 
HETATM 4204 C C24 . E10 B 2 .   ? -0.357  60.492 72.793 1.00 32.37 ? 1536 E10 A C24 1 
HETATM 4205 C C29 . E10 B 2 .   ? 0.991   68.368 60.899 1.00 32.23 ? 1536 E10 A C29 1 
HETATM 4206 N N30 . E10 B 2 .   ? 2.379   68.390 60.972 1.00 32.03 ? 1536 E10 A N30 1 
HETATM 4207 C C31 . E10 B 2 .   ? 3.154   68.313 62.090 1.00 31.53 ? 1536 E10 A C31 1 
HETATM 4208 C C32 . E10 B 2 .   ? 2.563   68.188 63.353 1.00 30.95 ? 1536 E10 A C32 1 
HETATM 4209 C C33 . E10 B 2 .   ? 1.076   68.126 63.410 1.00 31.67 ? 1536 E10 A C33 1 
HETATM 4210 C C34 . E10 B 2 .   ? 0.289   68.211 62.247 1.00 29.51 ? 1536 E10 A C34 1 
HETATM 4211 O O35 . E10 B 2 .   ? 0.423   68.562 59.806 1.00 31.41 ? 1536 E10 A O35 1 
HETATM 4212 C C36 . E10 B 2 .   ? 4.677   68.363 61.860 1.00 30.67 ? 1536 E10 A C36 1 
HETATM 4213 C C37 . E10 B 2 .   ? 3.463   68.101 64.632 1.00 33.59 ? 1536 E10 A C37 1 
HETATM 4214 C C38 . E10 B 2 .   ? 4.983   67.909 64.305 1.00 34.19 ? 1536 E10 A C38 1 
HETATM 4215 C C39 . E10 B 2 .   ? 5.444   68.762 63.148 1.00 33.46 ? 1536 E10 A C39 1 
HETATM 4216 N N40 . E10 B 2 .   ? 3.149   66.903 65.515 1.00 35.31 ? 1536 E10 A N40 1 
HETATM 4217 C C41 . E10 B 2 .   ? 4.145   66.540 66.635 1.00 39.48 ? 1536 E10 A C41 1 
HETATM 4218 C C63 . E10 B 2 .   ? -0.854  61.863 72.369 1.00 34.84 ? 1536 E10 A C63 1 
HETATM 4219 C C64 . E10 B 2 .   ? 0.280   62.833 72.022 1.00 36.96 ? 1536 E10 A C64 1 
HETATM 4220 C C65 . E10 B 2 .   ? 1.052   62.412 70.801 1.00 38.22 ? 1536 E10 A C65 1 
HETATM 4221 C C66 . E10 B 2 .   ? 1.793   63.583 70.151 1.00 42.80 ? 1536 E10 A C66 1 
HETATM 4222 C C67 . E10 B 2 .   ? 3.297   63.279 70.117 1.00 43.85 ? 1536 E10 A C67 1 
HETATM 4223 C C68 . E10 B 2 .   ? 4.129   63.855 68.956 1.00 45.17 ? 1536 E10 A C68 1 
HETATM 4224 C C69 . E10 B 2 .   ? 4.294   65.394 68.925 1.00 42.92 ? 1536 E10 A C69 1 
HETATM 4225 C C70 . E10 B 2 .   ? 3.380   66.017 67.837 1.00 43.13 ? 1536 E10 A C70 1 
HETATM 4226 C C1  . NAG C 3 .   ? -18.856 82.995 50.263 1.00 57.75 ? 1537 NAG A C1  1 
HETATM 4227 C C2  . NAG C 3 .   ? -19.831 84.107 50.393 1.00 61.04 ? 1537 NAG A C2  1 
HETATM 4228 C C3  . NAG C 3 .   ? -19.415 84.914 51.620 1.00 62.73 ? 1537 NAG A C3  1 
HETATM 4229 C C4  . NAG C 3 .   ? -19.325 84.002 52.904 1.00 62.39 ? 1537 NAG A C4  1 
HETATM 4230 C C5  . NAG C 3 .   ? -18.699 82.605 52.653 1.00 61.50 ? 1537 NAG A C5  1 
HETATM 4231 C C6  . NAG C 3 .   ? -19.116 81.564 53.717 1.00 60.31 ? 1537 NAG A C6  1 
HETATM 4232 C C7  . NAG C 3 .   ? -20.751 84.616 48.208 1.00 63.52 ? 1537 NAG A C7  1 
HETATM 4233 C C8  . NAG C 3 .   ? -20.668 85.422 46.922 1.00 62.02 ? 1537 NAG A C8  1 
HETATM 4234 N N2  . NAG C 3 .   ? -19.863 84.897 49.171 1.00 62.34 ? 1537 NAG A N2  1 
HETATM 4235 O O3  . NAG C 3 .   ? -20.398 85.923 51.819 1.00 65.09 ? 1537 NAG A O3  1 
HETATM 4236 O O4  . NAG C 3 .   ? -18.557 84.645 53.917 1.00 62.32 ? 1537 NAG A O4  1 
HETATM 4237 O O5  . NAG C 3 .   ? -19.086 82.068 51.340 1.00 60.11 ? 1537 NAG A O5  1 
HETATM 4238 O O6  . NAG C 3 .   ? -19.147 82.103 55.035 1.00 59.09 ? 1537 NAG A O6  1 
HETATM 4239 O O7  . NAG C 3 .   ? -21.626 83.740 48.315 1.00 64.27 ? 1537 NAG A O7  1 
HETATM 4240 C C1  . NAG D 3 .   ? 18.632  62.132 33.804 1.00 44.04 ? 1538 NAG A C1  1 
HETATM 4241 C C2  . NAG D 3 .   ? 20.138  62.008 33.894 1.00 44.89 ? 1538 NAG A C2  1 
HETATM 4242 C C3  . NAG D 3 .   ? 20.836  62.568 32.642 1.00 47.54 ? 1538 NAG A C3  1 
HETATM 4243 C C4  . NAG D 3 .   ? 20.210  61.961 31.362 1.00 49.04 ? 1538 NAG A C4  1 
HETATM 4244 C C5  . NAG D 3 .   ? 18.725  62.314 31.393 1.00 49.58 ? 1538 NAG A C5  1 
HETATM 4245 C C6  . NAG D 3 .   ? 17.968  61.918 30.107 1.00 49.77 ? 1538 NAG A C6  1 
HETATM 4246 C C7  . NAG D 3 .   ? 20.982  62.040 36.162 1.00 46.13 ? 1538 NAG A C7  1 
HETATM 4247 C C8  . NAG D 3 .   ? 21.444  62.836 37.367 1.00 46.16 ? 1538 NAG A C8  1 
HETATM 4248 N N2  . NAG D 3 .   ? 20.622  62.718 35.070 1.00 44.06 ? 1538 NAG A N2  1 
HETATM 4249 O O3  . NAG D 3 .   ? 22.217  62.254 32.730 1.00 47.58 ? 1538 NAG A O3  1 
HETATM 4250 O O4  . NAG D 3 .   ? 20.841  62.441 30.162 1.00 51.83 ? 1538 NAG A O4  1 
HETATM 4251 O O5  . NAG D 3 .   ? 18.114  61.645 32.540 1.00 45.40 ? 1538 NAG A O5  1 
HETATM 4252 O O6  . NAG D 3 .   ? 17.159  60.750 30.273 1.00 51.77 ? 1538 NAG A O6  1 
HETATM 4253 O O7  . NAG D 3 .   ? 20.929  60.797 36.232 1.00 48.80 ? 1538 NAG A O7  1 
HETATM 4254 O O   . HOH E 4 .   ? -4.725  85.281 39.745 1.00 33.00 ? 2001 HOH A O   1 
HETATM 4255 O O   . HOH E 4 .   ? -6.618  83.529 38.989 1.00 34.26 ? 2002 HOH A O   1 
HETATM 4256 O O   . HOH E 4 .   ? -7.769  69.123 30.171 1.00 33.07 ? 2003 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? 6.247   92.534 48.191 1.00 52.34 ? 2004 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? -6.450  88.388 42.633 1.00 41.10 ? 2005 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? -15.703 74.524 50.893 1.00 42.32 ? 2006 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -12.585 64.409 41.912 1.00 34.46 ? 2007 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? -15.469 67.282 49.524 1.00 26.28 ? 2008 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? -15.721 60.057 49.163 1.00 33.55 ? 2009 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? -13.547 57.501 56.584 1.00 33.41 ? 2010 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? -12.063 49.252 47.847 1.00 41.03 ? 2011 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? -18.237 68.379 49.140 1.00 36.77 ? 2012 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? -22.066 69.811 47.514 1.00 45.65 ? 2013 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? -20.631 75.105 37.749 1.00 40.82 ? 2014 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? -10.668 81.233 55.727 1.00 43.98 ? 2015 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? -9.988  69.970 54.893 1.00 31.43 ? 2016 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -15.605 72.490 54.370 1.00 40.20 ? 2017 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? -9.974  55.789 45.094 1.00 47.51 ? 2018 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? -8.151  59.102 42.157 1.00 31.44 ? 2019 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? -9.759  62.002 59.986 1.00 29.02 ? 2020 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? -8.745  60.702 63.751 1.00 29.40 ? 2021 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? -12.401 62.978 59.444 1.00 31.92 ? 2022 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? -14.596 64.986 67.181 1.00 35.92 ? 2023 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? -10.570 65.456 68.769 1.00 32.66 ? 2024 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? -4.166  69.814 62.460 1.00 24.20 ? 2025 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? -3.611  67.765 66.847 1.00 38.25 ? 2026 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? -3.772  62.251 75.012 1.00 38.82 ? 2027 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? -8.774  64.860 70.931 1.00 31.11 ? 2028 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? -2.185  71.889 29.923 1.00 30.72 ? 2029 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? -3.697  68.209 78.718 1.00 41.57 ? 2030 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? -3.444  66.756 74.551 1.00 38.79 ? 2031 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? -8.337  66.882 72.674 1.00 34.88 ? 2032 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -2.273  66.605 77.009 1.00 43.84 ? 2033 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -1.468  72.216 73.680 1.00 41.15 ? 2034 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? 2.317   81.296 73.286 1.00 48.99 ? 2035 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? 0.814   70.179 68.748 1.00 29.84 ? 2036 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? -3.657  73.095 73.538 1.00 47.26 ? 2037 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 0.170   77.094 62.378 1.00 32.54 ? 2038 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? -1.632  68.199 65.268 1.00 43.53 ? 2039 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? -3.594  75.841 64.626 1.00 33.52 ? 2040 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? -5.371  79.921 62.957 1.00 47.03 ? 2041 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? 4.992   47.419 62.958 1.00 35.59 ? 2042 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? -14.936 59.697 57.338 1.00 26.97 ? 2043 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? -20.159 59.218 59.361 1.00 33.52 ? 2044 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? -18.184 65.010 61.522 1.00 36.19 ? 2045 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? -13.720 62.062 57.057 1.00 32.58 ? 2046 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? -19.527 62.768 61.203 1.00 41.22 ? 2047 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? -20.382 68.894 51.331 1.00 46.70 ? 2048 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -15.568 66.220 52.049 1.00 26.80 ? 2049 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? 1.364   87.515 42.317 1.00 52.70 ? 2050 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? -11.300 82.169 33.500 1.00 43.80 ? 2051 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? -3.155  77.109 31.415 1.00 36.99 ? 2052 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? 7.263   77.984 36.034 1.00 46.07 ? 2053 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? 4.074   43.453 55.700 1.00 39.14 ? 2054 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 6.006   44.102 53.973 1.00 37.30 ? 2055 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? 10.692  48.776 54.830 1.00 50.28 ? 2056 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? -1.727  69.461 52.901 1.00 29.41 ? 2057 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? 4.258   62.552 64.020 1.00 47.45 ? 2058 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? -0.748  62.952 59.011 1.00 25.55 ? 2059 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? -0.689  65.735 68.249 1.00 37.14 ? 2060 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? -7.398  67.861 57.994 1.00 31.05 ? 2061 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? -7.643  70.270 56.538 1.00 27.17 ? 2062 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? -8.465  71.231 52.817 1.00 37.12 ? 2063 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? -2.115  75.251 53.055 1.00 29.32 ? 2064 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? -2.661  77.747 62.705 1.00 34.54 ? 2065 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? -0.141  82.909 58.230 1.00 48.14 ? 2066 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? 3.556   68.323 58.322 1.00 25.35 ? 2067 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? 3.830   80.481 51.756 1.00 28.25 ? 2068 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? 3.819   86.911 41.943 1.00 54.25 ? 2069 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? 8.842   88.178 48.524 1.00 42.29 ? 2070 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? 12.641  83.418 47.615 1.00 36.50 ? 2071 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? 13.171  84.360 43.977 1.00 47.97 ? 2072 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? -8.906  58.162 64.714 1.00 26.97 ? 2073 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? -4.389  51.724 56.270 1.00 23.46 ? 2074 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? -5.734  44.821 57.534 1.00 36.30 ? 2075 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? -9.342  44.603 51.351 1.00 50.24 ? 2076 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? 14.356  75.501 79.923 1.00 48.99 ? 2077 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? -13.864 51.130 49.724 1.00 47.11 ? 2078 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? -6.766  46.068 51.674 1.00 46.72 ? 2079 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? -10.026 51.757 54.900 1.00 30.48 ? 2080 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? -7.301  50.471 49.607 1.00 38.11 ? 2081 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? -8.127  57.774 44.595 1.00 32.07 ? 2082 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? -3.439  51.551 44.148 1.00 38.62 ? 2083 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? -10.147 63.402 40.843 1.00 36.32 ? 2084 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -6.387  58.525 40.369 1.00 42.92 ? 2085 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -4.475  67.281 32.233 1.00 39.88 ? 2086 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? -6.713  65.565 32.153 1.00 37.24 ? 2087 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? -10.113 64.889 38.373 1.00 30.90 ? 2088 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? -12.126 66.772 37.300 1.00 35.09 ? 2089 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? -3.697  69.655 29.703 1.00 40.29 ? 2090 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -4.682  70.492 33.973 1.00 26.47 ? 2091 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? 3.424   66.904 36.716 1.00 24.83 ? 2092 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? -0.211  66.341 36.635 1.00 35.95 ? 2093 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? 0.028   71.323 29.044 1.00 39.31 ? 2094 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? 2.921   73.062 26.798 1.00 37.90 ? 2095 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? 8.785   71.052 32.861 1.00 38.31 ? 2096 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 7.263   70.406 39.431 1.00 34.31 ? 2097 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? 10.592  68.452 59.831 1.00 26.00 ? 2098 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? 4.547   64.645 63.305 1.00 39.73 ? 2099 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? 5.004   61.484 61.379 1.00 32.54 ? 2100 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? -4.617  55.801 39.135 1.00 47.12 ? 2101 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? -1.087  50.960 42.478 1.00 38.42 ? 2102 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? 2.609   54.128 36.643 1.00 30.68 ? 2103 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? -0.155  56.850 38.191 1.00 42.75 ? 2104 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 1.720   63.938 35.397 1.00 38.12 ? 2105 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? -1.062  66.149 40.389 1.00 36.20 ? 2106 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 4.414   64.643 35.306 1.00 34.34 ? 2107 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 9.129   62.163 35.776 1.00 41.22 ? 2108 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 10.969  70.395 34.246 1.00 42.78 ? 2109 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? 14.068  50.959 55.869 1.00 33.91 ? 2110 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? 7.102   52.159 56.444 1.00 26.15 ? 2111 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? 2.950   53.820 63.522 1.00 25.69 ? 2112 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 6.365   48.257 55.916 1.00 25.81 ? 2113 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 4.857   50.213 62.089 1.00 29.21 ? 2114 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 3.461   45.717 61.189 1.00 33.20 ? 2115 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? -4.334  40.003 62.651 1.00 41.36 ? 2116 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 0.205   40.371 57.383 1.00 36.24 ? 2117 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? -6.373  49.108 61.281 1.00 30.75 ? 2118 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 3.431   51.184 64.268 1.00 30.07 ? 2119 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 3.395   47.122 65.375 1.00 34.11 ? 2120 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? -6.733  48.472 73.938 1.00 35.78 ? 2121 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? -20.260 56.527 59.869 1.00 34.44 ? 2122 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? -7.327  60.476 72.264 1.00 36.24 ? 2123 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? -3.850  56.929 63.975 1.00 25.88 ? 2124 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? -6.619  61.363 65.337 1.00 23.47 ? 2125 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? -2.173  57.350 66.794 1.00 31.67 ? 2126 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? -0.911  53.320 74.174 1.00 35.61 ? 2127 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 1.961   53.069 73.580 1.00 38.79 ? 2128 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 3.330   50.175 69.437 1.00 31.02 ? 2129 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 5.327   53.144 80.847 1.00 34.45 ? 2130 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 7.475   49.194 66.265 1.00 42.47 ? 2131 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -3.745  49.888 62.119 1.00 34.52 ? 2132 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? -1.775  57.469 62.543 1.00 23.84 ? 2133 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? -3.677  50.805 59.752 1.00 26.29 ? 2134 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 1.252   43.138 54.806 1.00 37.93 ? 2135 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? 7.126   46.696 53.726 1.00 30.71 ? 2136 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? 9.685   46.339 53.525 1.00 34.70 ? 2137 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 13.365  49.629 53.681 1.00 45.81 ? 2138 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? 4.664   46.542 40.622 1.00 41.52 ? 2139 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? 6.356   62.477 35.200 1.00 35.44 ? 2140 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? 9.632   56.164 36.097 1.00 29.95 ? 2141 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? 11.178  64.250 35.816 1.00 37.81 ? 2142 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? 13.315  68.711 57.261 1.00 28.65 ? 2143 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? 21.156  64.882 63.990 1.00 41.13 ? 2144 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? 17.398  64.304 64.201 1.00 42.28 ? 2145 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? 11.725  67.073 67.401 1.00 23.62 ? 2146 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? 4.580   57.554 76.010 1.00 31.74 ? 2147 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? 7.437   63.394 78.915 1.00 31.20 ? 2148 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? 11.685  66.916 83.392 1.00 40.19 ? 2149 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? 10.367  76.334 78.145 1.00 36.21 ? 2150 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? 4.292   77.649 78.619 1.00 44.51 ? 2151 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? 8.404   76.570 76.232 1.00 31.25 ? 2152 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? 4.890   77.446 81.317 1.00 37.57 ? 2153 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 14.794  64.697 84.094 1.00 41.33 ? 2154 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 15.691  62.020 84.537 1.00 40.35 ? 2155 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? 13.067  58.721 79.068 1.00 35.69 ? 2156 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? 10.561  55.439 68.503 1.00 27.14 ? 2157 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? 14.692  48.396 63.763 1.00 38.42 ? 2158 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? 17.635  39.317 74.212 1.00 43.83 ? 2159 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? 24.662  48.220 77.162 1.00 49.25 ? 2160 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? 26.417  58.928 77.521 1.00 43.92 ? 2161 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? 22.306  59.129 86.269 1.00 48.92 ? 2162 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? 21.020  72.205 78.729 1.00 43.72 ? 2163 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? 22.356  72.135 76.345 1.00 50.65 ? 2164 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? 25.427  66.142 74.622 1.00 35.66 ? 2165 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? 23.539  69.993 74.026 1.00 43.26 ? 2166 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? 16.857  63.672 67.225 1.00 29.41 ? 2167 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? 18.393  67.244 73.114 1.00 33.49 ? 2168 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? 19.804  62.775 65.397 1.00 38.78 ? 2169 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 19.088  65.118 68.737 1.00 48.31 ? 2170 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 15.679  52.885 61.730 1.00 35.29 ? 2171 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 12.641  59.545 57.124 1.00 43.30 ? 2172 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 21.173  51.912 54.196 1.00 45.82 ? 2173 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? 17.842  50.552 44.865 1.00 30.41 ? 2174 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? 20.481  59.583 40.863 1.00 47.39 ? 2175 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 16.410  57.546 36.064 1.00 42.08 ? 2176 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? 18.663  58.977 35.397 1.00 43.41 ? 2177 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 18.792  65.902 36.917 1.00 41.64 ? 2178 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? 18.252  60.052 41.900 1.00 33.31 ? 2179 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 19.324  67.830 38.558 1.00 41.66 ? 2180 HOH A O   1 
HETATM 4434 O O   . HOH E 4 .   ? 14.449  76.063 64.282 1.00 34.60 ? 2181 HOH A O   1 
HETATM 4435 O O   . HOH E 4 .   ? 22.273  79.125 61.649 1.00 42.82 ? 2182 HOH A O   1 
HETATM 4436 O O   . HOH E 4 .   ? 16.107  79.850 70.008 1.00 45.44 ? 2183 HOH A O   1 
HETATM 4437 O O   . HOH E 4 .   ? 21.531  77.572 64.957 1.00 43.39 ? 2184 HOH A O   1 
HETATM 4438 O O   . HOH E 4 .   ? 8.430   79.104 67.821 1.00 39.19 ? 2185 HOH A O   1 
HETATM 4439 O O   . HOH E 4 .   ? 15.123  77.142 77.009 1.00 38.15 ? 2186 HOH A O   1 
HETATM 4440 O O   . HOH E 4 .   ? 18.759  74.822 71.054 1.00 42.78 ? 2187 HOH A O   1 
HETATM 4441 O O   . HOH E 4 .   ? 19.061  73.631 77.615 1.00 48.60 ? 2188 HOH A O   1 
HETATM 4442 O O   . HOH E 4 .   ? 16.510  73.801 77.661 1.00 34.14 ? 2189 HOH A O   1 
HETATM 4443 O O   . HOH E 4 .   ? 13.688  74.195 66.188 1.00 30.37 ? 2190 HOH A O   1 
HETATM 4444 O O   . HOH E 4 .   ? 12.313  77.255 63.030 1.00 31.67 ? 2191 HOH A O   1 
HETATM 4445 O O   . HOH E 4 .   ? 9.818   80.019 65.355 1.00 34.40 ? 2192 HOH A O   1 
HETATM 4446 O O   . HOH E 4 .   ? 7.637   75.458 61.065 1.00 24.92 ? 2193 HOH A O   1 
HETATM 4447 O O   . HOH E 4 .   ? 6.709   78.917 64.613 1.00 46.78 ? 2194 HOH A O   1 
HETATM 4448 O O   . HOH E 4 .   ? 10.172  88.351 60.696 1.00 36.18 ? 2195 HOH A O   1 
HETATM 4449 O O   . HOH E 4 .   ? 19.230  84.484 62.854 1.00 38.68 ? 2196 HOH A O   1 
HETATM 4450 O O   . HOH E 4 .   ? 20.796  83.993 56.221 1.00 44.70 ? 2197 HOH A O   1 
HETATM 4451 O O   . HOH E 4 .   ? 18.651  85.093 50.526 1.00 41.52 ? 2198 HOH A O   1 
HETATM 4452 O O   . HOH E 4 .   ? 13.068  86.189 47.484 1.00 38.04 ? 2199 HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 18.080  79.638 46.454 1.00 39.70 ? 2200 HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 18.532  78.525 43.884 1.00 40.51 ? 2201 HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 17.819  74.878 37.795 1.00 35.76 ? 2202 HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? 22.725  77.555 44.003 1.00 45.86 ? 2203 HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? 23.414  78.739 47.071 1.00 51.71 ? 2204 HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? 22.981  66.884 47.774 1.00 30.72 ? 2205 HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? 27.544  63.576 45.935 1.00 32.73 ? 2206 HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 21.679  61.758 41.874 1.00 34.01 ? 2207 HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 24.978  61.536 52.635 1.00 29.21 ? 2208 HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 25.096  58.739 52.326 1.00 31.57 ? 2209 HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? 26.539  69.013 59.314 1.00 44.85 ? 2210 HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? 24.940  58.245 55.360 1.00 43.52 ? 2211 HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? 27.143  63.366 59.348 1.00 41.38 ? 2212 HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 28.825  59.217 61.046 1.00 39.11 ? 2213 HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? 26.540  58.894 62.845 1.00 36.76 ? 2214 HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? 16.129  50.304 62.599 1.00 35.18 ? 2215 HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 15.948  52.709 58.958 1.00 36.44 ? 2216 HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? 26.369  45.296 60.044 1.00 50.93 ? 2217 HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? 3.900   56.247 70.153 1.00 28.66 ? 2218 HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? 0.549   68.120 67.011 1.00 28.66 ? 2219 HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? 1.190   65.135 65.121 1.00 37.05 ? 2220 HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? -1.294  60.517 76.273 1.00 37.62 ? 2221 HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? 1.532   62.892 75.232 1.00 43.65 ? 2222 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 E10 1   1536 1536 E10 E10 A . 
C 3 NAG 1   1537 1537 NAG NAG A . 
D 3 NAG 1   1538 1538 NAG NAG A . 
E 4 HOH 1   2001 2001 HOH HOH A . 
E 4 HOH 2   2002 2002 HOH HOH A . 
E 4 HOH 3   2003 2003 HOH HOH A . 
E 4 HOH 4   2004 2004 HOH HOH A . 
E 4 HOH 5   2005 2005 HOH HOH A . 
E 4 HOH 6   2006 2006 HOH HOH A . 
E 4 HOH 7   2007 2007 HOH HOH A . 
E 4 HOH 8   2008 2008 HOH HOH A . 
E 4 HOH 9   2009 2009 HOH HOH A . 
E 4 HOH 10  2010 2010 HOH HOH A . 
E 4 HOH 11  2011 2011 HOH HOH A . 
E 4 HOH 12  2012 2012 HOH HOH A . 
E 4 HOH 13  2013 2013 HOH HOH A . 
E 4 HOH 14  2014 2014 HOH HOH A . 
E 4 HOH 15  2015 2015 HOH HOH A . 
E 4 HOH 16  2016 2016 HOH HOH A . 
E 4 HOH 17  2017 2017 HOH HOH A . 
E 4 HOH 18  2018 2018 HOH HOH A . 
E 4 HOH 19  2019 2019 HOH HOH A . 
E 4 HOH 20  2020 2020 HOH HOH A . 
E 4 HOH 21  2021 2021 HOH HOH A . 
E 4 HOH 22  2022 2022 HOH HOH A . 
E 4 HOH 23  2023 2023 HOH HOH A . 
E 4 HOH 24  2024 2024 HOH HOH A . 
E 4 HOH 25  2025 2025 HOH HOH A . 
E 4 HOH 26  2026 2026 HOH HOH A . 
E 4 HOH 27  2027 2027 HOH HOH A . 
E 4 HOH 28  2028 2028 HOH HOH A . 
E 4 HOH 29  2029 2029 HOH HOH A . 
E 4 HOH 30  2030 2030 HOH HOH A . 
E 4 HOH 31  2031 2031 HOH HOH A . 
E 4 HOH 32  2032 2032 HOH HOH A . 
E 4 HOH 33  2033 2033 HOH HOH A . 
E 4 HOH 34  2034 2034 HOH HOH A . 
E 4 HOH 35  2035 2035 HOH HOH A . 
E 4 HOH 36  2036 2036 HOH HOH A . 
E 4 HOH 37  2037 2037 HOH HOH A . 
E 4 HOH 38  2038 2038 HOH HOH A . 
E 4 HOH 39  2039 2039 HOH HOH A . 
E 4 HOH 40  2040 2040 HOH HOH A . 
E 4 HOH 41  2041 2041 HOH HOH A . 
E 4 HOH 42  2042 2042 HOH HOH A . 
E 4 HOH 43  2043 2043 HOH HOH A . 
E 4 HOH 44  2044 2044 HOH HOH A . 
E 4 HOH 45  2045 2045 HOH HOH A . 
E 4 HOH 46  2046 2046 HOH HOH A . 
E 4 HOH 47  2047 2047 HOH HOH A . 
E 4 HOH 48  2048 2048 HOH HOH A . 
E 4 HOH 49  2049 2049 HOH HOH A . 
E 4 HOH 50  2050 2050 HOH HOH A . 
E 4 HOH 51  2051 2051 HOH HOH A . 
E 4 HOH 52  2052 2052 HOH HOH A . 
E 4 HOH 53  2053 2053 HOH HOH A . 
E 4 HOH 54  2054 2054 HOH HOH A . 
E 4 HOH 55  2055 2055 HOH HOH A . 
E 4 HOH 56  2056 2056 HOH HOH A . 
E 4 HOH 57  2057 2057 HOH HOH A . 
E 4 HOH 58  2058 2058 HOH HOH A . 
E 4 HOH 59  2059 2059 HOH HOH A . 
E 4 HOH 60  2060 2060 HOH HOH A . 
E 4 HOH 61  2061 2061 HOH HOH A . 
E 4 HOH 62  2062 2062 HOH HOH A . 
E 4 HOH 63  2063 2063 HOH HOH A . 
E 4 HOH 64  2064 2064 HOH HOH A . 
E 4 HOH 65  2065 2065 HOH HOH A . 
E 4 HOH 66  2066 2066 HOH HOH A . 
E 4 HOH 67  2067 2067 HOH HOH A . 
E 4 HOH 68  2068 2068 HOH HOH A . 
E 4 HOH 69  2069 2069 HOH HOH A . 
E 4 HOH 70  2070 2070 HOH HOH A . 
E 4 HOH 71  2071 2071 HOH HOH A . 
E 4 HOH 72  2072 2072 HOH HOH A . 
E 4 HOH 73  2073 2073 HOH HOH A . 
E 4 HOH 74  2074 2074 HOH HOH A . 
E 4 HOH 75  2075 2075 HOH HOH A . 
E 4 HOH 76  2076 2076 HOH HOH A . 
E 4 HOH 77  2077 2077 HOH HOH A . 
E 4 HOH 78  2078 2078 HOH HOH A . 
E 4 HOH 79  2079 2079 HOH HOH A . 
E 4 HOH 80  2080 2080 HOH HOH A . 
E 4 HOH 81  2081 2081 HOH HOH A . 
E 4 HOH 82  2082 2082 HOH HOH A . 
E 4 HOH 83  2083 2083 HOH HOH A . 
E 4 HOH 84  2084 2084 HOH HOH A . 
E 4 HOH 85  2085 2085 HOH HOH A . 
E 4 HOH 86  2086 2086 HOH HOH A . 
E 4 HOH 87  2087 2087 HOH HOH A . 
E 4 HOH 88  2088 2088 HOH HOH A . 
E 4 HOH 89  2089 2089 HOH HOH A . 
E 4 HOH 90  2090 2090 HOH HOH A . 
E 4 HOH 91  2091 2091 HOH HOH A . 
E 4 HOH 92  2092 2092 HOH HOH A . 
E 4 HOH 93  2093 2093 HOH HOH A . 
E 4 HOH 94  2094 2094 HOH HOH A . 
E 4 HOH 95  2095 2095 HOH HOH A . 
E 4 HOH 96  2096 2096 HOH HOH A . 
E 4 HOH 97  2097 2097 HOH HOH A . 
E 4 HOH 98  2098 2098 HOH HOH A . 
E 4 HOH 99  2099 2099 HOH HOH A . 
E 4 HOH 100 2100 2100 HOH HOH A . 
E 4 HOH 101 2101 2101 HOH HOH A . 
E 4 HOH 102 2102 2102 HOH HOH A . 
E 4 HOH 103 2103 2103 HOH HOH A . 
E 4 HOH 104 2104 2104 HOH HOH A . 
E 4 HOH 105 2105 2105 HOH HOH A . 
E 4 HOH 106 2106 2106 HOH HOH A . 
E 4 HOH 107 2107 2107 HOH HOH A . 
E 4 HOH 108 2108 2108 HOH HOH A . 
E 4 HOH 109 2109 2109 HOH HOH A . 
E 4 HOH 110 2110 2110 HOH HOH A . 
E 4 HOH 111 2111 2111 HOH HOH A . 
E 4 HOH 112 2112 2112 HOH HOH A . 
E 4 HOH 113 2113 2113 HOH HOH A . 
E 4 HOH 114 2114 2114 HOH HOH A . 
E 4 HOH 115 2115 2115 HOH HOH A . 
E 4 HOH 116 2116 2116 HOH HOH A . 
E 4 HOH 117 2117 2117 HOH HOH A . 
E 4 HOH 118 2118 2118 HOH HOH A . 
E 4 HOH 119 2119 2119 HOH HOH A . 
E 4 HOH 120 2120 2120 HOH HOH A . 
E 4 HOH 121 2121 2121 HOH HOH A . 
E 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 123 2123 2123 HOH HOH A . 
E 4 HOH 124 2124 2124 HOH HOH A . 
E 4 HOH 125 2125 2125 HOH HOH A . 
E 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 127 2127 2127 HOH HOH A . 
E 4 HOH 128 2128 2128 HOH HOH A . 
E 4 HOH 129 2129 2129 HOH HOH A . 
E 4 HOH 130 2130 2130 HOH HOH A . 
E 4 HOH 131 2131 2131 HOH HOH A . 
E 4 HOH 132 2132 2132 HOH HOH A . 
E 4 HOH 133 2133 2133 HOH HOH A . 
E 4 HOH 134 2134 2134 HOH HOH A . 
E 4 HOH 135 2135 2135 HOH HOH A . 
E 4 HOH 136 2136 2136 HOH HOH A . 
E 4 HOH 137 2137 2137 HOH HOH A . 
E 4 HOH 138 2138 2138 HOH HOH A . 
E 4 HOH 139 2139 2139 HOH HOH A . 
E 4 HOH 140 2140 2140 HOH HOH A . 
E 4 HOH 141 2141 2141 HOH HOH A . 
E 4 HOH 142 2142 2142 HOH HOH A . 
E 4 HOH 143 2143 2143 HOH HOH A . 
E 4 HOH 144 2144 2144 HOH HOH A . 
E 4 HOH 145 2145 2145 HOH HOH A . 
E 4 HOH 146 2146 2146 HOH HOH A . 
E 4 HOH 147 2147 2147 HOH HOH A . 
E 4 HOH 148 2148 2148 HOH HOH A . 
E 4 HOH 149 2149 2149 HOH HOH A . 
E 4 HOH 150 2150 2150 HOH HOH A . 
E 4 HOH 151 2151 2151 HOH HOH A . 
E 4 HOH 152 2152 2152 HOH HOH A . 
E 4 HOH 153 2153 2153 HOH HOH A . 
E 4 HOH 154 2154 2154 HOH HOH A . 
E 4 HOH 155 2155 2155 HOH HOH A . 
E 4 HOH 156 2156 2156 HOH HOH A . 
E 4 HOH 157 2157 2157 HOH HOH A . 
E 4 HOH 158 2158 2158 HOH HOH A . 
E 4 HOH 159 2159 2159 HOH HOH A . 
E 4 HOH 160 2160 2160 HOH HOH A . 
E 4 HOH 161 2161 2161 HOH HOH A . 
E 4 HOH 162 2162 2162 HOH HOH A . 
E 4 HOH 163 2163 2163 HOH HOH A . 
E 4 HOH 164 2164 2164 HOH HOH A . 
E 4 HOH 165 2165 2165 HOH HOH A . 
E 4 HOH 166 2166 2166 HOH HOH A . 
E 4 HOH 167 2167 2167 HOH HOH A . 
E 4 HOH 168 2168 2168 HOH HOH A . 
E 4 HOH 169 2169 2169 HOH HOH A . 
E 4 HOH 170 2170 2170 HOH HOH A . 
E 4 HOH 171 2171 2171 HOH HOH A . 
E 4 HOH 172 2172 2172 HOH HOH A . 
E 4 HOH 173 2173 2173 HOH HOH A . 
E 4 HOH 174 2174 2174 HOH HOH A . 
E 4 HOH 175 2175 2175 HOH HOH A . 
E 4 HOH 176 2176 2176 HOH HOH A . 
E 4 HOH 177 2177 2177 HOH HOH A . 
E 4 HOH 178 2178 2178 HOH HOH A . 
E 4 HOH 179 2179 2179 HOH HOH A . 
E 4 HOH 180 2180 2180 HOH HOH A . 
E 4 HOH 181 2181 2181 HOH HOH A . 
E 4 HOH 182 2182 2182 HOH HOH A . 
E 4 HOH 183 2183 2183 HOH HOH A . 
E 4 HOH 184 2184 2184 HOH HOH A . 
E 4 HOH 185 2185 2185 HOH HOH A . 
E 4 HOH 186 2186 2186 HOH HOH A . 
E 4 HOH 187 2187 2187 HOH HOH A . 
E 4 HOH 188 2188 2188 HOH HOH A . 
E 4 HOH 189 2189 2189 HOH HOH A . 
E 4 HOH 190 2190 2190 HOH HOH A . 
E 4 HOH 191 2191 2191 HOH HOH A . 
E 4 HOH 192 2192 2192 HOH HOH A . 
E 4 HOH 193 2193 2193 HOH HOH A . 
E 4 HOH 194 2194 2194 HOH HOH A . 
E 4 HOH 195 2195 2195 HOH HOH A . 
E 4 HOH 196 2196 2196 HOH HOH A . 
E 4 HOH 197 2197 2197 HOH HOH A . 
E 4 HOH 198 2198 2198 HOH HOH A . 
E 4 HOH 199 2199 2199 HOH HOH A . 
E 4 HOH 200 2200 2200 HOH HOH A . 
E 4 HOH 201 2201 2201 HOH HOH A . 
E 4 HOH 202 2202 2202 HOH HOH A . 
E 4 HOH 203 2203 2203 HOH HOH A . 
E 4 HOH 204 2204 2204 HOH HOH A . 
E 4 HOH 205 2205 2205 HOH HOH A . 
E 4 HOH 206 2206 2206 HOH HOH A . 
E 4 HOH 207 2207 2207 HOH HOH A . 
E 4 HOH 208 2208 2208 HOH HOH A . 
E 4 HOH 209 2209 2209 HOH HOH A . 
E 4 HOH 210 2210 2210 HOH HOH A . 
E 4 HOH 211 2211 2211 HOH HOH A . 
E 4 HOH 212 2212 2212 HOH HOH A . 
E 4 HOH 213 2213 2213 HOH HOH A . 
E 4 HOH 214 2214 2214 HOH HOH A . 
E 4 HOH 215 2215 2215 HOH HOH A . 
E 4 HOH 216 2216 2216 HOH HOH A . 
E 4 HOH 217 2217 2217 HOH HOH A . 
E 4 HOH 218 2218 2218 HOH HOH A . 
E 4 HOH 219 2219 2219 HOH HOH A . 
E 4 HOH 220 2220 2220 HOH HOH A . 
E 4 HOH 221 2221 2221 HOH HOH A . 
E 4 HOH 222 2222 2222 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
1 2 A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.3370000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-23 
2 'Structure model' 1 1 2011-08-17 
3 'Structure model' 1 2 2014-01-22 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Derived calculations'      
2  2 'Structure model' 'Non-polymer description'   
3  2 'Structure model' Other                       
4  2 'Structure model' 'Refinement description'    
5  2 'Structure model' 'Version format compliance' 
6  3 'Structure model' 'Database references'       
7  4 'Structure model' 'Data collection'           
8  4 'Structure model' 'Database references'       
9  4 'Structure model' 'Derived calculations'      
10 4 'Structure model' 'Experimental preparation'  
11 4 'Structure model' Other                       
12 5 'Structure model' 'Data collection'           
13 5 'Structure model' 'Derived calculations'      
14 5 'Structure model' 'Structure summary'         
15 6 'Structure model' 'Derived calculations'      
16 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' exptl_crystal_grow        
3  4 'Structure model' pdbx_database_proc        
4  4 'Structure model' pdbx_database_status      
5  4 'Structure model' struct_conn               
6  5 'Structure model' chem_comp                 
7  5 'Structure model' entity                    
8  5 'Structure model' pdbx_chem_comp_identifier 
9  5 'Structure model' pdbx_entity_nonpoly       
10 5 'Structure model' struct_conn               
11 5 'Structure model' struct_site               
12 5 'Structure model' struct_site_gen           
13 6 'Structure model' chem_comp                 
14 6 'Structure model' pdbx_struct_assembly      
15 6 'Structure model' pdbx_struct_assembly_gen  
16 6 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.country'                           
2  4 'Structure model' '_exptl_crystal_grow.temp'                    
3  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
5  5 'Structure model' '_chem_comp.name'                             
6  5 'Structure model' '_chem_comp.type'                             
7  5 'Structure model' '_entity.pdbx_description'                    
8  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
9  5 'Structure model' '_struct_conn.pdbx_role'                      
10 6 'Structure model' '_chem_comp.pdbx_synonyms'                    
11 6 'Structure model' '_pdbx_struct_assembly.details'               
12 6 'Structure model' '_pdbx_struct_assembly.method_details'        
13 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
14 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1H22 
_pdbx_entry_details.compound_details         
;COMPOUND HYDROLYZES CHOLINE RELEASED INTO THE SYNAPSE.
CATALYTIC ACTIVITY: ACETYLCHOLINE + H(2)O = CHOLINE +
ACETATE. INHIBITORS OF THE ENZYME ACETYLCHOLINESTERASE
(ACHE) IMPROVE THE COGNITIVE ABILITIES OF INDIVIDUALS WITH
EARLY STAGE ALZHEIMER'S DISEASE. (-)-HUPERZINE A
((-)-HUPA), A NATURAL PRODUCT USED IN TRADITIONAL CHINESE
HERBAL MEDICINE, IS AMONG THE POTENT ACHE INHIBITORS USED
IN THIS TREATMENT. THE LIGAND, (S,S)-BIS(10)-HUPYRIDONE
((S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO-2'(1'H)-
QUINOLINONYL]-1,10-DIAMINODECANE) DIHYDROCHLORIDE, AN ALKYLENE
LINKED DIMER OF FRAGMENTS OF THE HUPA STRUCTURE, HUPYRIDONE
(5-AMINO-5,6,7,8-TETRAHYDROQUINOLINONE), HAVE BEEN
SHOWN TO EXHIBIT POTENT INHIBITION OF ACHE. ONE HUPYRIDONE
UNIT BINDS TO THE 'ANIONIC' SUBSITE OF THE ACTIVE SITE,
NEAR THE BOTTOM OF THE ACTIVE SITE GORGE OF TCACHE,
ADJACENT TO TRP84, AS SEEN FOR THE TCACHE/(-)-HUPA COMPLEX,
AND THE SECOND HUPYRIDONE UNIT NEAR TO TRP279 IN THE
'PERIPHERAL' ANIONIC SITE AT THE TOP OF THE GORGE, THUS
SPANNING THE ACTIVE SITE GORGE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.348 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            -0.426 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A VAL 129 ? ? CA A VAL 129 ? ? C   A VAL 129 ? ? 98.70  111.40 -12.70 1.90 N 
2 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 115.69 120.30 -4.61  0.50 N 
3 1 NE A ARG 515 ? ? CZ A ARG 515 ? ? NH2 A ARG 515 ? ? 117.16 120.30 -3.14  0.50 N 
4 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 96.37  111.40 -15.03 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -137.51 -155.55 
2  1 PHE A 45  ? ? 80.43   -14.78  
3  1 ALA A 60  ? ? -114.85 50.38   
4  1 CYS A 94  ? ? -141.68 12.33   
5  1 PRO A 102 ? ? -49.18  155.31  
6  1 SER A 108 ? ? -162.73 79.06   
7  1 ALA A 164 ? ? -150.37 72.92   
8  1 SER A 200 ? ? 54.07   -121.00 
9  1 PRO A 294 ? ? -49.14  151.07  
10 1 GLU A 299 ? ? -123.13 -72.80  
11 1 THR A 317 ? ? -165.68 -158.14 
12 1 ASP A 380 ? ? -153.00 56.49   
13 1 VAL A 400 ? ? -129.56 -60.03  
14 1 ASN A 457 ? ? 71.71   36.35   
15 1 ASN A 506 ? ? -164.44 -169.25 
16 1 THR A 535 ? ? -87.21  -86.37  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 442 ? ? 0.067 'SIDE CHAIN' 
2 1 TYR A 472 ? ? 0.082 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
2  1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
3  1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
4  1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
5  1 Y 1 A GLU 260 ? CG  ? A GLU 260 CG  
6  1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
7  1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
8  1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
9  1 Y 1 A GLU 268 ? CG  ? A GLU 268 CG  
10 1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
11 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
12 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
13 1 Y 1 A LYS 270 ? CD  ? A LYS 270 CD  
14 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
15 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
16 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
17 1 Y 1 A GLU 350 ? CD  ? A GLU 350 CD  
18 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
19 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
20 1 Y 1 A LYS 357 ? CE  ? A LYS 357 CE  
21 1 Y 1 A LYS 357 ? NZ  ? A LYS 357 NZ  
22 1 Y 1 A ASP 365 ? OD2 ? A ASP 365 OD2 
23 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
24 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
25 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
26 1 Y 1 A LYS 454 ? CG  ? A LYS 454 CG  
27 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
28 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
29 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
30 1 Y 1 A LYS 491 ? CG  ? A LYS 491 CG  
31 1 Y 1 A LYS 491 ? CD  ? A LYS 491 CD  
32 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
33 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
34 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
35 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
36 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
37 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
38 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
39 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
40 1 Y 1 A ALA 536 ? CA  ? A ALA 536 CA  
41 1 Y 1 A ALA 536 ? C   ? A ALA 536 C   
42 1 Y 1 A ALA 536 ? O   ? A ALA 536 O   
43 1 Y 1 A ALA 536 ? CB  ? A ALA 536 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A HIS 486 ? A HIS 486 
5  1 Y 1 A SER 487 ? A SER 487 
6  1 Y 1 A GLN 488 ? A GLN 488 
7  1 Y 1 A GLU 489 ? A GLU 489 
8  1 Y 1 A CYS 537 ? A CYS 537 
9  1 Y 1 A ASP 538 ? A ASP 538 
10 1 Y 1 A GLY 539 ? A GLY 539 
11 1 Y 1 A GLU 540 ? A GLU 540 
12 1 Y 1 A LEU 541 ? A LEU 541 
13 1 Y 1 A SER 542 ? A SER 542 
14 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,10-DIAMINODECANE DIHYDROCHLORIDE
;
E10 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                                               NAG 
4 water                                                                                                  HOH 
#