data_1H23
# 
_entry.id   1H23 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H23         
PDBE  EBI-11179    
WWPDB D_1290011179 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)-HUPYRIDONE AT 2.15A RESOLUTION' 
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H23 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wong, D.M.'       1 
'Greenblatt, H.M.' 2 
'Carlier, P.R.'    3 
'Han, Y.F.'        4 
'Pang, Y.P.'       5 
'Silman, I.'       6 
'Sussman, J.L.'    7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Acetylcholinesterase Complexed with Bivalent Ligands Related to Huperzine A: Experimental Evidence for Species-Dependent Protein-Ligand Complementarity
;
J.Am.Chem.Soc.               125 363  ? 2003 JACSAT US 0002-7863 0004 ? 12517147 10.1021/JA021111W 
1       'Dimerization of an Inactive Fragment of Huperzine a Produces a Drug with Twice the Potency of the Natural Product' 
Angew.Chem.Int.Ed.Engl.      39  1775 ? 2000 ?      GE 1433-7851 9999 ? 10934357 
'10.1002/(SICI)1521-3773(20000515)39:10<1775::AID-ANIE1775>3.0.CO;2-Q' 
2       'Structure of Acetylcholinesterase Complexed with the Nootropic Alkaloid, (-)-Huperzine A' Nat.Struct.Biol.             4 
57   ? 1997 NSBIEW US 1072-8368 2024 ? 8989325  10.1038/NSB0197-57                                                     
3       'Prediction of the Binding Sites of Huperzine a in Acetylcholinesterase by Docking Studies' 'J. Comput. Aided Mol. Des.' 8 
669  ? 1994 ?      NE 0920-654X ?    ? 7738603  10.1007/BF00124014                                                     
4       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ? 1991 SCIEAS US 0036-8075 0038 ? 1678899  10.1126/SCIENCE.1678899                                                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wong, D.M.'       1  ? 
primary 'Greenblatt, H.M.' 2  ? 
primary 'Dvir, H.'         3  ? 
primary 'Carlier, P.R.'    4  ? 
primary 'Han, Y.F.'        5  ? 
primary 'Pang, Y.P.'       6  ? 
primary 'Silman, I.'       7  ? 
primary 'Sussman, J.L.'    8  ? 
1       'Carlier, P.R.'    9  ? 
1       'Du, D.-M.'        10 ? 
1       'Han, Y.-F.'       11 ? 
1       'Liu, J.'          12 ? 
1       'Perola, E.'       13 ? 
1       'Williams, I.D.'   14 ? 
1       'Pang, Y.-P.'      15 ? 
2       'Raves, M.L.'      16 ? 
2       'Harel, M.'        17 ? 
2       'Pang, Y.-P.'      18 ? 
2       'Silman, I.'       19 ? 
2       'Kozikowski, A.P.' 20 ? 
2       'Sussman, J.L.'    21 ? 
3       'Pang, Y.-P.'      22 ? 
3       'Kozikowski, A.P.' 23 ? 
4       'Sussman, J.L.'    24 ? 
4       'Harel, M.'        25 ? 
4       'Frolow, F.'       26 ? 
4       'Oefner, C.'       27 ? 
4       'Goldman, A.'      28 ? 
4       'Toker, L.'        29 ? 
4       'Silman, I.'       30 ? 
# 
_cell.entry_id           1H23 
_cell.length_a           111.794 
_cell.length_b           111.794 
_cell.length_c           137.775 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H23 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                                     
61325.090 1   3.1.1.7 ? ? 'INTER-MONOMER DISULFIDE BRIDGE' 
2 non-polymer syn 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,12-DIAMINODODECANE DIHYDROCHLORIDE
;
494.712   1   ?       ? ? ?                                
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                                 221.208 
2   ?       ? ? ?                                
4 water       nat water                                                                                                    18.015 
269 ?       ? ? ?                                
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    
;SYNTHETIC BIVALENT HUPA-LIKE DIMER, (S, S)-(-)-BIS(12)-HUPYRIDONE ((S, S)-(-)-N, N'-DI-5'- -[5', 6', 7', 8'-TETRAHYDRO-2'(1'H)-QUINOLINONYL] 1, 12-DIAMINODODECANE) DIHYDROCHLORIDE, WITH ONE MONOMER UNIT BOUND TO THE 'ANIONIC' SUBSITE, NEAR THE BOTTOM OF THE ACTIVE SITE GORGE, AND THE SECOND MONOMER UNIT BOUND TO THE 'PERIPHERAL' ANIONIC SITE AT THE TOP OF THE GORGE, THUS SPANNING THE ACTIVE SITE GORGE.
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1H23 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
E12 non-polymer                  . 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,12-DIAMINODODECANE DIHYDROCHLORIDE
;
? 'C30 H46 N4 O2'  494.712 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H23 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.11 
_exptl_crystal.density_percent_sol   69.65 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLISED FROM 28-30% V/V PEG 200 0.5M MES PH 5.8 AT 4 DEG. CELSIUS; THEN SOAKED IN IN MOTHER LIQUOR (40% V/V PEG 200 IN 0.1 M MES BUFFER, PH 5.8) CONTAINING 10MM (S,S)-(-)-BIS(12)-HUPYRIDONE DIHYDROCHLORIDE FOR 2 DAYS
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2000-09-05 
_diffrn_detector.details                'OSMIC BLUE CONFOCAL MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H23 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.300 
_reflns.d_resolution_high            2.150 
_reflns.number_obs                   54602 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              0.380 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.39600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        9.79 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H23 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     53657 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.3 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.1893 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1893 
_refine.ls_R_factor_R_free                       0.2148 
_refine.ls_R_factor_R_free_error                 0.00415 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2677 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               34.753 
_refine.aniso_B[1][1]                            -7.197 
_refine.aniso_B[2][2]                            -7.197 
_refine.aniso_B[3][3]                            14.394 
_refine.aniso_B[1][2]                            -0.949 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.345 
_refine.solvent_model_param_bsol                 34.7 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;SEVERAL RESIDUES ARE NOT SEEN IN THE CRYSTAL STRUCTURE, DUE TO DISORDER. THESE INCLUDE ASP 1, ASP 2, HIS 3 AND THE C-TERMINAL RESIDUES AFTER THR 535. SEVERAL RESIDUES MISSING IN CHAIN BREAK, FROM HIS 486 - GLU 489 (INCLUSIVE).
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4184 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             269 
_refine_hist.number_atoms_total               4517 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        29.3 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.019531 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.94229  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.232    1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.854    2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.107    2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.052    2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.25 
_refine_ls_shell.number_reflns_R_work             6304 
_refine_ls_shell.R_factor_R_work                  0.2691 
_refine_ls_shell.percent_reflns_obs               98.26 
_refine_ls_shell.R_factor_R_free                  0.3130 
_refine_ls_shell.R_factor_R_free_error            0.0174 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             322 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 E12.PAR            E12-1.TOP        
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
# 
_struct.entry_id                  1H23 
_struct.title                     
'Structure of acetylcholinesterase (E.C. 3.1.1.7) complexed with (S,S)-(-)-bis(12)-hupyridone at 2.15A resolution' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H23 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE HYDROLASE, ACETYLCHOLINESTERASE, NEUROTRANSMITTER CLEAVAGE, ALZHEIMER'S DISEASE, BIVALENT LIGAND, DUAL-SITE BINDING, INHIBITOR, HUPERZINE A, HYDROLASE, SERINE ESTERASE SYNAPSE, MEMBRANE, NERVE, MUSCLE, GPI-ANCHOR NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, BIS(12)-HUPYRID
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 1537 1_555 ? ? ? ? ? ? ? 1.468 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 1538 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          1H23 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H23 
_atom_sites.fract_transf_matrix[1][1]   0.008945 
_atom_sites.fract_transf_matrix[1][2]   0.005164 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010329 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007258 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.364 87.832 35.003 1.00 52.67 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.636 88.247 36.260 1.00 51.51 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.545 87.249 36.694 1.00 50.38 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.692 86.025 36.554 1.00 49.52 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.606 88.403 37.428 1.00 50.96 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.896 88.516 38.662 1.00 52.99 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.466 87.802 37.239 1.00 47.81 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.327  87.043 37.723 1.00 46.68 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.690  86.048 38.853 1.00 44.31 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -9.049  85.000 39.010 1.00 41.53 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.276  88.033 38.211 1.00 48.66 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.961  87.445 38.730 1.00 52.02 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.901  88.525 38.879 1.00 52.68 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -6.302  89.682 39.018 1.00 54.41 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.684  88.243 38.870 1.00 54.87 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.708 86.372 39.641 1.00 41.18 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.089 85.483 40.734 1.00 40.59 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.080 84.418 40.311 1.00 38.75 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.519 83.606 41.128 1.00 38.18 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.658 86.287 41.913 1.00 40.01 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.672 87.324 42.465 1.00 41.58 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.387 88.238 43.506 1.00 40.16 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.477  86.587 43.114 1.00 41.18 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.418 84.399 39.035 1.00 38.34 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.376 83.403 38.558 1.00 39.17 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.678 82.403 37.648 1.00 37.24 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.063 82.767 36.641 1.00 37.00 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.564 84.066 37.825 1.00 40.70 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.616 83.018 37.386 1.00 44.60 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.426 82.527 38.619 1.00 44.36 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.552 83.608 36.338 1.00 45.13 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.776 81.134 38.022 1.00 36.00 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.140 80.084 37.254 1.00 35.58 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.121 78.951 37.004 1.00 37.18 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.871 78.531 37.888 1.00 36.25 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.907 79.511 38.001 1.00 36.08 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.387 78.239 37.275 1.00 32.24 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.811  80.585 38.097 1.00 32.30 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.104 78.458 35.779 1.00 38.98 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.970 77.362 35.364 1.00 39.96 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.197 76.054 35.379 1.00 38.77 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.175 75.955 34.723 1.00 38.06 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.460 77.616 33.956 1.00 44.66 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.906 77.917 33.940 1.00 51.04 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.721 77.047 34.326 1.00 54.03 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.271 79.161 33.543 1.00 50.70 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.676 75.052 36.112 1.00 37.30 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.964 73.799 36.164 1.00 34.73 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.916 72.739 35.676 1.00 36.39 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -15.123 73.004 35.475 1.00 35.02 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.561 73.446 37.603 1.00 33.70 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.718 72.964 38.307 1.00 30.65 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -12.014 74.688 38.349 1.00 33.31 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.388 71.520 35.527 1.00 36.24 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -14.191 70.371 35.083 1.00 34.55 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.227 69.991 36.134 1.00 35.09 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -16.162 69.236 35.850 1.00 34.63 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -13.259 69.183 34.767 1.00 33.45 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.314 69.449 33.555 1.00 31.23 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.048 68.591 33.591 1.00 28.47 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -10.338 68.675 32.228 1.00 26.02 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.107  67.868 32.272 1.00 27.25 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -15.070 70.497 37.349 1.00 34.87 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -16.062 70.220 38.409 1.00 38.50 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.100 71.374 38.516 1.00 39.18 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.150 71.249 39.179 1.00 38.78 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.387 70.050 39.777 1.00 39.09 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.478 68.955 39.765 1.00 44.47 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.810 72.496 37.866 1.00 39.72 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.734 73.622 37.951 1.00 38.88 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.945 74.892 38.148 1.00 38.63 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.708 74.852 38.174 1.00 39.25 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.666 76.007 38.279 1.00 39.23 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -17.088 77.356 38.449 1.00 39.36 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.707 77.536 39.897 1.00 37.68 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.392 77.058 40.792 1.00 35.58 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -18.088 78.476 38.050 1.00 41.50 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.371 78.586 36.525 1.00 46.41 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -19.577 79.502 36.166 1.00 50.15 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.653 79.900 34.644 1.00 52.66 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -18.592 80.932 34.204 1.00 54.74 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.620 78.257 40.110 1.00 36.58 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.136 78.471 41.443 1.00 38.00 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.814 79.958 41.531 1.00 36.65 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.303 80.529 40.582 1.00 36.02 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.865 77.543 41.671 1.00 39.22 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.649 78.143 41.032 1.00 39.59 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.618 77.345 43.072 1.00 40.10 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.155 80.594 42.648 1.00 38.03 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.854 82.022 42.819 1.00 38.91 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.911 82.236 44.002 1.00 36.88 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.240 81.918 45.167 1.00 34.46 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.149 82.825 43.041 1.00 42.10 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.956 84.340 43.270 1.00 47.46 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.561 85.388 41.792 1.00 52.67 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -15.344 87.036 42.776 1.00 52.96 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.761 82.818 43.689 1.00 35.84 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.773 83.055 44.709 1.00 37.67 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.889 84.378 45.440 1.00 38.89 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.929 85.032 45.409 1.00 38.23 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.793 84.772 46.092 1.00 39.58 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.752 86.005 46.847 1.00 39.86 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.377  86.586 46.721 1.00 39.86 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.413  85.853 46.598 1.00 40.63 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.117 85.754 48.348 1.00 41.06 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -11.063 86.996 49.050 1.00 42.95 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.132 84.750 49.031 1.00 42.68 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.279  87.904 46.725 1.00 40.90 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.991  88.568 46.618 1.00 42.93 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.354  88.717 48.018 1.00 42.28 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.007  89.106 48.964 1.00 41.31 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.172  89.933 45.946 1.00 47.05 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.874  90.710 45.866 1.00 53.26 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.944  91.940 44.985 1.00 59.33 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.729  91.990 44.164 1.00 64.57 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.047  93.087 43.847 1.00 67.20 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.448  94.278 44.272 1.00 68.76 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.937  92.978 43.117 1.00 68.22 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.085  88.365 48.173 1.00 42.12 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.482  88.493 49.487 1.00 41.48 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.191  89.275 49.441 1.00 40.12 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.405  89.138 48.508 1.00 39.49 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.180  87.117 50.122 1.00 43.41 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.407  86.237 50.060 1.00 43.35 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -4.016  86.443 49.385 1.00 44.99 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.959  90.119 50.453 1.00 40.32 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.742  90.930 50.528 1.00 39.96 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.567  90.063 50.985 1.00 40.36 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.755  89.137 51.796 1.00 39.93 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.127  92.022 51.535 1.00 39.55 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.975  91.267 52.504 1.00 40.17 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.880  90.441 51.560 1.00 40.30 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.374  90.366 50.456 1.00 39.71 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.863   89.639 50.749 1.00 39.56 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.012   90.602 50.578 1.00 39.83 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.191   91.081 49.459 1.00 37.06 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.288   88.592 49.654 1.00 40.57 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.062   87.431 50.287 1.00 34.70 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.142   88.259 48.750 1.00 38.10 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.815   90.818 51.628 1.00 40.43 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 3.991   91.673 51.533 1.00 41.45 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.697   92.937 50.711 1.00 42.37 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.388   93.257 49.736 1.00 41.07 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.127   90.845 50.900 1.00 41.36 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.398   89.561 51.716 1.00 41.31 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.453   88.708 51.071 1.00 38.79 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.816   89.973 53.160 1.00 40.71 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.625   93.607 51.122 1.00 44.59 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.121   94.841 50.502 1.00 46.18 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 1.822   94.744 48.986 1.00 45.23 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 1.942   95.709 48.251 1.00 45.94 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.076   96.008 50.797 1.00 48.25 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.184   95.932 49.912 1.00 51.06 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.466   93.552 48.522 1.00 43.48 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.030   93.365 47.145 1.00 41.09 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.209  92.495 47.307 1.00 40.39 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.824  92.480 48.377 1.00 39.53 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.077   92.669 46.293 1.00 40.59 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.587   92.542 44.967 1.00 39.68 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.583  91.740 46.286 1.00 40.54 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.778  90.911 46.411 1.00 41.44 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.697  89.711 45.483 1.00 40.32 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -1.018  89.776 44.455 1.00 39.82 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.041  91.707 46.001 1.00 45.08 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.310  92.951 46.818 1.00 52.46 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.727  94.182 46.547 1.00 54.18 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.162  93.168 47.862 1.00 54.55 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.211  95.093 47.381 1.00 55.73 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.085  94.506 48.187 1.00 55.15 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.378  88.623 45.837 1.00 38.61 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.474  87.458 44.958 1.00 38.15 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.885  86.889 45.098 1.00 36.95 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.673  87.378 45.915 1.00 37.09 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.506  86.362 45.292 1.00 39.45 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.725  85.911 46.710 1.00 42.05 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.095  86.817 45.043 1.00 42.40 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -1.193  84.532 46.888 1.00 46.30 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.230  85.873 44.322 1.00 34.29 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.570  85.327 44.444 1.00 34.33 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.484  84.047 45.236 1.00 34.56 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.489  83.327 45.130 1.00 36.10 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.160  84.945 43.084 1.00 33.93 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.925  85.899 42.083 1.00 34.34 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.539  83.732 45.974 1.00 34.07 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.631  82.481 46.735 1.00 33.81 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.989  81.837 46.463 1.00 34.54 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -9.037  82.530 46.433 1.00 36.22 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.490  82.731 48.259 1.00 31.06 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.983  80.519 46.271 1.00 32.60 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.209  79.782 46.057 1.00 31.62 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.169  78.771 47.172 1.00 32.55 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.436  77.786 47.113 1.00 30.00 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.202  79.113 44.700 1.00 31.35 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.071  80.092 43.554 1.00 31.24 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.832  80.641 43.222 1.00 29.98 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.203 80.463 42.811 1.00 30.93 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.700  81.539 42.172 1.00 29.91 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.095 81.352 41.764 1.00 30.17 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.815  81.898 41.440 1.00 31.76 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.985  79.014 48.189 1.00 32.11 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.973  78.208 49.381 1.00 32.33 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -11.158 77.315 49.495 1.00 33.13 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.286 77.679 49.130 1.00 34.44 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.908  79.124 50.617 1.00 31.32 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.858  80.231 50.565 1.00 32.41 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.971  81.118 51.804 1.00 32.53 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.454  79.605 50.437 1.00 32.95 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.890 76.128 50.006 1.00 32.55 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.934 75.150 50.209 1.00 32.83 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.627 74.589 48.978 1.00 32.18 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.839 74.497 48.957 1.00 32.49 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.881 74.212 47.953 1.00 32.55 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.502 73.611 46.775 1.00 31.09 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.666 72.129 47.084 1.00 30.91 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.691 71.457 47.420 1.00 30.81 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.586 73.768 45.546 1.00 31.21 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.338 75.258 45.278 1.00 31.22 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -12.211 73.075 44.330 1.00 31.92 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.466 75.499 44.057 1.00 29.36 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.887 71.582 46.963 1.00 31.26 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -14.049 70.146 47.269 1.00 30.90 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.491 69.256 46.154 1.00 30.96 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.584 69.615 44.968 1.00 31.16 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.561 69.995 47.411 1.00 29.90 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -16.069 70.927 46.294 1.00 30.94 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -15.134 72.159 46.411 1.00 30.78 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.898 68.110 46.496 1.00 30.57 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.382 67.255 45.412 1.00 28.98 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.937 65.868 45.548 1.00 29.57 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.680 65.009 44.723 1.00 30.51 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.834 67.220 45.370 1.00 27.57 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -10.182 66.695 46.639 1.00 26.02 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -10.113 65.338 46.885 1.00 24.12 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.688  67.594 47.608 1.00 25.21 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.556  64.847 48.118 1.00 25.29 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -9.134  67.140 48.813 1.00 25.41 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -9.063  65.755 49.080 1.00 25.68 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.752 65.658 46.564 1.00 30.76 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.329 64.337 46.790 1.00 30.55 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.696 64.523 47.423 1.00 32.77 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -16.018 65.606 47.926 1.00 30.91 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.458 63.546 47.762 1.00 29.39 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.505 63.467 47.422 1.00 33.35 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.789 63.559 48.074 1.00 34.15 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.479 63.478 49.587 1.00 34.71 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.481 62.892 49.985 1.00 34.67 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.647 62.381 47.633 1.00 35.56 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.215 62.551 46.188 1.00 39.71 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -20.307 63.649 46.168 1.00 40.84 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -21.279 63.472 46.923 1.00 41.18 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -20.180 64.668 45.452 1.00 40.54 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.306 64.103 50.434 1.00 35.07 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -18.075 64.041 51.880 1.00 34.12 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -18.055 62.566 52.313 1.00 35.46 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.993 61.811 52.037 1.00 34.57 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.269 64.782 52.445 1.00 33.78 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.477 65.885 51.389 1.00 35.02 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.365 65.090 50.098 1.00 34.12 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.975 62.124 52.994 1.00 35.75 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.958 60.711 53.395 1.00 35.92 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.657 60.490 54.746 1.00 37.20 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -17.065 60.034 55.710 1.00 36.44 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.474 60.396 53.401 1.00 35.41 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.875 61.710 53.957 1.00 34.95 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.697 62.802 53.285 1.00 33.53 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.951 60.810 54.769 1.00 38.81 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.782 60.744 55.963 1.00 38.43 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.758 59.570 55.915 1.00 39.86 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.967 58.984 54.854 1.00 39.37 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.542 62.074 56.099 1.00 38.19 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.525 63.243 56.076 1.00 38.49 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.508 62.259 54.895 1.00 37.93 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.326 59.223 57.075 1.00 41.76 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.280 58.129 57.187 1.00 42.49 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.721 56.779 56.764 1.00 44.63 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.685 56.333 57.263 1.00 45.15 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.416 56.101 55.858 1.00 44.32 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.948 54.810 55.367 1.00 45.64 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.669 54.902 54.525 1.00 43.24 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -20.156 53.904 54.067 1.00 40.42 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -23.057 54.131 54.560 1.00 50.96 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.876 53.173 55.403 1.00 55.23 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.384 53.544 56.472 1.00 58.88 ? 42   ASN A OD1 1 
ATOM   284  N N   . MET A 1 43  ? -20.166 56.108 54.313 1.00 43.03 ? 43   MET A N   1 
ATOM   285  C CA  . MET A 1 43  ? -18.930 56.297 53.549 1.00 42.70 ? 43   MET A CA  1 
ATOM   286  C C   . MET A 1 43  ? -17.706 56.359 54.465 1.00 39.99 ? 43   MET A C   1 
ATOM   287  O O   . MET A 1 43  ? -16.570 56.347 53.992 1.00 38.81 ? 43   MET A O   1 
ATOM   288  C CB  . MET A 1 43  ? -19.031 57.594 52.771 1.00 47.34 ? 43   MET A CB  1 
ATOM   289  C CG  . MET A 1 43  ? -20.274 57.596 51.920 1.00 51.66 ? 43   MET A CG  1 
ATOM   290  S SD  . MET A 1 43  ? -19.791 56.848 50.397 1.00 59.24 ? 43   MET A SD  1 
ATOM   291  C CE  . MET A 1 43  ? -19.300 58.518 49.582 1.00 55.21 ? 43   MET A CE  1 
ATOM   292  N N   . ARG A 1 44  ? -17.936 56.475 55.773 1.00 37.36 ? 44   ARG A N   1 
ATOM   293  C CA  . ARG A 1 44  ? -16.820 56.515 56.740 1.00 35.41 ? 44   ARG A CA  1 
ATOM   294  C C   . ARG A 1 44  ? -16.025 55.220 56.569 1.00 34.89 ? 44   ARG A C   1 
ATOM   295  O O   . ARG A 1 44  ? -16.604 54.128 56.560 1.00 36.44 ? 44   ARG A O   1 
ATOM   296  C CB  . ARG A 1 44  ? -17.314 56.657 58.209 1.00 33.50 ? 44   ARG A CB  1 
ATOM   297  C CG  . ARG A 1 44  ? -16.186 56.495 59.242 1.00 33.65 ? 44   ARG A CG  1 
ATOM   298  C CD  . ARG A 1 44  ? -16.721 56.473 60.664 1.00 33.24 ? 44   ARG A CD  1 
ATOM   299  N NE  . ARG A 1 44  ? -17.341 57.730 61.076 1.00 32.63 ? 44   ARG A NE  1 
ATOM   300  C CZ  . ARG A 1 44  ? -17.974 57.844 62.236 1.00 33.58 ? 44   ARG A CZ  1 
ATOM   301  N NH1 . ARG A 1 44  ? -18.063 56.779 63.043 1.00 35.14 ? 44   ARG A NH1 1 
ATOM   302  N NH2 . ARG A 1 44  ? -18.459 59.009 62.625 1.00 31.56 ? 44   ARG A NH2 1 
ATOM   303  N N   . PHE A 1 45  ? -14.719 55.368 56.393 1.00 32.52 ? 45   PHE A N   1 
ATOM   304  C CA  . PHE A 1 45  ? -13.773 54.276 56.192 1.00 33.27 ? 45   PHE A CA  1 
ATOM   305  C C   . PHE A 1 45  ? -13.641 53.789 54.759 1.00 33.80 ? 45   PHE A C   1 
ATOM   306  O O   . PHE A 1 45  ? -12.720 53.038 54.454 1.00 32.64 ? 45   PHE A O   1 
ATOM   307  C CB  . PHE A 1 45  ? -14.079 53.040 57.066 1.00 34.54 ? 45   PHE A CB  1 
ATOM   308  C CG  . PHE A 1 45  ? -14.201 53.337 58.535 1.00 33.36 ? 45   PHE A CG  1 
ATOM   309  C CD1 . PHE A 1 45  ? -13.233 54.096 59.203 1.00 33.54 ? 45   PHE A CD1 1 
ATOM   310  C CD2 . PHE A 1 45  ? -15.291 52.848 59.249 1.00 32.65 ? 45   PHE A CD2 1 
ATOM   311  C CE1 . PHE A 1 45  ? -13.368 54.369 60.609 1.00 35.09 ? 45   PHE A CE1 1 
ATOM   312  C CE2 . PHE A 1 45  ? -15.452 53.104 60.624 1.00 33.66 ? 45   PHE A CE2 1 
ATOM   313  C CZ  . PHE A 1 45  ? -14.498 53.863 61.323 1.00 31.96 ? 45   PHE A CZ  1 
ATOM   314  N N   . ARG A 1 46  ? -14.548 54.213 53.883 1.00 34.80 ? 46   ARG A N   1 
ATOM   315  C CA  . ARG A 1 46  ? -14.506 53.795 52.488 1.00 37.23 ? 46   ARG A CA  1 
ATOM   316  C C   . ARG A 1 46  ? -13.599 54.677 51.651 1.00 36.04 ? 46   ARG A C   1 
ATOM   317  O O   . ARG A 1 46  ? -13.324 55.829 52.013 1.00 34.94 ? 46   ARG A O   1 
ATOM   318  C CB  . ARG A 1 46  ? -15.898 53.874 51.817 1.00 42.22 ? 46   ARG A CB  1 
ATOM   319  C CG  . ARG A 1 46  ? -16.826 52.752 52.112 1.00 48.62 ? 46   ARG A CG  1 
ATOM   320  C CD  . ARG A 1 46  ? -17.893 52.606 51.030 1.00 55.01 ? 46   ARG A CD  1 
ATOM   321  N NE  . ARG A 1 46  ? -19.029 51.915 51.642 1.00 62.37 ? 46   ARG A NE  1 
ATOM   322  C CZ  . ARG A 1 46  ? -20.233 51.750 51.094 1.00 65.32 ? 46   ARG A CZ  1 
ATOM   323  N NH1 . ARG A 1 46  ? -21.169 51.108 51.786 1.00 67.28 ? 46   ARG A NH1 1 
ATOM   324  N N   . ARG A 1 47  ? -13.174 54.122 50.520 1.00 35.08 ? 47   ARG A N   1 
ATOM   325  C CA  . ARG A 1 47  ? -12.370 54.856 49.542 1.00 36.15 ? 47   ARG A CA  1 
ATOM   326  C C   . ARG A 1 47  ? -13.129 56.154 49.165 1.00 34.03 ? 47   ARG A C   1 
ATOM   327  O O   . ARG A 1 47  ? -14.361 56.210 49.228 1.00 32.16 ? 47   ARG A O   1 
ATOM   328  C CB  . ARG A 1 47  ? -12.180 54.010 48.288 1.00 38.71 ? 47   ARG A CB  1 
ATOM   329  C CG  . ARG A 1 47  ? -11.632 52.628 48.607 1.00 46.20 ? 47   ARG A CG  1 
ATOM   330  C CD  . ARG A 1 47  ? -11.027 51.919 47.377 1.00 51.59 ? 47   ARG A CD  1 
ATOM   331  N NE  . ARG A 1 47  ? -10.404 50.637 47.750 1.00 55.82 ? 47   ARG A NE  1 
ATOM   332  C CZ  . ARG A 1 47  ? -9.243  50.185 47.278 1.00 58.26 ? 47   ARG A CZ  1 
ATOM   333  N NH1 . ARG A 1 47  ? -8.535  50.913 46.404 1.00 60.26 ? 47   ARG A NH1 1 
ATOM   334  N NH2 . ARG A 1 47  ? -8.804  48.984 47.655 1.00 59.43 ? 47   ARG A NH2 1 
ATOM   335  N N   . PRO A 1 48  ? -12.399 57.219 48.784 1.00 32.24 ? 48   PRO A N   1 
ATOM   336  C CA  . PRO A 1 48  ? -13.121 58.440 48.425 1.00 31.10 ? 48   PRO A CA  1 
ATOM   337  C C   . PRO A 1 48  ? -13.780 58.295 47.057 1.00 32.62 ? 48   PRO A C   1 
ATOM   338  O O   . PRO A 1 48  ? -13.334 57.508 46.247 1.00 31.00 ? 48   PRO A O   1 
ATOM   339  C CB  . PRO A 1 48  ? -12.017 59.486 48.387 1.00 29.64 ? 48   PRO A CB  1 
ATOM   340  C CG  . PRO A 1 48  ? -10.813 58.671 47.882 1.00 28.48 ? 48   PRO A CG  1 
ATOM   341  C CD  . PRO A 1 48  ? -10.934 57.388 48.665 1.00 28.72 ? 48   PRO A CD  1 
ATOM   342  N N   . GLU A 1 49  ? -14.847 59.051 46.836 1.00 34.26 ? 49   GLU A N   1 
ATOM   343  C CA  . GLU A 1 49  ? -15.556 59.117 45.548 1.00 36.71 ? 49   GLU A CA  1 
ATOM   344  C C   . GLU A 1 49  ? -15.322 60.557 45.024 1.00 35.26 ? 49   GLU A C   1 
ATOM   345  O O   . GLU A 1 49  ? -15.303 61.505 45.816 1.00 31.48 ? 49   GLU A O   1 
ATOM   346  C CB  . GLU A 1 49  ? -17.075 58.973 45.715 1.00 41.50 ? 49   GLU A CB  1 
ATOM   347  C CG  . GLU A 1 49  ? -17.623 57.692 46.321 1.00 50.77 ? 49   GLU A CG  1 
ATOM   348  C CD  . GLU A 1 49  ? -17.209 56.450 45.519 1.00 56.93 ? 49   GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 49  ? -16.136 56.502 44.872 1.00 61.39 ? 49   GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 49  ? -17.913 55.412 45.538 1.00 59.49 ? 49   GLU A OE2 1 
ATOM   351  N N   . PRO A 1 50  ? -15.151 60.734 43.703 1.00 34.31 ? 50   PRO A N   1 
ATOM   352  C CA  . PRO A 1 50  ? -14.939 62.089 43.167 1.00 35.31 ? 50   PRO A CA  1 
ATOM   353  C C   . PRO A 1 50  ? -16.142 62.995 43.437 1.00 36.16 ? 50   PRO A C   1 
ATOM   354  O O   . PRO A 1 50  ? -17.284 62.528 43.494 1.00 36.55 ? 50   PRO A O   1 
ATOM   355  C CB  . PRO A 1 50  ? -14.689 61.855 41.669 1.00 36.86 ? 50   PRO A CB  1 
ATOM   356  C CG  . PRO A 1 50  ? -15.265 60.468 41.401 1.00 37.32 ? 50   PRO A CG  1 
ATOM   357  C CD  . PRO A 1 50  ? -15.036 59.695 42.660 1.00 34.64 ? 50   PRO A CD  1 
ATOM   358  N N   . LYS A 1 51  ? -15.885 64.276 43.661 1.00 35.70 ? 51   LYS A N   1 
ATOM   359  C CA  . LYS A 1 51  ? -16.946 65.240 43.952 1.00 36.88 ? 51   LYS A CA  1 
ATOM   360  C C   . LYS A 1 51  ? -17.860 65.383 42.716 1.00 38.22 ? 51   LYS A C   1 
ATOM   361  O O   . LYS A 1 51  ? -17.362 65.565 41.600 1.00 38.45 ? 51   LYS A O   1 
ATOM   362  C CB  . LYS A 1 51  ? -16.312 66.595 44.270 1.00 36.33 ? 51   LYS A CB  1 
ATOM   363  C CG  . LYS A 1 51  ? -17.308 67.750 44.351 1.00 36.71 ? 51   LYS A CG  1 
ATOM   364  C CD  . LYS A 1 51  ? -18.165 67.653 45.614 1.00 36.22 ? 51   LYS A CD  1 
ATOM   365  C CE  . LYS A 1 51  ? -19.087 68.852 45.769 1.00 36.14 ? 51   LYS A CE  1 
ATOM   366  N NZ  . LYS A 1 51  ? -19.967 68.702 46.992 1.00 38.52 ? 51   LYS A NZ  1 
ATOM   367  N N   . LYS A 1 52  ? -19.176 65.292 42.890 1.00 38.83 ? 52   LYS A N   1 
ATOM   368  C CA  . LYS A 1 52  ? -20.072 65.457 41.735 1.00 39.35 ? 52   LYS A CA  1 
ATOM   369  C C   . LYS A 1 52  ? -20.011 66.914 41.278 1.00 38.77 ? 52   LYS A C   1 
ATOM   370  O O   . LYS A 1 52  ? -19.997 67.845 42.090 1.00 37.67 ? 52   LYS A O   1 
ATOM   371  C CB  . LYS A 1 52  ? -21.518 65.080 42.095 1.00 42.61 ? 52   LYS A CB  1 
ATOM   372  C CG  . LYS A 1 52  ? -21.722 63.577 42.538 1.00 46.66 ? 52   LYS A CG  1 
ATOM   373  N N   . PRO A 1 53  ? -19.926 67.136 39.967 1.00 38.26 ? 53   PRO A N   1 
ATOM   374  C CA  . PRO A 1 53  ? -19.869 68.521 39.486 1.00 39.59 ? 53   PRO A CA  1 
ATOM   375  C C   . PRO A 1 53  ? -21.120 69.311 39.928 1.00 39.09 ? 53   PRO A C   1 
ATOM   376  O O   . PRO A 1 53  ? -22.194 68.734 40.110 1.00 37.87 ? 53   PRO A O   1 
ATOM   377  C CB  . PRO A 1 53  ? -19.774 68.348 37.954 1.00 39.17 ? 53   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 53  ? -19.049 66.994 37.821 1.00 40.14 ? 53   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 53  ? -19.820 66.184 38.842 1.00 39.29 ? 53   PRO A CD  1 
ATOM   380  N N   . TRP A 1 54  ? -20.960 70.619 40.085 1.00 39.11 ? 54   TRP A N   1 
ATOM   381  C CA  . TRP A 1 54  ? -22.039 71.489 40.518 1.00 40.37 ? 54   TRP A CA  1 
ATOM   382  C C   . TRP A 1 54  ? -22.288 72.580 39.485 1.00 43.09 ? 54   TRP A C   1 
ATOM   383  O O   . TRP A 1 54  ? -21.379 72.951 38.725 1.00 42.47 ? 54   TRP A O   1 
ATOM   384  C CB  . TRP A 1 54  ? -21.663 72.144 41.848 1.00 39.21 ? 54   TRP A CB  1 
ATOM   385  C CG  . TRP A 1 54  ? -20.385 72.930 41.773 1.00 36.45 ? 54   TRP A CG  1 
ATOM   386  C CD1 . TRP A 1 54  ? -20.243 74.209 41.323 1.00 37.57 ? 54   TRP A CD1 1 
ATOM   387  C CD2 . TRP A 1 54  ? -19.063 72.462 42.069 1.00 35.75 ? 54   TRP A CD2 1 
ATOM   388  N NE1 . TRP A 1 54  ? -18.909 74.579 41.305 1.00 36.46 ? 54   TRP A NE1 1 
ATOM   389  C CE2 . TRP A 1 54  ? -18.160 73.523 41.758 1.00 36.82 ? 54   TRP A CE2 1 
ATOM   390  C CE3 . TRP A 1 54  ? -18.542 71.257 42.564 1.00 34.05 ? 54   TRP A CE3 1 
ATOM   391  C CZ2 . TRP A 1 54  ? -16.764 73.405 41.924 1.00 34.14 ? 54   TRP A CZ2 1 
ATOM   392  C CZ3 . TRP A 1 54  ? -17.147 71.138 42.730 1.00 33.64 ? 54   TRP A CZ3 1 
ATOM   393  C CH2 . TRP A 1 54  ? -16.280 72.209 42.407 1.00 34.08 ? 54   TRP A CH2 1 
ATOM   394  N N   . SER A 1 55  ? -23.531 73.064 39.421 1.00 44.34 ? 55   SER A N   1 
ATOM   395  C CA  . SER A 1 55  ? -23.853 74.175 38.530 1.00 45.19 ? 55   SER A CA  1 
ATOM   396  C C   . SER A 1 55  ? -23.736 75.378 39.462 1.00 44.64 ? 55   SER A C   1 
ATOM   397  O O   . SER A 1 55  ? -23.677 75.211 40.694 1.00 44.68 ? 55   SER A O   1 
ATOM   398  C CB  . SER A 1 55  ? -25.270 74.041 37.959 1.00 46.68 ? 55   SER A CB  1 
ATOM   399  O OG  . SER A 1 55  ? -26.231 73.999 39.001 1.00 50.75 ? 55   SER A OG  1 
ATOM   400  N N   . GLY A 1 56  ? -23.669 76.590 38.919 1.00 44.92 ? 56   GLY A N   1 
ATOM   401  C CA  . GLY A 1 56  ? -23.534 77.732 39.817 1.00 43.95 ? 56   GLY A CA  1 
ATOM   402  C C   . GLY A 1 56  ? -22.083 77.970 40.195 1.00 43.82 ? 56   GLY A C   1 
ATOM   403  O O   . GLY A 1 56  ? -21.177 77.296 39.695 1.00 43.21 ? 56   GLY A O   1 
ATOM   404  N N   . VAL A 1 57  ? -21.853 78.905 41.103 1.00 42.86 ? 57   VAL A N   1 
ATOM   405  C CA  . VAL A 1 57  ? -20.501 79.259 41.493 1.00 42.67 ? 57   VAL A CA  1 
ATOM   406  C C   . VAL A 1 57  ? -20.143 78.812 42.898 1.00 42.43 ? 57   VAL A C   1 
ATOM   407  O O   . VAL A 1 57  ? -20.860 79.103 43.874 1.00 41.76 ? 57   VAL A O   1 
ATOM   408  C CB  . VAL A 1 57  ? -20.308 80.773 41.355 1.00 43.83 ? 57   VAL A CB  1 
ATOM   409  C CG1 . VAL A 1 57  ? -18.884 81.164 41.640 1.00 42.87 ? 57   VAL A CG1 1 
ATOM   410  C CG2 . VAL A 1 57  ? -20.689 81.181 39.946 1.00 44.61 ? 57   VAL A CG2 1 
ATOM   411  N N   . TRP A 1 58  ? -19.025 78.088 43.010 1.00 40.96 ? 58   TRP A N   1 
ATOM   412  C CA  . TRP A 1 58  ? -18.598 77.602 44.328 1.00 38.70 ? 58   TRP A CA  1 
ATOM   413  C C   . TRP A 1 58  ? -17.855 78.743 44.989 1.00 37.94 ? 58   TRP A C   1 
ATOM   414  O O   . TRP A 1 58  ? -16.893 79.244 44.405 1.00 36.30 ? 58   TRP A O   1 
ATOM   415  C CB  . TRP A 1 58  ? -17.679 76.370 44.192 1.00 37.38 ? 58   TRP A CB  1 
ATOM   416  C CG  . TRP A 1 58  ? -17.365 75.780 45.529 1.00 36.30 ? 58   TRP A CG  1 
ATOM   417  C CD1 . TRP A 1 58  ? -16.478 76.262 46.442 1.00 35.23 ? 58   TRP A CD1 1 
ATOM   418  C CD2 . TRP A 1 58  ? -18.054 74.697 46.168 1.00 35.86 ? 58   TRP A CD2 1 
ATOM   419  N NE1 . TRP A 1 58  ? -16.576 75.559 47.609 1.00 36.05 ? 58   TRP A NE1 1 
ATOM   420  C CE2 . TRP A 1 58  ? -17.538 74.592 47.474 1.00 35.37 ? 58   TRP A CE2 1 
ATOM   421  C CE3 . TRP A 1 58  ? -19.056 73.806 45.761 1.00 35.87 ? 58   TRP A CE3 1 
ATOM   422  C CZ2 . TRP A 1 58  ? -17.989 73.629 48.389 1.00 34.89 ? 58   TRP A CZ2 1 
ATOM   423  C CZ3 . TRP A 1 58  ? -19.508 72.842 46.668 1.00 35.96 ? 58   TRP A CZ3 1 
ATOM   424  C CH2 . TRP A 1 58  ? -18.970 72.767 47.968 1.00 35.37 ? 58   TRP A CH2 1 
ATOM   425  N N   . ASN A 1 59  ? -18.319 79.176 46.170 1.00 38.59 ? 59   ASN A N   1 
ATOM   426  C CA  . ASN A 1 59  ? -17.655 80.272 46.877 1.00 40.60 ? 59   ASN A CA  1 
ATOM   427  C C   . ASN A 1 59  ? -16.387 79.675 47.520 1.00 39.77 ? 59   ASN A C   1 
ATOM   428  O O   . ASN A 1 59  ? -16.489 78.863 48.445 1.00 38.22 ? 59   ASN A O   1 
ATOM   429  C CB  . ASN A 1 59  ? -18.553 80.925 47.998 1.00 44.46 ? 59   ASN A CB  1 
ATOM   430  C CG  . ASN A 1 59  ? -17.823 82.092 48.728 1.00 49.58 ? 59   ASN A CG  1 
ATOM   431  O OD1 . ASN A 1 59  ? -16.667 81.918 49.062 1.00 51.47 ? 59   ASN A OD1 1 
ATOM   432  N ND2 . ASN A 1 59  ? -18.414 83.282 48.919 1.00 55.82 ? 59   ASN A ND2 1 
ATOM   433  N N   . ALA A 1 60  ? -15.216 80.086 47.036 1.00 38.01 ? 60   ALA A N   1 
ATOM   434  C CA  . ALA A 1 60  ? -13.948 79.590 47.563 1.00 38.04 ? 60   ALA A CA  1 
ATOM   435  C C   . ALA A 1 60  ? -13.196 80.757 48.177 1.00 37.63 ? 60   ALA A C   1 
ATOM   436  O O   . ALA A 1 60  ? -12.037 80.992 47.874 1.00 36.89 ? 60   ALA A O   1 
ATOM   437  C CB  . ALA A 1 60  ? -13.110 78.984 46.454 1.00 36.73 ? 60   ALA A CB  1 
ATOM   438  N N   . SER A 1 61  ? -13.855 81.483 49.059 1.00 38.02 ? 61   SER A N   1 
ATOM   439  C CA  . SER A 1 61  ? -13.210 82.637 49.647 1.00 39.13 ? 61   SER A CA  1 
ATOM   440  C C   . SER A 1 61  ? -12.772 82.343 51.072 1.00 38.23 ? 61   SER A C   1 
ATOM   441  O O   . SER A 1 61  ? -12.039 83.120 51.664 1.00 38.88 ? 61   SER A O   1 
ATOM   442  C CB  . SER A 1 61  ? -14.180 83.831 49.616 1.00 39.43 ? 61   SER A CB  1 
ATOM   443  O OG  . SER A 1 61  ? -15.277 83.551 50.483 1.00 40.83 ? 61   SER A OG  1 
ATOM   444  N N   . THR A 1 62  ? -13.205 81.209 51.618 1.00 38.95 ? 62   THR A N   1 
ATOM   445  C CA  . THR A 1 62  ? -12.845 80.905 52.992 1.00 39.73 ? 62   THR A CA  1 
ATOM   446  C C   . THR A 1 62  ? -12.324 79.487 53.233 1.00 38.30 ? 62   THR A C   1 
ATOM   447  O O   . THR A 1 62  ? -12.740 78.556 52.558 1.00 38.56 ? 62   THR A O   1 
ATOM   448  C CB  . THR A 1 62  ? -14.047 81.155 53.899 1.00 41.56 ? 62   THR A CB  1 
ATOM   449  O OG1 . THR A 1 62  ? -15.088 80.238 53.546 1.00 43.05 ? 62   THR A OG1 1 
ATOM   450  C CG2 . THR A 1 62  ? -14.563 82.588 53.704 1.00 43.52 ? 62   THR A CG2 1 
ATOM   451  N N   . TYR A 1 63  ? -11.419 79.338 54.204 1.00 36.66 ? 63   TYR A N   1 
ATOM   452  C CA  . TYR A 1 63  ? -10.863 78.024 54.539 1.00 33.92 ? 63   TYR A CA  1 
ATOM   453  C C   . TYR A 1 63  ? -11.976 77.034 54.896 1.00 33.83 ? 63   TYR A C   1 
ATOM   454  O O   . TYR A 1 63  ? -13.013 77.402 55.466 1.00 32.64 ? 63   TYR A O   1 
ATOM   455  C CB  . TYR A 1 63  ? -9.883  78.107 55.722 1.00 31.37 ? 63   TYR A CB  1 
ATOM   456  C CG  . TYR A 1 63  ? -8.465  78.507 55.379 1.00 30.08 ? 63   TYR A CG  1 
ATOM   457  C CD1 . TYR A 1 63  ? -7.824  77.983 54.248 1.00 30.40 ? 63   TYR A CD1 1 
ATOM   458  C CD2 . TYR A 1 63  ? -7.707  79.338 56.251 1.00 31.48 ? 63   TYR A CD2 1 
ATOM   459  C CE1 . TYR A 1 63  ? -6.472  78.252 53.984 1.00 30.13 ? 63   TYR A CE1 1 
ATOM   460  C CE2 . TYR A 1 63  ? -6.321  79.616 55.998 1.00 30.29 ? 63   TYR A CE2 1 
ATOM   461  C CZ  . TYR A 1 63  ? -5.727  79.061 54.866 1.00 30.62 ? 63   TYR A CZ  1 
ATOM   462  O OH  . TYR A 1 63  ? -4.388  79.254 54.622 1.00 33.77 ? 63   TYR A OH  1 
ATOM   463  N N   . PRO A 1 64  ? -11.773 75.757 54.534 1.00 32.02 ? 64   PRO A N   1 
ATOM   464  C CA  . PRO A 1 64  ? -12.688 74.653 54.780 1.00 31.72 ? 64   PRO A CA  1 
ATOM   465  C C   . PRO A 1 64  ? -12.524 74.142 56.219 1.00 31.84 ? 64   PRO A C   1 
ATOM   466  O O   . PRO A 1 64  ? -11.630 74.606 56.939 1.00 30.68 ? 64   PRO A O   1 
ATOM   467  C CB  . PRO A 1 64  ? -12.196 73.592 53.792 1.00 32.27 ? 64   PRO A CB  1 
ATOM   468  C CG  . PRO A 1 64  ? -10.681 73.784 53.857 1.00 31.03 ? 64   PRO A CG  1 
ATOM   469  C CD  . PRO A 1 64  ? -10.614 75.310 53.732 1.00 32.13 ? 64   PRO A CD  1 
ATOM   470  N N   . ASN A 1 65  ? -13.392 73.203 56.613 1.00 29.41 ? 65   ASN A N   1 
ATOM   471  C CA  . ASN A 1 65  ? -13.274 72.562 57.894 1.00 31.25 ? 65   ASN A CA  1 
ATOM   472  C C   . ASN A 1 65  ? -11.984 71.680 57.846 1.00 30.68 ? 65   ASN A C   1 
ATOM   473  O O   . ASN A 1 65  ? -11.489 71.296 56.764 1.00 29.21 ? 65   ASN A O   1 
ATOM   474  C CB  . ASN A 1 65  ? -14.456 71.606 58.167 1.00 33.64 ? 65   ASN A CB  1 
ATOM   475  C CG  . ASN A 1 65  ? -15.837 72.302 58.123 1.00 38.06 ? 65   ASN A CG  1 
ATOM   476  O OD1 . ASN A 1 65  ? -16.060 73.322 58.770 1.00 38.11 ? 65   ASN A OD1 1 
ATOM   477  N ND2 . ASN A 1 65  ? -16.768 71.718 57.351 1.00 40.45 ? 65   ASN A ND2 1 
ATOM   478  N N   . ASN A 1 66  ? -11.471 71.332 59.019 1.00 30.50 ? 66   ASN A N   1 
ATOM   479  C CA  . ASN A 1 66  ? -10.304 70.455 59.120 1.00 31.15 ? 66   ASN A CA  1 
ATOM   480  C C   . ASN A 1 66  ? -10.892 69.054 59.400 1.00 30.63 ? 66   ASN A C   1 
ATOM   481  O O   . ASN A 1 66  ? -12.009 68.961 59.946 1.00 29.78 ? 66   ASN A O   1 
ATOM   482  C CB  . ASN A 1 66  ? -9.435  70.889 60.306 1.00 30.27 ? 66   ASN A CB  1 
ATOM   483  C CG  . ASN A 1 66  ? -8.884  72.315 60.162 1.00 31.76 ? 66   ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 66  ? -8.704  73.010 61.159 1.00 31.08 ? 66   ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 66  ? -8.573  72.726 58.931 1.00 31.81 ? 66   ASN A ND2 1 
ATOM   486  N N   . CYS A 1 67  ? -10.168 67.979 59.065 1.00 29.42 ? 67   CYS A N   1 
ATOM   487  C CA  . CYS A 1 67  ? -10.680 66.636 59.359 1.00 29.22 ? 67   CYS A CA  1 
ATOM   488  C C   . CYS A 1 67  ? -10.749 66.316 60.848 1.00 30.22 ? 67   CYS A C   1 
ATOM   489  O O   . CYS A 1 67  ? -10.049 66.924 61.638 1.00 30.55 ? 67   CYS A O   1 
ATOM   490  C CB  . CYS A 1 67  ? -9.823  65.586 58.652 1.00 28.62 ? 67   CYS A CB  1 
ATOM   491  S SG  . CYS A 1 67  ? -9.925  65.758 56.836 1.00 32.41 ? 67   CYS A SG  1 
ATOM   492  N N   . GLN A 1 68  ? -11.590 65.363 61.245 1.00 29.71 ? 68   GLN A N   1 
ATOM   493  C CA  . GLN A 1 68  ? -11.693 64.996 62.653 1.00 29.09 ? 68   GLN A CA  1 
ATOM   494  C C   . GLN A 1 68  ? -10.342 64.388 63.115 1.00 29.77 ? 68   GLN A C   1 
ATOM   495  O O   . GLN A 1 68  ? -9.815  63.448 62.487 1.00 28.11 ? 68   GLN A O   1 
ATOM   496  C CB  . GLN A 1 68  ? -12.840 63.979 62.864 1.00 29.01 ? 68   GLN A CB  1 
ATOM   497  C CG  . GLN A 1 68  ? -14.273 64.565 62.701 1.00 29.18 ? 68   GLN A CG  1 
ATOM   498  C CD  . GLN A 1 68  ? -14.715 65.388 63.927 1.00 33.44 ? 68   GLN A CD  1 
ATOM   499  O OE1 . GLN A 1 68  ? -15.829 65.926 63.969 1.00 34.75 ? 68   GLN A OE1 1 
ATOM   500  N NE2 . GLN A 1 68  ? -13.848 65.475 64.927 1.00 28.15 ? 68   GLN A NE2 1 
ATOM   501  N N   . GLN A 1 69  ? -9.808  64.907 64.224 1.00 28.18 ? 69   GLN A N   1 
ATOM   502  C CA  . GLN A 1 69  ? -8.509  64.449 64.729 1.00 28.40 ? 69   GLN A CA  1 
ATOM   503  C C   . GLN A 1 69  ? -8.297  64.758 66.225 1.00 28.09 ? 69   GLN A C   1 
ATOM   504  O O   . GLN A 1 69  ? -9.024  65.593 66.818 1.00 27.79 ? 69   GLN A O   1 
ATOM   505  C CB  . GLN A 1 69  ? -7.375  65.145 63.913 1.00 26.81 ? 69   GLN A CB  1 
ATOM   506  C CG  . GLN A 1 69  ? -7.437  66.684 63.986 1.00 27.09 ? 69   GLN A CG  1 
ATOM   507  C CD  . GLN A 1 69  ? -6.521  67.417 62.981 1.00 27.99 ? 69   GLN A CD  1 
ATOM   508  O OE1 . GLN A 1 69  ? -5.339  67.701 63.241 1.00 27.04 ? 69   GLN A OE1 1 
ATOM   509  N NE2 . GLN A 1 69  ? -7.083  67.714 61.818 1.00 25.61 ? 69   GLN A NE2 1 
ATOM   510  N N   . TYR A 1 70  ? -7.291  64.100 66.802 1.00 26.73 ? 70   TYR A N   1 
ATOM   511  C CA  . TYR A 1 70  ? -6.831  64.338 68.167 1.00 28.15 ? 70   TYR A CA  1 
ATOM   512  C C   . TYR A 1 70  ? -6.377  65.807 68.251 1.00 29.98 ? 70   TYR A C   1 
ATOM   513  O O   . TYR A 1 70  ? -5.731  66.339 67.307 1.00 27.74 ? 70   TYR A O   1 
ATOM   514  C CB  . TYR A 1 70  ? -5.601  63.499 68.456 1.00 29.59 ? 70   TYR A CB  1 
ATOM   515  C CG  . TYR A 1 70  ? -4.966  63.752 69.808 1.00 30.14 ? 70   TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 70  ? -5.453  63.130 70.958 1.00 29.10 ? 70   TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 70  ? -3.863  64.614 69.937 1.00 31.04 ? 70   TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 70  ? -4.856  63.357 72.216 1.00 31.32 ? 70   TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 70  ? -3.253  64.847 71.216 1.00 31.36 ? 70   TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 70  ? -3.757  64.226 72.326 1.00 30.42 ? 70   TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 70  ? -3.219  64.503 73.568 1.00 33.20 ? 70   TYR A OH  1 
ATOM   522  N N   . VAL A 1 71  ? -6.680  66.461 69.369 1.00 29.47 ? 71   VAL A N   1 
ATOM   523  C CA  . VAL A 1 71  ? -6.302  67.876 69.542 1.00 30.36 ? 71   VAL A CA  1 
ATOM   524  C C   . VAL A 1 71  ? -5.325  67.944 70.707 1.00 32.19 ? 71   VAL A C   1 
ATOM   525  O O   . VAL A 1 71  ? -5.615  67.436 71.813 1.00 31.60 ? 71   VAL A O   1 
ATOM   526  C CB  . VAL A 1 71  ? -7.563  68.751 69.876 1.00 30.02 ? 71   VAL A CB  1 
ATOM   527  C CG1 . VAL A 1 71  ? -7.164  70.142 70.370 1.00 28.14 ? 71   VAL A CG1 1 
ATOM   528  C CG2 . VAL A 1 71  ? -8.432  68.857 68.615 1.00 30.91 ? 71   VAL A CG2 1 
ATOM   529  N N   . ASP A 1 72  ? -4.173  68.562 70.485 1.00 32.33 ? 72   ASP A N   1 
ATOM   530  C CA  . ASP A 1 72  ? -3.181  68.654 71.525 1.00 32.91 ? 72   ASP A CA  1 
ATOM   531  C C   . ASP A 1 72  ? -3.616  69.671 72.580 1.00 33.33 ? 72   ASP A C   1 
ATOM   532  O O   . ASP A 1 72  ? -3.826  70.839 72.275 1.00 34.71 ? 72   ASP A O   1 
ATOM   533  C CB  . ASP A 1 72  ? -1.833  69.095 70.900 1.00 34.67 ? 72   ASP A CB  1 
ATOM   534  C CG  . ASP A 1 72  ? -0.701  69.215 71.925 1.00 34.38 ? 72   ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 72  ? -0.923  68.914 73.126 1.00 34.65 ? 72   ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 72  ? 0.411   69.591 71.508 1.00 34.03 ? 72   ASP A OD2 1 
ATOM   537  N N   . GLU A 1 73  ? -3.770  69.242 73.822 1.00 35.19 ? 73   GLU A N   1 
ATOM   538  C CA  . GLU A 1 73  ? -4.074  70.208 74.860 1.00 37.26 ? 73   GLU A CA  1 
ATOM   539  C C   . GLU A 1 73  ? -3.096  70.082 76.038 1.00 36.54 ? 73   GLU A C   1 
ATOM   540  O O   . GLU A 1 73  ? -3.376  70.450 77.163 1.00 37.04 ? 73   GLU A O   1 
ATOM   541  C CB  . GLU A 1 73  ? -5.553  70.163 75.264 1.00 38.53 ? 73   GLU A CB  1 
ATOM   542  C CG  . GLU A 1 73  ? -6.158  68.854 75.704 1.00 43.37 ? 73   GLU A CG  1 
ATOM   543  C CD  . GLU A 1 73  ? -7.704  68.999 75.854 1.00 46.38 ? 73   GLU A CD  1 
ATOM   544  O OE1 . GLU A 1 73  ? -8.428  68.839 74.840 1.00 49.46 ? 73   GLU A OE1 1 
ATOM   545  O OE2 . GLU A 1 73  ? -8.188  69.314 76.967 1.00 44.91 ? 73   GLU A OE2 1 
ATOM   546  N N   . GLN A 1 74  ? -1.906  69.585 75.743 1.00 37.09 ? 74   GLN A N   1 
ATOM   547  C CA  . GLN A 1 74  ? -0.855  69.466 76.743 1.00 38.28 ? 74   GLN A CA  1 
ATOM   548  C C   . GLN A 1 74  ? -0.436  70.860 77.337 1.00 37.44 ? 74   GLN A C   1 
ATOM   549  O O   . GLN A 1 74  ? -0.187  70.985 78.532 1.00 37.21 ? 74   GLN A O   1 
ATOM   550  C CB  . GLN A 1 74  ? 0.354   68.778 76.084 1.00 39.87 ? 74   GLN A CB  1 
ATOM   551  C CG  . GLN A 1 74  ? 1.473   68.469 77.032 1.00 42.61 ? 74   GLN A CG  1 
ATOM   552  C CD  . GLN A 1 74  ? 1.024   67.530 78.153 1.00 45.25 ? 74   GLN A CD  1 
ATOM   553  O OE1 . GLN A 1 74  ? 0.641   66.384 77.908 1.00 46.28 ? 74   GLN A OE1 1 
ATOM   554  N NE2 . GLN A 1 74  ? 1.060   68.020 79.386 1.00 46.32 ? 74   GLN A NE2 1 
ATOM   555  N N   . PHE A 1 75  ? -0.393  71.898 76.502 1.00 35.94 ? 75   PHE A N   1 
ATOM   556  C CA  . PHE A 1 75  ? -0.007  73.252 76.935 1.00 35.39 ? 75   PHE A CA  1 
ATOM   557  C C   . PHE A 1 75  ? -1.077  74.281 76.459 1.00 36.27 ? 75   PHE A C   1 
ATOM   558  O O   . PHE A 1 75  ? -0.877  75.031 75.508 1.00 35.67 ? 75   PHE A O   1 
ATOM   559  C CB  . PHE A 1 75  ? 1.382   73.571 76.340 1.00 32.85 ? 75   PHE A CB  1 
ATOM   560  C CG  . PHE A 1 75  ? 2.425   72.510 76.643 1.00 30.46 ? 75   PHE A CG  1 
ATOM   561  C CD1 . PHE A 1 75  ? 2.895   72.328 77.958 1.00 29.66 ? 75   PHE A CD1 1 
ATOM   562  C CD2 . PHE A 1 75  ? 2.915   71.681 75.634 1.00 28.23 ? 75   PHE A CD2 1 
ATOM   563  C CE1 . PHE A 1 75  ? 3.835   71.328 78.267 1.00 27.82 ? 75   PHE A CE1 1 
ATOM   564  C CE2 . PHE A 1 75  ? 3.860   70.676 75.922 1.00 29.09 ? 75   PHE A CE2 1 
ATOM   565  C CZ  . PHE A 1 75  ? 4.319   70.499 77.252 1.00 28.64 ? 75   PHE A CZ  1 
ATOM   566  N N   . PRO A 1 76  ? -2.226  74.321 77.134 1.00 37.70 ? 76   PRO A N   1 
ATOM   567  C CA  . PRO A 1 76  ? -3.292  75.242 76.751 1.00 37.65 ? 76   PRO A CA  1 
ATOM   568  C C   . PRO A 1 76  ? -2.793  76.672 76.507 1.00 38.02 ? 76   PRO A C   1 
ATOM   569  O O   . PRO A 1 76  ? -2.196  77.301 77.368 1.00 37.51 ? 76   PRO A O   1 
ATOM   570  C CB  . PRO A 1 76  ? -4.282  75.116 77.926 1.00 38.22 ? 76   PRO A CB  1 
ATOM   571  C CG  . PRO A 1 76  ? -4.104  73.667 78.361 1.00 38.26 ? 76   PRO A CG  1 
ATOM   572  C CD  . PRO A 1 76  ? -2.571  73.615 78.388 1.00 39.24 ? 76   PRO A CD  1 
ATOM   573  N N   . GLY A 1 77  ? -3.044  77.174 75.306 1.00 38.75 ? 77   GLY A N   1 
ATOM   574  C CA  . GLY A 1 77  ? -2.613  78.513 74.965 1.00 39.43 ? 77   GLY A CA  1 
ATOM   575  C C   . GLY A 1 77  ? -1.164  78.690 74.538 1.00 38.90 ? 77   GLY A C   1 
ATOM   576  O O   . GLY A 1 77  ? -0.792  79.763 74.090 1.00 41.19 ? 77   GLY A O   1 
ATOM   577  N N   . PHE A 1 78  ? -0.323  77.675 74.677 1.00 37.65 ? 78   PHE A N   1 
ATOM   578  C CA  . PHE A 1 78  ? 1.074   77.826 74.283 1.00 35.04 ? 78   PHE A CA  1 
ATOM   579  C C   . PHE A 1 78  ? 1.157   77.861 72.769 1.00 33.91 ? 78   PHE A C   1 
ATOM   580  O O   . PHE A 1 78  ? 0.659   76.971 72.095 1.00 32.99 ? 78   PHE A O   1 
ATOM   581  C CB  . PHE A 1 78  ? 1.874   76.666 74.852 1.00 34.96 ? 78   PHE A CB  1 
ATOM   582  C CG  . PHE A 1 78  ? 3.316   76.712 74.517 1.00 35.24 ? 78   PHE A CG  1 
ATOM   583  C CD1 . PHE A 1 78  ? 4.102   77.798 74.936 1.00 36.42 ? 78   PHE A CD1 1 
ATOM   584  C CD2 . PHE A 1 78  ? 3.927   75.636 73.867 1.00 34.07 ? 78   PHE A CD2 1 
ATOM   585  C CE1 . PHE A 1 78  ? 5.479   77.800 74.716 1.00 35.88 ? 78   PHE A CE1 1 
ATOM   586  C CE2 . PHE A 1 78  ? 5.304   75.615 73.642 1.00 34.59 ? 78   PHE A CE2 1 
ATOM   587  C CZ  . PHE A 1 78  ? 6.089   76.693 74.066 1.00 35.99 ? 78   PHE A CZ  1 
ATOM   588  N N   . SER A 1 79  ? 1.792   78.867 72.198 1.00 33.96 ? 79   SER A N   1 
ATOM   589  C CA  . SER A 1 79  ? 1.803   78.873 70.751 1.00 35.14 ? 79   SER A CA  1 
ATOM   590  C C   . SER A 1 79  ? 2.571   77.700 70.113 1.00 34.35 ? 79   SER A C   1 
ATOM   591  O O   . SER A 1 79  ? 2.205   77.246 69.031 1.00 33.51 ? 79   SER A O   1 
ATOM   592  C CB  . SER A 1 79  ? 2.350   80.191 70.203 1.00 34.46 ? 79   SER A CB  1 
ATOM   593  O OG  . SER A 1 79  ? 3.686   80.350 70.631 1.00 38.42 ? 79   SER A OG  1 
ATOM   594  N N   . GLY A 1 80  ? 3.633   77.228 70.769 1.00 33.72 ? 80   GLY A N   1 
ATOM   595  C CA  . GLY A 1 80  ? 4.437   76.148 70.206 1.00 30.95 ? 80   GLY A CA  1 
ATOM   596  C C   . GLY A 1 80  ? 3.660   74.894 69.818 1.00 31.31 ? 80   GLY A C   1 
ATOM   597  O O   . GLY A 1 80  ? 3.931   74.271 68.776 1.00 28.82 ? 80   GLY A O   1 
ATOM   598  N N   . SER A 1 81  ? 2.694   74.525 70.656 1.00 31.05 ? 81   SER A N   1 
ATOM   599  C CA  . SER A 1 81  ? 1.862   73.340 70.413 1.00 32.11 ? 81   SER A CA  1 
ATOM   600  C C   . SER A 1 81  ? 0.583   73.669 69.645 1.00 31.30 ? 81   SER A C   1 
ATOM   601  O O   . SER A 1 81  ? 0.153   72.884 68.786 1.00 29.02 ? 81   SER A O   1 
ATOM   602  C CB  . SER A 1 81  ? 1.459   72.682 71.740 1.00 31.22 ? 81   SER A CB  1 
ATOM   603  O OG  . SER A 1 81  ? 1.069   73.702 72.652 1.00 34.60 ? 81   SER A OG  1 
ATOM   604  N N   . GLU A 1 82  ? -0.023  74.813 69.969 1.00 30.71 ? 82   GLU A N   1 
ATOM   605  C CA  . GLU A 1 82  ? -1.278  75.186 69.333 1.00 33.28 ? 82   GLU A CA  1 
ATOM   606  C C   . GLU A 1 82  ? -1.224  75.562 67.874 1.00 31.79 ? 82   GLU A C   1 
ATOM   607  O O   . GLU A 1 82  ? -2.216  75.480 67.176 1.00 31.97 ? 82   GLU A O   1 
ATOM   608  C CB  . GLU A 1 82  ? -1.989  76.241 70.173 1.00 37.25 ? 82   GLU A CB  1 
ATOM   609  C CG  . GLU A 1 82  ? -3.156  75.534 70.903 1.00 45.32 ? 82   GLU A CG  1 
ATOM   610  C CD  . GLU A 1 82  ? -3.408  76.096 72.244 1.00 47.85 ? 82   GLU A CD  1 
ATOM   611  O OE1 . GLU A 1 82  ? -3.175  77.312 72.376 1.00 51.40 ? 82   GLU A OE1 1 
ATOM   612  O OE2 . GLU A 1 82  ? -3.843  75.346 73.150 1.00 49.64 ? 82   GLU A OE2 1 
ATOM   613  N N   . MET A 1 83  ? -0.040  75.922 67.403 1.00 30.32 ? 83   MET A N   1 
ATOM   614  C CA  . MET A 1 83  ? 0.148   76.216 65.994 1.00 28.39 ? 83   MET A CA  1 
ATOM   615  C C   . MET A 1 83  ? -0.034  74.959 65.100 1.00 27.20 ? 83   MET A C   1 
ATOM   616  O O   . MET A 1 83  ? -0.124  75.094 63.878 1.00 26.19 ? 83   MET A O   1 
ATOM   617  C CB  . MET A 1 83  ? 1.545   76.781 65.769 1.00 26.93 ? 83   MET A CB  1 
ATOM   618  C CG  . MET A 1 83  ? 2.655   75.743 65.960 1.00 28.94 ? 83   MET A CG  1 
ATOM   619  S SD  . MET A 1 83  ? 4.337   76.486 65.850 1.00 30.99 ? 83   MET A SD  1 
ATOM   620  C CE  . MET A 1 83  ? 4.617   76.481 64.112 1.00 29.42 ? 83   MET A CE  1 
ATOM   621  N N   . TRP A 1 84  ? -0.084  73.761 65.697 1.00 25.69 ? 84   TRP A N   1 
ATOM   622  C CA  . TRP A 1 84  ? -0.274  72.520 64.934 1.00 27.88 ? 84   TRP A CA  1 
ATOM   623  C C   . TRP A 1 84  ? -1.701  72.003 65.068 1.00 28.83 ? 84   TRP A C   1 
ATOM   624  O O   . TRP A 1 84  ? -2.096  71.054 64.392 1.00 29.37 ? 84   TRP A O   1 
ATOM   625  C CB  . TRP A 1 84  ? 0.698   71.420 65.418 1.00 26.20 ? 84   TRP A CB  1 
ATOM   626  C CG  . TRP A 1 84  ? 2.169   71.870 65.342 1.00 26.24 ? 84   TRP A CG  1 
ATOM   627  C CD1 . TRP A 1 84  ? 2.987   72.186 66.382 1.00 25.29 ? 84   TRP A CD1 1 
ATOM   628  C CD2 . TRP A 1 84  ? 2.932   72.094 64.151 1.00 26.42 ? 84   TRP A CD2 1 
ATOM   629  N NE1 . TRP A 1 84  ? 4.234   72.593 65.920 1.00 25.38 ? 84   TRP A NE1 1 
ATOM   630  C CE2 . TRP A 1 84  ? 4.221   72.550 64.552 1.00 27.76 ? 84   TRP A CE2 1 
ATOM   631  C CE3 . TRP A 1 84  ? 2.651   71.965 62.781 1.00 26.22 ? 84   TRP A CE3 1 
ATOM   632  C CZ2 . TRP A 1 84  ? 5.231   72.871 63.623 1.00 28.45 ? 84   TRP A CZ2 1 
ATOM   633  C CZ3 . TRP A 1 84  ? 3.652   72.294 61.855 1.00 28.28 ? 84   TRP A CZ3 1 
ATOM   634  C CH2 . TRP A 1 84  ? 4.924   72.737 62.283 1.00 27.95 ? 84   TRP A CH2 1 
ATOM   635  N N   . ASN A 1 85  ? -2.474  72.597 65.965 1.00 28.97 ? 85   ASN A N   1 
ATOM   636  C CA  . ASN A 1 85  ? -3.854  72.118 66.170 1.00 30.02 ? 85   ASN A CA  1 
ATOM   637  C C   . ASN A 1 85  ? -4.819  72.650 65.114 1.00 28.91 ? 85   ASN A C   1 
ATOM   638  O O   . ASN A 1 85  ? -4.551  73.651 64.490 1.00 27.77 ? 85   ASN A O   1 
ATOM   639  C CB  . ASN A 1 85  ? -4.395  72.567 67.549 1.00 31.11 ? 85   ASN A CB  1 
ATOM   640  C CG  . ASN A 1 85  ? -4.042  71.608 68.693 1.00 31.62 ? 85   ASN A CG  1 
ATOM   641  O OD1 . ASN A 1 85  ? -3.944  70.393 68.502 1.00 32.45 ? 85   ASN A OD1 1 
ATOM   642  N ND2 . ASN A 1 85  ? -3.896  72.157 69.904 1.00 32.45 ? 85   ASN A ND2 1 
ATOM   643  N N   . PRO A 1 86  ? -5.931  71.951 64.873 1.00 30.39 ? 86   PRO A N   1 
ATOM   644  C CA  . PRO A 1 86  ? -6.900  72.445 63.886 1.00 30.63 ? 86   PRO A CA  1 
ATOM   645  C C   . PRO A 1 86  ? -7.286  73.887 64.320 1.00 31.75 ? 86   PRO A C   1 
ATOM   646  O O   . PRO A 1 86  ? -7.483  74.156 65.515 1.00 29.89 ? 86   PRO A O   1 
ATOM   647  C CB  . PRO A 1 86  ? -8.126  71.544 64.083 1.00 29.91 ? 86   PRO A CB  1 
ATOM   648  C CG  . PRO A 1 86  ? -7.617  70.351 64.690 1.00 31.25 ? 86   PRO A CG  1 
ATOM   649  C CD  . PRO A 1 86  ? -6.447  70.760 65.570 1.00 30.34 ? 86   PRO A CD  1 
ATOM   650  N N   . ASN A 1 87  ? -7.376  74.794 63.360 1.00 32.34 ? 87   ASN A N   1 
ATOM   651  C CA  . ASN A 1 87  ? -7.767  76.155 63.658 1.00 35.73 ? 87   ASN A CA  1 
ATOM   652  C C   . ASN A 1 87  ? -9.111  76.442 62.970 1.00 36.90 ? 87   ASN A C   1 
ATOM   653  O O   . ASN A 1 87  ? -9.505  77.600 62.841 1.00 38.30 ? 87   ASN A O   1 
ATOM   654  C CB  . ASN A 1 87  ? -6.698  77.151 63.185 1.00 35.06 ? 87   ASN A CB  1 
ATOM   655  C CG  . ASN A 1 87  ? -6.438  77.057 61.693 1.00 36.52 ? 87   ASN A CG  1 
ATOM   656  O OD1 . ASN A 1 87  ? -6.777  76.060 61.051 1.00 37.73 ? 87   ASN A OD1 1 
ATOM   657  N ND2 . ASN A 1 87  ? -5.817  78.088 61.136 1.00 35.66 ? 87   ASN A ND2 1 
ATOM   658  N N   . ARG A 1 88  ? -9.798  75.392 62.524 1.00 36.29 ? 88   ARG A N   1 
ATOM   659  C CA  . ARG A 1 88  ? -11.123 75.543 61.918 1.00 36.45 ? 88   ARG A CA  1 
ATOM   660  C C   . ARG A 1 88  ? -11.992 74.515 62.613 1.00 36.15 ? 88   ARG A C   1 
ATOM   661  O O   . ARG A 1 88  ? -11.468 73.661 63.318 1.00 34.14 ? 88   ARG A O   1 
ATOM   662  C CB  . ARG A 1 88  ? -11.078 75.231 60.423 1.00 36.95 ? 88   ARG A CB  1 
ATOM   663  C CG  . ARG A 1 88  ? -10.359 76.259 59.662 1.00 39.56 ? 88   ARG A CG  1 
ATOM   664  C CD  . ARG A 1 88  ? -11.353 77.314 59.424 1.00 44.29 ? 88   ARG A CD  1 
ATOM   665  N NE  . ARG A 1 88  ? -10.740 78.598 59.588 1.00 48.19 ? 88   ARG A NE  1 
ATOM   666  C CZ  . ARG A 1 88  ? -11.278 79.706 59.133 1.00 51.10 ? 88   ARG A CZ  1 
ATOM   667  N NH1 . ARG A 1 88  ? -12.458 79.661 58.498 1.00 52.12 ? 88   ARG A NH1 1 
ATOM   668  N NH2 . ARG A 1 88  ? -10.588 80.835 59.238 1.00 52.10 ? 88   ARG A NH2 1 
ATOM   669  N N   . GLU A 1 89  ? -13.305 74.578 62.424 1.00 37.29 ? 89   GLU A N   1 
ATOM   670  C CA  . GLU A 1 89  ? -14.163 73.581 63.036 1.00 39.46 ? 89   GLU A CA  1 
ATOM   671  C C   . GLU A 1 89  ? -13.811 72.202 62.410 1.00 37.73 ? 89   GLU A C   1 
ATOM   672  O O   . GLU A 1 89  ? -13.514 72.109 61.203 1.00 36.45 ? 89   GLU A O   1 
ATOM   673  C CB  . GLU A 1 89  ? -15.641 73.926 62.761 1.00 43.38 ? 89   GLU A CB  1 
ATOM   674  C CG  . GLU A 1 89  ? -16.651 73.167 63.664 1.00 52.40 ? 89   GLU A CG  1 
ATOM   675  C CD  . GLU A 1 89  ? -18.017 72.889 62.966 1.00 57.75 ? 89   GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 89  ? -18.794 72.009 63.455 1.00 59.44 ? 89   GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 89  ? -18.314 73.542 61.922 1.00 61.60 ? 89   GLU A OE2 1 
ATOM   678  N N   . MET A 1 90  ? -13.805 71.142 63.210 1.00 35.98 ? 90   MET A N   1 
ATOM   679  C CA  . MET A 1 90  ? -13.538 69.817 62.646 1.00 36.30 ? 90   MET A CA  1 
ATOM   680  C C   . MET A 1 90  ? -14.827 69.215 62.127 1.00 35.12 ? 90   MET A C   1 
ATOM   681  O O   . MET A 1 90  ? -15.886 69.423 62.726 1.00 34.25 ? 90   MET A O   1 
ATOM   682  C CB  . MET A 1 90  ? -12.978 68.868 63.712 1.00 37.18 ? 90   MET A CB  1 
ATOM   683  C CG  . MET A 1 90  ? -11.578 69.270 64.170 1.00 36.59 ? 90   MET A CG  1 
ATOM   684  S SD  . MET A 1 90  ? -10.765 68.104 65.262 1.00 32.30 ? 90   MET A SD  1 
ATOM   685  C CE  . MET A 1 90  ? -11.737 68.224 66.744 1.00 33.38 ? 90   MET A CE  1 
ATOM   686  N N   . SER A 1 91  ? -14.737 68.456 61.039 1.00 33.92 ? 91   SER A N   1 
ATOM   687  C CA  . SER A 1 91  ? -15.903 67.776 60.476 1.00 32.92 ? 91   SER A CA  1 
ATOM   688  C C   . SER A 1 91  ? -15.426 66.596 59.649 1.00 32.90 ? 91   SER A C   1 
ATOM   689  O O   . SER A 1 91  ? -14.347 66.685 59.064 1.00 32.63 ? 91   SER A O   1 
ATOM   690  C CB  . SER A 1 91  ? -16.673 68.724 59.534 1.00 32.71 ? 91   SER A CB  1 
ATOM   691  O OG  . SER A 1 91  ? -17.718 68.049 58.874 1.00 31.04 ? 91   SER A OG  1 
ATOM   692  N N   . GLU A 1 92  ? -16.187 65.504 59.574 1.00 31.48 ? 92   GLU A N   1 
ATOM   693  C CA  . GLU A 1 92  ? -15.769 64.431 58.668 1.00 32.63 ? 92   GLU A CA  1 
ATOM   694  C C   . GLU A 1 92  ? -15.915 64.946 57.227 1.00 32.77 ? 92   GLU A C   1 
ATOM   695  O O   . GLU A 1 92  ? -15.323 64.390 56.289 1.00 34.41 ? 92   GLU A O   1 
ATOM   696  C CB  . GLU A 1 92  ? -16.617 63.180 58.829 1.00 33.22 ? 92   GLU A CB  1 
ATOM   697  C CG  . GLU A 1 92  ? -16.363 62.435 60.119 1.00 33.45 ? 92   GLU A CG  1 
ATOM   698  C CD  . GLU A 1 92  ? -17.122 61.118 60.169 1.00 35.43 ? 92   GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 92  ? -18.238 61.119 60.733 1.00 35.91 ? 92   GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 92  ? -16.601 60.104 59.621 1.00 35.50 ? 92   GLU A OE2 1 
ATOM   701  N N   . ASP A 1 93  ? -16.696 66.008 57.037 1.00 31.60 ? 93   ASP A N   1 
ATOM   702  C CA  . ASP A 1 93  ? -16.846 66.600 55.708 1.00 32.91 ? 93   ASP A CA  1 
ATOM   703  C C   . ASP A 1 93  ? -15.643 67.516 55.620 1.00 32.41 ? 93   ASP A C   1 
ATOM   704  O O   . ASP A 1 93  ? -15.753 68.693 55.958 1.00 32.76 ? 93   ASP A O   1 
ATOM   705  C CB  . ASP A 1 93  ? -18.149 67.414 55.622 1.00 33.77 ? 93   ASP A CB  1 
ATOM   706  C CG  . ASP A 1 93  ? -18.324 68.138 54.265 1.00 35.95 ? 93   ASP A CG  1 
ATOM   707  O OD1 . ASP A 1 93  ? -17.401 68.126 53.396 1.00 33.38 ? 93   ASP A OD1 1 
ATOM   708  O OD2 . ASP A 1 93  ? -19.407 68.753 54.087 1.00 37.11 ? 93   ASP A OD2 1 
ATOM   709  N N   . CYS A 1 94  ? -14.504 66.987 55.147 1.00 31.91 ? 94   CYS A N   1 
ATOM   710  C CA  . CYS A 1 94  ? -13.250 67.789 55.131 1.00 32.58 ? 94   CYS A CA  1 
ATOM   711  C C   . CYS A 1 94  ? -12.341 67.621 53.944 1.00 32.02 ? 94   CYS A C   1 
ATOM   712  O O   . CYS A 1 94  ? -11.199 68.126 53.979 1.00 31.53 ? 94   CYS A O   1 
ATOM   713  C CB  . CYS A 1 94  ? -12.414 67.454 56.384 1.00 32.34 ? 94   CYS A CB  1 
ATOM   714  S SG  . CYS A 1 94  ? -11.934 65.703 56.412 1.00 28.74 ? 94   CYS A SG  1 
ATOM   715  N N   . LEU A 1 95  ? -12.811 66.933 52.904 1.00 29.92 ? 95   LEU A N   1 
ATOM   716  C CA  . LEU A 1 95  ? -11.965 66.719 51.739 1.00 29.95 ? 95   LEU A CA  1 
ATOM   717  C C   . LEU A 1 95  ? -11.972 67.928 50.759 1.00 29.68 ? 95   LEU A C   1 
ATOM   718  O O   . LEU A 1 95  ? -12.712 67.967 49.774 1.00 28.95 ? 95   LEU A O   1 
ATOM   719  C CB  . LEU A 1 95  ? -12.361 65.377 51.074 1.00 28.74 ? 95   LEU A CB  1 
ATOM   720  C CG  . LEU A 1 95  ? -12.131 64.132 51.966 1.00 29.52 ? 95   LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 95  ? -12.341 62.833 51.192 1.00 29.45 ? 95   LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 95  ? -10.676 64.153 52.498 1.00 28.45 ? 95   LEU A CD2 1 
ATOM   723  N N   . TYR A 1 96  ? -11.105 68.905 51.035 1.00 29.32 ? 96   TYR A N   1 
ATOM   724  C CA  . TYR A 1 96  ? -11.015 70.133 50.230 1.00 29.84 ? 96   TYR A CA  1 
ATOM   725  C C   . TYR A 1 96  ? -9.568  70.484 49.962 1.00 29.43 ? 96   TYR A C   1 
ATOM   726  O O   . TYR A 1 96  ? -8.677  69.988 50.655 1.00 29.37 ? 96   TYR A O   1 
ATOM   727  C CB  . TYR A 1 96  ? -11.675 71.330 50.987 1.00 30.09 ? 96   TYR A CB  1 
ATOM   728  C CG  . TYR A 1 96  ? -13.135 71.100 51.306 1.00 30.99 ? 96   TYR A CG  1 
ATOM   729  C CD1 . TYR A 1 96  ? -13.503 70.344 52.419 1.00 30.47 ? 96   TYR A CD1 1 
ATOM   730  C CD2 . TYR A 1 96  ? -14.148 71.559 50.430 1.00 31.24 ? 96   TYR A CD2 1 
ATOM   731  C CE1 . TYR A 1 96  ? -14.829 70.032 52.661 1.00 32.85 ? 96   TYR A CE1 1 
ATOM   732  C CE2 . TYR A 1 96  ? -15.489 71.255 50.664 1.00 32.08 ? 96   TYR A CE2 1 
ATOM   733  C CZ  . TYR A 1 96  ? -15.819 70.495 51.773 1.00 33.50 ? 96   TYR A CZ  1 
ATOM   734  O OH  . TYR A 1 96  ? -17.118 70.192 52.015 1.00 33.20 ? 96   TYR A OH  1 
ATOM   735  N N   . LEU A 1 97  ? -9.325  71.323 48.957 1.00 28.44 ? 97   LEU A N   1 
ATOM   736  C CA  . LEU A 1 97  ? -7.959  71.751 48.690 1.00 29.47 ? 97   LEU A CA  1 
ATOM   737  C C   . LEU A 1 97  ? -7.932  73.279 48.586 1.00 29.92 ? 97   LEU A C   1 
ATOM   738  O O   . LEU A 1 97  ? -8.972  73.908 48.379 1.00 31.79 ? 97   LEU A O   1 
ATOM   739  C CB  . LEU A 1 97  ? -7.363  71.065 47.441 1.00 26.81 ? 97   LEU A CB  1 
ATOM   740  C CG  . LEU A 1 97  ? -8.085  71.026 46.083 1.00 28.30 ? 97   LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 97  ? -7.890  72.372 45.349 1.00 28.23 ? 97   LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 97  ? -7.489  69.883 45.189 1.00 26.63 ? 97   LEU A CD2 1 
ATOM   743  N N   . ASN A 1 98  ? -6.757  73.869 48.744 1.00 29.16 ? 98   ASN A N   1 
ATOM   744  C CA  . ASN A 1 98  ? -6.613  75.309 48.677 1.00 29.87 ? 98   ASN A CA  1 
ATOM   745  C C   . ASN A 1 98  ? -5.565  75.641 47.602 1.00 31.12 ? 98   ASN A C   1 
ATOM   746  O O   . ASN A 1 98  ? -4.550  74.931 47.464 1.00 30.83 ? 98   ASN A O   1 
ATOM   747  C CB  . ASN A 1 98  ? -6.144  75.872 50.046 1.00 27.95 ? 98   ASN A CB  1 
ATOM   748  C CG  . ASN A 1 98  ? -6.988  75.394 51.180 1.00 27.64 ? 98   ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 98  ? -8.170  75.636 51.199 1.00 31.19 ? 98   ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 98  ? -6.392  74.688 52.132 1.00 29.18 ? 98   ASN A ND2 1 
ATOM   751  N N   . ILE A 1 99  ? -5.808  76.719 46.853 1.00 30.61 ? 99   ILE A N   1 
ATOM   752  C CA  . ILE A 1 99  ? -4.876  77.175 45.818 1.00 30.81 ? 99   ILE A CA  1 
ATOM   753  C C   . ILE A 1 99  ? -4.476  78.667 45.891 1.00 30.79 ? 99   ILE A C   1 
ATOM   754  O O   . ILE A 1 99  ? -5.355  79.518 46.001 1.00 33.25 ? 99   ILE A O   1 
ATOM   755  C CB  . ILE A 1 99  ? -5.460  76.956 44.407 1.00 29.72 ? 99   ILE A CB  1 
ATOM   756  C CG1 . ILE A 1 99  ? -6.205  75.609 44.331 1.00 28.39 ? 99   ILE A CG1 1 
ATOM   757  C CG2 . ILE A 1 99  ? -4.308  76.979 43.402 1.00 28.04 ? 99   ILE A CG2 1 
ATOM   758  C CD1 . ILE A 1 99  ? -6.641  75.222 42.904 1.00 28.82 ? 99   ILE A CD1 1 
ATOM   759  N N   . TRP A 1 100 ? -3.181  78.976 45.824 1.00 29.86 ? 100  TRP A N   1 
ATOM   760  C CA  . TRP A 1 100 ? -2.738  80.355 45.825 1.00 31.15 ? 100  TRP A CA  1 
ATOM   761  C C   . TRP A 1 100 ? -2.173  80.534 44.448 1.00 31.73 ? 100  TRP A C   1 
ATOM   762  O O   . TRP A 1 100 ? -1.306  79.769 44.028 1.00 31.54 ? 100  TRP A O   1 
ATOM   763  C CB  . TRP A 1 100 ? -1.674  80.610 46.873 1.00 31.28 ? 100  TRP A CB  1 
ATOM   764  C CG  . TRP A 1 100 ? -2.266  80.750 48.234 1.00 33.16 ? 100  TRP A CG  1 
ATOM   765  C CD1 . TRP A 1 100 ? -2.711  81.908 48.839 1.00 34.04 ? 100  TRP A CD1 1 
ATOM   766  C CD2 . TRP A 1 100 ? -2.457  79.707 49.188 1.00 33.87 ? 100  TRP A CD2 1 
ATOM   767  N NE1 . TRP A 1 100 ? -3.153  81.647 50.117 1.00 33.51 ? 100  TRP A NE1 1 
ATOM   768  C CE2 . TRP A 1 100 ? -3.016  80.303 50.361 1.00 34.08 ? 100  TRP A CE2 1 
ATOM   769  C CE3 . TRP A 1 100 ? -2.227  78.320 49.172 1.00 33.80 ? 100  TRP A CE3 1 
ATOM   770  C CZ2 . TRP A 1 100 ? -3.326  79.557 51.507 1.00 33.89 ? 100  TRP A CZ2 1 
ATOM   771  C CZ3 . TRP A 1 100 ? -2.542  77.564 50.329 1.00 34.04 ? 100  TRP A CZ3 1 
ATOM   772  C CH2 . TRP A 1 100 ? -3.087  78.189 51.475 1.00 32.97 ? 100  TRP A CH2 1 
ATOM   773  N N   . VAL A 1 101 ? -2.678  81.546 43.746 1.00 32.13 ? 101  VAL A N   1 
ATOM   774  C CA  . VAL A 1 101 ? -2.317  81.845 42.369 1.00 31.70 ? 101  VAL A CA  1 
ATOM   775  C C   . VAL A 1 101 ? -1.741  83.258 42.180 1.00 34.42 ? 101  VAL A C   1 
ATOM   776  O O   . VAL A 1 101 ? -2.368  84.259 42.541 1.00 34.45 ? 101  VAL A O   1 
ATOM   777  C CB  . VAL A 1 101 ? -3.583  81.664 41.475 1.00 29.91 ? 101  VAL A CB  1 
ATOM   778  C CG1 . VAL A 1 101 ? -3.281  81.916 39.983 1.00 25.42 ? 101  VAL A CG1 1 
ATOM   779  C CG2 . VAL A 1 101 ? -4.176  80.268 41.708 1.00 28.59 ? 101  VAL A CG2 1 
ATOM   780  N N   . PRO A 1 102 ? -0.520  83.355 41.627 1.00 36.05 ? 102  PRO A N   1 
ATOM   781  C CA  . PRO A 1 102 ? 0.096   84.669 41.402 1.00 36.77 ? 102  PRO A CA  1 
ATOM   782  C C   . PRO A 1 102 ? -0.896  85.579 40.651 1.00 38.55 ? 102  PRO A C   1 
ATOM   783  O O   . PRO A 1 102 ? -1.785  85.071 39.921 1.00 38.00 ? 102  PRO A O   1 
ATOM   784  C CB  . PRO A 1 102 ? 1.294   84.342 40.527 1.00 35.33 ? 102  PRO A CB  1 
ATOM   785  C CG  . PRO A 1 102 ? 1.648   82.924 41.030 1.00 36.43 ? 102  PRO A CG  1 
ATOM   786  C CD  . PRO A 1 102 ? 0.335   82.258 41.138 1.00 35.77 ? 102  PRO A CD  1 
ATOM   787  N N   . SER A 1 103 ? -0.772  86.898 40.851 1.00 38.90 ? 103  SER A N   1 
ATOM   788  C CA  . SER A 1 103 ? -1.622  87.872 40.142 1.00 39.54 ? 103  SER A CA  1 
ATOM   789  C C   . SER A 1 103 ? -0.694  88.827 39.363 1.00 39.21 ? 103  SER A C   1 
ATOM   790  O O   . SER A 1 103 ? 0.203   89.429 39.940 1.00 37.01 ? 103  SER A O   1 
ATOM   791  C CB  . SER A 1 103 ? -2.486  88.669 41.128 1.00 40.55 ? 103  SER A CB  1 
ATOM   792  O OG  . SER A 1 103 ? -3.302  89.609 40.437 1.00 41.89 ? 103  SER A OG  1 
ATOM   793  N N   . PRO A 1 104 ? -0.915  88.995 38.043 1.00 40.30 ? 104  PRO A N   1 
ATOM   794  C CA  . PRO A 1 104 ? -1.966  88.387 37.204 1.00 39.31 ? 104  PRO A CA  1 
ATOM   795  C C   . PRO A 1 104 ? -1.805  86.859 37.023 1.00 37.82 ? 104  PRO A C   1 
ATOM   796  O O   . PRO A 1 104 ? -0.695  86.323 37.057 1.00 35.55 ? 104  PRO A O   1 
ATOM   797  C CB  . PRO A 1 104 ? -1.826  89.150 35.863 1.00 39.57 ? 104  PRO A CB  1 
ATOM   798  C CG  . PRO A 1 104 ? -0.327  89.345 35.748 1.00 41.22 ? 104  PRO A CG  1 
ATOM   799  C CD  . PRO A 1 104 ? 0.038   89.785 37.215 1.00 41.02 ? 104  PRO A CD  1 
ATOM   800  N N   . ARG A 1 105 ? -2.933  86.190 36.810 1.00 37.39 ? 105  ARG A N   1 
ATOM   801  C CA  . ARG A 1 105 ? -2.980  84.746 36.621 1.00 37.78 ? 105  ARG A CA  1 
ATOM   802  C C   . ARG A 1 105 ? -1.964  84.281 35.607 1.00 37.88 ? 105  ARG A C   1 
ATOM   803  O O   . ARG A 1 105 ? -1.997  84.715 34.463 1.00 36.67 ? 105  ARG A O   1 
ATOM   804  C CB  . ARG A 1 105 ? -4.365  84.289 36.129 1.00 38.59 ? 105  ARG A CB  1 
ATOM   805  C CG  . ARG A 1 105 ? -4.487  82.777 36.053 1.00 36.58 ? 105  ARG A CG  1 
ATOM   806  C CD  . ARG A 1 105 ? -5.779  82.356 35.492 1.00 35.08 ? 105  ARG A CD  1 
ATOM   807  N NE  . ARG A 1 105 ? -6.888  82.882 36.275 1.00 35.60 ? 105  ARG A NE  1 
ATOM   808  C CZ  . ARG A 1 105 ? -8.141  82.852 35.838 1.00 35.06 ? 105  ARG A CZ  1 
ATOM   809  N NH1 . ARG A 1 105 ? -8.388  82.337 34.647 1.00 37.21 ? 105  ARG A NH1 1 
ATOM   810  N NH2 . ARG A 1 105 ? -9.127  83.316 36.562 1.00 33.59 ? 105  ARG A NH2 1 
ATOM   811  N N   . PRO A 1 106 ? -1.040  83.390 36.018 1.00 38.00 ? 106  PRO A N   1 
ATOM   812  C CA  . PRO A 1 106 ? -0.009  82.861 35.103 1.00 37.24 ? 106  PRO A CA  1 
ATOM   813  C C   . PRO A 1 106 ? -0.696  82.049 33.992 1.00 37.00 ? 106  PRO A C   1 
ATOM   814  O O   . PRO A 1 106 ? -1.894  81.726 34.090 1.00 37.20 ? 106  PRO A O   1 
ATOM   815  C CB  . PRO A 1 106 ? 0.811   81.916 35.982 1.00 38.80 ? 106  PRO A CB  1 
ATOM   816  C CG  . PRO A 1 106 ? 0.318   82.135 37.373 1.00 38.05 ? 106  PRO A CG  1 
ATOM   817  C CD  . PRO A 1 106 ? -1.048  82.676 37.301 1.00 36.08 ? 106  PRO A CD  1 
ATOM   818  N N   . LYS A 1 107 ? 0.058   81.698 32.954 1.00 36.49 ? 107  LYS A N   1 
ATOM   819  C CA  . LYS A 1 107 ? -0.481  80.896 31.862 1.00 36.72 ? 107  LYS A CA  1 
ATOM   820  C C   . LYS A 1 107 ? -0.068  79.431 32.059 1.00 37.86 ? 107  LYS A C   1 
ATOM   821  O O   . LYS A 1 107 ? -0.863  78.515 31.844 1.00 37.05 ? 107  LYS A O   1 
ATOM   822  C CB  . LYS A 1 107 ? 0.071   81.379 30.528 1.00 38.63 ? 107  LYS A CB  1 
ATOM   823  C CG  . LYS A 1 107 ? -0.143  82.837 30.267 1.00 42.56 ? 107  LYS A CG  1 
ATOM   824  C CD  . LYS A 1 107 ? -1.609  83.141 30.404 1.00 44.50 ? 107  LYS A CD  1 
ATOM   825  C CE  . LYS A 1 107 ? -1.885  84.653 30.402 1.00 45.82 ? 107  LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 107 ? -3.331  84.850 30.589 1.00 45.55 ? 107  LYS A NZ  1 
ATOM   827  N N   . SER A 1 108 ? 1.178   79.203 32.483 1.00 37.11 ? 108  SER A N   1 
ATOM   828  C CA  . SER A 1 108 ? 1.657   77.829 32.647 1.00 38.62 ? 108  SER A CA  1 
ATOM   829  C C   . SER A 1 108 ? 2.839   77.853 33.590 1.00 37.53 ? 108  SER A C   1 
ATOM   830  O O   . SER A 1 108 ? 3.991   77.843 33.149 1.00 38.20 ? 108  SER A O   1 
ATOM   831  C CB  . SER A 1 108 ? 2.118   77.276 31.293 1.00 38.84 ? 108  SER A CB  1 
ATOM   832  O OG  . SER A 1 108 ? 2.236   75.855 31.352 1.00 40.35 ? 108  SER A OG  1 
ATOM   833  N N   . THR A 1 109 ? 2.571   77.881 34.877 1.00 35.27 ? 109  THR A N   1 
ATOM   834  C CA  . THR A 1 109 ? 3.688   77.970 35.782 1.00 35.83 ? 109  THR A CA  1 
ATOM   835  C C   . THR A 1 109 ? 3.821   76.764 36.715 1.00 34.60 ? 109  THR A C   1 
ATOM   836  O O   . THR A 1 109 ? 2.846   76.047 36.938 1.00 34.24 ? 109  THR A O   1 
ATOM   837  C CB  . THR A 1 109 ? 3.620   79.280 36.592 1.00 35.78 ? 109  THR A CB  1 
ATOM   838  O OG1 . THR A 1 109 ? 4.904   79.515 37.193 1.00 39.30 ? 109  THR A OG1 1 
ATOM   839  C CG2 . THR A 1 109 ? 2.601   79.165 37.694 1.00 34.80 ? 109  THR A CG2 1 
ATOM   840  N N   . THR A 1 110 ? 5.027   76.557 37.252 1.00 34.49 ? 110  THR A N   1 
ATOM   841  C CA  . THR A 1 110 ? 5.316   75.437 38.168 1.00 32.90 ? 110  THR A CA  1 
ATOM   842  C C   . THR A 1 110 ? 4.305   75.337 39.325 1.00 31.53 ? 110  THR A C   1 
ATOM   843  O O   . THR A 1 110 ? 3.929   76.329 39.939 1.00 30.49 ? 110  THR A O   1 
ATOM   844  C CB  . THR A 1 110 ? 6.729   75.572 38.770 1.00 35.34 ? 110  THR A CB  1 
ATOM   845  O OG1 . THR A 1 110 ? 7.702   75.624 37.722 1.00 36.09 ? 110  THR A OG1 1 
ATOM   846  C CG2 . THR A 1 110 ? 7.033   74.416 39.683 1.00 34.46 ? 110  THR A CG2 1 
ATOM   847  N N   . VAL A 1 111 ? 3.857   74.123 39.612 1.00 30.63 ? 111  VAL A N   1 
ATOM   848  C CA  . VAL A 1 111 ? 2.883   73.864 40.672 1.00 27.50 ? 111  VAL A CA  1 
ATOM   849  C C   . VAL A 1 111 ? 3.540   73.052 41.846 1.00 28.82 ? 111  VAL A C   1 
ATOM   850  O O   . VAL A 1 111 ? 4.290   72.090 41.594 1.00 27.67 ? 111  VAL A O   1 
ATOM   851  C CB  . VAL A 1 111 ? 1.699   73.039 40.092 1.00 28.73 ? 111  VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 111 ? 0.644   72.745 41.169 1.00 23.35 ? 111  VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 111 ? 1.056   73.794 38.848 1.00 26.86 ? 111  VAL A CG2 1 
ATOM   854  N N   . MET A 1 112 ? 3.270   73.449 43.098 1.00 27.77 ? 112  MET A N   1 
ATOM   855  C CA  . MET A 1 112 ? 3.762   72.769 44.303 1.00 28.27 ? 112  MET A CA  1 
ATOM   856  C C   . MET A 1 112 ? 2.537   72.402 45.101 1.00 28.42 ? 112  MET A C   1 
ATOM   857  O O   . MET A 1 112 ? 1.644   73.250 45.298 1.00 31.61 ? 112  MET A O   1 
ATOM   858  C CB  . MET A 1 112 ? 4.702   73.671 45.104 1.00 28.02 ? 112  MET A CB  1 
ATOM   859  C CG  . MET A 1 112 ? 5.971   74.004 44.298 1.00 29.31 ? 112  MET A CG  1 
ATOM   860  S SD  . MET A 1 112 ? 7.184   75.003 45.181 1.00 29.52 ? 112  MET A SD  1 
ATOM   861  C CE  . MET A 1 112 ? 7.571   73.870 46.489 1.00 31.27 ? 112  MET A CE  1 
ATOM   862  N N   . VAL A 1 113 ? 2.454   71.132 45.525 1.00 26.86 ? 113  VAL A N   1 
ATOM   863  C CA  . VAL A 1 113 ? 1.289   70.620 46.253 1.00 27.06 ? 113  VAL A CA  1 
ATOM   864  C C   . VAL A 1 113 ? 1.790   70.082 47.584 1.00 27.81 ? 113  VAL A C   1 
ATOM   865  O O   . VAL A 1 113 ? 2.519   69.080 47.625 1.00 28.47 ? 113  VAL A O   1 
ATOM   866  C CB  . VAL A 1 113 ? 0.575   69.431 45.490 1.00 25.61 ? 113  VAL A CB  1 
ATOM   867  C CG1 . VAL A 1 113 ? -0.626  68.908 46.331 1.00 23.69 ? 113  VAL A CG1 1 
ATOM   868  C CG2 . VAL A 1 113 ? 0.156   69.847 44.099 1.00 23.58 ? 113  VAL A CG2 1 
ATOM   869  N N   . TRP A 1 114 ? 1.354   70.747 48.646 1.00 27.23 ? 114  TRP A N   1 
ATOM   870  C CA  . TRP A 1 114 ? 1.724   70.472 50.022 1.00 27.37 ? 114  TRP A CA  1 
ATOM   871  C C   . TRP A 1 114 ? 0.827   69.438 50.688 1.00 27.11 ? 114  TRP A C   1 
ATOM   872  O O   . TRP A 1 114 ? -0.403  69.527 50.643 1.00 27.00 ? 114  TRP A O   1 
ATOM   873  C CB  . TRP A 1 114 ? 1.666   71.771 50.839 1.00 27.09 ? 114  TRP A CB  1 
ATOM   874  C CG  . TRP A 1 114 ? 1.982   71.609 52.336 1.00 26.71 ? 114  TRP A CG  1 
ATOM   875  C CD1 . TRP A 1 114 ? 1.129   71.815 53.392 1.00 27.55 ? 114  TRP A CD1 1 
ATOM   876  C CD2 . TRP A 1 114 ? 3.263   71.332 52.912 1.00 26.63 ? 114  TRP A CD2 1 
ATOM   877  N NE1 . TRP A 1 114 ? 1.797   71.694 54.595 1.00 27.92 ? 114  TRP A NE1 1 
ATOM   878  C CE2 . TRP A 1 114 ? 3.111   71.398 54.331 1.00 27.65 ? 114  TRP A CE2 1 
ATOM   879  C CE3 . TRP A 1 114 ? 4.534   71.051 52.370 1.00 26.11 ? 114  TRP A CE3 1 
ATOM   880  C CZ2 . TRP A 1 114 ? 4.188   71.196 55.213 1.00 28.13 ? 114  TRP A CZ2 1 
ATOM   881  C CZ3 . TRP A 1 114 ? 5.607   70.859 53.239 1.00 26.02 ? 114  TRP A CZ3 1 
ATOM   882  C CH2 . TRP A 1 114 ? 5.428   70.930 54.648 1.00 28.32 ? 114  TRP A CH2 1 
ATOM   883  N N   . ILE A 1 115 ? 1.460   68.461 51.308 1.00 27.06 ? 115  ILE A N   1 
ATOM   884  C CA  . ILE A 1 115 ? 0.756   67.397 52.036 1.00 26.69 ? 115  ILE A CA  1 
ATOM   885  C C   . ILE A 1 115 ? 1.088   67.487 53.539 1.00 26.34 ? 115  ILE A C   1 
ATOM   886  O O   . ILE A 1 115 ? 2.248   67.258 53.916 1.00 26.26 ? 115  ILE A O   1 
ATOM   887  C CB  . ILE A 1 115 ? 1.192   66.008 51.494 1.00 25.78 ? 115  ILE A CB  1 
ATOM   888  C CG1 . ILE A 1 115 ? 0.947   65.964 49.988 1.00 24.77 ? 115  ILE A CG1 1 
ATOM   889  C CG2 . ILE A 1 115 ? 0.408   64.905 52.243 1.00 24.05 ? 115  ILE A CG2 1 
ATOM   890  C CD1 . ILE A 1 115 ? 1.382   64.654 49.333 1.00 26.92 ? 115  ILE A CD1 1 
ATOM   891  N N   . TYR A 1 116 ? 0.101   67.819 54.391 1.00 25.45 ? 116  TYR A N   1 
ATOM   892  C CA  . TYR A 1 116 ? 0.376   67.924 55.812 1.00 24.77 ? 116  TYR A CA  1 
ATOM   893  C C   . TYR A 1 116 ? 0.766   66.591 56.443 1.00 25.76 ? 116  TYR A C   1 
ATOM   894  O O   . TYR A 1 116 ? 0.582   65.514 55.879 1.00 25.44 ? 116  TYR A O   1 
ATOM   895  C CB  . TYR A 1 116 ? -0.777  68.625 56.582 1.00 24.31 ? 116  TYR A CB  1 
ATOM   896  C CG  . TYR A 1 116 ? -2.149  67.990 56.513 1.00 23.49 ? 116  TYR A CG  1 
ATOM   897  C CD1 . TYR A 1 116 ? -2.414  66.752 57.089 1.00 22.65 ? 116  TYR A CD1 1 
ATOM   898  C CD2 . TYR A 1 116 ? -3.201  68.673 55.910 1.00 24.27 ? 116  TYR A CD2 1 
ATOM   899  C CE1 . TYR A 1 116 ? -3.702  66.220 57.058 1.00 23.70 ? 116  TYR A CE1 1 
ATOM   900  C CE2 . TYR A 1 116 ? -4.468  68.167 55.882 1.00 23.40 ? 116  TYR A CE2 1 
ATOM   901  C CZ  . TYR A 1 116 ? -4.728  66.948 56.445 1.00 24.34 ? 116  TYR A CZ  1 
ATOM   902  O OH  . TYR A 1 116 ? -6.042  66.494 56.385 1.00 23.85 ? 116  TYR A OH  1 
ATOM   903  N N   . GLY A 1 117 ? 1.358   66.651 57.613 1.00 28.08 ? 117  GLY A N   1 
ATOM   904  C CA  . GLY A 1 117 ? 1.823   65.402 58.155 1.00 30.28 ? 117  GLY A CA  1 
ATOM   905  C C   . GLY A 1 117 ? 2.028   65.111 59.618 1.00 29.76 ? 117  GLY A C   1 
ATOM   906  O O   . GLY A 1 117 ? 3.116   64.649 60.005 1.00 30.85 ? 117  GLY A O   1 
ATOM   907  N N   . GLY A 1 118 ? 1.000   65.319 60.430 1.00 29.98 ? 118  GLY A N   1 
ATOM   908  C CA  . GLY A 1 118 ? 1.150   64.980 61.832 1.00 27.13 ? 118  GLY A CA  1 
ATOM   909  C C   . GLY A 1 118 ? 0.991   63.474 62.102 1.00 27.86 ? 118  GLY A C   1 
ATOM   910  O O   . GLY A 1 118 ? -0.075  63.055 62.577 1.00 26.24 ? 118  GLY A O   1 
ATOM   911  N N   . GLY A 1 119 ? 2.012   62.658 61.798 1.00 26.68 ? 119  GLY A N   1 
ATOM   912  C CA  . GLY A 1 119 ? 1.942   61.226 62.101 1.00 26.02 ? 119  GLY A CA  1 
ATOM   913  C C   . GLY A 1 119 ? 0.741   60.392 61.624 1.00 27.60 ? 119  GLY A C   1 
ATOM   914  O O   . GLY A 1 119 ? 0.464   59.329 62.181 1.00 27.14 ? 119  GLY A O   1 
ATOM   915  N N   . PHE A 1 120 ? 0.092   60.833 60.546 1.00 25.56 ? 120  PHE A N   1 
ATOM   916  C CA  . PHE A 1 120 ? -1.101  60.195 60.002 1.00 26.78 ? 120  PHE A CA  1 
ATOM   917  C C   . PHE A 1 120 ? -2.325  60.274 60.955 1.00 27.44 ? 120  PHE A C   1 
ATOM   918  O O   . PHE A 1 120 ? -3.423  59.777 60.599 1.00 26.06 ? 120  PHE A O   1 
ATOM   919  C CB  . PHE A 1 120 ? -0.851  58.738 59.570 1.00 25.48 ? 120  PHE A CB  1 
ATOM   920  C CG  . PHE A 1 120 ? 0.108   58.617 58.414 1.00 25.87 ? 120  PHE A CG  1 
ATOM   921  C CD1 . PHE A 1 120 ? -0.260  59.021 57.141 1.00 24.02 ? 120  PHE A CD1 1 
ATOM   922  C CD2 . PHE A 1 120 ? 1.381   58.108 58.611 1.00 24.97 ? 120  PHE A CD2 1 
ATOM   923  C CE1 . PHE A 1 120 ? 0.619   58.920 56.066 1.00 23.55 ? 120  PHE A CE1 1 
ATOM   924  C CE2 . PHE A 1 120 ? 2.288   57.995 57.545 1.00 25.71 ? 120  PHE A CE2 1 
ATOM   925  C CZ  . PHE A 1 120 ? 1.903   58.403 56.259 1.00 25.80 ? 120  PHE A CZ  1 
ATOM   926  N N   . TYR A 1 121 ? -2.173  60.917 62.125 1.00 25.30 ? 121  TYR A N   1 
ATOM   927  C CA  . TYR A 1 121 ? -3.321  61.039 63.034 1.00 26.22 ? 121  TYR A CA  1 
ATOM   928  C C   . TYR A 1 121 ? -3.790  62.493 63.190 1.00 28.06 ? 121  TYR A C   1 
ATOM   929  O O   . TYR A 1 121 ? -4.810  62.736 63.860 1.00 28.78 ? 121  TYR A O   1 
ATOM   930  C CB  . TYR A 1 121 ? -3.024  60.465 64.440 1.00 26.12 ? 121  TYR A CB  1 
ATOM   931  C CG  . TYR A 1 121 ? -2.050  61.294 65.266 1.00 24.64 ? 121  TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 121 ? -2.498  62.363 66.027 1.00 24.46 ? 121  TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 121 ? -0.666  61.065 65.192 1.00 24.19 ? 121  TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 121 ? -1.587  63.232 66.712 1.00 25.66 ? 121  TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 121 ? 0.243   61.898 65.868 1.00 26.05 ? 121  TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 121 ? -0.242  62.993 66.631 1.00 26.76 ? 121  TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 121 ? 0.620   63.846 67.299 1.00 29.10 ? 121  TYR A OH  1 
ATOM   938  N N   . SER A 1 122 ? -3.052  63.460 62.624 1.00 27.82 ? 122  SER A N   1 
ATOM   939  C CA  . SER A 1 122 ? -3.468  64.854 62.740 1.00 28.45 ? 122  SER A CA  1 
ATOM   940  C C   . SER A 1 122 ? -2.915  65.633 61.577 1.00 26.91 ? 122  SER A C   1 
ATOM   941  O O   . SER A 1 122 ? -2.136  65.088 60.757 1.00 24.87 ? 122  SER A O   1 
ATOM   942  C CB  . SER A 1 122 ? -3.012  65.481 64.086 1.00 29.09 ? 122  SER A CB  1 
ATOM   943  O OG  . SER A 1 122 ? -1.619  65.750 64.063 1.00 30.57 ? 122  SER A OG  1 
ATOM   944  N N   . GLY A 1 123 ? -3.330  66.902 61.504 1.00 26.68 ? 123  GLY A N   1 
ATOM   945  C CA  . GLY A 1 123 ? -2.921  67.775 60.400 1.00 26.93 ? 123  GLY A CA  1 
ATOM   946  C C   . GLY A 1 123 ? -4.119  68.530 59.785 1.00 27.33 ? 123  GLY A C   1 
ATOM   947  O O   . GLY A 1 123 ? -5.242  68.016 59.774 1.00 26.83 ? 123  GLY A O   1 
ATOM   948  N N   . SER A 1 124 ? -3.863  69.743 59.300 1.00 25.17 ? 124  SER A N   1 
ATOM   949  C CA  . SER A 1 124 ? -4.868  70.605 58.712 1.00 26.77 ? 124  SER A CA  1 
ATOM   950  C C   . SER A 1 124 ? -4.185  71.354 57.598 1.00 27.77 ? 124  SER A C   1 
ATOM   951  O O   . SER A 1 124 ? -2.992  71.675 57.686 1.00 27.39 ? 124  SER A O   1 
ATOM   952  C CB  . SER A 1 124 ? -5.375  71.628 59.747 1.00 26.47 ? 124  SER A CB  1 
ATOM   953  O OG  . SER A 1 124 ? -5.979  70.967 60.866 1.00 25.32 ? 124  SER A OG  1 
ATOM   954  N N   . SER A 1 125 ? -4.926  71.677 56.550 1.00 28.86 ? 125  SER A N   1 
ATOM   955  C CA  . SER A 1 125 ? -4.295  72.391 55.446 1.00 30.88 ? 125  SER A CA  1 
ATOM   956  C C   . SER A 1 125 ? -4.373  73.890 55.674 1.00 31.72 ? 125  SER A C   1 
ATOM   957  O O   . SER A 1 125 ? -3.863  74.685 54.862 1.00 32.70 ? 125  SER A O   1 
ATOM   958  C CB  . SER A 1 125 ? -5.017  72.075 54.142 1.00 31.00 ? 125  SER A CB  1 
ATOM   959  O OG  . SER A 1 125 ? -6.329  72.625 54.174 1.00 32.14 ? 125  SER A OG  1 
ATOM   960  N N   . THR A 1 126 ? -4.980  74.266 56.791 1.00 31.36 ? 126  THR A N   1 
ATOM   961  C CA  . THR A 1 126 ? -5.269  75.668 57.068 1.00 31.26 ? 126  THR A CA  1 
ATOM   962  C C   . THR A 1 126 ? -4.417  76.327 58.130 1.00 32.41 ? 126  THR A C   1 
ATOM   963  O O   . THR A 1 126 ? -4.680  77.470 58.496 1.00 31.04 ? 126  THR A O   1 
ATOM   964  C CB  . THR A 1 126 ? -6.734  75.777 57.545 1.00 31.32 ? 126  THR A CB  1 
ATOM   965  O OG1 . THR A 1 126 ? -6.888  75.003 58.753 1.00 29.28 ? 126  THR A OG1 1 
ATOM   966  C CG2 . THR A 1 126 ? -7.699  75.199 56.489 1.00 30.80 ? 126  THR A CG2 1 
ATOM   967  N N   . LEU A 1 127 ? -3.433  75.614 58.671 1.00 31.39 ? 127  LEU A N   1 
ATOM   968  C CA  . LEU A 1 127 ? -2.604  76.211 59.718 1.00 32.70 ? 127  LEU A CA  1 
ATOM   969  C C   . LEU A 1 127 ? -1.925  77.517 59.311 1.00 32.43 ? 127  LEU A C   1 
ATOM   970  O O   . LEU A 1 127 ? -1.583  77.705 58.156 1.00 31.99 ? 127  LEU A O   1 
ATOM   971  C CB  . LEU A 1 127 ? -1.514  75.231 60.122 1.00 30.50 ? 127  LEU A CB  1 
ATOM   972  C CG  . LEU A 1 127 ? -2.003  73.838 60.557 1.00 31.47 ? 127  LEU A CG  1 
ATOM   973  C CD1 . LEU A 1 127 ? -0.759  72.973 60.935 1.00 28.87 ? 127  LEU A CD1 1 
ATOM   974  C CD2 . LEU A 1 127 ? -2.971  73.962 61.730 1.00 29.03 ? 127  LEU A CD2 1 
ATOM   975  N N   . ASP A 1 128 ? -1.672  78.409 60.257 1.00 34.53 ? 128  ASP A N   1 
ATOM   976  C CA  . ASP A 1 128 ? -0.962  79.642 59.871 1.00 34.90 ? 128  ASP A CA  1 
ATOM   977  C C   . ASP A 1 128 ? 0.440   79.303 59.303 1.00 34.29 ? 128  ASP A C   1 
ATOM   978  O O   . ASP A 1 128 ? 0.859   79.970 58.346 1.00 35.35 ? 128  ASP A O   1 
ATOM   979  C CB  . ASP A 1 128 ? -0.831  80.665 61.049 1.00 38.06 ? 128  ASP A CB  1 
ATOM   980  C CG  . ASP A 1 128 ? -2.194  81.166 61.582 1.00 40.16 ? 128  ASP A CG  1 
ATOM   981  O OD1 . ASP A 1 128 ? -3.152  81.304 60.797 1.00 41.44 ? 128  ASP A OD1 1 
ATOM   982  O OD2 . ASP A 1 128 ? -2.299  81.440 62.802 1.00 43.16 ? 128  ASP A OD2 1 
ATOM   983  N N   . VAL A 1 129 ? 1.174   78.298 59.825 1.00 32.68 ? 129  VAL A N   1 
ATOM   984  C CA  . VAL A 1 129 ? 2.501   78.046 59.217 1.00 31.61 ? 129  VAL A CA  1 
ATOM   985  C C   . VAL A 1 129 ? 2.339   77.490 57.821 1.00 30.91 ? 129  VAL A C   1 
ATOM   986  O O   . VAL A 1 129 ? 3.354   77.333 57.153 1.00 29.29 ? 129  VAL A O   1 
ATOM   987  C CB  . VAL A 1 129 ? 3.433   76.943 59.853 1.00 33.17 ? 129  VAL A CB  1 
ATOM   988  C CG1 . VAL A 1 129 ? 4.506   77.533 60.669 1.00 32.12 ? 129  VAL A CG1 1 
ATOM   989  C CG2 . VAL A 1 129 ? 2.616   75.910 60.537 1.00 32.01 ? 129  VAL A CG2 1 
ATOM   990  N N   . TYR A 1 130 ? 1.128   77.117 57.384 1.00 29.95 ? 130  TYR A N   1 
ATOM   991  C CA  . TYR A 1 130 ? 0.996   76.593 55.999 1.00 30.97 ? 130  TYR A CA  1 
ATOM   992  C C   . TYR A 1 130 ? 0.395   77.627 55.011 1.00 32.09 ? 130  TYR A C   1 
ATOM   993  O O   . TYR A 1 130 ? -0.003  77.271 53.890 1.00 30.22 ? 130  TYR A O   1 
ATOM   994  C CB  . TYR A 1 130 ? 0.110   75.316 55.943 1.00 29.89 ? 130  TYR A CB  1 
ATOM   995  C CG  . TYR A 1 130 ? 0.604   74.111 56.725 1.00 27.68 ? 130  TYR A CG  1 
ATOM   996  C CD1 . TYR A 1 130 ? 1.963   73.978 57.076 1.00 25.32 ? 130  TYR A CD1 1 
ATOM   997  C CD2 . TYR A 1 130 ? -0.297  73.091 57.115 1.00 27.43 ? 130  TYR A CD2 1 
ATOM   998  C CE1 . TYR A 1 130 ? 2.412   72.860 57.806 1.00 26.70 ? 130  TYR A CE1 1 
ATOM   999  C CE2 . TYR A 1 130 ? 0.131   71.970 57.839 1.00 25.37 ? 130  TYR A CE2 1 
ATOM   1000 C CZ  . TYR A 1 130 ? 1.482   71.857 58.176 1.00 26.65 ? 130  TYR A CZ  1 
ATOM   1001 O OH  . TYR A 1 130 ? 1.935   70.731 58.813 1.00 27.32 ? 130  TYR A OH  1 
ATOM   1002 N N   . ASN A 1 131 ? 0.285   78.883 55.439 1.00 33.26 ? 131  ASN A N   1 
ATOM   1003 C CA  . ASN A 1 131 ? -0.270  79.916 54.569 1.00 33.17 ? 131  ASN A CA  1 
ATOM   1004 C C   . ASN A 1 131 ? 0.613   79.988 53.301 1.00 33.41 ? 131  ASN A C   1 
ATOM   1005 O O   . ASN A 1 131 ? 1.773   80.413 53.349 1.00 34.51 ? 131  ASN A O   1 
ATOM   1006 C CB  . ASN A 1 131 ? -0.289  81.242 55.291 1.00 33.46 ? 131  ASN A CB  1 
ATOM   1007 C CG  . ASN A 1 131 ? -1.117  82.298 54.544 1.00 37.09 ? 131  ASN A CG  1 
ATOM   1008 O OD1 . ASN A 1 131 ? -1.346  82.169 53.329 1.00 33.95 ? 131  ASN A OD1 1 
ATOM   1009 N ND2 . ASN A 1 131 ? -1.566  83.362 55.278 1.00 35.83 ? 131  ASN A ND2 1 
ATOM   1010 N N   . GLY A 1 132 ? 0.062   79.558 52.167 1.00 33.95 ? 132  GLY A N   1 
ATOM   1011 C CA  . GLY A 1 132 ? 0.828   79.520 50.934 1.00 33.56 ? 132  GLY A CA  1 
ATOM   1012 C C   . GLY A 1 132 ? 1.056   80.806 50.164 1.00 34.05 ? 132  GLY A C   1 
ATOM   1013 O O   . GLY A 1 132 ? 1.791   80.784 49.164 1.00 33.71 ? 132  GLY A O   1 
ATOM   1014 N N   . LYS A 1 133 ? 0.485   81.926 50.619 1.00 33.83 ? 133  LYS A N   1 
ATOM   1015 C CA  . LYS A 1 133 ? 0.650   83.164 49.880 1.00 33.78 ? 133  LYS A CA  1 
ATOM   1016 C C   . LYS A 1 133 ? 2.092   83.636 49.781 1.00 34.43 ? 133  LYS A C   1 
ATOM   1017 O O   . LYS A 1 133 ? 2.495   84.095 48.711 1.00 34.88 ? 133  LYS A O   1 
ATOM   1018 C CB  . LYS A 1 133 ? -0.241  84.272 50.465 1.00 35.15 ? 133  LYS A CB  1 
ATOM   1019 C CG  . LYS A 1 133 ? 0.286   84.973 51.732 1.00 33.70 ? 133  LYS A CG  1 
ATOM   1020 C CD  . LYS A 1 133 ? -0.864  85.669 52.494 1.00 33.88 ? 133  LYS A CD  1 
ATOM   1021 C CE  . LYS A 1 133 ? -0.298  86.762 53.398 1.00 35.27 ? 133  LYS A CE  1 
ATOM   1022 N NZ  . LYS A 1 133 ? -1.349  87.466 54.177 1.00 34.25 ? 133  LYS A NZ  1 
ATOM   1023 N N   . TYR A 1 134 ? 2.905   83.481 50.829 1.00 34.31 ? 134  TYR A N   1 
ATOM   1024 C CA  . TYR A 1 134 ? 4.279   83.994 50.731 1.00 35.46 ? 134  TYR A CA  1 
ATOM   1025 C C   . TYR A 1 134 ? 5.119   83.284 49.705 1.00 35.79 ? 134  TYR A C   1 
ATOM   1026 O O   . TYR A 1 134 ? 5.922   83.914 48.995 1.00 37.36 ? 134  TYR A O   1 
ATOM   1027 C CB  . TYR A 1 134 ? 5.013   83.967 52.076 1.00 35.87 ? 134  TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 134 ? 4.205   84.600 53.171 1.00 36.62 ? 134  TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 134 ? 3.527   83.804 54.085 1.00 35.90 ? 134  TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 134 ? 4.083   85.997 53.267 1.00 36.38 ? 134  TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 134 ? 2.742   84.357 55.086 1.00 37.10 ? 134  TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 134 ? 3.277   86.579 54.273 1.00 36.41 ? 134  TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 134 ? 2.615   85.742 55.174 1.00 37.26 ? 134  TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 134 ? 1.813   86.257 56.163 1.00 39.88 ? 134  TYR A OH  1 
ATOM   1035 N N   . LEU A 1 135 ? 4.948   81.974 49.620 1.00 35.22 ? 135  LEU A N   1 
ATOM   1036 C CA  . LEU A 1 135 ? 5.700   81.196 48.666 1.00 33.78 ? 135  LEU A CA  1 
ATOM   1037 C C   . LEU A 1 135 ? 5.150   81.403 47.260 1.00 33.32 ? 135  LEU A C   1 
ATOM   1038 O O   . LEU A 1 135 ? 5.908   81.606 46.324 1.00 32.10 ? 135  LEU A O   1 
ATOM   1039 C CB  . LEU A 1 135 ? 5.626   79.714 49.040 1.00 34.39 ? 135  LEU A CB  1 
ATOM   1040 C CG  . LEU A 1 135 ? 6.420   78.694 48.226 1.00 33.14 ? 135  LEU A CG  1 
ATOM   1041 C CD1 . LEU A 1 135 ? 7.919   79.070 48.162 1.00 30.74 ? 135  LEU A CD1 1 
ATOM   1042 C CD2 . LEU A 1 135 ? 6.237   77.363 48.955 1.00 34.36 ? 135  LEU A CD2 1 
ATOM   1043 N N   . ALA A 1 136 ? 3.833   81.329 47.102 1.00 33.71 ? 136  ALA A N   1 
ATOM   1044 C CA  . ALA A 1 136 ? 3.248   81.514 45.781 1.00 34.06 ? 136  ALA A CA  1 
ATOM   1045 C C   . ALA A 1 136 ? 3.640   82.887 45.262 1.00 35.32 ? 136  ALA A C   1 
ATOM   1046 O O   . ALA A 1 136 ? 4.052   83.041 44.110 1.00 35.98 ? 136  ALA A O   1 
ATOM   1047 C CB  . ALA A 1 136 ? 1.745   81.388 45.851 1.00 33.82 ? 136  ALA A CB  1 
ATOM   1048 N N   . TYR A 1 137 ? 3.562   83.901 46.116 1.00 37.26 ? 137  TYR A N   1 
ATOM   1049 C CA  . TYR A 1 137 ? 3.930   85.243 45.671 1.00 37.10 ? 137  TYR A CA  1 
ATOM   1050 C C   . TYR A 1 137 ? 5.424   85.392 45.373 1.00 36.85 ? 137  TYR A C   1 
ATOM   1051 O O   . TYR A 1 137 ? 5.808   85.759 44.275 1.00 36.14 ? 137  TYR A O   1 
ATOM   1052 C CB  . TYR A 1 137 ? 3.519   86.262 46.711 1.00 37.47 ? 137  TYR A CB  1 
ATOM   1053 C CG  . TYR A 1 137 ? 4.002   87.649 46.421 1.00 40.44 ? 137  TYR A CG  1 
ATOM   1054 C CD1 . TYR A 1 137 ? 5.064   88.214 47.151 1.00 43.22 ? 137  TYR A CD1 1 
ATOM   1055 C CD2 . TYR A 1 137 ? 3.398   88.419 45.422 1.00 41.09 ? 137  TYR A CD2 1 
ATOM   1056 C CE1 . TYR A 1 137 ? 5.510   89.537 46.889 1.00 43.47 ? 137  TYR A CE1 1 
ATOM   1057 C CE2 . TYR A 1 137 ? 3.834   89.711 45.151 1.00 42.96 ? 137  TYR A CE2 1 
ATOM   1058 C CZ  . TYR A 1 137 ? 4.885   90.268 45.885 1.00 44.10 ? 137  TYR A CZ  1 
ATOM   1059 O OH  . TYR A 1 137 ? 5.305   91.558 45.612 1.00 46.82 ? 137  TYR A OH  1 
ATOM   1060 N N   . THR A 1 138 ? 6.270   85.078 46.335 1.00 36.29 ? 138  THR A N   1 
ATOM   1061 C CA  . THR A 1 138 ? 7.699   85.258 46.137 1.00 36.27 ? 138  THR A CA  1 
ATOM   1062 C C   . THR A 1 138 ? 8.351   84.460 45.024 1.00 36.21 ? 138  THR A C   1 
ATOM   1063 O O   . THR A 1 138 ? 9.235   84.985 44.347 1.00 35.61 ? 138  THR A O   1 
ATOM   1064 C CB  . THR A 1 138 ? 8.484   84.980 47.422 1.00 35.51 ? 138  THR A CB  1 
ATOM   1065 O OG1 . THR A 1 138 ? 7.935   85.771 48.481 1.00 33.92 ? 138  THR A OG1 1 
ATOM   1066 C CG2 . THR A 1 138 ? 9.944   85.336 47.231 1.00 34.41 ? 138  THR A CG2 1 
ATOM   1067 N N   . GLU A 1 139 ? 7.931   83.210 44.817 1.00 35.15 ? 139  GLU A N   1 
ATOM   1068 C CA  . GLU A 1 139 ? 8.574   82.403 43.785 1.00 36.00 ? 139  GLU A CA  1 
ATOM   1069 C C   . GLU A 1 139 ? 7.761   82.238 42.500 1.00 37.01 ? 139  GLU A C   1 
ATOM   1070 O O   . GLU A 1 139 ? 8.208   81.552 41.543 1.00 36.64 ? 139  GLU A O   1 
ATOM   1071 C CB  . GLU A 1 139 ? 8.999   81.018 44.358 1.00 35.52 ? 139  GLU A CB  1 
ATOM   1072 C CG  . GLU A 1 139 ? 10.055  81.114 45.475 1.00 32.18 ? 139  GLU A CG  1 
ATOM   1073 C CD  . GLU A 1 139 ? 11.371  81.658 44.964 1.00 31.26 ? 139  GLU A CD  1 
ATOM   1074 O OE1 . GLU A 1 139 ? 11.711  81.355 43.817 1.00 29.93 ? 139  GLU A OE1 1 
ATOM   1075 O OE2 . GLU A 1 139 ? 12.085  82.375 45.697 1.00 32.37 ? 139  GLU A OE2 1 
ATOM   1076 N N   . GLU A 1 140 ? 6.582   82.866 42.460 1.00 37.49 ? 140  GLU A N   1 
ATOM   1077 C CA  . GLU A 1 140 ? 5.719   82.789 41.286 1.00 39.00 ? 140  GLU A CA  1 
ATOM   1078 C C   . GLU A 1 140 ? 5.320   81.378 40.942 1.00 37.42 ? 140  GLU A C   1 
ATOM   1079 O O   . GLU A 1 140 ? 5.496   80.959 39.798 1.00 37.93 ? 140  GLU A O   1 
ATOM   1080 C CB  . GLU A 1 140 ? 6.410   83.383 40.057 1.00 44.41 ? 140  GLU A CB  1 
ATOM   1081 C CG  . GLU A 1 140 ? 5.698   84.586 39.382 1.00 52.81 ? 140  GLU A CG  1 
ATOM   1082 C CD  . GLU A 1 140 ? 6.631   85.836 39.286 1.00 57.65 ? 140  GLU A CD  1 
ATOM   1083 O OE1 . GLU A 1 140 ? 7.711   85.774 38.617 1.00 58.88 ? 140  GLU A OE1 1 
ATOM   1084 O OE2 . GLU A 1 140 ? 6.279   86.878 39.898 1.00 60.28 ? 140  GLU A OE2 1 
ATOM   1085 N N   . VAL A 1 141 ? 4.773   80.647 41.915 1.00 34.41 ? 141  VAL A N   1 
ATOM   1086 C CA  . VAL A 1 141 ? 4.328   79.306 41.643 1.00 32.48 ? 141  VAL A CA  1 
ATOM   1087 C C   . VAL A 1 141 ? 2.851   79.224 42.043 1.00 31.49 ? 141  VAL A C   1 
ATOM   1088 O O   . VAL A 1 141 ? 2.368   80.038 42.825 1.00 29.97 ? 141  VAL A O   1 
ATOM   1089 C CB  . VAL A 1 141 ? 5.145   78.242 42.478 1.00 31.87 ? 141  VAL A CB  1 
ATOM   1090 C CG1 . VAL A 1 141 ? 6.629   78.224 42.089 1.00 31.51 ? 141  VAL A CG1 1 
ATOM   1091 C CG2 . VAL A 1 141 ? 5.034   78.564 43.932 1.00 29.48 ? 141  VAL A CG2 1 
ATOM   1092 N N   . VAL A 1 142 ? 2.131   78.252 41.485 1.00 30.77 ? 142  VAL A N   1 
ATOM   1093 C CA  . VAL A 1 142 ? 0.753   78.038 41.894 1.00 31.84 ? 142  VAL A CA  1 
ATOM   1094 C C   . VAL A 1 142 ? 0.895   77.048 43.080 1.00 32.09 ? 142  VAL A C   1 
ATOM   1095 O O   . VAL A 1 142 ? 1.399   75.924 42.917 1.00 30.77 ? 142  VAL A O   1 
ATOM   1096 C CB  . VAL A 1 142 ? -0.099  77.436 40.751 1.00 30.24 ? 142  VAL A CB  1 
ATOM   1097 C CG1 . VAL A 1 142 ? -1.389  76.943 41.282 1.00 29.81 ? 142  VAL A CG1 1 
ATOM   1098 C CG2 . VAL A 1 142 ? -0.375  78.494 39.702 1.00 29.55 ? 142  VAL A CG2 1 
ATOM   1099 N N   . LEU A 1 143 ? 0.508   77.485 44.276 1.00 31.66 ? 143  LEU A N   1 
ATOM   1100 C CA  . LEU A 1 143 ? 0.656   76.626 45.444 1.00 31.85 ? 143  LEU A CA  1 
ATOM   1101 C C   . LEU A 1 143 ? -0.630  75.960 45.878 1.00 30.59 ? 143  LEU A C   1 
ATOM   1102 O O   . LEU A 1 143 ? -1.629  76.666 46.120 1.00 30.17 ? 143  LEU A O   1 
ATOM   1103 C CB  . LEU A 1 143 ? 1.243   77.430 46.621 1.00 33.41 ? 143  LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 143 ? 1.765   76.471 47.690 1.00 35.29 ? 143  LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 143 ? 3.009   76.972 48.240 1.00 39.32 ? 143  LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 143 ? 0.757   76.298 48.764 1.00 33.99 ? 143  LEU A CD2 1 
ATOM   1107 N N   . VAL A 1 144 ? -0.613  74.625 45.967 1.00 28.65 ? 144  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 144 ? -1.810  73.884 46.391 1.00 28.30 ? 144  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 144 ? -1.566  73.155 47.725 1.00 28.28 ? 144  VAL A C   1 
ATOM   1110 O O   . VAL A 1 144 ? -0.494  72.529 47.903 1.00 28.68 ? 144  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 144 ? -2.220  72.785 45.344 1.00 29.82 ? 144  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 144 ? -3.426  71.987 45.870 1.00 28.80 ? 144  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 144 ? -2.534  73.409 43.961 1.00 28.97 ? 144  VAL A CG2 1 
ATOM   1114 N N   . SER A 1 145 ? -2.494  73.257 48.679 1.00 27.15 ? 145  SER A N   1 
ATOM   1115 C CA  . SER A 1 145 ? -2.358  72.438 49.910 1.00 28.58 ? 145  SER A CA  1 
ATOM   1116 C C   . SER A 1 145 ? -3.586  71.541 49.845 1.00 29.38 ? 145  SER A C   1 
ATOM   1117 O O   . SER A 1 145 ? -4.714  72.023 49.625 1.00 28.24 ? 145  SER A O   1 
ATOM   1118 C CB  . SER A 1 145 ? -2.340  73.255 51.234 1.00 27.54 ? 145  SER A CB  1 
ATOM   1119 O OG  . SER A 1 145 ? -3.419  74.172 51.357 1.00 30.07 ? 145  SER A OG  1 
ATOM   1120 N N   . LEU A 1 146 ? -3.398  70.230 49.989 1.00 30.01 ? 146  LEU A N   1 
ATOM   1121 C CA  . LEU A 1 146 ? -4.564  69.349 49.955 1.00 28.49 ? 146  LEU A CA  1 
ATOM   1122 C C   . LEU A 1 146 ? -4.944  68.895 51.373 1.00 28.41 ? 146  LEU A C   1 
ATOM   1123 O O   . LEU A 1 146 ? -4.421  69.403 52.342 1.00 27.84 ? 146  LEU A O   1 
ATOM   1124 C CB  . LEU A 1 146 ? -4.284  68.157 49.030 1.00 27.31 ? 146  LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 146 ? -3.031  67.285 49.287 1.00 28.16 ? 146  LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 146 ? -3.201  66.475 50.579 1.00 25.77 ? 146  LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 146 ? -2.852  66.314 48.102 1.00 27.23 ? 146  LEU A CD2 1 
ATOM   1128 N N   . SER A 1 147 ? -5.875  67.963 51.501 1.00 28.06 ? 147  SER A N   1 
ATOM   1129 C CA  . SER A 1 147 ? -6.229  67.452 52.817 1.00 27.97 ? 147  SER A CA  1 
ATOM   1130 C C   . SER A 1 147 ? -6.521  65.986 52.584 1.00 27.11 ? 147  SER A C   1 
ATOM   1131 O O   . SER A 1 147 ? -6.609  65.549 51.436 1.00 26.21 ? 147  SER A O   1 
ATOM   1132 C CB  . SER A 1 147 ? -7.473  68.155 53.361 1.00 28.62 ? 147  SER A CB  1 
ATOM   1133 O OG  . SER A 1 147 ? -8.543  67.938 52.453 1.00 33.03 ? 147  SER A OG  1 
ATOM   1134 N N   . TYR A 1 148 ? -6.617  65.230 53.671 1.00 26.73 ? 148  TYR A N   1 
ATOM   1135 C CA  . TYR A 1 148 ? -6.924  63.792 53.628 1.00 26.69 ? 148  TYR A CA  1 
ATOM   1136 C C   . TYR A 1 148 ? -7.301  63.365 55.037 1.00 27.18 ? 148  TYR A C   1 
ATOM   1137 O O   . TYR A 1 148 ? -6.827  63.959 56.038 1.00 27.07 ? 148  TYR A O   1 
ATOM   1138 C CB  . TYR A 1 148 ? -5.726  62.945 53.131 1.00 25.20 ? 148  TYR A CB  1 
ATOM   1139 C CG  . TYR A 1 148 ? -4.447  63.059 53.958 1.00 24.02 ? 148  TYR A CG  1 
ATOM   1140 C CD1 . TYR A 1 148 ? -3.569  64.130 53.775 1.00 23.67 ? 148  TYR A CD1 1 
ATOM   1141 C CD2 . TYR A 1 148 ? -4.133  62.107 54.931 1.00 22.77 ? 148  TYR A CD2 1 
ATOM   1142 C CE1 . TYR A 1 148 ? -2.387  64.258 54.560 1.00 24.02 ? 148  TYR A CE1 1 
ATOM   1143 C CE2 . TYR A 1 148 ? -2.958  62.224 55.726 1.00 23.59 ? 148  TYR A CE2 1 
ATOM   1144 C CZ  . TYR A 1 148 ? -2.098  63.300 55.536 1.00 24.20 ? 148  TYR A CZ  1 
ATOM   1145 O OH  . TYR A 1 148 ? -0.970  63.431 56.360 1.00 24.43 ? 148  TYR A OH  1 
ATOM   1146 N N   . ARG A 1 149 ? -8.159  62.350 55.115 1.00 26.24 ? 149  ARG A N   1 
ATOM   1147 C CA  . ARG A 1 149 ? -8.580  61.822 56.405 1.00 26.72 ? 149  ARG A CA  1 
ATOM   1148 C C   . ARG A 1 149 ? -7.359  61.248 57.174 1.00 26.69 ? 149  ARG A C   1 
ATOM   1149 O O   . ARG A 1 149 ? -6.517  60.557 56.586 1.00 27.59 ? 149  ARG A O   1 
ATOM   1150 C CB  . ARG A 1 149 ? -9.629  60.719 56.207 1.00 25.39 ? 149  ARG A CB  1 
ATOM   1151 C CG  . ARG A 1 149 ? -11.005 61.241 55.726 1.00 29.06 ? 149  ARG A CG  1 
ATOM   1152 C CD  . ARG A 1 149 ? -11.935 60.085 55.320 1.00 28.09 ? 149  ARG A CD  1 
ATOM   1153 N NE  . ARG A 1 149 ? -11.636 59.652 53.949 1.00 30.32 ? 149  ARG A NE  1 
ATOM   1154 C CZ  . ARG A 1 149 ? -12.190 58.591 53.359 1.00 30.00 ? 149  ARG A CZ  1 
ATOM   1155 N NH1 . ARG A 1 149 ? -13.067 57.837 54.037 1.00 27.47 ? 149  ARG A NH1 1 
ATOM   1156 N NH2 . ARG A 1 149 ? -11.914 58.306 52.079 1.00 27.99 ? 149  ARG A NH2 1 
ATOM   1157 N N   . VAL A 1 150 ? -7.301  61.514 58.478 1.00 24.64 ? 150  VAL A N   1 
ATOM   1158 C CA  . VAL A 1 150 ? -6.249  61.007 59.343 1.00 26.26 ? 150  VAL A CA  1 
ATOM   1159 C C   . VAL A 1 150 ? -6.907  60.108 60.419 1.00 27.23 ? 150  VAL A C   1 
ATOM   1160 O O   . VAL A 1 150 ? -8.146  59.995 60.486 1.00 26.50 ? 150  VAL A O   1 
ATOM   1161 C CB  . VAL A 1 150 ? -5.474  62.178 60.012 1.00 24.65 ? 150  VAL A CB  1 
ATOM   1162 C CG1 . VAL A 1 150 ? -4.668  62.935 58.938 1.00 23.09 ? 150  VAL A CG1 1 
ATOM   1163 C CG2 . VAL A 1 150 ? -6.445  63.149 60.716 1.00 24.96 ? 150  VAL A CG2 1 
ATOM   1164 N N   . GLY A 1 151 ? -6.082  59.469 61.245 1.00 28.11 ? 151  GLY A N   1 
ATOM   1165 C CA  . GLY A 1 151 ? -6.600  58.589 62.294 1.00 27.83 ? 151  GLY A CA  1 
ATOM   1166 C C   . GLY A 1 151 ? -7.415  57.414 61.758 1.00 27.57 ? 151  GLY A C   1 
ATOM   1167 O O   . GLY A 1 151 ? -7.257  56.977 60.618 1.00 26.45 ? 151  GLY A O   1 
ATOM   1168 N N   . ALA A 1 152 ? -8.284  56.882 62.596 1.00 28.92 ? 152  ALA A N   1 
ATOM   1169 C CA  . ALA A 1 152 ? -9.138  55.748 62.212 1.00 29.51 ? 152  ALA A CA  1 
ATOM   1170 C C   . ALA A 1 152 ? -9.914  56.103 60.917 1.00 29.45 ? 152  ALA A C   1 
ATOM   1171 O O   . ALA A 1 152 ? -10.039 55.270 60.006 1.00 29.21 ? 152  ALA A O   1 
ATOM   1172 C CB  . ALA A 1 152 ? -10.120 55.405 63.373 1.00 28.43 ? 152  ALA A CB  1 
ATOM   1173 N N   . PHE A 1 153 ? -10.371 57.351 60.805 1.00 28.82 ? 153  PHE A N   1 
ATOM   1174 C CA  . PHE A 1 153 ? -11.129 57.755 59.611 1.00 29.53 ? 153  PHE A CA  1 
ATOM   1175 C C   . PHE A 1 153 ? -10.381 57.578 58.302 1.00 29.04 ? 153  PHE A C   1 
ATOM   1176 O O   . PHE A 1 153 ? -11.000 57.303 57.257 1.00 26.49 ? 153  PHE A O   1 
ATOM   1177 C CB  . PHE A 1 153 ? -11.563 59.204 59.734 1.00 28.63 ? 153  PHE A CB  1 
ATOM   1178 C CG  . PHE A 1 153 ? -12.180 59.517 61.068 1.00 32.22 ? 153  PHE A CG  1 
ATOM   1179 C CD1 . PHE A 1 153 ? -13.541 59.310 61.285 1.00 31.25 ? 153  PHE A CD1 1 
ATOM   1180 C CD2 . PHE A 1 153 ? -11.384 59.963 62.130 1.00 31.88 ? 153  PHE A CD2 1 
ATOM   1181 C CE1 . PHE A 1 153 ? -14.090 59.534 62.532 1.00 33.12 ? 153  PHE A CE1 1 
ATOM   1182 C CE2 . PHE A 1 153 ? -11.929 60.190 63.398 1.00 31.75 ? 153  PHE A CE2 1 
ATOM   1183 C CZ  . PHE A 1 153 ? -13.269 59.978 63.605 1.00 32.42 ? 153  PHE A CZ  1 
ATOM   1184 N N   . GLY A 1 154 ? -9.054  57.734 58.339 1.00 29.49 ? 154  GLY A N   1 
ATOM   1185 C CA  . GLY A 1 154 ? -8.292  57.587 57.109 1.00 28.21 ? 154  GLY A CA  1 
ATOM   1186 C C   . GLY A 1 154 ? -7.516  56.281 56.972 1.00 28.00 ? 154  GLY A C   1 
ATOM   1187 O O   . GLY A 1 154 ? -7.146  55.885 55.873 1.00 28.33 ? 154  GLY A O   1 
ATOM   1188 N N   . PHE A 1 155 ? -7.283  55.591 58.079 1.00 28.37 ? 155  PHE A N   1 
ATOM   1189 C CA  . PHE A 1 155 ? -6.454  54.415 58.009 1.00 27.25 ? 155  PHE A CA  1 
ATOM   1190 C C   . PHE A 1 155 ? -6.901  53.125 58.721 1.00 28.34 ? 155  PHE A C   1 
ATOM   1191 O O   . PHE A 1 155 ? -6.156  52.142 58.777 1.00 27.90 ? 155  PHE A O   1 
ATOM   1192 C CB  . PHE A 1 155 ? -5.056  54.866 58.428 1.00 25.37 ? 155  PHE A CB  1 
ATOM   1193 C CG  . PHE A 1 155 ? -4.461  55.899 57.485 1.00 25.84 ? 155  PHE A CG  1 
ATOM   1194 C CD1 . PHE A 1 155 ? -3.878  55.512 56.275 1.00 24.87 ? 155  PHE A CD1 1 
ATOM   1195 C CD2 . PHE A 1 155 ? -4.587  57.253 57.750 1.00 25.99 ? 155  PHE A CD2 1 
ATOM   1196 C CE1 . PHE A 1 155 ? -3.435  56.448 55.329 1.00 25.89 ? 155  PHE A CE1 1 
ATOM   1197 C CE2 . PHE A 1 155 ? -4.153  58.215 56.822 1.00 25.33 ? 155  PHE A CE2 1 
ATOM   1198 C CZ  . PHE A 1 155 ? -3.573  57.823 55.601 1.00 26.65 ? 155  PHE A CZ  1 
ATOM   1199 N N   . LEU A 1 156 ? -8.112  53.115 59.267 1.00 30.23 ? 156  LEU A N   1 
ATOM   1200 C CA  . LEU A 1 156 ? -8.612  51.897 59.903 1.00 30.82 ? 156  LEU A CA  1 
ATOM   1201 C C   . LEU A 1 156 ? -8.501  50.869 58.767 1.00 31.73 ? 156  LEU A C   1 
ATOM   1202 O O   . LEU A 1 156 ? -8.960  51.126 57.654 1.00 31.81 ? 156  LEU A O   1 
ATOM   1203 C CB  . LEU A 1 156 ? -10.066 52.048 60.315 1.00 30.54 ? 156  LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 156 ? -10.545 50.762 61.006 1.00 32.67 ? 156  LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 156 ? -10.615 50.953 62.495 1.00 30.32 ? 156  LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 156 ? -11.903 50.375 60.474 1.00 33.30 ? 156  LEU A CD2 1 
ATOM   1207 N N   . ALA A 1 157 ? -7.880  49.722 59.031 1.00 31.87 ? 157  ALA A N   1 
ATOM   1208 C CA  . ALA A 1 157 ? -7.679  48.744 57.981 1.00 32.13 ? 157  ALA A CA  1 
ATOM   1209 C C   . ALA A 1 157 ? -8.114  47.304 58.296 1.00 34.61 ? 157  ALA A C   1 
ATOM   1210 O O   . ALA A 1 157 ? -7.496  46.630 59.139 1.00 31.51 ? 157  ALA A O   1 
ATOM   1211 C CB  . ALA A 1 157 ? -6.198  48.750 57.573 1.00 30.57 ? 157  ALA A CB  1 
ATOM   1212 N N   . LEU A 1 158 ? -9.157  46.829 57.601 1.00 35.67 ? 158  LEU A N   1 
ATOM   1213 C CA  . LEU A 1 158 ? -9.612  45.447 57.769 1.00 36.62 ? 158  LEU A CA  1 
ATOM   1214 C C   . LEU A 1 158 ? -9.456  44.828 56.394 1.00 38.29 ? 158  LEU A C   1 
ATOM   1215 O O   . LEU A 1 158 ? -10.435 44.662 55.677 1.00 39.56 ? 158  LEU A O   1 
ATOM   1216 C CB  . LEU A 1 158 ? -11.074 45.408 58.202 1.00 36.02 ? 158  LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 158 ? -11.276 45.826 59.671 1.00 36.77 ? 158  LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 158 ? -12.727 46.118 59.956 1.00 35.74 ? 158  LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 158 ? -10.753 44.728 60.572 1.00 36.37 ? 158  LEU A CD2 1 
ATOM   1220 N N   . HIS A 1 159 ? -8.228  44.504 56.015 1.00 40.16 ? 159  HIS A N   1 
ATOM   1221 C CA  . HIS A 1 159 ? -7.941  43.929 54.693 1.00 42.70 ? 159  HIS A CA  1 
ATOM   1222 C C   . HIS A 1 159 ? -8.893  42.820 54.254 1.00 44.10 ? 159  HIS A C   1 
ATOM   1223 O O   . HIS A 1 159 ? -9.156  41.891 55.012 1.00 44.15 ? 159  HIS A O   1 
ATOM   1224 C CB  . HIS A 1 159 ? -6.523  43.389 54.649 1.00 42.77 ? 159  HIS A CB  1 
ATOM   1225 C CG  . HIS A 1 159 ? -6.064  43.008 53.274 1.00 44.83 ? 159  HIS A CG  1 
ATOM   1226 N ND1 . HIS A 1 159 ? -5.915  43.925 52.251 1.00 44.43 ? 159  HIS A ND1 1 
ATOM   1227 C CD2 . HIS A 1 159 ? -5.669  41.810 52.770 1.00 44.88 ? 159  HIS A CD2 1 
ATOM   1228 C CE1 . HIS A 1 159 ? -5.444  43.310 51.179 1.00 44.65 ? 159  HIS A CE1 1 
ATOM   1229 N NE2 . HIS A 1 159 ? -5.287  42.026 51.468 1.00 43.59 ? 159  HIS A NE2 1 
ATOM   1230 N N   . GLY A 1 160 ? -9.386  42.918 53.013 1.00 45.66 ? 160  GLY A N   1 
ATOM   1231 C CA  . GLY A 1 160 ? -10.325 41.935 52.484 1.00 47.18 ? 160  GLY A CA  1 
ATOM   1232 C C   . GLY A 1 160 ? -11.717 42.533 52.372 1.00 47.93 ? 160  GLY A C   1 
ATOM   1233 O O   . GLY A 1 160 ? -12.501 42.206 51.485 1.00 49.27 ? 160  GLY A O   1 
ATOM   1234 N N   . SER A 1 161 ? -12.019 43.436 53.289 1.00 48.51 ? 161  SER A N   1 
ATOM   1235 C CA  . SER A 1 161 ? -13.292 44.125 53.328 1.00 48.89 ? 161  SER A CA  1 
ATOM   1236 C C   . SER A 1 161 ? -13.226 45.253 52.342 1.00 49.35 ? 161  SER A C   1 
ATOM   1237 O O   . SER A 1 161 ? -12.175 45.863 52.184 1.00 50.53 ? 161  SER A O   1 
ATOM   1238 C CB  . SER A 1 161 ? -13.512 44.746 54.697 1.00 50.52 ? 161  SER A CB  1 
ATOM   1239 O OG  . SER A 1 161 ? -14.654 45.602 54.678 1.00 53.11 ? 161  SER A OG  1 
ATOM   1240 N N   . GLN A 1 162 ? -14.328 45.564 51.687 1.00 48.62 ? 162  GLN A N   1 
ATOM   1241 C CA  . GLN A 1 162 ? -14.291 46.665 50.762 1.00 49.15 ? 162  GLN A CA  1 
ATOM   1242 C C   . GLN A 1 162 ? -14.873 47.870 51.490 1.00 48.08 ? 162  GLN A C   1 
ATOM   1243 O O   . GLN A 1 162 ? -14.812 49.002 50.991 1.00 47.50 ? 162  GLN A O   1 
ATOM   1244 C CB  . GLN A 1 162 ? -15.093 46.372 49.477 1.00 52.77 ? 162  GLN A CB  1 
ATOM   1245 C CG  . GLN A 1 162 ? -14.488 45.302 48.520 1.00 57.61 ? 162  GLN A CG  1 
ATOM   1246 C CD  . GLN A 1 162 ? -13.003 45.552 48.171 1.00 61.21 ? 162  GLN A CD  1 
ATOM   1247 O OE1 . GLN A 1 162 ? -12.583 46.707 47.958 1.00 63.05 ? 162  GLN A OE1 1 
ATOM   1248 N NE2 . GLN A 1 162 ? -12.210 44.468 48.096 1.00 61.87 ? 162  GLN A NE2 1 
ATOM   1249 N N   . GLU A 1 163 ? -15.430 47.621 52.674 1.00 45.97 ? 163  GLU A N   1 
ATOM   1250 C CA  . GLU A 1 163 ? -16.021 48.675 53.491 1.00 45.82 ? 163  GLU A CA  1 
ATOM   1251 C C   . GLU A 1 163 ? -14.995 49.574 54.242 1.00 44.13 ? 163  GLU A C   1 
ATOM   1252 O O   . GLU A 1 163 ? -15.226 50.770 54.394 1.00 43.34 ? 163  GLU A O   1 
ATOM   1253 C CB  . GLU A 1 163 ? -17.034 48.068 54.479 1.00 47.85 ? 163  GLU A CB  1 
ATOM   1254 C CG  . GLU A 1 163 ? -18.299 47.531 53.777 1.00 52.93 ? 163  GLU A CG  1 
ATOM   1255 C CD  . GLU A 1 163 ? -18.895 48.552 52.780 1.00 55.36 ? 163  GLU A CD  1 
ATOM   1256 O OE1 . GLU A 1 163 ? -19.180 48.167 51.610 1.00 58.70 ? 163  GLU A OE1 1 
ATOM   1257 O OE2 . GLU A 1 163 ? -19.067 49.740 53.154 1.00 54.22 ? 163  GLU A OE2 1 
ATOM   1258 N N   . ALA A 1 164 ? -13.876 48.983 54.678 1.00 41.58 ? 164  ALA A N   1 
ATOM   1259 C CA  . ALA A 1 164 ? -12.779 49.668 55.388 1.00 38.22 ? 164  ALA A CA  1 
ATOM   1260 C C   . ALA A 1 164 ? -11.515 48.906 54.958 1.00 35.80 ? 164  ALA A C   1 
ATOM   1261 O O   . ALA A 1 164 ? -10.933 48.136 55.729 1.00 33.44 ? 164  ALA A O   1 
ATOM   1262 C CB  . ALA A 1 164 ? -12.987 49.550 56.898 1.00 36.89 ? 164  ALA A CB  1 
ATOM   1263 N N   . PRO A 1 165 ? -11.070 49.119 53.714 1.00 34.95 ? 165  PRO A N   1 
ATOM   1264 C CA  . PRO A 1 165 ? -9.884  48.421 53.205 1.00 34.54 ? 165  PRO A CA  1 
ATOM   1265 C C   . PRO A 1 165 ? -8.523  48.902 53.692 1.00 34.98 ? 165  PRO A C   1 
ATOM   1266 O O   . PRO A 1 165 ? -7.532  48.162 53.562 1.00 35.87 ? 165  PRO A O   1 
ATOM   1267 C CB  . PRO A 1 165 ? -10.009 48.581 51.687 1.00 33.98 ? 165  PRO A CB  1 
ATOM   1268 C CG  . PRO A 1 165 ? -10.585 49.997 51.554 1.00 35.40 ? 165  PRO A CG  1 
ATOM   1269 C CD  . PRO A 1 165 ? -11.608 50.075 52.726 1.00 35.62 ? 165  PRO A CD  1 
ATOM   1270 N N   . GLY A 1 166 ? -8.476  50.108 54.260 1.00 32.47 ? 166  GLY A N   1 
ATOM   1271 C CA  . GLY A 1 166 ? -7.193  50.666 54.656 1.00 32.06 ? 166  GLY A CA  1 
ATOM   1272 C C   . GLY A 1 166 ? -6.710  51.611 53.534 1.00 33.51 ? 166  GLY A C   1 
ATOM   1273 O O   . GLY A 1 166 ? -7.242  51.583 52.406 1.00 31.54 ? 166  GLY A O   1 
ATOM   1274 N N   . ASN A 1 167 ? -5.758  52.486 53.873 1.00 30.98 ? 167  ASN A N   1 
ATOM   1275 C CA  . ASN A 1 167 ? -5.159  53.426 52.959 1.00 31.07 ? 167  ASN A CA  1 
ATOM   1276 C C   . ASN A 1 167 ? -6.090  54.472 52.330 1.00 30.24 ? 167  ASN A C   1 
ATOM   1277 O O   . ASN A 1 167 ? -5.671  55.167 51.399 1.00 29.59 ? 167  ASN A O   1 
ATOM   1278 C CB  . ASN A 1 167 ? -4.427  52.649 51.841 1.00 30.99 ? 167  ASN A CB  1 
ATOM   1279 C CG  . ASN A 1 167 ? -3.238  51.853 52.374 1.00 32.40 ? 167  ASN A CG  1 
ATOM   1280 O OD1 . ASN A 1 167 ? -2.665  52.206 53.405 1.00 30.83 ? 167  ASN A OD1 1 
ATOM   1281 N ND2 . ASN A 1 167 ? -2.862  50.784 51.682 1.00 30.64 ? 167  ASN A ND2 1 
ATOM   1282 N N   . VAL A 1 168 ? -7.315  54.626 52.828 1.00 28.86 ? 168  VAL A N   1 
ATOM   1283 C CA  . VAL A 1 168 ? -8.179  55.567 52.140 1.00 27.03 ? 168  VAL A CA  1 
ATOM   1284 C C   . VAL A 1 168 ? -7.682  57.022 52.259 1.00 27.87 ? 168  VAL A C   1 
ATOM   1285 O O   . VAL A 1 168 ? -7.902  57.837 51.328 1.00 27.80 ? 168  VAL A O   1 
ATOM   1286 C CB  . VAL A 1 168 ? -9.696  55.354 52.523 1.00 26.78 ? 168  VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 168 ? -10.056 53.796 52.295 1.00 24.75 ? 168  VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 168 ? -10.014 55.826 53.944 1.00 24.76 ? 168  VAL A CG2 1 
ATOM   1289 N N   . GLY A 1 169 ? -6.969  57.331 53.353 1.00 25.91 ? 169  GLY A N   1 
ATOM   1290 C CA  . GLY A 1 169 ? -6.384  58.657 53.491 1.00 24.73 ? 169  GLY A CA  1 
ATOM   1291 C C   . GLY A 1 169 ? -5.348  58.849 52.380 1.00 24.65 ? 169  GLY A C   1 
ATOM   1292 O O   . GLY A 1 169 ? -5.185  59.961 51.883 1.00 23.10 ? 169  GLY A O   1 
ATOM   1293 N N   . LEU A 1 170 ? -4.639  57.784 51.988 1.00 23.84 ? 170  LEU A N   1 
ATOM   1294 C CA  . LEU A 1 170 ? -3.673  57.919 50.889 1.00 25.87 ? 170  LEU A CA  1 
ATOM   1295 C C   . LEU A 1 170 ? -4.477  58.078 49.575 1.00 26.13 ? 170  LEU A C   1 
ATOM   1296 O O   . LEU A 1 170 ? -4.038  58.828 48.686 1.00 24.93 ? 170  LEU A O   1 
ATOM   1297 C CB  . LEU A 1 170 ? -2.715  56.725 50.795 1.00 24.15 ? 170  LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 170 ? -1.591  56.684 51.854 1.00 27.30 ? 170  LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 170 ? -0.945  55.296 51.873 1.00 23.07 ? 170  LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 170 ? -0.491  57.785 51.555 1.00 24.67 ? 170  LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 171 ? -5.605  57.358 49.439 1.00 26.09 ? 171  LEU A N   1 
ATOM   1302 C CA  . LEU A 1 171 ? -6.488  57.516 48.245 1.00 27.67 ? 171  LEU A CA  1 
ATOM   1303 C C   . LEU A 1 171 ? -7.082  58.963 48.238 1.00 26.56 ? 171  LEU A C   1 
ATOM   1304 O O   . LEU A 1 171 ? -7.215  59.542 47.162 1.00 26.36 ? 171  LEU A O   1 
ATOM   1305 C CB  . LEU A 1 171 ? -7.605  56.438 48.188 1.00 27.20 ? 171  LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 171 ? -7.056  54.990 47.999 1.00 28.65 ? 171  LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 171 ? -8.229  53.983 47.996 1.00 27.20 ? 171  LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 171 ? -6.232  54.865 46.695 1.00 24.29 ? 171  LEU A CD2 1 
ATOM   1309 N N   . ASP A 1 172 ? -7.355  59.564 49.414 1.00 27.05 ? 172  ASP A N   1 
ATOM   1310 C CA  . ASP A 1 172 ? -7.820  60.971 49.447 1.00 27.75 ? 172  ASP A CA  1 
ATOM   1311 C C   . ASP A 1 172 ? -6.710  61.867 48.800 1.00 26.83 ? 172  ASP A C   1 
ATOM   1312 O O   . ASP A 1 172 ? -6.967  62.717 47.943 1.00 26.67 ? 172  ASP A O   1 
ATOM   1313 C CB  . ASP A 1 172 ? -8.079  61.479 50.899 1.00 27.34 ? 172  ASP A CB  1 
ATOM   1314 C CG  . ASP A 1 172 ? -9.206  60.764 51.593 1.00 28.61 ? 172  ASP A CG  1 
ATOM   1315 O OD1 . ASP A 1 172 ? -9.959  60.024 50.912 1.00 28.33 ? 172  ASP A OD1 1 
ATOM   1316 O OD2 . ASP A 1 172 ? -9.354  60.931 52.835 1.00 29.64 ? 172  ASP A OD2 1 
ATOM   1317 N N   . GLN A 1 173 ? -5.458  61.664 49.195 1.00 27.12 ? 173  GLN A N   1 
ATOM   1318 C CA  . GLN A 1 173 ? -4.357  62.486 48.648 1.00 26.84 ? 173  GLN A CA  1 
ATOM   1319 C C   . GLN A 1 173 ? -4.266  62.290 47.158 1.00 26.43 ? 173  GLN A C   1 
ATOM   1320 O O   . GLN A 1 173 ? -4.115  63.238 46.384 1.00 26.72 ? 173  GLN A O   1 
ATOM   1321 C CB  . GLN A 1 173 ? -3.002  62.100 49.282 1.00 26.82 ? 173  GLN A CB  1 
ATOM   1322 C CG  . GLN A 1 173 ? -2.892  62.302 50.788 1.00 24.96 ? 173  GLN A CG  1 
ATOM   1323 C CD  . GLN A 1 173 ? -1.554  61.787 51.362 1.00 27.88 ? 173  GLN A CD  1 
ATOM   1324 O OE1 . GLN A 1 173 ? -0.588  61.548 50.620 1.00 27.85 ? 173  GLN A OE1 1 
ATOM   1325 N NE2 . GLN A 1 173 ? -1.488  61.643 52.694 1.00 27.12 ? 173  GLN A NE2 1 
ATOM   1326 N N   . ARG A 1 174 ? -4.349  61.033 46.751 1.00 26.72 ? 174  ARG A N   1 
ATOM   1327 C CA  . ARG A 1 174 ? -4.254  60.724 45.344 1.00 28.32 ? 174  ARG A CA  1 
ATOM   1328 C C   . ARG A 1 174 ? -5.407  61.417 44.554 1.00 28.94 ? 174  ARG A C   1 
ATOM   1329 O O   . ARG A 1 174 ? -5.142  61.944 43.465 1.00 27.21 ? 174  ARG A O   1 
ATOM   1330 C CB  . ARG A 1 174 ? -4.275  59.193 45.093 1.00 27.41 ? 174  ARG A CB  1 
ATOM   1331 C CG  . ARG A 1 174 ? -4.328  58.860 43.590 1.00 29.64 ? 174  ARG A CG  1 
ATOM   1332 C CD  . ARG A 1 174 ? -4.388  57.357 43.334 1.00 31.93 ? 174  ARG A CD  1 
ATOM   1333 N NE  . ARG A 1 174 ? -3.195  56.618 43.791 1.00 30.58 ? 174  ARG A NE  1 
ATOM   1334 C CZ  . ARG A 1 174 ? -3.179  55.287 43.901 1.00 31.87 ? 174  ARG A CZ  1 
ATOM   1335 N NH1 . ARG A 1 174 ? -4.267  54.599 43.610 1.00 30.19 ? 174  ARG A NH1 1 
ATOM   1336 N NH2 . ARG A 1 174 ? -2.080  54.616 44.225 1.00 31.19 ? 174  ARG A NH2 1 
ATOM   1337 N N   . MET A 1 175 ? -6.635  61.426 45.113 1.00 29.55 ? 175  MET A N   1 
ATOM   1338 C CA  . MET A 1 175 ? -7.785  62.056 44.440 1.00 31.20 ? 175  MET A CA  1 
ATOM   1339 C C   . MET A 1 175 ? -7.552  63.563 44.266 1.00 31.09 ? 175  MET A C   1 
ATOM   1340 O O   . MET A 1 175 ? -7.901  64.136 43.228 1.00 30.41 ? 175  MET A O   1 
ATOM   1341 C CB  . MET A 1 175 ? -9.087  61.824 45.205 1.00 31.37 ? 175  MET A CB  1 
ATOM   1342 C CG  . MET A 1 175 ? -10.337 62.263 44.386 1.00 34.58 ? 175  MET A CG  1 
ATOM   1343 S SD  . MET A 1 175 ? -11.629 61.047 44.652 1.00 39.33 ? 175  MET A SD  1 
ATOM   1344 C CE  . MET A 1 175 ? -12.476 61.815 45.468 1.00 36.14 ? 175  MET A CE  1 
ATOM   1345 N N   . ALA A 1 176 ? -6.969  64.197 45.279 1.00 30.11 ? 176  ALA A N   1 
ATOM   1346 C CA  . ALA A 1 176 ? -6.648  65.618 45.181 1.00 29.21 ? 176  ALA A CA  1 
ATOM   1347 C C   . ALA A 1 176 ? -5.542  65.772 44.091 1.00 29.48 ? 176  ALA A C   1 
ATOM   1348 O O   . ALA A 1 176 ? -5.541  66.740 43.312 1.00 27.85 ? 176  ALA A O   1 
ATOM   1349 C CB  . ALA A 1 176 ? -6.155  66.145 46.557 1.00 26.66 ? 176  ALA A CB  1 
ATOM   1350 N N   . LEU A 1 177 ? -4.609  64.813 43.999 1.00 29.67 ? 177  LEU A N   1 
ATOM   1351 C CA  . LEU A 1 177 ? -3.558  64.943 42.969 1.00 28.59 ? 177  LEU A CA  1 
ATOM   1352 C C   . LEU A 1 177 ? -4.185  64.744 41.593 1.00 28.72 ? 177  LEU A C   1 
ATOM   1353 O O   . LEU A 1 177 ? -3.761  65.378 40.621 1.00 27.67 ? 177  LEU A O   1 
ATOM   1354 C CB  . LEU A 1 177 ? -2.408  63.942 43.179 1.00 28.07 ? 177  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1 177 ? -1.562  64.157 44.445 1.00 30.84 ? 177  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1 177 ? -0.595  62.978 44.518 1.00 32.07 ? 177  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1 177 ? -0.815  65.518 44.445 1.00 28.58 ? 177  LEU A CD2 1 
ATOM   1358 N N   . GLN A 1 178 ? -5.196  63.865 41.519 1.00 28.60 ? 178  GLN A N   1 
ATOM   1359 C CA  . GLN A 1 178 ? -5.914  63.603 40.257 1.00 29.74 ? 178  GLN A CA  1 
ATOM   1360 C C   . GLN A 1 178 ? -6.622  64.910 39.872 1.00 28.82 ? 178  GLN A C   1 
ATOM   1361 O O   . GLN A 1 178 ? -6.575  65.351 38.721 1.00 28.39 ? 178  GLN A O   1 
ATOM   1362 C CB  . GLN A 1 178 ? -6.953  62.455 40.436 1.00 30.12 ? 178  GLN A CB  1 
ATOM   1363 C CG  . GLN A 1 178 ? -7.711  62.026 39.159 1.00 30.95 ? 178  GLN A CG  1 
ATOM   1364 C CD  . GLN A 1 178 ? -6.778  61.482 38.089 1.00 33.05 ? 178  GLN A CD  1 
ATOM   1365 O OE1 . GLN A 1 178 ? -6.111  60.454 38.292 1.00 34.44 ? 178  GLN A OE1 1 
ATOM   1366 N NE2 . GLN A 1 178 ? -6.698  62.180 36.950 1.00 31.38 ? 178  GLN A NE2 1 
ATOM   1367 N N   . TRP A 1 179 ? -7.259  65.540 40.853 1.00 27.95 ? 179  TRP A N   1 
ATOM   1368 C CA  . TRP A 1 179 ? -7.941  66.805 40.562 1.00 29.59 ? 179  TRP A CA  1 
ATOM   1369 C C   . TRP A 1 179 ? -6.972  67.924 40.115 1.00 28.81 ? 179  TRP A C   1 
ATOM   1370 O O   . TRP A 1 179 ? -7.277  68.648 39.165 1.00 29.86 ? 179  TRP A O   1 
ATOM   1371 C CB  . TRP A 1 179 ? -8.759  67.256 41.769 1.00 29.41 ? 179  TRP A CB  1 
ATOM   1372 C CG  . TRP A 1 179 ? -9.776  68.280 41.452 1.00 29.74 ? 179  TRP A CG  1 
ATOM   1373 C CD1 . TRP A 1 179 ? -11.081 68.067 41.166 1.00 27.83 ? 179  TRP A CD1 1 
ATOM   1374 C CD2 . TRP A 1 179 ? -9.568  69.709 41.413 1.00 29.33 ? 179  TRP A CD2 1 
ATOM   1375 N NE1 . TRP A 1 179 ? -11.697 69.267 40.960 1.00 29.41 ? 179  TRP A NE1 1 
ATOM   1376 C CE2 . TRP A 1 179 ? -10.796 70.291 41.100 1.00 28.78 ? 179  TRP A CE2 1 
ATOM   1377 C CE3 . TRP A 1 179 ? -8.451  70.540 41.606 1.00 27.90 ? 179  TRP A CE3 1 
ATOM   1378 C CZ2 . TRP A 1 179 ? -10.960 71.694 40.969 1.00 28.28 ? 179  TRP A CZ2 1 
ATOM   1379 C CZ3 . TRP A 1 179 ? -8.617  71.949 41.474 1.00 29.90 ? 179  TRP A CZ3 1 
ATOM   1380 C CH2 . TRP A 1 179 ? -9.852  72.494 41.160 1.00 28.57 ? 179  TRP A CH2 1 
ATOM   1381 N N   . VAL A 1 180 ? -5.815  68.062 40.765 1.00 27.90 ? 180  VAL A N   1 
ATOM   1382 C CA  . VAL A 1 180 ? -4.843  69.079 40.372 1.00 28.38 ? 180  VAL A CA  1 
ATOM   1383 C C   . VAL A 1 180 ? -4.368  68.811 38.915 1.00 31.16 ? 180  VAL A C   1 
ATOM   1384 O O   . VAL A 1 180 ? -4.292  69.697 38.055 1.00 30.65 ? 180  VAL A O   1 
ATOM   1385 C CB  . VAL A 1 180 ? -3.615  69.024 41.296 1.00 28.74 ? 180  VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 180 ? -2.424  69.777 40.682 1.00 28.64 ? 180  VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 180 ? -3.945  69.631 42.634 1.00 28.90 ? 180  VAL A CG2 1 
ATOM   1388 N N   . HIS A 1 181 ? -4.039  67.559 38.651 1.00 30.39 ? 181  HIS A N   1 
ATOM   1389 C CA  . HIS A 1 181 ? -3.595  67.175 37.328 1.00 31.51 ? 181  HIS A CA  1 
ATOM   1390 C C   . HIS A 1 181 ? -4.646  67.538 36.273 1.00 30.91 ? 181  HIS A C   1 
ATOM   1391 O O   . HIS A 1 181 ? -4.286  68.072 35.218 1.00 27.76 ? 181  HIS A O   1 
ATOM   1392 C CB  . HIS A 1 181 ? -3.308  65.663 37.295 1.00 30.77 ? 181  HIS A CB  1 
ATOM   1393 C CG  . HIS A 1 181 ? -3.112  65.123 35.930 1.00 34.68 ? 181  HIS A CG  1 
ATOM   1394 N ND1 . HIS A 1 181 ? -4.141  64.539 35.206 1.00 36.56 ? 181  HIS A ND1 1 
ATOM   1395 C CD2 . HIS A 1 181 ? -2.035  65.143 35.115 1.00 33.25 ? 181  HIS A CD2 1 
ATOM   1396 C CE1 . HIS A 1 181 ? -3.699  64.229 34.003 1.00 36.58 ? 181  HIS A CE1 1 
ATOM   1397 N NE2 . HIS A 1 181 ? -2.427  64.587 33.922 1.00 36.76 ? 181  HIS A NE2 1 
ATOM   1398 N N   . ASP A 1 182 ? -5.914  67.223 36.569 1.00 29.51 ? 182  ASP A N   1 
ATOM   1399 C CA  . ASP A 1 182 ? -7.006  67.477 35.635 1.00 30.95 ? 182  ASP A CA  1 
ATOM   1400 C C   . ASP A 1 182 ? -7.488  68.954 35.536 1.00 31.23 ? 182  ASP A C   1 
ATOM   1401 O O   . ASP A 1 182 ? -8.044  69.358 34.510 1.00 30.83 ? 182  ASP A O   1 
ATOM   1402 C CB  . ASP A 1 182 ? -8.233  66.617 35.972 1.00 29.80 ? 182  ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 182 ? -8.034  65.134 35.708 1.00 31.86 ? 182  ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 182 ? -7.275  64.706 34.815 1.00 33.76 ? 182  ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 182 ? -8.693  64.364 36.395 1.00 33.65 ? 182  ASP A OD2 1 
ATOM   1406 N N   . ASN A 1 183 ? -7.249  69.758 36.557 1.00 30.48 ? 183  ASN A N   1 
ATOM   1407 C CA  . ASN A 1 183 ? -7.787  71.125 36.563 1.00 30.66 ? 183  ASN A CA  1 
ATOM   1408 C C   . ASN A 1 183 ? -6.870  72.287 36.803 1.00 30.85 ? 183  ASN A C   1 
ATOM   1409 O O   . ASN A 1 183 ? -7.276  73.427 36.563 1.00 30.08 ? 183  ASN A O   1 
ATOM   1410 C CB  . ASN A 1 183 ? -8.874  71.208 37.624 1.00 28.40 ? 183  ASN A CB  1 
ATOM   1411 C CG  . ASN A 1 183 ? -10.057 70.402 37.262 1.00 32.31 ? 183  ASN A CG  1 
ATOM   1412 O OD1 . ASN A 1 183 ? -10.864 70.825 36.418 1.00 31.06 ? 183  ASN A OD1 1 
ATOM   1413 N ND2 . ASN A 1 183 ? -10.181 69.202 37.862 1.00 30.92 ? 183  ASN A ND2 1 
ATOM   1414 N N   . ILE A 1 184 ? -5.660  72.024 37.308 1.00 31.34 ? 184  ILE A N   1 
ATOM   1415 C CA  . ILE A 1 184 ? -4.735  73.116 37.616 1.00 30.59 ? 184  ILE A CA  1 
ATOM   1416 C C   . ILE A 1 184 ? -4.410  74.047 36.428 1.00 30.66 ? 184  ILE A C   1 
ATOM   1417 O O   . ILE A 1 184 ? -4.138  75.235 36.665 1.00 31.47 ? 184  ILE A O   1 
ATOM   1418 C CB  . ILE A 1 184 ? -3.419  72.599 38.291 1.00 28.77 ? 184  ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 184 ? -2.856  73.687 39.236 1.00 26.72 ? 184  ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 184 ? -2.385  72.207 37.239 1.00 27.26 ? 184  ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 184 ? -3.805  74.014 40.465 1.00 25.34 ? 184  ILE A CD1 1 
ATOM   1422 N N   . GLN A 1 185 ? -4.488  73.552 35.181 1.00 29.84 ? 185  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 185 ? -4.198  74.392 33.999 1.00 30.63 ? 185  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 185 ? -5.139  75.600 33.943 1.00 30.23 ? 185  GLN A C   1 
ATOM   1425 O O   . GLN A 1 185 ? -4.731  76.685 33.513 1.00 29.58 ? 185  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 185 ? -4.318  73.614 32.673 1.00 28.26 ? 185  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 185 ? -5.721  73.188 32.347 1.00 31.37 ? 185  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 185 ? -5.815  72.049 31.319 1.00 33.36 ? 185  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 185 ? -5.655  70.855 31.659 1.00 33.50 ? 185  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 185 ? -6.078  72.407 30.058 1.00 31.72 ? 185  GLN A NE2 1 
ATOM   1431 N N   . PHE A 1 186 ? -6.369  75.424 34.404 1.00 30.83 ? 186  PHE A N   1 
ATOM   1432 C CA  . PHE A 1 186 ? -7.345  76.544 34.386 1.00 32.82 ? 186  PHE A CA  1 
ATOM   1433 C C   . PHE A 1 186 ? -6.987  77.674 35.362 1.00 34.01 ? 186  PHE A C   1 
ATOM   1434 O O   . PHE A 1 186 ? -7.468  78.803 35.221 1.00 35.33 ? 186  PHE A O   1 
ATOM   1435 C CB  . PHE A 1 186 ? -8.738  76.000 34.677 1.00 30.92 ? 186  PHE A CB  1 
ATOM   1436 C CG  . PHE A 1 186 ? -9.131  74.915 33.722 1.00 32.06 ? 186  PHE A CG  1 
ATOM   1437 C CD1 . PHE A 1 186 ? -9.070  75.158 32.327 1.00 30.15 ? 186  PHE A CD1 1 
ATOM   1438 C CD2 . PHE A 1 186 ? -9.432  73.621 34.185 1.00 29.49 ? 186  PHE A CD2 1 
ATOM   1439 C CE1 . PHE A 1 186 ? -9.287  74.123 31.394 1.00 31.15 ? 186  PHE A CE1 1 
ATOM   1440 C CE2 . PHE A 1 186 ? -9.652  72.567 33.251 1.00 32.73 ? 186  PHE A CE2 1 
ATOM   1441 C CZ  . PHE A 1 186 ? -9.575  72.828 31.850 1.00 30.39 ? 186  PHE A CZ  1 
ATOM   1442 N N   . PHE A 1 187 ? -6.114  77.357 36.330 1.00 32.89 ? 187  PHE A N   1 
ATOM   1443 C CA  . PHE A 1 187 ? -5.662  78.313 37.325 1.00 31.25 ? 187  PHE A CA  1 
ATOM   1444 C C   . PHE A 1 187 ? -4.328  78.883 36.937 1.00 30.78 ? 187  PHE A C   1 
ATOM   1445 O O   . PHE A 1 187 ? -3.773  79.686 37.660 1.00 30.47 ? 187  PHE A O   1 
ATOM   1446 C CB  . PHE A 1 187 ? -5.534  77.669 38.687 1.00 28.69 ? 187  PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 187 ? -6.836  77.232 39.247 1.00 29.33 ? 187  PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 187 ? -7.377  75.980 38.918 1.00 27.05 ? 187  PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 187 ? -7.545  78.070 40.127 1.00 29.26 ? 187  PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 187 ? -8.573  75.568 39.439 1.00 26.08 ? 187  PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 187 ? -8.754  77.665 40.665 1.00 29.23 ? 187  PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 187 ? -9.276  76.404 40.320 1.00 28.20 ? 187  PHE A CZ  1 
ATOM   1453 N N   . GLY A 1 188 ? -3.826  78.483 35.775 1.00 31.35 ? 188  GLY A N   1 
ATOM   1454 C CA  . GLY A 1 188 ? -2.526  78.980 35.333 1.00 30.48 ? 188  GLY A CA  1 
ATOM   1455 C C   . GLY A 1 188 ? -1.360  78.032 35.644 1.00 30.91 ? 188  GLY A C   1 
ATOM   1456 O O   . GLY A 1 188 ? -0.207  78.327 35.312 1.00 30.57 ? 188  GLY A O   1 
ATOM   1457 N N   . GLY A 1 189 ? -1.649  76.894 36.286 1.00 31.02 ? 189  GLY A N   1 
ATOM   1458 C CA  . GLY A 1 189 ? -0.593  75.945 36.618 1.00 31.29 ? 189  GLY A CA  1 
ATOM   1459 C C   . GLY A 1 189 ? -0.277  74.982 35.488 1.00 31.22 ? 189  GLY A C   1 
ATOM   1460 O O   . GLY A 1 189 ? -1.135  74.678 34.677 1.00 32.99 ? 189  GLY A O   1 
ATOM   1461 N N   . ASP A 1 190 ? 0.954   74.505 35.440 1.00 30.98 ? 190  ASP A N   1 
ATOM   1462 C CA  . ASP A 1 190 ? 1.408   73.587 34.423 1.00 30.75 ? 190  ASP A CA  1 
ATOM   1463 C C   . ASP A 1 190 ? 1.197   72.132 34.923 1.00 31.23 ? 190  ASP A C   1 
ATOM   1464 O O   . ASP A 1 190 ? 1.924   71.669 35.781 1.00 31.90 ? 190  ASP A O   1 
ATOM   1465 C CB  . ASP A 1 190 ? 2.886   73.876 34.127 1.00 30.37 ? 190  ASP A CB  1 
ATOM   1466 C CG  . ASP A 1 190 ? 3.472   72.955 33.059 1.00 30.32 ? 190  ASP A CG  1 
ATOM   1467 O OD1 . ASP A 1 190 ? 2.692   72.201 32.429 1.00 30.13 ? 190  ASP A OD1 1 
ATOM   1468 O OD2 . ASP A 1 190 ? 4.706   72.982 32.851 1.00 29.14 ? 190  ASP A OD2 1 
ATOM   1469 N N   . PRO A 1 191 ? 0.225   71.390 34.360 1.00 29.54 ? 191  PRO A N   1 
ATOM   1470 C CA  . PRO A 1 191 ? 0.052   70.037 34.869 1.00 30.37 ? 191  PRO A CA  1 
ATOM   1471 C C   . PRO A 1 191 ? 1.267   69.162 34.616 1.00 31.29 ? 191  PRO A C   1 
ATOM   1472 O O   . PRO A 1 191 ? 1.423   68.122 35.246 1.00 31.47 ? 191  PRO A O   1 
ATOM   1473 C CB  . PRO A 1 191 ? -1.222  69.541 34.154 1.00 30.39 ? 191  PRO A CB  1 
ATOM   1474 C CG  . PRO A 1 191 ? -1.166  70.309 32.825 1.00 29.23 ? 191  PRO A CG  1 
ATOM   1475 C CD  . PRO A 1 191 ? -0.730  71.684 33.282 1.00 30.59 ? 191  PRO A CD  1 
ATOM   1476 N N   . LYS A 1 192 ? 2.149   69.546 33.706 1.00 32.41 ? 192  LYS A N   1 
ATOM   1477 C CA  . LYS A 1 192 ? 3.305   68.675 33.547 1.00 32.93 ? 192  LYS A CA  1 
ATOM   1478 C C   . LYS A 1 192 ? 4.486   68.999 34.438 1.00 31.85 ? 192  LYS A C   1 
ATOM   1479 O O   . LYS A 1 192 ? 5.531   68.332 34.369 1.00 31.33 ? 192  LYS A O   1 
ATOM   1480 C CB  . LYS A 1 192 ? 3.760   68.545 32.098 1.00 33.30 ? 192  LYS A CB  1 
ATOM   1481 C CG  . LYS A 1 192 ? 4.031   69.772 31.402 1.00 34.30 ? 192  LYS A CG  1 
ATOM   1482 C CD  . LYS A 1 192 ? 3.640   69.588 29.893 1.00 33.92 ? 192  LYS A CD  1 
ATOM   1483 C CE  . LYS A 1 192 ? 4.017   70.872 29.158 1.00 32.25 ? 192  LYS A CE  1 
ATOM   1484 N NZ  . LYS A 1 192 ? 3.333   72.075 29.812 1.00 32.97 ? 192  LYS A NZ  1 
ATOM   1485 N N   . THR A 1 193 ? 4.308   69.969 35.320 1.00 28.87 ? 193  THR A N   1 
ATOM   1486 C CA  . THR A 1 193 ? 5.381   70.318 36.201 1.00 29.98 ? 193  THR A CA  1 
ATOM   1487 C C   . THR A 1 193 ? 4.882   70.470 37.647 1.00 29.18 ? 193  THR A C   1 
ATOM   1488 O O   . THR A 1 193 ? 5.049   71.527 38.258 1.00 26.82 ? 193  THR A O   1 
ATOM   1489 C CB  . THR A 1 193 ? 6.088   71.616 35.714 1.00 30.50 ? 193  THR A CB  1 
ATOM   1490 O OG1 . THR A 1 193 ? 6.377   71.500 34.306 1.00 32.35 ? 193  THR A OG1 1 
ATOM   1491 C CG2 . THR A 1 193 ? 7.391   71.797 36.420 1.00 29.71 ? 193  THR A CG2 1 
ATOM   1492 N N   . VAL A 1 194 ? 4.239   69.415 38.167 1.00 28.54 ? 194  VAL A N   1 
ATOM   1493 C CA  . VAL A 1 194 ? 3.779   69.465 39.544 1.00 29.03 ? 194  VAL A CA  1 
ATOM   1494 C C   . VAL A 1 194 ? 4.714   68.722 40.505 1.00 28.56 ? 194  VAL A C   1 
ATOM   1495 O O   . VAL A 1 194 ? 5.112   67.570 40.272 1.00 28.34 ? 194  VAL A O   1 
ATOM   1496 C CB  . VAL A 1 194 ? 2.298   68.996 39.678 1.00 29.97 ? 194  VAL A CB  1 
ATOM   1497 C CG1 . VAL A 1 194 ? 2.014   67.930 38.776 1.00 32.39 ? 194  VAL A CG1 1 
ATOM   1498 C CG2 . VAL A 1 194 ? 1.979   68.575 41.082 1.00 28.65 ? 194  VAL A CG2 1 
ATOM   1499 N N   . THR A 1 195 ? 5.108   69.425 41.564 1.00 28.73 ? 195  THR A N   1 
ATOM   1500 C CA  . THR A 1 195 ? 5.962   68.850 42.604 1.00 27.00 ? 195  THR A CA  1 
ATOM   1501 C C   . THR A 1 195 ? 5.121   68.595 43.858 1.00 26.75 ? 195  THR A C   1 
ATOM   1502 O O   . THR A 1 195 ? 4.421   69.516 44.330 1.00 26.91 ? 195  THR A O   1 
ATOM   1503 C CB  . THR A 1 195 ? 7.098   69.803 42.988 1.00 24.72 ? 195  THR A CB  1 
ATOM   1504 O OG1 . THR A 1 195 ? 7.992   69.914 41.886 1.00 26.69 ? 195  THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 195 ? 7.908   69.264 44.205 1.00 24.14 ? 195  THR A CG2 1 
ATOM   1506 N N   . ILE A 1 196 ? 5.141   67.368 44.378 1.00 24.08 ? 196  ILE A N   1 
ATOM   1507 C CA  . ILE A 1 196 ? 4.434   67.137 45.626 1.00 23.64 ? 196  ILE A CA  1 
ATOM   1508 C C   . ILE A 1 196 ? 5.499   67.269 46.720 1.00 24.32 ? 196  ILE A C   1 
ATOM   1509 O O   . ILE A 1 196 ? 6.635   66.846 46.532 1.00 23.19 ? 196  ILE A O   1 
ATOM   1510 C CB  . ILE A 1 196 ? 3.746   65.756 45.639 1.00 23.38 ? 196  ILE A CB  1 
ATOM   1511 C CG1 . ILE A 1 196 ? 4.730   64.607 45.340 1.00 21.51 ? 196  ILE A CG1 1 
ATOM   1512 C CG2 . ILE A 1 196 ? 2.677   65.724 44.534 1.00 21.86 ? 196  ILE A CG2 1 
ATOM   1513 C CD1 . ILE A 1 196 ? 4.050   63.235 45.568 1.00 22.39 ? 196  ILE A CD1 1 
ATOM   1514 N N   . PHE A 1 197 ? 5.172   67.917 47.827 1.00 25.53 ? 197  PHE A N   1 
ATOM   1515 C CA  . PHE A 1 197 ? 6.124   68.042 48.928 1.00 26.36 ? 197  PHE A CA  1 
ATOM   1516 C C   . PHE A 1 197 ? 5.374   67.965 50.253 1.00 26.25 ? 197  PHE A C   1 
ATOM   1517 O O   . PHE A 1 197 ? 4.218   68.315 50.329 1.00 28.18 ? 197  PHE A O   1 
ATOM   1518 C CB  . PHE A 1 197 ? 7.019   69.308 48.796 1.00 25.52 ? 197  PHE A CB  1 
ATOM   1519 C CG  . PHE A 1 197 ? 6.333   70.646 49.060 1.00 27.01 ? 197  PHE A CG  1 
ATOM   1520 C CD1 . PHE A 1 197 ? 5.189   71.034 48.363 1.00 26.51 ? 197  PHE A CD1 1 
ATOM   1521 C CD2 . PHE A 1 197 ? 6.915   71.573 49.961 1.00 26.67 ? 197  PHE A CD2 1 
ATOM   1522 C CE1 . PHE A 1 197 ? 4.626   72.346 48.555 1.00 26.19 ? 197  PHE A CE1 1 
ATOM   1523 C CE2 . PHE A 1 197 ? 6.366   72.881 50.165 1.00 25.40 ? 197  PHE A CE2 1 
ATOM   1524 C CZ  . PHE A 1 197 ? 5.221   73.266 49.462 1.00 23.33 ? 197  PHE A CZ  1 
ATOM   1525 N N   . GLY A 1 198 ? 6.003   67.423 51.282 1.00 26.79 ? 198  GLY A N   1 
ATOM   1526 C CA  . GLY A 1 198 ? 5.352   67.289 52.573 1.00 25.48 ? 198  GLY A CA  1 
ATOM   1527 C C   . GLY A 1 198 ? 6.379   67.027 53.657 1.00 24.82 ? 198  GLY A C   1 
ATOM   1528 O O   . GLY A 1 198 ? 7.515   66.657 53.338 1.00 24.55 ? 198  GLY A O   1 
ATOM   1529 N N   . GLU A 1 199 ? 5.996   67.228 54.924 1.00 24.25 ? 199  GLU A N   1 
ATOM   1530 C CA  . GLU A 1 199 ? 6.897   67.018 56.041 1.00 24.83 ? 199  GLU A CA  1 
ATOM   1531 C C   . GLU A 1 199 ? 6.347   65.940 56.962 1.00 24.49 ? 199  GLU A C   1 
ATOM   1532 O O   . GLU A 1 199 ? 5.142   65.783 57.068 1.00 24.32 ? 199  GLU A O   1 
ATOM   1533 C CB  . GLU A 1 199 ? 7.104   68.340 56.814 1.00 23.65 ? 199  GLU A CB  1 
ATOM   1534 C CG  . GLU A 1 199 ? 8.139   68.266 57.925 1.00 22.53 ? 199  GLU A CG  1 
ATOM   1535 C CD  . GLU A 1 199 ? 7.517   67.925 59.281 1.00 25.35 ? 199  GLU A CD  1 
ATOM   1536 O OE1 . GLU A 1 199 ? 6.275   67.815 59.353 1.00 25.03 ? 199  GLU A OE1 1 
ATOM   1537 O OE2 . GLU A 1 199 ? 8.251   67.767 60.287 1.00 24.03 ? 199  GLU A OE2 1 
ATOM   1538 N N   . SER A 1 200 ? 7.248   65.226 57.644 1.00 24.43 ? 200  SER A N   1 
ATOM   1539 C CA  . SER A 1 200 ? 6.896   64.135 58.580 1.00 25.69 ? 200  SER A CA  1 
ATOM   1540 C C   . SER A 1 200 ? 5.999   63.095 57.859 1.00 22.92 ? 200  SER A C   1 
ATOM   1541 O O   . SER A 1 200 ? 6.412   62.563 56.854 1.00 21.39 ? 200  SER A O   1 
ATOM   1542 C CB  . SER A 1 200 ? 6.210   64.705 59.841 1.00 26.39 ? 200  SER A CB  1 
ATOM   1543 O OG  . SER A 1 200 ? 6.223   63.726 60.889 1.00 28.66 ? 200  SER A OG  1 
ATOM   1544 N N   . ALA A 1 201 ? 4.793   62.811 58.338 1.00 22.87 ? 201  ALA A N   1 
ATOM   1545 C CA  . ALA A 1 201 ? 3.911   61.855 57.626 1.00 24.27 ? 201  ALA A CA  1 
ATOM   1546 C C   . ALA A 1 201 ? 3.662   62.313 56.184 1.00 23.45 ? 201  ALA A C   1 
ATOM   1547 O O   . ALA A 1 201 ? 3.314   61.507 55.312 1.00 23.33 ? 201  ALA A O   1 
ATOM   1548 C CB  . ALA A 1 201 ? 2.544   61.715 58.367 1.00 25.50 ? 201  ALA A CB  1 
ATOM   1549 N N   . GLY A 1 202 ? 3.838   63.616 55.946 1.00 23.04 ? 202  GLY A N   1 
ATOM   1550 C CA  . GLY A 1 202 ? 3.640   64.163 54.610 1.00 24.12 ? 202  GLY A CA  1 
ATOM   1551 C C   . GLY A 1 202 ? 4.823   63.806 53.723 1.00 25.08 ? 202  GLY A C   1 
ATOM   1552 O O   . GLY A 1 202 ? 4.680   63.645 52.486 1.00 25.80 ? 202  GLY A O   1 
ATOM   1553 N N   . GLY A 1 203 ? 5.997   63.711 54.351 1.00 24.49 ? 203  GLY A N   1 
ATOM   1554 C CA  . GLY A 1 203 ? 7.197   63.320 53.626 1.00 25.55 ? 203  GLY A CA  1 
ATOM   1555 C C   . GLY A 1 203 ? 7.076   61.818 53.322 1.00 26.52 ? 203  GLY A C   1 
ATOM   1556 O O   . GLY A 1 203 ? 7.415   61.352 52.219 1.00 28.31 ? 203  GLY A O   1 
ATOM   1557 N N   . ALA A 1 204 ? 6.572   61.043 54.278 1.00 26.49 ? 204  ALA A N   1 
ATOM   1558 C CA  . ALA A 1 204 ? 6.394   59.612 54.066 1.00 25.96 ? 204  ALA A CA  1 
ATOM   1559 C C   . ALA A 1 204 ? 5.353   59.429 52.927 1.00 26.98 ? 204  ALA A C   1 
ATOM   1560 O O   . ALA A 1 204 ? 5.556   58.594 52.022 1.00 26.88 ? 204  ALA A O   1 
ATOM   1561 C CB  . ALA A 1 204 ? 5.902   58.924 55.357 1.00 23.81 ? 204  ALA A CB  1 
ATOM   1562 N N   . SER A 1 205 ? 4.249   60.191 52.984 1.00 25.35 ? 205  SER A N   1 
ATOM   1563 C CA  . SER A 1 205 ? 3.197   60.113 51.949 1.00 25.28 ? 205  SER A CA  1 
ATOM   1564 C C   . SER A 1 205 ? 3.797   60.383 50.545 1.00 24.87 ? 205  SER A C   1 
ATOM   1565 O O   . SER A 1 205 ? 3.480   59.643 49.585 1.00 23.79 ? 205  SER A O   1 
ATOM   1566 C CB  . SER A 1 205 ? 2.070   61.152 52.202 1.00 23.94 ? 205  SER A CB  1 
ATOM   1567 O OG  . SER A 1 205 ? 1.279   60.875 53.364 1.00 20.95 ? 205  SER A OG  1 
ATOM   1568 N N   . VAL A 1 206 ? 4.629   61.445 50.426 1.00 22.72 ? 206  VAL A N   1 
ATOM   1569 C CA  . VAL A 1 206 ? 5.244   61.790 49.151 1.00 23.55 ? 206  VAL A CA  1 
ATOM   1570 C C   . VAL A 1 206 ? 6.023   60.561 48.656 1.00 25.99 ? 206  VAL A C   1 
ATOM   1571 O O   . VAL A 1 206 ? 5.894   60.184 47.494 1.00 28.07 ? 206  VAL A O   1 
ATOM   1572 C CB  . VAL A 1 206 ? 6.226   63.046 49.249 1.00 24.34 ? 206  VAL A CB  1 
ATOM   1573 C CG1 . VAL A 1 206 ? 7.066   63.188 47.949 1.00 22.10 ? 206  VAL A CG1 1 
ATOM   1574 C CG2 . VAL A 1 206 ? 5.424   64.338 49.496 1.00 24.27 ? 206  VAL A CG2 1 
ATOM   1575 N N   . GLY A 1 207 ? 6.803   59.920 49.529 1.00 24.92 ? 207  GLY A N   1 
ATOM   1576 C CA  . GLY A 1 207 ? 7.541   58.744 49.099 1.00 23.32 ? 207  GLY A CA  1 
ATOM   1577 C C   . GLY A 1 207 ? 6.596   57.609 48.740 1.00 25.85 ? 207  GLY A C   1 
ATOM   1578 O O   . GLY A 1 207 ? 6.913   56.784 47.880 1.00 25.43 ? 207  GLY A O   1 
ATOM   1579 N N   . MET A 1 208 ? 5.427   57.559 49.389 1.00 24.97 ? 208  MET A N   1 
ATOM   1580 C CA  . MET A 1 208 ? 4.467   56.517 49.080 1.00 26.25 ? 208  MET A CA  1 
ATOM   1581 C C   . MET A 1 208 ? 3.856   56.703 47.677 1.00 25.14 ? 208  MET A C   1 
ATOM   1582 O O   . MET A 1 208 ? 3.516   55.710 47.022 1.00 25.47 ? 208  MET A O   1 
ATOM   1583 C CB  . MET A 1 208 ? 3.378   56.395 50.189 1.00 23.65 ? 208  MET A CB  1 
ATOM   1584 C CG  . MET A 1 208 ? 3.946   55.795 51.506 1.00 24.56 ? 208  MET A CG  1 
ATOM   1585 S SD  . MET A 1 208 ? 2.890   55.982 52.972 1.00 26.20 ? 208  MET A SD  1 
ATOM   1586 C CE  . MET A 1 208 ? 3.832   54.962 54.143 1.00 27.47 ? 208  MET A CE  1 
ATOM   1587 N N   . HIS A 1 209 ? 3.734   57.943 47.203 1.00 25.18 ? 209  HIS A N   1 
ATOM   1588 C CA  . HIS A 1 209 ? 3.157   58.145 45.852 1.00 25.46 ? 209  HIS A CA  1 
ATOM   1589 C C   . HIS A 1 209 ? 4.243   57.901 44.823 1.00 25.68 ? 209  HIS A C   1 
ATOM   1590 O O   . HIS A 1 209 ? 3.941   57.595 43.664 1.00 26.56 ? 209  HIS A O   1 
ATOM   1591 C CB  . HIS A 1 209 ? 2.586   59.548 45.669 1.00 24.45 ? 209  HIS A CB  1 
ATOM   1592 C CG  . HIS A 1 209 ? 1.387   59.814 46.515 1.00 26.56 ? 209  HIS A CG  1 
ATOM   1593 N ND1 . HIS A 1 209 ? 0.203   59.129 46.357 1.00 27.18 ? 209  HIS A ND1 1 
ATOM   1594 C CD2 . HIS A 1 209 ? 1.208   60.641 47.575 1.00 25.77 ? 209  HIS A CD2 1 
ATOM   1595 C CE1 . HIS A 1 209 ? -0.657  59.519 47.285 1.00 27.90 ? 209  HIS A CE1 1 
ATOM   1596 N NE2 . HIS A 1 209 ? -0.069  60.434 48.040 1.00 26.71 ? 209  HIS A NE2 1 
ATOM   1597 N N   . ILE A 1 210 ? 5.499   58.077 45.228 1.00 25.41 ? 210  ILE A N   1 
ATOM   1598 C CA  . ILE A 1 210 ? 6.616   57.773 44.338 1.00 25.18 ? 210  ILE A CA  1 
ATOM   1599 C C   . ILE A 1 210 ? 6.614   56.240 44.143 1.00 26.36 ? 210  ILE A C   1 
ATOM   1600 O O   . ILE A 1 210 ? 6.833   55.735 43.036 1.00 26.88 ? 210  ILE A O   1 
ATOM   1601 C CB  . ILE A 1 210 ? 7.962   58.204 44.975 1.00 25.26 ? 210  ILE A CB  1 
ATOM   1602 C CG1 . ILE A 1 210 ? 8.183   59.699 44.751 1.00 24.39 ? 210  ILE A CG1 1 
ATOM   1603 C CG2 . ILE A 1 210 ? 9.136   57.420 44.356 1.00 24.37 ? 210  ILE A CG2 1 
ATOM   1604 C CD1 . ILE A 1 210 ? 9.223   60.226 45.664 1.00 27.43 ? 210  ILE A CD1 1 
ATOM   1605 N N   . LEU A 1 211 ? 6.329   55.499 45.208 1.00 25.48 ? 211  LEU A N   1 
ATOM   1606 C CA  . LEU A 1 211 ? 6.320   54.034 45.128 1.00 27.37 ? 211  LEU A CA  1 
ATOM   1607 C C   . LEU A 1 211 ? 5.076   53.453 44.454 1.00 27.17 ? 211  LEU A C   1 
ATOM   1608 O O   . LEU A 1 211 ? 5.183   52.597 43.603 1.00 29.02 ? 211  LEU A O   1 
ATOM   1609 C CB  . LEU A 1 211 ? 6.408   53.417 46.512 1.00 26.23 ? 211  LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 211 ? 7.782   53.505 47.153 1.00 30.10 ? 211  LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 211 ? 7.646   53.373 48.677 1.00 29.84 ? 211  LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 211 ? 8.604   52.415 46.620 1.00 30.71 ? 211  LEU A CD2 1 
ATOM   1613 N N   . SER A 1 212 ? 3.910   53.927 44.832 1.00 27.55 ? 212  SER A N   1 
ATOM   1614 C CA  . SER A 1 212 ? 2.659   53.379 44.311 1.00 29.66 ? 212  SER A CA  1 
ATOM   1615 C C   . SER A 1 212 ? 2.383   53.628 42.825 1.00 30.18 ? 212  SER A C   1 
ATOM   1616 O O   . SER A 1 212 ? 2.224   54.787 42.378 1.00 29.08 ? 212  SER A O   1 
ATOM   1617 C CB  . SER A 1 212 ? 1.477   53.900 45.141 1.00 30.82 ? 212  SER A CB  1 
ATOM   1618 O OG  . SER A 1 212 ? 0.265   53.227 44.825 1.00 32.18 ? 212  SER A OG  1 
ATOM   1619 N N   . PRO A 1 213 ? 2.319   52.539 42.038 1.00 28.84 ? 213  PRO A N   1 
ATOM   1620 C CA  . PRO A 1 213 ? 2.062   52.613 40.601 1.00 29.62 ? 213  PRO A CA  1 
ATOM   1621 C C   . PRO A 1 213 ? 0.908   53.537 40.275 1.00 29.26 ? 213  PRO A C   1 
ATOM   1622 O O   . PRO A 1 213 ? 0.984   54.335 39.346 1.00 30.40 ? 213  PRO A O   1 
ATOM   1623 C CB  . PRO A 1 213 ? 1.730   51.159 40.210 1.00 29.01 ? 213  PRO A CB  1 
ATOM   1624 C CG  . PRO A 1 213 ? 2.634   50.353 41.208 1.00 30.92 ? 213  PRO A CG  1 
ATOM   1625 C CD  . PRO A 1 213 ? 2.433   51.140 42.509 1.00 29.81 ? 213  PRO A CD  1 
ATOM   1626 N N   . GLY A 1 214 ? -0.157  53.429 41.052 1.00 29.32 ? 214  GLY A N   1 
ATOM   1627 C CA  . GLY A 1 214 ? -1.360  54.213 40.768 1.00 30.38 ? 214  GLY A CA  1 
ATOM   1628 C C   . GLY A 1 214 ? -1.291  55.717 40.974 1.00 30.02 ? 214  GLY A C   1 
ATOM   1629 O O   . GLY A 1 214 ? -2.185  56.443 40.569 1.00 30.51 ? 214  GLY A O   1 
ATOM   1630 N N   . SER A 1 215 ? -0.229  56.184 41.602 1.00 29.33 ? 215  SER A N   1 
ATOM   1631 C CA  . SER A 1 215 ? -0.056  57.601 41.853 1.00 28.81 ? 215  SER A CA  1 
ATOM   1632 C C   . SER A 1 215 ? 1.018   58.209 41.009 1.00 28.58 ? 215  SER A C   1 
ATOM   1633 O O   . SER A 1 215 ? 1.004   59.410 40.815 1.00 27.90 ? 215  SER A O   1 
ATOM   1634 C CB  . SER A 1 215 ? 0.387   57.869 43.313 1.00 27.74 ? 215  SER A CB  1 
ATOM   1635 O OG  . SER A 1 215 ? -0.633  57.591 44.246 1.00 30.15 ? 215  SER A OG  1 
ATOM   1636 N N   . ARG A 1 216 ? 1.960   57.403 40.531 1.00 29.38 ? 216  ARG A N   1 
ATOM   1637 C CA  . ARG A 1 216 ? 3.135   57.940 39.821 1.00 31.81 ? 216  ARG A CA  1 
ATOM   1638 C C   . ARG A 1 216 ? 2.947   58.885 38.685 1.00 32.93 ? 216  ARG A C   1 
ATOM   1639 O O   . ARG A 1 216 ? 3.786   59.786 38.503 1.00 33.50 ? 216  ARG A O   1 
ATOM   1640 C CB  . ARG A 1 216 ? 4.021   56.833 39.246 1.00 33.58 ? 216  ARG A CB  1 
ATOM   1641 C CG  . ARG A 1 216 ? 4.466   55.811 40.251 1.00 36.23 ? 216  ARG A CG  1 
ATOM   1642 C CD  . ARG A 1 216 ? 5.351   54.782 39.580 1.00 33.89 ? 216  ARG A CD  1 
ATOM   1643 N NE  . ARG A 1 216 ? 5.580   53.706 40.520 1.00 31.99 ? 216  ARG A NE  1 
ATOM   1644 C CZ  . ARG A 1 216 ? 6.118   52.543 40.200 1.00 32.08 ? 216  ARG A CZ  1 
ATOM   1645 N NH1 . ARG A 1 216 ? 6.267   51.612 41.149 1.00 29.45 ? 216  ARG A NH1 1 
ATOM   1646 N NH2 . ARG A 1 216 ? 6.512   52.325 38.935 1.00 29.72 ? 216  ARG A NH2 1 
ATOM   1647 N N   . ASP A 1 217 ? 1.901   58.663 37.885 1.00 31.54 ? 217  ASP A N   1 
ATOM   1648 C CA  . ASP A 1 217 ? 1.728   59.493 36.704 1.00 32.76 ? 217  ASP A CA  1 
ATOM   1649 C C   . ASP A 1 217 ? 1.067   60.832 36.983 1.00 32.28 ? 217  ASP A C   1 
ATOM   1650 O O   . ASP A 1 217 ? 0.920   61.620 36.058 1.00 33.20 ? 217  ASP A O   1 
ATOM   1651 C CB  . ASP A 1 217 ? 0.912   58.767 35.606 1.00 30.93 ? 217  ASP A CB  1 
ATOM   1652 C CG  . ASP A 1 217 ? 1.507   57.395 35.194 1.00 33.83 ? 217  ASP A CG  1 
ATOM   1653 O OD1 . ASP A 1 217 ? 2.616   57.004 35.603 1.00 31.80 ? 217  ASP A OD1 1 
ATOM   1654 O OD2 . ASP A 1 217 ? 0.818   56.706 34.427 1.00 33.94 ? 217  ASP A OD2 1 
ATOM   1655 N N   . LEU A 1 218 ? 0.667   61.095 38.231 1.00 31.49 ? 218  LEU A N   1 
ATOM   1656 C CA  . LEU A 1 218 ? -0.032  62.348 38.530 1.00 30.95 ? 218  LEU A CA  1 
ATOM   1657 C C   . LEU A 1 218 ? 0.872   63.535 38.881 1.00 31.09 ? 218  LEU A C   1 
ATOM   1658 O O   . LEU A 1 218 ? 0.381   64.657 39.060 1.00 32.36 ? 218  LEU A O   1 
ATOM   1659 C CB  . LEU A 1 218 ? -1.052  62.141 39.662 1.00 30.06 ? 218  LEU A CB  1 
ATOM   1660 C CG  . LEU A 1 218 ? -2.067  61.029 39.389 1.00 32.68 ? 218  LEU A CG  1 
ATOM   1661 C CD1 . LEU A 1 218 ? -2.953  60.892 40.597 1.00 33.85 ? 218  LEU A CD1 1 
ATOM   1662 C CD2 . LEU A 1 218 ? -2.905  61.289 38.152 1.00 30.41 ? 218  LEU A CD2 1 
ATOM   1663 N N   . PHE A 1 219 ? 2.186   63.307 38.974 1.00 30.15 ? 219  PHE A N   1 
ATOM   1664 C CA  . PHE A 1 219 ? 3.097   64.385 39.335 1.00 27.35 ? 219  PHE A CA  1 
ATOM   1665 C C   . PHE A 1 219 ? 4.456   64.194 38.689 1.00 27.77 ? 219  PHE A C   1 
ATOM   1666 O O   . PHE A 1 219 ? 4.766   63.112 38.176 1.00 25.25 ? 219  PHE A O   1 
ATOM   1667 C CB  . PHE A 1 219 ? 3.233   64.478 40.881 1.00 27.71 ? 219  PHE A CB  1 
ATOM   1668 C CG  . PHE A 1 219 ? 3.855   63.275 41.530 1.00 25.55 ? 219  PHE A CG  1 
ATOM   1669 C CD1 . PHE A 1 219 ? 3.091   62.114 41.791 1.00 26.36 ? 219  PHE A CD1 1 
ATOM   1670 C CD2 . PHE A 1 219 ? 5.223   63.263 41.824 1.00 25.08 ? 219  PHE A CD2 1 
ATOM   1671 C CE1 . PHE A 1 219 ? 3.700   60.925 42.337 1.00 25.65 ? 219  PHE A CE1 1 
ATOM   1672 C CE2 . PHE A 1 219 ? 5.855   62.094 42.373 1.00 25.92 ? 219  PHE A CE2 1 
ATOM   1673 C CZ  . PHE A 1 219 ? 5.077   60.910 42.634 1.00 24.90 ? 219  PHE A CZ  1 
ATOM   1674 N N   . ARG A 1 220 ? 5.279   65.237 38.757 1.00 26.24 ? 220  ARG A N   1 
ATOM   1675 C CA  . ARG A 1 220 ? 6.561   65.209 38.123 1.00 27.17 ? 220  ARG A CA  1 
ATOM   1676 C C   . ARG A 1 220 ? 7.794   64.941 39.012 1.00 28.07 ? 220  ARG A C   1 
ATOM   1677 O O   . ARG A 1 220 ? 8.635   64.120 38.655 1.00 25.96 ? 220  ARG A O   1 
ATOM   1678 C CB  . ARG A 1 220 ? 6.717   66.552 37.370 1.00 27.42 ? 220  ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 220 ? 8.051   66.821 36.673 1.00 31.02 ? 220  ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 220 ? 8.283   65.858 35.550 1.00 33.77 ? 220  ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 220 ? 9.442   66.217 34.731 1.00 37.51 ? 220  ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 220 ? 9.424   67.083 33.709 1.00 38.04 ? 220  ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 220 ? 8.290   67.710 33.365 1.00 36.71 ? 220  ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 220 ? 10.543  67.282 32.999 1.00 36.47 ? 220  ARG A NH2 1 
ATOM   1685 N N   . ARG A 1 221 ? 7.872   65.638 40.146 1.00 28.75 ? 221  ARG A N   1 
ATOM   1686 C CA  . ARG A 1 221 ? 9.034   65.623 41.073 1.00 30.76 ? 221  ARG A CA  1 
ATOM   1687 C C   . ARG A 1 221 ? 8.541   65.647 42.499 1.00 29.36 ? 221  ARG A C   1 
ATOM   1688 O O   . ARG A 1 221 ? 7.349   65.947 42.741 1.00 29.83 ? 221  ARG A O   1 
ATOM   1689 C CB  . ARG A 1 221 ? 9.918   66.861 40.888 1.00 32.18 ? 221  ARG A CB  1 
ATOM   1690 C CG  . ARG A 1 221 ? 10.616  66.862 39.602 1.00 40.51 ? 221  ARG A CG  1 
ATOM   1691 C CD  . ARG A 1 221 ? 11.689  67.897 39.510 1.00 39.22 ? 221  ARG A CD  1 
ATOM   1692 N NE  . ARG A 1 221 ? 11.223  68.978 38.709 1.00 41.48 ? 221  ARG A NE  1 
ATOM   1693 C CZ  . ARG A 1 221 ? 11.250  69.071 37.384 1.00 39.44 ? 221  ARG A CZ  1 
ATOM   1694 N NH1 . ARG A 1 221 ? 11.753  68.128 36.581 1.00 36.65 ? 221  ARG A NH1 1 
ATOM   1695 N NH2 . ARG A 1 221 ? 10.694  70.163 36.866 1.00 41.05 ? 221  ARG A NH2 1 
ATOM   1696 N N   . ALA A 1 222 ? 9.472   65.440 43.434 1.00 27.27 ? 222  ALA A N   1 
ATOM   1697 C CA  . ALA A 1 222 ? 9.111   65.279 44.838 1.00 26.78 ? 222  ALA A CA  1 
ATOM   1698 C C   . ALA A 1 222 ? 10.087  65.845 45.842 1.00 26.77 ? 222  ALA A C   1 
ATOM   1699 O O   . ALA A 1 222 ? 11.286  65.833 45.613 1.00 26.32 ? 222  ALA A O   1 
ATOM   1700 C CB  . ALA A 1 222 ? 8.897   63.745 45.118 1.00 23.61 ? 222  ALA A CB  1 
ATOM   1701 N N   . ILE A 1 223 ? 9.560   66.362 46.961 1.00 27.30 ? 223  ILE A N   1 
ATOM   1702 C CA  . ILE A 1 223 ? 10.400  66.900 48.026 1.00 24.99 ? 223  ILE A CA  1 
ATOM   1703 C C   . ILE A 1 223 ? 9.926   66.230 49.312 1.00 25.49 ? 223  ILE A C   1 
ATOM   1704 O O   . ILE A 1 223 ? 8.729   66.248 49.601 1.00 24.19 ? 223  ILE A O   1 
ATOM   1705 C CB  . ILE A 1 223 ? 10.196  68.414 48.186 1.00 25.70 ? 223  ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 223 ? 10.672  69.132 46.928 1.00 25.87 ? 223  ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 223 ? 10.974  68.944 49.418 1.00 24.13 ? 223  ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 223 ? 10.362  70.668 46.961 1.00 25.23 ? 223  ILE A CD1 1 
ATOM   1709 N N   . LEU A 1 224 ? 10.846  65.630 50.075 1.00 23.91 ? 224  LEU A N   1 
ATOM   1710 C CA  . LEU A 1 224 ? 10.502  64.979 51.336 1.00 24.39 ? 224  LEU A CA  1 
ATOM   1711 C C   . LEU A 1 224 ? 11.261  65.645 52.502 1.00 24.83 ? 224  LEU A C   1 
ATOM   1712 O O   . LEU A 1 224 ? 12.498  65.743 52.498 1.00 24.01 ? 224  LEU A O   1 
ATOM   1713 C CB  . LEU A 1 224 ? 10.838  63.485 51.287 1.00 23.75 ? 224  LEU A CB  1 
ATOM   1714 C CG  . LEU A 1 224 ? 10.161  62.624 50.199 1.00 24.84 ? 224  LEU A CG  1 
ATOM   1715 C CD1 . LEU A 1 224 ? 10.816  62.849 48.831 1.00 21.27 ? 224  LEU A CD1 1 
ATOM   1716 C CD2 . LEU A 1 224 ? 10.283  61.116 50.596 1.00 23.56 ? 224  LEU A CD2 1 
ATOM   1717 N N   . GLN A 1 225 ? 10.507  66.114 53.488 1.00 24.63 ? 225  GLN A N   1 
ATOM   1718 C CA  . GLN A 1 225 ? 11.066  66.797 54.670 1.00 24.75 ? 225  GLN A CA  1 
ATOM   1719 C C   . GLN A 1 225 ? 10.828  65.948 55.945 1.00 24.41 ? 225  GLN A C   1 
ATOM   1720 O O   . GLN A 1 225 ? 9.673   65.692 56.334 1.00 23.67 ? 225  GLN A O   1 
ATOM   1721 C CB  . GLN A 1 225 ? 10.428  68.201 54.824 1.00 24.49 ? 225  GLN A CB  1 
ATOM   1722 C CG  . GLN A 1 225 ? 10.681  69.069 53.597 1.00 23.90 ? 225  GLN A CG  1 
ATOM   1723 C CD  . GLN A 1 225 ? 9.798   70.337 53.520 1.00 26.01 ? 225  GLN A CD  1 
ATOM   1724 O OE1 . GLN A 1 225 ? 9.436   70.738 52.443 1.00 27.10 ? 225  GLN A OE1 1 
ATOM   1725 N NE2 . GLN A 1 225 ? 9.472   70.956 54.660 1.00 27.10 ? 225  GLN A NE2 1 
ATOM   1726 N N   . SER A 1 226 ? 11.941  65.459 56.519 1.00 23.71 ? 226  SER A N   1 
ATOM   1727 C CA  . SER A 1 226 ? 11.955  64.667 57.737 1.00 21.93 ? 226  SER A CA  1 
ATOM   1728 C C   . SER A 1 226 ? 10.962  63.522 57.687 1.00 22.56 ? 226  SER A C   1 
ATOM   1729 O O   . SER A 1 226 ? 10.205  63.315 58.626 1.00 21.75 ? 226  SER A O   1 
ATOM   1730 C CB  . SER A 1 226 ? 11.613  65.568 58.938 1.00 23.82 ? 226  SER A CB  1 
ATOM   1731 O OG  . SER A 1 226 ? 12.424  66.742 59.034 1.00 23.49 ? 226  SER A OG  1 
ATOM   1732 N N   . GLY A 1 227 ? 10.932  62.772 56.606 1.00 22.68 ? 227  GLY A N   1 
ATOM   1733 C CA  . GLY A 1 227 ? 9.971   61.691 56.547 1.00 22.96 ? 227  GLY A CA  1 
ATOM   1734 C C   . GLY A 1 227 ? 10.250  60.901 55.290 1.00 25.13 ? 227  GLY A C   1 
ATOM   1735 O O   . GLY A 1 227 ? 10.741  61.453 54.274 1.00 24.33 ? 227  GLY A O   1 
ATOM   1736 N N   . SER A 1 228 ? 10.002  59.600 55.356 1.00 23.29 ? 228  SER A N   1 
ATOM   1737 C CA  . SER A 1 228 ? 10.218  58.776 54.207 1.00 24.58 ? 228  SER A CA  1 
ATOM   1738 C C   . SER A 1 228 ? 9.277   57.601 54.344 1.00 24.50 ? 228  SER A C   1 
ATOM   1739 O O   . SER A 1 228 ? 8.825   57.272 55.433 1.00 22.39 ? 228  SER A O   1 
ATOM   1740 C CB  . SER A 1 228 ? 11.708  58.409 53.983 1.00 24.46 ? 228  SER A CB  1 
ATOM   1741 O OG  . SER A 1 228 ? 12.223  57.661 55.002 1.00 25.16 ? 228  SER A OG  1 
ATOM   1742 N N   . PRO A 1 229 ? 8.963   56.962 53.216 1.00 25.18 ? 229  PRO A N   1 
ATOM   1743 C CA  . PRO A 1 229 ? 8.014   55.844 53.236 1.00 25.37 ? 229  PRO A CA  1 
ATOM   1744 C C   . PRO A 1 229 ? 8.313   54.642 54.070 1.00 25.58 ? 229  PRO A C   1 
ATOM   1745 O O   . PRO A 1 229 ? 7.389   54.061 54.643 1.00 27.51 ? 229  PRO A O   1 
ATOM   1746 C CB  . PRO A 1 229 ? 7.774   55.556 51.728 1.00 25.42 ? 229  PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 229 ? 9.210   55.872 51.098 1.00 25.99 ? 229  PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 229 ? 9.681   57.095 51.922 1.00 24.57 ? 229  PRO A CD  1 
ATOM   1749 N N   . ASN A 1 230 ? 9.594   54.320 54.204 1.00 25.86 ? 230  ASN A N   1 
ATOM   1750 C CA  . ASN A 1 230 ? 10.045  53.188 54.946 1.00 25.58 ? 230  ASN A CA  1 
ATOM   1751 C C   . ASN A 1 230 ? 10.189  53.485 56.441 1.00 26.45 ? 230  ASN A C   1 
ATOM   1752 O O   . ASN A 1 230 ? 10.709  52.622 57.166 1.00 25.67 ? 230  ASN A O   1 
ATOM   1753 C CB  . ASN A 1 230 ? 11.397  52.755 54.354 1.00 27.57 ? 230  ASN A CB  1 
ATOM   1754 C CG  . ASN A 1 230 ? 12.437  53.888 54.399 1.00 28.86 ? 230  ASN A CG  1 
ATOM   1755 O OD1 . ASN A 1 230 ? 12.130  55.021 53.985 1.00 27.51 ? 230  ASN A OD1 1 
ATOM   1756 N ND2 . ASN A 1 230 ? 13.663  53.596 54.899 1.00 24.80 ? 230  ASN A ND2 1 
ATOM   1757 N N   . CYS A 1 231 ? 9.755   54.664 56.921 1.00 24.64 ? 231  CYS A N   1 
ATOM   1758 C CA  . CYS A 1 231 ? 9.912   54.955 58.366 1.00 26.81 ? 231  CYS A CA  1 
ATOM   1759 C C   . CYS A 1 231 ? 9.220   53.868 59.202 1.00 27.86 ? 231  CYS A C   1 
ATOM   1760 O O   . CYS A 1 231 ? 8.151   53.380 58.819 1.00 27.17 ? 231  CYS A O   1 
ATOM   1761 C CB  . CYS A 1 231 ? 9.320   56.320 58.710 1.00 27.58 ? 231  CYS A CB  1 
ATOM   1762 S SG  . CYS A 1 231 ? 10.422  57.655 58.177 1.00 25.47 ? 231  CYS A SG  1 
ATOM   1763 N N   . PRO A 1 232 ? 9.809   53.490 60.348 1.00 26.18 ? 232  PRO A N   1 
ATOM   1764 C CA  . PRO A 1 232 ? 9.198   52.437 61.163 1.00 25.98 ? 232  PRO A CA  1 
ATOM   1765 C C   . PRO A 1 232 ? 7.789   52.695 61.652 1.00 26.31 ? 232  PRO A C   1 
ATOM   1766 O O   . PRO A 1 232 ? 7.072   51.753 61.929 1.00 27.10 ? 232  PRO A O   1 
ATOM   1767 C CB  . PRO A 1 232 ? 10.209  52.235 62.304 1.00 24.38 ? 232  PRO A CB  1 
ATOM   1768 C CG  . PRO A 1 232 ? 10.810  53.626 62.498 1.00 24.93 ? 232  PRO A CG  1 
ATOM   1769 C CD  . PRO A 1 232 ? 10.987  54.086 61.009 1.00 26.27 ? 232  PRO A CD  1 
ATOM   1770 N N   . TRP A 1 233 ? 7.386   53.962 61.763 1.00 26.18 ? 233  TRP A N   1 
ATOM   1771 C CA  . TRP A 1 233 ? 6.036   54.347 62.223 1.00 25.63 ? 233  TRP A CA  1 
ATOM   1772 C C   . TRP A 1 233 ? 5.026   54.597 61.082 1.00 26.72 ? 233  TRP A C   1 
ATOM   1773 O O   . TRP A 1 233 ? 3.832   54.727 61.336 1.00 27.32 ? 233  TRP A O   1 
ATOM   1774 C CB  . TRP A 1 233 ? 6.121   55.650 63.029 1.00 26.10 ? 233  TRP A CB  1 
ATOM   1775 C CG  . TRP A 1 233 ? 6.974   56.734 62.285 1.00 26.00 ? 233  TRP A CG  1 
ATOM   1776 C CD1 . TRP A 1 233 ? 8.311   56.992 62.454 1.00 23.59 ? 233  TRP A CD1 1 
ATOM   1777 C CD2 . TRP A 1 233 ? 6.522   57.631 61.251 1.00 25.19 ? 233  TRP A CD2 1 
ATOM   1778 N NE1 . TRP A 1 233 ? 8.716   57.992 61.585 1.00 24.26 ? 233  TRP A NE1 1 
ATOM   1779 C CE2 . TRP A 1 233 ? 7.645   58.405 60.841 1.00 24.53 ? 233  TRP A CE2 1 
ATOM   1780 C CE3 . TRP A 1 233 ? 5.278   57.852 60.630 1.00 24.66 ? 233  TRP A CE3 1 
ATOM   1781 C CZ2 . TRP A 1 233 ? 7.562   59.391 59.842 1.00 24.12 ? 233  TRP A CZ2 1 
ATOM   1782 C CZ3 . TRP A 1 233 ? 5.191   58.821 59.632 1.00 24.00 ? 233  TRP A CZ3 1 
ATOM   1783 C CH2 . TRP A 1 233 ? 6.326   59.583 59.247 1.00 25.58 ? 233  TRP A CH2 1 
ATOM   1784 N N   . ALA A 1 234 ? 5.513   54.649 59.838 1.00 26.06 ? 234  ALA A N   1 
ATOM   1785 C CA  . ALA A 1 234 ? 4.719   54.983 58.657 1.00 24.52 ? 234  ALA A CA  1 
ATOM   1786 C C   . ALA A 1 234 ? 3.822   53.913 58.046 1.00 24.91 ? 234  ALA A C   1 
ATOM   1787 O O   . ALA A 1 234 ? 3.017   54.230 57.205 1.00 23.40 ? 234  ALA A O   1 
ATOM   1788 C CB  . ALA A 1 234 ? 5.634   55.523 57.587 1.00 22.12 ? 234  ALA A CB  1 
ATOM   1789 N N   . SER A 1 235 ? 4.009   52.646 58.403 1.00 25.97 ? 235  SER A N   1 
ATOM   1790 C CA  . SER A 1 235 ? 3.156   51.613 57.875 1.00 27.65 ? 235  SER A CA  1 
ATOM   1791 C C   . SER A 1 235 ? 3.105   50.383 58.787 1.00 29.21 ? 235  SER A C   1 
ATOM   1792 O O   . SER A 1 235 ? 3.955   50.222 59.660 1.00 30.06 ? 235  SER A O   1 
ATOM   1793 C CB  . SER A 1 235 ? 3.610   51.218 56.464 1.00 25.15 ? 235  SER A CB  1 
ATOM   1794 O OG  . SER A 1 235 ? 4.837   50.540 56.471 1.00 27.05 ? 235  SER A OG  1 
ATOM   1795 N N   . VAL A 1 236 ? 2.066   49.561 58.631 1.00 30.21 ? 236  VAL A N   1 
ATOM   1796 C CA  . VAL A 1 236 ? 1.924   48.298 59.394 1.00 30.14 ? 236  VAL A CA  1 
ATOM   1797 C C   . VAL A 1 236 ? 1.491   47.193 58.409 1.00 31.58 ? 236  VAL A C   1 
ATOM   1798 O O   . VAL A 1 236 ? 1.030   47.497 57.293 1.00 32.05 ? 236  VAL A O   1 
ATOM   1799 C CB  . VAL A 1 236 ? 0.839   48.390 60.503 1.00 29.45 ? 236  VAL A CB  1 
ATOM   1800 C CG1 . VAL A 1 236 ? 1.323   49.307 61.615 1.00 27.89 ? 236  VAL A CG1 1 
ATOM   1801 C CG2 . VAL A 1 236 ? -0.482  48.886 59.923 1.00 27.02 ? 236  VAL A CG2 1 
ATOM   1802 N N   . SER A 1 237 ? 1.650   45.933 58.793 1.00 30.61 ? 237  SER A N   1 
ATOM   1803 C CA  . SER A 1 237 ? 1.243   44.832 57.932 1.00 30.85 ? 237  SER A CA  1 
ATOM   1804 C C   . SER A 1 237 ? -0.279  44.801 58.003 1.00 31.03 ? 237  SER A C   1 
ATOM   1805 O O   . SER A 1 237 ? -0.851  45.438 58.885 1.00 28.68 ? 237  SER A O   1 
ATOM   1806 C CB  . SER A 1 237 ? 1.750   43.500 58.481 1.00 31.11 ? 237  SER A CB  1 
ATOM   1807 O OG  . SER A 1 237 ? 1.190   43.310 59.788 1.00 32.42 ? 237  SER A OG  1 
ATOM   1808 N N   . VAL A 1 238 ? -0.933  44.043 57.109 1.00 31.71 ? 238  VAL A N   1 
ATOM   1809 C CA  . VAL A 1 238 ? -2.403  43.969 57.156 1.00 32.31 ? 238  VAL A CA  1 
ATOM   1810 C C   . VAL A 1 238 ? -2.843  43.236 58.409 1.00 31.64 ? 238  VAL A C   1 
ATOM   1811 O O   . VAL A 1 238 ? -3.941  43.507 58.948 1.00 32.00 ? 238  VAL A O   1 
ATOM   1812 C CB  . VAL A 1 238 ? -3.031  43.223 55.923 1.00 34.66 ? 238  VAL A CB  1 
ATOM   1813 C CG1 . VAL A 1 238 ? -2.737  43.971 54.651 1.00 35.42 ? 238  VAL A CG1 1 
ATOM   1814 C CG2 . VAL A 1 238 ? -2.494  41.821 55.820 1.00 35.08 ? 238  VAL A CG2 1 
ATOM   1815 N N   . ALA A 1 239 ? -2.016  42.296 58.879 1.00 31.62 ? 239  ALA A N   1 
ATOM   1816 C CA  . ALA A 1 239 ? -2.342  41.560 60.120 1.00 32.54 ? 239  ALA A CA  1 
ATOM   1817 C C   . ALA A 1 239 ? -2.365  42.515 61.352 1.00 32.71 ? 239  ALA A C   1 
ATOM   1818 O O   . ALA A 1 239 ? -3.270  42.463 62.188 1.00 33.10 ? 239  ALA A O   1 
ATOM   1819 C CB  . ALA A 1 239 ? -1.338  40.435 60.339 1.00 33.03 ? 239  ALA A CB  1 
ATOM   1820 N N   . GLU A 1 240 ? -1.386  43.404 61.457 1.00 32.48 ? 240  GLU A N   1 
ATOM   1821 C CA  . GLU A 1 240 ? -1.373  44.363 62.575 1.00 32.40 ? 240  GLU A CA  1 
ATOM   1822 C C   . GLU A 1 240 ? -2.540  45.402 62.429 1.00 32.13 ? 240  GLU A C   1 
ATOM   1823 O O   . GLU A 1 240 ? -3.199  45.786 63.416 1.00 31.40 ? 240  GLU A O   1 
ATOM   1824 C CB  . GLU A 1 240 ? 0.005   45.035 62.608 1.00 31.75 ? 240  GLU A CB  1 
ATOM   1825 C CG  . GLU A 1 240 ? 0.225   46.113 63.702 1.00 34.78 ? 240  GLU A CG  1 
ATOM   1826 C CD  . GLU A 1 240 ? -0.057  45.626 65.113 1.00 33.84 ? 240  GLU A CD  1 
ATOM   1827 O OE1 . GLU A 1 240 ? -0.068  44.423 65.333 1.00 36.13 ? 240  GLU A OE1 1 
ATOM   1828 O OE2 . GLU A 1 240 ? -0.280  46.450 66.011 1.00 33.37 ? 240  GLU A OE2 1 
ATOM   1829 N N   . GLY A 1 241 ? -2.784  45.857 61.195 1.00 32.46 ? 241  GLY A N   1 
ATOM   1830 C CA  . GLY A 1 241 ? -3.878  46.795 60.951 1.00 32.22 ? 241  GLY A CA  1 
ATOM   1831 C C   . GLY A 1 241 ? -5.182  46.182 61.424 1.00 31.32 ? 241  GLY A C   1 
ATOM   1832 O O   . GLY A 1 241 ? -5.959  46.805 62.134 1.00 29.95 ? 241  GLY A O   1 
ATOM   1833 N N   . ARG A 1 242 ? -5.387  44.927 61.050 1.00 33.38 ? 242  ARG A N   1 
ATOM   1834 C CA  . ARG A 1 242 ? -6.593  44.192 61.411 1.00 35.35 ? 242  ARG A CA  1 
ATOM   1835 C C   . ARG A 1 242 ? -6.689  44.122 62.929 1.00 35.98 ? 242  ARG A C   1 
ATOM   1836 O O   . ARG A 1 242 ? -7.713  44.451 63.512 1.00 36.29 ? 242  ARG A O   1 
ATOM   1837 C CB  . ARG A 1 242 ? -6.520  42.791 60.769 1.00 37.11 ? 242  ARG A CB  1 
ATOM   1838 C CG  . ARG A 1 242 ? -7.566  41.756 61.208 1.00 40.26 ? 242  ARG A CG  1 
ATOM   1839 C CD  . ARG A 1 242 ? -7.770  40.630 60.128 1.00 39.89 ? 242  ARG A CD  1 
ATOM   1840 N NE  . ARG A 1 242 ? -8.414  41.108 58.888 1.00 38.94 ? 242  ARG A NE  1 
ATOM   1841 C CZ  . ARG A 1 242 ? -9.732  41.284 58.756 1.00 40.62 ? 242  ARG A CZ  1 
ATOM   1842 N NH1 . ARG A 1 242 ? -10.252 41.730 57.610 1.00 40.85 ? 242  ARG A NH1 1 
ATOM   1843 N NH2 . ARG A 1 242 ? -10.543 40.981 59.771 1.00 38.42 ? 242  ARG A NH2 1 
ATOM   1844 N N   . ARG A 1 243 ? -5.594  43.729 63.563 1.00 35.93 ? 243  ARG A N   1 
ATOM   1845 C CA  . ARG A 1 243 ? -5.553  43.598 65.015 1.00 36.82 ? 243  ARG A CA  1 
ATOM   1846 C C   . ARG A 1 243 ? -5.932  44.916 65.741 1.00 35.29 ? 243  ARG A C   1 
ATOM   1847 O O   . ARG A 1 243 ? -6.702  44.901 66.723 1.00 33.34 ? 243  ARG A O   1 
ATOM   1848 C CB  . ARG A 1 243 ? -4.151  43.089 65.411 1.00 38.65 ? 243  ARG A CB  1 
ATOM   1849 C CG  . ARG A 1 243 ? -3.977  42.631 66.853 1.00 46.15 ? 243  ARG A CG  1 
ATOM   1850 C CD  . ARG A 1 243 ? -2.630  43.183 67.491 1.00 51.29 ? 243  ARG A CD  1 
ATOM   1851 N NE  . ARG A 1 243 ? -2.995  43.979 68.659 1.00 54.28 ? 243  ARG A NE  1 
ATOM   1852 C CZ  . ARG A 1 243 ? -2.599  45.212 68.917 1.00 54.74 ? 243  ARG A CZ  1 
ATOM   1853 N NH1 . ARG A 1 243 ? -1.779  45.841 68.104 1.00 55.20 ? 243  ARG A NH1 1 
ATOM   1854 N NH2 . ARG A 1 243 ? -3.095  45.836 69.972 1.00 56.63 ? 243  ARG A NH2 1 
ATOM   1855 N N   . ARG A 1 244 ? -5.421  46.055 65.244 1.00 33.52 ? 244  ARG A N   1 
ATOM   1856 C CA  . ARG A 1 244 ? -5.719  47.329 65.887 1.00 31.14 ? 244  ARG A CA  1 
ATOM   1857 C C   . ARG A 1 244 ? -7.148  47.756 65.632 1.00 31.09 ? 244  ARG A C   1 
ATOM   1858 O O   . ARG A 1 244 ? -7.757  48.423 66.498 1.00 29.97 ? 244  ARG A O   1 
ATOM   1859 C CB  . ARG A 1 244 ? -4.749  48.437 65.433 1.00 29.60 ? 244  ARG A CB  1 
ATOM   1860 C CG  . ARG A 1 244 ? -3.289  48.167 65.790 1.00 26.87 ? 244  ARG A CG  1 
ATOM   1861 C CD  . ARG A 1 244 ? -2.375  49.254 65.260 1.00 25.62 ? 244  ARG A CD  1 
ATOM   1862 N NE  . ARG A 1 244 ? -0.952  48.945 65.421 1.00 27.85 ? 244  ARG A NE  1 
ATOM   1863 C CZ  . ARG A 1 244 ? 0.045   49.789 65.182 1.00 27.81 ? 244  ARG A CZ  1 
ATOM   1864 N NH1 . ARG A 1 244 ? -0.211  51.028 64.771 1.00 26.87 ? 244  ARG A NH1 1 
ATOM   1865 N NH2 . ARG A 1 244 ? 1.306   49.388 65.322 1.00 27.66 ? 244  ARG A NH2 1 
ATOM   1866 N N   . ALA A 1 245 ? -7.696  47.388 64.468 1.00 31.44 ? 245  ALA A N   1 
ATOM   1867 C CA  . ALA A 1 245 ? -9.112  47.734 64.152 1.00 32.82 ? 245  ALA A CA  1 
ATOM   1868 C C   . ALA A 1 245 ? -10.034 46.974 65.130 1.00 33.65 ? 245  ALA A C   1 
ATOM   1869 O O   . ALA A 1 245 ? -10.971 47.553 65.708 1.00 34.85 ? 245  ALA A O   1 
ATOM   1870 C CB  . ALA A 1 245 ? -9.453  47.347 62.706 1.00 32.27 ? 245  ALA A CB  1 
ATOM   1871 N N   . VAL A 1 246 ? -9.742  45.685 65.317 1.00 34.37 ? 246  VAL A N   1 
ATOM   1872 C CA  . VAL A 1 246 ? -10.488 44.836 66.245 1.00 36.43 ? 246  VAL A CA  1 
ATOM   1873 C C   . VAL A 1 246 ? -10.337 45.391 67.671 1.00 37.43 ? 246  VAL A C   1 
ATOM   1874 O O   . VAL A 1 246 ? -11.327 45.482 68.420 1.00 36.88 ? 246  VAL A O   1 
ATOM   1875 C CB  . VAL A 1 246 ? -9.980  43.351 66.212 1.00 37.13 ? 246  VAL A CB  1 
ATOM   1876 C CG1 . VAL A 1 246 ? -10.681 42.517 67.316 1.00 38.37 ? 246  VAL A CG1 1 
ATOM   1877 C CG2 . VAL A 1 246 ? -10.289 42.704 64.831 1.00 34.77 ? 246  VAL A CG2 1 
ATOM   1878 N N   . GLU A 1 247 ? -9.119  45.799 68.050 1.00 36.07 ? 247  GLU A N   1 
ATOM   1879 C CA  . GLU A 1 247 ? -8.970  46.347 69.397 1.00 36.08 ? 247  GLU A CA  1 
ATOM   1880 C C   . GLU A 1 247 ? -9.740  47.691 69.575 1.00 34.18 ? 247  GLU A C   1 
ATOM   1881 O O   . GLU A 1 247 ? -10.250 47.998 70.672 1.00 31.94 ? 247  GLU A O   1 
ATOM   1882 C CB  . GLU A 1 247 ? -7.467  46.496 69.747 1.00 38.80 ? 247  GLU A CB  1 
ATOM   1883 C CG  . GLU A 1 247 ? -7.190  46.898 71.193 1.00 43.09 ? 247  GLU A CG  1 
ATOM   1884 C CD  . GLU A 1 247 ? -7.537  45.774 72.232 1.00 47.46 ? 247  GLU A CD  1 
ATOM   1885 O OE1 . GLU A 1 247 ? -7.597  46.116 73.456 1.00 45.89 ? 247  GLU A OE1 1 
ATOM   1886 O OE2 . GLU A 1 247 ? -7.731  44.576 71.821 1.00 46.30 ? 247  GLU A OE2 1 
ATOM   1887 N N   . LEU A 1 248 ? -9.846  48.480 68.500 1.00 32.79 ? 248  LEU A N   1 
ATOM   1888 C CA  . LEU A 1 248 ? -10.576 49.740 68.575 1.00 32.84 ? 248  LEU A CA  1 
ATOM   1889 C C   . LEU A 1 248 ? -12.018 49.344 68.810 1.00 34.21 ? 248  LEU A C   1 
ATOM   1890 O O   . LEU A 1 248 ? -12.694 49.935 69.631 1.00 33.20 ? 248  LEU A O   1 
ATOM   1891 C CB  . LEU A 1 248 ? -10.494 50.526 67.263 1.00 32.85 ? 248  LEU A CB  1 
ATOM   1892 C CG  . LEU A 1 248 ? -11.202 51.889 67.292 1.00 34.07 ? 248  LEU A CG  1 
ATOM   1893 C CD1 . LEU A 1 248 ? -10.411 52.834 68.246 1.00 34.66 ? 248  LEU A CD1 1 
ATOM   1894 C CD2 . LEU A 1 248 ? -11.272 52.494 65.900 1.00 32.54 ? 248  LEU A CD2 1 
ATOM   1895 N N   . GLY A 1 249 ? -12.478 48.329 68.073 1.00 35.64 ? 249  GLY A N   1 
ATOM   1896 C CA  . GLY A 1 249 ? -13.835 47.848 68.239 1.00 36.33 ? 249  GLY A CA  1 
ATOM   1897 C C   . GLY A 1 249 ? -14.079 47.428 69.675 1.00 37.13 ? 249  GLY A C   1 
ATOM   1898 O O   . GLY A 1 249 ? -15.086 47.794 70.278 1.00 36.57 ? 249  GLY A O   1 
ATOM   1899 N N   . ARG A 1 250 ? -13.136 46.688 70.246 1.00 38.53 ? 250  ARG A N   1 
ATOM   1900 C CA  . ARG A 1 250 ? -13.281 46.203 71.615 1.00 39.26 ? 250  ARG A CA  1 
ATOM   1901 C C   . ARG A 1 250 ? -13.374 47.342 72.656 1.00 40.14 ? 250  ARG A C   1 
ATOM   1902 O O   . ARG A 1 250 ? -14.126 47.248 73.652 1.00 39.85 ? 250  ARG A O   1 
ATOM   1903 C CB  . ARG A 1 250 ? -12.124 45.257 71.908 1.00 42.00 ? 250  ARG A CB  1 
ATOM   1904 C CG  . ARG A 1 250 ? -12.299 44.389 73.118 1.00 45.76 ? 250  ARG A CG  1 
ATOM   1905 C CD  . ARG A 1 250 ? -11.044 43.550 73.334 1.00 48.54 ? 250  ARG A CD  1 
ATOM   1906 N NE  . ARG A 1 250 ? -11.082 42.279 72.615 1.00 51.91 ? 250  ARG A NE  1 
ATOM   1907 C CZ  . ARG A 1 250 ? -10.402 41.989 71.504 1.00 56.02 ? 250  ARG A CZ  1 
ATOM   1908 N NH1 . ARG A 1 250 ? -9.596  42.903 70.926 1.00 57.87 ? 250  ARG A NH1 1 
ATOM   1909 N NH2 . ARG A 1 250 ? -10.488 40.749 70.986 1.00 55.98 ? 250  ARG A NH2 1 
ATOM   1910 N N   . ASN A 1 251 ? -12.634 48.427 72.409 1.00 38.32 ? 251  ASN A N   1 
ATOM   1911 C CA  . ASN A 1 251 ? -12.636 49.589 73.293 1.00 37.73 ? 251  ASN A CA  1 
ATOM   1912 C C   . ASN A 1 251 ? -13.997 50.297 73.259 1.00 36.99 ? 251  ASN A C   1 
ATOM   1913 O O   . ASN A 1 251 ? -14.359 50.973 74.219 1.00 34.98 ? 251  ASN A O   1 
ATOM   1914 C CB  . ASN A 1 251 ? -11.537 50.608 72.852 1.00 36.99 ? 251  ASN A CB  1 
ATOM   1915 C CG  . ASN A 1 251 ? -10.176 50.357 73.505 1.00 36.42 ? 251  ASN A CG  1 
ATOM   1916 O OD1 . ASN A 1 251 ? -9.878  50.903 74.567 1.00 36.86 ? 251  ASN A OD1 1 
ATOM   1917 N ND2 . ASN A 1 251 ? -9.347  49.541 72.869 1.00 33.80 ? 251  ASN A ND2 1 
ATOM   1918 N N   . LEU A 1 252 ? -14.725 50.191 72.146 1.00 37.52 ? 252  LEU A N   1 
ATOM   1919 C CA  . LEU A 1 252 ? -16.034 50.867 72.053 1.00 38.83 ? 252  LEU A CA  1 
ATOM   1920 C C   . LEU A 1 252 ? -17.227 49.876 72.167 1.00 40.06 ? 252  LEU A C   1 
ATOM   1921 O O   . LEU A 1 252 ? -18.352 50.146 71.677 1.00 37.40 ? 252  LEU A O   1 
ATOM   1922 C CB  . LEU A 1 252 ? -16.114 51.699 70.757 1.00 36.95 ? 252  LEU A CB  1 
ATOM   1923 C CG  . LEU A 1 252 ? -15.020 52.771 70.694 1.00 36.44 ? 252  LEU A CG  1 
ATOM   1924 C CD1 . LEU A 1 252 ? -14.895 53.296 69.267 1.00 35.82 ? 252  LEU A CD1 1 
ATOM   1925 C CD2 . LEU A 1 252 ? -15.298 53.902 71.659 1.00 35.65 ? 252  LEU A CD2 1 
ATOM   1926 N N   . ASN A 1 253 ? -16.949 48.738 72.824 1.00 42.14 ? 253  ASN A N   1 
ATOM   1927 C CA  . ASN A 1 253 ? -17.938 47.684 73.071 1.00 44.83 ? 253  ASN A CA  1 
ATOM   1928 C C   . ASN A 1 253 ? -18.719 47.318 71.796 1.00 44.84 ? 253  ASN A C   1 
ATOM   1929 O O   . ASN A 1 253 ? -19.950 47.354 71.758 1.00 43.46 ? 253  ASN A O   1 
ATOM   1930 C CB  . ASN A 1 253 ? -18.888 48.149 74.174 1.00 47.35 ? 253  ASN A CB  1 
ATOM   1931 C CG  . ASN A 1 253 ? -18.130 48.656 75.418 1.00 51.05 ? 253  ASN A CG  1 
ATOM   1932 O OD1 . ASN A 1 253 ? -17.344 47.910 76.032 1.00 52.75 ? 253  ASN A OD1 1 
ATOM   1933 N ND2 . ASN A 1 253 ? -18.360 49.925 75.786 1.00 50.94 ? 253  ASN A ND2 1 
ATOM   1934 N N   . CYS A 1 254 ? -17.976 47.003 70.747 1.00 44.08 ? 254  CYS A N   1 
ATOM   1935 C CA  . CYS A 1 254 ? -18.575 46.618 69.477 1.00 44.85 ? 254  CYS A CA  1 
ATOM   1936 C C   . CYS A 1 254 ? -18.707 45.112 69.380 1.00 44.90 ? 254  CYS A C   1 
ATOM   1937 O O   . CYS A 1 254 ? -17.924 44.371 69.961 1.00 44.26 ? 254  CYS A O   1 
ATOM   1938 C CB  . CYS A 1 254 ? -17.692 47.059 68.312 1.00 43.90 ? 254  CYS A CB  1 
ATOM   1939 S SG  . CYS A 1 254 ? -17.721 48.822 67.907 1.00 40.97 ? 254  CYS A SG  1 
ATOM   1940 N N   . ASN A 1 255 ? -19.701 44.663 68.626 1.00 46.73 ? 255  ASN A N   1 
ATOM   1941 C CA  . ASN A 1 255 ? -19.865 43.228 68.383 1.00 47.07 ? 255  ASN A CA  1 
ATOM   1942 C C   . ASN A 1 255 ? -18.642 42.919 67.519 1.00 46.63 ? 255  ASN A C   1 
ATOM   1943 O O   . ASN A 1 255 ? -18.417 43.630 66.532 1.00 46.35 ? 255  ASN A O   1 
ATOM   1944 C CB  . ASN A 1 255 ? -21.121 42.991 67.552 1.00 48.43 ? 255  ASN A CB  1 
ATOM   1945 C CG  . ASN A 1 255 ? -21.281 41.533 67.142 1.00 49.23 ? 255  ASN A CG  1 
ATOM   1946 O OD1 . ASN A 1 255 ? -20.369 40.908 66.574 1.00 48.71 ? 255  ASN A OD1 1 
ATOM   1947 N ND2 . ASN A 1 255 ? -22.447 40.980 67.431 1.00 49.60 ? 255  ASN A ND2 1 
ATOM   1948 N N   . LEU A 1 256 ? -17.871 41.885 67.852 1.00 46.90 ? 256  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 256 ? -16.683 41.547 67.078 1.00 47.34 ? 256  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 256 ? -16.753 40.293 66.213 1.00 48.77 ? 256  LEU A C   1 
ATOM   1951 O O   . LEU A 1 256 ? -15.714 39.830 65.746 1.00 49.17 ? 256  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 256 ? -15.479 41.405 68.009 1.00 47.15 ? 256  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 256 ? -15.260 42.569 68.985 1.00 47.66 ? 256  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 256 ? -14.144 42.210 69.973 1.00 46.74 ? 256  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 256 ? -14.929 43.845 68.181 1.00 48.23 ? 256  LEU A CD2 1 
ATOM   1956 N N   . ASN A 1 257 ? -17.945 39.758 65.963 1.00 49.25 ? 257  ASN A N   1 
ATOM   1957 C CA  . ASN A 1 257 ? -18.099 38.519 65.174 1.00 50.16 ? 257  ASN A CA  1 
ATOM   1958 C C   . ASN A 1 257 ? -17.763 38.510 63.682 1.00 49.39 ? 257  ASN A C   1 
ATOM   1959 O O   . ASN A 1 257 ? -17.443 37.446 63.125 1.00 48.60 ? 257  ASN A O   1 
ATOM   1960 C CB  . ASN A 1 257 ? -19.522 37.991 65.339 1.00 52.54 ? 257  ASN A CB  1 
ATOM   1961 C CG  . ASN A 1 257 ? -19.793 37.526 66.750 1.00 55.77 ? 257  ASN A CG  1 
ATOM   1962 O OD1 . ASN A 1 257 ? -20.936 37.568 67.228 1.00 58.63 ? 257  ASN A OD1 1 
ATOM   1963 N ND2 . ASN A 1 257 ? -18.740 37.075 67.437 1.00 55.71 ? 257  ASN A ND2 1 
ATOM   1964 N N   . SER A 1 258 ? -17.882 39.667 63.030 1.00 47.72 ? 258  SER A N   1 
ATOM   1965 C CA  . SER A 1 258 ? -17.581 39.795 61.598 1.00 46.47 ? 258  SER A CA  1 
ATOM   1966 C C   . SER A 1 258 ? -17.072 41.199 61.261 1.00 45.89 ? 258  SER A C   1 
ATOM   1967 O O   . SER A 1 258 ? -17.311 42.164 62.015 1.00 45.34 ? 258  SER A O   1 
ATOM   1968 C CB  . SER A 1 258 ? -18.837 39.542 60.770 1.00 45.88 ? 258  SER A CB  1 
ATOM   1969 O OG  . SER A 1 258 ? -19.875 40.476 61.078 1.00 45.69 ? 258  SER A OG  1 
ATOM   1970 N N   . ASP A 1 259 ? -16.376 41.319 60.133 1.00 45.41 ? 259  ASP A N   1 
ATOM   1971 C CA  . ASP A 1 259 ? -15.912 42.630 59.717 1.00 45.11 ? 259  ASP A CA  1 
ATOM   1972 C C   . ASP A 1 259 ? -17.140 43.526 59.584 1.00 46.10 ? 259  ASP A C   1 
ATOM   1973 O O   . ASP A 1 259 ? -17.117 44.686 60.037 1.00 45.82 ? 259  ASP A O   1 
ATOM   1974 C CB  . ASP A 1 259 ? -15.183 42.566 58.361 1.00 44.08 ? 259  ASP A CB  1 
ATOM   1975 C CG  . ASP A 1 259 ? -13.776 42.019 58.486 1.00 43.07 ? 259  ASP A CG  1 
ATOM   1976 O OD1 . ASP A 1 259 ? -13.348 41.755 59.616 1.00 41.42 ? 259  ASP A OD1 1 
ATOM   1977 O OD2 . ASP A 1 259 ? -13.087 41.845 57.464 1.00 43.76 ? 259  ASP A OD2 1 
ATOM   1978 N N   . GLU A 1 260 ? -18.214 42.989 58.988 1.00 46.07 ? 260  GLU A N   1 
ATOM   1979 C CA  . GLU A 1 260 ? -19.431 43.785 58.767 1.00 47.50 ? 260  GLU A CA  1 
ATOM   1980 C C   . GLU A 1 260 ? -20.014 44.298 60.081 1.00 46.43 ? 260  GLU A C   1 
ATOM   1981 O O   . GLU A 1 260 ? -20.474 45.452 60.174 1.00 44.49 ? 260  GLU A O   1 
ATOM   1982 C CB  . GLU A 1 260 ? -20.510 42.977 58.001 1.00 50.82 ? 260  GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 260 ? -20.010 42.233 56.731 1.00 56.54 ? 260  GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 260 ? -19.301 40.881 57.043 1.00 60.22 ? 260  GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 260 ? -18.044 40.828 57.194 1.00 61.25 ? 260  GLU A OE1 1 
ATOM   1986 N N   . GLU A 1 261 ? -20.000 43.427 61.088 1.00 45.02 ? 261  GLU A N   1 
ATOM   1987 C CA  . GLU A 1 261 ? -20.507 43.781 62.401 1.00 45.62 ? 261  GLU A CA  1 
ATOM   1988 C C   . GLU A 1 261 ? -19.626 44.888 63.036 1.00 42.94 ? 261  GLU A C   1 
ATOM   1989 O O   . GLU A 1 261 ? -20.147 45.889 63.549 1.00 41.10 ? 261  GLU A O   1 
ATOM   1990 C CB  . GLU A 1 261 ? -20.554 42.526 63.321 1.00 48.80 ? 261  GLU A CB  1 
ATOM   1991 C CG  . GLU A 1 261 ? -21.712 41.532 63.045 1.00 55.07 ? 261  GLU A CG  1 
ATOM   1992 C CD  . GLU A 1 261 ? -23.038 41.982 63.685 1.00 59.73 ? 261  GLU A CD  1 
ATOM   1993 O OE1 . GLU A 1 261 ? -23.139 43.167 64.098 1.00 61.27 ? 261  GLU A OE1 1 
ATOM   1994 O OE2 . GLU A 1 261 ? -23.989 41.156 63.782 1.00 62.27 ? 261  GLU A OE2 1 
ATOM   1995 N N   . LEU A 1 262 ? -18.301 44.694 62.995 1.00 41.43 ? 262  LEU A N   1 
ATOM   1996 C CA  . LEU A 1 262 ? -17.348 45.664 63.557 1.00 39.63 ? 262  LEU A CA  1 
ATOM   1997 C C   . LEU A 1 262 ? -17.484 47.017 62.865 1.00 38.91 ? 262  LEU A C   1 
ATOM   1998 O O   . LEU A 1 262 ? -17.635 48.031 63.520 1.00 39.33 ? 262  LEU A O   1 
ATOM   1999 C CB  . LEU A 1 262 ? -15.903 45.147 63.424 1.00 39.04 ? 262  LEU A CB  1 
ATOM   2000 C CG  . LEU A 1 262 ? -14.755 46.109 63.802 1.00 38.35 ? 262  LEU A CG  1 
ATOM   2001 C CD1 . LEU A 1 262 ? -14.991 46.613 65.215 1.00 36.10 ? 262  LEU A CD1 1 
ATOM   2002 C CD2 . LEU A 1 262 ? -13.374 45.399 63.706 1.00 35.48 ? 262  LEU A CD2 1 
ATOM   2003 N N   . ILE A 1 263 ? -17.482 47.029 61.544 1.00 37.83 ? 263  ILE A N   1 
ATOM   2004 C CA  . ILE A 1 263 ? -17.565 48.295 60.820 1.00 39.64 ? 263  ILE A CA  1 
ATOM   2005 C C   . ILE A 1 263 ? -18.870 49.035 61.064 1.00 40.80 ? 263  ILE A C   1 
ATOM   2006 O O   . ILE A 1 263 ? -18.860 50.251 61.265 1.00 39.79 ? 263  ILE A O   1 
ATOM   2007 C CB  . ILE A 1 263 ? -17.331 48.078 59.301 1.00 39.47 ? 263  ILE A CB  1 
ATOM   2008 C CG1 . ILE A 1 263 ? -15.859 47.727 59.062 1.00 37.13 ? 263  ILE A CG1 1 
ATOM   2009 C CG2 . ILE A 1 263 ? -17.782 49.296 58.509 1.00 39.01 ? 263  ILE A CG2 1 
ATOM   2010 C CD1 . ILE A 1 263 ? -15.625 47.073 57.727 1.00 37.68 ? 263  ILE A CD1 1 
ATOM   2011 N N   . HIS A 1 264 ? -19.990 48.306 61.082 1.00 42.82 ? 264  HIS A N   1 
ATOM   2012 C CA  . HIS A 1 264 ? -21.291 48.940 61.316 1.00 43.69 ? 264  HIS A CA  1 
ATOM   2013 C C   . HIS A 1 264 ? -21.298 49.634 62.679 1.00 42.37 ? 264  HIS A C   1 
ATOM   2014 O O   . HIS A 1 264 ? -21.736 50.799 62.804 1.00 42.49 ? 264  HIS A O   1 
ATOM   2015 C CB  . HIS A 1 264 ? -22.440 47.916 61.220 1.00 48.73 ? 264  HIS A CB  1 
ATOM   2016 C CG  . HIS A 1 264 ? -23.796 48.516 61.478 1.00 53.33 ? 264  HIS A CG  1 
ATOM   2017 N ND1 . HIS A 1 264 ? -24.359 48.589 62.743 1.00 54.74 ? 264  HIS A ND1 1 
ATOM   2018 C CD2 . HIS A 1 264 ? -24.655 49.160 60.648 1.00 54.96 ? 264  HIS A CD2 1 
ATOM   2019 C CE1 . HIS A 1 264 ? -25.501 49.254 62.678 1.00 56.16 ? 264  HIS A CE1 1 
ATOM   2020 N NE2 . HIS A 1 264 ? -25.705 49.611 61.418 1.00 56.66 ? 264  HIS A NE2 1 
ATOM   2021 N N   . CYS A 1 265 ? -20.815 48.930 63.705 1.00 40.91 ? 265  CYS A N   1 
ATOM   2022 C CA  . CYS A 1 265 ? -20.706 49.520 65.041 1.00 40.82 ? 265  CYS A CA  1 
ATOM   2023 C C   . CYS A 1 265 ? -19.829 50.809 65.020 1.00 39.83 ? 265  CYS A C   1 
ATOM   2024 O O   . CYS A 1 265 ? -20.239 51.852 65.540 1.00 39.37 ? 265  CYS A O   1 
ATOM   2025 C CB  . CYS A 1 265 ? -20.088 48.503 66.018 1.00 41.93 ? 265  CYS A CB  1 
ATOM   2026 S SG  . CYS A 1 265 ? -19.704 49.172 67.689 1.00 42.83 ? 265  CYS A SG  1 
ATOM   2027 N N   . LEU A 1 266 ? -18.644 50.720 64.403 1.00 39.19 ? 266  LEU A N   1 
ATOM   2028 C CA  . LEU A 1 266 ? -17.718 51.853 64.320 1.00 39.13 ? 266  LEU A CA  1 
ATOM   2029 C C   . LEU A 1 266 ? -18.334 52.992 63.527 1.00 40.44 ? 266  LEU A C   1 
ATOM   2030 O O   . LEU A 1 266 ? -18.063 54.153 63.816 1.00 42.34 ? 266  LEU A O   1 
ATOM   2031 C CB  . LEU A 1 266 ? -16.357 51.425 63.708 1.00 36.74 ? 266  LEU A CB  1 
ATOM   2032 C CG  . LEU A 1 266 ? -15.504 50.435 64.531 1.00 34.89 ? 266  LEU A CG  1 
ATOM   2033 C CD1 . LEU A 1 266 ? -14.226 50.145 63.794 1.00 33.52 ? 266  LEU A CD1 1 
ATOM   2034 C CD2 . LEU A 1 266 ? -15.183 50.998 65.909 1.00 34.95 ? 266  LEU A CD2 1 
ATOM   2035 N N   . ARG A 1 267 ? -19.181 52.699 62.542 1.00 41.16 ? 267  ARG A N   1 
ATOM   2036 C CA  . ARG A 1 267 ? -19.792 53.804 61.808 1.00 41.92 ? 267  ARG A CA  1 
ATOM   2037 C C   . ARG A 1 267 ? -20.846 54.567 62.615 1.00 43.24 ? 267  ARG A C   1 
ATOM   2038 O O   . ARG A 1 267 ? -21.151 55.710 62.278 1.00 43.67 ? 267  ARG A O   1 
ATOM   2039 C CB  . ARG A 1 267 ? -20.408 53.318 60.501 1.00 41.66 ? 267  ARG A CB  1 
ATOM   2040 C CG  . ARG A 1 267 ? -19.389 52.975 59.482 1.00 41.91 ? 267  ARG A CG  1 
ATOM   2041 C CD  . ARG A 1 267 ? -20.016 52.586 58.205 1.00 42.23 ? 267  ARG A CD  1 
ATOM   2042 N NE  . ARG A 1 267 ? -18.976 52.490 57.205 1.00 43.43 ? 267  ARG A NE  1 
ATOM   2043 C CZ  . ARG A 1 267 ? -19.031 51.696 56.150 1.00 43.24 ? 267  ARG A CZ  1 
ATOM   2044 N NH1 . ARG A 1 267 ? -20.098 50.926 55.972 1.00 43.30 ? 267  ARG A NH1 1 
ATOM   2045 N NH2 . ARG A 1 267 ? -18.020 51.677 55.283 1.00 43.26 ? 267  ARG A NH2 1 
ATOM   2046 N N   . GLU A 1 268 ? -21.389 53.955 63.675 1.00 44.59 ? 268  GLU A N   1 
ATOM   2047 C CA  . GLU A 1 268 ? -22.424 54.609 64.516 1.00 46.65 ? 268  GLU A CA  1 
ATOM   2048 C C   . GLU A 1 268 ? -21.855 55.498 65.606 1.00 44.98 ? 268  GLU A C   1 
ATOM   2049 O O   . GLU A 1 268 ? -22.585 56.259 66.227 1.00 45.34 ? 268  GLU A O   1 
ATOM   2050 C CB  . GLU A 1 268 ? -23.324 53.578 65.237 1.00 48.79 ? 268  GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 268 ? -24.210 52.773 64.331 1.00 56.74 ? 268  GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 268 ? -25.140 53.670 63.515 1.00 60.92 ? 268  GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 268 ? -25.489 53.286 62.366 1.00 63.62 ? 268  GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 268 ? -25.518 54.759 64.029 1.00 63.00 ? 268  GLU A OE2 1 
ATOM   2055 N N   . LYS A 1 269 ? -20.569 55.362 65.885 1.00 43.32 ? 269  LYS A N   1 
ATOM   2056 C CA  . LYS A 1 269 ? -19.949 56.162 66.951 1.00 41.33 ? 269  LYS A CA  1 
ATOM   2057 C C   . LYS A 1 269 ? -19.704 57.589 66.477 1.00 39.57 ? 269  LYS A C   1 
ATOM   2058 O O   . LYS A 1 269 ? -19.387 57.790 65.315 1.00 38.40 ? 269  LYS A O   1 
ATOM   2059 C CB  . LYS A 1 269 ? -18.640 55.492 67.353 1.00 40.73 ? 269  LYS A CB  1 
ATOM   2060 C CG  . LYS A 1 269 ? -18.832 54.053 67.815 1.00 42.71 ? 269  LYS A CG  1 
ATOM   2061 C CD  . LYS A 1 269 ? -19.800 54.024 69.022 1.00 43.38 ? 269  LYS A CD  1 
ATOM   2062 C CE  . LYS A 1 269 ? -19.728 52.705 69.748 1.00 45.48 ? 269  LYS A CE  1 
ATOM   2063 N NZ  . LYS A 1 269 ? -20.499 52.795 71.036 1.00 49.94 ? 269  LYS A NZ  1 
ATOM   2064 N N   . LYS A 1 270 ? -19.886 58.583 67.349 1.00 39.47 ? 270  LYS A N   1 
ATOM   2065 C CA  . LYS A 1 270 ? -19.625 59.963 66.926 1.00 38.70 ? 270  LYS A CA  1 
ATOM   2066 C C   . LYS A 1 270 ? -18.080 60.014 66.702 1.00 36.67 ? 270  LYS A C   1 
ATOM   2067 O O   . LYS A 1 270 ? -17.350 59.224 67.276 1.00 34.46 ? 270  LYS A O   1 
ATOM   2068 C CB  . LYS A 1 270 ? -20.038 60.970 68.021 1.00 40.03 ? 270  LYS A CB  1 
ATOM   2069 C CG  . LYS A 1 270 ? -21.545 60.989 68.432 1.00 43.88 ? 270  LYS A CG  1 
ATOM   2070 N N   . PRO A 1 271 ? -17.575 60.920 65.846 1.00 35.59 ? 271  PRO A N   1 
ATOM   2071 C CA  . PRO A 1 271 ? -16.116 61.003 65.605 1.00 34.59 ? 271  PRO A CA  1 
ATOM   2072 C C   . PRO A 1 271 ? -15.238 61.014 66.892 1.00 34.00 ? 271  PRO A C   1 
ATOM   2073 O O   . PRO A 1 271 ? -14.282 60.231 67.031 1.00 31.59 ? 271  PRO A O   1 
ATOM   2074 C CB  . PRO A 1 271 ? -15.964 62.305 64.824 1.00 33.45 ? 271  PRO A CB  1 
ATOM   2075 C CG  . PRO A 1 271 ? -17.288 62.443 64.130 1.00 34.64 ? 271  PRO A CG  1 
ATOM   2076 C CD  . PRO A 1 271 ? -18.299 61.989 65.139 1.00 33.85 ? 271  PRO A CD  1 
ATOM   2077 N N   . GLN A 1 272 ? -15.578 61.892 67.830 1.00 34.58 ? 272  GLN A N   1 
ATOM   2078 C CA  . GLN A 1 272 ? -14.839 62.002 69.092 1.00 35.34 ? 272  GLN A CA  1 
ATOM   2079 C C   . GLN A 1 272 ? -14.752 60.710 69.931 1.00 36.50 ? 272  GLN A C   1 
ATOM   2080 O O   . GLN A 1 272 ? -13.822 60.568 70.737 1.00 36.20 ? 272  GLN A O   1 
ATOM   2081 C CB  . GLN A 1 272 ? -15.439 63.126 69.959 1.00 35.93 ? 272  GLN A CB  1 
ATOM   2082 C CG  . GLN A 1 272 ? -14.489 63.620 71.065 1.00 36.41 ? 272  GLN A CG  1 
ATOM   2083 C CD  . GLN A 1 272 ? -13.092 64.017 70.496 1.00 36.77 ? 272  GLN A CD  1 
ATOM   2084 O OE1 . GLN A 1 272 ? -13.005 64.775 69.518 1.00 35.54 ? 272  GLN A OE1 1 
ATOM   2085 N NE2 . GLN A 1 272 ? -12.015 63.498 71.116 1.00 32.74 ? 272  GLN A NE2 1 
ATOM   2086 N N   . GLU A 1 273 ? -15.701 59.777 69.771 1.00 35.70 ? 273  GLU A N   1 
ATOM   2087 C CA  . GLU A 1 273 ? -15.652 58.520 70.525 1.00 36.16 ? 273  GLU A CA  1 
ATOM   2088 C C   . GLU A 1 273 ? -14.494 57.707 69.996 1.00 35.57 ? 273  GLU A C   1 
ATOM   2089 O O   . GLU A 1 273 ? -13.824 57.018 70.754 1.00 35.92 ? 273  GLU A O   1 
ATOM   2090 C CB  . GLU A 1 273 ? -16.966 57.722 70.392 1.00 37.44 ? 273  GLU A CB  1 
ATOM   2091 C CG  . GLU A 1 273 ? -18.175 58.464 70.924 1.00 40.03 ? 273  GLU A CG  1 
ATOM   2092 C CD  . GLU A 1 273 ? -19.414 57.620 70.839 1.00 43.41 ? 273  GLU A CD  1 
ATOM   2093 O OE1 . GLU A 1 273 ? -19.538 56.712 71.682 1.00 45.80 ? 273  GLU A OE1 1 
ATOM   2094 O OE2 . GLU A 1 273 ? -20.238 57.836 69.927 1.00 42.35 ? 273  GLU A OE2 1 
ATOM   2095 N N   . LEU A 1 274 ? -14.254 57.779 68.688 1.00 35.16 ? 274  LEU A N   1 
ATOM   2096 C CA  . LEU A 1 274 ? -13.120 57.059 68.123 1.00 35.00 ? 274  LEU A CA  1 
ATOM   2097 C C   . LEU A 1 274 ? -11.811 57.740 68.534 1.00 33.13 ? 274  LEU A C   1 
ATOM   2098 O O   . LEU A 1 274 ? -10.862 57.084 68.974 1.00 32.10 ? 274  LEU A O   1 
ATOM   2099 C CB  . LEU A 1 274 ? -13.210 56.976 66.580 1.00 37.35 ? 274  LEU A CB  1 
ATOM   2100 C CG  . LEU A 1 274 ? -13.905 55.750 65.935 1.00 38.36 ? 274  LEU A CG  1 
ATOM   2101 C CD1 . LEU A 1 274 ? -15.104 55.361 66.710 1.00 39.20 ? 274  LEU A CD1 1 
ATOM   2102 C CD2 . LEU A 1 274 ? -14.323 56.080 64.534 1.00 39.29 ? 274  LEU A CD2 1 
ATOM   2103 N N   . ILE A 1 275 ? -11.740 59.053 68.379 1.00 32.81 ? 275  ILE A N   1 
ATOM   2104 C CA  . ILE A 1 275 ? -10.522 59.753 68.746 1.00 31.83 ? 275  ILE A CA  1 
ATOM   2105 C C   . ILE A 1 275 ? -10.179 59.533 70.252 1.00 32.85 ? 275  ILE A C   1 
ATOM   2106 O O   . ILE A 1 275 ? -9.003  59.324 70.593 1.00 32.26 ? 275  ILE A O   1 
ATOM   2107 C CB  . ILE A 1 275 ? -10.671 61.251 68.447 1.00 32.01 ? 275  ILE A CB  1 
ATOM   2108 C CG1 . ILE A 1 275 ? -10.819 61.431 66.936 1.00 32.01 ? 275  ILE A CG1 1 
ATOM   2109 C CG2 . ILE A 1 275 ? -9.493  62.083 69.069 1.00 27.96 ? 275  ILE A CG2 1 
ATOM   2110 C CD1 . ILE A 1 275 ? -11.434 62.796 66.573 1.00 31.35 ? 275  ILE A CD1 1 
ATOM   2111 N N   . ASP A 1 276 ? -11.184 59.557 71.140 1.00 31.39 ? 276  ASP A N   1 
ATOM   2112 C CA  . ASP A 1 276 ? -10.931 59.365 72.579 1.00 31.77 ? 276  ASP A CA  1 
ATOM   2113 C C   . ASP A 1 276 ? -10.215 58.057 72.983 1.00 30.96 ? 276  ASP A C   1 
ATOM   2114 O O   . ASP A 1 276 ? -9.572  58.010 74.042 1.00 29.91 ? 276  ASP A O   1 
ATOM   2115 C CB  . ASP A 1 276 ? -12.263 59.480 73.381 1.00 34.94 ? 276  ASP A CB  1 
ATOM   2116 C CG  . ASP A 1 276 ? -12.696 60.948 73.621 1.00 35.04 ? 276  ASP A CG  1 
ATOM   2117 O OD1 . ASP A 1 276 ? -11.855 61.868 73.440 1.00 38.80 ? 276  ASP A OD1 1 
ATOM   2118 O OD2 . ASP A 1 276 ? -13.862 61.191 73.993 1.00 36.06 ? 276  ASP A OD2 1 
ATOM   2119 N N   . VAL A 1 277 ? -10.297 57.005 72.164 1.00 29.70 ? 277  VAL A N   1 
ATOM   2120 C CA  . VAL A 1 277 ? -9.644  55.736 72.536 1.00 29.07 ? 277  VAL A CA  1 
ATOM   2121 C C   . VAL A 1 277 ? -8.536  55.317 71.559 1.00 28.65 ? 277  VAL A C   1 
ATOM   2122 O O   . VAL A 1 277 ? -7.921  54.262 71.713 1.00 29.25 ? 277  VAL A O   1 
ATOM   2123 C CB  . VAL A 1 277 ? -10.684 54.567 72.631 1.00 28.28 ? 277  VAL A CB  1 
ATOM   2124 C CG1 . VAL A 1 277 ? -11.695 54.856 73.692 1.00 28.28 ? 277  VAL A CG1 1 
ATOM   2125 C CG2 . VAL A 1 277 ? -11.373 54.360 71.310 1.00 28.65 ? 277  VAL A CG2 1 
ATOM   2126 N N   . GLU A 1 278 ? -8.293  56.151 70.555 1.00 27.74 ? 278  GLU A N   1 
ATOM   2127 C CA  . GLU A 1 278 ? -7.279  55.888 69.520 1.00 28.85 ? 278  GLU A CA  1 
ATOM   2128 C C   . GLU A 1 278 ? -5.915  55.392 70.034 1.00 28.45 ? 278  GLU A C   1 
ATOM   2129 O O   . GLU A 1 278 ? -5.346  54.448 69.508 1.00 28.95 ? 278  GLU A O   1 
ATOM   2130 C CB  . GLU A 1 278 ? -7.047  57.178 68.743 1.00 29.19 ? 278  GLU A CB  1 
ATOM   2131 C CG  . GLU A 1 278 ? -6.074  57.092 67.568 1.00 30.21 ? 278  GLU A CG  1 
ATOM   2132 C CD  . GLU A 1 278 ? -5.837  58.442 66.839 1.00 29.25 ? 278  GLU A CD  1 
ATOM   2133 O OE1 . GLU A 1 278 ? -6.771  59.258 66.701 1.00 30.15 ? 278  GLU A OE1 1 
ATOM   2134 O OE2 . GLU A 1 278 ? -4.701  58.656 66.373 1.00 30.47 ? 278  GLU A OE2 1 
ATOM   2135 N N   . TRP A 1 279 ? -5.375  56.063 71.043 1.00 28.81 ? 279  TRP A N   1 
ATOM   2136 C CA  . TRP A 1 279 ? -4.070  55.714 71.564 1.00 27.97 ? 279  TRP A CA  1 
ATOM   2137 C C   . TRP A 1 279 ? -4.089  54.408 72.346 1.00 29.21 ? 279  TRP A C   1 
ATOM   2138 O O   . TRP A 1 279 ? -3.032  53.872 72.643 1.00 29.14 ? 279  TRP A O   1 
ATOM   2139 C CB  . TRP A 1 279 ? -3.520  56.851 72.436 1.00 27.94 ? 279  TRP A CB  1 
ATOM   2140 C CG  . TRP A 1 279 ? -3.322  58.120 71.667 1.00 29.29 ? 279  TRP A CG  1 
ATOM   2141 C CD1 . TRP A 1 279 ? -4.209  59.179 71.561 1.00 29.38 ? 279  TRP A CD1 1 
ATOM   2142 C CD2 . TRP A 1 279 ? -2.238  58.419 70.769 1.00 26.88 ? 279  TRP A CD2 1 
ATOM   2143 N NE1 . TRP A 1 279 ? -3.735  60.091 70.646 1.00 27.75 ? 279  TRP A NE1 1 
ATOM   2144 C CE2 . TRP A 1 279 ? -2.535  59.645 70.141 1.00 29.62 ? 279  TRP A CE2 1 
ATOM   2145 C CE3 . TRP A 1 279 ? -1.069  57.759 70.423 1.00 28.72 ? 279  TRP A CE3 1 
ATOM   2146 C CZ2 . TRP A 1 279 ? -1.679  60.233 69.185 1.00 27.72 ? 279  TRP A CZ2 1 
ATOM   2147 C CZ3 . TRP A 1 279 ? -0.220  58.338 69.468 1.00 28.91 ? 279  TRP A CZ3 1 
ATOM   2148 C CH2 . TRP A 1 279 ? -0.544  59.559 68.860 1.00 27.96 ? 279  TRP A CH2 1 
ATOM   2149 N N   . ASN A 1 280 ? -5.268  53.866 72.650 1.00 29.80 ? 280  ASN A N   1 
ATOM   2150 C CA  . ASN A 1 280 ? -5.310  52.596 73.390 1.00 31.92 ? 280  ASN A CA  1 
ATOM   2151 C C   . ASN A 1 280 ? -4.961  51.371 72.575 1.00 32.08 ? 280  ASN A C   1 
ATOM   2152 O O   . ASN A 1 280 ? -4.681  50.329 73.138 1.00 33.34 ? 280  ASN A O   1 
ATOM   2153 C CB  . ASN A 1 280 ? -6.693  52.339 74.006 1.00 33.33 ? 280  ASN A CB  1 
ATOM   2154 C CG  . ASN A 1 280 ? -7.090  53.409 75.055 1.00 34.83 ? 280  ASN A CG  1 
ATOM   2155 O OD1 . ASN A 1 280 ? -6.256  54.213 75.514 1.00 37.13 ? 280  ASN A OD1 1 
ATOM   2156 N ND2 . ASN A 1 280 ? -8.359  53.417 75.430 1.00 33.04 ? 280  ASN A ND2 1 
ATOM   2157 N N   . VAL A 1 281 ? -4.975  51.464 71.254 1.00 31.48 ? 281  VAL A N   1 
ATOM   2158 C CA  . VAL A 1 281 ? -4.713  50.273 70.456 1.00 30.33 ? 281  VAL A CA  1 
ATOM   2159 C C   . VAL A 1 281 ? -3.268  50.011 70.067 1.00 29.91 ? 281  VAL A C   1 
ATOM   2160 O O   . VAL A 1 281 ? -2.999  49.036 69.365 1.00 29.89 ? 281  VAL A O   1 
ATOM   2161 C CB  . VAL A 1 281 ? -5.596  50.252 69.158 1.00 32.70 ? 281  VAL A CB  1 
ATOM   2162 C CG1 . VAL A 1 281 ? -7.064  50.537 69.553 1.00 31.65 ? 281  VAL A CG1 1 
ATOM   2163 C CG2 . VAL A 1 281 ? -5.115  51.299 68.105 1.00 30.32 ? 281  VAL A CG2 1 
ATOM   2164 N N   . LEU A 1 282 ? -2.338  50.874 70.482 1.00 28.40 ? 282  LEU A N   1 
ATOM   2165 C CA  . LEU A 1 282 ? -0.919  50.636 70.154 1.00 29.26 ? 282  LEU A CA  1 
ATOM   2166 C C   . LEU A 1 282 ? -0.552  49.297 70.782 1.00 30.40 ? 282  LEU A C   1 
ATOM   2167 O O   . LEU A 1 282 ? -1.006  48.965 71.885 1.00 29.97 ? 282  LEU A O   1 
ATOM   2168 C CB  . LEU A 1 282 ? -0.013  51.714 70.757 1.00 27.72 ? 282  LEU A CB  1 
ATOM   2169 C CG  . LEU A 1 282 ? -0.140  53.003 69.933 1.00 28.12 ? 282  LEU A CG  1 
ATOM   2170 C CD1 . LEU A 1 282 ? 0.649   54.096 70.558 1.00 27.61 ? 282  LEU A CD1 1 
ATOM   2171 C CD2 . LEU A 1 282 ? 0.291   52.757 68.493 1.00 27.25 ? 282  LEU A CD2 1 
ATOM   2172 N N   . PRO A 1 283 ? 0.278   48.514 70.106 1.00 31.17 ? 283  PRO A N   1 
ATOM   2173 C CA  . PRO A 1 283 ? 0.613   47.223 70.725 1.00 31.16 ? 283  PRO A CA  1 
ATOM   2174 C C   . PRO A 1 283 ? 1.638   47.329 71.835 1.00 32.28 ? 283  PRO A C   1 
ATOM   2175 O O   . PRO A 1 283 ? 1.689   46.478 72.715 1.00 33.45 ? 283  PRO A O   1 
ATOM   2176 C CB  . PRO A 1 283 ? 1.152   46.394 69.535 1.00 30.83 ? 283  PRO A CB  1 
ATOM   2177 C CG  . PRO A 1 283 ? 1.854   47.531 68.670 1.00 31.33 ? 283  PRO A CG  1 
ATOM   2178 C CD  . PRO A 1 283 ? 0.779   48.621 68.715 1.00 29.22 ? 283  PRO A CD  1 
ATOM   2179 N N   . PHE A 1 284 ? 2.477   48.355 71.804 1.00 32.05 ? 284  PHE A N   1 
ATOM   2180 C CA  . PHE A 1 284 ? 3.518   48.467 72.818 1.00 31.79 ? 284  PHE A CA  1 
ATOM   2181 C C   . PHE A 1 284 ? 3.554   49.824 73.506 1.00 30.81 ? 284  PHE A C   1 
ATOM   2182 O O   . PHE A 1 284 ? 3.077   50.817 72.966 1.00 30.35 ? 284  PHE A O   1 
ATOM   2183 C CB  . PHE A 1 284 ? 4.897   48.309 72.172 1.00 35.63 ? 284  PHE A CB  1 
ATOM   2184 C CG  . PHE A 1 284 ? 5.000   47.168 71.220 1.00 39.58 ? 284  PHE A CG  1 
ATOM   2185 C CD1 . PHE A 1 284 ? 5.010   45.857 71.689 1.00 42.00 ? 284  PHE A CD1 1 
ATOM   2186 C CD2 . PHE A 1 284 ? 5.093   47.402 69.849 1.00 41.40 ? 284  PHE A CD2 1 
ATOM   2187 C CE1 . PHE A 1 284 ? 5.117   44.768 70.797 1.00 43.53 ? 284  PHE A CE1 1 
ATOM   2188 C CE2 . PHE A 1 284 ? 5.200   46.340 68.951 1.00 43.25 ? 284  PHE A CE2 1 
ATOM   2189 C CZ  . PHE A 1 284 ? 5.208   45.008 69.429 1.00 43.37 ? 284  PHE A CZ  1 
ATOM   2190 N N   . ASP A 1 285 ? 4.177   49.858 74.681 1.00 28.94 ? 285  ASP A N   1 
ATOM   2191 C CA  . ASP A 1 285 ? 4.410   51.108 75.426 1.00 28.43 ? 285  ASP A CA  1 
ATOM   2192 C C   . ASP A 1 285 ? 5.484   51.750 74.488 1.00 28.36 ? 285  ASP A C   1 
ATOM   2193 O O   . ASP A 1 285 ? 6.570   51.201 74.296 1.00 27.96 ? 285  ASP A O   1 
ATOM   2194 C CB  . ASP A 1 285 ? 5.009   50.748 76.789 1.00 27.88 ? 285  ASP A CB  1 
ATOM   2195 C CG  . ASP A 1 285 ? 5.109   51.946 77.718 1.00 30.54 ? 285  ASP A CG  1 
ATOM   2196 O OD1 . ASP A 1 285 ? 4.702   53.060 77.311 1.00 27.15 ? 285  ASP A OD1 1 
ATOM   2197 O OD2 . ASP A 1 285 ? 5.596   51.764 78.864 1.00 32.66 ? 285  ASP A OD2 1 
ATOM   2198 N N   . SER A 1 286 ? 5.215   52.892 73.892 1.00 26.82 ? 286  SER A N   1 
ATOM   2199 C CA  . SER A 1 286 ? 6.177   53.364 72.927 1.00 27.26 ? 286  SER A CA  1 
ATOM   2200 C C   . SER A 1 286 ? 6.087   54.839 72.708 1.00 27.22 ? 286  SER A C   1 
ATOM   2201 O O   . SER A 1 286 ? 5.187   55.503 73.187 1.00 27.76 ? 286  SER A O   1 
ATOM   2202 C CB  . SER A 1 286 ? 5.911   52.689 71.582 1.00 26.55 ? 286  SER A CB  1 
ATOM   2203 O OG  . SER A 1 286 ? 4.633   53.097 71.140 1.00 27.69 ? 286  SER A OG  1 
ATOM   2204 N N   . ILE A 1 287 ? 7.032   55.318 71.932 1.00 28.52 ? 287  ILE A N   1 
ATOM   2205 C CA  . ILE A 1 287 ? 7.134   56.712 71.539 1.00 28.33 ? 287  ILE A CA  1 
ATOM   2206 C C   . ILE A 1 287 ? 7.336   56.716 70.019 1.00 26.83 ? 287  ILE A C   1 
ATOM   2207 O O   . ILE A 1 287 ? 7.929   55.765 69.452 1.00 23.74 ? 287  ILE A O   1 
ATOM   2208 C CB  . ILE A 1 287 ? 8.268   57.348 72.407 1.00 30.58 ? 287  ILE A CB  1 
ATOM   2209 C CG1 . ILE A 1 287 ? 7.679   58.558 73.029 1.00 32.39 ? 287  ILE A CG1 1 
ATOM   2210 C CG2 . ILE A 1 287 ? 9.600   57.509 71.790 1.00 25.34 ? 287  ILE A CG2 1 
ATOM   2211 C CD1 . ILE A 1 287 ? 6.921   58.108 74.152 1.00 32.57 ? 287  ILE A CD1 1 
ATOM   2212 N N   . PHE A 1 288 ? 6.769   57.718 69.352 1.00 24.49 ? 288  PHE A N   1 
ATOM   2213 C CA  . PHE A 1 288 ? 6.890   57.841 67.889 1.00 24.00 ? 288  PHE A CA  1 
ATOM   2214 C C   . PHE A 1 288 ? 6.221   56.673 67.135 1.00 24.52 ? 288  PHE A C   1 
ATOM   2215 O O   . PHE A 1 288 ? 6.749   56.137 66.151 1.00 24.67 ? 288  PHE A O   1 
ATOM   2216 C CB  . PHE A 1 288 ? 8.356   57.937 67.459 1.00 22.31 ? 288  PHE A CB  1 
ATOM   2217 C CG  . PHE A 1 288 ? 8.593   58.939 66.357 1.00 22.76 ? 288  PHE A CG  1 
ATOM   2218 C CD1 . PHE A 1 288 ? 7.823   58.928 65.213 1.00 21.04 ? 288  PHE A CD1 1 
ATOM   2219 C CD2 . PHE A 1 288 ? 9.602   59.889 66.458 1.00 24.15 ? 288  PHE A CD2 1 
ATOM   2220 C CE1 . PHE A 1 288 ? 8.054   59.838 64.178 1.00 24.86 ? 288  PHE A CE1 1 
ATOM   2221 C CE2 . PHE A 1 288 ? 9.840   60.808 65.416 1.00 24.55 ? 288  PHE A CE2 1 
ATOM   2222 C CZ  . PHE A 1 288 ? 9.062   60.778 64.275 1.00 22.80 ? 288  PHE A CZ  1 
ATOM   2223 N N   . ARG A 1 289 ? 5.065   56.257 67.635 1.00 24.70 ? 289  ARG A N   1 
ATOM   2224 C CA  . ARG A 1 289 ? 4.294   55.170 67.015 1.00 25.15 ? 289  ARG A CA  1 
ATOM   2225 C C   . ARG A 1 289 ? 2.827   55.677 67.057 1.00 25.15 ? 289  ARG A C   1 
ATOM   2226 O O   . ARG A 1 289 ? 2.347   56.183 68.083 1.00 25.19 ? 289  ARG A O   1 
ATOM   2227 C CB  . ARG A 1 289 ? 4.465   53.833 67.783 1.00 23.76 ? 289  ARG A CB  1 
ATOM   2228 C CG  . ARG A 1 289 ? 5.819   53.218 67.677 1.00 25.28 ? 289  ARG A CG  1 
ATOM   2229 C CD  . ARG A 1 289 ? 6.157   52.824 66.243 1.00 27.83 ? 289  ARG A CD  1 
ATOM   2230 N NE  . ARG A 1 289 ? 7.447   52.128 66.192 1.00 27.21 ? 289  ARG A NE  1 
ATOM   2231 C CZ  . ARG A 1 289 ? 8.626   52.735 66.045 1.00 27.93 ? 289  ARG A CZ  1 
ATOM   2232 N NH1 . ARG A 1 289 ? 8.684   54.045 65.938 1.00 27.92 ? 289  ARG A NH1 1 
ATOM   2233 N NH2 . ARG A 1 289 ? 9.751   52.031 65.963 1.00 26.23 ? 289  ARG A NH2 1 
ATOM   2234 N N   . PHE A 1 290 ? 2.151   55.553 65.925 1.00 25.21 ? 290  PHE A N   1 
ATOM   2235 C CA  . PHE A 1 290 ? 0.795   56.044 65.780 1.00 25.99 ? 290  PHE A CA  1 
ATOM   2236 C C   . PHE A 1 290 ? -0.146  54.901 65.440 1.00 25.45 ? 290  PHE A C   1 
ATOM   2237 O O   . PHE A 1 290 ? 0.230   53.939 64.768 1.00 24.69 ? 290  PHE A O   1 
ATOM   2238 C CB  . PHE A 1 290 ? 0.824   57.137 64.706 1.00 25.66 ? 290  PHE A CB  1 
ATOM   2239 C CG  . PHE A 1 290 ? 1.979   58.096 64.895 1.00 26.48 ? 290  PHE A CG  1 
ATOM   2240 C CD1 . PHE A 1 290 ? 2.086   58.834 66.059 1.00 24.69 ? 290  PHE A CD1 1 
ATOM   2241 C CD2 . PHE A 1 290 ? 3.013   58.177 63.945 1.00 24.80 ? 290  PHE A CD2 1 
ATOM   2242 C CE1 . PHE A 1 290 ? 3.242   59.650 66.288 1.00 27.66 ? 290  PHE A CE1 1 
ATOM   2243 C CE2 . PHE A 1 290 ? 4.135   58.973 64.158 1.00 26.78 ? 290  PHE A CE2 1 
ATOM   2244 C CZ  . PHE A 1 290 ? 4.257   59.714 65.329 1.00 26.75 ? 290  PHE A CZ  1 
ATOM   2245 N N   . SER A 1 291 ? -1.377  55.014 65.889 1.00 25.44 ? 291  SER A N   1 
ATOM   2246 C CA  . SER A 1 291 ? -2.312  53.893 65.713 1.00 27.99 ? 291  SER A CA  1 
ATOM   2247 C C   . SER A 1 291 ? -2.749  53.459 64.312 1.00 27.10 ? 291  SER A C   1 
ATOM   2248 O O   . SER A 1 291 ? -2.618  52.298 63.951 1.00 26.95 ? 291  SER A O   1 
ATOM   2249 C CB  . SER A 1 291 ? -3.563  54.143 66.573 1.00 26.91 ? 291  SER A CB  1 
ATOM   2250 O OG  . SER A 1 291 ? -3.175  54.013 67.926 1.00 29.40 ? 291  SER A OG  1 
ATOM   2251 N N   . PHE A 1 292 ? -3.249  54.416 63.541 1.00 28.01 ? 292  PHE A N   1 
ATOM   2252 C CA  . PHE A 1 292 ? -3.761  54.135 62.210 1.00 27.78 ? 292  PHE A CA  1 
ATOM   2253 C C   . PHE A 1 292 ? -2.919  54.779 61.142 1.00 26.26 ? 292  PHE A C   1 
ATOM   2254 O O   . PHE A 1 292 ? -2.938  55.981 60.963 1.00 26.07 ? 292  PHE A O   1 
ATOM   2255 C CB  . PHE A 1 292 ? -5.213  54.607 62.162 1.00 26.92 ? 292  PHE A CB  1 
ATOM   2256 C CG  . PHE A 1 292 ? -6.059  53.941 63.187 1.00 28.90 ? 292  PHE A CG  1 
ATOM   2257 C CD1 . PHE A 1 292 ? -6.433  52.601 63.018 1.00 28.30 ? 292  PHE A CD1 1 
ATOM   2258 C CD2 . PHE A 1 292 ? -6.432  54.617 64.369 1.00 28.19 ? 292  PHE A CD2 1 
ATOM   2259 C CE1 . PHE A 1 292 ? -7.158  51.923 64.003 1.00 28.47 ? 292  PHE A CE1 1 
ATOM   2260 C CE2 . PHE A 1 292 ? -7.158  53.939 65.375 1.00 29.81 ? 292  PHE A CE2 1 
ATOM   2261 C CZ  . PHE A 1 292 ? -7.517  52.580 65.179 1.00 30.17 ? 292  PHE A CZ  1 
ATOM   2262 N N   . VAL A 1 293 ? -2.179  53.936 60.435 1.00 25.28 ? 293  VAL A N   1 
ATOM   2263 C CA  . VAL A 1 293 ? -1.277  54.372 59.426 1.00 24.25 ? 293  VAL A CA  1 
ATOM   2264 C C   . VAL A 1 293 ? -1.453  53.448 58.207 1.00 25.42 ? 293  VAL A C   1 
ATOM   2265 O O   . VAL A 1 293 ? -2.163  52.445 58.265 1.00 26.77 ? 293  VAL A O   1 
ATOM   2266 C CB  . VAL A 1 293 ? 0.186   54.264 59.963 1.00 22.62 ? 293  VAL A CB  1 
ATOM   2267 C CG1 . VAL A 1 293 ? 0.396   55.200 61.168 1.00 22.03 ? 293  VAL A CG1 1 
ATOM   2268 C CG2 . VAL A 1 293 ? 0.487   52.811 60.373 1.00 21.56 ? 293  VAL A CG2 1 
ATOM   2269 N N   . PRO A 1 294 ? -0.827  53.797 57.086 1.00 25.46 ? 294  PRO A N   1 
ATOM   2270 C CA  . PRO A 1 294 ? -0.897  53.000 55.860 1.00 27.58 ? 294  PRO A CA  1 
ATOM   2271 C C   . PRO A 1 294 ? -0.608  51.498 56.098 1.00 29.30 ? 294  PRO A C   1 
ATOM   2272 O O   . PRO A 1 294 ? 0.191   51.155 56.980 1.00 29.55 ? 294  PRO A O   1 
ATOM   2273 C CB  . PRO A 1 294 ? 0.185   53.647 54.981 1.00 24.05 ? 294  PRO A CB  1 
ATOM   2274 C CG  . PRO A 1 294 ? -0.044  55.136 55.291 1.00 26.00 ? 294  PRO A CG  1 
ATOM   2275 C CD  . PRO A 1 294 ? -0.274  55.145 56.818 1.00 24.46 ? 294  PRO A CD  1 
ATOM   2276 N N   . VAL A 1 295 ? -1.221  50.626 55.295 1.00 29.84 ? 295  VAL A N   1 
ATOM   2277 C CA  . VAL A 1 295 ? -0.986  49.183 55.387 1.00 31.20 ? 295  VAL A CA  1 
ATOM   2278 C C   . VAL A 1 295 ? -0.345  48.690 54.118 1.00 30.62 ? 295  VAL A C   1 
ATOM   2279 O O   . VAL A 1 295 ? -0.691  49.160 53.022 1.00 30.30 ? 295  VAL A O   1 
ATOM   2280 C CB  . VAL A 1 295 ? -2.274  48.343 55.562 1.00 31.75 ? 295  VAL A CB  1 
ATOM   2281 C CG1 . VAL A 1 295 ? -2.648  48.351 56.966 1.00 34.40 ? 295  VAL A CG1 1 
ATOM   2282 C CG2 . VAL A 1 295 ? -3.437  48.868 54.702 1.00 32.37 ? 295  VAL A CG2 1 
ATOM   2283 N N   . ILE A 1 296 ? 0.599   47.762 54.258 1.00 30.53 ? 296  ILE A N   1 
ATOM   2284 C CA  . ILE A 1 296 ? 1.263   47.170 53.100 1.00 30.98 ? 296  ILE A CA  1 
ATOM   2285 C C   . ILE A 1 296 ? 0.209   46.161 52.619 1.00 32.04 ? 296  ILE A C   1 
ATOM   2286 O O   . ILE A 1 296 ? 0.076   45.032 53.119 1.00 31.87 ? 296  ILE A O   1 
ATOM   2287 C CB  . ILE A 1 296 ? 2.581   46.526 53.553 1.00 31.91 ? 296  ILE A CB  1 
ATOM   2288 C CG1 . ILE A 1 296 ? 3.426   47.605 54.242 1.00 30.18 ? 296  ILE A CG1 1 
ATOM   2289 C CG2 . ILE A 1 296 ? 3.340   45.943 52.326 1.00 31.01 ? 296  ILE A CG2 1 
ATOM   2290 C CD1 . ILE A 1 296 ? 3.737   48.811 53.296 1.00 28.61 ? 296  ILE A CD1 1 
ATOM   2291 N N   . ASP A 1 297 ? -0.591  46.598 51.666 1.00 32.58 ? 297  ASP A N   1 
ATOM   2292 C CA  . ASP A 1 297 ? -1.727  45.792 51.256 1.00 34.53 ? 297  ASP A CA  1 
ATOM   2293 C C   . ASP A 1 297 ? -1.685  44.959 50.002 1.00 35.80 ? 297  ASP A C   1 
ATOM   2294 O O   . ASP A 1 297 ? -2.621  44.219 49.772 1.00 36.99 ? 297  ASP A O   1 
ATOM   2295 C CB  . ASP A 1 297 ? -2.941  46.708 51.141 1.00 34.67 ? 297  ASP A CB  1 
ATOM   2296 C CG  . ASP A 1 297 ? -2.775  47.755 50.017 1.00 35.76 ? 297  ASP A CG  1 
ATOM   2297 O OD1 . ASP A 1 297 ? -1.639  47.882 49.497 1.00 36.26 ? 297  ASP A OD1 1 
ATOM   2298 O OD2 . ASP A 1 297 ? -3.759  48.454 49.652 1.00 36.65 ? 297  ASP A OD2 1 
ATOM   2299 N N   . GLY A 1 298 ? -0.650  45.066 49.178 1.00 36.65 ? 298  GLY A N   1 
ATOM   2300 C CA  . GLY A 1 298 ? -0.647  44.310 47.928 1.00 36.69 ? 298  GLY A CA  1 
ATOM   2301 C C   . GLY A 1 298 ? -1.367  45.078 46.809 1.00 38.80 ? 298  GLY A C   1 
ATOM   2302 O O   . GLY A 1 298 ? -1.454  44.591 45.678 1.00 39.43 ? 298  GLY A O   1 
ATOM   2303 N N   . GLU A 1 299 ? -1.901  46.273 47.085 1.00 38.25 ? 299  GLU A N   1 
ATOM   2304 C CA  . GLU A 1 299 ? -2.588  47.055 46.041 1.00 38.11 ? 299  GLU A CA  1 
ATOM   2305 C C   . GLU A 1 299 ? -1.978  48.464 45.899 1.00 36.45 ? 299  GLU A C   1 
ATOM   2306 O O   . GLU A 1 299 ? -1.341  48.759 44.892 1.00 35.28 ? 299  GLU A O   1 
ATOM   2307 C CB  . GLU A 1 299 ? -4.067  47.138 46.354 1.00 41.60 ? 299  GLU A CB  1 
ATOM   2308 C CG  . GLU A 1 299 ? -4.750  45.798 46.280 1.00 51.31 ? 299  GLU A CG  1 
ATOM   2309 C CD  . GLU A 1 299 ? -6.008  45.774 47.129 1.00 56.82 ? 299  GLU A CD  1 
ATOM   2310 O OE1 . GLU A 1 299 ? -6.839  46.706 46.957 1.00 59.76 ? 299  GLU A OE1 1 
ATOM   2311 O OE2 . GLU A 1 299 ? -6.162  44.841 47.967 1.00 59.44 ? 299  GLU A OE2 1 
ATOM   2312 N N   . PHE A 1 300 ? -2.190  49.339 46.887 1.00 33.95 ? 300  PHE A N   1 
ATOM   2313 C CA  . PHE A 1 300 ? -1.560  50.645 46.844 1.00 32.41 ? 300  PHE A CA  1 
ATOM   2314 C C   . PHE A 1 300 ? -0.047  50.349 46.831 1.00 32.00 ? 300  PHE A C   1 
ATOM   2315 O O   . PHE A 1 300 ? 0.694   50.959 46.076 1.00 31.16 ? 300  PHE A O   1 
ATOM   2316 C CB  . PHE A 1 300 ? -1.959  51.476 48.065 1.00 31.91 ? 300  PHE A CB  1 
ATOM   2317 C CG  . PHE A 1 300 ? -1.591  52.938 47.946 1.00 31.97 ? 300  PHE A CG  1 
ATOM   2318 C CD1 . PHE A 1 300 ? -0.272  53.367 48.198 1.00 29.70 ? 300  PHE A CD1 1 
ATOM   2319 C CD2 . PHE A 1 300 ? -2.546  53.881 47.565 1.00 29.44 ? 300  PHE A CD2 1 
ATOM   2320 C CE1 . PHE A 1 300 ? 0.085   54.714 48.069 1.00 26.87 ? 300  PHE A CE1 1 
ATOM   2321 C CE2 . PHE A 1 300 ? -2.202  55.228 47.434 1.00 28.42 ? 300  PHE A CE2 1 
ATOM   2322 C CZ  . PHE A 1 300 ? -0.871  55.643 47.689 1.00 26.04 ? 300  PHE A CZ  1 
ATOM   2323 N N   . PHE A 1 301 ? 0.407   49.389 47.645 1.00 31.68 ? 301  PHE A N   1 
ATOM   2324 C CA  . PHE A 1 301 ? 1.829   48.983 47.635 1.00 31.81 ? 301  PHE A CA  1 
ATOM   2325 C C   . PHE A 1 301 ? 1.772   47.556 47.077 1.00 32.99 ? 301  PHE A C   1 
ATOM   2326 O O   . PHE A 1 301 ? 1.208   46.669 47.721 1.00 33.76 ? 301  PHE A O   1 
ATOM   2327 C CB  . PHE A 1 301 ? 2.386   49.011 49.069 1.00 29.73 ? 301  PHE A CB  1 
ATOM   2328 C CG  . PHE A 1 301 ? 2.259   50.366 49.729 1.00 27.82 ? 301  PHE A CG  1 
ATOM   2329 C CD1 . PHE A 1 301 ? 3.091   51.429 49.333 1.00 26.02 ? 301  PHE A CD1 1 
ATOM   2330 C CD2 . PHE A 1 301 ? 1.308   50.583 50.730 1.00 25.00 ? 301  PHE A CD2 1 
ATOM   2331 C CE1 . PHE A 1 301 ? 2.987   52.715 49.938 1.00 26.25 ? 301  PHE A CE1 1 
ATOM   2332 C CE2 . PHE A 1 301 ? 1.179   51.851 51.347 1.00 27.26 ? 301  PHE A CE2 1 
ATOM   2333 C CZ  . PHE A 1 301 ? 2.038   52.930 50.946 1.00 24.33 ? 301  PHE A CZ  1 
ATOM   2334 N N   . PRO A 1 302 ? 2.339   47.306 45.885 1.00 33.44 ? 302  PRO A N   1 
ATOM   2335 C CA  . PRO A 1 302 ? 2.241   45.914 45.375 1.00 34.51 ? 302  PRO A CA  1 
ATOM   2336 C C   . PRO A 1 302 ? 3.000   44.826 46.174 1.00 34.87 ? 302  PRO A C   1 
ATOM   2337 O O   . PRO A 1 302 ? 2.541   43.689 46.266 1.00 34.74 ? 302  PRO A O   1 
ATOM   2338 C CB  . PRO A 1 302 ? 2.683   46.040 43.900 1.00 34.81 ? 302  PRO A CB  1 
ATOM   2339 C CG  . PRO A 1 302 ? 3.487   47.402 43.876 1.00 35.37 ? 302  PRO A CG  1 
ATOM   2340 C CD  . PRO A 1 302 ? 2.756   48.258 44.841 1.00 33.37 ? 302  PRO A CD  1 
ATOM   2341 N N   . THR A 1 303 ? 4.164   45.172 46.721 1.00 34.08 ? 303  THR A N   1 
ATOM   2342 C CA  . THR A 1 303 ? 4.907   44.248 47.563 1.00 34.99 ? 303  THR A CA  1 
ATOM   2343 C C   . THR A 1 303 ? 5.512   45.073 48.709 1.00 34.80 ? 303  THR A C   1 
ATOM   2344 O O   . THR A 1 303 ? 5.231   46.296 48.838 1.00 34.24 ? 303  THR A O   1 
ATOM   2345 C CB  . THR A 1 303 ? 6.024   43.558 46.815 1.00 35.67 ? 303  THR A CB  1 
ATOM   2346 O OG1 . THR A 1 303 ? 6.913   44.535 46.271 1.00 37.46 ? 303  THR A OG1 1 
ATOM   2347 C CG2 . THR A 1 303 ? 5.461   42.763 45.674 1.00 39.13 ? 303  THR A CG2 1 
ATOM   2348 N N   . SER A 1 304 ? 6.339   44.428 49.529 1.00 31.64 ? 304  SER A N   1 
ATOM   2349 C CA  . SER A 1 304 ? 6.963   45.111 50.661 1.00 32.21 ? 304  SER A CA  1 
ATOM   2350 C C   . SER A 1 304 ? 7.733   46.329 50.169 1.00 31.11 ? 304  SER A C   1 
ATOM   2351 O O   . SER A 1 304 ? 8.282   46.318 49.052 1.00 31.11 ? 304  SER A O   1 
ATOM   2352 C CB  . SER A 1 304 ? 7.935   44.176 51.392 1.00 30.47 ? 304  SER A CB  1 
ATOM   2353 O OG  . SER A 1 304 ? 9.013   43.946 50.530 1.00 33.29 ? 304  SER A OG  1 
ATOM   2354 N N   . LEU A 1 305 ? 7.806   47.356 51.010 1.00 30.67 ? 305  LEU A N   1 
ATOM   2355 C CA  . LEU A 1 305 ? 8.491   48.577 50.635 1.00 29.35 ? 305  LEU A CA  1 
ATOM   2356 C C   . LEU A 1 305 ? 9.961   48.324 50.260 1.00 30.45 ? 305  LEU A C   1 
ATOM   2357 O O   . LEU A 1 305 ? 10.447  48.837 49.223 1.00 28.54 ? 305  LEU A O   1 
ATOM   2358 C CB  . LEU A 1 305 ? 8.358   49.594 51.755 1.00 28.04 ? 305  LEU A CB  1 
ATOM   2359 C CG  . LEU A 1 305 ? 6.935   50.046 52.125 1.00 29.50 ? 305  LEU A CG  1 
ATOM   2360 C CD1 . LEU A 1 305 ? 7.082   51.089 53.237 1.00 29.26 ? 305  LEU A CD1 1 
ATOM   2361 C CD2 . LEU A 1 305 ? 6.151   50.628 50.927 1.00 28.01 ? 305  LEU A CD2 1 
ATOM   2362 N N   . GLU A 1 306 ? 10.646  47.498 51.064 1.00 31.79 ? 306  GLU A N   1 
ATOM   2363 C CA  . GLU A 1 306 ? 12.041  47.147 50.823 1.00 33.49 ? 306  GLU A CA  1 
ATOM   2364 C C   . GLU A 1 306 ? 12.272  46.443 49.472 1.00 34.61 ? 306  GLU A C   1 
ATOM   2365 O O   . GLU A 1 306 ? 13.263  46.762 48.786 1.00 34.86 ? 306  GLU A O   1 
ATOM   2366 C CB  . GLU A 1 306 ? 12.587  46.262 51.963 1.00 35.37 ? 306  GLU A CB  1 
ATOM   2367 C CG  . GLU A 1 306 ? 14.065  45.901 51.811 1.00 38.42 ? 306  GLU A CG  1 
ATOM   2368 C CD  . GLU A 1 306 ? 14.989  47.131 51.923 1.00 42.23 ? 306  GLU A CD  1 
ATOM   2369 O OE1 . GLU A 1 306 ? 14.489  48.240 52.260 1.00 43.45 ? 306  GLU A OE1 1 
ATOM   2370 O OE2 . GLU A 1 306 ? 16.216  46.988 51.683 1.00 43.17 ? 306  GLU A OE2 1 
ATOM   2371 N N   . SER A 1 307 ? 11.397  45.512 49.059 1.00 33.87 ? 307  SER A N   1 
ATOM   2372 C CA  . SER A 1 307 ? 11.645  44.867 47.759 1.00 34.58 ? 307  SER A CA  1 
ATOM   2373 C C   . SER A 1 307 ? 11.310  45.836 46.632 1.00 33.55 ? 307  SER A C   1 
ATOM   2374 O O   . SER A 1 307 ? 11.942  45.817 45.580 1.00 34.38 ? 307  SER A O   1 
ATOM   2375 C CB  . SER A 1 307 ? 10.874  43.544 47.597 1.00 34.54 ? 307  SER A CB  1 
ATOM   2376 O OG  . SER A 1 307 ? 9.490   43.714 47.785 1.00 38.97 ? 307  SER A OG  1 
ATOM   2377 N N   . MET A 1 308 ? 10.342  46.713 46.858 1.00 32.13 ? 308  MET A N   1 
ATOM   2378 C CA  . MET A 1 308 ? 10.047  47.685 45.830 1.00 31.71 ? 308  MET A CA  1 
ATOM   2379 C C   . MET A 1 308 ? 11.306  48.561 45.740 1.00 31.19 ? 308  MET A C   1 
ATOM   2380 O O   . MET A 1 308 ? 11.799  48.816 44.653 1.00 31.05 ? 308  MET A O   1 
ATOM   2381 C CB  . MET A 1 308 ? 8.813   48.533 46.197 1.00 31.32 ? 308  MET A CB  1 
ATOM   2382 C CG  . MET A 1 308 ? 7.494   47.814 46.036 1.00 29.62 ? 308  MET A CG  1 
ATOM   2383 S SD  . MET A 1 308 ? 6.067   48.899 46.451 1.00 32.69 ? 308  MET A SD  1 
ATOM   2384 C CE  . MET A 1 308 ? 6.084   49.843 44.800 1.00 31.11 ? 308  MET A CE  1 
ATOM   2385 N N   . LEU A 1 309 ? 11.846  49.009 46.869 1.00 30.51 ? 309  LEU A N   1 
ATOM   2386 C CA  . LEU A 1 309 ? 13.042  49.840 46.790 1.00 32.13 ? 309  LEU A CA  1 
ATOM   2387 C C   . LEU A 1 309 ? 14.265  49.183 46.132 1.00 34.49 ? 309  LEU A C   1 
ATOM   2388 O O   . LEU A 1 309 ? 15.015  49.830 45.351 1.00 33.66 ? 309  LEU A O   1 
ATOM   2389 C CB  . LEU A 1 309 ? 13.422  50.319 48.176 1.00 31.42 ? 309  LEU A CB  1 
ATOM   2390 C CG  . LEU A 1 309 ? 12.528  51.397 48.786 1.00 32.72 ? 309  LEU A CG  1 
ATOM   2391 C CD1 . LEU A 1 309 ? 12.964  51.682 50.230 1.00 32.15 ? 309  LEU A CD1 1 
ATOM   2392 C CD2 . LEU A 1 309 ? 12.654  52.705 47.956 1.00 32.45 ? 309  LEU A CD2 1 
ATOM   2393 N N   . ASN A 1 310 ? 14.465  47.899 46.440 1.00 36.25 ? 310  ASN A N   1 
ATOM   2394 C CA  . ASN A 1 310 ? 15.600  47.122 45.913 1.00 37.02 ? 310  ASN A CA  1 
ATOM   2395 C C   . ASN A 1 310 ? 15.591  46.855 44.441 1.00 36.73 ? 310  ASN A C   1 
ATOM   2396 O O   . ASN A 1 310 ? 16.655  46.807 43.818 1.00 35.95 ? 310  ASN A O   1 
ATOM   2397 C CB  . ASN A 1 310 ? 15.684  45.748 46.579 1.00 40.86 ? 310  ASN A CB  1 
ATOM   2398 C CG  . ASN A 1 310 ? 16.447  45.807 47.843 1.00 45.41 ? 310  ASN A CG  1 
ATOM   2399 O OD1 . ASN A 1 310 ? 17.434  46.571 47.930 1.00 47.64 ? 310  ASN A OD1 1 
ATOM   2400 N ND2 . ASN A 1 310 ? 16.034  45.017 48.850 1.00 47.24 ? 310  ASN A ND2 1 
ATOM   2401 N N   . SER A 1 311 ? 14.390  46.621 43.914 1.00 35.63 ? 311  SER A N   1 
ATOM   2402 C CA  . SER A 1 311 ? 14.198  46.298 42.520 1.00 35.63 ? 311  SER A CA  1 
ATOM   2403 C C   . SER A 1 311 ? 13.938  47.517 41.647 1.00 35.06 ? 311  SER A C   1 
ATOM   2404 O O   . SER A 1 311 ? 13.731  47.374 40.442 1.00 36.57 ? 311  SER A O   1 
ATOM   2405 C CB  . SER A 1 311 ? 13.027  45.301 42.381 1.00 37.63 ? 311  SER A CB  1 
ATOM   2406 O OG  . SER A 1 311 ? 11.745  45.925 42.571 1.00 38.76 ? 311  SER A OG  1 
ATOM   2407 N N   . GLY A 1 312 ? 13.976  48.720 42.217 1.00 34.55 ? 312  GLY A N   1 
ATOM   2408 C CA  . GLY A 1 312 ? 13.702  49.900 41.409 1.00 32.49 ? 312  GLY A CA  1 
ATOM   2409 C C   . GLY A 1 312 ? 12.218  50.050 40.998 1.00 31.60 ? 312  GLY A C   1 
ATOM   2410 O O   . GLY A 1 312 ? 11.896  50.762 40.035 1.00 30.02 ? 312  GLY A O   1 
ATOM   2411 N N   . ASN A 1 313 ? 11.322  49.376 41.711 1.00 29.10 ? 313  ASN A N   1 
ATOM   2412 C CA  . ASN A 1 313 ? 9.911   49.492 41.432 1.00 30.89 ? 313  ASN A CA  1 
ATOM   2413 C C   . ASN A 1 313 ? 9.369   50.826 42.016 1.00 30.84 ? 313  ASN A C   1 
ATOM   2414 O O   . ASN A 1 313 ? 8.713   50.846 43.070 1.00 30.84 ? 313  ASN A O   1 
ATOM   2415 C CB  . ASN A 1 313 ? 9.143   48.332 42.043 1.00 31.16 ? 313  ASN A CB  1 
ATOM   2416 C CG  . ASN A 1 313 ? 7.709   48.253 41.532 1.00 36.21 ? 313  ASN A CG  1 
ATOM   2417 O OD1 . ASN A 1 313 ? 7.262   49.115 40.747 1.00 37.92 ? 313  ASN A OD1 1 
ATOM   2418 N ND2 . ASN A 1 313 ? 6.968   47.225 41.973 1.00 36.44 ? 313  ASN A ND2 1 
ATOM   2419 N N   . PHE A 1 314 ? 9.679   51.935 41.358 1.00 30.51 ? 314  PHE A N   1 
ATOM   2420 C CA  . PHE A 1 314 ? 9.196   53.236 41.810 1.00 31.11 ? 314  PHE A CA  1 
ATOM   2421 C C   . PHE A 1 314 ? 9.379   54.294 40.731 1.00 31.56 ? 314  PHE A C   1 
ATOM   2422 O O   . PHE A 1 314 ? 10.123  54.077 39.749 1.00 29.31 ? 314  PHE A O   1 
ATOM   2423 C CB  . PHE A 1 314 ? 9.861   53.654 43.131 1.00 28.62 ? 314  PHE A CB  1 
ATOM   2424 C CG  . PHE A 1 314 ? 11.367  53.526 43.147 1.00 27.32 ? 314  PHE A CG  1 
ATOM   2425 C CD1 . PHE A 1 314 ? 12.164  54.496 42.559 1.00 27.88 ? 314  PHE A CD1 1 
ATOM   2426 C CD2 . PHE A 1 314 ? 11.979  52.468 43.818 1.00 27.28 ? 314  PHE A CD2 1 
ATOM   2427 C CE1 . PHE A 1 314 ? 13.556  54.424 42.646 1.00 27.75 ? 314  PHE A CE1 1 
ATOM   2428 C CE2 . PHE A 1 314 ? 13.369  52.372 43.920 1.00 25.35 ? 314  PHE A CE2 1 
ATOM   2429 C CZ  . PHE A 1 314 ? 14.165  53.346 43.338 1.00 26.53 ? 314  PHE A CZ  1 
ATOM   2430 N N   . LYS A 1 315 ? 8.679   55.423 40.876 1.00 30.67 ? 315  LYS A N   1 
ATOM   2431 C CA  . LYS A 1 315 ? 8.786   56.471 39.869 1.00 30.25 ? 315  LYS A CA  1 
ATOM   2432 C C   . LYS A 1 315 ? 10.218  56.959 39.857 1.00 31.61 ? 315  LYS A C   1 
ATOM   2433 O O   . LYS A 1 315 ? 10.780  57.243 40.916 1.00 30.75 ? 315  LYS A O   1 
ATOM   2434 C CB  . LYS A 1 315 ? 7.878   57.658 40.207 1.00 30.50 ? 315  LYS A CB  1 
ATOM   2435 C CG  . LYS A 1 315 ? 7.822   58.770 39.121 1.00 29.52 ? 315  LYS A CG  1 
ATOM   2436 C CD  . LYS A 1 315 ? 7.015   60.002 39.654 1.00 28.16 ? 315  LYS A CD  1 
ATOM   2437 C CE  . LYS A 1 315 ? 6.980   61.127 38.624 1.00 27.16 ? 315  LYS A CE  1 
ATOM   2438 N NZ  . LYS A 1 315 ? 6.213   60.702 37.417 1.00 24.28 ? 315  LYS A NZ  1 
ATOM   2439 N N   . LYS A 1 316 ? 10.814  57.071 38.671 1.00 31.37 ? 316  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 316 ? 12.193  57.565 38.574 1.00 32.48 ? 316  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 316 ? 12.159  59.041 38.118 1.00 31.42 ? 316  LYS A C   1 
ATOM   2442 O O   . LYS A 1 316 ? 11.699  59.359 37.024 1.00 30.64 ? 316  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 316 ? 12.989  56.653 37.620 1.00 35.69 ? 316  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 316 ? 13.008  55.233 38.228 1.00 39.83 ? 316  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 316 ? 13.378  54.115 37.335 1.00 42.93 ? 316  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 316 ? 12.921  52.806 38.013 1.00 45.02 ? 316  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 316 ? 13.099  51.587 37.146 1.00 49.63 ? 316  LYS A NZ  1 
ATOM   2448 N N   . THR A 1 317 ? 12.612  59.940 38.983 1.00 29.51 ? 317  THR A N   1 
ATOM   2449 C CA  . THR A 1 317 ? 12.578  61.368 38.689 1.00 28.50 ? 317  THR A CA  1 
ATOM   2450 C C   . THR A 1 317 ? 13.605  62.013 39.652 1.00 29.12 ? 317  THR A C   1 
ATOM   2451 O O   . THR A 1 317 ? 14.503  61.302 40.144 1.00 28.21 ? 317  THR A O   1 
ATOM   2452 C CB  . THR A 1 317 ? 11.131  61.911 38.919 1.00 27.83 ? 317  THR A CB  1 
ATOM   2453 O OG1 . THR A 1 317 ? 11.070  63.315 38.594 1.00 25.45 ? 317  THR A OG1 1 
ATOM   2454 C CG2 . THR A 1 317 ? 10.678  61.667 40.391 1.00 25.61 ? 317  THR A CG2 1 
ATOM   2455 N N   . GLN A 1 318 ? 13.517  63.322 39.898 1.00 27.36 ? 318  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 318 ? 14.442  63.971 40.812 1.00 28.39 ? 318  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 318 ? 13.720  64.142 42.147 1.00 28.31 ? 318  GLN A C   1 
ATOM   2458 O O   . GLN A 1 318 ? 12.477  64.232 42.205 1.00 27.48 ? 318  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 318 ? 14.908  65.367 40.305 1.00 29.81 ? 318  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 318 ? 15.453  65.458 38.849 1.00 31.96 ? 318  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 318 ? 14.331  65.408 37.791 1.00 34.26 ? 318  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 318 ? 13.238  65.915 38.016 1.00 35.86 ? 318  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 318 ? 14.607  64.800 36.641 1.00 35.87 ? 318  GLN A NE2 1 
ATOM   2464 N N   . ILE A 1 319 ? 14.491  64.141 43.228 1.00 26.98 ? 319  ILE A N   1 
ATOM   2465 C CA  . ILE A 1 319 ? 13.933  64.330 44.548 1.00 27.51 ? 319  ILE A CA  1 
ATOM   2466 C C   . ILE A 1 319 ? 14.898  65.263 45.319 1.00 27.78 ? 319  ILE A C   1 
ATOM   2467 O O   . ILE A 1 319 ? 16.105  65.299 45.061 1.00 27.20 ? 319  ILE A O   1 
ATOM   2468 C CB  . ILE A 1 319 ? 13.802  62.977 45.324 1.00 27.49 ? 319  ILE A CB  1 
ATOM   2469 C CG1 . ILE A 1 319 ? 15.182  62.291 45.409 1.00 27.01 ? 319  ILE A CG1 1 
ATOM   2470 C CG2 . ILE A 1 319 ? 12.758  62.059 44.678 1.00 26.37 ? 319  ILE A CG2 1 
ATOM   2471 C CD1 . ILE A 1 319 ? 15.230  61.160 46.429 1.00 22.62 ? 319  ILE A CD1 1 
ATOM   2472 N N   . LEU A 1 320 ? 14.339  66.032 46.235 1.00 26.78 ? 320  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 320 ? 15.084  66.913 47.099 1.00 26.83 ? 320  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 320 ? 14.503  66.535 48.470 1.00 27.62 ? 320  LEU A C   1 
ATOM   2475 O O   . LEU A 1 320 ? 13.287  66.507 48.641 1.00 27.15 ? 320  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 320 ? 14.776  68.345 46.749 1.00 28.11 ? 320  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 320 ? 15.575  69.348 47.538 1.00 27.81 ? 320  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 320 ? 15.761  70.613 46.686 1.00 26.25 ? 320  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 320 ? 14.856  69.643 48.838 1.00 29.37 ? 320  LEU A CD2 1 
ATOM   2480 N N   . LEU A 1 321 ? 15.365  66.235 49.443 1.00 26.76 ? 321  LEU A N   1 
ATOM   2481 C CA  . LEU A 1 321 ? 14.889  65.814 50.734 1.00 26.26 ? 321  LEU A CA  1 
ATOM   2482 C C   . LEU A 1 321 ? 15.951  66.083 51.812 1.00 26.92 ? 321  LEU A C   1 
ATOM   2483 O O   . LEU A 1 321 ? 17.110  66.386 51.517 1.00 29.17 ? 321  LEU A O   1 
ATOM   2484 C CB  . LEU A 1 321 ? 14.514  64.316 50.680 1.00 25.93 ? 321  LEU A CB  1 
ATOM   2485 C CG  . LEU A 1 321 ? 15.651  63.258 50.596 1.00 27.15 ? 321  LEU A CG  1 
ATOM   2486 C CD1 . LEU A 1 321 ? 15.032  61.839 50.522 1.00 27.58 ? 321  LEU A CD1 1 
ATOM   2487 C CD2 . LEU A 1 321 ? 16.508  63.432 49.319 1.00 24.58 ? 321  LEU A CD2 1 
ATOM   2488 N N   . GLY A 1 322 ? 15.551  65.967 53.070 1.00 25.46 ? 322  GLY A N   1 
ATOM   2489 C CA  . GLY A 1 322 ? 16.472  66.234 54.152 1.00 25.18 ? 322  GLY A CA  1 
ATOM   2490 C C   . GLY A 1 322 ? 15.833  66.053 55.511 1.00 24.89 ? 322  GLY A C   1 
ATOM   2491 O O   . GLY A 1 322 ? 14.644  65.657 55.628 1.00 22.51 ? 322  GLY A O   1 
ATOM   2492 N N   . VAL A 1 323 ? 16.628  66.335 56.539 1.00 24.11 ? 323  VAL A N   1 
ATOM   2493 C CA  . VAL A 1 323 ? 16.215  66.171 57.913 1.00 25.47 ? 323  VAL A CA  1 
ATOM   2494 C C   . VAL A 1 323 ? 16.676  67.361 58.794 1.00 27.48 ? 323  VAL A C   1 
ATOM   2495 O O   . VAL A 1 323 ? 17.487  68.201 58.358 1.00 27.51 ? 323  VAL A O   1 
ATOM   2496 C CB  . VAL A 1 323 ? 16.816  64.852 58.471 1.00 25.37 ? 323  VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 323 ? 16.463  63.682 57.545 1.00 25.74 ? 323  VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 323 ? 18.319  64.939 58.502 1.00 23.90 ? 323  VAL A CG2 1 
ATOM   2499 N N   . ASN A 1 324 ? 16.143  67.443 60.011 1.00 26.19 ? 324  ASN A N   1 
ATOM   2500 C CA  . ASN A 1 324 ? 16.553  68.475 60.958 1.00 26.90 ? 324  ASN A CA  1 
ATOM   2501 C C   . ASN A 1 324 ? 17.495  67.835 62.004 1.00 28.33 ? 324  ASN A C   1 
ATOM   2502 O O   . ASN A 1 324 ? 17.485  66.596 62.208 1.00 25.22 ? 324  ASN A O   1 
ATOM   2503 C CB  . ASN A 1 324 ? 15.345  69.097 61.654 1.00 24.90 ? 324  ASN A CB  1 
ATOM   2504 C CG  . ASN A 1 324 ? 14.395  69.804 60.661 1.00 27.67 ? 324  ASN A CG  1 
ATOM   2505 O OD1 . ASN A 1 324 ? 14.686  69.928 59.441 1.00 25.55 ? 324  ASN A OD1 1 
ATOM   2506 N ND2 . ASN A 1 324 ? 13.271  70.284 61.178 1.00 24.44 ? 324  ASN A ND2 1 
ATOM   2507 N N   . LYS A 1 325 ? 18.299  68.673 62.659 1.00 28.62 ? 325  LYS A N   1 
ATOM   2508 C CA  . LYS A 1 325 ? 19.275  68.204 63.656 1.00 29.34 ? 325  LYS A CA  1 
ATOM   2509 C C   . LYS A 1 325 ? 18.688  67.466 64.860 1.00 29.33 ? 325  LYS A C   1 
ATOM   2510 O O   . LYS A 1 325 ? 19.257  66.477 65.281 1.00 28.25 ? 325  LYS A O   1 
ATOM   2511 C CB  . LYS A 1 325 ? 20.168  69.385 64.161 1.00 31.86 ? 325  LYS A CB  1 
ATOM   2512 C CG  . LYS A 1 325 ? 21.233  69.003 65.243 1.00 34.87 ? 325  LYS A CG  1 
ATOM   2513 C CD  . LYS A 1 325 ? 22.114  70.189 65.705 1.00 36.34 ? 325  LYS A CD  1 
ATOM   2514 C CE  . LYS A 1 325 ? 22.586  70.071 67.185 1.00 39.20 ? 325  LYS A CE  1 
ATOM   2515 N NZ  . LYS A 1 325 ? 21.534  70.702 68.222 1.00 42.38 ? 325  LYS A NZ  1 
ATOM   2516 N N   . ASP A 1 326 ? 17.557  67.931 65.417 1.00 28.05 ? 326  ASP A N   1 
ATOM   2517 C CA  . ASP A 1 326 ? 16.993  67.250 66.590 1.00 28.38 ? 326  ASP A CA  1 
ATOM   2518 C C   . ASP A 1 326 ? 15.539  66.737 66.402 1.00 28.78 ? 326  ASP A C   1 
ATOM   2519 O O   . ASP A 1 326 ? 14.582  67.181 67.103 1.00 27.74 ? 326  ASP A O   1 
ATOM   2520 C CB  . ASP A 1 326 ? 17.120  68.191 67.806 1.00 27.96 ? 326  ASP A CB  1 
ATOM   2521 C CG  . ASP A 1 326 ? 18.556  68.726 67.968 1.00 28.08 ? 326  ASP A CG  1 
ATOM   2522 O OD1 . ASP A 1 326 ? 19.436  67.957 68.423 1.00 26.37 ? 326  ASP A OD1 1 
ATOM   2523 O OD2 . ASP A 1 326 ? 18.814  69.901 67.588 1.00 28.19 ? 326  ASP A OD2 1 
ATOM   2524 N N   . GLU A 1 327 ? 15.387  65.778 65.475 1.00 27.77 ? 327  GLU A N   1 
ATOM   2525 C CA  . GLU A 1 327 ? 14.078  65.236 65.151 1.00 26.31 ? 327  GLU A CA  1 
ATOM   2526 C C   . GLU A 1 327 ? 13.387  64.597 66.338 1.00 27.70 ? 327  GLU A C   1 
ATOM   2527 O O   . GLU A 1 327 ? 12.149  64.671 66.443 1.00 28.49 ? 327  GLU A O   1 
ATOM   2528 C CB  . GLU A 1 327 ? 14.165  64.200 64.023 1.00 26.80 ? 327  GLU A CB  1 
ATOM   2529 C CG  . GLU A 1 327 ? 14.793  64.673 62.701 1.00 27.75 ? 327  GLU A CG  1 
ATOM   2530 C CD  . GLU A 1 327 ? 13.857  65.526 61.854 1.00 28.31 ? 327  GLU A CD  1 
ATOM   2531 O OE1 . GLU A 1 327 ? 12.742  65.846 62.315 1.00 29.74 ? 327  GLU A OE1 1 
ATOM   2532 O OE2 . GLU A 1 327 ? 14.226  65.876 60.711 1.00 29.32 ? 327  GLU A OE2 1 
ATOM   2533 N N   . GLY A 1 328 ? 14.136  64.002 67.263 1.00 26.04 ? 328  GLY A N   1 
ATOM   2534 C CA  . GLY A 1 328 ? 13.455  63.321 68.341 1.00 26.21 ? 328  GLY A CA  1 
ATOM   2535 C C   . GLY A 1 328 ? 12.935  64.102 69.547 1.00 27.25 ? 328  GLY A C   1 
ATOM   2536 O O   . GLY A 1 328 ? 12.104  63.562 70.288 1.00 24.86 ? 328  GLY A O   1 
ATOM   2537 N N   . SER A 1 329 ? 13.356  65.353 69.753 1.00 26.49 ? 329  SER A N   1 
ATOM   2538 C CA  . SER A 1 329 ? 12.953  66.022 70.979 1.00 25.50 ? 329  SER A CA  1 
ATOM   2539 C C   . SER A 1 329 ? 11.450  66.204 71.247 1.00 27.18 ? 329  SER A C   1 
ATOM   2540 O O   . SER A 1 329 ? 10.973  66.075 72.405 1.00 26.15 ? 329  SER A O   1 
ATOM   2541 C CB  . SER A 1 329 ? 13.691  67.348 71.089 1.00 24.59 ? 329  SER A CB  1 
ATOM   2542 O OG  . SER A 1 329 ? 13.362  68.235 70.049 1.00 23.74 ? 329  SER A OG  1 
ATOM   2543 N N   . PHE A 1 330 ? 10.703  66.471 70.188 1.00 26.82 ? 330  PHE A N   1 
ATOM   2544 C CA  . PHE A 1 330 ? 9.279   66.696 70.298 1.00 27.67 ? 330  PHE A CA  1 
ATOM   2545 C C   . PHE A 1 330 ? 8.632   65.456 70.953 1.00 28.59 ? 330  PHE A C   1 
ATOM   2546 O O   . PHE A 1 330 ? 7.789   65.561 71.867 1.00 25.20 ? 330  PHE A O   1 
ATOM   2547 C CB  . PHE A 1 330 ? 8.713   66.896 68.891 1.00 31.23 ? 330  PHE A CB  1 
ATOM   2548 C CG  . PHE A 1 330 ? 7.650   67.973 68.787 1.00 33.64 ? 330  PHE A CG  1 
ATOM   2549 C CD1 . PHE A 1 330 ? 6.781   68.223 69.841 1.00 34.18 ? 330  PHE A CD1 1 
ATOM   2550 C CD2 . PHE A 1 330 ? 7.549   68.746 67.628 1.00 33.11 ? 330  PHE A CD2 1 
ATOM   2551 C CE1 . PHE A 1 330 ? 5.822   69.237 69.754 1.00 36.42 ? 330  PHE A CE1 1 
ATOM   2552 C CE2 . PHE A 1 330 ? 6.604   69.759 67.521 1.00 33.88 ? 330  PHE A CE2 1 
ATOM   2553 C CZ  . PHE A 1 330 ? 5.734   70.018 68.574 1.00 35.81 ? 330  PHE A CZ  1 
ATOM   2554 N N   . PHE A 1 331 ? 9.076   64.278 70.523 1.00 26.68 ? 331  PHE A N   1 
ATOM   2555 C CA  . PHE A 1 331 ? 8.477   63.063 71.025 1.00 26.55 ? 331  PHE A CA  1 
ATOM   2556 C C   . PHE A 1 331 ? 8.885   62.674 72.406 1.00 26.56 ? 331  PHE A C   1 
ATOM   2557 O O   . PHE A 1 331 ? 8.085   62.047 73.122 1.00 26.96 ? 331  PHE A O   1 
ATOM   2558 C CB  . PHE A 1 331 ? 8.715   61.920 70.031 1.00 25.14 ? 331  PHE A CB  1 
ATOM   2559 C CG  . PHE A 1 331 ? 8.240   62.265 68.633 1.00 25.72 ? 331  PHE A CG  1 
ATOM   2560 C CD1 . PHE A 1 331 ? 9.055   63.023 67.780 1.00 24.91 ? 331  PHE A CD1 1 
ATOM   2561 C CD2 . PHE A 1 331 ? 6.950   61.942 68.218 1.00 23.46 ? 331  PHE A CD2 1 
ATOM   2562 C CE1 . PHE A 1 331 ? 8.585   63.458 66.522 1.00 23.95 ? 331  PHE A CE1 1 
ATOM   2563 C CE2 . PHE A 1 331 ? 6.471   62.367 66.976 1.00 22.83 ? 331  PHE A CE2 1 
ATOM   2564 C CZ  . PHE A 1 331 ? 7.280   63.118 66.129 1.00 22.92 ? 331  PHE A CZ  1 
ATOM   2565 N N   . LEU A 1 332 ? 10.112  63.029 72.792 1.00 25.26 ? 332  LEU A N   1 
ATOM   2566 C CA  . LEU A 1 332 ? 10.598  62.709 74.130 1.00 26.11 ? 332  LEU A CA  1 
ATOM   2567 C C   . LEU A 1 332 ? 9.848   63.617 75.121 1.00 26.44 ? 332  LEU A C   1 
ATOM   2568 O O   . LEU A 1 332 ? 9.381   63.152 76.159 1.00 27.03 ? 332  LEU A O   1 
ATOM   2569 C CB  . LEU A 1 332 ? 12.131  62.929 74.199 1.00 24.70 ? 332  LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 332 ? 12.980  61.835 73.495 1.00 24.57 ? 332  LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 332 ? 14.396  62.327 73.276 1.00 21.57 ? 332  LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 332 ? 12.945  60.548 74.354 1.00 20.50 ? 332  LEU A CD2 1 
ATOM   2573 N N   . LEU A 1 333 ? 9.696   64.901 74.780 1.00 27.10 ? 333  LEU A N   1 
ATOM   2574 C CA  . LEU A 1 333 ? 8.997   65.862 75.641 1.00 27.95 ? 333  LEU A CA  1 
ATOM   2575 C C   . LEU A 1 333 ? 7.617   65.335 76.019 1.00 29.24 ? 333  LEU A C   1 
ATOM   2576 O O   . LEU A 1 333 ? 7.204   65.305 77.211 1.00 28.95 ? 333  LEU A O   1 
ATOM   2577 C CB  . LEU A 1 333 ? 8.826   67.218 74.912 1.00 26.13 ? 333  LEU A CB  1 
ATOM   2578 C CG  . LEU A 1 333 ? 7.807   68.123 75.612 1.00 27.41 ? 333  LEU A CG  1 
ATOM   2579 C CD1 . LEU A 1 333 ? 8.246   68.391 77.120 1.00 24.56 ? 333  LEU A CD1 1 
ATOM   2580 C CD2 . LEU A 1 333 ? 7.651   69.427 74.865 1.00 27.89 ? 333  LEU A CD2 1 
ATOM   2581 N N   . TYR A 1 334 ? 6.906   64.923 74.974 1.00 29.62 ? 334  TYR A N   1 
ATOM   2582 C CA  . TYR A 1 334 ? 5.561   64.433 75.147 1.00 31.44 ? 334  TYR A CA  1 
ATOM   2583 C C   . TYR A 1 334 ? 5.488   63.017 75.656 1.00 30.43 ? 334  TYR A C   1 
ATOM   2584 O O   . TYR A 1 334 ? 4.542   62.688 76.328 1.00 32.19 ? 334  TYR A O   1 
ATOM   2585 C CB  . TYR A 1 334 ? 4.740   64.528 73.839 1.00 30.24 ? 334  TYR A CB  1 
ATOM   2586 C CG  . TYR A 1 334 ? 4.181   65.909 73.547 1.00 30.76 ? 334  TYR A CG  1 
ATOM   2587 C CD1 . TYR A 1 334 ? 5.031   66.950 73.190 1.00 30.48 ? 334  TYR A CD1 1 
ATOM   2588 C CD2 . TYR A 1 334 ? 2.795   66.172 73.607 1.00 29.41 ? 334  TYR A CD2 1 
ATOM   2589 C CE1 . TYR A 1 334 ? 4.529   68.217 72.897 1.00 30.77 ? 334  TYR A CE1 1 
ATOM   2590 C CE2 . TYR A 1 334 ? 2.285   67.437 73.313 1.00 28.04 ? 334  TYR A CE2 1 
ATOM   2591 C CZ  . TYR A 1 334 ? 3.171   68.450 72.955 1.00 30.09 ? 334  TYR A CZ  1 
ATOM   2592 O OH  . TYR A 1 334 ? 2.740   69.702 72.594 1.00 30.48 ? 334  TYR A OH  1 
ATOM   2593 N N   . GLY A 1 335 ? 6.455   62.166 75.413 1.00 28.97 ? 335  GLY A N   1 
ATOM   2594 C CA  . GLY A 1 335 ? 6.173   60.846 75.927 1.00 30.97 ? 335  GLY A CA  1 
ATOM   2595 C C   . GLY A 1 335 ? 7.129   60.023 76.760 1.00 30.90 ? 335  GLY A C   1 
ATOM   2596 O O   . GLY A 1 335 ? 6.830   58.856 77.002 1.00 31.13 ? 335  GLY A O   1 
ATOM   2597 N N   . ALA A 1 336 ? 8.254   60.597 77.177 1.00 29.51 ? 336  ALA A N   1 
ATOM   2598 C CA  . ALA A 1 336 ? 9.243   59.854 77.936 1.00 29.69 ? 336  ALA A CA  1 
ATOM   2599 C C   . ALA A 1 336 ? 9.448   60.472 79.310 1.00 30.96 ? 336  ALA A C   1 
ATOM   2600 O O   . ALA A 1 336 ? 9.471   61.695 79.453 1.00 29.68 ? 336  ALA A O   1 
ATOM   2601 C CB  . ALA A 1 336 ? 10.525  59.875 77.213 1.00 26.37 ? 336  ALA A CB  1 
ATOM   2602 N N   . PRO A 1 337 ? 9.598   59.642 80.343 1.00 32.71 ? 337  PRO A N   1 
ATOM   2603 C CA  . PRO A 1 337 ? 9.801   60.160 81.709 1.00 33.46 ? 337  PRO A CA  1 
ATOM   2604 C C   . PRO A 1 337 ? 11.108  60.944 81.874 1.00 32.03 ? 337  PRO A C   1 
ATOM   2605 O O   . PRO A 1 337 ? 12.152  60.574 81.295 1.00 32.46 ? 337  PRO A O   1 
ATOM   2606 C CB  . PRO A 1 337 ? 9.746   58.900 82.582 1.00 33.80 ? 337  PRO A CB  1 
ATOM   2607 C CG  . PRO A 1 337 ? 10.314  57.836 81.654 1.00 35.66 ? 337  PRO A CG  1 
ATOM   2608 C CD  . PRO A 1 337 ? 9.623   58.170 80.319 1.00 35.08 ? 337  PRO A CD  1 
ATOM   2609 N N   . GLY A 1 338 ? 11.023  62.037 82.638 1.00 30.49 ? 338  GLY A N   1 
ATOM   2610 C CA  . GLY A 1 338 ? 12.175  62.894 82.886 1.00 30.07 ? 338  GLY A CA  1 
ATOM   2611 C C   . GLY A 1 338 ? 12.277  64.141 82.014 1.00 30.80 ? 338  GLY A C   1 
ATOM   2612 O O   . GLY A 1 338 ? 13.071  65.059 82.297 1.00 29.66 ? 338  GLY A O   1 
ATOM   2613 N N   . PHE A 1 339 ? 11.489  64.186 80.938 1.00 30.71 ? 339  PHE A N   1 
ATOM   2614 C CA  . PHE A 1 339 ? 11.506  65.339 80.042 1.00 31.34 ? 339  PHE A CA  1 
ATOM   2615 C C   . PHE A 1 339 ? 10.312  66.244 80.352 1.00 31.34 ? 339  PHE A C   1 
ATOM   2616 O O   . PHE A 1 339 ? 9.207   65.752 80.607 1.00 32.24 ? 339  PHE A O   1 
ATOM   2617 C CB  . PHE A 1 339 ? 11.391  64.881 78.584 1.00 29.50 ? 339  PHE A CB  1 
ATOM   2618 C CG  . PHE A 1 339 ? 12.583  64.137 78.085 1.00 26.66 ? 339  PHE A CG  1 
ATOM   2619 C CD1 . PHE A 1 339 ? 13.585  64.808 77.404 1.00 26.54 ? 339  PHE A CD1 1 
ATOM   2620 C CD2 . PHE A 1 339 ? 12.690  62.757 78.281 1.00 25.13 ? 339  PHE A CD2 1 
ATOM   2621 C CE1 . PHE A 1 339 ? 14.707  64.108 76.915 1.00 25.04 ? 339  PHE A CE1 1 
ATOM   2622 C CE2 . PHE A 1 339 ? 13.787  62.041 77.813 1.00 24.69 ? 339  PHE A CE2 1 
ATOM   2623 C CZ  . PHE A 1 339 ? 14.806  62.722 77.123 1.00 25.12 ? 339  PHE A CZ  1 
ATOM   2624 N N   . SER A 1 340 ? 10.519  67.551 80.336 1.00 29.83 ? 340  SER A N   1 
ATOM   2625 C CA  . SER A 1 340 ? 9.401   68.453 80.543 1.00 30.30 ? 340  SER A CA  1 
ATOM   2626 C C   . SER A 1 340 ? 9.689   69.778 79.859 1.00 30.97 ? 340  SER A C   1 
ATOM   2627 O O   . SER A 1 340 ? 10.857  70.123 79.592 1.00 29.52 ? 340  SER A O   1 
ATOM   2628 C CB  . SER A 1 340 ? 9.060   68.601 82.036 1.00 32.64 ? 340  SER A CB  1 
ATOM   2629 O OG  . SER A 1 340 ? 10.194  68.941 82.790 1.00 36.76 ? 340  SER A OG  1 
ATOM   2630 N N   . LYS A 1 341 ? 8.629   70.519 79.536 1.00 29.45 ? 341  LYS A N   1 
ATOM   2631 C CA  . LYS A 1 341 ? 8.816   71.733 78.777 1.00 30.68 ? 341  LYS A CA  1 
ATOM   2632 C C   . LYS A 1 341 ? 9.614   72.835 79.468 1.00 30.53 ? 341  LYS A C   1 
ATOM   2633 O O   . LYS A 1 341 ? 10.434  73.504 78.820 1.00 30.66 ? 341  LYS A O   1 
ATOM   2634 C CB  . LYS A 1 341 ? 7.454   72.282 78.320 1.00 31.31 ? 341  LYS A CB  1 
ATOM   2635 C CG  . LYS A 1 341 ? 7.568   73.450 77.312 1.00 33.11 ? 341  LYS A CG  1 
ATOM   2636 C CD  . LYS A 1 341 ? 6.210   73.980 76.756 1.00 32.60 ? 341  LYS A CD  1 
ATOM   2637 C CE  . LYS A 1 341 ? 5.531   74.960 77.742 1.00 31.41 ? 341  LYS A CE  1 
ATOM   2638 N NZ  . LYS A 1 341 ? 6.353   76.173 78.098 1.00 32.65 ? 341  LYS A NZ  1 
ATOM   2639 N N   . ASP A 1 342 ? 9.379   73.028 80.767 1.00 29.87 ? 342  ASP A N   1 
ATOM   2640 C CA  . ASP A 1 342 ? 10.058  74.094 81.483 1.00 31.34 ? 342  ASP A CA  1 
ATOM   2641 C C   . ASP A 1 342 ? 11.342  73.794 82.267 1.00 31.80 ? 342  ASP A C   1 
ATOM   2642 O O   . ASP A 1 342 ? 11.736  74.573 83.124 1.00 31.63 ? 342  ASP A O   1 
ATOM   2643 C CB  . ASP A 1 342 ? 9.075   74.825 82.391 1.00 29.24 ? 342  ASP A CB  1 
ATOM   2644 C CG  . ASP A 1 342 ? 7.797   75.251 81.657 1.00 30.61 ? 342  ASP A CG  1 
ATOM   2645 O OD1 . ASP A 1 342 ? 7.829   75.486 80.414 1.00 28.91 ? 342  ASP A OD1 1 
ATOM   2646 O OD2 . ASP A 1 342 ? 6.756   75.359 82.349 1.00 28.19 ? 342  ASP A OD2 1 
ATOM   2647 N N   . SER A 1 343 ? 11.992  72.674 82.000 1.00 32.50 ? 343  SER A N   1 
ATOM   2648 C CA  . SER A 1 343 ? 13.246  72.411 82.669 1.00 33.19 ? 343  SER A CA  1 
ATOM   2649 C C   . SER A 1 343 ? 14.237  72.023 81.568 1.00 33.93 ? 343  SER A C   1 
ATOM   2650 O O   . SER A 1 343 ? 13.859  71.785 80.412 1.00 31.57 ? 343  SER A O   1 
ATOM   2651 C CB  . SER A 1 343 ? 13.115  71.277 83.650 1.00 34.46 ? 343  SER A CB  1 
ATOM   2652 O OG  . SER A 1 343 ? 13.257  70.057 82.988 1.00 40.65 ? 343  SER A OG  1 
ATOM   2653 N N   . GLU A 1 344 ? 15.510  71.965 81.916 1.00 33.95 ? 344  GLU A N   1 
ATOM   2654 C CA  . GLU A 1 344 ? 16.507  71.595 80.962 1.00 34.90 ? 344  GLU A CA  1 
ATOM   2655 C C   . GLU A 1 344 ? 16.454  70.083 80.686 1.00 34.00 ? 344  GLU A C   1 
ATOM   2656 O O   . GLU A 1 344 ? 17.216  69.578 79.872 1.00 33.24 ? 344  GLU A O   1 
ATOM   2657 C CB  . GLU A 1 344 ? 17.868  71.929 81.491 1.00 38.44 ? 344  GLU A CB  1 
ATOM   2658 C CG  . GLU A 1 344 ? 18.272  73.389 81.489 1.00 45.55 ? 344  GLU A CG  1 
ATOM   2659 C CD  . GLU A 1 344 ? 19.705  73.478 82.075 1.00 49.38 ? 344  GLU A CD  1 
ATOM   2660 O OE1 . GLU A 1 344 ? 19.878  73.075 83.252 1.00 49.97 ? 344  GLU A OE1 1 
ATOM   2661 O OE2 . GLU A 1 344 ? 20.642  73.889 81.352 1.00 51.74 ? 344  GLU A OE2 1 
ATOM   2662 N N   . SER A 1 345 ? 15.598  69.357 81.394 1.00 31.82 ? 345  SER A N   1 
ATOM   2663 C CA  . SER A 1 345 ? 15.437  67.911 81.162 1.00 33.62 ? 345  SER A CA  1 
ATOM   2664 C C   . SER A 1 345 ? 16.707  67.047 81.175 1.00 33.79 ? 345  SER A C   1 
ATOM   2665 O O   . SER A 1 345 ? 16.946  66.227 80.240 1.00 32.15 ? 345  SER A O   1 
ATOM   2666 C CB  . SER A 1 345 ? 14.713  67.641 79.818 1.00 32.20 ? 345  SER A CB  1 
ATOM   2667 O OG  . SER A 1 345 ? 13.419  68.200 79.846 1.00 33.55 ? 345  SER A OG  1 
ATOM   2668 N N   . LYS A 1 346 ? 17.490  67.205 82.232 1.00 34.92 ? 346  LYS A N   1 
ATOM   2669 C CA  . LYS A 1 346 ? 18.698  66.424 82.381 1.00 35.64 ? 346  LYS A CA  1 
ATOM   2670 C C   . LYS A 1 346 ? 18.171  65.080 82.823 1.00 35.50 ? 346  LYS A C   1 
ATOM   2671 O O   . LYS A 1 346 ? 17.378  64.961 83.756 1.00 35.58 ? 346  LYS A O   1 
ATOM   2672 C CB  . LYS A 1 346 ? 19.623  67.098 83.363 1.00 38.90 ? 346  LYS A CB  1 
ATOM   2673 C CG  . LYS A 1 346 ? 20.225  68.407 82.795 1.00 41.98 ? 346  LYS A CG  1 
ATOM   2674 C CD  . LYS A 1 346 ? 21.227  68.996 83.791 1.00 47.96 ? 346  LYS A CD  1 
ATOM   2675 C CE  . LYS A 1 346 ? 21.597  70.502 83.561 1.00 50.67 ? 346  LYS A CE  1 
ATOM   2676 N NZ  . LYS A 1 346 ? 22.410  71.029 84.754 1.00 53.48 ? 346  LYS A NZ  1 
ATOM   2677 N N   . ILE A 1 347 ? 18.594  64.060 82.106 1.00 34.66 ? 347  ILE A N   1 
ATOM   2678 C CA  . ILE A 1 347 ? 18.080  62.703 82.294 1.00 37.01 ? 347  ILE A CA  1 
ATOM   2679 C C   . ILE A 1 347 ? 19.075  61.832 83.038 1.00 36.96 ? 347  ILE A C   1 
ATOM   2680 O O   . ILE A 1 347 ? 20.261  61.799 82.672 1.00 36.18 ? 347  ILE A O   1 
ATOM   2681 C CB  . ILE A 1 347 ? 17.805  62.058 80.848 1.00 37.10 ? 347  ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 347 ? 16.776  62.887 80.111 1.00 37.74 ? 347  ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 347 ? 17.373  60.635 80.937 1.00 37.56 ? 347  ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 347 ? 15.462  63.007 80.882 1.00 37.61 ? 347  ILE A CD1 1 
ATOM   2685 N N   . SER A 1 348 ? 18.585  61.131 84.054 1.00 37.65 ? 348  SER A N   1 
ATOM   2686 C CA  . SER A 1 348 ? 19.391  60.192 84.851 1.00 39.65 ? 348  SER A CA  1 
ATOM   2687 C C   . SER A 1 348 ? 19.601  58.930 83.988 1.00 41.18 ? 348  SER A C   1 
ATOM   2688 O O   . SER A 1 348 ? 18.884  58.750 82.986 1.00 40.73 ? 348  SER A O   1 
ATOM   2689 C CB  . SER A 1 348 ? 18.588  59.784 86.082 1.00 40.07 ? 348  SER A CB  1 
ATOM   2690 O OG  . SER A 1 348 ? 17.498  58.951 85.681 1.00 39.27 ? 348  SER A OG  1 
ATOM   2691 N N   . ARG A 1 349 ? 20.545  58.064 84.375 1.00 42.05 ? 349  ARG A N   1 
ATOM   2692 C CA  . ARG A 1 349 ? 20.810  56.808 83.648 1.00 43.84 ? 349  ARG A CA  1 
ATOM   2693 C C   . ARG A 1 349 ? 19.549  55.984 83.592 1.00 43.48 ? 349  ARG A C   1 
ATOM   2694 O O   . ARG A 1 349 ? 19.295  55.279 82.626 1.00 42.47 ? 349  ARG A O   1 
ATOM   2695 C CB  . ARG A 1 349 ? 21.812  55.881 84.357 1.00 45.39 ? 349  ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 349 ? 23.261  56.122 84.088 1.00 50.26 ? 349  ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 349 ? 23.526  56.435 82.629 1.00 51.41 ? 349  ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 349 ? 23.463  55.285 81.757 1.00 49.41 ? 349  ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 349 ? 23.583  55.378 80.432 1.00 49.26 ? 349  ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 349 ? 23.768  56.560 79.870 1.00 49.67 ? 349  ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 349 ? 23.517  54.296 79.667 1.00 47.44 ? 349  ARG A NH2 1 
ATOM   2702 N N   . GLU A 1 350 ? 18.814  56.025 84.688 1.00 43.43 ? 350  GLU A N   1 
ATOM   2703 C CA  . GLU A 1 350 ? 17.600  55.260 84.824 1.00 44.05 ? 350  GLU A CA  1 
ATOM   2704 C C   . GLU A 1 350 ? 16.568  55.730 83.771 1.00 43.21 ? 350  GLU A C   1 
ATOM   2705 O O   . GLU A 1 350 ? 15.963  54.919 83.045 1.00 41.79 ? 350  GLU A O   1 
ATOM   2706 C CB  . GLU A 1 350 ? 17.097  55.466 86.242 1.00 47.20 ? 350  GLU A CB  1 
ATOM   2707 C CG  . GLU A 1 350 ? 16.062  54.497 86.753 1.00 53.16 ? 350  GLU A CG  1 
ATOM   2708 C CD  . GLU A 1 350 ? 15.566  54.942 88.126 1.00 56.95 ? 350  GLU A CD  1 
ATOM   2709 O OE1 . GLU A 1 350 ? 15.769  54.171 89.100 1.00 58.55 ? 350  GLU A OE1 1 
ATOM   2710 O OE2 . GLU A 1 350 ? 14.992  56.073 88.205 1.00 58.39 ? 350  GLU A OE2 1 
ATOM   2711 N N   . ASP A 1 351 ? 16.370  57.040 83.669 1.00 41.07 ? 351  ASP A N   1 
ATOM   2712 C CA  . ASP A 1 351 ? 15.422  57.513 82.681 1.00 40.57 ? 351  ASP A CA  1 
ATOM   2713 C C   . ASP A 1 351 ? 15.954  57.292 81.259 1.00 38.78 ? 351  ASP A C   1 
ATOM   2714 O O   . ASP A 1 351 ? 15.184  57.102 80.326 1.00 37.87 ? 351  ASP A O   1 
ATOM   2715 C CB  . ASP A 1 351 ? 15.053  58.975 82.941 1.00 41.04 ? 351  ASP A CB  1 
ATOM   2716 C CG  . ASP A 1 351 ? 14.064  59.110 84.101 1.00 42.76 ? 351  ASP A CG  1 
ATOM   2717 O OD1 . ASP A 1 351 ? 13.413  58.096 84.432 1.00 42.86 ? 351  ASP A OD1 1 
ATOM   2718 O OD2 . ASP A 1 351 ? 13.928  60.223 84.667 1.00 44.22 ? 351  ASP A OD2 1 
ATOM   2719 N N   . PHE A 1 352 ? 17.265  57.253 81.103 1.00 36.88 ? 352  PHE A N   1 
ATOM   2720 C CA  . PHE A 1 352 ? 17.824  57.039 79.782 1.00 36.52 ? 352  PHE A CA  1 
ATOM   2721 C C   . PHE A 1 352 ? 17.404  55.657 79.329 1.00 36.52 ? 352  PHE A C   1 
ATOM   2722 O O   . PHE A 1 352 ? 16.919  55.456 78.214 1.00 35.40 ? 352  PHE A O   1 
ATOM   2723 C CB  . PHE A 1 352 ? 19.344  57.129 79.825 1.00 34.71 ? 352  PHE A CB  1 
ATOM   2724 C CG  . PHE A 1 352 ? 19.999  56.867 78.509 1.00 33.63 ? 352  PHE A CG  1 
ATOM   2725 C CD1 . PHE A 1 352 ? 20.160  57.889 77.575 1.00 30.70 ? 352  PHE A CD1 1 
ATOM   2726 C CD2 . PHE A 1 352 ? 20.437  55.585 78.203 1.00 32.33 ? 352  PHE A CD2 1 
ATOM   2727 C CE1 . PHE A 1 352 ? 20.746  57.643 76.363 1.00 31.08 ? 352  PHE A CE1 1 
ATOM   2728 C CE2 . PHE A 1 352 ? 21.022  55.314 77.011 1.00 32.85 ? 352  PHE A CE2 1 
ATOM   2729 C CZ  . PHE A 1 352 ? 21.186  56.343 76.067 1.00 33.34 ? 352  PHE A CZ  1 
ATOM   2730 N N   . MET A 1 353 ? 17.559  54.703 80.220 1.00 37.16 ? 353  MET A N   1 
ATOM   2731 C CA  . MET A 1 353 ? 17.219  53.340 79.881 1.00 39.72 ? 353  MET A CA  1 
ATOM   2732 C C   . MET A 1 353 ? 15.739  53.060 79.683 1.00 38.96 ? 353  MET A C   1 
ATOM   2733 O O   . MET A 1 353 ? 15.372  52.239 78.822 1.00 36.59 ? 353  MET A O   1 
ATOM   2734 C CB  . MET A 1 353 ? 17.835  52.393 80.907 1.00 43.84 ? 353  MET A CB  1 
ATOM   2735 C CG  . MET A 1 353 ? 19.352  52.281 80.681 1.00 46.73 ? 353  MET A CG  1 
ATOM   2736 S SD  . MET A 1 353 ? 20.006  50.945 81.622 1.00 56.58 ? 353  MET A SD  1 
ATOM   2737 C CE  . MET A 1 353 ? 19.424  51.382 83.384 1.00 51.32 ? 353  MET A CE  1 
ATOM   2738 N N   . SER A 1 354 ? 14.876  53.723 80.449 1.00 37.36 ? 354  SER A N   1 
ATOM   2739 C CA  . SER A 1 354 ? 13.467  53.484 80.200 1.00 38.40 ? 354  SER A CA  1 
ATOM   2740 C C   . SER A 1 354 ? 13.081  54.229 78.864 1.00 37.29 ? 354  SER A C   1 
ATOM   2741 O O   . SER A 1 354 ? 12.193  53.793 78.134 1.00 36.49 ? 354  SER A O   1 
ATOM   2742 C CB  . SER A 1 354 ? 12.621  53.884 81.434 1.00 38.56 ? 354  SER A CB  1 
ATOM   2743 O OG  . SER A 1 354 ? 12.710  55.267 81.691 1.00 44.40 ? 354  SER A OG  1 
ATOM   2744 N N   . GLY A 1 355 ? 13.797  55.314 78.537 1.00 35.26 ? 355  GLY A N   1 
ATOM   2745 C CA  . GLY A 1 355 ? 13.584  56.021 77.290 1.00 32.68 ? 355  GLY A CA  1 
ATOM   2746 C C   . GLY A 1 355 ? 14.009  55.155 76.093 1.00 32.54 ? 355  GLY A C   1 
ATOM   2747 O O   . GLY A 1 355 ? 13.292  55.159 75.063 1.00 29.30 ? 355  GLY A O   1 
ATOM   2748 N N   . VAL A 1 356 ? 15.120  54.393 76.192 1.00 29.94 ? 356  VAL A N   1 
ATOM   2749 C CA  . VAL A 1 356 ? 15.497  53.605 75.043 1.00 30.21 ? 356  VAL A CA  1 
ATOM   2750 C C   . VAL A 1 356 ? 14.496  52.515 74.803 1.00 30.46 ? 356  VAL A C   1 
ATOM   2751 O O   . VAL A 1 356 ? 14.159  52.239 73.651 1.00 30.90 ? 356  VAL A O   1 
ATOM   2752 C CB  . VAL A 1 356 ? 16.986  52.992 75.043 1.00 32.91 ? 356  VAL A CB  1 
ATOM   2753 C CG1 . VAL A 1 356 ? 17.943  53.839 75.780 1.00 28.46 ? 356  VAL A CG1 1 
ATOM   2754 C CG2 . VAL A 1 356 ? 16.998  51.575 75.464 1.00 33.26 ? 356  VAL A CG2 1 
ATOM   2755 N N   . LYS A 1 357 ? 13.996  51.906 75.872 1.00 31.05 ? 357  LYS A N   1 
ATOM   2756 C CA  . LYS A 1 357 ? 12.968  50.863 75.777 1.00 33.09 ? 357  LYS A CA  1 
ATOM   2757 C C   . LYS A 1 357 ? 11.677  51.403 75.060 1.00 31.23 ? 357  LYS A C   1 
ATOM   2758 O O   . LYS A 1 357 ? 11.063  50.733 74.207 1.00 29.36 ? 357  LYS A O   1 
ATOM   2759 C CB  . LYS A 1 357 ? 12.708  50.371 77.191 1.00 37.40 ? 357  LYS A CB  1 
ATOM   2760 C CG  . LYS A 1 357 ? 11.438  49.666 77.415 1.00 44.17 ? 357  LYS A CG  1 
ATOM   2761 C CD  . LYS A 1 357 ? 11.437  48.252 76.898 1.00 49.30 ? 357  LYS A CD  1 
ATOM   2762 C CE  . LYS A 1 357 ? 10.181  47.554 77.482 1.00 53.25 ? 357  LYS A CE  1 
ATOM   2763 N NZ  . LYS A 1 357 ? 8.890   48.381 77.322 1.00 54.48 ? 357  LYS A NZ  1 
ATOM   2764 N N   . LEU A 1 358 ? 11.302  52.634 75.378 1.00 29.69 ? 358  LEU A N   1 
ATOM   2765 C CA  . LEU A 1 358 ? 10.153  53.299 74.740 1.00 30.75 ? 358  LEU A CA  1 
ATOM   2766 C C   . LEU A 1 358 ? 10.410  53.579 73.240 1.00 30.40 ? 358  LEU A C   1 
ATOM   2767 O O   . LEU A 1 358 ? 9.502   53.499 72.408 1.00 30.97 ? 358  LEU A O   1 
ATOM   2768 C CB  . LEU A 1 358 ? 9.888   54.632 75.443 1.00 30.32 ? 358  LEU A CB  1 
ATOM   2769 C CG  . LEU A 1 358 ? 8.668   54.977 76.292 1.00 34.10 ? 358  LEU A CG  1 
ATOM   2770 C CD1 . LEU A 1 358 ? 7.924   53.729 76.791 1.00 29.73 ? 358  LEU A CD1 1 
ATOM   2771 C CD2 . LEU A 1 358 ? 9.162   55.952 77.425 1.00 29.04 ? 358  LEU A CD2 1 
ATOM   2772 N N   . SER A 1 359 ? 11.662  53.896 72.904 1.00 29.69 ? 359  SER A N   1 
ATOM   2773 C CA  . SER A 1 359 ? 12.066  54.236 71.536 1.00 28.81 ? 359  SER A CA  1 
ATOM   2774 C C   . SER A 1 359 ? 12.223  53.100 70.564 1.00 29.38 ? 359  SER A C   1 
ATOM   2775 O O   . SER A 1 359 ? 12.107  53.307 69.373 1.00 29.56 ? 359  SER A O   1 
ATOM   2776 C CB  . SER A 1 359 ? 13.378  54.973 71.574 1.00 30.07 ? 359  SER A CB  1 
ATOM   2777 O OG  . SER A 1 359 ? 13.268  56.072 72.442 1.00 30.09 ? 359  SER A OG  1 
ATOM   2778 N N   . VAL A 1 360 ? 12.498  51.902 71.049 1.00 27.65 ? 360  VAL A N   1 
ATOM   2779 C CA  . VAL A 1 360 ? 12.682  50.775 70.135 1.00 31.93 ? 360  VAL A CA  1 
ATOM   2780 C C   . VAL A 1 360 ? 11.775  49.701 70.724 1.00 33.43 ? 360  VAL A C   1 
ATOM   2781 O O   . VAL A 1 360 ? 12.249  48.677 71.235 1.00 32.30 ? 360  VAL A O   1 
ATOM   2782 C CB  . VAL A 1 360 ? 14.181  50.360 70.141 1.00 31.90 ? 360  VAL A CB  1 
ATOM   2783 C CG1 . VAL A 1 360 ? 14.475  49.401 69.045 1.00 34.69 ? 360  VAL A CG1 1 
ATOM   2784 C CG2 . VAL A 1 360 ? 15.038  51.576 69.913 1.00 33.52 ? 360  VAL A CG2 1 
ATOM   2785 N N   . PRO A 1 361 ? 10.442  49.940 70.676 1.00 35.17 ? 361  PRO A N   1 
ATOM   2786 C CA  . PRO A 1 361 ? 9.429   49.019 71.229 1.00 37.29 ? 361  PRO A CA  1 
ATOM   2787 C C   . PRO A 1 361 ? 9.493   47.571 70.768 1.00 39.71 ? 361  PRO A C   1 
ATOM   2788 O O   . PRO A 1 361 ? 9.218   46.659 71.538 1.00 39.31 ? 361  PRO A O   1 
ATOM   2789 C CB  . PRO A 1 361 ? 8.100   49.718 70.895 1.00 37.42 ? 361  PRO A CB  1 
ATOM   2790 C CG  . PRO A 1 361 ? 8.408   50.507 69.639 1.00 35.98 ? 361  PRO A CG  1 
ATOM   2791 C CD  . PRO A 1 361 ? 9.815   51.040 69.908 1.00 35.24 ? 361  PRO A CD  1 
ATOM   2792 N N   . HIS A 1 362 ? 9.901   47.374 69.528 1.00 42.86 ? 362  HIS A N   1 
ATOM   2793 C CA  . HIS A 1 362 ? 10.033  46.050 68.925 1.00 49.04 ? 362  HIS A CA  1 
ATOM   2794 C C   . HIS A 1 362 ? 11.400  45.336 69.238 1.00 50.21 ? 362  HIS A C   1 
ATOM   2795 O O   . HIS A 1 362 ? 11.841  44.472 68.457 1.00 50.83 ? 362  HIS A O   1 
ATOM   2796 C CB  . HIS A 1 362 ? 9.865   46.193 67.396 1.00 53.22 ? 362  HIS A CB  1 
ATOM   2797 C CG  . HIS A 1 362 ? 10.886  47.102 66.758 1.00 56.65 ? 362  HIS A CG  1 
ATOM   2798 N ND1 . HIS A 1 362 ? 10.805  48.487 66.807 1.00 58.06 ? 362  HIS A ND1 1 
ATOM   2799 C CD2 . HIS A 1 362 ? 12.032  46.817 66.092 1.00 56.95 ? 362  HIS A CD2 1 
ATOM   2800 C CE1 . HIS A 1 362 ? 11.858  49.007 66.198 1.00 58.64 ? 362  HIS A CE1 1 
ATOM   2801 N NE2 . HIS A 1 362 ? 12.617  48.016 65.755 1.00 58.66 ? 362  HIS A NE2 1 
ATOM   2802 N N   . ALA A 1 363 ? 12.035  45.658 70.383 1.00 49.25 ? 363  ALA A N   1 
ATOM   2803 C CA  . ALA A 1 363 ? 13.346  45.080 70.720 1.00 46.92 ? 363  ALA A CA  1 
ATOM   2804 C C   . ALA A 1 363 ? 13.500  44.178 71.938 1.00 45.36 ? 363  ALA A C   1 
ATOM   2805 O O   . ALA A 1 363 ? 13.046  44.492 73.043 1.00 45.44 ? 363  ALA A O   1 
ATOM   2806 C CB  . ALA A 1 363 ? 14.387  46.203 70.826 1.00 45.65 ? 363  ALA A CB  1 
ATOM   2807 N N   . ASN A 1 364 ? 14.188  43.058 71.746 1.00 43.51 ? 364  ASN A N   1 
ATOM   2808 C CA  . ASN A 1 364 ? 14.455  42.178 72.882 1.00 41.89 ? 364  ASN A CA  1 
ATOM   2809 C C   . ASN A 1 364 ? 15.561  42.851 73.728 1.00 41.02 ? 364  ASN A C   1 
ATOM   2810 O O   . ASN A 1 364 ? 16.086  43.920 73.362 1.00 39.73 ? 364  ASN A O   1 
ATOM   2811 C CB  . ASN A 1 364 ? 14.934  40.803 72.406 1.00 41.99 ? 364  ASN A CB  1 
ATOM   2812 C CG  . ASN A 1 364 ? 16.078  40.884 71.412 1.00 40.75 ? 364  ASN A CG  1 
ATOM   2813 O OD1 . ASN A 1 364 ? 16.855  41.857 71.389 1.00 40.29 ? 364  ASN A OD1 1 
ATOM   2814 N ND2 . ASN A 1 364 ? 16.189  39.862 70.588 1.00 37.72 ? 364  ASN A ND2 1 
ATOM   2815 N N   . ASP A 1 365 ? 15.902  42.229 74.848 1.00 40.55 ? 365  ASP A N   1 
ATOM   2816 C CA  . ASP A 1 365 ? 16.911  42.754 75.750 1.00 41.08 ? 365  ASP A CA  1 
ATOM   2817 C C   . ASP A 1 365 ? 18.282  42.976 75.107 1.00 39.04 ? 365  ASP A C   1 
ATOM   2818 O O   . ASP A 1 365 ? 18.939  43.972 75.387 1.00 38.46 ? 365  ASP A O   1 
ATOM   2819 C CB  . ASP A 1 365 ? 17.062  41.836 76.965 1.00 46.35 ? 365  ASP A CB  1 
ATOM   2820 C CG  . ASP A 1 365 ? 15.969  42.050 77.994 1.00 51.68 ? 365  ASP A CG  1 
ATOM   2821 O OD1 . ASP A 1 365 ? 15.016  42.836 77.711 1.00 53.61 ? 365  ASP A OD1 1 
ATOM   2822 O OD2 . ASP A 1 365 ? 16.067  41.429 79.089 1.00 54.68 ? 365  ASP A OD2 1 
ATOM   2823 N N   . LEU A 1 366 ? 18.715  42.042 74.271 1.00 36.95 ? 366  LEU A N   1 
ATOM   2824 C CA  . LEU A 1 366 ? 19.984  42.147 73.603 1.00 35.37 ? 366  LEU A CA  1 
ATOM   2825 C C   . LEU A 1 366 ? 19.975  43.390 72.708 1.00 34.73 ? 366  LEU A C   1 
ATOM   2826 O O   . LEU A 1 366 ? 20.937  44.156 72.709 1.00 35.17 ? 366  LEU A O   1 
ATOM   2827 C CB  . LEU A 1 366 ? 20.239  40.897 72.776 1.00 36.38 ? 366  LEU A CB  1 
ATOM   2828 C CG  . LEU A 1 366 ? 21.613  40.948 72.130 1.00 39.41 ? 366  LEU A CG  1 
ATOM   2829 C CD1 . LEU A 1 366 ? 22.687  40.833 73.218 1.00 40.06 ? 366  LEU A CD1 1 
ATOM   2830 C CD2 . LEU A 1 366 ? 21.750  39.814 71.150 1.00 40.56 ? 366  LEU A CD2 1 
ATOM   2831 N N   . GLY A 1 367 ? 18.886  43.606 71.962 1.00 32.85 ? 367  GLY A N   1 
ATOM   2832 C CA  . GLY A 1 367 ? 18.780  44.779 71.106 1.00 31.52 ? 367  GLY A CA  1 
ATOM   2833 C C   . GLY A 1 367 ? 18.795  46.091 71.914 1.00 31.15 ? 367  GLY A C   1 
ATOM   2834 O O   . GLY A 1 367 ? 19.443  47.065 71.510 1.00 30.11 ? 367  GLY A O   1 
ATOM   2835 N N   . LEU A 1 368 ? 18.080  46.126 73.039 1.00 30.83 ? 368  LEU A N   1 
ATOM   2836 C CA  . LEU A 1 368 ? 18.100  47.310 73.880 1.00 32.06 ? 368  LEU A CA  1 
ATOM   2837 C C   . LEU A 1 368 ? 19.540  47.572 74.379 1.00 33.28 ? 368  LEU A C   1 
ATOM   2838 O O   . LEU A 1 368 ? 19.986  48.750 74.432 1.00 33.11 ? 368  LEU A O   1 
ATOM   2839 C CB  . LEU A 1 368 ? 17.136  47.139 75.054 1.00 32.98 ? 368  LEU A CB  1 
ATOM   2840 C CG  . LEU A 1 368 ? 15.627  47.092 74.696 1.00 34.58 ? 368  LEU A CG  1 
ATOM   2841 C CD1 . LEU A 1 368 ? 14.824  46.800 75.962 1.00 35.21 ? 368  LEU A CD1 1 
ATOM   2842 C CD2 . LEU A 1 368 ? 15.167  48.404 74.115 1.00 33.30 ? 368  LEU A CD2 1 
ATOM   2843 N N   . ASP A 1 369 ? 20.273  46.501 74.736 1.00 32.49 ? 369  ASP A N   1 
ATOM   2844 C CA  . ASP A 1 369 ? 21.674  46.649 75.192 1.00 32.79 ? 369  ASP A CA  1 
ATOM   2845 C C   . ASP A 1 369 ? 22.565  47.232 74.044 1.00 31.29 ? 369  ASP A C   1 
ATOM   2846 O O   . ASP A 1 369 ? 23.429  48.093 74.286 1.00 30.01 ? 369  ASP A O   1 
ATOM   2847 C CB  . ASP A 1 369 ? 22.285  45.304 75.629 1.00 35.21 ? 369  ASP A CB  1 
ATOM   2848 C CG  . ASP A 1 369 ? 21.749  44.796 76.965 1.00 38.41 ? 369  ASP A CG  1 
ATOM   2849 O OD1 . ASP A 1 369 ? 21.163  45.565 77.767 1.00 39.55 ? 369  ASP A OD1 1 
ATOM   2850 O OD2 . ASP A 1 369 ? 21.928  43.587 77.218 1.00 42.02 ? 369  ASP A OD2 1 
ATOM   2851 N N   . ALA A 1 370 ? 22.331  46.771 72.818 1.00 29.91 ? 370  ALA A N   1 
ATOM   2852 C CA  . ALA A 1 370 ? 23.083  47.256 71.670 1.00 30.08 ? 370  ALA A CA  1 
ATOM   2853 C C   . ALA A 1 370 ? 22.841  48.763 71.496 1.00 30.04 ? 370  ALA A C   1 
ATOM   2854 O O   . ALA A 1 370 ? 23.789  49.499 71.271 1.00 30.43 ? 370  ALA A O   1 
ATOM   2855 C CB  . ALA A 1 370 ? 22.673  46.520 70.425 1.00 27.29 ? 370  ALA A CB  1 
ATOM   2856 N N   . VAL A 1 371 ? 21.593  49.221 71.609 1.00 28.52 ? 371  VAL A N   1 
ATOM   2857 C CA  . VAL A 1 371 ? 21.308  50.653 71.448 1.00 29.37 ? 371  VAL A CA  1 
ATOM   2858 C C   . VAL A 1 371 ? 21.999  51.447 72.571 1.00 29.33 ? 371  VAL A C   1 
ATOM   2859 O O   . VAL A 1 371 ? 22.719  52.409 72.316 1.00 29.92 ? 371  VAL A O   1 
ATOM   2860 C CB  . VAL A 1 371 ? 19.725  50.956 71.438 1.00 28.94 ? 371  VAL A CB  1 
ATOM   2861 C CG1 . VAL A 1 371 ? 19.457  52.466 71.379 1.00 27.15 ? 371  VAL A CG1 1 
ATOM   2862 C CG2 . VAL A 1 371 ? 19.061  50.252 70.207 1.00 28.12 ? 371  VAL A CG2 1 
ATOM   2863 N N   . THR A 1 372 ? 21.802  51.011 73.802 1.00 30.23 ? 372  THR A N   1 
ATOM   2864 C CA  . THR A 1 372 ? 22.385  51.679 74.959 1.00 32.01 ? 372  THR A CA  1 
ATOM   2865 C C   . THR A 1 372 ? 23.908  51.807 74.858 1.00 32.76 ? 372  THR A C   1 
ATOM   2866 O O   . THR A 1 372 ? 24.459  52.890 75.077 1.00 32.06 ? 372  THR A O   1 
ATOM   2867 C CB  . THR A 1 372 ? 21.994  50.932 76.238 1.00 33.87 ? 372  THR A CB  1 
ATOM   2868 O OG1 . THR A 1 372 ? 20.573  50.965 76.348 1.00 35.97 ? 372  THR A OG1 1 
ATOM   2869 C CG2 . THR A 1 372 ? 22.622  51.566 77.491 1.00 32.26 ? 372  THR A CG2 1 
ATOM   2870 N N   . LEU A 1 373 ? 24.586  50.721 74.490 1.00 32.86 ? 373  LEU A N   1 
ATOM   2871 C CA  . LEU A 1 373 ? 26.031  50.762 74.313 1.00 33.38 ? 373  LEU A CA  1 
ATOM   2872 C C   . LEU A 1 373 ? 26.462  51.793 73.228 1.00 33.50 ? 373  LEU A C   1 
ATOM   2873 O O   . LEU A 1 373 ? 27.479  52.486 73.366 1.00 31.85 ? 373  LEU A O   1 
ATOM   2874 C CB  . LEU A 1 373 ? 26.543  49.376 73.893 1.00 36.39 ? 373  LEU A CB  1 
ATOM   2875 C CG  . LEU A 1 373 ? 28.036  49.383 73.554 1.00 39.02 ? 373  LEU A CG  1 
ATOM   2876 C CD1 . LEU A 1 373 ? 28.829  49.876 74.751 1.00 40.77 ? 373  LEU A CD1 1 
ATOM   2877 C CD2 . LEU A 1 373 ? 28.496  48.010 73.193 1.00 41.19 ? 373  LEU A CD2 1 
ATOM   2878 N N   . GLN A 1 374 ? 25.683  51.875 72.154 1.00 31.68 ? 374  GLN A N   1 
ATOM   2879 C CA  . GLN A 1 374 ? 25.962  52.752 71.039 1.00 33.22 ? 374  GLN A CA  1 
ATOM   2880 C C   . GLN A 1 374 ? 25.837  54.263 71.359 1.00 32.54 ? 374  GLN A C   1 
ATOM   2881 O O   . GLN A 1 374 ? 26.537  55.085 70.795 1.00 30.89 ? 374  GLN A O   1 
ATOM   2882 C CB  . GLN A 1 374 ? 24.994  52.389 69.885 1.00 36.09 ? 374  GLN A CB  1 
ATOM   2883 C CG  . GLN A 1 374 ? 25.352  52.946 68.543 1.00 40.23 ? 374  GLN A CG  1 
ATOM   2884 C CD  . GLN A 1 374 ? 26.511  52.172 67.885 1.00 43.45 ? 374  GLN A CD  1 
ATOM   2885 O OE1 . GLN A 1 374 ? 27.037  52.602 66.851 1.00 45.52 ? 374  GLN A OE1 1 
ATOM   2886 N NE2 . GLN A 1 374 ? 26.898  51.027 68.475 1.00 43.82 ? 374  GLN A NE2 1 
ATOM   2887 N N   . TYR A 1 375 ? 24.948  54.618 72.268 1.00 31.79 ? 375  TYR A N   1 
ATOM   2888 C CA  . TYR A 1 375 ? 24.720  56.022 72.554 1.00 32.81 ? 375  TYR A CA  1 
ATOM   2889 C C   . TYR A 1 375 ? 25.165  56.489 73.946 1.00 34.27 ? 375  TYR A C   1 
ATOM   2890 O O   . TYR A 1 375 ? 24.891  57.619 74.353 1.00 35.30 ? 375  TYR A O   1 
ATOM   2891 C CB  . TYR A 1 375 ? 23.224  56.298 72.329 1.00 30.43 ? 375  TYR A CB  1 
ATOM   2892 C CG  . TYR A 1 375 ? 22.854  56.350 70.847 1.00 29.86 ? 375  TYR A CG  1 
ATOM   2893 C CD1 . TYR A 1 375 ? 22.867  57.552 70.167 1.00 28.85 ? 375  TYR A CD1 1 
ATOM   2894 C CD2 . TYR A 1 375 ? 22.510  55.195 70.126 1.00 27.97 ? 375  TYR A CD2 1 
ATOM   2895 C CE1 . TYR A 1 375 ? 22.546  57.640 68.808 1.00 27.67 ? 375  TYR A CE1 1 
ATOM   2896 C CE2 . TYR A 1 375 ? 22.192  55.277 68.747 1.00 28.05 ? 375  TYR A CE2 1 
ATOM   2897 C CZ  . TYR A 1 375 ? 22.210  56.520 68.107 1.00 27.97 ? 375  TYR A CZ  1 
ATOM   2898 O OH  . TYR A 1 375 ? 21.860  56.670 66.771 1.00 28.76 ? 375  TYR A OH  1 
ATOM   2899 N N   . THR A 1 376 ? 25.856  55.629 74.675 1.00 34.73 ? 376  THR A N   1 
ATOM   2900 C CA  . THR A 1 376 ? 26.304  55.986 76.018 1.00 34.27 ? 376  THR A CA  1 
ATOM   2901 C C   . THR A 1 376 ? 27.786  56.301 76.011 1.00 34.64 ? 376  THR A C   1 
ATOM   2902 O O   . THR A 1 376 ? 28.585  55.570 75.429 1.00 33.32 ? 376  THR A O   1 
ATOM   2903 C CB  . THR A 1 376 ? 26.109  54.827 77.004 1.00 34.93 ? 376  THR A CB  1 
ATOM   2904 O OG1 . THR A 1 376 ? 24.710  54.527 77.142 1.00 34.95 ? 376  THR A OG1 1 
ATOM   2905 C CG2 . THR A 1 376 ? 26.689  55.183 78.385 1.00 35.65 ? 376  THR A CG2 1 
ATOM   2906 N N   . ASP A 1 377 ? 28.154  57.395 76.650 1.00 34.45 ? 377  ASP A N   1 
ATOM   2907 C CA  . ASP A 1 377 ? 29.560  57.743 76.771 1.00 35.65 ? 377  ASP A CA  1 
ATOM   2908 C C   . ASP A 1 377 ? 29.933  57.107 78.136 1.00 37.06 ? 377  ASP A C   1 
ATOM   2909 O O   . ASP A 1 377 ? 29.570  57.671 79.198 1.00 35.26 ? 377  ASP A O   1 
ATOM   2910 C CB  . ASP A 1 377 ? 29.692  59.241 76.860 1.00 36.46 ? 377  ASP A CB  1 
ATOM   2911 C CG  . ASP A 1 377 ? 31.091  59.679 77.235 1.00 38.43 ? 377  ASP A CG  1 
ATOM   2912 O OD1 . ASP A 1 377 ? 31.920  58.804 77.606 1.00 37.28 ? 377  ASP A OD1 1 
ATOM   2913 O OD2 . ASP A 1 377 ? 31.347  60.911 77.168 1.00 38.01 ? 377  ASP A OD2 1 
ATOM   2914 N N   . TRP A 1 378 ? 30.625  55.952 78.122 1.00 36.42 ? 378  TRP A N   1 
ATOM   2915 C CA  . TRP A 1 378 ? 30.964  55.269 79.377 1.00 37.84 ? 378  TRP A CA  1 
ATOM   2916 C C   . TRP A 1 378 ? 31.970  55.916 80.293 1.00 38.59 ? 378  TRP A C   1 
ATOM   2917 O O   . TRP A 1 378 ? 32.141  55.450 81.407 1.00 38.94 ? 378  TRP A O   1 
ATOM   2918 C CB  . TRP A 1 378 ? 31.355  53.797 79.165 1.00 38.08 ? 378  TRP A CB  1 
ATOM   2919 C CG  . TRP A 1 378 ? 30.226  52.998 78.637 1.00 40.33 ? 378  TRP A CG  1 
ATOM   2920 C CD1 . TRP A 1 378 ? 30.054  52.611 77.349 1.00 41.99 ? 378  TRP A CD1 1 
ATOM   2921 C CD2 . TRP A 1 378 ? 29.028  52.621 79.334 1.00 40.91 ? 378  TRP A CD2 1 
ATOM   2922 N NE1 . TRP A 1 378 ? 28.831  52.027 77.191 1.00 43.60 ? 378  TRP A NE1 1 
ATOM   2923 C CE2 . TRP A 1 378 ? 28.177  52.019 78.392 1.00 41.98 ? 378  TRP A CE2 1 
ATOM   2924 C CE3 . TRP A 1 378 ? 28.595  52.740 80.661 1.00 42.93 ? 378  TRP A CE3 1 
ATOM   2925 C CZ2 . TRP A 1 378 ? 26.895  51.540 78.721 1.00 44.06 ? 378  TRP A CZ2 1 
ATOM   2926 C CZ3 . TRP A 1 378 ? 27.310  52.265 80.998 1.00 43.96 ? 378  TRP A CZ3 1 
ATOM   2927 C CH2 . TRP A 1 378 ? 26.482  51.675 80.031 1.00 44.23 ? 378  TRP A CH2 1 
ATOM   2928 N N   . MET A 1 379 ? 32.645  56.967 79.848 1.00 39.96 ? 379  MET A N   1 
ATOM   2929 C CA  . MET A 1 379 ? 33.553  57.668 80.758 1.00 42.54 ? 379  MET A CA  1 
ATOM   2930 C C   . MET A 1 379 ? 32.766  58.708 81.545 1.00 42.63 ? 379  MET A C   1 
ATOM   2931 O O   . MET A 1 379 ? 33.307  59.351 82.454 1.00 42.99 ? 379  MET A O   1 
ATOM   2932 C CB  . MET A 1 379 ? 34.631  58.442 80.011 1.00 45.29 ? 379  MET A CB  1 
ATOM   2933 C CG  . MET A 1 379 ? 35.195  57.768 78.778 1.00 50.82 ? 379  MET A CG  1 
ATOM   2934 S SD  . MET A 1 379 ? 36.809  58.465 78.491 1.00 56.05 ? 379  MET A SD  1 
ATOM   2935 C CE  . MET A 1 379 ? 37.593  57.765 80.114 1.00 52.62 ? 379  MET A CE  1 
ATOM   2936 N N   . ASP A 1 380 ? 31.485  58.886 81.221 1.00 42.66 ? 380  ASP A N   1 
ATOM   2937 C CA  . ASP A 1 380 ? 30.695  59.944 81.872 1.00 41.58 ? 380  ASP A CA  1 
ATOM   2938 C C   . ASP A 1 380 ? 29.211  59.594 81.764 1.00 41.18 ? 380  ASP A C   1 
ATOM   2939 O O   . ASP A 1 380 ? 28.393  60.404 81.325 1.00 39.93 ? 380  ASP A O   1 
ATOM   2940 C CB  . ASP A 1 380 ? 31.030  61.260 81.123 1.00 40.09 ? 380  ASP A CB  1 
ATOM   2941 C CG  . ASP A 1 380 ? 30.506  62.513 81.824 1.00 40.58 ? 380  ASP A CG  1 
ATOM   2942 O OD1 . ASP A 1 380 ? 30.172  62.452 83.034 1.00 39.30 ? 380  ASP A OD1 1 
ATOM   2943 O OD2 . ASP A 1 380 ? 30.445  63.563 81.149 1.00 39.06 ? 380  ASP A OD2 1 
ATOM   2944 N N   . ASP A 1 381 ? 28.869  58.387 82.186 1.00 42.11 ? 381  ASP A N   1 
ATOM   2945 C CA  . ASP A 1 381 ? 27.499  57.895 82.060 1.00 43.41 ? 381  ASP A CA  1 
ATOM   2946 C C   . ASP A 1 381 ? 26.422  58.543 82.925 1.00 44.35 ? 381  ASP A C   1 
ATOM   2947 O O   . ASP A 1 381 ? 25.234  58.292 82.716 1.00 43.59 ? 381  ASP A O   1 
ATOM   2948 C CB  . ASP A 1 381 ? 27.474  56.384 82.262 1.00 43.37 ? 381  ASP A CB  1 
ATOM   2949 C CG  . ASP A 1 381 ? 28.034  55.982 83.602 1.00 44.47 ? 381  ASP A CG  1 
ATOM   2950 O OD1 . ASP A 1 381 ? 29.236  56.216 83.860 1.00 45.04 ? 381  ASP A OD1 1 
ATOM   2951 O OD2 . ASP A 1 381 ? 27.260  55.447 84.397 1.00 45.37 ? 381  ASP A OD2 1 
ATOM   2952 N N   . ASN A 1 382 ? 26.815  59.367 83.890 1.00 45.34 ? 382  ASN A N   1 
ATOM   2953 C CA  . ASN A 1 382 ? 25.818  60.034 84.721 1.00 45.75 ? 382  ASN A CA  1 
ATOM   2954 C C   . ASN A 1 382 ? 25.597  61.468 84.324 1.00 45.28 ? 382  ASN A C   1 
ATOM   2955 O O   . ASN A 1 382 ? 24.905  62.213 85.034 1.00 47.25 ? 382  ASN A O   1 
ATOM   2956 C CB  . ASN A 1 382 ? 26.203  59.980 86.192 1.00 47.56 ? 382  ASN A CB  1 
ATOM   2957 C CG  . ASN A 1 382 ? 25.987  58.617 86.763 1.00 49.50 ? 382  ASN A CG  1 
ATOM   2958 O OD1 . ASN A 1 382 ? 24.878  58.079 86.683 1.00 49.80 ? 382  ASN A OD1 1 
ATOM   2959 N ND2 . ASN A 1 382 ? 27.039  58.024 87.323 1.00 50.73 ? 382  ASN A ND2 1 
ATOM   2960 N N   . ASN A 1 383 ? 26.188  61.863 83.197 1.00 42.91 ? 383  ASN A N   1 
ATOM   2961 C CA  . ASN A 1 383 ? 26.025  63.221 82.670 1.00 39.47 ? 383  ASN A CA  1 
ATOM   2962 C C   . ASN A 1 383 ? 24.565  63.342 82.146 1.00 37.86 ? 383  ASN A C   1 
ATOM   2963 O O   . ASN A 1 383 ? 24.191  62.684 81.158 1.00 34.86 ? 383  ASN A O   1 
ATOM   2964 C CB  . ASN A 1 383 ? 27.039  63.416 81.540 1.00 39.14 ? 383  ASN A CB  1 
ATOM   2965 C CG  . ASN A 1 383 ? 27.072  64.828 81.023 1.00 40.21 ? 383  ASN A CG  1 
ATOM   2966 O OD1 . ASN A 1 383 ? 28.151  65.366 80.738 1.00 39.95 ? 383  ASN A OD1 1 
ATOM   2967 N ND2 . ASN A 1 383 ? 25.899  65.444 80.878 1.00 39.15 ? 383  ASN A ND2 1 
ATOM   2968 N N   . GLY A 1 384 ? 23.755  64.143 82.849 1.00 35.73 ? 384  GLY A N   1 
ATOM   2969 C CA  . GLY A 1 384 ? 22.370  64.372 82.503 1.00 32.70 ? 384  GLY A CA  1 
ATOM   2970 C C   . GLY A 1 384 ? 22.165  64.974 81.126 1.00 33.24 ? 384  GLY A C   1 
ATOM   2971 O O   . GLY A 1 384 ? 21.192  64.610 80.455 1.00 32.78 ? 384  GLY A O   1 
ATOM   2972 N N   . ILE A 1 385 ? 23.049  65.881 80.717 1.00 32.03 ? 385  ILE A N   1 
ATOM   2973 C CA  . ILE A 1 385 ? 22.988  66.511 79.403 1.00 33.60 ? 385  ILE A CA  1 
ATOM   2974 C C   . ILE A 1 385 ? 23.280  65.486 78.277 1.00 34.73 ? 385  ILE A C   1 
ATOM   2975 O O   . ILE A 1 385 ? 22.577  65.456 77.240 1.00 35.71 ? 385  ILE A O   1 
ATOM   2976 C CB  . ILE A 1 385 ? 24.029  67.618 79.256 1.00 33.11 ? 385  ILE A CB  1 
ATOM   2977 C CG1 . ILE A 1 385 ? 23.844  68.680 80.338 1.00 35.70 ? 385  ILE A CG1 1 
ATOM   2978 C CG2 . ILE A 1 385 ? 23.928  68.243 77.892 1.00 30.77 ? 385  ILE A CG2 1 
ATOM   2979 C CD1 . ILE A 1 385 ? 22.671  69.543 80.126 1.00 36.60 ? 385  ILE A CD1 1 
ATOM   2980 N N   . LYS A 1 386 ? 24.317  64.670 78.466 1.00 33.23 ? 386  LYS A N   1 
ATOM   2981 C CA  . LYS A 1 386 ? 24.684  63.669 77.469 1.00 33.76 ? 386  LYS A CA  1 
ATOM   2982 C C   . LYS A 1 386 ? 23.605  62.608 77.380 1.00 33.50 ? 386  LYS A C   1 
ATOM   2983 O O   . LYS A 1 386 ? 23.343  62.082 76.290 1.00 32.14 ? 386  LYS A O   1 
ATOM   2984 C CB  . LYS A 1 386 ? 26.029  63.008 77.806 1.00 35.25 ? 386  LYS A CB  1 
ATOM   2985 C CG  . LYS A 1 386 ? 27.253  63.861 77.466 1.00 37.98 ? 386  LYS A CG  1 
ATOM   2986 C CD  . LYS A 1 386 ? 28.564  63.123 77.834 1.00 40.78 ? 386  LYS A CD  1 
ATOM   2987 C CE  . LYS A 1 386 ? 29.809  63.867 77.316 1.00 41.14 ? 386  LYS A CE  1 
ATOM   2988 N NZ  . LYS A 1 386 ? 30.992  63.558 78.193 1.00 42.66 ? 386  LYS A NZ  1 
ATOM   2989 N N   . ASN A 1 387 ? 22.972  62.300 78.511 1.00 31.12 ? 387  ASN A N   1 
ATOM   2990 C CA  . ASN A 1 387 ? 21.912  61.326 78.487 1.00 32.94 ? 387  ASN A CA  1 
ATOM   2991 C C   . ASN A 1 387 ? 20.684  61.874 77.736 1.00 32.34 ? 387  ASN A C   1 
ATOM   2992 O O   . ASN A 1 387 ? 20.090  61.170 76.921 1.00 31.22 ? 387  ASN A O   1 
ATOM   2993 C CB  . ASN A 1 387 ? 21.537  60.913 79.898 1.00 33.08 ? 387  ASN A CB  1 
ATOM   2994 C CG  . ASN A 1 387 ? 22.628  60.047 80.561 1.00 37.75 ? 387  ASN A CG  1 
ATOM   2995 O OD1 . ASN A 1 387 ? 23.442  59.425 79.876 1.00 38.93 ? 387  ASN A OD1 1 
ATOM   2996 N ND2 . ASN A 1 387 ? 22.636  60.004 81.897 1.00 37.65 ? 387  ASN A ND2 1 
ATOM   2997 N N   . ARG A 1 388 ? 20.315  63.123 78.016 1.00 30.65 ? 388  ARG A N   1 
ATOM   2998 C CA  . ARG A 1 388 ? 19.181  63.757 77.355 1.00 30.52 ? 388  ARG A CA  1 
ATOM   2999 C C   . ARG A 1 388 ? 19.487  63.803 75.849 1.00 30.89 ? 388  ARG A C   1 
ATOM   3000 O O   . ARG A 1 388 ? 18.706  63.326 75.055 1.00 31.00 ? 388  ARG A O   1 
ATOM   3001 C CB  . ARG A 1 388 ? 18.970  65.184 77.900 1.00 28.79 ? 388  ARG A CB  1 
ATOM   3002 C CG  . ARG A 1 388 ? 17.924  66.012 77.179 1.00 28.17 ? 388  ARG A CG  1 
ATOM   3003 C CD  . ARG A 1 388 ? 18.081  67.494 77.459 1.00 26.09 ? 388  ARG A CD  1 
ATOM   3004 N NE  . ARG A 1 388 ? 19.224  68.039 76.757 1.00 31.41 ? 388  ARG A NE  1 
ATOM   3005 C CZ  . ARG A 1 388 ? 19.905  69.132 77.137 1.00 32.23 ? 388  ARG A CZ  1 
ATOM   3006 N NH1 . ARG A 1 388 ? 20.951  69.560 76.424 1.00 30.91 ? 388  ARG A NH1 1 
ATOM   3007 N NH2 . ARG A 1 388 ? 19.544  69.802 78.236 1.00 31.14 ? 388  ARG A NH2 1 
ATOM   3008 N N   . ASP A 1 389 ? 20.640  64.340 75.463 1.00 29.83 ? 389  ASP A N   1 
ATOM   3009 C CA  . ASP A 1 389 ? 20.967  64.438 74.044 1.00 30.20 ? 389  ASP A CA  1 
ATOM   3010 C C   . ASP A 1 389 ? 21.138  63.072 73.304 1.00 29.04 ? 389  ASP A C   1 
ATOM   3011 O O   . ASP A 1 389 ? 20.792  62.947 72.120 1.00 26.80 ? 389  ASP A O   1 
ATOM   3012 C CB  . ASP A 1 389 ? 22.233  65.306 73.829 1.00 28.41 ? 389  ASP A CB  1 
ATOM   3013 C CG  . ASP A 1 389 ? 22.047  66.772 74.236 1.00 31.22 ? 389  ASP A CG  1 
ATOM   3014 O OD1 . ASP A 1 389 ? 20.889  67.250 74.349 1.00 32.53 ? 389  ASP A OD1 1 
ATOM   3015 O OD2 . ASP A 1 389 ? 23.090  67.451 74.428 1.00 33.17 ? 389  ASP A OD2 1 
ATOM   3016 N N   . GLY A 1 390 ? 21.683  62.071 73.986 1.00 29.35 ? 390  GLY A N   1 
ATOM   3017 C CA  . GLY A 1 390 ? 21.870  60.760 73.366 1.00 30.19 ? 390  GLY A CA  1 
ATOM   3018 C C   . GLY A 1 390 ? 20.516  60.140 73.056 1.00 29.47 ? 390  GLY A C   1 
ATOM   3019 O O   . GLY A 1 390 ? 20.311  59.511 72.034 1.00 28.34 ? 390  GLY A O   1 
ATOM   3020 N N   . LEU A 1 391 ? 19.572  60.352 73.954 1.00 29.57 ? 391  LEU A N   1 
ATOM   3021 C CA  . LEU A 1 391 ? 18.218  59.837 73.763 1.00 30.36 ? 391  LEU A CA  1 
ATOM   3022 C C   . LEU A 1 391 ? 17.551  60.623 72.614 1.00 29.47 ? 391  LEU A C   1 
ATOM   3023 O O   . LEU A 1 391 ? 16.837  60.056 71.792 1.00 28.79 ? 391  LEU A O   1 
ATOM   3024 C CB  . LEU A 1 391 ? 17.460  59.996 75.094 1.00 31.98 ? 391  LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 391 ? 16.226  59.164 75.431 1.00 33.90 ? 391  LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 391 ? 16.365  57.719 74.906 1.00 33.50 ? 391  LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 391 ? 16.034  59.199 76.955 1.00 31.95 ? 391  LEU A CD2 1 
ATOM   3028 N N   . ASP A 1 392 ? 17.786  61.931 72.564 1.00 27.34 ? 392  ASP A N   1 
ATOM   3029 C CA  . ASP A 1 392 ? 17.261  62.756 71.488 1.00 28.52 ? 392  ASP A CA  1 
ATOM   3030 C C   . ASP A 1 392 ? 17.790  62.162 70.138 1.00 27.39 ? 392  ASP A C   1 
ATOM   3031 O O   . ASP A 1 392 ? 17.035  61.932 69.196 1.00 26.82 ? 392  ASP A O   1 
ATOM   3032 C CB  . ASP A 1 392 ? 17.739  64.209 71.697 1.00 28.98 ? 392  ASP A CB  1 
ATOM   3033 C CG  . ASP A 1 392 ? 16.928  65.253 70.874 1.00 33.93 ? 392  ASP A CG  1 
ATOM   3034 O OD1 . ASP A 1 392 ? 16.219  64.891 69.890 1.00 34.05 ? 392  ASP A OD1 1 
ATOM   3035 O OD2 . ASP A 1 392 ? 17.015  66.472 71.198 1.00 32.88 ? 392  ASP A OD2 1 
ATOM   3036 N N   . ASP A 1 393 ? 19.080  61.880 70.056 1.00 26.61 ? 393  ASP A N   1 
ATOM   3037 C CA  . ASP A 1 393 ? 19.659  61.325 68.818 1.00 27.11 ? 393  ASP A CA  1 
ATOM   3038 C C   . ASP A 1 393 ? 19.092  59.937 68.543 1.00 27.06 ? 393  ASP A C   1 
ATOM   3039 O O   . ASP A 1 393 ? 18.823  59.595 67.406 1.00 27.68 ? 393  ASP A O   1 
ATOM   3040 C CB  . ASP A 1 393 ? 21.177  61.240 68.950 1.00 28.18 ? 393  ASP A CB  1 
ATOM   3041 C CG  . ASP A 1 393 ? 21.831  62.589 68.827 1.00 32.06 ? 393  ASP A CG  1 
ATOM   3042 O OD1 . ASP A 1 393 ? 21.278  63.456 68.099 1.00 32.98 ? 393  ASP A OD1 1 
ATOM   3043 O OD2 . ASP A 1 393 ? 22.897  62.772 69.433 1.00 31.65 ? 393  ASP A OD2 1 
ATOM   3044 N N   . ILE A 1 394 ? 18.896  59.131 69.577 1.00 26.05 ? 394  ILE A N   1 
ATOM   3045 C CA  . ILE A 1 394 ? 18.329  57.797 69.320 1.00 25.26 ? 394  ILE A CA  1 
ATOM   3046 C C   . ILE A 1 394 ? 16.974  57.908 68.637 1.00 24.78 ? 394  ILE A C   1 
ATOM   3047 O O   . ILE A 1 394 ? 16.735  57.262 67.600 1.00 23.86 ? 394  ILE A O   1 
ATOM   3048 C CB  . ILE A 1 394 ? 18.154  57.024 70.625 1.00 24.32 ? 394  ILE A CB  1 
ATOM   3049 C CG1 . ILE A 1 394 ? 19.515  56.465 71.073 1.00 23.94 ? 394  ILE A CG1 1 
ATOM   3050 C CG2 . ILE A 1 394 ? 17.054  55.899 70.480 1.00 22.96 ? 394  ILE A CG2 1 
ATOM   3051 C CD1 . ILE A 1 394 ? 19.457  56.054 72.590 1.00 23.72 ? 394  ILE A CD1 1 
ATOM   3052 N N   . VAL A 1 395 ? 16.084  58.743 69.198 1.00 24.52 ? 395  VAL A N   1 
ATOM   3053 C CA  . VAL A 1 395 ? 14.749  58.854 68.645 1.00 23.80 ? 395  VAL A CA  1 
ATOM   3054 C C   . VAL A 1 395 ? 14.800  59.389 67.229 1.00 24.00 ? 395  VAL A C   1 
ATOM   3055 O O   . VAL A 1 395 ? 14.189  58.815 66.326 1.00 24.80 ? 395  VAL A O   1 
ATOM   3056 C CB  . VAL A 1 395 ? 13.829  59.706 69.599 1.00 24.47 ? 395  VAL A CB  1 
ATOM   3057 C CG1 . VAL A 1 395 ? 12.469  59.866 69.014 1.00 23.38 ? 395  VAL A CG1 1 
ATOM   3058 C CG2 . VAL A 1 395 ? 13.719  59.022 70.948 1.00 21.94 ? 395  VAL A CG2 1 
ATOM   3059 N N   . GLY A 1 396 ? 15.565  60.459 67.019 1.00 23.94 ? 396  GLY A N   1 
ATOM   3060 C CA  . GLY A 1 396 ? 15.684  61.020 65.679 1.00 23.37 ? 396  GLY A CA  1 
ATOM   3061 C C   . GLY A 1 396 ? 16.354  60.116 64.639 1.00 24.56 ? 396  GLY A C   1 
ATOM   3062 O O   . GLY A 1 396 ? 15.908  60.055 63.457 1.00 26.36 ? 396  GLY A O   1 
ATOM   3063 N N   . ASP A 1 397 ? 17.448  59.456 65.020 1.00 23.94 ? 397  ASP A N   1 
ATOM   3064 C CA  . ASP A 1 397 ? 18.146  58.559 64.096 1.00 23.85 ? 397  ASP A CA  1 
ATOM   3065 C C   . ASP A 1 397 ? 17.265  57.381 63.709 1.00 24.51 ? 397  ASP A C   1 
ATOM   3066 O O   . ASP A 1 397 ? 17.117  57.086 62.535 1.00 25.13 ? 397  ASP A O   1 
ATOM   3067 C CB  . ASP A 1 397 ? 19.425  57.991 64.733 1.00 25.34 ? 397  ASP A CB  1 
ATOM   3068 C CG  . ASP A 1 397 ? 20.509  59.077 64.951 1.00 28.37 ? 397  ASP A CG  1 
ATOM   3069 O OD1 . ASP A 1 397 ? 20.384  60.159 64.349 1.00 26.25 ? 397  ASP A OD1 1 
ATOM   3070 O OD2 . ASP A 1 397 ? 21.499  58.849 65.699 1.00 27.32 ? 397  ASP A OD2 1 
ATOM   3071 N N   . HIS A 1 398 ? 16.674  56.715 64.694 1.00 24.37 ? 398  HIS A N   1 
ATOM   3072 C CA  . HIS A 1 398 ? 15.834  55.560 64.412 1.00 24.89 ? 398  HIS A CA  1 
ATOM   3073 C C   . HIS A 1 398 ? 14.549  55.887 63.652 1.00 26.46 ? 398  HIS A C   1 
ATOM   3074 O O   . HIS A 1 398 ? 14.212  55.167 62.716 1.00 26.14 ? 398  HIS A O   1 
ATOM   3075 C CB  . HIS A 1 398 ? 15.492  54.813 65.708 1.00 24.65 ? 398  HIS A CB  1 
ATOM   3076 C CG  . HIS A 1 398 ? 14.383  53.826 65.561 1.00 27.08 ? 398  HIS A CG  1 
ATOM   3077 N ND1 . HIS A 1 398 ? 14.498  52.687 64.797 1.00 26.97 ? 398  HIS A ND1 1 
ATOM   3078 C CD2 . HIS A 1 398 ? 13.151  53.775 66.133 1.00 29.77 ? 398  HIS A CD2 1 
ATOM   3079 C CE1 . HIS A 1 398 ? 13.395  51.964 64.912 1.00 26.58 ? 398  HIS A CE1 1 
ATOM   3080 N NE2 . HIS A 1 398 ? 12.565  52.595 65.719 1.00 29.44 ? 398  HIS A NE2 1 
ATOM   3081 N N   . ASN A 1 399 ? 13.869  56.986 63.988 1.00 26.09 ? 399  ASN A N   1 
ATOM   3082 C CA  . ASN A 1 399 ? 12.588  57.275 63.341 1.00 23.93 ? 399  ASN A CA  1 
ATOM   3083 C C   . ASN A 1 399 ? 12.558  58.123 62.101 1.00 24.92 ? 399  ASN A C   1 
ATOM   3084 O O   . ASN A 1 399 ? 11.618  58.047 61.307 1.00 24.80 ? 399  ASN A O   1 
ATOM   3085 C CB  . ASN A 1 399 ? 11.689  57.887 64.383 1.00 22.41 ? 399  ASN A CB  1 
ATOM   3086 C CG  . ASN A 1 399 ? 11.235  56.880 65.411 1.00 23.77 ? 399  ASN A CG  1 
ATOM   3087 O OD1 . ASN A 1 399 ? 10.482  55.940 65.072 1.00 20.73 ? 399  ASN A OD1 1 
ATOM   3088 N ND2 . ASN A 1 399 ? 11.672  57.049 66.674 1.00 20.47 ? 399  ASN A ND2 1 
ATOM   3089 N N   . VAL A 1 400 ? 13.579  58.964 61.934 1.00 25.66 ? 400  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 400 ? 13.614  59.866 60.803 1.00 23.69 ? 400  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 400 ? 14.888  59.812 59.984 1.00 24.58 ? 400  VAL A C   1 
ATOM   3092 O O   . VAL A 1 400 ? 14.864  59.458 58.787 1.00 23.31 ? 400  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 400 ? 13.401  61.306 61.276 1.00 25.33 ? 400  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 400 ? 13.482  62.281 60.100 1.00 22.81 ? 400  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 400 ? 12.036  61.417 61.990 1.00 22.84 ? 400  VAL A CG2 1 
ATOM   3096 N N   . ILE A 1 401 ? 16.020  60.130 60.608 1.00 24.99 ? 401  ILE A N   1 
ATOM   3097 C CA  . ILE A 1 401 ? 17.252  60.167 59.848 1.00 24.17 ? 401  ILE A CA  1 
ATOM   3098 C C   . ILE A 1 401 ? 17.720  58.876 59.178 1.00 25.43 ? 401  ILE A C   1 
ATOM   3099 O O   . ILE A 1 401 ? 17.871  58.840 57.961 1.00 26.05 ? 401  ILE A O   1 
ATOM   3100 C CB  . ILE A 1 401 ? 18.399  60.743 60.662 1.00 23.61 ? 401  ILE A CB  1 
ATOM   3101 C CG1 . ILE A 1 401 ? 17.969  62.123 61.151 1.00 25.66 ? 401  ILE A CG1 1 
ATOM   3102 C CG2 . ILE A 1 401 ? 19.695  60.850 59.760 1.00 22.66 ? 401  ILE A CG2 1 
ATOM   3103 C CD1 . ILE A 1 401 ? 19.027  62.875 61.948 1.00 26.16 ? 401  ILE A CD1 1 
ATOM   3104 N N   . CYS A 1 402 ? 17.932  57.814 59.921 1.00 24.20 ? 402  CYS A N   1 
ATOM   3105 C CA  . CYS A 1 402 ? 18.397  56.623 59.249 1.00 25.50 ? 402  CYS A CA  1 
ATOM   3106 C C   . CYS A 1 402 ? 17.382  56.027 58.271 1.00 26.24 ? 402  CYS A C   1 
ATOM   3107 O O   . CYS A 1 402 ? 17.783  55.453 57.282 1.00 26.95 ? 402  CYS A O   1 
ATOM   3108 C CB  . CYS A 1 402 ? 18.896  55.618 60.280 1.00 25.72 ? 402  CYS A CB  1 
ATOM   3109 S SG  . CYS A 1 402 ? 20.311  56.367 61.188 1.00 28.62 ? 402  CYS A SG  1 
ATOM   3110 N N   . PRO A 1 403 ? 16.068  56.124 58.542 1.00 24.65 ? 403  PRO A N   1 
ATOM   3111 C CA  . PRO A 1 403 ? 15.179  55.547 57.518 1.00 25.00 ? 403  PRO A CA  1 
ATOM   3112 C C   . PRO A 1 403 ? 15.317  56.410 56.260 1.00 25.37 ? 403  PRO A C   1 
ATOM   3113 O O   . PRO A 1 403 ? 15.306  55.904 55.142 1.00 26.82 ? 403  PRO A O   1 
ATOM   3114 C CB  . PRO A 1 403 ? 13.763  55.680 58.140 1.00 25.74 ? 403  PRO A CB  1 
ATOM   3115 C CG  . PRO A 1 403 ? 14.043  55.429 59.628 1.00 25.21 ? 403  PRO A CG  1 
ATOM   3116 C CD  . PRO A 1 403 ? 15.386  56.233 59.843 1.00 25.38 ? 403  PRO A CD  1 
ATOM   3117 N N   . LEU A 1 404 ? 15.440  57.721 56.423 1.00 25.37 ? 404  LEU A N   1 
ATOM   3118 C CA  . LEU A 1 404 ? 15.556  58.571 55.230 1.00 26.00 ? 404  LEU A CA  1 
ATOM   3119 C C   . LEU A 1 404 ? 16.880  58.305 54.470 1.00 27.11 ? 404  LEU A C   1 
ATOM   3120 O O   . LEU A 1 404 ? 16.929  58.283 53.219 1.00 27.06 ? 404  LEU A O   1 
ATOM   3121 C CB  . LEU A 1 404 ? 15.443  60.045 55.609 1.00 25.23 ? 404  LEU A CB  1 
ATOM   3122 C CG  . LEU A 1 404 ? 15.438  61.015 54.402 1.00 25.67 ? 404  LEU A CG  1 
ATOM   3123 C CD1 . LEU A 1 404 ? 14.493  62.187 54.675 1.00 25.16 ? 404  LEU A CD1 1 
ATOM   3124 C CD2 . LEU A 1 404 ? 16.859  61.487 54.113 1.00 26.09 ? 404  LEU A CD2 1 
ATOM   3125 N N   . MET A 1 405 ? 17.950  58.043 55.213 1.00 27.26 ? 405  MET A N   1 
ATOM   3126 C CA  . MET A 1 405 ? 19.217  57.780 54.558 1.00 26.79 ? 405  MET A CA  1 
ATOM   3127 C C   . MET A 1 405 ? 19.155  56.477 53.767 1.00 27.28 ? 405  MET A C   1 
ATOM   3128 O O   . MET A 1 405 ? 19.689  56.386 52.663 1.00 25.87 ? 405  MET A O   1 
ATOM   3129 C CB  . MET A 1 405 ? 20.365  57.782 55.575 1.00 27.19 ? 405  MET A CB  1 
ATOM   3130 C CG  . MET A 1 405 ? 20.635  59.182 56.106 1.00 25.10 ? 405  MET A CG  1 
ATOM   3131 S SD  . MET A 1 405 ? 20.827  60.446 54.816 1.00 26.17 ? 405  MET A SD  1 
ATOM   3132 C CE  . MET A 1 405 ? 22.255  59.702 53.805 1.00 22.36 ? 405  MET A CE  1 
ATOM   3133 N N   . HIS A 1 406 ? 18.444  55.495 54.298 1.00 28.17 ? 406  HIS A N   1 
ATOM   3134 C CA  . HIS A 1 406 ? 18.301  54.221 53.603 1.00 28.96 ? 406  HIS A CA  1 
ATOM   3135 C C   . HIS A 1 406 ? 17.446  54.461 52.333 1.00 29.40 ? 406  HIS A C   1 
ATOM   3136 O O   . HIS A 1 406 ? 17.735  53.922 51.262 1.00 29.52 ? 406  HIS A O   1 
ATOM   3137 C CB  . HIS A 1 406 ? 17.621  53.204 54.513 1.00 28.53 ? 406  HIS A CB  1 
ATOM   3138 C CG  . HIS A 1 406 ? 17.355  51.889 53.857 1.00 30.52 ? 406  HIS A CG  1 
ATOM   3139 N ND1 . HIS A 1 406 ? 18.354  50.966 53.594 1.00 32.35 ? 406  HIS A ND1 1 
ATOM   3140 C CD2 . HIS A 1 406 ? 16.199  51.336 53.418 1.00 29.74 ? 406  HIS A CD2 1 
ATOM   3141 C CE1 . HIS A 1 406 ? 17.816  49.900 53.025 1.00 30.98 ? 406  HIS A CE1 1 
ATOM   3142 N NE2 . HIS A 1 406 ? 16.514  50.097 52.912 1.00 31.75 ? 406  HIS A NE2 1 
ATOM   3143 N N   . PHE A 1 407 ? 16.410  55.286 52.442 1.00 28.49 ? 407  PHE A N   1 
ATOM   3144 C CA  . PHE A 1 407 ? 15.587  55.554 51.265 1.00 28.53 ? 407  PHE A CA  1 
ATOM   3145 C C   . PHE A 1 407 ? 16.424  56.311 50.225 1.00 28.45 ? 407  PHE A C   1 
ATOM   3146 O O   . PHE A 1 407 ? 16.362  55.988 49.027 1.00 27.19 ? 407  PHE A O   1 
ATOM   3147 C CB  . PHE A 1 407 ? 14.337  56.388 51.627 1.00 27.72 ? 407  PHE A CB  1 
ATOM   3148 C CG  . PHE A 1 407 ? 13.552  56.891 50.427 1.00 26.49 ? 407  PHE A CG  1 
ATOM   3149 C CD1 . PHE A 1 407 ? 12.644  56.061 49.772 1.00 26.16 ? 407  PHE A CD1 1 
ATOM   3150 C CD2 . PHE A 1 407 ? 13.719  58.204 49.973 1.00 25.89 ? 407  PHE A CD2 1 
ATOM   3151 C CE1 . PHE A 1 407 ? 11.878  56.534 48.658 1.00 26.60 ? 407  PHE A CE1 1 
ATOM   3152 C CE2 . PHE A 1 407 ? 12.968  58.694 48.858 1.00 27.56 ? 407  PHE A CE2 1 
ATOM   3153 C CZ  . PHE A 1 407 ? 12.041  57.850 48.207 1.00 25.51 ? 407  PHE A CZ  1 
ATOM   3154 N N   . VAL A 1 408 ? 17.231  57.286 50.648 1.00 28.79 ? 408  VAL A N   1 
ATOM   3155 C CA  . VAL A 1 408 ? 17.954  58.026 49.631 1.00 30.42 ? 408  VAL A CA  1 
ATOM   3156 C C   . VAL A 1 408 ? 19.028  57.204 48.899 1.00 30.79 ? 408  VAL A C   1 
ATOM   3157 O O   . VAL A 1 408 ? 19.256  57.372 47.684 1.00 29.26 ? 408  VAL A O   1 
ATOM   3158 C CB  . VAL A 1 408 ? 18.569  59.340 50.180 1.00 32.03 ? 408  VAL A CB  1 
ATOM   3159 C CG1 . VAL A 1 408 ? 19.602  59.065 51.201 1.00 32.40 ? 408  VAL A CG1 1 
ATOM   3160 C CG2 . VAL A 1 408 ? 19.210  60.128 49.033 1.00 35.13 ? 408  VAL A CG2 1 
ATOM   3161 N N   . ASN A 1 409 ? 19.653  56.286 49.613 1.00 30.95 ? 409  ASN A N   1 
ATOM   3162 C CA  . ASN A 1 409 ? 20.681  55.488 48.977 1.00 32.40 ? 409  ASN A CA  1 
ATOM   3163 C C   . ASN A 1 409 ? 20.025  54.509 48.042 1.00 31.22 ? 409  ASN A C   1 
ATOM   3164 O O   . ASN A 1 409 ? 20.525  54.281 46.948 1.00 31.43 ? 409  ASN A O   1 
ATOM   3165 C CB  . ASN A 1 409 ? 21.578  54.834 50.044 1.00 31.85 ? 409  ASN A CB  1 
ATOM   3166 C CG  . ASN A 1 409 ? 22.779  55.769 50.431 1.00 37.76 ? 409  ASN A CG  1 
ATOM   3167 O OD1 . ASN A 1 409 ? 23.710  55.999 49.603 1.00 41.04 ? 409  ASN A OD1 1 
ATOM   3168 N ND2 . ASN A 1 409 ? 22.755  56.318 51.660 1.00 35.91 ? 409  ASN A ND2 1 
ATOM   3169 N N   . LYS A 1 410 ? 18.899  53.935 48.426 1.00 30.30 ? 410  LYS A N   1 
ATOM   3170 C CA  . LYS A 1 410 ? 18.229  53.019 47.505 1.00 31.27 ? 410  LYS A CA  1 
ATOM   3171 C C   . LYS A 1 410 ? 17.662  53.751 46.279 1.00 31.93 ? 410  LYS A C   1 
ATOM   3172 O O   . LYS A 1 410 ? 17.766  53.264 45.158 1.00 31.15 ? 410  LYS A O   1 
ATOM   3173 C CB  . LYS A 1 410 ? 17.081  52.287 48.190 1.00 31.53 ? 410  LYS A CB  1 
ATOM   3174 C CG  . LYS A 1 410 ? 17.560  51.257 49.204 1.00 35.14 ? 410  LYS A CG  1 
ATOM   3175 C CD  . LYS A 1 410 ? 18.224  50.087 48.487 1.00 39.05 ? 410  LYS A CD  1 
ATOM   3176 C CE  . LYS A 1 410 ? 18.602  48.984 49.444 1.00 40.36 ? 410  LYS A CE  1 
ATOM   3177 N NZ  . LYS A 1 410 ? 19.163  47.855 48.684 1.00 41.59 ? 410  LYS A NZ  1 
ATOM   3178 N N   . TYR A 1 411 ? 17.090  54.933 46.495 1.00 31.30 ? 411  TYR A N   1 
ATOM   3179 C CA  . TYR A 1 411 ? 16.475  55.684 45.394 1.00 32.14 ? 411  TYR A CA  1 
ATOM   3180 C C   . TYR A 1 411 ? 17.468  56.176 44.366 1.00 32.30 ? 411  TYR A C   1 
ATOM   3181 O O   . TYR A 1 411 ? 17.228  56.092 43.159 1.00 31.60 ? 411  TYR A O   1 
ATOM   3182 C CB  . TYR A 1 411 ? 15.716  56.920 45.907 1.00 30.82 ? 411  TYR A CB  1 
ATOM   3183 C CG  . TYR A 1 411 ? 14.863  57.582 44.841 1.00 29.14 ? 411  TYR A CG  1 
ATOM   3184 C CD1 . TYR A 1 411 ? 13.566  57.140 44.597 1.00 28.23 ? 411  TYR A CD1 1 
ATOM   3185 C CD2 . TYR A 1 411 ? 15.391  58.588 44.016 1.00 27.81 ? 411  TYR A CD2 1 
ATOM   3186 C CE1 . TYR A 1 411 ? 12.824  57.657 43.562 1.00 26.72 ? 411  TYR A CE1 1 
ATOM   3187 C CE2 . TYR A 1 411 ? 14.669  59.114 42.983 1.00 25.45 ? 411  TYR A CE2 1 
ATOM   3188 C CZ  . TYR A 1 411 ? 13.381  58.639 42.750 1.00 27.79 ? 411  TYR A CZ  1 
ATOM   3189 O OH  . TYR A 1 411 ? 12.677  59.086 41.659 1.00 25.98 ? 411  TYR A OH  1 
ATOM   3190 N N   . THR A 1 412 ? 18.574  56.706 44.863 1.00 32.52 ? 412  THR A N   1 
ATOM   3191 C CA  . THR A 1 412 ? 19.599  57.272 44.024 1.00 32.15 ? 412  THR A CA  1 
ATOM   3192 C C   . THR A 1 412 ? 20.178  56.284 43.019 1.00 33.73 ? 412  THR A C   1 
ATOM   3193 O O   . THR A 1 412 ? 20.578  56.657 41.941 1.00 34.05 ? 412  THR A O   1 
ATOM   3194 C CB  . THR A 1 412 ? 20.655  57.883 44.916 1.00 30.27 ? 412  THR A CB  1 
ATOM   3195 O OG1 . THR A 1 412 ? 20.038  58.931 45.661 1.00 29.55 ? 412  THR A OG1 1 
ATOM   3196 C CG2 . THR A 1 412 ? 21.809  58.454 44.109 1.00 29.42 ? 412  THR A CG2 1 
ATOM   3197 N N   . LYS A 1 413 ? 20.194  55.019 43.375 1.00 35.31 ? 413  LYS A N   1 
ATOM   3198 C CA  . LYS A 1 413 ? 20.681  54.013 42.468 1.00 37.45 ? 413  LYS A CA  1 
ATOM   3199 C C   . LYS A 1 413 ? 19.849  54.007 41.165 1.00 38.89 ? 413  LYS A C   1 
ATOM   3200 O O   . LYS A 1 413 ? 20.387  53.735 40.079 1.00 39.25 ? 413  LYS A O   1 
ATOM   3201 C CB  . LYS A 1 413 ? 20.607  52.663 43.183 1.00 38.83 ? 413  LYS A CB  1 
ATOM   3202 C CG  . LYS A 1 413 ? 20.959  51.461 42.335 1.00 43.83 ? 413  LYS A CG  1 
ATOM   3203 N N   . PHE A 1 414 ? 18.552  54.323 41.239 1.00 37.48 ? 414  PHE A N   1 
ATOM   3204 C CA  . PHE A 1 414 ? 17.717  54.304 40.033 1.00 36.64 ? 414  PHE A CA  1 
ATOM   3205 C C   . PHE A 1 414 ? 17.151  55.635 39.586 1.00 36.43 ? 414  PHE A C   1 
ATOM   3206 O O   . PHE A 1 414 ? 16.660  55.725 38.463 1.00 36.76 ? 414  PHE A O   1 
ATOM   3207 C CB  . PHE A 1 414 ? 16.513  53.379 40.219 1.00 37.27 ? 414  PHE A CB  1 
ATOM   3208 C CG  . PHE A 1 414 ? 16.862  51.934 40.356 1.00 37.81 ? 414  PHE A CG  1 
ATOM   3209 C CD1 . PHE A 1 414 ? 16.956  51.116 39.233 1.00 38.92 ? 414  PHE A CD1 1 
ATOM   3210 C CD2 . PHE A 1 414 ? 17.058  51.388 41.604 1.00 38.21 ? 414  PHE A CD2 1 
ATOM   3211 C CE1 . PHE A 1 414 ? 17.239  49.763 39.366 1.00 39.72 ? 414  PHE A CE1 1 
ATOM   3212 C CE2 . PHE A 1 414 ? 17.344  50.045 41.769 1.00 39.74 ? 414  PHE A CE2 1 
ATOM   3213 C CZ  . PHE A 1 414 ? 17.435  49.222 40.654 1.00 40.19 ? 414  PHE A CZ  1 
ATOM   3214 N N   . GLY A 1 415 ? 17.217  56.658 40.444 1.00 35.40 ? 415  GLY A N   1 
ATOM   3215 C CA  . GLY A 1 415 ? 16.631  57.955 40.117 1.00 33.62 ? 415  GLY A CA  1 
ATOM   3216 C C   . GLY A 1 415 ? 17.364  58.890 39.168 1.00 33.93 ? 415  GLY A C   1 
ATOM   3217 O O   . GLY A 1 415 ? 18.466  58.598 38.706 1.00 32.85 ? 415  GLY A O   1 
ATOM   3218 N N   . ASN A 1 416 ? 16.757  60.034 38.893 1.00 32.97 ? 416  ASN A N   1 
ATOM   3219 C CA  . ASN A 1 416 ? 17.360  60.944 37.955 1.00 35.28 ? 416  ASN A CA  1 
ATOM   3220 C C   . ASN A 1 416 ? 17.994  62.184 38.583 1.00 35.28 ? 416  ASN A C   1 
ATOM   3221 O O   . ASN A 1 416 ? 18.274  63.165 37.892 1.00 35.34 ? 416  ASN A O   1 
ATOM   3222 C CB  . ASN A 1 416 ? 16.310  61.321 36.869 1.00 38.36 ? 416  ASN A CB  1 
ATOM   3223 C CG  . ASN A 1 416 ? 16.930  62.095 35.666 1.00 42.15 ? 416  ASN A CG  1 
ATOM   3224 O OD1 . ASN A 1 416 ? 16.434  63.180 35.296 1.00 40.09 ? 416  ASN A OD1 1 
ATOM   3225 N ND2 . ASN A 1 416 ? 18.001  61.546 35.075 1.00 42.05 ? 416  ASN A ND2 1 
ATOM   3226 N N   . GLY A 1 417 ? 18.266  62.127 39.887 1.00 34.23 ? 417  GLY A N   1 
ATOM   3227 C CA  . GLY A 1 417 ? 18.867  63.265 40.544 1.00 33.15 ? 417  GLY A CA  1 
ATOM   3228 C C   . GLY A 1 417 ? 18.314  63.440 41.959 1.00 33.20 ? 417  GLY A C   1 
ATOM   3229 O O   . GLY A 1 417 ? 17.089  63.509 42.182 1.00 32.58 ? 417  GLY A O   1 
ATOM   3230 N N   . THR A 1 418 ? 19.240  63.517 42.910 1.00 31.95 ? 418  THR A N   1 
ATOM   3231 C CA  . THR A 1 418 ? 18.937  63.627 44.324 1.00 30.39 ? 418  THR A CA  1 
ATOM   3232 C C   . THR A 1 418 ? 19.706  64.787 44.940 1.00 30.84 ? 418  THR A C   1 
ATOM   3233 O O   . THR A 1 418 ? 20.928  64.913 44.681 1.00 30.10 ? 418  THR A O   1 
ATOM   3234 C CB  . THR A 1 418 ? 19.407  62.360 45.079 1.00 29.86 ? 418  THR A CB  1 
ATOM   3235 O OG1 . THR A 1 418 ? 18.825  61.183 44.498 1.00 28.42 ? 418  THR A OG1 1 
ATOM   3236 C CG2 . THR A 1 418 ? 19.044  62.478 46.557 1.00 27.09 ? 418  THR A CG2 1 
ATOM   3237 N N   . TYR A 1 419 ? 19.000  65.632 45.709 1.00 28.50 ? 419  TYR A N   1 
ATOM   3238 C CA  . TYR A 1 419 ? 19.617  66.731 46.456 1.00 29.16 ? 419  TYR A CA  1 
ATOM   3239 C C   . TYR A 1 419 ? 19.267  66.515 47.941 1.00 29.28 ? 419  TYR A C   1 
ATOM   3240 O O   . TYR A 1 419 ? 18.079  66.431 48.299 1.00 29.90 ? 419  TYR A O   1 
ATOM   3241 C CB  . TYR A 1 419 ? 19.113  68.087 45.996 1.00 28.98 ? 419  TYR A CB  1 
ATOM   3242 C CG  . TYR A 1 419 ? 19.540  68.350 44.568 1.00 32.02 ? 419  TYR A CG  1 
ATOM   3243 C CD1 . TYR A 1 419 ? 18.766  67.885 43.489 1.00 30.62 ? 419  TYR A CD1 1 
ATOM   3244 C CD2 . TYR A 1 419 ? 20.777  68.951 44.286 1.00 29.85 ? 419  TYR A CD2 1 
ATOM   3245 C CE1 . TYR A 1 419 ? 19.223  67.999 42.156 1.00 31.30 ? 419  TYR A CE1 1 
ATOM   3246 C CE2 . TYR A 1 419 ? 21.222  69.080 42.964 1.00 32.32 ? 419  TYR A CE2 1 
ATOM   3247 C CZ  . TYR A 1 419 ? 20.441  68.605 41.908 1.00 31.19 ? 419  TYR A CZ  1 
ATOM   3248 O OH  . TYR A 1 419 ? 20.848  68.800 40.591 1.00 32.14 ? 419  TYR A OH  1 
ATOM   3249 N N   . LEU A 1 420 ? 20.294  66.414 48.797 1.00 28.41 ? 420  LEU A N   1 
ATOM   3250 C CA  . LEU A 1 420 ? 20.105  66.148 50.235 1.00 26.32 ? 420  LEU A CA  1 
ATOM   3251 C C   . LEU A 1 420 ? 20.504  67.293 51.172 1.00 27.28 ? 420  LEU A C   1 
ATOM   3252 O O   . LEU A 1 420 ? 21.564  67.924 51.017 1.00 25.28 ? 420  LEU A O   1 
ATOM   3253 C CB  . LEU A 1 420 ? 20.886  64.901 50.607 1.00 25.19 ? 420  LEU A CB  1 
ATOM   3254 C CG  . LEU A 1 420 ? 20.776  64.413 52.052 1.00 26.01 ? 420  LEU A CG  1 
ATOM   3255 C CD1 . LEU A 1 420 ? 19.354  63.933 52.322 1.00 25.10 ? 420  LEU A CD1 1 
ATOM   3256 C CD2 . LEU A 1 420 ? 21.766  63.251 52.238 1.00 25.95 ? 420  LEU A CD2 1 
ATOM   3257 N N   . TYR A 1 421 ? 19.670  67.582 52.166 1.00 27.26 ? 421  TYR A N   1 
ATOM   3258 C CA  . TYR A 1 421 ? 20.042  68.662 53.089 1.00 28.20 ? 421  TYR A CA  1 
ATOM   3259 C C   . TYR A 1 421 ? 19.985  68.285 54.577 1.00 27.98 ? 421  TYR A C   1 
ATOM   3260 O O   . TYR A 1 421 ? 19.308  67.324 54.956 1.00 27.61 ? 421  TYR A O   1 
ATOM   3261 C CB  . TYR A 1 421 ? 19.133  69.885 52.871 1.00 27.94 ? 421  TYR A CB  1 
ATOM   3262 C CG  . TYR A 1 421 ? 17.704  69.706 53.371 1.00 25.83 ? 421  TYR A CG  1 
ATOM   3263 C CD1 . TYR A 1 421 ? 17.393  69.799 54.730 1.00 26.86 ? 421  TYR A CD1 1 
ATOM   3264 C CD2 . TYR A 1 421 ? 16.677  69.414 52.478 1.00 26.43 ? 421  TYR A CD2 1 
ATOM   3265 C CE1 . TYR A 1 421 ? 16.062  69.590 55.178 1.00 26.50 ? 421  TYR A CE1 1 
ATOM   3266 C CE2 . TYR A 1 421 ? 15.370  69.209 52.904 1.00 25.56 ? 421  TYR A CE2 1 
ATOM   3267 C CZ  . TYR A 1 421 ? 15.077  69.297 54.241 1.00 26.05 ? 421  TYR A CZ  1 
ATOM   3268 O OH  . TYR A 1 421 ? 13.795  69.084 54.610 1.00 27.82 ? 421  TYR A OH  1 
ATOM   3269 N N   . PHE A 1 422 ? 20.661  69.061 55.416 1.00 27.22 ? 422  PHE A N   1 
ATOM   3270 C CA  . PHE A 1 422 ? 20.642  68.819 56.852 1.00 29.07 ? 422  PHE A CA  1 
ATOM   3271 C C   . PHE A 1 422 ? 20.368  70.205 57.424 1.00 30.28 ? 422  PHE A C   1 
ATOM   3272 O O   . PHE A 1 422 ? 21.240  71.081 57.403 1.00 31.26 ? 422  PHE A O   1 
ATOM   3273 C CB  . PHE A 1 422 ? 21.999  68.287 57.339 1.00 29.65 ? 422  PHE A CB  1 
ATOM   3274 C CG  . PHE A 1 422 ? 22.058  68.032 58.817 1.00 30.70 ? 422  PHE A CG  1 
ATOM   3275 C CD1 . PHE A 1 422 ? 21.442  66.901 59.376 1.00 32.47 ? 422  PHE A CD1 1 
ATOM   3276 C CD2 . PHE A 1 422 ? 22.751  68.891 59.648 1.00 29.34 ? 422  PHE A CD2 1 
ATOM   3277 C CE1 . PHE A 1 422 ? 21.535  66.634 60.777 1.00 33.18 ? 422  PHE A CE1 1 
ATOM   3278 C CE2 . PHE A 1 422 ? 22.853  68.642 61.035 1.00 32.04 ? 422  PHE A CE2 1 
ATOM   3279 C CZ  . PHE A 1 422 ? 22.240  67.504 61.597 1.00 33.45 ? 422  PHE A CZ  1 
ATOM   3280 N N   . PHE A 1 423 ? 19.156  70.405 57.930 1.00 30.39 ? 423  PHE A N   1 
ATOM   3281 C CA  . PHE A 1 423 ? 18.730  71.718 58.446 1.00 31.05 ? 423  PHE A CA  1 
ATOM   3282 C C   . PHE A 1 423 ? 19.055  71.835 59.935 1.00 31.59 ? 423  PHE A C   1 
ATOM   3283 O O   . PHE A 1 423 ? 18.517  71.076 60.749 1.00 30.57 ? 423  PHE A O   1 
ATOM   3284 C CB  . PHE A 1 423 ? 17.225  71.900 58.212 1.00 28.97 ? 423  PHE A CB  1 
ATOM   3285 C CG  . PHE A 1 423 ? 16.673  73.184 58.759 1.00 32.79 ? 423  PHE A CG  1 
ATOM   3286 C CD1 . PHE A 1 423 ? 16.706  74.353 57.995 1.00 33.42 ? 423  PHE A CD1 1 
ATOM   3287 C CD2 . PHE A 1 423 ? 16.069  73.219 60.015 1.00 31.07 ? 423  PHE A CD2 1 
ATOM   3288 C CE1 . PHE A 1 423 ? 16.128  75.543 58.471 1.00 33.86 ? 423  PHE A CE1 1 
ATOM   3289 C CE2 . PHE A 1 423 ? 15.495  74.408 60.506 1.00 31.43 ? 423  PHE A CE2 1 
ATOM   3290 C CZ  . PHE A 1 423 ? 15.519  75.568 59.733 1.00 31.83 ? 423  PHE A CZ  1 
ATOM   3291 N N   . ASN A 1 424 ? 19.936  72.776 60.296 1.00 31.05 ? 424  ASN A N   1 
ATOM   3292 C CA  . ASN A 1 424 ? 20.333  72.879 61.698 1.00 32.92 ? 424  ASN A CA  1 
ATOM   3293 C C   . ASN A 1 424 ? 20.342  74.294 62.274 1.00 33.54 ? 424  ASN A C   1 
ATOM   3294 O O   . ASN A 1 424 ? 21.199  74.628 63.128 1.00 31.62 ? 424  ASN A O   1 
ATOM   3295 C CB  . ASN A 1 424 ? 21.710  72.178 61.970 1.00 31.13 ? 424  ASN A CB  1 
ATOM   3296 C CG  . ASN A 1 424 ? 22.889  72.807 61.183 1.00 33.15 ? 424  ASN A CG  1 
ATOM   3297 O OD1 . ASN A 1 424 ? 22.695  73.654 60.334 1.00 29.38 ? 424  ASN A OD1 1 
ATOM   3298 N ND2 . ASN A 1 424 ? 24.125  72.346 61.468 1.00 33.91 ? 424  ASN A ND2 1 
ATOM   3299 N N   . HIS A 1 425 ? 19.388  75.110 61.820 1.00 33.11 ? 425  HIS A N   1 
ATOM   3300 C CA  . HIS A 1 425 ? 19.275  76.452 62.373 1.00 33.56 ? 425  HIS A CA  1 
ATOM   3301 C C   . HIS A 1 425 ? 18.143  76.500 63.399 1.00 32.95 ? 425  HIS A C   1 
ATOM   3302 O O   . HIS A 1 425 ? 16.988  76.197 63.106 1.00 32.30 ? 425  HIS A O   1 
ATOM   3303 C CB  . HIS A 1 425 ? 18.971  77.535 61.320 1.00 34.41 ? 425  HIS A CB  1 
ATOM   3304 C CG  . HIS A 1 425 ? 18.879  78.925 61.913 1.00 34.71 ? 425  HIS A CG  1 
ATOM   3305 N ND1 . HIS A 1 425 ? 19.984  79.616 62.362 1.00 35.87 ? 425  HIS A ND1 1 
ATOM   3306 C CD2 . HIS A 1 425 ? 17.814  79.728 62.170 1.00 36.80 ? 425  HIS A CD2 1 
ATOM   3307 C CE1 . HIS A 1 425 ? 19.612  80.786 62.861 1.00 37.11 ? 425  HIS A CE1 1 
ATOM   3308 N NE2 . HIS A 1 425 ? 18.297  80.881 62.756 1.00 37.59 ? 425  HIS A NE2 1 
ATOM   3309 N N   . ARG A 1 426 ? 18.504  76.921 64.590 1.00 33.21 ? 426  ARG A N   1 
ATOM   3310 C CA  . ARG A 1 426 ? 17.582  77.083 65.694 1.00 35.55 ? 426  ARG A CA  1 
ATOM   3311 C C   . ARG A 1 426 ? 17.038  78.525 65.562 1.00 35.49 ? 426  ARG A C   1 
ATOM   3312 O O   . ARG A 1 426 ? 17.792  79.471 65.681 1.00 35.77 ? 426  ARG A O   1 
ATOM   3313 C CB  . ARG A 1 426 ? 18.373  76.863 67.006 1.00 35.63 ? 426  ARG A CB  1 
ATOM   3314 C CG  . ARG A 1 426 ? 17.756  77.416 68.253 1.00 38.25 ? 426  ARG A CG  1 
ATOM   3315 C CD  . ARG A 1 426 ? 16.741  76.495 68.883 1.00 35.37 ? 426  ARG A CD  1 
ATOM   3316 N NE  . ARG A 1 426 ? 16.164  77.131 70.064 1.00 34.67 ? 426  ARG A NE  1 
ATOM   3317 C CZ  . ARG A 1 426 ? 15.412  76.509 70.967 1.00 34.48 ? 426  ARG A CZ  1 
ATOM   3318 N NH1 . ARG A 1 426 ? 14.932  77.216 72.000 1.00 30.22 ? 426  ARG A NH1 1 
ATOM   3319 N NH2 . ARG A 1 426 ? 15.145  75.180 70.834 1.00 31.10 ? 426  ARG A NH2 1 
ATOM   3320 N N   . ALA A 1 427 ? 15.739  78.675 65.307 1.00 35.73 ? 427  ALA A N   1 
ATOM   3321 C CA  . ALA A 1 427 ? 15.138  79.978 65.130 1.00 36.99 ? 427  ALA A CA  1 
ATOM   3322 C C   . ALA A 1 427 ? 15.280  80.852 66.372 1.00 38.98 ? 427  ALA A C   1 
ATOM   3323 O O   . ALA A 1 427 ? 15.025  80.417 67.514 1.00 39.66 ? 427  ALA A O   1 
ATOM   3324 C CB  . ALA A 1 427 ? 13.687  79.843 64.753 1.00 37.08 ? 427  ALA A CB  1 
ATOM   3325 N N   . SER A 1 428 ? 15.651  82.111 66.126 1.00 39.69 ? 428  SER A N   1 
ATOM   3326 C CA  . SER A 1 428 ? 15.884  83.090 67.189 1.00 40.28 ? 428  SER A CA  1 
ATOM   3327 C C   . SER A 1 428 ? 14.657  83.331 68.075 1.00 40.31 ? 428  SER A C   1 
ATOM   3328 O O   . SER A 1 428 ? 14.818  83.634 69.254 1.00 40.47 ? 428  SER A O   1 
ATOM   3329 C CB  . SER A 1 428 ? 16.370  84.433 66.585 1.00 41.92 ? 428  SER A CB  1 
ATOM   3330 O OG  . SER A 1 428 ? 15.351  85.031 65.775 1.00 42.54 ? 428  SER A OG  1 
ATOM   3331 N N   . ASN A 1 429 ? 13.452  83.161 67.517 1.00 38.84 ? 429  ASN A N   1 
ATOM   3332 C CA  . ASN A 1 429 ? 12.208  83.396 68.238 1.00 38.08 ? 429  ASN A CA  1 
ATOM   3333 C C   . ASN A 1 429 ? 11.466  82.107 68.636 1.00 38.01 ? 429  ASN A C   1 
ATOM   3334 O O   . ASN A 1 429 ? 10.237  82.166 68.917 1.00 37.01 ? 429  ASN A O   1 
ATOM   3335 C CB  . ASN A 1 429 ? 11.264  84.237 67.358 1.00 38.12 ? 429  ASN A CB  1 
ATOM   3336 C CG  . ASN A 1 429 ? 10.989  83.569 65.991 1.00 39.43 ? 429  ASN A CG  1 
ATOM   3337 O OD1 . ASN A 1 429 ? 11.455  82.454 65.738 1.00 38.53 ? 429  ASN A OD1 1 
ATOM   3338 N ND2 . ASN A 1 429 ? 10.244  84.249 65.116 1.00 38.25 ? 429  ASN A ND2 1 
ATOM   3339 N N   . LEU A 1 430 ? 12.157  80.960 68.664 1.00 36.08 ? 430  LEU A N   1 
ATOM   3340 C CA  . LEU A 1 430 ? 11.460  79.701 69.031 1.00 36.63 ? 430  LEU A CA  1 
ATOM   3341 C C   . LEU A 1 430 ? 10.919  79.807 70.447 1.00 34.79 ? 430  LEU A C   1 
ATOM   3342 O O   . LEU A 1 430 ? 11.654  80.200 71.348 1.00 33.08 ? 430  LEU A O   1 
ATOM   3343 C CB  . LEU A 1 430 ? 12.414  78.481 69.021 1.00 37.23 ? 430  LEU A CB  1 
ATOM   3344 C CG  . LEU A 1 430 ? 12.226  77.282 68.088 1.00 39.37 ? 430  LEU A CG  1 
ATOM   3345 C CD1 . LEU A 1 430 ? 13.044  76.174 68.726 1.00 41.35 ? 430  LEU A CD1 1 
ATOM   3346 C CD2 . LEU A 1 430 ? 10.783  76.801 67.954 1.00 39.32 ? 430  LEU A CD2 1 
ATOM   3347 N N   . VAL A 1 431 ? 9.674   79.405 70.668 1.00 35.00 ? 431  VAL A N   1 
ATOM   3348 C CA  . VAL A 1 431 ? 9.124   79.459 72.024 1.00 35.30 ? 431  VAL A CA  1 
ATOM   3349 C C   . VAL A 1 431 ? 9.417   78.175 72.844 1.00 34.44 ? 431  VAL A C   1 
ATOM   3350 O O   . VAL A 1 431 ? 9.244   78.158 74.062 1.00 35.24 ? 431  VAL A O   1 
ATOM   3351 C CB  . VAL A 1 431 ? 7.609   79.709 71.965 1.00 37.05 ? 431  VAL A CB  1 
ATOM   3352 C CG1 . VAL A 1 431 ? 7.328   81.086 71.274 1.00 37.17 ? 431  VAL A CG1 1 
ATOM   3353 C CG2 . VAL A 1 431 ? 6.940   78.597 71.115 1.00 36.30 ? 431  VAL A CG2 1 
ATOM   3354 N N   . TRP A 1 432 ? 9.872   77.114 72.183 1.00 32.04 ? 432  TRP A N   1 
ATOM   3355 C CA  . TRP A 1 432 ? 10.182  75.839 72.856 1.00 30.96 ? 432  TRP A CA  1 
ATOM   3356 C C   . TRP A 1 432 ? 11.530  75.935 73.570 1.00 29.99 ? 432  TRP A C   1 
ATOM   3357 O O   . TRP A 1 432 ? 12.409  76.686 73.143 1.00 30.67 ? 432  TRP A O   1 
ATOM   3358 C CB  . TRP A 1 432 ? 10.229  74.669 71.839 1.00 29.60 ? 432  TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 432 ? 8.882   74.274 71.253 1.00 27.49 ? 432  TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 432 ? 8.448   74.513 69.983 1.00 27.46 ? 432  TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 432 ? 7.825   73.549 71.902 1.00 25.86 ? 432  TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 432 ? 7.193   73.983 69.790 1.00 25.99 ? 432  TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 432 ? 6.782   73.384 70.945 1.00 26.18 ? 432  TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 432 ? 7.650   73.030 73.189 1.00 25.35 ? 432  TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 432 ? 5.582   72.714 71.232 1.00 25.96 ? 432  TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 432 ? 6.454   72.355 73.486 1.00 27.05 ? 432  TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 432 ? 5.435   72.205 72.502 1.00 28.03 ? 432  TRP A CH2 1 
ATOM   3368 N N   . PRO A 1 433 ? 11.733  75.144 74.628 1.00 29.20 ? 433  PRO A N   1 
ATOM   3369 C CA  . PRO A 1 433 ? 13.030  75.283 75.289 1.00 30.12 ? 433  PRO A CA  1 
ATOM   3370 C C   . PRO A 1 433 ? 14.261  74.949 74.473 1.00 31.51 ? 433  PRO A C   1 
ATOM   3371 O O   . PRO A 1 433 ? 14.223  74.221 73.475 1.00 31.81 ? 433  PRO A O   1 
ATOM   3372 C CB  . PRO A 1 433 ? 12.892  74.393 76.519 1.00 28.83 ? 433  PRO A CB  1 
ATOM   3373 C CG  . PRO A 1 433 ? 11.976  73.271 75.978 1.00 28.25 ? 433  PRO A CG  1 
ATOM   3374 C CD  . PRO A 1 433 ? 10.935  74.059 75.238 1.00 27.79 ? 433  PRO A CD  1 
ATOM   3375 N N   . GLU A 1 434 ? 15.368  75.467 74.956 1.00 32.23 ? 434  GLU A N   1 
ATOM   3376 C CA  . GLU A 1 434 ? 16.679  75.308 74.363 1.00 34.24 ? 434  GLU A CA  1 
ATOM   3377 C C   . GLU A 1 434 ? 17.086  73.845 74.173 1.00 31.65 ? 434  GLU A C   1 
ATOM   3378 O O   . GLU A 1 434 ? 17.625  73.479 73.119 1.00 31.04 ? 434  GLU A O   1 
ATOM   3379 C CB  . GLU A 1 434 ? 17.704  76.032 75.255 1.00 37.51 ? 434  GLU A CB  1 
ATOM   3380 C CG  . GLU A 1 434 ? 18.755  76.780 74.498 1.00 48.77 ? 434  GLU A CG  1 
ATOM   3381 C CD  . GLU A 1 434 ? 18.174  77.875 73.566 1.00 54.42 ? 434  GLU A CD  1 
ATOM   3382 O OE1 . GLU A 1 434 ? 17.263  78.625 74.012 1.00 57.72 ? 434  GLU A OE1 1 
ATOM   3383 O OE2 . GLU A 1 434 ? 18.639  77.995 72.389 1.00 58.14 ? 434  GLU A OE2 1 
ATOM   3384 N N   . TRP A 1 435 ? 16.811  72.999 75.166 1.00 31.08 ? 435  TRP A N   1 
ATOM   3385 C CA  . TRP A 1 435 ? 17.231  71.601 75.070 1.00 29.25 ? 435  TRP A CA  1 
ATOM   3386 C C   . TRP A 1 435 ? 16.655  70.862 73.852 1.00 29.72 ? 435  TRP A C   1 
ATOM   3387 O O   . TRP A 1 435 ? 17.253  69.890 73.370 1.00 27.09 ? 435  TRP A O   1 
ATOM   3388 C CB  . TRP A 1 435 ? 16.918  70.817 76.364 1.00 29.34 ? 435  TRP A CB  1 
ATOM   3389 C CG  . TRP A 1 435 ? 15.467  70.463 76.659 1.00 29.99 ? 435  TRP A CG  1 
ATOM   3390 C CD1 . TRP A 1 435 ? 14.621  71.110 77.535 1.00 31.22 ? 435  TRP A CD1 1 
ATOM   3391 C CD2 . TRP A 1 435 ? 14.710  69.354 76.120 1.00 29.26 ? 435  TRP A CD2 1 
ATOM   3392 N NE1 . TRP A 1 435 ? 13.397  70.466 77.575 1.00 31.70 ? 435  TRP A NE1 1 
ATOM   3393 C CE2 . TRP A 1 435 ? 13.424  69.397 76.708 1.00 29.73 ? 435  TRP A CE2 1 
ATOM   3394 C CE3 . TRP A 1 435 ? 14.995  68.339 75.191 1.00 29.94 ? 435  TRP A CE3 1 
ATOM   3395 C CZ2 . TRP A 1 435 ? 12.422  68.468 76.393 1.00 29.17 ? 435  TRP A CZ2 1 
ATOM   3396 C CZ3 . TRP A 1 435 ? 13.992  67.406 74.880 1.00 29.08 ? 435  TRP A CZ3 1 
ATOM   3397 C CH2 . TRP A 1 435 ? 12.725  67.486 75.474 1.00 29.94 ? 435  TRP A CH2 1 
ATOM   3398 N N   . MET A 1 436 ? 15.537  71.357 73.315 1.00 28.69 ? 436  MET A N   1 
ATOM   3399 C CA  . MET A 1 436 ? 14.915  70.686 72.173 1.00 29.50 ? 436  MET A CA  1 
ATOM   3400 C C   . MET A 1 436 ? 15.622  70.896 70.858 1.00 29.01 ? 436  MET A C   1 
ATOM   3401 O O   . MET A 1 436 ? 15.381  70.148 69.906 1.00 28.02 ? 436  MET A O   1 
ATOM   3402 C CB  . MET A 1 436 ? 13.431  71.082 72.065 1.00 30.93 ? 436  MET A CB  1 
ATOM   3403 C CG  . MET A 1 436 ? 12.628  70.524 73.281 1.00 27.38 ? 436  MET A CG  1 
ATOM   3404 S SD  . MET A 1 436 ? 10.885  70.959 73.336 1.00 30.36 ? 436  MET A SD  1 
ATOM   3405 C CE  . MET A 1 436 ? 10.194  69.725 71.994 1.00 26.16 ? 436  MET A CE  1 
ATOM   3406 N N   . GLY A 1 437 ? 16.509  71.898 70.810 1.00 29.69 ? 437  GLY A N   1 
ATOM   3407 C CA  . GLY A 1 437 ? 17.282  72.161 69.593 1.00 27.93 ? 437  GLY A CA  1 
ATOM   3408 C C   . GLY A 1 437 ? 16.470  72.553 68.365 1.00 28.80 ? 437  GLY A C   1 
ATOM   3409 O O   . GLY A 1 437 ? 15.527  73.356 68.445 1.00 27.42 ? 437  GLY A O   1 
ATOM   3410 N N   . VAL A 1 438 ? 16.846  71.981 67.226 1.00 27.61 ? 438  VAL A N   1 
ATOM   3411 C CA  . VAL A 1 438 ? 16.200  72.225 65.938 1.00 27.70 ? 438  VAL A CA  1 
ATOM   3412 C C   . VAL A 1 438 ? 15.159  71.102 65.798 1.00 27.36 ? 438  VAL A C   1 
ATOM   3413 O O   . VAL A 1 438 ? 15.430  69.978 65.314 1.00 25.03 ? 438  VAL A O   1 
ATOM   3414 C CB  . VAL A 1 438 ? 17.280  72.173 64.832 1.00 29.49 ? 438  VAL A CB  1 
ATOM   3415 C CG1 . VAL A 1 438 ? 16.687  72.532 63.480 1.00 28.62 ? 438  VAL A CG1 1 
ATOM   3416 C CG2 . VAL A 1 438 ? 18.432  73.165 65.193 1.00 27.18 ? 438  VAL A CG2 1 
ATOM   3417 N N   . ILE A 1 439 ? 13.960  71.461 66.238 1.00 27.20 ? 439  ILE A N   1 
ATOM   3418 C CA  . ILE A 1 439 ? 12.804  70.572 66.346 1.00 27.17 ? 439  ILE A CA  1 
ATOM   3419 C C   . ILE A 1 439 ? 12.148  70.069 65.063 1.00 26.82 ? 439  ILE A C   1 
ATOM   3420 O O   . ILE A 1 439 ? 12.164  70.711 64.016 1.00 26.82 ? 439  ILE A O   1 
ATOM   3421 C CB  . ILE A 1 439 ? 11.768  71.274 67.246 1.00 26.60 ? 439  ILE A CB  1 
ATOM   3422 C CG1 . ILE A 1 439 ? 12.474  71.668 68.562 1.00 26.92 ? 439  ILE A CG1 1 
ATOM   3423 C CG2 . ILE A 1 439 ? 10.531  70.413 67.495 1.00 22.94 ? 439  ILE A CG2 1 
ATOM   3424 C CD1 . ILE A 1 439 ? 11.622  72.558 69.385 1.00 24.84 ? 439  ILE A CD1 1 
ATOM   3425 N N   . HIS A 1 440 ? 11.602  68.872 65.179 1.00 26.92 ? 440  HIS A N   1 
ATOM   3426 C CA  . HIS A 1 440 ? 10.877  68.231 64.120 1.00 26.64 ? 440  HIS A CA  1 
ATOM   3427 C C   . HIS A 1 440 ? 9.772   69.201 63.702 1.00 27.07 ? 440  HIS A C   1 
ATOM   3428 O O   . HIS A 1 440 ? 8.945   69.586 64.520 1.00 28.73 ? 440  HIS A O   1 
ATOM   3429 C CB  . HIS A 1 440 ? 10.256  66.945 64.673 1.00 25.64 ? 440  HIS A CB  1 
ATOM   3430 C CG  . HIS A 1 440 ? 9.552   66.105 63.657 1.00 23.34 ? 440  HIS A CG  1 
ATOM   3431 N ND1 . HIS A 1 440 ? 10.206  65.527 62.597 1.00 21.19 ? 440  HIS A ND1 1 
ATOM   3432 C CD2 . HIS A 1 440 ? 8.263   65.681 63.585 1.00 23.26 ? 440  HIS A CD2 1 
ATOM   3433 C CE1 . HIS A 1 440 ? 9.358   64.770 61.917 1.00 22.83 ? 440  HIS A CE1 1 
ATOM   3434 N NE2 . HIS A 1 440 ? 8.165   64.848 62.495 1.00 22.90 ? 440  HIS A NE2 1 
ATOM   3435 N N   . GLY A 1 441 ? 9.784   69.602 62.442 1.00 26.24 ? 441  GLY A N   1 
ATOM   3436 C CA  . GLY A 1 441 ? 8.759   70.493 61.927 1.00 26.95 ? 441  GLY A CA  1 
ATOM   3437 C C   . GLY A 1 441 ? 9.104   71.968 61.825 1.00 28.25 ? 441  GLY A C   1 
ATOM   3438 O O   . GLY A 1 441 ? 8.388   72.761 61.176 1.00 26.85 ? 441  GLY A O   1 
ATOM   3439 N N   . TYR A 1 442 ? 10.206  72.364 62.449 1.00 28.45 ? 442  TYR A N   1 
ATOM   3440 C CA  . TYR A 1 442 ? 10.528  73.772 62.437 1.00 28.77 ? 442  TYR A CA  1 
ATOM   3441 C C   . TYR A 1 442 ? 11.318  74.356 61.284 1.00 29.61 ? 442  TYR A C   1 
ATOM   3442 O O   . TYR A 1 442 ? 11.761  75.520 61.336 1.00 29.43 ? 442  TYR A O   1 
ATOM   3443 C CB  . TYR A 1 442 ? 11.078  74.174 63.815 1.00 29.67 ? 442  TYR A CB  1 
ATOM   3444 C CG  . TYR A 1 442 ? 9.934   74.215 64.829 1.00 29.75 ? 442  TYR A CG  1 
ATOM   3445 C CD1 . TYR A 1 442 ? 9.398   73.033 65.368 1.00 30.04 ? 442  TYR A CD1 1 
ATOM   3446 C CD2 . TYR A 1 442 ? 9.270   75.433 65.106 1.00 31.13 ? 442  TYR A CD2 1 
ATOM   3447 C CE1 . TYR A 1 442 ? 8.190   73.069 66.166 1.00 30.14 ? 442  TYR A CE1 1 
ATOM   3448 C CE2 . TYR A 1 442 ? 8.094   75.489 65.870 1.00 29.11 ? 442  TYR A CE2 1 
ATOM   3449 C CZ  . TYR A 1 442 ? 7.560   74.314 66.390 1.00 30.74 ? 442  TYR A CZ  1 
ATOM   3450 O OH  . TYR A 1 442 ? 6.385   74.380 67.076 1.00 28.96 ? 442  TYR A OH  1 
ATOM   3451 N N   . GLU A 1 443 ? 11.497  73.555 60.226 1.00 28.43 ? 443  GLU A N   1 
ATOM   3452 C CA  . GLU A 1 443 ? 12.081  74.090 58.997 1.00 27.50 ? 443  GLU A CA  1 
ATOM   3453 C C   . GLU A 1 443 ? 10.860  74.553 58.119 1.00 28.22 ? 443  GLU A C   1 
ATOM   3454 O O   . GLU A 1 443 ? 10.974  75.392 57.193 1.00 28.69 ? 443  GLU A O   1 
ATOM   3455 C CB  . GLU A 1 443 ? 12.882  73.034 58.220 1.00 26.05 ? 443  GLU A CB  1 
ATOM   3456 C CG  . GLU A 1 443 ? 12.049  72.165 57.276 1.00 24.40 ? 443  GLU A CG  1 
ATOM   3457 C CD  . GLU A 1 443 ? 11.100  71.157 57.989 1.00 25.20 ? 443  GLU A CD  1 
ATOM   3458 O OE1 . GLU A 1 443 ? 11.172  71.003 59.225 1.00 21.42 ? 443  GLU A OE1 1 
ATOM   3459 O OE2 . GLU A 1 443 ? 10.284  70.504 57.294 1.00 27.00 ? 443  GLU A OE2 1 
ATOM   3460 N N   . ILE A 1 444 ? 9.680   74.045 58.435 1.00 27.00 ? 444  ILE A N   1 
ATOM   3461 C CA  . ILE A 1 444 ? 8.497   74.387 57.641 1.00 27.91 ? 444  ILE A CA  1 
ATOM   3462 C C   . ILE A 1 444 ? 8.276   75.908 57.513 1.00 29.61 ? 444  ILE A C   1 
ATOM   3463 O O   . ILE A 1 444 ? 8.047   76.421 56.408 1.00 28.54 ? 444  ILE A O   1 
ATOM   3464 C CB  . ILE A 1 444 ? 7.192   73.727 58.240 1.00 27.40 ? 444  ILE A CB  1 
ATOM   3465 C CG1 . ILE A 1 444 ? 7.303   72.190 58.162 1.00 24.37 ? 444  ILE A CG1 1 
ATOM   3466 C CG2 . ILE A 1 444 ? 5.940   74.262 57.477 1.00 23.69 ? 444  ILE A CG2 1 
ATOM   3467 C CD1 . ILE A 1 444 ? 6.158   71.446 58.805 1.00 21.12 ? 444  ILE A CD1 1 
ATOM   3468 N N   . GLU A 1 445 ? 8.357   76.614 58.639 1.00 28.65 ? 445  GLU A N   1 
ATOM   3469 C CA  . GLU A 1 445 ? 8.175   78.055 58.621 1.00 30.74 ? 445  GLU A CA  1 
ATOM   3470 C C   . GLU A 1 445 ? 9.170   78.740 57.695 1.00 30.85 ? 445  GLU A C   1 
ATOM   3471 O O   . GLU A 1 445 ? 8.839   79.781 57.123 1.00 32.01 ? 445  GLU A O   1 
ATOM   3472 C CB  . GLU A 1 445 ? 8.232   78.634 60.059 1.00 31.09 ? 445  GLU A CB  1 
ATOM   3473 C CG  . GLU A 1 445 ? 9.520   78.352 60.817 1.00 31.64 ? 445  GLU A CG  1 
ATOM   3474 C CD  . GLU A 1 445 ? 9.304   78.464 62.288 1.00 33.44 ? 445  GLU A CD  1 
ATOM   3475 O OE1 . GLU A 1 445 ? 8.400   77.767 62.773 1.00 35.55 ? 445  GLU A OE1 1 
ATOM   3476 O OE2 . GLU A 1 445 ? 10.005  79.236 62.969 1.00 33.41 ? 445  GLU A OE2 1 
ATOM   3477 N N   . PHE A 1 446 ? 10.371  78.175 57.520 1.00 30.37 ? 446  PHE A N   1 
ATOM   3478 C CA  . PHE A 1 446 ? 11.299  78.779 56.585 1.00 30.24 ? 446  PHE A CA  1 
ATOM   3479 C C   . PHE A 1 446 ? 10.885  78.425 55.163 1.00 30.56 ? 446  PHE A C   1 
ATOM   3480 O O   . PHE A 1 446 ? 11.021  79.227 54.256 1.00 32.39 ? 446  PHE A O   1 
ATOM   3481 C CB  . PHE A 1 446 ? 12.737  78.309 56.828 1.00 30.84 ? 446  PHE A CB  1 
ATOM   3482 C CG  . PHE A 1 446 ? 13.369  78.942 58.048 1.00 31.86 ? 446  PHE A CG  1 
ATOM   3483 C CD1 . PHE A 1 446 ? 13.092  78.446 59.324 1.00 30.72 ? 446  PHE A CD1 1 
ATOM   3484 C CD2 . PHE A 1 446 ? 14.126  80.127 57.916 1.00 32.02 ? 446  PHE A CD2 1 
ATOM   3485 C CE1 . PHE A 1 446 ? 13.538  79.112 60.462 1.00 31.67 ? 446  PHE A CE1 1 
ATOM   3486 C CE2 . PHE A 1 446 ? 14.595  80.833 59.065 1.00 32.46 ? 446  PHE A CE2 1 
ATOM   3487 C CZ  . PHE A 1 446 ? 14.299  80.330 60.337 1.00 32.58 ? 446  PHE A CZ  1 
ATOM   3488 N N   . VAL A 1 447 ? 10.373  77.217 54.943 1.00 31.08 ? 447  VAL A N   1 
ATOM   3489 C CA  . VAL A 1 447 ? 9.983   76.812 53.602 1.00 29.51 ? 447  VAL A CA  1 
ATOM   3490 C C   . VAL A 1 447 ? 8.778   77.636 53.159 1.00 30.92 ? 447  VAL A C   1 
ATOM   3491 O O   . VAL A 1 447 ? 8.672   77.953 51.979 1.00 31.60 ? 447  VAL A O   1 
ATOM   3492 C CB  . VAL A 1 447 ? 9.638   75.295 53.549 1.00 29.86 ? 447  VAL A CB  1 
ATOM   3493 C CG1 . VAL A 1 447 ? 8.866   74.964 52.255 1.00 28.55 ? 447  VAL A CG1 1 
ATOM   3494 C CG2 . VAL A 1 447 ? 10.922  74.471 53.670 1.00 28.07 ? 447  VAL A CG2 1 
ATOM   3495 N N   . PHE A 1 448 ? 7.900   78.010 54.104 1.00 30.59 ? 448  PHE A N   1 
ATOM   3496 C CA  . PHE A 1 448 ? 6.738   78.801 53.760 1.00 31.74 ? 448  PHE A CA  1 
ATOM   3497 C C   . PHE A 1 448 ? 6.918   80.300 53.856 1.00 33.06 ? 448  PHE A C   1 
ATOM   3498 O O   . PHE A 1 448 ? 5.947   81.052 53.723 1.00 33.88 ? 448  PHE A O   1 
ATOM   3499 C CB  . PHE A 1 448 ? 5.522   78.372 54.562 1.00 29.23 ? 448  PHE A CB  1 
ATOM   3500 C CG  . PHE A 1 448 ? 4.854   77.188 53.983 1.00 31.46 ? 448  PHE A CG  1 
ATOM   3501 C CD1 . PHE A 1 448 ? 5.452   75.916 54.070 1.00 28.40 ? 448  PHE A CD1 1 
ATOM   3502 C CD2 . PHE A 1 448 ? 3.657   77.334 53.277 1.00 30.96 ? 448  PHE A CD2 1 
ATOM   3503 C CE1 . PHE A 1 448 ? 4.863   74.818 53.449 1.00 30.69 ? 448  PHE A CE1 1 
ATOM   3504 C CE2 . PHE A 1 448 ? 3.064   76.229 52.652 1.00 30.98 ? 448  PHE A CE2 1 
ATOM   3505 C CZ  . PHE A 1 448 ? 3.666   74.977 52.738 1.00 30.65 ? 448  PHE A CZ  1 
ATOM   3506 N N   . GLY A 1 449 ? 8.151   80.736 54.082 1.00 32.86 ? 449  GLY A N   1 
ATOM   3507 C CA  . GLY A 1 449 ? 8.409   82.147 54.113 1.00 34.58 ? 449  GLY A CA  1 
ATOM   3508 C C   . GLY A 1 449 ? 7.974   83.039 55.256 1.00 35.33 ? 449  GLY A C   1 
ATOM   3509 O O   . GLY A 1 449 ? 8.039   84.259 55.077 1.00 35.50 ? 449  GLY A O   1 
ATOM   3510 N N   . LEU A 1 450 ? 7.560   82.483 56.396 1.00 35.72 ? 450  LEU A N   1 
ATOM   3511 C CA  . LEU A 1 450 ? 7.152   83.285 57.565 1.00 36.27 ? 450  LEU A CA  1 
ATOM   3512 C C   . LEU A 1 450 ? 8.205   84.317 58.004 1.00 36.58 ? 450  LEU A C   1 
ATOM   3513 O O   . LEU A 1 450 ? 7.836   85.375 58.502 1.00 38.90 ? 450  LEU A O   1 
ATOM   3514 C CB  . LEU A 1 450 ? 6.806   82.383 58.757 1.00 34.77 ? 450  LEU A CB  1 
ATOM   3515 C CG  . LEU A 1 450 ? 5.470   81.627 58.676 1.00 36.77 ? 450  LEU A CG  1 
ATOM   3516 C CD1 . LEU A 1 450 ? 4.345   82.607 58.732 1.00 38.08 ? 450  LEU A CD1 1 
ATOM   3517 C CD2 . LEU A 1 450 ? 5.348   80.867 57.374 1.00 37.07 ? 450  LEU A CD2 1 
ATOM   3518 N N   . PRO A 1 451 ? 9.511   84.018 57.861 1.00 36.81 ? 451  PRO A N   1 
ATOM   3519 C CA  . PRO A 1 451 ? 10.504  85.008 58.277 1.00 38.32 ? 451  PRO A CA  1 
ATOM   3520 C C   . PRO A 1 451 ? 10.474  86.313 57.470 1.00 39.72 ? 451  PRO A C   1 
ATOM   3521 O O   . PRO A 1 451 ? 11.075  87.302 57.896 1.00 39.44 ? 451  PRO A O   1 
ATOM   3522 C CB  . PRO A 1 451 ? 11.827  84.268 58.128 1.00 37.56 ? 451  PRO A CB  1 
ATOM   3523 C CG  . PRO A 1 451 ? 11.442  82.856 58.409 1.00 37.78 ? 451  PRO A CG  1 
ATOM   3524 C CD  . PRO A 1 451 ? 10.160  82.720 57.605 1.00 38.05 ? 451  PRO A CD  1 
ATOM   3525 N N   . LEU A 1 452 ? 9.806   86.330 56.312 1.00 40.45 ? 452  LEU A N   1 
ATOM   3526 C CA  . LEU A 1 452 ? 9.717   87.574 55.553 1.00 41.46 ? 452  LEU A CA  1 
ATOM   3527 C C   . LEU A 1 452 ? 8.707   88.546 56.179 1.00 42.60 ? 452  LEU A C   1 
ATOM   3528 O O   . LEU A 1 452 ? 8.667   89.698 55.787 1.00 42.68 ? 452  LEU A O   1 
ATOM   3529 C CB  . LEU A 1 452 ? 9.273   87.372 54.111 1.00 39.50 ? 452  LEU A CB  1 
ATOM   3530 C CG  . LEU A 1 452 ? 9.823   86.326 53.166 1.00 42.35 ? 452  LEU A CG  1 
ATOM   3531 C CD1 . LEU A 1 452 ? 9.708   86.913 51.775 1.00 42.45 ? 452  LEU A CD1 1 
ATOM   3532 C CD2 . LEU A 1 452 ? 11.225  85.886 53.485 1.00 40.42 ? 452  LEU A CD2 1 
ATOM   3533 N N   . VAL A 1 453 ? 7.852   88.106 57.101 1.00 44.06 ? 453  VAL A N   1 
ATOM   3534 C CA  . VAL A 1 453 ? 6.908   89.060 57.682 1.00 45.50 ? 453  VAL A CA  1 
ATOM   3535 C C   . VAL A 1 453 ? 7.459   89.555 59.018 1.00 47.37 ? 453  VAL A C   1 
ATOM   3536 O O   . VAL A 1 453 ? 7.563   88.825 60.026 1.00 46.42 ? 453  VAL A O   1 
ATOM   3537 C CB  . VAL A 1 453 ? 5.436   88.505 57.767 1.00 45.28 ? 453  VAL A CB  1 
ATOM   3538 C CG1 . VAL A 1 453 ? 5.305   87.175 57.049 1.00 43.87 ? 453  VAL A CG1 1 
ATOM   3539 C CG2 . VAL A 1 453 ? 4.956   88.442 59.164 1.00 44.95 ? 453  VAL A CG2 1 
ATOM   3540 N N   . LYS A 1 454 ? 7.865   90.821 58.986 1.00 48.86 ? 454  LYS A N   1 
ATOM   3541 C CA  . LYS A 1 454 ? 8.506   91.500 60.122 1.00 49.11 ? 454  LYS A CA  1 
ATOM   3542 C C   . LYS A 1 454 ? 7.785   91.382 61.455 1.00 48.56 ? 454  LYS A C   1 
ATOM   3543 O O   . LYS A 1 454 ? 8.418   91.166 62.474 1.00 46.50 ? 454  LYS A O   1 
ATOM   3544 C CB  . LYS A 1 454 ? 8.772   92.976 59.747 1.00 51.79 ? 454  LYS A CB  1 
ATOM   3545 N N   . GLU A 1 455 ? 6.464   91.475 61.450 1.00 48.42 ? 455  GLU A N   1 
ATOM   3546 C CA  . GLU A 1 455 ? 5.757   91.361 62.707 1.00 49.84 ? 455  GLU A CA  1 
ATOM   3547 C C   . GLU A 1 455 ? 6.108   90.038 63.425 1.00 50.06 ? 455  GLU A C   1 
ATOM   3548 O O   . GLU A 1 455 ? 5.985   89.949 64.646 1.00 50.53 ? 455  GLU A O   1 
ATOM   3549 C CB  . GLU A 1 455 ? 4.245   91.453 62.486 1.00 51.85 ? 455  GLU A CB  1 
ATOM   3550 C CG  . GLU A 1 455 ? 3.803   92.690 61.680 1.00 56.49 ? 455  GLU A CG  1 
ATOM   3551 C CD  . GLU A 1 455 ? 4.289   92.661 60.217 1.00 58.74 ? 455  GLU A CD  1 
ATOM   3552 O OE1 . GLU A 1 455 ? 3.645   91.990 59.386 1.00 60.73 ? 455  GLU A OE1 1 
ATOM   3553 O OE2 . GLU A 1 455 ? 5.318   93.301 59.888 1.00 61.96 ? 455  GLU A OE2 1 
ATOM   3554 N N   . LEU A 1 456 ? 6.553   89.015 62.696 1.00 48.77 ? 456  LEU A N   1 
ATOM   3555 C CA  . LEU A 1 456 ? 6.857   87.746 63.350 1.00 48.01 ? 456  LEU A CA  1 
ATOM   3556 C C   . LEU A 1 456 ? 8.192   87.689 64.111 1.00 48.77 ? 456  LEU A C   1 
ATOM   3557 O O   . LEU A 1 456 ? 8.462   86.725 64.836 1.00 49.49 ? 456  LEU A O   1 
ATOM   3558 C CB  . LEU A 1 456 ? 6.706   86.582 62.352 1.00 45.74 ? 456  LEU A CB  1 
ATOM   3559 C CG  . LEU A 1 456 ? 5.258   86.416 61.874 1.00 43.59 ? 456  LEU A CG  1 
ATOM   3560 C CD1 . LEU A 1 456 ? 5.098   85.174 60.987 1.00 44.16 ? 456  LEU A CD1 1 
ATOM   3561 C CD2 . LEU A 1 456 ? 4.349   86.328 63.083 1.00 42.33 ? 456  LEU A CD2 1 
ATOM   3562 N N   . ASN A 1 457 ? 9.040   88.702 63.943 1.00 49.24 ? 457  ASN A N   1 
ATOM   3563 C CA  . ASN A 1 457 ? 10.251  88.768 64.754 1.00 49.11 ? 457  ASN A CA  1 
ATOM   3564 C C   . ASN A 1 457 ? 11.412  87.843 64.450 1.00 47.68 ? 457  ASN A C   1 
ATOM   3565 O O   . ASN A 1 457 ? 12.038  87.361 65.388 1.00 47.68 ? 457  ASN A O   1 
ATOM   3566 C CB  . ASN A 1 457 ? 9.873   88.584 66.257 1.00 52.75 ? 457  ASN A CB  1 
ATOM   3567 C CG  . ASN A 1 457 ? 8.954   89.715 66.798 1.00 55.74 ? 457  ASN A CG  1 
ATOM   3568 O OD1 . ASN A 1 457 ? 8.224   89.561 67.813 1.00 57.14 ? 457  ASN A OD1 1 
ATOM   3569 N ND2 . ASN A 1 457 ? 8.996   90.850 66.119 1.00 55.75 ? 457  ASN A ND2 1 
ATOM   3570 N N   . TYR A 1 458 ? 11.708  87.575 63.180 1.00 45.21 ? 458  TYR A N   1 
ATOM   3571 C CA  . TYR A 1 458 ? 12.869  86.750 62.872 1.00 44.05 ? 458  TYR A CA  1 
ATOM   3572 C C   . TYR A 1 458 ? 13.976  87.728 62.621 1.00 44.57 ? 458  TYR A C   1 
ATOM   3573 O O   . TYR A 1 458 ? 13.727  88.923 62.424 1.00 46.25 ? 458  TYR A O   1 
ATOM   3574 C CB  . TYR A 1 458 ? 12.675  85.894 61.608 1.00 40.59 ? 458  TYR A CB  1 
ATOM   3575 C CG  . TYR A 1 458 ? 11.703  84.750 61.790 1.00 38.83 ? 458  TYR A CG  1 
ATOM   3576 C CD1 . TYR A 1 458 ? 10.330  84.943 61.622 1.00 37.61 ? 458  TYR A CD1 1 
ATOM   3577 C CD2 . TYR A 1 458 ? 12.161  83.459 62.111 1.00 38.49 ? 458  TYR A CD2 1 
ATOM   3578 C CE1 . TYR A 1 458 ? 9.409   83.878 61.750 1.00 37.38 ? 458  TYR A CE1 1 
ATOM   3579 C CE2 . TYR A 1 458 ? 11.259  82.370 62.250 1.00 36.80 ? 458  TYR A CE2 1 
ATOM   3580 C CZ  . TYR A 1 458 ? 9.886   82.570 62.063 1.00 37.09 ? 458  TYR A CZ  1 
ATOM   3581 O OH  . TYR A 1 458 ? 8.997   81.486 62.116 1.00 32.33 ? 458  TYR A OH  1 
ATOM   3582 N N   . THR A 1 459 ? 15.198  87.239 62.584 1.00 44.39 ? 459  THR A N   1 
ATOM   3583 C CA  . THR A 1 459 ? 16.311  88.145 62.322 1.00 45.34 ? 459  THR A CA  1 
ATOM   3584 C C   . THR A 1 459 ? 16.445  88.325 60.829 1.00 45.79 ? 459  THR A C   1 
ATOM   3585 O O   . THR A 1 459 ? 15.933  87.529 60.041 1.00 46.18 ? 459  THR A O   1 
ATOM   3586 C CB  . THR A 1 459 ? 17.633  87.566 62.784 1.00 45.19 ? 459  THR A CB  1 
ATOM   3587 O OG1 . THR A 1 459 ? 17.872  86.353 62.053 1.00 43.49 ? 459  THR A OG1 1 
ATOM   3588 C CG2 . THR A 1 459 ? 17.616  87.316 64.302 1.00 43.79 ? 459  THR A CG2 1 
ATOM   3589 N N   . ALA A 1 460 ? 17.175  89.354 60.433 1.00 45.80 ? 460  ALA A N   1 
ATOM   3590 C CA  . ALA A 1 460 ? 17.407  89.595 59.012 1.00 44.70 ? 460  ALA A CA  1 
ATOM   3591 C C   . ALA A 1 460 ? 18.072  88.363 58.357 1.00 43.04 ? 460  ALA A C   1 
ATOM   3592 O O   . ALA A 1 460 ? 17.761  88.015 57.212 1.00 42.76 ? 460  ALA A O   1 
ATOM   3593 C CB  . ALA A 1 460 ? 18.310  90.851 58.815 1.00 43.60 ? 460  ALA A CB  1 
ATOM   3594 N N   . GLU A 1 461 ? 18.987  87.703 59.056 1.00 42.54 ? 461  GLU A N   1 
ATOM   3595 C CA  . GLU A 1 461 ? 19.658  86.553 58.449 1.00 43.50 ? 461  GLU A CA  1 
ATOM   3596 C C   . GLU A 1 461 ? 18.707  85.360 58.294 1.00 41.63 ? 461  GLU A C   1 
ATOM   3597 O O   . GLU A 1 461 ? 18.899  84.506 57.430 1.00 40.36 ? 461  GLU A O   1 
ATOM   3598 C CB  . GLU A 1 461 ? 20.917  86.173 59.230 1.00 46.66 ? 461  GLU A CB  1 
ATOM   3599 C CG  . GLU A 1 461 ? 20.901  86.569 60.699 1.00 53.58 ? 461  GLU A CG  1 
ATOM   3600 C CD  . GLU A 1 461 ? 21.071  88.080 60.938 1.00 54.79 ? 461  GLU A CD  1 
ATOM   3601 O OE1 . GLU A 1 461 ? 22.115  88.620 60.519 1.00 57.81 ? 461  GLU A OE1 1 
ATOM   3602 O OE2 . GLU A 1 461 ? 20.172  88.719 61.549 1.00 56.32 ? 461  GLU A OE2 1 
ATOM   3603 N N   . GLU A 1 462 ? 17.671  85.328 59.128 1.00 39.95 ? 462  GLU A N   1 
ATOM   3604 C CA  . GLU A 1 462 ? 16.650  84.298 59.038 1.00 39.12 ? 462  GLU A CA  1 
ATOM   3605 C C   . GLU A 1 462 ? 15.765  84.593 57.815 1.00 39.02 ? 462  GLU A C   1 
ATOM   3606 O O   . GLU A 1 462 ? 15.366  83.662 57.107 1.00 36.80 ? 462  GLU A O   1 
ATOM   3607 C CB  . GLU A 1 462 ? 15.843  84.220 60.350 1.00 36.56 ? 462  GLU A CB  1 
ATOM   3608 C CG  . GLU A 1 462 ? 16.639  83.403 61.391 1.00 36.80 ? 462  GLU A CG  1 
ATOM   3609 C CD  . GLU A 1 462 ? 16.124  83.459 62.818 1.00 35.77 ? 462  GLU A CD  1 
ATOM   3610 O OE1 . GLU A 1 462 ? 15.288  84.315 63.120 1.00 36.12 ? 462  GLU A OE1 1 
ATOM   3611 O OE2 . GLU A 1 462 ? 16.588  82.650 63.665 1.00 37.66 ? 462  GLU A OE2 1 
ATOM   3612 N N   . GLU A 1 463 ? 15.493  85.874 57.547 1.00 38.41 ? 463  GLU A N   1 
ATOM   3613 C CA  . GLU A 1 463 ? 14.694  86.224 56.380 1.00 38.46 ? 463  GLU A CA  1 
ATOM   3614 C C   . GLU A 1 463 ? 15.525  85.807 55.195 1.00 37.82 ? 463  GLU A C   1 
ATOM   3615 O O   . GLU A 1 463 ? 15.002  85.243 54.237 1.00 37.11 ? 463  GLU A O   1 
ATOM   3616 C CB  . GLU A 1 463 ? 14.401  87.734 56.272 1.00 40.43 ? 463  GLU A CB  1 
ATOM   3617 C CG  . GLU A 1 463 ? 13.813  88.062 54.879 1.00 42.61 ? 463  GLU A CG  1 
ATOM   3618 C CD  . GLU A 1 463 ? 13.426  89.533 54.668 1.00 43.89 ? 463  GLU A CD  1 
ATOM   3619 O OE1 . GLU A 1 463 ? 13.615  90.354 55.594 1.00 44.98 ? 463  GLU A OE1 1 
ATOM   3620 O OE2 . GLU A 1 463 ? 12.933  89.867 53.556 1.00 42.66 ? 463  GLU A OE2 1 
ATOM   3621 N N   . ALA A 1 464 ? 16.829  86.074 55.246 1.00 36.40 ? 464  ALA A N   1 
ATOM   3622 C CA  . ALA A 1 464 ? 17.667  85.676 54.131 1.00 35.91 ? 464  ALA A CA  1 
ATOM   3623 C C   . ALA A 1 464 ? 17.707  84.135 53.915 1.00 35.42 ? 464  ALA A C   1 
ATOM   3624 O O   . ALA A 1 464 ? 17.740  83.675 52.770 1.00 34.22 ? 464  ALA A O   1 
ATOM   3625 C CB  . ALA A 1 464 ? 19.092  86.224 54.313 1.00 36.88 ? 464  ALA A CB  1 
ATOM   3626 N N   . LEU A 1 465 ? 17.712  83.352 54.993 1.00 34.10 ? 465  LEU A N   1 
ATOM   3627 C CA  . LEU A 1 465 ? 17.739  81.877 54.850 1.00 32.75 ? 465  LEU A CA  1 
ATOM   3628 C C   . LEU A 1 465 ? 16.390  81.425 54.245 1.00 31.66 ? 465  LEU A C   1 
ATOM   3629 O O   . LEU A 1 465 ? 16.335  80.564 53.355 1.00 29.73 ? 465  LEU A O   1 
ATOM   3630 C CB  . LEU A 1 465 ? 17.978  81.217 56.227 1.00 32.78 ? 465  LEU A CB  1 
ATOM   3631 C CG  . LEU A 1 465 ? 17.797  79.720 56.437 1.00 31.81 ? 465  LEU A CG  1 
ATOM   3632 C CD1 . LEU A 1 465 ? 18.701  78.920 55.473 1.00 33.22 ? 465  LEU A CD1 1 
ATOM   3633 C CD2 . LEU A 1 465 ? 18.133  79.410 57.885 1.00 32.88 ? 465  LEU A CD2 1 
ATOM   3634 N N   . SER A 1 466 ? 15.310  82.013 54.736 1.00 29.97 ? 466  SER A N   1 
ATOM   3635 C CA  . SER A 1 466 ? 13.998  81.675 54.205 1.00 32.45 ? 466  SER A CA  1 
ATOM   3636 C C   . SER A 1 466 ? 13.971  81.935 52.690 1.00 33.92 ? 466  SER A C   1 
ATOM   3637 O O   . SER A 1 466 ? 13.510  81.078 51.911 1.00 34.25 ? 466  SER A O   1 
ATOM   3638 C CB  . SER A 1 466 ? 12.888  82.476 54.900 1.00 31.59 ? 466  SER A CB  1 
ATOM   3639 O OG  . SER A 1 466 ? 11.606  82.043 54.444 1.00 28.93 ? 466  SER A OG  1 
ATOM   3640 N N   . ARG A 1 467 ? 14.490  83.081 52.250 1.00 34.52 ? 467  ARG A N   1 
ATOM   3641 C CA  . ARG A 1 467 ? 14.468  83.347 50.824 1.00 35.45 ? 467  ARG A CA  1 
ATOM   3642 C C   . ARG A 1 467 ? 15.311  82.330 50.059 1.00 36.46 ? 467  ARG A C   1 
ATOM   3643 O O   . ARG A 1 467 ? 14.885  81.869 48.983 1.00 34.79 ? 467  ARG A O   1 
ATOM   3644 C CB  . ARG A 1 467 ? 14.904  84.785 50.503 1.00 36.57 ? 467  ARG A CB  1 
ATOM   3645 C CG  . ARG A 1 467 ? 13.861  85.824 50.912 1.00 36.77 ? 467  ARG A CG  1 
ATOM   3646 C CD  . ARG A 1 467 ? 14.329  87.274 50.603 1.00 39.25 ? 467  ARG A CD  1 
ATOM   3647 N NE  . ARG A 1 467 ? 13.329  88.244 51.079 1.00 39.04 ? 467  ARG A NE  1 
ATOM   3648 C CZ  . ARG A 1 467 ? 12.232  88.575 50.407 1.00 39.39 ? 467  ARG A CZ  1 
ATOM   3649 N NH1 . ARG A 1 467 ? 11.997  88.026 49.215 1.00 39.11 ? 467  ARG A NH1 1 
ATOM   3650 N NH2 . ARG A 1 467 ? 11.356  89.422 50.937 1.00 37.75 ? 467  ARG A NH2 1 
ATOM   3651 N N   . ARG A 1 468 ? 16.492  81.973 50.578 1.00 36.48 ? 468  ARG A N   1 
ATOM   3652 C CA  . ARG A 1 468 ? 17.310  80.961 49.891 1.00 37.77 ? 468  ARG A CA  1 
ATOM   3653 C C   . ARG A 1 468 ? 16.561  79.605 49.804 1.00 36.34 ? 468  ARG A C   1 
ATOM   3654 O O   . ARG A 1 468 ? 16.563  78.956 48.740 1.00 35.51 ? 468  ARG A O   1 
ATOM   3655 C CB  . ARG A 1 468 ? 18.627  80.707 50.618 1.00 39.85 ? 468  ARG A CB  1 
ATOM   3656 C CG  . ARG A 1 468 ? 19.620  81.834 50.557 1.00 44.57 ? 468  ARG A CG  1 
ATOM   3657 C CD  . ARG A 1 468 ? 20.821  81.541 51.485 1.00 46.39 ? 468  ARG A CD  1 
ATOM   3658 N NE  . ARG A 1 468 ? 21.345  80.209 51.214 1.00 46.40 ? 468  ARG A NE  1 
ATOM   3659 C CZ  . ARG A 1 468 ? 21.708  79.377 52.179 1.00 47.80 ? 468  ARG A CZ  1 
ATOM   3660 N NH1 . ARG A 1 468 ? 21.589  79.787 53.434 1.00 49.47 ? 468  ARG A NH1 1 
ATOM   3661 N NH2 . ARG A 1 468 ? 22.187  78.164 51.901 1.00 47.09 ? 468  ARG A NH2 1 
ATOM   3662 N N   . ILE A 1 469 ? 15.947  79.184 50.917 1.00 33.23 ? 469  ILE A N   1 
ATOM   3663 C CA  . ILE A 1 469 ? 15.234  77.924 50.941 1.00 31.33 ? 469  ILE A CA  1 
ATOM   3664 C C   . ILE A 1 469 ? 14.041  77.914 49.978 1.00 32.54 ? 469  ILE A C   1 
ATOM   3665 O O   . ILE A 1 469 ? 13.917  76.976 49.160 1.00 32.22 ? 469  ILE A O   1 
ATOM   3666 C CB  . ILE A 1 469 ? 14.835  77.581 52.408 1.00 31.43 ? 469  ILE A CB  1 
ATOM   3667 C CG1 . ILE A 1 469 ? 16.095  77.078 53.148 1.00 30.40 ? 469  ILE A CG1 1 
ATOM   3668 C CG2 . ILE A 1 469 ? 13.736  76.509 52.445 1.00 30.15 ? 469  ILE A CG2 1 
ATOM   3669 C CD1 . ILE A 1 469 ? 15.898  76.828 54.642 1.00 29.89 ? 469  ILE A CD1 1 
ATOM   3670 N N   . MET A 1 470 ? 13.179  78.937 50.032 1.00 32.08 ? 470  MET A N   1 
ATOM   3671 C CA  . MET A 1 470 ? 12.033  78.995 49.105 1.00 31.82 ? 470  MET A CA  1 
ATOM   3672 C C   . MET A 1 470 ? 12.513  78.966 47.632 1.00 32.57 ? 470  MET A C   1 
ATOM   3673 O O   . MET A 1 470 ? 11.909  78.276 46.766 1.00 30.95 ? 470  MET A O   1 
ATOM   3674 C CB  . MET A 1 470 ? 11.181  80.258 49.317 1.00 31.32 ? 470  MET A CB  1 
ATOM   3675 C CG  . MET A 1 470 ? 10.465  80.306 50.643 1.00 34.61 ? 470  MET A CG  1 
ATOM   3676 S SD  . MET A 1 470 ? 9.208   81.636 50.607 1.00 38.00 ? 470  MET A SD  1 
ATOM   3677 C CE  . MET A 1 470 ? 10.351  83.081 50.994 1.00 34.12 ? 470  MET A CE  1 
ATOM   3678 N N   . HIS A 1 471 ? 13.595  79.701 47.343 1.00 32.54 ? 471  HIS A N   1 
ATOM   3679 C CA  . HIS A 1 471 ? 14.107  79.735 45.977 1.00 32.10 ? 471  HIS A CA  1 
ATOM   3680 C C   . HIS A 1 471 ? 14.725  78.386 45.618 1.00 32.23 ? 471  HIS A C   1 
ATOM   3681 O O   . HIS A 1 471 ? 14.630  77.955 44.466 1.00 33.17 ? 471  HIS A O   1 
ATOM   3682 C CB  . HIS A 1 471 ? 15.106  80.882 45.745 1.00 32.90 ? 471  HIS A CB  1 
ATOM   3683 C CG  . HIS A 1 471 ? 15.317  81.181 44.287 1.00 35.50 ? 471  HIS A CG  1 
ATOM   3684 N ND1 . HIS A 1 471 ? 14.276  81.524 43.449 1.00 36.49 ? 471  HIS A ND1 1 
ATOM   3685 C CD2 . HIS A 1 471 ? 16.421  81.099 43.496 1.00 35.75 ? 471  HIS A CD2 1 
ATOM   3686 C CE1 . HIS A 1 471 ? 14.726  81.635 42.207 1.00 35.93 ? 471  HIS A CE1 1 
ATOM   3687 N NE2 . HIS A 1 471 ? 16.024  81.382 42.209 1.00 35.47 ? 471  HIS A NE2 1 
ATOM   3688 N N   . TYR A 1 472 ? 15.360  77.702 46.570 1.00 32.42 ? 472  TYR A N   1 
ATOM   3689 C CA  . TYR A 1 472 ? 15.872  76.348 46.259 1.00 31.95 ? 472  TYR A CA  1 
ATOM   3690 C C   . TYR A 1 472 ? 14.671  75.423 45.992 1.00 30.80 ? 472  TYR A C   1 
ATOM   3691 O O   . TYR A 1 472 ? 14.682  74.686 45.016 1.00 30.58 ? 472  TYR A O   1 
ATOM   3692 C CB  . TYR A 1 472 ? 16.606  75.697 47.432 1.00 32.86 ? 472  TYR A CB  1 
ATOM   3693 C CG  . TYR A 1 472 ? 17.984  76.183 47.759 1.00 34.39 ? 472  TYR A CG  1 
ATOM   3694 C CD1 . TYR A 1 472 ? 18.884  76.578 46.756 1.00 34.96 ? 472  TYR A CD1 1 
ATOM   3695 C CD2 . TYR A 1 472 ? 18.424  76.171 49.092 1.00 34.64 ? 472  TYR A CD2 1 
ATOM   3696 C CE1 . TYR A 1 472 ? 20.203  76.946 47.093 1.00 35.04 ? 472  TYR A CE1 1 
ATOM   3697 C CE2 . TYR A 1 472 ? 19.693  76.532 49.443 1.00 34.98 ? 472  TYR A CE2 1 
ATOM   3698 C CZ  . TYR A 1 472 ? 20.592  76.920 48.448 1.00 37.29 ? 472  TYR A CZ  1 
ATOM   3699 O OH  . TYR A 1 472 ? 21.871  77.271 48.845 1.00 38.36 ? 472  TYR A OH  1 
ATOM   3700 N N   . TRP A 1 473 ? 13.653  75.430 46.873 1.00 30.85 ? 473  TRP A N   1 
ATOM   3701 C CA  . TRP A 1 473 ? 12.499  74.510 46.671 1.00 29.89 ? 473  TRP A CA  1 
ATOM   3702 C C   . TRP A 1 473 ? 11.792  74.784 45.332 1.00 30.25 ? 473  TRP A C   1 
ATOM   3703 O O   . TRP A 1 473 ? 11.465  73.853 44.614 1.00 28.75 ? 473  TRP A O   1 
ATOM   3704 C CB  . TRP A 1 473 ? 11.459  74.623 47.787 1.00 26.94 ? 473  TRP A CB  1 
ATOM   3705 C CG  . TRP A 1 473 ? 11.607  73.661 48.971 1.00 27.79 ? 473  TRP A CG  1 
ATOM   3706 C CD1 . TRP A 1 473 ? 10.576  73.043 49.641 1.00 25.12 ? 473  TRP A CD1 1 
ATOM   3707 C CD2 . TRP A 1 473 ? 12.810  73.347 49.728 1.00 26.49 ? 473  TRP A CD2 1 
ATOM   3708 N NE1 . TRP A 1 473 ? 11.047  72.391 50.763 1.00 26.38 ? 473  TRP A NE1 1 
ATOM   3709 C CE2 . TRP A 1 473 ? 12.410  72.555 50.840 1.00 26.59 ? 473  TRP A CE2 1 
ATOM   3710 C CE3 . TRP A 1 473 ? 14.178  73.661 49.577 1.00 27.30 ? 473  TRP A CE3 1 
ATOM   3711 C CZ2 . TRP A 1 473 ? 13.327  72.067 51.785 1.00 24.53 ? 473  TRP A CZ2 1 
ATOM   3712 C CZ3 . TRP A 1 473 ? 15.094  73.173 50.524 1.00 25.68 ? 473  TRP A CZ3 1 
ATOM   3713 C CH2 . TRP A 1 473 ? 14.655  72.383 51.616 1.00 25.40 ? 473  TRP A CH2 1 
ATOM   3714 N N   . ALA A 1 474 ? 11.558  76.065 45.013 1.00 30.09 ? 474  ALA A N   1 
ATOM   3715 C CA  . ALA A 1 474 ? 10.854  76.421 43.775 1.00 30.13 ? 474  ALA A CA  1 
ATOM   3716 C C   . ALA A 1 474 ? 11.669  76.186 42.538 1.00 28.92 ? 474  ALA A C   1 
ATOM   3717 O O   . ALA A 1 474 ? 11.131  75.733 41.550 1.00 28.65 ? 474  ALA A O   1 
ATOM   3718 C CB  . ALA A 1 474 ? 10.381  77.893 43.819 1.00 28.02 ? 474  ALA A CB  1 
ATOM   3719 N N   . THR A 1 475 ? 12.960  76.485 42.581 1.00 29.59 ? 475  THR A N   1 
ATOM   3720 C CA  . THR A 1 475 ? 13.778  76.262 41.408 1.00 30.50 ? 475  THR A CA  1 
ATOM   3721 C C   . THR A 1 475 ? 13.879  74.743 41.184 1.00 32.19 ? 475  THR A C   1 
ATOM   3722 O O   . THR A 1 475 ? 13.832  74.254 40.034 1.00 32.26 ? 475  THR A O   1 
ATOM   3723 C CB  . THR A 1 475 ? 15.157  76.877 41.564 1.00 31.06 ? 475  THR A CB  1 
ATOM   3724 O OG1 . THR A 1 475 ? 15.018  78.299 41.816 1.00 27.61 ? 475  THR A OG1 1 
ATOM   3725 C CG2 . THR A 1 475 ? 15.958  76.638 40.281 1.00 28.20 ? 475  THR A CG2 1 
ATOM   3726 N N   . PHE A 1 476 ? 14.015  73.972 42.265 1.00 31.49 ? 476  PHE A N   1 
ATOM   3727 C CA  . PHE A 1 476 ? 14.019  72.521 42.075 1.00 30.82 ? 476  PHE A CA  1 
ATOM   3728 C C   . PHE A 1 476 ? 12.653  72.043 41.486 1.00 30.24 ? 476  PHE A C   1 
ATOM   3729 O O   . PHE A 1 476 ? 12.614  71.194 40.599 1.00 30.23 ? 476  PHE A O   1 
ATOM   3730 C CB  . PHE A 1 476 ? 14.255  71.783 43.404 1.00 31.40 ? 476  PHE A CB  1 
ATOM   3731 C CG  . PHE A 1 476 ? 13.994  70.304 43.309 1.00 30.11 ? 476  PHE A CG  1 
ATOM   3732 C CD1 . PHE A 1 476 ? 14.985  69.437 42.851 1.00 31.02 ? 476  PHE A CD1 1 
ATOM   3733 C CD2 . PHE A 1 476 ? 12.754  69.780 43.662 1.00 29.93 ? 476  PHE A CD2 1 
ATOM   3734 C CE1 . PHE A 1 476 ? 14.758  68.050 42.750 1.00 28.18 ? 476  PHE A CE1 1 
ATOM   3735 C CE2 . PHE A 1 476 ? 12.511  68.399 43.565 1.00 30.72 ? 476  PHE A CE2 1 
ATOM   3736 C CZ  . PHE A 1 476 ? 13.530  67.526 43.109 1.00 29.69 ? 476  PHE A CZ  1 
ATOM   3737 N N   . ALA A 1 477 ? 11.536  72.585 41.983 1.00 30.36 ? 477  ALA A N   1 
ATOM   3738 C CA  . ALA A 1 477 ? 10.206  72.172 41.499 1.00 30.31 ? 477  ALA A CA  1 
ATOM   3739 C C   . ALA A 1 477 ? 10.081  72.445 40.019 1.00 30.83 ? 477  ALA A C   1 
ATOM   3740 O O   . ALA A 1 477 ? 9.505   71.656 39.269 1.00 31.57 ? 477  ALA A O   1 
ATOM   3741 C CB  . ALA A 1 477 ? 9.111   72.919 42.249 1.00 26.74 ? 477  ALA A CB  1 
ATOM   3742 N N   . LYS A 1 478 ? 10.645  73.573 39.606 1.00 31.69 ? 478  LYS A N   1 
ATOM   3743 C CA  . LYS A 1 478 ? 10.560  73.991 38.226 1.00 34.46 ? 478  LYS A CA  1 
ATOM   3744 C C   . LYS A 1 478 ? 11.493  73.288 37.258 1.00 34.05 ? 478  LYS A C   1 
ATOM   3745 O O   . LYS A 1 478 ? 11.099  73.012 36.139 1.00 34.31 ? 478  LYS A O   1 
ATOM   3746 C CB  . LYS A 1 478 ? 10.766  75.505 38.163 1.00 36.59 ? 478  LYS A CB  1 
ATOM   3747 C CG  . LYS A 1 478 ? 10.775  76.105 36.750 1.00 43.76 ? 478  LYS A CG  1 
ATOM   3748 C CD  . LYS A 1 478 ? 11.079  77.628 36.851 1.00 47.69 ? 478  LYS A CD  1 
ATOM   3749 C CE  . LYS A 1 478 ? 11.537  78.217 35.521 1.00 51.74 ? 478  LYS A CE  1 
ATOM   3750 N NZ  . LYS A 1 478 ? 11.721  79.726 35.613 1.00 55.21 ? 478  LYS A NZ  1 
ATOM   3751 N N   . THR A 1 479 ? 12.704  72.958 37.704 1.00 34.43 ? 479  THR A N   1 
ATOM   3752 C CA  . THR A 1 479 ? 13.713  72.352 36.829 1.00 35.24 ? 479  THR A CA  1 
ATOM   3753 C C   . THR A 1 479 ? 14.288  70.985 37.208 1.00 35.83 ? 479  THR A C   1 
ATOM   3754 O O   . THR A 1 479 ? 14.888  70.314 36.370 1.00 35.09 ? 479  THR A O   1 
ATOM   3755 C CB  . THR A 1 479 ? 14.919  73.265 36.725 1.00 35.45 ? 479  THR A CB  1 
ATOM   3756 O OG1 . THR A 1 479 ? 15.559  73.317 37.999 1.00 33.62 ? 479  THR A OG1 1 
ATOM   3757 C CG2 . THR A 1 479 ? 14.472  74.696 36.350 1.00 36.27 ? 479  THR A CG2 1 
ATOM   3758 N N   . GLY A 1 480 ? 14.124  70.573 38.462 1.00 35.34 ? 480  GLY A N   1 
ATOM   3759 C CA  . GLY A 1 480 ? 14.705  69.311 38.879 1.00 34.69 ? 480  GLY A CA  1 
ATOM   3760 C C   . GLY A 1 480 ? 16.083  69.545 39.474 1.00 34.12 ? 480  GLY A C   1 
ATOM   3761 O O   . GLY A 1 480 ? 16.804  68.585 39.724 1.00 34.79 ? 480  GLY A O   1 
ATOM   3762 N N   . ASN A 1 481 ? 16.448  70.816 39.705 1.00 34.70 ? 481  ASN A N   1 
ATOM   3763 C CA  . ASN A 1 481 ? 17.770  71.214 40.266 1.00 34.50 ? 481  ASN A CA  1 
ATOM   3764 C C   . ASN A 1 481 ? 17.538  72.493 41.109 1.00 34.90 ? 481  ASN A C   1 
ATOM   3765 O O   . ASN A 1 481 ? 17.026  73.489 40.583 1.00 35.31 ? 481  ASN A O   1 
ATOM   3766 C CB  . ASN A 1 481 ? 18.731  71.496 39.086 1.00 36.58 ? 481  ASN A CB  1 
ATOM   3767 C CG  . ASN A 1 481 ? 20.193  71.879 39.527 1.00 36.85 ? 481  ASN A CG  1 
ATOM   3768 O OD1 . ASN A 1 481 ? 20.452  72.319 40.663 1.00 36.30 ? 481  ASN A OD1 1 
ATOM   3769 N ND2 . ASN A 1 481 ? 21.136  71.713 38.597 1.00 34.39 ? 481  ASN A ND2 1 
ATOM   3770 N N   . PRO A 1 482 ? 17.890  72.490 42.428 1.00 34.82 ? 482  PRO A N   1 
ATOM   3771 C CA  . PRO A 1 482 ? 17.661  73.696 43.251 1.00 36.08 ? 482  PRO A CA  1 
ATOM   3772 C C   . PRO A 1 482 ? 18.509  74.905 42.888 1.00 37.50 ? 482  PRO A C   1 
ATOM   3773 O O   . PRO A 1 482 ? 18.195  76.018 43.301 1.00 37.68 ? 482  PRO A O   1 
ATOM   3774 C CB  . PRO A 1 482 ? 17.986  73.230 44.673 1.00 34.57 ? 482  PRO A CB  1 
ATOM   3775 C CG  . PRO A 1 482 ? 19.132  72.293 44.419 1.00 33.59 ? 482  PRO A CG  1 
ATOM   3776 C CD  . PRO A 1 482 ? 18.646  71.484 43.204 1.00 33.54 ? 482  PRO A CD  1 
ATOM   3777 N N   . ASN A 1 483 ? 19.581  74.677 42.136 1.00 38.60 ? 483  ASN A N   1 
ATOM   3778 C CA  . ASN A 1 483 ? 20.500  75.747 41.752 1.00 41.64 ? 483  ASN A CA  1 
ATOM   3779 C C   . ASN A 1 483 ? 20.115  76.529 40.508 1.00 43.82 ? 483  ASN A C   1 
ATOM   3780 O O   . ASN A 1 483 ? 19.642  75.979 39.515 1.00 42.12 ? 483  ASN A O   1 
ATOM   3781 C CB  . ASN A 1 483 ? 21.904  75.177 41.504 1.00 38.70 ? 483  ASN A CB  1 
ATOM   3782 C CG  . ASN A 1 483 ? 22.424  74.395 42.693 1.00 38.10 ? 483  ASN A CG  1 
ATOM   3783 O OD1 . ASN A 1 483 ? 22.717  74.974 43.737 1.00 34.71 ? 483  ASN A OD1 1 
ATOM   3784 N ND2 . ASN A 1 483 ? 22.514  73.062 42.547 1.00 36.47 ? 483  ASN A ND2 1 
ATOM   3785 N N   . GLU A 1 484 ? 20.364  77.823 40.578 1.00 48.46 ? 484  GLU A N   1 
ATOM   3786 C CA  . GLU A 1 484 ? 20.134  78.744 39.458 1.00 54.04 ? 484  GLU A CA  1 
ATOM   3787 C C   . GLU A 1 484 ? 21.283  78.499 38.420 1.00 55.90 ? 484  GLU A C   1 
ATOM   3788 O O   . GLU A 1 484 ? 22.465  78.448 38.785 1.00 55.73 ? 484  GLU A O   1 
ATOM   3789 C CB  . GLU A 1 484 ? 20.188  80.165 40.022 1.00 56.38 ? 484  GLU A CB  1 
ATOM   3790 C CG  . GLU A 1 484 ? 19.770  81.233 39.087 1.00 60.27 ? 484  GLU A CG  1 
ATOM   3791 C CD  . GLU A 1 484 ? 18.294  81.271 38.932 1.00 61.78 ? 484  GLU A CD  1 
ATOM   3792 O OE1 . GLU A 1 484 ? 17.630  81.788 39.860 1.00 61.21 ? 484  GLU A OE1 1 
ATOM   3793 O OE2 . GLU A 1 484 ? 17.819  80.772 37.881 1.00 64.19 ? 484  GLU A OE2 1 
ATOM   3794 N N   . PRO A 1 485 ? 20.954  78.337 37.121 1.00 58.60 ? 485  PRO A N   1 
ATOM   3795 C CA  . PRO A 1 485 ? 21.990  78.096 36.095 1.00 60.20 ? 485  PRO A CA  1 
ATOM   3796 C C   . PRO A 1 485 ? 23.015  79.200 35.718 1.00 61.26 ? 485  PRO A C   1 
ATOM   3797 O O   . PRO A 1 485 ? 23.439  80.053 36.523 1.00 62.92 ? 485  PRO A O   1 
ATOM   3798 C CB  . PRO A 1 485 ? 21.171  77.639 34.883 1.00 60.40 ? 485  PRO A CB  1 
ATOM   3799 C CG  . PRO A 1 485 ? 19.856  78.366 35.055 1.00 60.68 ? 485  PRO A CG  1 
ATOM   3800 C CD  . PRO A 1 485 ? 19.597  78.217 36.548 1.00 59.95 ? 485  PRO A CD  1 
ATOM   3801 N N   . SER A 1 490 ? 26.989  79.784 44.569 1.00 47.92 ? 490  SER A N   1 
ATOM   3802 C CA  . SER A 1 490 ? 27.422  78.757 45.568 1.00 49.52 ? 490  SER A CA  1 
ATOM   3803 C C   . SER A 1 490 ? 26.551  77.484 45.373 1.00 47.73 ? 490  SER A C   1 
ATOM   3804 O O   . SER A 1 490 ? 25.368  77.493 45.715 1.00 45.58 ? 490  SER A O   1 
ATOM   3805 C CB  . SER A 1 490 ? 27.247  79.317 46.992 1.00 52.01 ? 490  SER A CB  1 
ATOM   3806 O OG  . SER A 1 490 ? 28.269  78.863 47.887 1.00 53.52 ? 490  SER A OG  1 
ATOM   3807 N N   . LYS A 1 491 ? 27.141  76.414 44.830 1.00 46.35 ? 491  LYS A N   1 
ATOM   3808 C CA  . LYS A 1 491 ? 26.392  75.202 44.487 1.00 46.16 ? 491  LYS A CA  1 
ATOM   3809 C C   . LYS A 1 491 ? 26.096  74.064 45.476 1.00 43.92 ? 491  LYS A C   1 
ATOM   3810 O O   . LYS A 1 491 ? 27.014  73.533 46.145 1.00 43.30 ? 491  LYS A O   1 
ATOM   3811 C CB  . LYS A 1 491 ? 27.012  74.539 43.259 1.00 49.34 ? 491  LYS A CB  1 
ATOM   3812 C CG  . LYS A 1 491 ? 27.096  75.403 42.019 1.00 54.53 ? 491  LYS A CG  1 
ATOM   3813 C CD  . LYS A 1 491 ? 25.753  75.948 41.599 1.00 57.48 ? 491  LYS A CD  1 
ATOM   3814 C CE  . LYS A 1 491 ? 25.916  77.399 41.116 1.00 60.55 ? 491  LYS A CE  1 
ATOM   3815 N NZ  . LYS A 1 491 ? 24.698  77.921 40.411 1.00 63.30 ? 491  LYS A NZ  1 
ATOM   3816 N N   . TRP A 1 492 ? 24.808  73.689 45.515 1.00 39.36 ? 492  TRP A N   1 
ATOM   3817 C CA  . TRP A 1 492 ? 24.291  72.592 46.324 1.00 35.25 ? 492  TRP A CA  1 
ATOM   3818 C C   . TRP A 1 492 ? 24.573  71.439 45.388 1.00 34.81 ? 492  TRP A C   1 
ATOM   3819 O O   . TRP A 1 492 ? 23.945  71.319 44.356 1.00 34.40 ? 492  TRP A O   1 
ATOM   3820 C CB  . TRP A 1 492 ? 22.784  72.732 46.487 1.00 33.89 ? 492  TRP A CB  1 
ATOM   3821 C CG  . TRP A 1 492 ? 22.086  71.620 47.274 1.00 31.59 ? 492  TRP A CG  1 
ATOM   3822 C CD1 . TRP A 1 492 ? 22.559  70.375 47.547 1.00 31.02 ? 492  TRP A CD1 1 
ATOM   3823 C CD2 . TRP A 1 492 ? 20.802  71.703 47.896 1.00 30.14 ? 492  TRP A CD2 1 
ATOM   3824 N NE1 . TRP A 1 492 ? 21.655  69.673 48.306 1.00 32.03 ? 492  TRP A NE1 1 
ATOM   3825 C CE2 . TRP A 1 492 ? 20.565  70.466 48.535 1.00 29.77 ? 492  TRP A CE2 1 
ATOM   3826 C CE3 . TRP A 1 492 ? 19.832  72.702 47.971 1.00 28.84 ? 492  TRP A CE3 1 
ATOM   3827 C CZ2 . TRP A 1 492 ? 19.406  70.203 49.244 1.00 29.67 ? 492  TRP A CZ2 1 
ATOM   3828 C CZ3 . TRP A 1 492 ? 18.676  72.444 48.665 1.00 30.57 ? 492  TRP A CZ3 1 
ATOM   3829 C CH2 . TRP A 1 492 ? 18.466  71.193 49.301 1.00 31.32 ? 492  TRP A CH2 1 
ATOM   3830 N N   . PRO A 1 493 ? 25.524  70.568 45.729 1.00 34.68 ? 493  PRO A N   1 
ATOM   3831 C CA  . PRO A 1 493 ? 25.803  69.461 44.799 1.00 34.26 ? 493  PRO A CA  1 
ATOM   3832 C C   . PRO A 1 493 ? 24.822  68.305 44.789 1.00 35.44 ? 493  PRO A C   1 
ATOM   3833 O O   . PRO A 1 493 ? 24.091  68.053 45.748 1.00 34.11 ? 493  PRO A O   1 
ATOM   3834 C CB  . PRO A 1 493 ? 27.190  68.978 45.237 1.00 34.89 ? 493  PRO A CB  1 
ATOM   3835 C CG  . PRO A 1 493 ? 27.183  69.232 46.707 1.00 34.34 ? 493  PRO A CG  1 
ATOM   3836 C CD  . PRO A 1 493 ? 26.503  70.603 46.832 1.00 33.71 ? 493  PRO A CD  1 
ATOM   3837 N N   . LEU A 1 494 ? 24.838  67.597 43.680 1.00 35.06 ? 494  LEU A N   1 
ATOM   3838 C CA  . LEU A 1 494 ? 24.013  66.441 43.520 1.00 36.60 ? 494  LEU A CA  1 
ATOM   3839 C C   . LEU A 1 494 ? 24.514  65.338 44.508 1.00 36.84 ? 494  LEU A C   1 
ATOM   3840 O O   . LEU A 1 494 ? 25.737  65.172 44.738 1.00 35.12 ? 494  LEU A O   1 
ATOM   3841 C CB  . LEU A 1 494 ? 24.141  66.010 42.063 1.00 38.15 ? 494  LEU A CB  1 
ATOM   3842 C CG  . LEU A 1 494 ? 23.133  65.179 41.275 1.00 40.67 ? 494  LEU A CG  1 
ATOM   3843 C CD1 . LEU A 1 494 ? 21.735  65.792 41.269 1.00 37.70 ? 494  LEU A CD1 1 
ATOM   3844 C CD2 . LEU A 1 494 ? 23.692  65.067 39.846 1.00 40.93 ? 494  LEU A CD2 1 
ATOM   3845 N N   . PHE A 1 495 ? 23.574  64.637 45.144 1.00 36.31 ? 495  PHE A N   1 
ATOM   3846 C CA  . PHE A 1 495 ? 23.925  63.525 46.040 1.00 35.37 ? 495  PHE A CA  1 
ATOM   3847 C C   . PHE A 1 495 ? 24.128  62.358 45.053 1.00 35.80 ? 495  PHE A C   1 
ATOM   3848 O O   . PHE A 1 495 ? 23.270  62.113 44.218 1.00 35.09 ? 495  PHE A O   1 
ATOM   3849 C CB  . PHE A 1 495 ? 22.755  63.208 47.032 1.00 34.00 ? 495  PHE A CB  1 
ATOM   3850 C CG  . PHE A 1 495 ? 22.894  61.877 47.785 1.00 33.40 ? 495  PHE A CG  1 
ATOM   3851 C CD1 . PHE A 1 495 ? 22.584  60.654 47.172 1.00 33.34 ? 495  PHE A CD1 1 
ATOM   3852 C CD2 . PHE A 1 495 ? 23.371  61.858 49.093 1.00 31.53 ? 495  PHE A CD2 1 
ATOM   3853 C CE1 . PHE A 1 495 ? 22.771  59.440 47.874 1.00 33.90 ? 495  PHE A CE1 1 
ATOM   3854 C CE2 . PHE A 1 495 ? 23.553  60.651 49.797 1.00 32.58 ? 495  PHE A CE2 1 
ATOM   3855 C CZ  . PHE A 1 495 ? 23.263  59.455 49.204 1.00 31.59 ? 495  PHE A CZ  1 
ATOM   3856 N N   . THR A 1 496 ? 25.255  61.643 45.130 1.00 36.24 ? 496  THR A N   1 
ATOM   3857 C CA  . THR A 1 496 ? 25.485  60.503 44.232 1.00 36.98 ? 496  THR A CA  1 
ATOM   3858 C C   . THR A 1 496 ? 25.807  59.289 45.041 1.00 39.38 ? 496  THR A C   1 
ATOM   3859 O O   . THR A 1 496 ? 26.220  59.387 46.208 1.00 41.05 ? 496  THR A O   1 
ATOM   3860 C CB  . THR A 1 496 ? 26.678  60.714 43.266 1.00 35.95 ? 496  THR A CB  1 
ATOM   3861 O OG1 . THR A 1 496 ? 27.877  60.969 44.030 1.00 33.43 ? 496  THR A OG1 1 
ATOM   3862 C CG2 . THR A 1 496 ? 26.367  61.885 42.284 1.00 32.54 ? 496  THR A CG2 1 
ATOM   3863 N N   . THR A 1 497 ? 25.640  58.131 44.425 1.00 41.33 ? 497  THR A N   1 
ATOM   3864 C CA  . THR A 1 497 ? 25.932  56.879 45.101 1.00 42.71 ? 497  THR A CA  1 
ATOM   3865 C C   . THR A 1 497 ? 27.364  56.841 45.660 1.00 42.51 ? 497  THR A C   1 
ATOM   3866 O O   . THR A 1 497 ? 27.581  56.389 46.796 1.00 41.27 ? 497  THR A O   1 
ATOM   3867 C CB  . THR A 1 497 ? 25.706  55.711 44.130 1.00 43.88 ? 497  THR A CB  1 
ATOM   3868 O OG1 . THR A 1 497 ? 24.330  55.697 43.728 1.00 45.62 ? 497  THR A OG1 1 
ATOM   3869 C CG2 . THR A 1 497 ? 26.034  54.416 44.784 1.00 44.36 ? 497  THR A CG2 1 
ATOM   3870 N N   . LYS A 1 498 ? 28.322  57.345 44.874 1.00 42.86 ? 498  LYS A N   1 
ATOM   3871 C CA  . LYS A 1 498 ? 29.733  57.358 45.272 1.00 43.67 ? 498  LYS A CA  1 
ATOM   3872 C C   . LYS A 1 498 ? 30.097  58.413 46.300 1.00 43.24 ? 498  LYS A C   1 
ATOM   3873 O O   . LYS A 1 498 ? 30.621  58.093 47.358 1.00 44.73 ? 498  LYS A O   1 
ATOM   3874 C CB  . LYS A 1 498 ? 30.651  57.516 44.038 1.00 43.00 ? 498  LYS A CB  1 
ATOM   3875 N N   . GLU A 1 499 ? 29.816  59.672 46.004 1.00 43.02 ? 499  GLU A N   1 
ATOM   3876 C CA  . GLU A 1 499 ? 30.182  60.781 46.901 1.00 42.38 ? 499  GLU A CA  1 
ATOM   3877 C C   . GLU A 1 499 ? 29.269  61.065 48.129 1.00 39.60 ? 499  GLU A C   1 
ATOM   3878 O O   . GLU A 1 499 ? 29.727  61.594 49.142 1.00 35.84 ? 499  GLU A O   1 
ATOM   3879 C CB  . GLU A 1 499 ? 30.308  62.061 46.063 1.00 46.22 ? 499  GLU A CB  1 
ATOM   3880 C CG  . GLU A 1 499 ? 31.717  62.462 45.576 1.00 52.53 ? 499  GLU A CG  1 
ATOM   3881 C CD  . GLU A 1 499 ? 32.574  61.277 45.233 1.00 55.56 ? 499  GLU A CD  1 
ATOM   3882 O OE1 . GLU A 1 499 ? 32.165  60.506 44.330 1.00 57.63 ? 499  GLU A OE1 1 
ATOM   3883 O OE2 . GLU A 1 499 ? 33.647  61.114 45.877 1.00 57.69 ? 499  GLU A OE2 1 
ATOM   3884 N N   . GLN A 1 500 ? 27.979  60.756 48.004 1.00 38.16 ? 500  GLN A N   1 
ATOM   3885 C CA  . GLN A 1 500 ? 27.002  60.961 49.099 1.00 37.68 ? 500  GLN A CA  1 
ATOM   3886 C C   . GLN A 1 500 ? 27.023  62.361 49.767 1.00 35.15 ? 500  GLN A C   1 
ATOM   3887 O O   . GLN A 1 500 ? 26.930  62.507 50.998 1.00 31.66 ? 500  GLN A O   1 
ATOM   3888 C CB  . GLN A 1 500 ? 27.219  59.841 50.120 1.00 38.63 ? 500  GLN A CB  1 
ATOM   3889 C CG  . GLN A 1 500 ? 26.914  58.507 49.471 1.00 39.76 ? 500  GLN A CG  1 
ATOM   3890 C CD  . GLN A 1 500 ? 27.268  57.335 50.349 1.00 41.50 ? 500  GLN A CD  1 
ATOM   3891 O OE1 . GLN A 1 500 ? 26.939  57.313 51.532 1.00 39.08 ? 500  GLN A OE1 1 
ATOM   3892 N NE2 . GLN A 1 500 ? 27.942  56.343 49.767 1.00 41.35 ? 500  GLN A NE2 1 
ATOM   3893 N N   . LYS A 1 501 ? 27.158  63.382 48.924 1.00 34.07 ? 501  LYS A N   1 
ATOM   3894 C CA  . LYS A 1 501 ? 27.217  64.769 49.374 1.00 34.51 ? 501  LYS A CA  1 
ATOM   3895 C C   . LYS A 1 501 ? 25.866  65.363 49.780 1.00 33.37 ? 501  LYS A C   1 
ATOM   3896 O O   . LYS A 1 501 ? 24.818  65.052 49.178 1.00 33.68 ? 501  LYS A O   1 
ATOM   3897 C CB  . LYS A 1 501 ? 27.810  65.663 48.267 1.00 34.57 ? 501  LYS A CB  1 
ATOM   3898 C CG  . LYS A 1 501 ? 29.274  65.374 47.942 1.00 39.80 ? 501  LYS A CG  1 
ATOM   3899 C CD  . LYS A 1 501 ? 29.795  66.186 46.719 1.00 43.18 ? 501  LYS A CD  1 
ATOM   3900 C CE  . LYS A 1 501 ? 31.320  66.015 46.580 1.00 46.29 ? 501  LYS A CE  1 
ATOM   3901 N NZ  . LYS A 1 501 ? 31.887  66.751 45.410 1.00 49.87 ? 501  LYS A NZ  1 
ATOM   3902 N N   . PHE A 1 502 ? 25.911  66.227 50.785 1.00 31.57 ? 502  PHE A N   1 
ATOM   3903 C CA  . PHE A 1 502 ? 24.740  66.957 51.241 1.00 31.43 ? 502  PHE A CA  1 
ATOM   3904 C C   . PHE A 1 502 ? 25.209  68.337 51.727 1.00 32.27 ? 502  PHE A C   1 
ATOM   3905 O O   . PHE A 1 502 ? 26.408  68.583 51.852 1.00 32.87 ? 502  PHE A O   1 
ATOM   3906 C CB  . PHE A 1 502 ? 24.019  66.196 52.359 1.00 29.62 ? 502  PHE A CB  1 
ATOM   3907 C CG  . PHE A 1 502 ? 24.777  66.122 53.671 1.00 29.94 ? 502  PHE A CG  1 
ATOM   3908 C CD1 . PHE A 1 502 ? 24.520  67.034 54.707 1.00 29.57 ? 502  PHE A CD1 1 
ATOM   3909 C CD2 . PHE A 1 502 ? 25.681  65.072 53.907 1.00 28.80 ? 502  PHE A CD2 1 
ATOM   3910 C CE1 . PHE A 1 502 ? 25.119  66.896 55.957 1.00 30.00 ? 502  PHE A CE1 1 
ATOM   3911 C CE2 . PHE A 1 502 ? 26.299  64.919 55.160 1.00 29.69 ? 502  PHE A CE2 1 
ATOM   3912 C CZ  . PHE A 1 502 ? 26.026  65.818 56.193 1.00 30.54 ? 502  PHE A CZ  1 
ATOM   3913 N N   . ILE A 1 503 ? 24.279  69.248 51.984 1.00 33.00 ? 503  ILE A N   1 
ATOM   3914 C CA  . ILE A 1 503 ? 24.663  70.555 52.498 1.00 33.22 ? 503  ILE A CA  1 
ATOM   3915 C C   . ILE A 1 503 ? 23.935  70.853 53.822 1.00 34.35 ? 503  ILE A C   1 
ATOM   3916 O O   . ILE A 1 503 ? 22.925  70.259 54.139 1.00 34.12 ? 503  ILE A O   1 
ATOM   3917 C CB  . ILE A 1 503 ? 24.302  71.705 51.547 1.00 34.75 ? 503  ILE A CB  1 
ATOM   3918 C CG1 . ILE A 1 503 ? 22.794  71.710 51.309 1.00 35.77 ? 503  ILE A CG1 1 
ATOM   3919 C CG2 . ILE A 1 503 ? 25.056  71.596 50.242 1.00 33.91 ? 503  ILE A CG2 1 
ATOM   3920 C CD1 . ILE A 1 503 ? 22.272  73.014 50.803 1.00 37.50 ? 503  ILE A CD1 1 
ATOM   3921 N N   . ASP A 1 504 ? 24.495  71.752 54.612 1.00 35.19 ? 504  ASP A N   1 
ATOM   3922 C CA  . ASP A 1 504 ? 23.853  72.165 55.837 1.00 36.37 ? 504  ASP A CA  1 
ATOM   3923 C C   . ASP A 1 504 ? 22.976  73.276 55.325 1.00 35.91 ? 504  ASP A C   1 
ATOM   3924 O O   . ASP A 1 504 ? 23.279  73.919 54.321 1.00 37.15 ? 504  ASP A O   1 
ATOM   3925 C CB  . ASP A 1 504 ? 24.840  72.761 56.852 1.00 36.72 ? 504  ASP A CB  1 
ATOM   3926 C CG  . ASP A 1 504 ? 25.822  71.736 57.404 1.00 39.24 ? 504  ASP A CG  1 
ATOM   3927 O OD1 . ASP A 1 504 ? 25.453  70.556 57.532 1.00 38.01 ? 504  ASP A OD1 1 
ATOM   3928 O OD2 . ASP A 1 504 ? 26.967  72.107 57.739 1.00 40.00 ? 504  ASP A OD2 1 
ATOM   3929 N N   . LEU A 1 505 ? 21.883  73.518 56.009 1.00 35.18 ? 505  LEU A N   1 
ATOM   3930 C CA  . LEU A 1 505 ? 21.002  74.575 55.599 1.00 35.26 ? 505  LEU A CA  1 
ATOM   3931 C C   . LEU A 1 505 ? 20.874  75.423 56.853 1.00 34.90 ? 505  LEU A C   1 
ATOM   3932 O O   . LEU A 1 505 ? 20.240  75.002 57.830 1.00 34.22 ? 505  LEU A O   1 
ATOM   3933 C CB  . LEU A 1 505 ? 19.670  73.942 55.177 1.00 35.32 ? 505  LEU A CB  1 
ATOM   3934 C CG  . LEU A 1 505 ? 18.789  74.469 54.035 1.00 37.32 ? 505  LEU A CG  1 
ATOM   3935 C CD1 . LEU A 1 505 ? 19.596  75.015 52.852 1.00 32.01 ? 505  LEU A CD1 1 
ATOM   3936 C CD2 . LEU A 1 505 ? 17.902  73.342 53.581 1.00 34.16 ? 505  LEU A CD2 1 
ATOM   3937 N N   . ASN A 1 506 ? 21.510  76.586 56.867 1.00 35.08 ? 506  ASN A N   1 
ATOM   3938 C CA  . ASN A 1 506 ? 21.424  77.465 58.056 1.00 37.21 ? 506  ASN A CA  1 
ATOM   3939 C C   . ASN A 1 506 ? 21.844  78.877 57.680 1.00 36.96 ? 506  ASN A C   1 
ATOM   3940 O O   . ASN A 1 506 ? 21.923  79.187 56.512 1.00 37.42 ? 506  ASN A O   1 
ATOM   3941 C CB  . ASN A 1 506 ? 22.307  76.905 59.194 1.00 37.36 ? 506  ASN A CB  1 
ATOM   3942 C CG  . ASN A 1 506 ? 23.759  76.722 58.762 1.00 37.21 ? 506  ASN A CG  1 
ATOM   3943 O OD1 . ASN A 1 506 ? 24.295  77.590 58.095 1.00 35.23 ? 506  ASN A OD1 1 
ATOM   3944 N ND2 . ASN A 1 506 ? 24.399  75.598 59.150 1.00 36.06 ? 506  ASN A ND2 1 
ATOM   3945 N N   . THR A 1 507 ? 22.106  79.735 58.640 1.00 38.60 ? 507  THR A N   1 
ATOM   3946 C CA  . THR A 1 507 ? 22.494  81.113 58.300 1.00 41.41 ? 507  THR A CA  1 
ATOM   3947 C C   . THR A 1 507 ? 23.987  81.365 57.939 1.00 42.71 ? 507  THR A C   1 
ATOM   3948 O O   . THR A 1 507 ? 24.357  82.487 57.595 1.00 42.33 ? 507  THR A O   1 
ATOM   3949 C CB  . THR A 1 507 ? 22.063  82.071 59.439 1.00 41.56 ? 507  THR A CB  1 
ATOM   3950 O OG1 . THR A 1 507 ? 22.565  81.588 60.700 1.00 41.35 ? 507  THR A OG1 1 
ATOM   3951 C CG2 . THR A 1 507 ? 20.518  82.127 59.529 1.00 41.72 ? 507  THR A CG2 1 
ATOM   3952 N N   . GLU A 1 508 ? 24.825  80.324 58.006 1.00 44.47 ? 508  GLU A N   1 
ATOM   3953 C CA  . GLU A 1 508 ? 26.262  80.426 57.699 1.00 46.77 ? 508  GLU A CA  1 
ATOM   3954 C C   . GLU A 1 508 ? 26.496  80.090 56.254 1.00 46.71 ? 508  GLU A C   1 
ATOM   3955 O O   . GLU A 1 508 ? 25.643  79.528 55.606 1.00 46.23 ? 508  GLU A O   1 
ATOM   3956 C CB  . GLU A 1 508 ? 27.116  79.415 58.483 1.00 49.18 ? 508  GLU A CB  1 
ATOM   3957 C CG  . GLU A 1 508 ? 26.613  79.027 59.831 1.00 55.08 ? 508  GLU A CG  1 
ATOM   3958 C CD  . GLU A 1 508 ? 26.225  80.236 60.633 1.00 57.99 ? 508  GLU A CD  1 
ATOM   3959 O OE1 . GLU A 1 508 ? 27.071  81.148 60.723 1.00 60.19 ? 508  GLU A OE1 1 
ATOM   3960 O OE2 . GLU A 1 508 ? 25.086  80.284 61.169 1.00 59.41 ? 508  GLU A OE2 1 
ATOM   3961 N N   . PRO A 1 509 ? 27.675  80.433 55.732 1.00 48.07 ? 509  PRO A N   1 
ATOM   3962 C CA  . PRO A 1 509 ? 28.016  80.142 54.338 1.00 49.27 ? 509  PRO A CA  1 
ATOM   3963 C C   . PRO A 1 509 ? 27.885  78.630 54.113 1.00 49.72 ? 509  PRO A C   1 
ATOM   3964 O O   . PRO A 1 509 ? 28.319  77.819 54.933 1.00 49.58 ? 509  PRO A O   1 
ATOM   3965 C CB  . PRO A 1 509 ? 29.463  80.624 54.237 1.00 48.77 ? 509  PRO A CB  1 
ATOM   3966 C CG  . PRO A 1 509 ? 29.446  81.840 55.134 1.00 50.00 ? 509  PRO A CG  1 
ATOM   3967 C CD  . PRO A 1 509 ? 28.665  81.341 56.341 1.00 49.14 ? 509  PRO A CD  1 
ATOM   3968 N N   . MET A 1 510 ? 27.310  78.256 52.986 1.00 50.37 ? 510  MET A N   1 
ATOM   3969 C CA  . MET A 1 510 ? 27.090  76.857 52.686 1.00 50.39 ? 510  MET A CA  1 
ATOM   3970 C C   . MET A 1 510 ? 28.287  75.951 52.872 1.00 50.05 ? 510  MET A C   1 
ATOM   3971 O O   . MET A 1 510 ? 29.362  76.259 52.390 1.00 50.28 ? 510  MET A O   1 
ATOM   3972 C CB  . MET A 1 510 ? 26.604  76.721 51.248 1.00 51.22 ? 510  MET A CB  1 
ATOM   3973 C CG  . MET A 1 510 ? 26.271  75.299 50.835 1.00 52.37 ? 510  MET A CG  1 
ATOM   3974 S SD  . MET A 1 510 ? 26.121  75.099 49.045 1.00 51.75 ? 510  MET A SD  1 
ATOM   3975 C CE  . MET A 1 510 ? 24.520  75.906 48.782 1.00 53.14 ? 510  MET A CE  1 
ATOM   3976 N N   . LYS A 1 511 ? 28.111  74.839 53.582 1.00 49.10 ? 511  LYS A N   1 
ATOM   3977 C CA  . LYS A 1 511 ? 29.189  73.854 53.715 1.00 48.59 ? 511  LYS A CA  1 
ATOM   3978 C C   . LYS A 1 511 ? 28.653  72.528 53.137 1.00 46.78 ? 511  LYS A C   1 
ATOM   3979 O O   . LYS A 1 511 ? 27.481  72.159 53.334 1.00 46.60 ? 511  LYS A O   1 
ATOM   3980 C CB  . LYS A 1 511 ? 29.624  73.650 55.172 1.00 50.20 ? 511  LYS A CB  1 
ATOM   3981 C CG  . LYS A 1 511 ? 30.299  74.859 55.798 1.00 54.27 ? 511  LYS A CG  1 
ATOM   3982 C CD  . LYS A 1 511 ? 31.227  74.445 56.957 1.00 56.51 ? 511  LYS A CD  1 
ATOM   3983 C CE  . LYS A 1 511 ? 31.606  75.643 57.817 1.00 58.85 ? 511  LYS A CE  1 
ATOM   3984 N NZ  . LYS A 1 511 ? 32.128  75.221 59.164 1.00 59.72 ? 511  LYS A NZ  1 
ATOM   3985 N N   . VAL A 1 512 ? 29.502  71.827 52.405 1.00 44.14 ? 512  VAL A N   1 
ATOM   3986 C CA  . VAL A 1 512 ? 29.129  70.560 51.804 1.00 42.72 ? 512  VAL A CA  1 
ATOM   3987 C C   . VAL A 1 512 ? 29.789  69.448 52.628 1.00 42.46 ? 512  VAL A C   1 
ATOM   3988 O O   . VAL A 1 512 ? 30.957  69.572 53.006 1.00 41.39 ? 512  VAL A O   1 
ATOM   3989 C CB  . VAL A 1 512 ? 29.657  70.481 50.355 1.00 42.37 ? 512  VAL A CB  1 
ATOM   3990 C CG1 . VAL A 1 512 ? 29.389  69.098 49.754 1.00 40.71 ? 512  VAL A CG1 1 
ATOM   3991 C CG2 . VAL A 1 512 ? 29.022  71.601 49.499 1.00 40.85 ? 512  VAL A CG2 1 
ATOM   3992 N N   . HIS A 1 513 ? 29.046  68.387 52.952 1.00 41.46 ? 513  HIS A N   1 
ATOM   3993 C CA  . HIS A 1 513 ? 29.648  67.271 53.686 1.00 39.04 ? 513  HIS A CA  1 
ATOM   3994 C C   . HIS A 1 513 ? 29.282  65.968 52.986 1.00 38.86 ? 513  HIS A C   1 
ATOM   3995 O O   . HIS A 1 513 ? 28.537  65.961 51.995 1.00 37.95 ? 513  HIS A O   1 
ATOM   3996 C CB  . HIS A 1 513 ? 29.127  67.148 55.109 1.00 40.43 ? 513  HIS A CB  1 
ATOM   3997 C CG  . HIS A 1 513 ? 29.136  68.415 55.893 1.00 40.19 ? 513  HIS A CG  1 
ATOM   3998 N ND1 . HIS A 1 513 ? 30.261  68.881 56.545 1.00 41.05 ? 513  HIS A ND1 1 
ATOM   3999 C CD2 . HIS A 1 513 ? 28.137  69.276 56.194 1.00 39.47 ? 513  HIS A CD2 1 
ATOM   4000 C CE1 . HIS A 1 513 ? 29.946  69.973 57.220 1.00 41.70 ? 513  HIS A CE1 1 
ATOM   4001 N NE2 . HIS A 1 513 ? 28.662  70.234 57.023 1.00 41.00 ? 513  HIS A NE2 1 
ATOM   4002 N N   . GLN A 1 514 ? 29.761  64.863 53.549 1.00 37.38 ? 514  GLN A N   1 
ATOM   4003 C CA  . GLN A 1 514 ? 29.497  63.556 53.005 1.00 36.95 ? 514  GLN A CA  1 
ATOM   4004 C C   . GLN A 1 514 ? 29.035  62.526 54.035 1.00 35.19 ? 514  GLN A C   1 
ATOM   4005 O O   . GLN A 1 514 ? 29.406  62.579 55.202 1.00 34.11 ? 514  GLN A O   1 
ATOM   4006 C CB  . GLN A 1 514 ? 30.758  63.036 52.346 1.00 39.44 ? 514  GLN A CB  1 
ATOM   4007 C CG  . GLN A 1 514 ? 31.266  63.928 51.261 1.00 44.33 ? 514  GLN A CG  1 
ATOM   4008 C CD  . GLN A 1 514 ? 32.529  63.362 50.637 1.00 46.75 ? 514  GLN A CD  1 
ATOM   4009 O OE1 . GLN A 1 514 ? 33.641  63.646 51.084 1.00 49.43 ? 514  GLN A OE1 1 
ATOM   4010 N NE2 . GLN A 1 514 ? 32.358  62.519 49.625 1.00 46.26 ? 514  GLN A NE2 1 
ATOM   4011 N N   . ARG A 1 515 ? 28.237  61.577 53.566 1.00 34.38 ? 515  ARG A N   1 
ATOM   4012 C CA  . ARG A 1 515 ? 27.755  60.482 54.396 1.00 34.42 ? 515  ARG A CA  1 
ATOM   4013 C C   . ARG A 1 515 ? 27.049  60.888 55.704 1.00 32.68 ? 515  ARG A C   1 
ATOM   4014 O O   . ARG A 1 515 ? 27.530  60.593 56.818 1.00 28.33 ? 515  ARG A O   1 
ATOM   4015 C CB  . ARG A 1 515 ? 28.925  59.589 54.697 1.00 38.18 ? 515  ARG A CB  1 
ATOM   4016 C CG  . ARG A 1 515 ? 29.663  59.099 53.438 1.00 43.73 ? 515  ARG A CG  1 
ATOM   4017 C CD  . ARG A 1 515 ? 29.999  57.636 53.632 1.00 47.68 ? 515  ARG A CD  1 
ATOM   4018 N NE  . ARG A 1 515 ? 31.011  57.120 52.733 1.00 53.25 ? 515  ARG A NE  1 
ATOM   4019 N N   . LEU A 1 516 ? 25.906  61.572 55.539 1.00 31.00 ? 516  LEU A N   1 
ATOM   4020 C CA  . LEU A 1 516 ? 25.079  62.025 56.665 1.00 30.66 ? 516  LEU A CA  1 
ATOM   4021 C C   . LEU A 1 516 ? 24.829  60.888 57.688 1.00 31.17 ? 516  LEU A C   1 
ATOM   4022 O O   . LEU A 1 516 ? 24.238  59.848 57.374 1.00 28.29 ? 516  LEU A O   1 
ATOM   4023 C CB  . LEU A 1 516 ? 23.759  62.589 56.123 1.00 31.00 ? 516  LEU A CB  1 
ATOM   4024 C CG  . LEU A 1 516 ? 22.678  63.221 57.005 1.00 32.39 ? 516  LEU A CG  1 
ATOM   4025 C CD1 . LEU A 1 516 ? 23.262  63.949 58.129 1.00 32.10 ? 516  LEU A CD1 1 
ATOM   4026 C CD2 . LEU A 1 516 ? 21.840  64.184 56.134 1.00 30.81 ? 516  LEU A CD2 1 
ATOM   4027 N N   . ARG A 1 517 ? 25.306  61.124 58.908 1.00 31.44 ? 517  ARG A N   1 
ATOM   4028 C CA  . ARG A 1 517 ? 25.217  60.182 60.016 1.00 32.56 ? 517  ARG A CA  1 
ATOM   4029 C C   . ARG A 1 517 ? 25.465  58.701 59.648 1.00 31.10 ? 517  ARG A C   1 
ATOM   4030 O O   . ARG A 1 517 ? 24.795  57.816 60.168 1.00 28.25 ? 517  ARG A O   1 
ATOM   4031 C CB  . ARG A 1 517 ? 23.880  60.405 60.780 1.00 34.68 ? 517  ARG A CB  1 
ATOM   4032 C CG  . ARG A 1 517 ? 24.026  61.683 61.690 1.00 39.86 ? 517  ARG A CG  1 
ATOM   4033 C CD  . ARG A 1 517 ? 22.860  62.078 62.576 1.00 39.81 ? 517  ARG A CD  1 
ATOM   4034 N NE  . ARG A 1 517 ? 22.828  61.310 63.811 1.00 40.46 ? 517  ARG A NE  1 
ATOM   4035 C CZ  . ARG A 1 517 ? 23.643  61.512 64.851 1.00 41.39 ? 517  ARG A CZ  1 
ATOM   4036 N NH1 . ARG A 1 517 ? 24.556  62.484 64.771 1.00 40.97 ? 517  ARG A NH1 1 
ATOM   4037 N NH2 . ARG A 1 517 ? 23.548  60.752 65.963 1.00 33.80 ? 517  ARG A NH2 1 
ATOM   4038 N N   . VAL A 1 518 ? 26.462  58.435 58.795 1.00 31.45 ? 518  VAL A N   1 
ATOM   4039 C CA  . VAL A 1 518 ? 26.747  57.050 58.383 1.00 32.27 ? 518  VAL A CA  1 
ATOM   4040 C C   . VAL A 1 518 ? 26.980  56.122 59.563 1.00 31.96 ? 518  VAL A C   1 
ATOM   4041 O O   . VAL A 1 518 ? 26.505  55.016 59.567 1.00 30.87 ? 518  VAL A O   1 
ATOM   4042 C CB  . VAL A 1 518 ? 28.061  56.806 57.655 1.00 33.16 ? 518  VAL A CB  1 
ATOM   4043 C CG1 . VAL A 1 518 ? 27.794  56.098 56.399 1.00 30.63 ? 518  VAL A CG1 1 
ATOM   4044 C CG2 . VAL A 1 518 ? 28.914  58.018 57.624 1.00 31.97 ? 518  VAL A CG2 1 
ATOM   4045 N N   . GLN A 1 519 ? 27.806  56.552 60.510 1.00 32.37 ? 519  GLN A N   1 
ATOM   4046 C CA  . GLN A 1 519 ? 28.129  55.719 61.665 1.00 32.62 ? 519  GLN A CA  1 
ATOM   4047 C C   . GLN A 1 519 ? 26.868  55.169 62.373 1.00 31.81 ? 519  GLN A C   1 
ATOM   4048 O O   . GLN A 1 519 ? 26.677  53.943 62.483 1.00 28.79 ? 519  GLN A O   1 
ATOM   4049 C CB  . GLN A 1 519 ? 29.044  56.515 62.629 1.00 33.79 ? 519  GLN A CB  1 
ATOM   4050 C CG  . GLN A 1 519 ? 29.882  55.645 63.591 1.00 34.03 ? 519  GLN A CG  1 
ATOM   4051 C CD  . GLN A 1 519 ? 30.880  54.731 62.861 1.00 36.95 ? 519  GLN A CD  1 
ATOM   4052 O OE1 . GLN A 1 519 ? 31.527  55.149 61.887 1.00 35.95 ? 519  GLN A OE1 1 
ATOM   4053 N NE2 . GLN A 1 519 ? 31.016  53.481 63.338 1.00 37.52 ? 519  GLN A NE2 1 
ATOM   4054 N N   . MET A 1 520 ? 25.992  56.055 62.830 1.00 30.27 ? 520  MET A N   1 
ATOM   4055 C CA  . MET A 1 520 ? 24.779  55.569 63.477 1.00 31.35 ? 520  MET A CA  1 
ATOM   4056 C C   . MET A 1 520 ? 23.822  54.856 62.483 1.00 31.62 ? 520  MET A C   1 
ATOM   4057 O O   . MET A 1 520 ? 23.133  53.877 62.856 1.00 31.29 ? 520  MET A O   1 
ATOM   4058 C CB  . MET A 1 520 ? 24.030  56.720 64.153 1.00 32.93 ? 520  MET A CB  1 
ATOM   4059 C CG  . MET A 1 520 ? 24.776  57.397 65.302 1.00 37.04 ? 520  MET A CG  1 
ATOM   4060 S SD  . MET A 1 520 ? 25.263  56.149 66.572 1.00 40.85 ? 520  MET A SD  1 
ATOM   4061 C CE  . MET A 1 520 ? 27.027  56.070 66.154 1.00 44.59 ? 520  MET A CE  1 
ATOM   4062 N N   . CYS A 1 521 ? 23.749  55.319 61.234 1.00 29.29 ? 521  CYS A N   1 
ATOM   4063 C CA  . CYS A 1 521 ? 22.831  54.670 60.338 1.00 29.15 ? 521  CYS A CA  1 
ATOM   4064 C C   . CYS A 1 521 ? 23.275  53.265 59.934 1.00 28.75 ? 521  CYS A C   1 
ATOM   4065 O O   . CYS A 1 521 ? 22.436  52.444 59.595 1.00 30.27 ? 521  CYS A O   1 
ATOM   4066 C CB  . CYS A 1 521 ? 22.498  55.602 59.161 1.00 30.30 ? 521  CYS A CB  1 
ATOM   4067 S SG  . CYS A 1 521 ? 21.521  57.077 59.708 1.00 28.95 ? 521  CYS A SG  1 
ATOM   4068 N N   . VAL A 1 522 ? 24.561  52.915 60.044 1.00 28.91 ? 522  VAL A N   1 
ATOM   4069 C CA  . VAL A 1 522 ? 24.907  51.516 59.721 1.00 27.99 ? 522  VAL A CA  1 
ATOM   4070 C C   . VAL A 1 522 ? 24.352  50.676 60.880 1.00 28.23 ? 522  VAL A C   1 
ATOM   4071 O O   . VAL A 1 522 ? 23.894  49.519 60.712 1.00 25.43 ? 522  VAL A O   1 
ATOM   4072 C CB  . VAL A 1 522 ? 26.435  51.277 59.593 1.00 28.64 ? 522  VAL A CB  1 
ATOM   4073 C CG1 . VAL A 1 522 ? 26.733  49.749 59.587 1.00 28.48 ? 522  VAL A CG1 1 
ATOM   4074 C CG2 . VAL A 1 522 ? 26.945  51.889 58.273 1.00 28.79 ? 522  VAL A CG2 1 
ATOM   4075 N N   . PHE A 1 523 ? 24.379  51.266 62.069 1.00 26.63 ? 523  PHE A N   1 
ATOM   4076 C CA  . PHE A 1 523 ? 23.853  50.556 63.224 1.00 28.28 ? 523  PHE A CA  1 
ATOM   4077 C C   . PHE A 1 523 ? 22.319  50.295 63.052 1.00 29.33 ? 523  PHE A C   1 
ATOM   4078 O O   . PHE A 1 523 ? 21.846  49.141 63.164 1.00 30.15 ? 523  PHE A O   1 
ATOM   4079 C CB  . PHE A 1 523 ? 24.104  51.369 64.503 1.00 26.51 ? 523  PHE A CB  1 
ATOM   4080 C CG  . PHE A 1 523 ? 23.404  50.815 65.684 1.00 27.49 ? 523  PHE A CG  1 
ATOM   4081 C CD1 . PHE A 1 523 ? 23.968  49.779 66.407 1.00 28.61 ? 523  PHE A CD1 1 
ATOM   4082 C CD2 . PHE A 1 523 ? 22.147  51.312 66.069 1.00 26.51 ? 523  PHE A CD2 1 
ATOM   4083 C CE1 . PHE A 1 523 ? 23.289  49.221 67.525 1.00 29.29 ? 523  PHE A CE1 1 
ATOM   4084 C CE2 . PHE A 1 523 ? 21.463  50.767 67.171 1.00 28.26 ? 523  PHE A CE2 1 
ATOM   4085 C CZ  . PHE A 1 523 ? 22.049  49.716 67.903 1.00 28.90 ? 523  PHE A CZ  1 
ATOM   4086 N N   . TRP A 1 524 ? 21.554  51.351 62.780 1.00 27.05 ? 524  TRP A N   1 
ATOM   4087 C CA  . TRP A 1 524 ? 20.101  51.203 62.595 1.00 28.48 ? 524  TRP A CA  1 
ATOM   4088 C C   . TRP A 1 524 ? 19.629  50.475 61.338 1.00 28.04 ? 524  TRP A C   1 
ATOM   4089 O O   . TRP A 1 524 ? 18.609  49.816 61.379 1.00 26.10 ? 524  TRP A O   1 
ATOM   4090 C CB  . TRP A 1 524 ? 19.386  52.573 62.617 1.00 24.73 ? 524  TRP A CB  1 
ATOM   4091 C CG  . TRP A 1 524 ? 19.517  53.250 63.966 1.00 26.57 ? 524  TRP A CG  1 
ATOM   4092 C CD1 . TRP A 1 524 ? 20.348  54.289 64.281 1.00 25.29 ? 524  TRP A CD1 1 
ATOM   4093 C CD2 . TRP A 1 524 ? 18.810  52.912 65.175 1.00 23.44 ? 524  TRP A CD2 1 
ATOM   4094 N NE1 . TRP A 1 524 ? 20.199  54.621 65.599 1.00 24.29 ? 524  TRP A NE1 1 
ATOM   4095 C CE2 . TRP A 1 524 ? 19.264  53.789 66.175 1.00 25.27 ? 524  TRP A CE2 1 
ATOM   4096 C CE3 . TRP A 1 524 ? 17.840  51.951 65.499 1.00 24.03 ? 524  TRP A CE3 1 
ATOM   4097 C CZ2 . TRP A 1 524 ? 18.783  53.736 67.514 1.00 21.76 ? 524  TRP A CZ2 1 
ATOM   4098 C CZ3 . TRP A 1 524 ? 17.361  51.891 66.800 1.00 22.76 ? 524  TRP A CZ3 1 
ATOM   4099 C CH2 . TRP A 1 524 ? 17.839  52.785 67.799 1.00 24.06 ? 524  TRP A CH2 1 
ATOM   4100 N N   . ASN A 1 525 ? 20.359  50.573 60.233 1.00 29.66 ? 525  ASN A N   1 
ATOM   4101 C CA  . ASN A 1 525 ? 19.871  49.958 59.006 1.00 32.87 ? 525  ASN A CA  1 
ATOM   4102 C C   . ASN A 1 525 ? 20.477  48.597 58.723 1.00 33.83 ? 525  ASN A C   1 
ATOM   4103 O O   . ASN A 1 525 ? 19.891  47.813 57.994 1.00 32.99 ? 525  ASN A O   1 
ATOM   4104 C CB  . ASN A 1 525 ? 20.126  50.865 57.804 1.00 32.37 ? 525  ASN A CB  1 
ATOM   4105 C CG  . ASN A 1 525 ? 19.450  52.219 57.954 1.00 34.58 ? 525  ASN A CG  1 
ATOM   4106 O OD1 . ASN A 1 525 ? 18.482  52.343 58.690 1.00 37.14 ? 525  ASN A OD1 1 
ATOM   4107 N ND2 . ASN A 1 525 ? 19.941  53.221 57.260 1.00 32.68 ? 525  ASN A ND2 1 
ATOM   4108 N N   . GLN A 1 526 ? 21.637  48.314 59.290 1.00 32.66 ? 526  GLN A N   1 
ATOM   4109 C CA  . GLN A 1 526 ? 22.229  47.026 59.001 1.00 36.19 ? 526  GLN A CA  1 
ATOM   4110 C C   . GLN A 1 526 ? 22.433  46.131 60.196 1.00 34.75 ? 526  GLN A C   1 
ATOM   4111 O O   . GLN A 1 526 ? 21.974  45.003 60.165 1.00 35.48 ? 526  GLN A O   1 
ATOM   4112 C CB  . GLN A 1 526 ? 23.567  47.175 58.294 1.00 38.23 ? 526  GLN A CB  1 
ATOM   4113 C CG  . GLN A 1 526 ? 23.533  47.919 56.980 1.00 45.59 ? 526  GLN A CG  1 
ATOM   4114 N N   . PHE A 1 527 ? 23.092  46.625 61.256 1.00 32.57 ? 527  PHE A N   1 
ATOM   4115 C CA  . PHE A 1 527 ? 23.361  45.774 62.415 1.00 31.34 ? 527  PHE A CA  1 
ATOM   4116 C C   . PHE A 1 527 ? 22.198  45.445 63.321 1.00 30.77 ? 527  PHE A C   1 
ATOM   4117 O O   . PHE A 1 527 ? 21.929  44.258 63.586 1.00 30.40 ? 527  PHE A O   1 
ATOM   4118 C CB  . PHE A 1 527 ? 24.499  46.344 63.296 1.00 30.95 ? 527  PHE A CB  1 
ATOM   4119 C CG  . PHE A 1 527 ? 24.847  45.439 64.490 1.00 29.56 ? 527  PHE A CG  1 
ATOM   4120 C CD1 . PHE A 1 527 ? 25.576  44.256 64.306 1.00 29.63 ? 527  PHE A CD1 1 
ATOM   4121 C CD2 . PHE A 1 527 ? 24.476  45.787 65.768 1.00 28.85 ? 527  PHE A CD2 1 
ATOM   4122 C CE1 . PHE A 1 527 ? 25.917  43.461 65.377 1.00 28.22 ? 527  PHE A CE1 1 
ATOM   4123 C CE2 . PHE A 1 527 ? 24.821  44.989 66.884 1.00 29.11 ? 527  PHE A CE2 1 
ATOM   4124 C CZ  . PHE A 1 527 ? 25.534  43.837 66.692 1.00 30.09 ? 527  PHE A CZ  1 
ATOM   4125 N N   . LEU A 1 528 ? 21.506  46.469 63.820 1.00 30.72 ? 528  LEU A N   1 
ATOM   4126 C CA  . LEU A 1 528 ? 20.402  46.191 64.732 1.00 31.06 ? 528  LEU A CA  1 
ATOM   4127 C C   . LEU A 1 528 ? 19.361  45.236 64.137 1.00 32.56 ? 528  LEU A C   1 
ATOM   4128 O O   . LEU A 1 528 ? 18.910  44.331 64.836 1.00 32.61 ? 528  LEU A O   1 
ATOM   4129 C CB  . LEU A 1 528 ? 19.714  47.467 65.253 1.00 28.74 ? 528  LEU A CB  1 
ATOM   4130 C CG  . LEU A 1 528 ? 18.545  47.204 66.240 1.00 31.26 ? 528  LEU A CG  1 
ATOM   4131 C CD1 . LEU A 1 528 ? 19.006  46.333 67.466 1.00 29.06 ? 528  LEU A CD1 1 
ATOM   4132 C CD2 . LEU A 1 528 ? 17.993  48.557 66.772 1.00 28.61 ? 528  LEU A CD2 1 
ATOM   4133 N N   . PRO A 1 529 ? 18.937  45.439 62.868 1.00 33.60 ? 529  PRO A N   1 
ATOM   4134 C CA  . PRO A 1 529 ? 17.945  44.503 62.312 1.00 35.50 ? 529  PRO A CA  1 
ATOM   4135 C C   . PRO A 1 529 ? 18.502  43.083 62.220 1.00 37.84 ? 529  PRO A C   1 
ATOM   4136 O O   . PRO A 1 529 ? 17.775  42.114 62.496 1.00 38.30 ? 529  PRO A O   1 
ATOM   4137 C CB  . PRO A 1 529 ? 17.641  45.076 60.921 1.00 34.24 ? 529  PRO A CB  1 
ATOM   4138 C CG  . PRO A 1 529 ? 17.919  46.553 61.089 1.00 33.19 ? 529  PRO A CG  1 
ATOM   4139 C CD  . PRO A 1 529 ? 19.192  46.544 61.925 1.00 33.68 ? 529  PRO A CD  1 
ATOM   4140 N N   . LYS A 1 530 ? 19.773  42.935 61.828 1.00 39.13 ? 530  LYS A N   1 
ATOM   4141 C CA  . LYS A 1 530 ? 20.338  41.588 61.754 1.00 41.25 ? 530  LYS A CA  1 
ATOM   4142 C C   . LYS A 1 530 ? 20.286  40.978 63.153 1.00 42.04 ? 530  LYS A C   1 
ATOM   4143 O O   . LYS A 1 530 ? 19.911  39.806 63.320 1.00 40.91 ? 530  LYS A O   1 
ATOM   4144 C CB  . LYS A 1 530 ? 21.765  41.618 61.232 1.00 44.62 ? 530  LYS A CB  1 
ATOM   4145 C CG  . LYS A 1 530 ? 22.348  40.245 60.991 1.00 48.90 ? 530  LYS A CG  1 
ATOM   4146 C CD  . LYS A 1 530 ? 23.618  40.309 60.105 1.00 52.96 ? 530  LYS A CD  1 
ATOM   4147 C CE  . LYS A 1 530 ? 24.304  38.918 59.978 1.00 54.38 ? 530  LYS A CE  1 
ATOM   4148 N NZ  . LYS A 1 530 ? 25.565  38.943 59.132 1.00 56.12 ? 530  LYS A NZ  1 
ATOM   4149 N N   . LEU A 1 531 ? 20.605  41.791 64.161 1.00 40.74 ? 531  LEU A N   1 
ATOM   4150 C CA  . LEU A 1 531 ? 20.559  41.355 65.546 1.00 40.89 ? 531  LEU A CA  1 
ATOM   4151 C C   . LEU A 1 531 ? 19.185  40.865 65.992 1.00 41.55 ? 531  LEU A C   1 
ATOM   4152 O O   . LEU A 1 531 ? 19.060  39.763 66.525 1.00 40.84 ? 531  LEU A O   1 
ATOM   4153 C CB  . LEU A 1 531 ? 21.012  42.504 66.439 1.00 41.75 ? 531  LEU A CB  1 
ATOM   4154 C CG  . LEU A 1 531 ? 21.092  42.319 67.947 1.00 42.75 ? 531  LEU A CG  1 
ATOM   4155 C CD1 . LEU A 1 531 ? 21.263  40.898 68.234 1.00 46.59 ? 531  LEU A CD1 1 
ATOM   4156 C CD2 . LEU A 1 531 ? 22.294  43.092 68.505 1.00 42.71 ? 531  LEU A CD2 1 
ATOM   4157 N N   . LEU A 1 532 ? 18.157  41.683 65.780 1.00 42.34 ? 532  LEU A N   1 
ATOM   4158 C CA  . LEU A 1 532 ? 16.796  41.314 66.173 1.00 44.69 ? 532  LEU A CA  1 
ATOM   4159 C C   . LEU A 1 532 ? 16.296  40.085 65.404 1.00 46.48 ? 532  LEU A C   1 
ATOM   4160 O O   . LEU A 1 532 ? 15.538  39.308 65.942 1.00 46.63 ? 532  LEU A O   1 
ATOM   4161 C CB  . LEU A 1 532 ? 15.825  42.502 65.995 1.00 42.10 ? 532  LEU A CB  1 
ATOM   4162 C CG  . LEU A 1 532 ? 16.110  43.751 66.835 1.00 40.09 ? 532  LEU A CG  1 
ATOM   4163 C CD1 . LEU A 1 532 ? 15.291  44.916 66.334 1.00 39.45 ? 532  LEU A CD1 1 
ATOM   4164 C CD2 . LEU A 1 532 ? 15.807  43.460 68.272 1.00 39.32 ? 532  LEU A CD2 1 
ATOM   4165 N N   . ASN A 1 533 ? 16.744  39.899 64.165 1.00 50.30 ? 533  ASN A N   1 
ATOM   4166 C CA  . ASN A 1 533 ? 16.340  38.731 63.355 1.00 53.75 ? 533  ASN A CA  1 
ATOM   4167 C C   . ASN A 1 533 ? 17.008  37.410 63.785 1.00 55.53 ? 533  ASN A C   1 
ATOM   4168 O O   . ASN A 1 533 ? 16.390  36.353 63.694 1.00 54.69 ? 533  ASN A O   1 
ATOM   4169 C CB  . ASN A 1 533 ? 16.650  38.935 61.867 1.00 54.98 ? 533  ASN A CB  1 
ATOM   4170 C CG  . ASN A 1 533 ? 15.929  37.917 60.986 1.00 58.47 ? 533  ASN A CG  1 
ATOM   4171 O OD1 . ASN A 1 533 ? 14.690  37.847 61.007 1.00 60.46 ? 533  ASN A OD1 1 
ATOM   4172 N ND2 . ASN A 1 533 ? 16.689  37.114 60.220 1.00 59.12 ? 533  ASN A ND2 1 
ATOM   4173 N N   . ALA A 1 534 ? 18.264  37.473 64.226 1.00 57.18 ? 534  ALA A N   1 
ATOM   4174 C CA  . ALA A 1 534 ? 18.992  36.285 64.636 1.00 59.94 ? 534  ALA A CA  1 
ATOM   4175 C C   . ALA A 1 534 ? 18.454  35.772 65.960 1.00 62.55 ? 534  ALA A C   1 
ATOM   4176 O O   . ALA A 1 534 ? 18.266  34.567 66.141 1.00 63.18 ? 534  ALA A O   1 
ATOM   4177 C CB  . ALA A 1 534 ? 20.460  36.598 64.764 1.00 59.34 ? 534  ALA A CB  1 
ATOM   4178 N N   . THR A 1 535 ? 18.180  36.703 66.872 1.00 64.86 ? 535  THR A N   1 
ATOM   4179 C CA  . THR A 1 535 ? 17.666  36.373 68.198 1.00 66.54 ? 535  THR A CA  1 
ATOM   4180 C C   . THR A 1 535 ? 16.147  36.152 68.204 1.00 67.21 ? 535  THR A C   1 
ATOM   4181 O O   . THR A 1 535 ? 15.409  37.128 68.456 1.00 68.57 ? 535  THR A O   1 
ATOM   4182 C CB  . THR A 1 535 ? 18.073  37.486 69.230 1.00 66.90 ? 535  THR A CB  1 
ATOM   4183 O OG1 . THR A 1 535 ? 17.833  38.785 68.676 1.00 66.62 ? 535  THR A OG1 1 
ATOM   4184 C CG2 . THR A 1 535 ? 19.547  37.390 69.555 1.00 66.83 ? 535  THR A CG2 1 
HETATM 4185 C C1  . E12 B 2 .   ? 4.522   59.602 71.666 1.00 32.64 ? 1536 E12 A C1  1 
HETATM 4186 N N2  . E12 B 2 .   ? 3.700   58.511 71.897 1.00 31.73 ? 1536 E12 A N2  1 
HETATM 4187 O O7  . E12 B 2 .   ? 5.331   59.604 70.717 1.00 28.66 ? 1536 E12 A O7  1 
HETATM 4188 C C4  . E12 B 2 .   ? 2.505   59.421 73.742 1.00 32.40 ? 1536 E12 A C4  1 
HETATM 4189 C C5  . E12 B 2 .   ? 3.345   60.645 73.597 1.00 31.68 ? 1536 E12 A C5  1 
HETATM 4190 C C14 . E12 B 2 .   ? 0.633   57.193 73.609 1.00 32.27 ? 1536 E12 A C14 1 
HETATM 4191 N N17 . E12 B 2 .   ? 0.428   60.376 74.765 1.00 33.64 ? 1536 E12 A N17 1 
HETATM 4192 C C24 . E12 B 2 .   ? -0.413  60.535 73.489 1.00 34.65 ? 1536 E12 A C24 1 
HETATM 4193 C C6  . E12 B 2 .   ? 4.304   60.758 72.616 1.00 30.97 ? 1536 E12 A C6  1 
HETATM 4194 C C9  . E12 B 2 .   ? 2.005   57.036 72.928 1.00 32.97 ? 1536 E12 A C9  1 
HETATM 4195 C C10 . E12 B 2 .   ? 1.477   59.297 74.887 1.00 31.61 ? 1536 E12 A C10 1 
HETATM 4196 C C13 . E12 B 2 .   ? 0.784   57.911 74.989 1.00 32.77 ? 1536 E12 A C13 1 
HETATM 4197 C C63 . E12 B 2 .   ? -0.701  62.045 73.395 1.00 38.21 ? 1536 E12 A C63 1 
HETATM 4198 C C29 . E12 B 2 .   ? 1.083   68.622 60.981 1.00 31.32 ? 1536 E12 A C29 1 
HETATM 4199 C C3  . E12 B 2 .   ? 2.751   58.375 72.871 1.00 32.58 ? 1536 E12 A C3  1 
HETATM 4200 N N30 . E12 B 2 .   ? 2.473   68.594 61.022 1.00 31.50 ? 1536 E12 A N30 1 
HETATM 4201 C C31 . E12 B 2 .   ? 3.258   68.560 62.137 1.00 32.34 ? 1536 E12 A C31 1 
HETATM 4202 C C32 . E12 B 2 .   ? 2.651   68.527 63.392 1.00 32.04 ? 1536 E12 A C32 1 
HETATM 4203 C C33 . E12 B 2 .   ? 1.168   68.531 63.456 1.00 30.03 ? 1536 E12 A C33 1 
HETATM 4204 C C34 . E12 B 2 .   ? 0.399   68.567 62.332 1.00 29.02 ? 1536 E12 A C34 1 
HETATM 4205 O O35 . E12 B 2 .   ? 0.494   68.772 59.902 1.00 30.19 ? 1536 E12 A O35 1 
HETATM 4206 C C36 . E12 B 2 .   ? 4.787   68.554 61.926 1.00 30.84 ? 1536 E12 A C36 1 
HETATM 4207 C C37 . E12 B 2 .   ? 3.508   68.530 64.655 1.00 34.98 ? 1536 E12 A C37 1 
HETATM 4208 C C38 . E12 B 2 .   ? 5.007   68.250 64.418 1.00 34.23 ? 1536 E12 A C38 1 
HETATM 4209 C C39 . E12 B 2 .   ? 5.520   69.022 63.197 1.00 32.77 ? 1536 E12 A C39 1 
HETATM 4210 N N40 . E12 B 2 .   ? 3.038   67.597 65.754 1.00 39.70 ? 1536 E12 A N40 1 
HETATM 4211 C C41 . E12 B 2 .   ? 3.190   66.131 65.576 1.00 42.95 ? 1536 E12 A C41 1 
HETATM 4212 C C64 . E12 B 2 .   ? -0.465  62.556 71.994 1.00 39.83 ? 1536 E12 A C64 1 
HETATM 4213 C C65 . E12 B 2 .   ? 1.026   62.586 71.689 1.00 39.33 ? 1536 E12 A C65 1 
HETATM 4214 C C66 . E12 B 2 .   ? 1.297   62.498 70.208 1.00 40.48 ? 1536 E12 A C66 1 
HETATM 4215 C C67 . E12 B 2 .   ? 2.781   62.582 69.929 1.00 40.99 ? 1536 E12 A C67 1 
HETATM 4216 C C68 . E12 B 2 .   ? 3.345   63.972 70.136 1.00 44.19 ? 1536 E12 A C68 1 
HETATM 4217 C C69 . E12 B 2 .   ? 4.602   64.242 69.326 1.00 44.19 ? 1536 E12 A C69 1 
HETATM 4218 C C70 . E12 B 2 .   ? 4.808   65.734 69.131 1.00 43.68 ? 1536 E12 A C70 1 
HETATM 4219 C C71 . E12 B 2 .   ? 3.955   66.334 68.017 1.00 44.17 ? 1536 E12 A C71 1 
HETATM 4220 C C72 . E12 B 2 .   ? 4.182   65.665 66.648 1.00 43.66 ? 1536 E12 A C72 1 
HETATM 4221 C C1  . NAG C 3 .   ? -19.252 83.642 50.069 1.00 60.39 ? 1537 NAG A C1  1 
HETATM 4222 C C2  . NAG C 3 .   ? -19.947 85.007 49.843 1.00 62.92 ? 1537 NAG A C2  1 
HETATM 4223 C C3  . NAG C 3 .   ? -19.201 86.173 50.478 1.00 65.18 ? 1537 NAG A C3  1 
HETATM 4224 C C4  . NAG C 3 .   ? -19.064 85.880 51.955 1.00 65.32 ? 1537 NAG A C4  1 
HETATM 4225 C C5  . NAG C 3 .   ? -18.156 84.646 52.115 1.00 64.21 ? 1537 NAG A C5  1 
HETATM 4226 C C6  . NAG C 3 .   ? -17.948 84.307 53.620 1.00 63.30 ? 1537 NAG A C6  1 
HETATM 4227 C C7  . NAG C 3 .   ? -21.083 84.721 47.750 1.00 63.89 ? 1537 NAG A C7  1 
HETATM 4228 C C8  . NAG C 3 .   ? -21.567 85.485 46.529 1.00 63.17 ? 1537 NAG A C8  1 
HETATM 4229 N N2  . NAG C 3 .   ? -20.076 85.262 48.424 1.00 62.80 ? 1537 NAG A N2  1 
HETATM 4230 O O3  . NAG C 3 .   ? -19.936 87.388 50.282 1.00 66.29 ? 1537 NAG A O3  1 
HETATM 4231 O O4  . NAG C 3 .   ? -18.510 87.021 52.629 1.00 67.15 ? 1537 NAG A O4  1 
HETATM 4232 O O5  . NAG C 3 .   ? -18.692 83.452 51.420 1.00 61.73 ? 1537 NAG A O5  1 
HETATM 4233 O O6  . NAG C 3 .   ? -18.914 83.396 54.162 1.00 64.12 ? 1537 NAG A O6  1 
HETATM 4234 O O7  . NAG C 3 .   ? -21.622 83.647 48.075 1.00 64.22 ? 1537 NAG A O7  1 
HETATM 4235 C C1  . NAG D 3 .   ? 18.586  62.155 33.892 1.00 46.25 ? 1538 NAG A C1  1 
HETATM 4236 C C2  . NAG D 3 .   ? 20.115  61.996 33.952 1.00 47.84 ? 1538 NAG A C2  1 
HETATM 4237 C C3  . NAG D 3 .   ? 20.794  62.523 32.679 1.00 49.30 ? 1538 NAG A C3  1 
HETATM 4238 C C4  . NAG D 3 .   ? 20.144  61.887 31.413 1.00 50.51 ? 1538 NAG A C4  1 
HETATM 4239 C C5  . NAG D 3 .   ? 18.597  62.068 31.453 1.00 51.11 ? 1538 NAG A C5  1 
HETATM 4240 C C6  . NAG D 3 .   ? 17.858  61.380 30.271 1.00 51.38 ? 1538 NAG A C6  1 
HETATM 4241 C C7  . NAG D 3 .   ? 20.960  61.974 36.228 1.00 46.67 ? 1538 NAG A C7  1 
HETATM 4242 C C8  . NAG D 3 .   ? 21.525  62.750 37.393 1.00 45.48 ? 1538 NAG A C8  1 
HETATM 4243 N N2  . NAG D 3 .   ? 20.670  62.671 35.126 1.00 47.50 ? 1538 NAG A N2  1 
HETATM 4244 O O3  . NAG D 3 .   ? 22.185  62.198 32.760 1.00 47.89 ? 1538 NAG A O3  1 
HETATM 4245 O O4  . NAG D 3 .   ? 20.700  62.459 30.210 1.00 52.32 ? 1538 NAG A O4  1 
HETATM 4246 O O5  . NAG D 3 .   ? 18.054  61.526 32.702 1.00 47.58 ? 1538 NAG A O5  1 
HETATM 4247 O O6  . NAG D 3 .   ? 17.086  60.232 30.657 1.00 54.30 ? 1538 NAG A O6  1 
HETATM 4248 O O7  . NAG D 3 .   ? 20.769  60.743 36.330 1.00 46.95 ? 1538 NAG A O7  1 
HETATM 4249 O O   . HOH E 4 .   ? -6.602  83.869 39.107 1.00 39.48 ? 2001 HOH A O   1 
HETATM 4250 O O   . HOH E 4 .   ? -7.845  69.434 30.438 1.00 37.11 ? 2002 HOH A O   1 
HETATM 4251 O O   . HOH E 4 .   ? -15.968 65.749 36.615 1.00 48.65 ? 2003 HOH A O   1 
HETATM 4252 O O   . HOH E 4 .   ? -5.117  95.203 45.897 1.00 48.68 ? 2004 HOH A O   1 
HETATM 4253 O O   . HOH E 4 .   ? -4.525  85.512 39.928 1.00 33.56 ? 2005 HOH A O   1 
HETATM 4254 O O   . HOH E 4 .   ? -2.121  63.208 77.259 1.00 33.35 ? 2006 HOH A O   1 
HETATM 4255 O O   . HOH E 4 .   ? -15.627 74.813 51.323 1.00 49.56 ? 2007 HOH A O   1 
HETATM 4256 O O   . HOH E 4 .   ? -12.700 64.937 42.156 1.00 37.64 ? 2008 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? -15.464 67.617 49.730 1.00 25.67 ? 2009 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? -15.908 60.488 49.314 1.00 31.67 ? 2010 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? -24.798 57.318 54.878 1.00 39.17 ? 2011 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -10.200 52.116 55.180 1.00 33.27 ? 2012 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? -13.645 57.810 56.800 1.00 30.58 ? 2013 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? -5.451  51.015 46.397 1.00 42.22 ? 2014 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? -12.159 49.198 48.034 1.00 49.92 ? 2015 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? -10.177 56.145 45.148 1.00 43.51 ? 2016 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? -18.238 68.657 49.462 1.00 33.67 ? 2017 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? -22.154 68.448 43.731 1.00 49.43 ? 2018 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? -20.568 75.465 37.927 1.00 41.08 ? 2019 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? -2.895  79.928 56.642 1.00 43.01 ? 2020 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? -10.488 81.610 55.975 1.00 41.82 ? 2021 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -15.689 72.928 54.663 1.00 35.09 ? 2022 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? -9.838  70.257 55.043 1.00 28.42 ? 2023 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? -8.350  59.396 42.542 1.00 36.49 ? 2024 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? -12.334 63.235 59.637 1.00 31.65 ? 2025 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? -14.584 65.584 67.437 1.00 42.93 ? 2026 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? -9.762  62.325 60.070 1.00 27.92 ? 2027 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? -8.836  61.113 63.928 1.00 28.56 ? 2028 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? -3.834  62.509 75.150 1.00 35.17 ? 2029 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? -3.381  66.769 74.743 1.00 34.82 ? 2030 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? -8.828  65.290 71.138 1.00 35.69 ? 2031 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? -2.232  72.037 29.911 1.00 30.91 ? 2032 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? 0.316   66.115 71.227 1.00 41.69 ? 2033 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? -0.748  66.059 73.513 1.00 32.40 ? 2034 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? -3.693  68.500 79.040 1.00 33.86 ? 2035 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? -8.236  67.253 72.886 1.00 32.38 ? 2036 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? 1.819   70.558 80.806 1.00 40.84 ? 2037 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -0.139  64.881 76.087 1.00 42.38 ? 2038 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -1.075  64.661 79.445 1.00 53.48 ? 2039 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? -2.295  66.737 77.224 1.00 43.63 ? 2040 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? -1.353  72.125 73.739 1.00 41.86 ? 2041 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? 2.656   81.314 73.641 1.00 40.95 ? 2042 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 5.224   79.429 67.797 1.00 48.52 ? 2043 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? 0.793   70.314 68.952 1.00 31.44 ? 2044 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? 0.370   77.364 62.488 1.00 28.43 ? 2045 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? -1.545  68.453 65.381 1.00 34.31 ? 2046 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? -3.476  76.032 64.800 1.00 36.10 ? 2047 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? -3.711  68.329 66.666 1.00 40.56 ? 2048 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? -5.732  76.919 66.955 1.00 43.54 ? 2049 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? -7.882  72.880 68.099 1.00 45.58 ? 2050 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? 4.710   47.645 63.160 1.00 37.57 ? 2051 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? -14.178 71.617 65.945 1.00 38.03 ? 2052 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? -19.441 63.283 61.566 1.00 39.81 ? 2053 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -18.143 65.519 61.759 1.00 39.89 ? 2054 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -20.282 59.670 59.623 1.00 34.79 ? 2055 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? -14.968 60.009 57.597 1.00 26.32 ? 2056 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? -13.759 62.434 57.305 1.00 34.70 ? 2057 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? -15.562 66.572 52.193 1.00 28.81 ? 2058 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? -20.398 69.300 51.561 1.00 45.37 ? 2059 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? -5.061  87.991 35.670 1.00 43.05 ? 2060 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -11.005 82.647 33.608 1.00 48.19 ? 2061 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? 3.020   81.449 32.809 1.00 47.88 ? 2062 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? 0.587   74.482 29.911 1.00 41.43 ? 2063 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? 7.315   78.206 36.240 1.00 45.70 ? 2064 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? 4.029   43.648 55.736 1.00 43.11 ? 2065 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 5.792   44.252 54.045 1.00 34.06 ? 2066 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? 10.414  49.021 54.850 1.00 43.32 ? 2067 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? 4.337   62.826 64.191 1.00 44.60 ? 2068 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? -0.798  63.106 59.245 1.00 23.19 ? 2069 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? 1.400   65.230 65.153 1.00 41.74 ? 2070 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? -0.304  65.872 68.403 1.00 30.04 ? 2071 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? -7.434  68.245 58.146 1.00 29.55 ? 2072 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -4.046  70.049 62.567 1.00 23.73 ? 2073 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -8.374  71.387 53.117 1.00 34.17 ? 2074 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? -7.604  70.565 56.734 1.00 30.82 ? 2075 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? -2.024  75.526 53.206 1.00 30.27 ? 2076 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? -2.533  78.070 62.880 1.00 33.29 ? 2077 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? -4.768  80.255 63.223 1.00 45.07 ? 2078 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 0.025   83.100 58.327 1.00 47.69 ? 2079 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 3.777   80.621 51.872 1.00 30.45 ? 2080 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 11.401  51.004 81.568 1.00 40.31 ? 2081 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? -3.462  85.754 54.546 1.00 41.36 ? 2082 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 25.980  45.650 77.551 1.00 40.21 ? 2083 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 9.046   88.339 48.636 1.00 39.84 ? 2084 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? 13.334  84.578 44.068 1.00 43.98 ? 2085 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? 12.717  83.472 47.737 1.00 32.34 ? 2086 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? 10.742  80.372 41.066 1.00 44.66 ? 2087 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? -1.766  69.657 53.174 1.00 27.81 ? 2088 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? -4.495  52.006 56.493 1.00 24.44 ? 2089 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -6.688  49.465 61.521 1.00 33.40 ? 2090 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -6.055  45.035 57.752 1.00 37.87 ? 2091 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? -6.747  46.199 52.040 1.00 43.44 ? 2092 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? -9.283  45.112 51.607 1.00 42.34 ? 2093 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? -14.149 51.288 49.925 1.00 41.99 ? 2094 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? 14.447  75.637 80.197 1.00 45.57 ? 2095 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -7.175  50.572 49.844 1.00 40.88 ? 2096 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? -8.157  57.934 44.796 1.00 32.30 ? 2097 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? 19.570  83.658 65.567 1.00 43.25 ? 2098 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? -7.015  55.524 43.395 1.00 46.44 ? 2099 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? -3.762  51.695 44.403 1.00 37.62 ? 2100 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? -5.284  57.950 37.381 1.00 32.29 ? 2101 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? -4.649  70.687 34.294 1.00 31.25 ? 2102 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? -4.626  67.245 32.475 1.00 38.90 ? 2103 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? -6.981  65.770 32.389 1.00 33.29 ? 2104 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? -10.237 65.219 38.606 1.00 31.72 ? 2105 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? -12.161 67.119 37.549 1.00 31.99 ? 2106 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? -3.296  77.546 31.556 1.00 41.21 ? 2107 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? -3.762  69.750 29.914 1.00 36.92 ? 2108 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? 25.240  66.320 60.001 1.00 42.07 ? 2109 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 3.479   67.034 36.821 1.00 27.19 ? 2110 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? -0.225  66.501 36.760 1.00 29.05 ? 2111 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 0.169   71.540 29.141 1.00 38.52 ? 2112 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 4.502   64.704 63.215 1.00 35.25 ? 2113 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 5.106   61.607 61.529 1.00 33.89 ? 2114 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? -4.784  55.727 39.177 1.00 42.68 ? 2115 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? -1.267  51.206 42.634 1.00 44.36 ? 2116 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? -0.480  58.514 32.803 1.00 35.19 ? 2117 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 1.656   63.983 35.536 1.00 38.33 ? 2118 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? -0.608  57.420 38.240 1.00 41.49 ? 2119 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 2.608   54.421 36.684 1.00 33.00 ? 2120 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? -1.012  66.333 40.611 1.00 38.15 ? 2121 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 4.367   64.803 35.452 1.00 31.15 ? 2122 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? 12.921  65.542 34.021 1.00 58.46 ? 2123 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 9.053   62.283 35.882 1.00 43.33 ? 2124 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 11.206  64.309 35.861 1.00 38.74 ? 2125 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? 11.073  70.399 34.214 1.00 40.90 ? 2126 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? 10.731  68.485 59.927 1.00 26.16 ? 2127 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 13.985  51.046 56.223 1.00 34.86 ? 2128 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? 7.061   52.245 56.699 1.00 30.96 ? 2129 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? 2.877   54.052 63.672 1.00 23.07 ? 2130 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 4.638   50.290 62.362 1.00 28.40 ? 2131 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? 6.178   48.248 56.024 1.00 27.74 ? 2132 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 3.369   45.825 61.368 1.00 32.77 ? 2133 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? -4.581  40.229 63.021 1.00 41.17 ? 2134 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 0.118   40.522 57.479 1.00 42.42 ? 2135 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 3.364   44.444 66.057 1.00 45.41 ? 2136 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -3.305  46.672 72.454 1.00 42.64 ? 2137 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 3.293   51.412 64.447 1.00 30.91 ? 2138 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? 4.414   49.764 66.992 1.00 36.13 ? 2139 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 3.305   47.371 65.553 1.00 31.26 ? 2140 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? -6.983  48.599 74.140 1.00 42.75 ? 2141 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? -21.975 46.553 67.564 1.00 43.99 ? 2142 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? -13.444 40.601 62.939 1.00 54.83 ? 2143 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? -20.321 57.058 60.054 1.00 34.10 ? 2144 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? -10.577 65.738 69.055 1.00 29.17 ? 2145 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? -15.225 56.919 73.161 1.00 36.21 ? 2146 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? -7.278  60.710 72.423 1.00 35.01 ? 2147 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? -15.618 59.349 73.942 1.00 45.17 ? 2148 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? -9.075  62.689 72.882 1.00 35.98 ? 2149 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? -8.857  58.445 64.937 1.00 26.50 ? 2150 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? -6.683  61.598 65.502 1.00 22.91 ? 2151 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? -2.211  57.484 67.061 1.00 28.29 ? 2152 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? -1.118  53.444 74.517 1.00 34.86 ? 2153 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? 1.770   53.231 73.862 1.00 38.50 ? 2154 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? 4.590   55.479 78.611 1.00 28.73 ? 2155 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? 3.611   54.781 75.595 1.00 40.10 ? 2156 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? 5.299   53.285 81.105 1.00 41.44 ? 2157 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? 3.392   50.642 69.588 1.00 21.82 ? 2158 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 10.478  55.367 68.776 1.00 26.21 ? 2159 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 3.885   56.068 70.380 1.00 28.51 ? 2160 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? 7.185   49.196 66.404 1.00 33.26 ? 2161 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? -3.891  50.070 62.268 1.00 33.76 ? 2162 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? -1.761  57.717 62.716 1.00 24.55 ? 2163 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? -3.960  57.074 64.143 1.00 25.96 ? 2164 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? -3.784  50.953 59.941 1.00 26.50 ? 2165 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? 1.132   43.302 55.063 1.00 41.66 ? 2166 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? 7.222   41.427 49.464 1.00 47.21 ? 2167 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? 6.979   46.721 53.898 1.00 30.05 ? 2168 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? 9.485   46.621 53.622 1.00 33.08 ? 2169 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? 13.053  49.584 53.966 1.00 44.19 ? 2170 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? 4.398   46.648 40.566 1.00 42.88 ? 2171 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? 6.291   62.577 35.349 1.00 32.47 ? 2172 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? 5.997   58.217 35.938 1.00 40.42 ? 2173 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? 9.570   56.343 36.217 1.00 31.96 ? 2174 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 13.453  68.763 57.380 1.00 32.02 ? 2175 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 20.167  73.975 68.957 1.00 42.25 ? 2176 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 21.320  65.002 64.258 1.00 42.32 ? 2177 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 19.054  65.296 68.918 1.00 41.37 ? 2178 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? 11.815  67.218 67.554 1.00 24.77 ? 2179 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? 17.387  64.512 64.292 1.00 46.64 ? 2180 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 7.258   63.365 79.070 1.00 29.96 ? 2181 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? 4.633   57.508 76.259 1.00 29.39 ? 2182 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 13.027  58.833 79.354 1.00 38.71 ? 2183 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? 6.743   65.090 82.161 1.00 42.70 ? 2184 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 11.764  66.954 83.708 1.00 40.33 ? 2185 HOH A O   1 
HETATM 4434 O O   . HOH E 4 .   ? 8.447   76.659 76.485 1.00 29.95 ? 2186 HOH A O   1 
HETATM 4435 O O   . HOH E 4 .   ? 10.504  76.348 78.400 1.00 38.00 ? 2187 HOH A O   1 
HETATM 4436 O O   . HOH E 4 .   ? 4.314   77.934 78.884 1.00 43.04 ? 2188 HOH A O   1 
HETATM 4437 O O   . HOH E 4 .   ? 4.997   77.444 81.581 1.00 38.05 ? 2189 HOH A O   1 
HETATM 4438 O O   . HOH E 4 .   ? 21.081  72.195 79.151 1.00 45.08 ? 2190 HOH A O   1 
HETATM 4439 O O   . HOH E 4 .   ? 14.826  64.795 84.295 1.00 33.07 ? 2191 HOH A O   1 
HETATM 4440 O O   . HOH E 4 .   ? 15.843  62.066 84.807 1.00 37.09 ? 2192 HOH A O   1 
HETATM 4441 O O   . HOH E 4 .   ? 10.011  52.476 79.460 1.00 36.05 ? 2193 HOH A O   1 
HETATM 4442 O O   . HOH E 4 .   ? 8.607   49.339 75.150 1.00 40.83 ? 2194 HOH A O   1 
HETATM 4443 O O   . HOH E 4 .   ? 8.328   50.589 78.709 1.00 48.99 ? 2195 HOH A O   1 
HETATM 4444 O O   . HOH E 4 .   ? 14.577  48.349 63.916 1.00 45.85 ? 2196 HOH A O   1 
HETATM 4445 O O   . HOH E 4 .   ? 14.059  39.873 75.752 1.00 52.24 ? 2197 HOH A O   1 
HETATM 4446 O O   . HOH E 4 .   ? 17.595  39.245 74.310 1.00 45.49 ? 2198 HOH A O   1 
HETATM 4447 O O   . HOH E 4 .   ? 24.689  48.050 77.276 1.00 41.83 ? 2199 HOH A O   1 
HETATM 4448 O O   . HOH E 4 .   ? 29.308  60.926 84.536 1.00 40.60 ? 2200 HOH A O   1 
HETATM 4449 O O   . HOH E 4 .   ? 30.060  58.074 85.492 1.00 43.17 ? 2201 HOH A O   1 
HETATM 4450 O O   . HOH E 4 .   ? 22.227  59.251 86.513 1.00 45.91 ? 2202 HOH A O   1 
HETATM 4451 O O   . HOH E 4 .   ? 22.464  71.765 76.710 1.00 42.47 ? 2203 HOH A O   1 
HETATM 4452 O O   . HOH E 4 .   ? 23.607  70.063 74.045 1.00 43.26 ? 2204 HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 25.470  66.169 74.735 1.00 35.51 ? 2205 HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 16.987  63.783 67.391 1.00 31.24 ? 2206 HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 18.342  67.217 73.257 1.00 31.80 ? 2207 HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? 19.874  62.791 65.456 1.00 36.31 ? 2208 HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? 15.562  52.929 61.872 1.00 35.84 ? 2209 HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? 12.459  59.505 57.235 1.00 42.09 ? 2210 HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? 21.390  52.194 54.008 1.00 33.15 ? 2211 HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 17.685  50.570 44.881 1.00 29.51 ? 2212 HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 20.566  59.270 41.085 1.00 39.31 ? 2213 HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 16.415  57.680 36.166 1.00 40.54 ? 2214 HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? 18.971  65.734 37.134 1.00 41.61 ? 2215 HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? 18.723  58.903 35.427 1.00 47.73 ? 2216 HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? 18.163  60.007 42.043 1.00 28.54 ? 2217 HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 19.215  67.682 38.655 1.00 42.38 ? 2218 HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? 23.562  70.165 40.343 1.00 40.98 ? 2219 HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? 24.772  70.368 63.708 1.00 41.27 ? 2220 HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 22.540  78.920 61.903 1.00 40.22 ? 2221 HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? 14.350  76.246 64.220 1.00 35.04 ? 2222 HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? 21.468  77.668 65.126 1.00 38.99 ? 2223 HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? 16.185  79.910 70.144 1.00 36.17 ? 2224 HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? 8.249   79.143 67.974 1.00 40.28 ? 2225 HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? 12.845  79.464 75.450 1.00 59.55 ? 2226 HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? 15.138  77.383 77.223 1.00 39.40 ? 2227 HOH A O   1 
HETATM 4476 O O   . HOH E 4 .   ? 19.036  75.014 71.347 1.00 42.23 ? 2228 HOH A O   1 
HETATM 4477 O O   . HOH E 4 .   ? 16.567  73.867 77.791 1.00 31.70 ? 2229 HOH A O   1 
HETATM 4478 O O   . HOH E 4 .   ? 19.185  73.812 77.829 1.00 43.63 ? 2230 HOH A O   1 
HETATM 4479 O O   . HOH E 4 .   ? 13.812  74.432 66.420 1.00 38.95 ? 2231 HOH A O   1 
HETATM 4480 O O   . HOH E 4 .   ? 12.433  77.330 63.144 1.00 34.04 ? 2232 HOH A O   1 
HETATM 4481 O O   . HOH E 4 .   ? 7.776   75.736 61.137 1.00 28.21 ? 2233 HOH A O   1 
HETATM 4482 O O   . HOH E 4 .   ? 9.909   80.074 65.456 1.00 38.12 ? 2234 HOH A O   1 
HETATM 4483 O O   . HOH E 4 .   ? 6.682   79.189 64.657 1.00 50.88 ? 2235 HOH A O   1 
HETATM 4484 O O   . HOH E 4 .   ? 10.304  88.573 60.807 1.00 40.12 ? 2236 HOH A O   1 
HETATM 4485 O O   . HOH E 4 .   ? 19.537  84.537 63.125 1.00 39.52 ? 2237 HOH A O   1 
HETATM 4486 O O   . HOH E 4 .   ? 20.906  84.059 56.283 1.00 41.76 ? 2238 HOH A O   1 
HETATM 4487 O O   . HOH E 4 .   ? 18.948  85.164 50.642 1.00 47.38 ? 2239 HOH A O   1 
HETATM 4488 O O   . HOH E 4 .   ? 13.284  86.261 47.616 1.00 41.75 ? 2240 HOH A O   1 
HETATM 4489 O O   . HOH E 4 .   ? 18.084  79.670 46.684 1.00 35.17 ? 2241 HOH A O   1 
HETATM 4490 O O   . HOH E 4 .   ? 17.798  84.296 48.198 1.00 39.89 ? 2242 HOH A O   1 
HETATM 4491 O O   . HOH E 4 .   ? 7.302   70.639 39.598 1.00 33.23 ? 2243 HOH A O   1 
HETATM 4492 O O   . HOH E 4 .   ? 24.115  72.974 39.248 1.00 41.66 ? 2244 HOH A O   1 
HETATM 4493 O O   . HOH E 4 .   ? 18.378  78.724 44.171 1.00 40.47 ? 2245 HOH A O   1 
HETATM 4494 O O   . HOH E 4 .   ? 17.801  74.970 37.765 1.00 36.95 ? 2246 HOH A O   1 
HETATM 4495 O O   . HOH E 4 .   ? 22.853  77.527 44.164 1.00 41.49 ? 2247 HOH A O   1 
HETATM 4496 O O   . HOH E 4 .   ? 21.169  79.338 42.719 1.00 44.47 ? 2248 HOH A O   1 
HETATM 4497 O O   . HOH E 4 .   ? 23.111  66.879 47.902 1.00 28.71 ? 2249 HOH A O   1 
HETATM 4498 O O   . HOH E 4 .   ? 27.524  63.368 45.980 1.00 31.40 ? 2250 HOH A O   1 
HETATM 4499 O O   . HOH E 4 .   ? 21.766  61.708 41.929 1.00 35.99 ? 2251 HOH A O   1 
HETATM 4500 O O   . HOH E 4 .   ? 24.965  58.603 52.590 1.00 35.42 ? 2252 HOH A O   1 
HETATM 4501 O O   . HOH E 4 .   ? 31.162  69.825 46.250 1.00 48.26 ? 2253 HOH A O   1 
HETATM 4502 O O   . HOH E 4 .   ? 34.784  64.982 45.857 1.00 44.77 ? 2254 HOH A O   1 
HETATM 4503 O O   . HOH E 4 .   ? 27.207  74.806 58.206 1.00 38.20 ? 2255 HOH A O   1 
HETATM 4504 O O   . HOH E 4 .   ? 26.683  68.499 59.220 1.00 40.44 ? 2256 HOH A O   1 
HETATM 4505 O O   . HOH E 4 .   ? 23.207  77.132 54.535 1.00 46.52 ? 2257 HOH A O   1 
HETATM 4506 O O   . HOH E 4 .   ? 24.937  61.358 52.821 1.00 26.09 ? 2258 HOH A O   1 
HETATM 4507 O O   . HOH E 4 .   ? 25.003  58.170 55.453 1.00 41.19 ? 2259 HOH A O   1 
HETATM 4508 O O   . HOH E 4 .   ? 26.953  63.363 59.465 1.00 36.33 ? 2260 HOH A O   1 
HETATM 4509 O O   . HOH E 4 .   ? 28.841  59.301 61.234 1.00 33.97 ? 2261 HOH A O   1 
HETATM 4510 O O   . HOH E 4 .   ? 26.598  58.986 62.941 1.00 32.12 ? 2262 HOH A O   1 
HETATM 4511 O O   . HOH E 4 .   ? 16.085  50.296 62.807 1.00 40.75 ? 2263 HOH A O   1 
HETATM 4512 O O   . HOH E 4 .   ? 15.932  52.736 59.141 1.00 39.42 ? 2264 HOH A O   1 
HETATM 4513 O O   . HOH E 4 .   ? 22.488  54.281 55.078 1.00 51.83 ? 2265 HOH A O   1 
HETATM 4514 O O   . HOH E 4 .   ? 3.665   68.453 58.554 1.00 27.98 ? 2266 HOH A O   1 
HETATM 4515 O O   . HOH E 4 .   ? 0.486   68.151 67.145 1.00 27.57 ? 2267 HOH A O   1 
HETATM 4516 O O   . HOH E 4 .   ? -1.203  60.603 76.727 1.00 37.48 ? 2268 HOH A O   1 
HETATM 4517 O O   . HOH E 4 .   ? 1.472   62.902 75.795 1.00 42.87 ? 2269 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 1537 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 E12 1   1536 1536 E12 E12 A . 
C 3 NAG 1   1537 1537 NAG NAG A . 
D 3 NAG 1   1538 1538 NAG NAG A . 
E 4 HOH 1   2001 2001 HOH HOH A . 
E 4 HOH 2   2002 2002 HOH HOH A . 
E 4 HOH 3   2003 2003 HOH HOH A . 
E 4 HOH 4   2004 2004 HOH HOH A . 
E 4 HOH 5   2005 2005 HOH HOH A . 
E 4 HOH 6   2006 2006 HOH HOH A . 
E 4 HOH 7   2007 2007 HOH HOH A . 
E 4 HOH 8   2008 2008 HOH HOH A . 
E 4 HOH 9   2009 2009 HOH HOH A . 
E 4 HOH 10  2010 2010 HOH HOH A . 
E 4 HOH 11  2011 2011 HOH HOH A . 
E 4 HOH 12  2012 2012 HOH HOH A . 
E 4 HOH 13  2013 2013 HOH HOH A . 
E 4 HOH 14  2014 2014 HOH HOH A . 
E 4 HOH 15  2015 2015 HOH HOH A . 
E 4 HOH 16  2016 2016 HOH HOH A . 
E 4 HOH 17  2017 2017 HOH HOH A . 
E 4 HOH 18  2018 2018 HOH HOH A . 
E 4 HOH 19  2019 2019 HOH HOH A . 
E 4 HOH 20  2020 2020 HOH HOH A . 
E 4 HOH 21  2021 2021 HOH HOH A . 
E 4 HOH 22  2022 2022 HOH HOH A . 
E 4 HOH 23  2023 2023 HOH HOH A . 
E 4 HOH 24  2024 2024 HOH HOH A . 
E 4 HOH 25  2025 2025 HOH HOH A . 
E 4 HOH 26  2026 2026 HOH HOH A . 
E 4 HOH 27  2027 2027 HOH HOH A . 
E 4 HOH 28  2028 2028 HOH HOH A . 
E 4 HOH 29  2029 2029 HOH HOH A . 
E 4 HOH 30  2030 2030 HOH HOH A . 
E 4 HOH 31  2031 2031 HOH HOH A . 
E 4 HOH 32  2032 2032 HOH HOH A . 
E 4 HOH 33  2033 2033 HOH HOH A . 
E 4 HOH 34  2034 2034 HOH HOH A . 
E 4 HOH 35  2035 2035 HOH HOH A . 
E 4 HOH 36  2036 2036 HOH HOH A . 
E 4 HOH 37  2037 2037 HOH HOH A . 
E 4 HOH 38  2038 2038 HOH HOH A . 
E 4 HOH 39  2039 2039 HOH HOH A . 
E 4 HOH 40  2040 2040 HOH HOH A . 
E 4 HOH 41  2041 2041 HOH HOH A . 
E 4 HOH 42  2042 2042 HOH HOH A . 
E 4 HOH 43  2043 2043 HOH HOH A . 
E 4 HOH 44  2044 2044 HOH HOH A . 
E 4 HOH 45  2045 2045 HOH HOH A . 
E 4 HOH 46  2046 2046 HOH HOH A . 
E 4 HOH 47  2047 2047 HOH HOH A . 
E 4 HOH 48  2048 2048 HOH HOH A . 
E 4 HOH 49  2049 2049 HOH HOH A . 
E 4 HOH 50  2050 2050 HOH HOH A . 
E 4 HOH 51  2051 2051 HOH HOH A . 
E 4 HOH 52  2052 2052 HOH HOH A . 
E 4 HOH 53  2053 2053 HOH HOH A . 
E 4 HOH 54  2054 2054 HOH HOH A . 
E 4 HOH 55  2055 2055 HOH HOH A . 
E 4 HOH 56  2056 2056 HOH HOH A . 
E 4 HOH 57  2057 2057 HOH HOH A . 
E 4 HOH 58  2058 2058 HOH HOH A . 
E 4 HOH 59  2059 2059 HOH HOH A . 
E 4 HOH 60  2060 2060 HOH HOH A . 
E 4 HOH 61  2061 2061 HOH HOH A . 
E 4 HOH 62  2062 2062 HOH HOH A . 
E 4 HOH 63  2063 2063 HOH HOH A . 
E 4 HOH 64  2064 2064 HOH HOH A . 
E 4 HOH 65  2065 2065 HOH HOH A . 
E 4 HOH 66  2066 2066 HOH HOH A . 
E 4 HOH 67  2067 2067 HOH HOH A . 
E 4 HOH 68  2068 2068 HOH HOH A . 
E 4 HOH 69  2069 2069 HOH HOH A . 
E 4 HOH 70  2070 2070 HOH HOH A . 
E 4 HOH 71  2071 2071 HOH HOH A . 
E 4 HOH 72  2072 2072 HOH HOH A . 
E 4 HOH 73  2073 2073 HOH HOH A . 
E 4 HOH 74  2074 2074 HOH HOH A . 
E 4 HOH 75  2075 2075 HOH HOH A . 
E 4 HOH 76  2076 2076 HOH HOH A . 
E 4 HOH 77  2077 2077 HOH HOH A . 
E 4 HOH 78  2078 2078 HOH HOH A . 
E 4 HOH 79  2079 2079 HOH HOH A . 
E 4 HOH 80  2080 2080 HOH HOH A . 
E 4 HOH 81  2081 2081 HOH HOH A . 
E 4 HOH 82  2082 2082 HOH HOH A . 
E 4 HOH 83  2083 2083 HOH HOH A . 
E 4 HOH 84  2084 2084 HOH HOH A . 
E 4 HOH 85  2085 2085 HOH HOH A . 
E 4 HOH 86  2086 2086 HOH HOH A . 
E 4 HOH 87  2087 2087 HOH HOH A . 
E 4 HOH 88  2088 2088 HOH HOH A . 
E 4 HOH 89  2089 2089 HOH HOH A . 
E 4 HOH 90  2090 2090 HOH HOH A . 
E 4 HOH 91  2091 2091 HOH HOH A . 
E 4 HOH 92  2092 2092 HOH HOH A . 
E 4 HOH 93  2093 2093 HOH HOH A . 
E 4 HOH 94  2094 2094 HOH HOH A . 
E 4 HOH 95  2095 2095 HOH HOH A . 
E 4 HOH 96  2096 2096 HOH HOH A . 
E 4 HOH 97  2097 2097 HOH HOH A . 
E 4 HOH 98  2098 2098 HOH HOH A . 
E 4 HOH 99  2099 2099 HOH HOH A . 
E 4 HOH 100 2100 2100 HOH HOH A . 
E 4 HOH 101 2101 2101 HOH HOH A . 
E 4 HOH 102 2102 2102 HOH HOH A . 
E 4 HOH 103 2103 2103 HOH HOH A . 
E 4 HOH 104 2104 2104 HOH HOH A . 
E 4 HOH 105 2105 2105 HOH HOH A . 
E 4 HOH 106 2106 2106 HOH HOH A . 
E 4 HOH 107 2107 2107 HOH HOH A . 
E 4 HOH 108 2108 2108 HOH HOH A . 
E 4 HOH 109 2109 2109 HOH HOH A . 
E 4 HOH 110 2110 2110 HOH HOH A . 
E 4 HOH 111 2111 2111 HOH HOH A . 
E 4 HOH 112 2112 2112 HOH HOH A . 
E 4 HOH 113 2113 2113 HOH HOH A . 
E 4 HOH 114 2114 2114 HOH HOH A . 
E 4 HOH 115 2115 2115 HOH HOH A . 
E 4 HOH 116 2116 2116 HOH HOH A . 
E 4 HOH 117 2117 2117 HOH HOH A . 
E 4 HOH 118 2118 2118 HOH HOH A . 
E 4 HOH 119 2119 2119 HOH HOH A . 
E 4 HOH 120 2120 2120 HOH HOH A . 
E 4 HOH 121 2121 2121 HOH HOH A . 
E 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 123 2123 2123 HOH HOH A . 
E 4 HOH 124 2124 2124 HOH HOH A . 
E 4 HOH 125 2125 2125 HOH HOH A . 
E 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 127 2127 2127 HOH HOH A . 
E 4 HOH 128 2128 2128 HOH HOH A . 
E 4 HOH 129 2129 2129 HOH HOH A . 
E 4 HOH 130 2130 2130 HOH HOH A . 
E 4 HOH 131 2131 2131 HOH HOH A . 
E 4 HOH 132 2132 2132 HOH HOH A . 
E 4 HOH 133 2133 2133 HOH HOH A . 
E 4 HOH 134 2134 2134 HOH HOH A . 
E 4 HOH 135 2135 2135 HOH HOH A . 
E 4 HOH 136 2136 2136 HOH HOH A . 
E 4 HOH 137 2137 2137 HOH HOH A . 
E 4 HOH 138 2138 2138 HOH HOH A . 
E 4 HOH 139 2139 2139 HOH HOH A . 
E 4 HOH 140 2140 2140 HOH HOH A . 
E 4 HOH 141 2141 2141 HOH HOH A . 
E 4 HOH 142 2142 2142 HOH HOH A . 
E 4 HOH 143 2143 2143 HOH HOH A . 
E 4 HOH 144 2144 2144 HOH HOH A . 
E 4 HOH 145 2145 2145 HOH HOH A . 
E 4 HOH 146 2146 2146 HOH HOH A . 
E 4 HOH 147 2147 2147 HOH HOH A . 
E 4 HOH 148 2148 2148 HOH HOH A . 
E 4 HOH 149 2149 2149 HOH HOH A . 
E 4 HOH 150 2150 2150 HOH HOH A . 
E 4 HOH 151 2151 2151 HOH HOH A . 
E 4 HOH 152 2152 2152 HOH HOH A . 
E 4 HOH 153 2153 2153 HOH HOH A . 
E 4 HOH 154 2154 2154 HOH HOH A . 
E 4 HOH 155 2155 2155 HOH HOH A . 
E 4 HOH 156 2156 2156 HOH HOH A . 
E 4 HOH 157 2157 2157 HOH HOH A . 
E 4 HOH 158 2158 2158 HOH HOH A . 
E 4 HOH 159 2159 2159 HOH HOH A . 
E 4 HOH 160 2160 2160 HOH HOH A . 
E 4 HOH 161 2161 2161 HOH HOH A . 
E 4 HOH 162 2162 2162 HOH HOH A . 
E 4 HOH 163 2163 2163 HOH HOH A . 
E 4 HOH 164 2164 2164 HOH HOH A . 
E 4 HOH 165 2165 2165 HOH HOH A . 
E 4 HOH 166 2166 2166 HOH HOH A . 
E 4 HOH 167 2167 2167 HOH HOH A . 
E 4 HOH 168 2168 2168 HOH HOH A . 
E 4 HOH 169 2169 2169 HOH HOH A . 
E 4 HOH 170 2170 2170 HOH HOH A . 
E 4 HOH 171 2171 2171 HOH HOH A . 
E 4 HOH 172 2172 2172 HOH HOH A . 
E 4 HOH 173 2173 2173 HOH HOH A . 
E 4 HOH 174 2174 2174 HOH HOH A . 
E 4 HOH 175 2175 2175 HOH HOH A . 
E 4 HOH 176 2176 2176 HOH HOH A . 
E 4 HOH 177 2177 2177 HOH HOH A . 
E 4 HOH 178 2178 2178 HOH HOH A . 
E 4 HOH 179 2179 2179 HOH HOH A . 
E 4 HOH 180 2180 2180 HOH HOH A . 
E 4 HOH 181 2181 2181 HOH HOH A . 
E 4 HOH 182 2182 2182 HOH HOH A . 
E 4 HOH 183 2183 2183 HOH HOH A . 
E 4 HOH 184 2184 2184 HOH HOH A . 
E 4 HOH 185 2185 2185 HOH HOH A . 
E 4 HOH 186 2186 2186 HOH HOH A . 
E 4 HOH 187 2187 2187 HOH HOH A . 
E 4 HOH 188 2188 2188 HOH HOH A . 
E 4 HOH 189 2189 2189 HOH HOH A . 
E 4 HOH 190 2190 2190 HOH HOH A . 
E 4 HOH 191 2191 2191 HOH HOH A . 
E 4 HOH 192 2192 2192 HOH HOH A . 
E 4 HOH 193 2193 2193 HOH HOH A . 
E 4 HOH 194 2194 2194 HOH HOH A . 
E 4 HOH 195 2195 2195 HOH HOH A . 
E 4 HOH 196 2196 2196 HOH HOH A . 
E 4 HOH 197 2197 2197 HOH HOH A . 
E 4 HOH 198 2198 2198 HOH HOH A . 
E 4 HOH 199 2199 2199 HOH HOH A . 
E 4 HOH 200 2200 2200 HOH HOH A . 
E 4 HOH 201 2201 2201 HOH HOH A . 
E 4 HOH 202 2202 2202 HOH HOH A . 
E 4 HOH 203 2203 2203 HOH HOH A . 
E 4 HOH 204 2204 2204 HOH HOH A . 
E 4 HOH 205 2205 2205 HOH HOH A . 
E 4 HOH 206 2206 2206 HOH HOH A . 
E 4 HOH 207 2207 2207 HOH HOH A . 
E 4 HOH 208 2208 2208 HOH HOH A . 
E 4 HOH 209 2209 2209 HOH HOH A . 
E 4 HOH 210 2210 2210 HOH HOH A . 
E 4 HOH 211 2211 2211 HOH HOH A . 
E 4 HOH 212 2212 2212 HOH HOH A . 
E 4 HOH 213 2213 2213 HOH HOH A . 
E 4 HOH 214 2214 2214 HOH HOH A . 
E 4 HOH 215 2215 2215 HOH HOH A . 
E 4 HOH 216 2216 2216 HOH HOH A . 
E 4 HOH 217 2217 2217 HOH HOH A . 
E 4 HOH 218 2218 2218 HOH HOH A . 
E 4 HOH 219 2219 2219 HOH HOH A . 
E 4 HOH 220 2220 2220 HOH HOH A . 
E 4 HOH 221 2221 2221 HOH HOH A . 
E 4 HOH 222 2222 2222 HOH HOH A . 
E 4 HOH 223 2223 2223 HOH HOH A . 
E 4 HOH 224 2224 2224 HOH HOH A . 
E 4 HOH 225 2225 2225 HOH HOH A . 
E 4 HOH 226 2226 2226 HOH HOH A . 
E 4 HOH 227 2227 2227 HOH HOH A . 
E 4 HOH 228 2228 2228 HOH HOH A . 
E 4 HOH 229 2229 2229 HOH HOH A . 
E 4 HOH 230 2230 2230 HOH HOH A . 
E 4 HOH 231 2231 2231 HOH HOH A . 
E 4 HOH 232 2232 2232 HOH HOH A . 
E 4 HOH 233 2233 2233 HOH HOH A . 
E 4 HOH 234 2234 2234 HOH HOH A . 
E 4 HOH 235 2235 2235 HOH HOH A . 
E 4 HOH 236 2236 2236 HOH HOH A . 
E 4 HOH 237 2237 2237 HOH HOH A . 
E 4 HOH 238 2238 2238 HOH HOH A . 
E 4 HOH 239 2239 2239 HOH HOH A . 
E 4 HOH 240 2240 2240 HOH HOH A . 
E 4 HOH 241 2241 2241 HOH HOH A . 
E 4 HOH 242 2242 2242 HOH HOH A . 
E 4 HOH 243 2243 2243 HOH HOH A . 
E 4 HOH 244 2244 2244 HOH HOH A . 
E 4 HOH 245 2245 2245 HOH HOH A . 
E 4 HOH 246 2246 2246 HOH HOH A . 
E 4 HOH 247 2247 2247 HOH HOH A . 
E 4 HOH 248 2248 2248 HOH HOH A . 
E 4 HOH 249 2249 2249 HOH HOH A . 
E 4 HOH 250 2250 2250 HOH HOH A . 
E 4 HOH 251 2251 2251 HOH HOH A . 
E 4 HOH 252 2252 2252 HOH HOH A . 
E 4 HOH 253 2253 2253 HOH HOH A . 
E 4 HOH 254 2254 2254 HOH HOH A . 
E 4 HOH 255 2255 2255 HOH HOH A . 
E 4 HOH 256 2256 2256 HOH HOH A . 
E 4 HOH 257 2257 2257 HOH HOH A . 
E 4 HOH 258 2258 2258 HOH HOH A . 
E 4 HOH 259 2259 2259 HOH HOH A . 
E 4 HOH 260 2260 2260 HOH HOH A . 
E 4 HOH 261 2261 2261 HOH HOH A . 
E 4 HOH 262 2262 2262 HOH HOH A . 
E 4 HOH 263 2263 2263 HOH HOH A . 
E 4 HOH 264 2264 2264 HOH HOH A . 
E 4 HOH 265 2265 2265 HOH HOH A . 
E 4 HOH 266 2266 2266 HOH HOH A . 
E 4 HOH 267 2267 2267 HOH HOH A . 
E 4 HOH 268 2268 2268 HOH HOH A . 
E 4 HOH 269 2269 2269 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-23 
2 'Structure model' 1 1 2011-08-31 
3 'Structure model' 1 2 2014-01-22 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory                    
2  2 'Structure model' 'Atomic model'              
3  2 'Structure model' 'Derived calculations'      
4  2 'Structure model' 'Non-polymer description'   
5  2 'Structure model' Other                       
6  2 'Structure model' 'Refinement description'    
7  2 'Structure model' 'Version format compliance' 
8  3 'Structure model' 'Database references'       
9  4 'Structure model' 'Data collection'           
10 4 'Structure model' 'Database references'       
11 4 'Structure model' 'Derived calculations'      
12 4 'Structure model' 'Experimental preparation'  
13 4 'Structure model' Other                       
14 5 'Structure model' Advisory                    
15 5 'Structure model' 'Data collection'           
16 5 'Structure model' 'Derived calculations'      
17 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' exptl_crystal_grow        
3  4 'Structure model' pdbx_database_proc        
4  4 'Structure model' pdbx_database_status      
5  4 'Structure model' struct_conn               
6  5 'Structure model' chem_comp                 
7  5 'Structure model' database_PDB_caveat       
8  5 'Structure model' entity                    
9  5 'Structure model' pdbx_chem_comp_identifier 
10 5 'Structure model' pdbx_entity_nonpoly       
11 5 'Structure model' struct_conn               
12 5 'Structure model' struct_site               
13 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.country'                           
2  4 'Structure model' '_exptl_crystal_grow.temp'                    
3  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
5  5 'Structure model' '_chem_comp.name'                             
6  5 'Structure model' '_chem_comp.type'                             
7  5 'Structure model' '_database_PDB_caveat.text'                   
8  5 'Structure model' '_entity.pdbx_description'                    
9  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
10 5 'Structure model' '_struct_conn.pdbx_role'                      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1H23 
_pdbx_entry_details.compound_details         
;COMPOUND HYDROLYZES CHOLINE RELEASED INTO THE SYNAPSE.
CATALYTIC ACTIVITY: ACETYLCHOLINE + H(2)O = CHOLINE +
ACETATE. INHIBITORS OF THE ENZYME ACETYLCHOLINESTERASE
(ACHE) IMPROVE THE COGNITIVE ABILITIES OF INDIVIDUALS WITH
EARLY STAGE ALZHEIMER'S DISEASE. (-)-HUPERZINE A
((-)-HUPA), A NATURAL PRODUCT USED IN TRADITIONAL CHINESE
HERBAL MEDICINE, IS AMONG THE POTENT ACHE INHIBITORS USED
IN THIS TREATMENT. THE LIGAND, (S,S)-(-)-BIS(12)-HUPYRIDONE
((S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO-2'(1'H)-
QUINOLINONYL]-1,12-DIAMINODODECANE) DIHYDROCHLORIDE, AN
ALKYLENE LINKED DIMER OF FRAGMENTS OF THE HUPA STRUCTURE,
HUPYRIDONE (5-AMINO-5,6,7,8-TETRAHYDROQUINOLINONE), HAVE
BEEN SHOWN TO EXHIBIT POTENT INHIBITION OF ACHE. ONE
HUPYRIDONE UNIT BINDS TO THE 'ANIONIC' SUBSITE OF THE
ACTIVE SITE, NEAR THE BOTTOM OF THE ACTIVE SITE GORGE OF
TCACHE, ADJACENT TO TRP84, AS SEEN FOR THE TCACHE/(-)-HUPA
COMPLEX, AND THE SECOND HUPYRIDONE UNIT NEAR TO TRP279 IN
THE 'PERIPHERAL' ANIONIC SITE AT THE TOP OF THE GORGE, THUS
 SPANNING THE ACTIVE SITE GORGE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 19   ? ? O A HOH 2004 ? ? 1.90 
2 1 C41 A E12 1536 ? ? O A HOH 2070 ? ? 2.05 
3 1 O   A HOH 2068 ? ? O A HOH 2113 ? ? 2.12 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     49 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     350 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_564 
_pdbx_validate_symm_contact.dist              1.90 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.405 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            -0.369 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A VAL 22  ? ? CA A VAL 22  ? ? C   A VAL 22  ? ? 98.06  111.40 -13.34 1.90 N 
2 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH1 A ARG 221 ? ? 123.87 120.30 3.57   0.50 N 
3 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 115.93 120.30 -4.37  0.50 N 
4 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 98.12  111.40 -13.28 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -134.32 -155.85 
2  1 PHE A 45  ? ? 84.62   -11.93  
3  1 ALA A 60  ? ? -116.48 52.24   
4  1 CYS A 94  ? ? -141.89 10.07   
5  1 SER A 108 ? ? -159.13 82.06   
6  1 LEU A 158 ? ? -119.33 76.37   
7  1 SER A 200 ? ? 54.28   -122.06 
8  1 GLU A 299 ? ? -124.44 -70.61  
9  1 THR A 317 ? ? -160.52 -160.38 
10 1 ASP A 380 ? ? -157.67 52.49   
11 1 VAL A 400 ? ? -127.45 -61.38  
12 1 ASN A 457 ? ? 74.96   38.31   
13 1 ASN A 506 ? ? -162.25 -165.86 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     442 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.067 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     1537 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
2  1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
3  1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
4  1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
5  1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
6  1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
7  1 Y 1 A LYS 270 ? CD  ? A LYS 270 CD  
8  1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
9  1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
10 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
11 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
12 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
13 1 Y 1 A LYS 454 ? CG  ? A LYS 454 CG  
14 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
15 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
16 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
17 1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
18 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
19 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
20 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
21 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
22 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
23 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
24 1 Y 1 A GLN 526 ? CD  ? A GLN 526 CD  
25 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
26 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A HIS 486 ? A HIS 486 
5  1 Y 1 A SER 487 ? A SER 487 
6  1 Y 1 A GLN 488 ? A GLN 488 
7  1 Y 1 A GLU 489 ? A GLU 489 
8  1 Y 1 A ALA 536 ? A ALA 536 
9  1 Y 1 A CYS 537 ? A CYS 537 
10 1 Y 1 A ASP 538 ? A ASP 538 
11 1 Y 1 A GLY 539 ? A GLY 539 
12 1 Y 1 A GLU 540 ? A GLU 540 
13 1 Y 1 A LEU 541 ? A LEU 541 
14 1 Y 1 A SER 542 ? A SER 542 
15 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;(S,S)-(-)-N,N'-DI-5'-[5',6',7',8'-TETRAHYDRO- 2'(1'H)-QUINOLYNYL]-1,12-DIAMINODODECANE DIHYDROCHLORIDE
;
E12 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                                                 NAG 
4 water                                                                                                    HOH 
#