data_1H2I
# 
_entry.id   1H2I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H2I         
PDBE  EBI-11218    
WWPDB D_1290011218 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H2I 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-08-09 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Singleton, M.R.' 1 
'Wentzell, L.M.'  2 
'Liu, Y.'         3 
'West, S.C.'      4 
'Wigley, D.B.'    5 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Single-Strand Annealing Domain of Human Rad52 Protein' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                13492 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12370410 
_citation.pdbx_database_id_DOI      10.1073/PNAS.212449899 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Singleton, M.R.' 1 
primary 'Wentzell, L.M.'  2 
primary 'Liu, Y.'         3 
primary 'West, S.C.'      4 
primary 'Wigley, D.B.'    5 
# 
_cell.entry_id           1H2I 
_cell.length_a           117.259 
_cell.length_b           127.319 
_cell.length_c           191.227 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              44 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H2I 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA REPAIR PROTEIN RAD52 HOMOLOG' 23089.096 22  ? ? 'DNA-BINDING DOMAIN, RESIDUES 1-209' ? 
2 water   nat water                              18.015    484 ? ? ?                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RAD52 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   THR n 
1 5   GLU n 
1 6   GLU n 
1 7   ALA n 
1 8   ILE n 
1 9   LEU n 
1 10  GLY n 
1 11  GLY n 
1 12  ARG n 
1 13  ASP n 
1 14  SER n 
1 15  HIS n 
1 16  PRO n 
1 17  ALA n 
1 18  ALA n 
1 19  GLY n 
1 20  GLY n 
1 21  GLY n 
1 22  SER n 
1 23  VAL n 
1 24  LEU n 
1 25  CYS n 
1 26  PHE n 
1 27  GLY n 
1 28  GLN n 
1 29  CYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  GLU n 
1 36  TYR n 
1 37  GLN n 
1 38  ALA n 
1 39  ILE n 
1 40  GLN n 
1 41  LYS n 
1 42  ALA n 
1 43  LEU n 
1 44  ARG n 
1 45  GLN n 
1 46  ARG n 
1 47  LEU n 
1 48  GLY n 
1 49  PRO n 
1 50  GLU n 
1 51  TYR n 
1 52  ILE n 
1 53  SER n 
1 54  SER n 
1 55  ARG n 
1 56  MET n 
1 57  ALA n 
1 58  GLY n 
1 59  GLY n 
1 60  GLY n 
1 61  GLN n 
1 62  LYS n 
1 63  VAL n 
1 64  CYS n 
1 65  TYR n 
1 66  ILE n 
1 67  GLU n 
1 68  GLY n 
1 69  HIS n 
1 70  ARG n 
1 71  VAL n 
1 72  ILE n 
1 73  ASN n 
1 74  LEU n 
1 75  ALA n 
1 76  ASN n 
1 77  GLU n 
1 78  MET n 
1 79  PHE n 
1 80  GLY n 
1 81  TYR n 
1 82  ASN n 
1 83  GLY n 
1 84  TRP n 
1 85  ALA n 
1 86  HIS n 
1 87  SER n 
1 88  ILE n 
1 89  THR n 
1 90  GLN n 
1 91  GLN n 
1 92  ASN n 
1 93  VAL n 
1 94  ASP n 
1 95  PHE n 
1 96  VAL n 
1 97  ASP n 
1 98  LEU n 
1 99  ASN n 
1 100 ASN n 
1 101 GLY n 
1 102 LYS n 
1 103 PHE n 
1 104 TYR n 
1 105 VAL n 
1 106 GLY n 
1 107 VAL n 
1 108 CYS n 
1 109 ALA n 
1 110 PHE n 
1 111 VAL n 
1 112 ARG n 
1 113 VAL n 
1 114 GLN n 
1 115 LEU n 
1 116 LYS n 
1 117 ASP n 
1 118 GLY n 
1 119 SER n 
1 120 TYR n 
1 121 HIS n 
1 122 GLU n 
1 123 ASP n 
1 124 VAL n 
1 125 GLY n 
1 126 TYR n 
1 127 GLY n 
1 128 VAL n 
1 129 SER n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 LYS n 
1 134 SER n 
1 135 LYS n 
1 136 ALA n 
1 137 LEU n 
1 138 SER n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 ALA n 
1 143 ARG n 
1 144 LYS n 
1 145 GLU n 
1 146 ALA n 
1 147 VAL n 
1 148 THR n 
1 149 ASP n 
1 150 GLY n 
1 151 LEU n 
1 152 LYS n 
1 153 ARG n 
1 154 ALA n 
1 155 LEU n 
1 156 ARG n 
1 157 SER n 
1 158 PHE n 
1 159 GLY n 
1 160 ASN n 
1 161 ALA n 
1 162 LEU n 
1 163 GLY n 
1 164 ASN n 
1 165 CYS n 
1 166 ILE n 
1 167 LEU n 
1 168 ASP n 
1 169 LYS n 
1 170 ASP n 
1 171 TYR n 
1 172 LEU n 
1 173 ARG n 
1 174 SER n 
1 175 LEU n 
1 176 ASN n 
1 177 LYS n 
1 178 LEU n 
1 179 PRO n 
1 180 ARG n 
1 181 GLN n 
1 182 LEU n 
1 183 PRO n 
1 184 LEU n 
1 185 GLU n 
1 186 VAL n 
1 187 ASP n 
1 188 LEU n 
1 189 THR n 
1 190 LYS n 
1 191 ALA n 
1 192 LYS n 
1 193 ARG n 
1 194 GLN n 
1 195 ASP n 
1 196 LEU n 
1 197 GLU n 
1 198 PRO n 
1 199 SER n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 ALA n 
1 204 ARG n 
1 205 TYR n 
1 206 ASN n 
1 207 SER n 
1 208 CYS n 
1 209 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RA52_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P43351 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1H2I A 1 ? 209 ? P43351 1 ? 209 ? 1 209 
2  1 1H2I B 1 ? 209 ? P43351 1 ? 209 ? 1 209 
3  1 1H2I C 1 ? 209 ? P43351 1 ? 209 ? 1 209 
4  1 1H2I D 1 ? 209 ? P43351 1 ? 209 ? 1 209 
5  1 1H2I E 1 ? 209 ? P43351 1 ? 209 ? 1 209 
6  1 1H2I F 1 ? 209 ? P43351 1 ? 209 ? 1 209 
7  1 1H2I G 1 ? 209 ? P43351 1 ? 209 ? 1 209 
8  1 1H2I H 1 ? 209 ? P43351 1 ? 209 ? 1 209 
9  1 1H2I I 1 ? 209 ? P43351 1 ? 209 ? 1 209 
10 1 1H2I J 1 ? 209 ? P43351 1 ? 209 ? 1 209 
11 1 1H2I K 1 ? 209 ? P43351 1 ? 209 ? 1 209 
12 1 1H2I L 1 ? 209 ? P43351 1 ? 209 ? 1 209 
13 1 1H2I M 1 ? 209 ? P43351 1 ? 209 ? 1 209 
14 1 1H2I N 1 ? 209 ? P43351 1 ? 209 ? 1 209 
15 1 1H2I O 1 ? 209 ? P43351 1 ? 209 ? 1 209 
16 1 1H2I P 1 ? 209 ? P43351 1 ? 209 ? 1 209 
17 1 1H2I Q 1 ? 209 ? P43351 1 ? 209 ? 1 209 
18 1 1H2I R 1 ? 209 ? P43351 1 ? 209 ? 1 209 
19 1 1H2I S 1 ? 209 ? P43351 1 ? 209 ? 1 209 
20 1 1H2I T 1 ? 209 ? P43351 1 ? 209 ? 1 209 
21 1 1H2I U 1 ? 209 ? P43351 1 ? 209 ? 1 209 
22 1 1H2I V 1 ? 209 ? P43351 1 ? 209 ? 1 209 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H2I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.81 
_exptl_crystal.density_percent_sol   56.23 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 8.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H2I 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   149457 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.0 
_reflns.pdbx_Rmerge_I_obs            0.05500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.27900 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.700 
_reflns_shell.pdbx_redundancy        2.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H2I 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     149457 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        32318 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             484 
_refine_hist.number_atoms_total               32802 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.78  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1H2I 
_struct.title                     'Human Rad52 protein, N-terminal domain' 
_struct.pdbx_descriptor           'DNA REPAIR PROTEIN RAD52 HOMOLOG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H2I 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'DNA-BINDING PROTEIN, DNA REPAIR, DNA RECOMBINATION, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;CHAINS A-K FORM ONE UNDECAMERIC UNITCHAINS                   
 L-V FORM ONE UNDECAMERIC UNIT
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 32  ? GLN A 45  ? THR A 32  GLN A 45  1 ? 14 
HELX_P HELX_P2   2   GLU A 67  ? GLY A 80  ? GLU A 67  GLY A 80  1 ? 14 
HELX_P HELX_P3   3   SER A 134 ? SER A 157 ? SER A 134 SER A 157 1 ? 24 
HELX_P HELX_P4   4   PHE A 158 ? GLY A 163 ? PHE A 158 GLY A 163 5 ? 6  
HELX_P HELX_P5   5   ASN A 164 ? LEU A 167 ? ASN A 164 LEU A 167 5 ? 4  
HELX_P HELX_P6   6   ASP A 168 ? LYS A 177 ? ASP A 168 LYS A 177 1 ? 10 
HELX_P HELX_P7   7   GLU A 197 ? ASN A 206 ? GLU A 197 ASN A 206 1 ? 10 
HELX_P HELX_P8   8   THR B 32  ? GLN B 45  ? THR B 32  GLN B 45  1 ? 14 
HELX_P HELX_P9   9   GLU B 67  ? GLY B 80  ? GLU B 67  GLY B 80  1 ? 14 
HELX_P HELX_P10  10  SER B 134 ? SER B 157 ? SER B 134 SER B 157 1 ? 24 
HELX_P HELX_P11  11  PHE B 158 ? LEU B 167 ? PHE B 158 LEU B 167 5 ? 10 
HELX_P HELX_P12  12  ASP B 168 ? LYS B 177 ? ASP B 168 LYS B 177 1 ? 10 
HELX_P HELX_P13  13  ASP B 187 ? ALA B 191 ? ASP B 187 ALA B 191 5 ? 5  
HELX_P HELX_P14  14  GLU B 197 ? CYS B 208 ? GLU B 197 CYS B 208 1 ? 12 
HELX_P HELX_P15  15  THR C 32  ? GLN C 45  ? THR C 32  GLN C 45  1 ? 14 
HELX_P HELX_P16  16  GLU C 67  ? GLY C 80  ? GLU C 67  GLY C 80  1 ? 14 
HELX_P HELX_P17  17  SER C 134 ? SER C 157 ? SER C 134 SER C 157 1 ? 24 
HELX_P HELX_P18  18  PHE C 158 ? LEU C 167 ? PHE C 158 LEU C 167 5 ? 10 
HELX_P HELX_P19  19  ASP C 168 ? LYS C 177 ? ASP C 168 LYS C 177 1 ? 10 
HELX_P HELX_P20  20  GLU C 197 ? ASN C 206 ? GLU C 197 ASN C 206 1 ? 10 
HELX_P HELX_P21  21  THR D 32  ? GLN D 45  ? THR D 32  GLN D 45  1 ? 14 
HELX_P HELX_P22  22  GLU D 67  ? GLY D 80  ? GLU D 67  GLY D 80  1 ? 14 
HELX_P HELX_P23  23  SER D 134 ? SER D 157 ? SER D 134 SER D 157 1 ? 24 
HELX_P HELX_P24  24  PHE D 158 ? GLY D 163 ? PHE D 158 GLY D 163 5 ? 6  
HELX_P HELX_P25  25  ASN D 164 ? LEU D 167 ? ASN D 164 LEU D 167 5 ? 4  
HELX_P HELX_P26  26  ASP D 168 ? LYS D 177 ? ASP D 168 LYS D 177 1 ? 10 
HELX_P HELX_P27  27  GLU D 197 ? SER D 207 ? GLU D 197 SER D 207 1 ? 11 
HELX_P HELX_P28  28  THR E 32  ? GLN E 45  ? THR E 32  GLN E 45  1 ? 14 
HELX_P HELX_P29  29  GLU E 67  ? GLY E 80  ? GLU E 67  GLY E 80  1 ? 14 
HELX_P HELX_P30  30  SER E 134 ? SER E 157 ? SER E 134 SER E 157 1 ? 24 
HELX_P HELX_P31  31  PHE E 158 ? GLY E 163 ? PHE E 158 GLY E 163 5 ? 6  
HELX_P HELX_P32  32  ASN E 164 ? LEU E 167 ? ASN E 164 LEU E 167 5 ? 4  
HELX_P HELX_P33  33  ASP E 168 ? LYS E 177 ? ASP E 168 LYS E 177 1 ? 10 
HELX_P HELX_P34  34  GLU E 197 ? CYS E 208 ? GLU E 197 CYS E 208 1 ? 12 
HELX_P HELX_P35  35  THR F 32  ? GLN F 45  ? THR F 32  GLN F 45  1 ? 14 
HELX_P HELX_P36  36  GLU F 67  ? GLY F 80  ? GLU F 67  GLY F 80  1 ? 14 
HELX_P HELX_P37  37  SER F 134 ? SER F 157 ? SER F 134 SER F 157 1 ? 24 
HELX_P HELX_P38  38  PHE F 158 ? GLY F 163 ? PHE F 158 GLY F 163 5 ? 6  
HELX_P HELX_P39  39  ASN F 164 ? LEU F 167 ? ASN F 164 LEU F 167 5 ? 4  
HELX_P HELX_P40  40  ASP F 168 ? LYS F 177 ? ASP F 168 LYS F 177 1 ? 10 
HELX_P HELX_P41  41  GLU F 197 ? CYS F 208 ? GLU F 197 CYS F 208 1 ? 12 
HELX_P HELX_P42  42  THR G 32  ? GLN G 45  ? THR G 32  GLN G 45  1 ? 14 
HELX_P HELX_P43  43  GLU G 67  ? GLY G 80  ? GLU G 67  GLY G 80  1 ? 14 
HELX_P HELX_P44  44  SER G 134 ? SER G 157 ? SER G 134 SER G 157 1 ? 24 
HELX_P HELX_P45  45  PHE G 158 ? GLY G 163 ? PHE G 158 GLY G 163 5 ? 6  
HELX_P HELX_P46  46  ASN G 164 ? LEU G 167 ? ASN G 164 LEU G 167 5 ? 4  
HELX_P HELX_P47  47  ASP G 168 ? LYS G 177 ? ASP G 168 LYS G 177 1 ? 10 
HELX_P HELX_P48  48  SER G 199 ? SER G 207 ? SER G 199 SER G 207 1 ? 9  
HELX_P HELX_P49  49  THR H 32  ? GLN H 45  ? THR H 32  GLN H 45  1 ? 14 
HELX_P HELX_P50  50  GLU H 67  ? GLY H 80  ? GLU H 67  GLY H 80  1 ? 14 
HELX_P HELX_P51  51  SER H 134 ? SER H 157 ? SER H 134 SER H 157 1 ? 24 
HELX_P HELX_P52  52  PHE H 158 ? GLY H 163 ? PHE H 158 GLY H 163 5 ? 6  
HELX_P HELX_P53  53  ASN H 164 ? LEU H 167 ? ASN H 164 LEU H 167 5 ? 4  
HELX_P HELX_P54  54  ASP H 168 ? LYS H 177 ? ASP H 168 LYS H 177 1 ? 10 
HELX_P HELX_P55  55  GLU H 197 ? TYR H 205 ? GLU H 197 TYR H 205 1 ? 9  
HELX_P HELX_P56  56  THR I 32  ? GLN I 45  ? THR I 32  GLN I 45  1 ? 14 
HELX_P HELX_P57  57  GLU I 67  ? GLY I 80  ? GLU I 67  GLY I 80  1 ? 14 
HELX_P HELX_P58  58  SER I 134 ? SER I 157 ? SER I 134 SER I 157 1 ? 24 
HELX_P HELX_P59  59  PHE I 158 ? GLY I 163 ? PHE I 158 GLY I 163 5 ? 6  
HELX_P HELX_P60  60  ASN I 164 ? LEU I 167 ? ASN I 164 LEU I 167 5 ? 4  
HELX_P HELX_P61  61  ASP I 168 ? LYS I 177 ? ASP I 168 LYS I 177 1 ? 10 
HELX_P HELX_P62  62  ASP I 187 ? ALA I 191 ? ASP I 187 ALA I 191 5 ? 5  
HELX_P HELX_P63  63  GLU I 197 ? ASN I 206 ? GLU I 197 ASN I 206 1 ? 10 
HELX_P HELX_P64  64  THR J 32  ? GLN J 45  ? THR J 32  GLN J 45  1 ? 14 
HELX_P HELX_P65  65  GLU J 67  ? GLY J 80  ? GLU J 67  GLY J 80  1 ? 14 
HELX_P HELX_P66  66  SER J 134 ? SER J 157 ? SER J 134 SER J 157 1 ? 24 
HELX_P HELX_P67  67  PHE J 158 ? GLY J 163 ? PHE J 158 GLY J 163 5 ? 6  
HELX_P HELX_P68  68  ASN J 164 ? LEU J 167 ? ASN J 164 LEU J 167 5 ? 4  
HELX_P HELX_P69  69  ASP J 168 ? LYS J 177 ? ASP J 168 LYS J 177 1 ? 10 
HELX_P HELX_P70  70  GLU J 197 ? SER J 207 ? GLU J 197 SER J 207 1 ? 11 
HELX_P HELX_P71  71  THR K 32  ? GLN K 45  ? THR K 32  GLN K 45  1 ? 14 
HELX_P HELX_P72  72  GLU K 67  ? GLY K 80  ? GLU K 67  GLY K 80  1 ? 14 
HELX_P HELX_P73  73  SER K 134 ? SER K 157 ? SER K 134 SER K 157 1 ? 24 
HELX_P HELX_P74  74  PHE K 158 ? GLY K 163 ? PHE K 158 GLY K 163 5 ? 6  
HELX_P HELX_P75  75  ASN K 164 ? LEU K 167 ? ASN K 164 LEU K 167 5 ? 4  
HELX_P HELX_P76  76  ASP K 168 ? LYS K 177 ? ASP K 168 LYS K 177 1 ? 10 
HELX_P HELX_P77  77  GLU K 197 ? ARG K 209 ? GLU K 197 ARG K 209 1 ? 13 
HELX_P HELX_P78  78  THR L 32  ? GLN L 45  ? THR L 32  GLN L 45  1 ? 14 
HELX_P HELX_P79  79  GLU L 67  ? GLY L 80  ? GLU L 67  GLY L 80  1 ? 14 
HELX_P HELX_P80  80  SER L 134 ? SER L 157 ? SER L 134 SER L 157 1 ? 24 
HELX_P HELX_P81  81  PHE L 158 ? GLY L 163 ? PHE L 158 GLY L 163 5 ? 6  
HELX_P HELX_P82  82  ASN L 164 ? LEU L 167 ? ASN L 164 LEU L 167 5 ? 4  
HELX_P HELX_P83  83  ASP L 168 ? LYS L 177 ? ASP L 168 LYS L 177 1 ? 10 
HELX_P HELX_P84  84  GLU L 197 ? SER L 207 ? GLU L 197 SER L 207 1 ? 11 
HELX_P HELX_P85  85  THR M 32  ? GLN M 45  ? THR M 32  GLN M 45  1 ? 14 
HELX_P HELX_P86  86  GLU M 67  ? GLY M 80  ? GLU M 67  GLY M 80  1 ? 14 
HELX_P HELX_P87  87  SER M 134 ? SER M 157 ? SER M 134 SER M 157 1 ? 24 
HELX_P HELX_P88  88  PHE M 158 ? LEU M 167 ? PHE M 158 LEU M 167 5 ? 10 
HELX_P HELX_P89  89  ASP M 168 ? LYS M 177 ? ASP M 168 LYS M 177 1 ? 10 
HELX_P HELX_P90  90  ASP M 187 ? ALA M 191 ? ASP M 187 ALA M 191 5 ? 5  
HELX_P HELX_P91  91  GLU M 197 ? CYS M 208 ? GLU M 197 CYS M 208 1 ? 12 
HELX_P HELX_P92  92  THR N 32  ? GLN N 45  ? THR N 32  GLN N 45  1 ? 14 
HELX_P HELX_P93  93  GLU N 67  ? GLY N 80  ? GLU N 67  GLY N 80  1 ? 14 
HELX_P HELX_P94  94  SER N 134 ? SER N 157 ? SER N 134 SER N 157 1 ? 24 
HELX_P HELX_P95  95  PHE N 158 ? GLY N 163 ? PHE N 158 GLY N 163 5 ? 6  
HELX_P HELX_P96  96  ASN N 164 ? LEU N 167 ? ASN N 164 LEU N 167 5 ? 4  
HELX_P HELX_P97  97  ASP N 168 ? LYS N 177 ? ASP N 168 LYS N 177 1 ? 10 
HELX_P HELX_P98  98  ASP N 187 ? ALA N 191 ? ASP N 187 ALA N 191 5 ? 5  
HELX_P HELX_P99  99  GLU N 197 ? CYS N 208 ? GLU N 197 CYS N 208 1 ? 12 
HELX_P HELX_P100 100 THR O 32  ? GLN O 45  ? THR O 32  GLN O 45  1 ? 14 
HELX_P HELX_P101 101 GLU O 67  ? GLY O 80  ? GLU O 67  GLY O 80  1 ? 14 
HELX_P HELX_P102 102 SER O 134 ? SER O 157 ? SER O 134 SER O 157 1 ? 24 
HELX_P HELX_P103 103 PHE O 158 ? LEU O 167 ? PHE O 158 LEU O 167 5 ? 10 
HELX_P HELX_P104 104 ASP O 168 ? LYS O 177 ? ASP O 168 LYS O 177 1 ? 10 
HELX_P HELX_P105 105 GLU O 197 ? CYS O 208 ? GLU O 197 CYS O 208 1 ? 12 
HELX_P HELX_P106 106 THR P 32  ? GLN P 45  ? THR P 32  GLN P 45  1 ? 14 
HELX_P HELX_P107 107 GLU P 67  ? GLY P 80  ? GLU P 67  GLY P 80  1 ? 14 
HELX_P HELX_P108 108 SER P 134 ? SER P 157 ? SER P 134 SER P 157 1 ? 24 
HELX_P HELX_P109 109 PHE P 158 ? GLY P 163 ? PHE P 158 GLY P 163 5 ? 6  
HELX_P HELX_P110 110 ASN P 164 ? LEU P 167 ? ASN P 164 LEU P 167 5 ? 4  
HELX_P HELX_P111 111 ASP P 168 ? LYS P 177 ? ASP P 168 LYS P 177 1 ? 10 
HELX_P HELX_P112 112 GLU P 197 ? ASN P 206 ? GLU P 197 ASN P 206 1 ? 10 
HELX_P HELX_P113 113 THR Q 32  ? GLN Q 45  ? THR Q 32  GLN Q 45  1 ? 14 
HELX_P HELX_P114 114 GLU Q 67  ? GLY Q 80  ? GLU Q 67  GLY Q 80  1 ? 14 
HELX_P HELX_P115 115 SER Q 134 ? SER Q 157 ? SER Q 134 SER Q 157 1 ? 24 
HELX_P HELX_P116 116 PHE Q 158 ? GLY Q 163 ? PHE Q 158 GLY Q 163 5 ? 6  
HELX_P HELX_P117 117 ASN Q 164 ? LEU Q 167 ? ASN Q 164 LEU Q 167 5 ? 4  
HELX_P HELX_P118 118 ASP Q 168 ? LYS Q 177 ? ASP Q 168 LYS Q 177 1 ? 10 
HELX_P HELX_P119 119 GLU Q 197 ? CYS Q 208 ? GLU Q 197 CYS Q 208 1 ? 12 
HELX_P HELX_P120 120 THR R 32  ? GLN R 45  ? THR R 32  GLN R 45  1 ? 14 
HELX_P HELX_P121 121 GLU R 67  ? GLY R 80  ? GLU R 67  GLY R 80  1 ? 14 
HELX_P HELX_P122 122 SER R 134 ? SER R 157 ? SER R 134 SER R 157 1 ? 24 
HELX_P HELX_P123 123 PHE R 158 ? GLY R 163 ? PHE R 158 GLY R 163 5 ? 6  
HELX_P HELX_P124 124 ASP R 168 ? LYS R 177 ? ASP R 168 LYS R 177 1 ? 10 
HELX_P HELX_P125 125 ASP R 187 ? ALA R 191 ? ASP R 187 ALA R 191 5 ? 5  
HELX_P HELX_P126 126 GLU R 197 ? CYS R 208 ? GLU R 197 CYS R 208 1 ? 12 
HELX_P HELX_P127 127 THR S 32  ? GLN S 45  ? THR S 32  GLN S 45  1 ? 14 
HELX_P HELX_P128 128 GLU S 67  ? GLY S 80  ? GLU S 67  GLY S 80  1 ? 14 
HELX_P HELX_P129 129 SER S 134 ? SER S 157 ? SER S 134 SER S 157 1 ? 24 
HELX_P HELX_P130 130 PHE S 158 ? LEU S 167 ? PHE S 158 LEU S 167 5 ? 10 
HELX_P HELX_P131 131 ASP S 168 ? LYS S 177 ? ASP S 168 LYS S 177 1 ? 10 
HELX_P HELX_P132 132 ASP S 187 ? ALA S 191 ? ASP S 187 ALA S 191 5 ? 5  
HELX_P HELX_P133 133 GLU S 197 ? ASN S 206 ? GLU S 197 ASN S 206 1 ? 10 
HELX_P HELX_P134 134 THR T 32  ? GLN T 45  ? THR T 32  GLN T 45  1 ? 14 
HELX_P HELX_P135 135 GLU T 67  ? GLY T 80  ? GLU T 67  GLY T 80  1 ? 14 
HELX_P HELX_P136 136 SER T 134 ? SER T 157 ? SER T 134 SER T 157 1 ? 24 
HELX_P HELX_P137 137 PHE T 158 ? GLY T 163 ? PHE T 158 GLY T 163 5 ? 6  
HELX_P HELX_P138 138 ASN T 164 ? LEU T 167 ? ASN T 164 LEU T 167 5 ? 4  
HELX_P HELX_P139 139 ASP T 168 ? LYS T 177 ? ASP T 168 LYS T 177 1 ? 10 
HELX_P HELX_P140 140 GLU T 197 ? ASN T 206 ? GLU T 197 ASN T 206 1 ? 10 
HELX_P HELX_P141 141 THR U 32  ? GLN U 45  ? THR U 32  GLN U 45  1 ? 14 
HELX_P HELX_P142 142 GLU U 67  ? GLY U 80  ? GLU U 67  GLY U 80  1 ? 14 
HELX_P HELX_P143 143 SER U 134 ? SER U 157 ? SER U 134 SER U 157 1 ? 24 
HELX_P HELX_P144 144 PHE U 158 ? GLY U 163 ? PHE U 158 GLY U 163 5 ? 6  
HELX_P HELX_P145 145 ASN U 164 ? LEU U 167 ? ASN U 164 LEU U 167 5 ? 4  
HELX_P HELX_P146 146 ASP U 168 ? LYS U 177 ? ASP U 168 LYS U 177 1 ? 10 
HELX_P HELX_P147 147 ASP U 187 ? ALA U 191 ? ASP U 187 ALA U 191 5 ? 5  
HELX_P HELX_P148 148 GLU U 197 ? ASN U 206 ? GLU U 197 ASN U 206 1 ? 10 
HELX_P HELX_P149 149 THR V 32  ? GLN V 45  ? THR V 32  GLN V 45  1 ? 14 
HELX_P HELX_P150 150 GLU V 67  ? GLY V 80  ? GLU V 67  GLY V 80  1 ? 14 
HELX_P HELX_P151 151 SER V 134 ? SER V 157 ? SER V 134 SER V 157 1 ? 24 
HELX_P HELX_P152 152 PHE V 158 ? GLY V 163 ? PHE V 158 GLY V 163 5 ? 6  
HELX_P HELX_P153 153 ASN V 164 ? LEU V 167 ? ASN V 164 LEU V 167 5 ? 4  
HELX_P HELX_P154 154 ASP V 168 ? LYS V 177 ? ASP V 168 LYS V 177 1 ? 10 
HELX_P HELX_P155 155 ASP V 187 ? ALA V 191 ? ASP V 187 ALA V 191 5 ? 5  
HELX_P HELX_P156 156 GLU V 197 ? ASN V 206 ? GLU V 197 ASN V 206 1 ? 10 
HELX_P HELX_P157 157 SER V 207 ? ARG V 209 ? SER V 207 ARG V 209 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 3 ? 
BA ? 2 ? 
BB ? 3 ? 
CA ? 2 ? 
CB ? 3 ? 
DA ? 2 ? 
DB ? 3 ? 
EA ? 2 ? 
EB ? 3 ? 
FA ? 2 ? 
FB ? 3 ? 
GA ? 2 ? 
GB ? 3 ? 
HA ? 2 ? 
HB ? 3 ? 
IA ? 2 ? 
IB ? 3 ? 
JA ? 2 ? 
JB ? 3 ? 
KA ? 2 ? 
KB ? 3 ? 
LA ? 2 ? 
LB ? 3 ? 
MA ? 2 ? 
MB ? 3 ? 
NA ? 2 ? 
NB ? 3 ? 
OA ? 2 ? 
OB ? 3 ? 
PA ? 2 ? 
PB ? 3 ? 
QA ? 2 ? 
QB ? 3 ? 
RA ? 2 ? 
RB ? 3 ? 
SA ? 2 ? 
SB ? 3 ? 
TA ? 2 ? 
TB ? 3 ? 
UA ? 2 ? 
UB ? 3 ? 
VA ? 2 ? 
VB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? anti-parallel 
FA 1 2 ? anti-parallel 
FB 1 2 ? anti-parallel 
FB 2 3 ? anti-parallel 
GA 1 2 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
HA 1 2 ? anti-parallel 
HB 1 2 ? anti-parallel 
HB 2 3 ? anti-parallel 
IA 1 2 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
JA 1 2 ? anti-parallel 
JB 1 2 ? anti-parallel 
JB 2 3 ? anti-parallel 
KA 1 2 ? anti-parallel 
KB 1 2 ? anti-parallel 
KB 2 3 ? anti-parallel 
LA 1 2 ? anti-parallel 
LB 1 2 ? anti-parallel 
LB 2 3 ? anti-parallel 
MA 1 2 ? anti-parallel 
MB 1 2 ? anti-parallel 
MB 2 3 ? anti-parallel 
NA 1 2 ? anti-parallel 
NB 1 2 ? anti-parallel 
NB 2 3 ? anti-parallel 
OA 1 2 ? anti-parallel 
OB 1 2 ? anti-parallel 
OB 2 3 ? anti-parallel 
PA 1 2 ? anti-parallel 
PB 1 2 ? anti-parallel 
PB 2 3 ? anti-parallel 
QA 1 2 ? anti-parallel 
QB 1 2 ? anti-parallel 
QB 2 3 ? anti-parallel 
RA 1 2 ? anti-parallel 
RB 1 2 ? anti-parallel 
RB 2 3 ? anti-parallel 
SA 1 2 ? anti-parallel 
SB 1 2 ? anti-parallel 
SB 2 3 ? anti-parallel 
TA 1 2 ? anti-parallel 
TB 1 2 ? anti-parallel 
TB 2 3 ? anti-parallel 
UA 1 2 ? anti-parallel 
UB 1 2 ? anti-parallel 
UB 2 3 ? anti-parallel 
VA 1 2 ? anti-parallel 
VB 1 2 ? anti-parallel 
VB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 52  ? MET A 56  ? ILE A 52  MET A 56  
AA 2 LYS A 62  ? ILE A 66  ? LYS A 62  ILE A 66  
AB 1 TRP A 84  ? LEU A 98  ? TRP A 84  LEU A 98  
AB 2 PHE A 103 ? LEU A 115 ? PHE A 103 LEU A 115 
AB 3 TYR A 120 ? LEU A 132 ? TYR A 120 LEU A 132 
BA 1 ILE B 52  ? MET B 56  ? ILE B 52  MET B 56  
BA 2 LYS B 62  ? ILE B 66  ? LYS B 62  ILE B 66  
BB 1 TRP B 84  ? LEU B 98  ? TRP B 84  LEU B 98  
BB 2 PHE B 103 ? LEU B 115 ? PHE B 103 LEU B 115 
BB 3 TYR B 120 ? LEU B 132 ? TYR B 120 LEU B 132 
CA 1 ILE C 52  ? MET C 56  ? ILE C 52  MET C 56  
CA 2 LYS C 62  ? ILE C 66  ? LYS C 62  ILE C 66  
CB 1 TRP C 84  ? LEU C 98  ? TRP C 84  LEU C 98  
CB 2 PHE C 103 ? LEU C 115 ? PHE C 103 LEU C 115 
CB 3 TYR C 120 ? GLU C 130 ? TYR C 120 GLU C 130 
DA 1 ILE D 52  ? MET D 56  ? ILE D 52  MET D 56  
DA 2 LYS D 62  ? ILE D 66  ? LYS D 62  ILE D 66  
DB 1 TRP D 84  ? LEU D 98  ? TRP D 84  LEU D 98  
DB 2 PHE D 103 ? LEU D 115 ? PHE D 103 LEU D 115 
DB 3 TYR D 120 ? GLU D 130 ? TYR D 120 GLU D 130 
EA 1 ILE E 52  ? MET E 56  ? ILE E 52  MET E 56  
EA 2 LYS E 62  ? ILE E 66  ? LYS E 62  ILE E 66  
EB 1 TRP E 84  ? LEU E 98  ? TRP E 84  LEU E 98  
EB 2 PHE E 103 ? LEU E 115 ? PHE E 103 LEU E 115 
EB 3 TYR E 120 ? GLU E 130 ? TYR E 120 GLU E 130 
FA 1 ILE F 52  ? MET F 56  ? ILE F 52  MET F 56  
FA 2 LYS F 62  ? ILE F 66  ? LYS F 62  ILE F 66  
FB 1 TRP F 84  ? LEU F 98  ? TRP F 84  LEU F 98  
FB 2 PHE F 103 ? LEU F 115 ? PHE F 103 LEU F 115 
FB 3 TYR F 120 ? GLU F 130 ? TYR F 120 GLU F 130 
GA 1 ILE G 52  ? MET G 56  ? ILE G 52  MET G 56  
GA 2 LYS G 62  ? ILE G 66  ? LYS G 62  ILE G 66  
GB 1 TRP G 84  ? LEU G 98  ? TRP G 84  LEU G 98  
GB 2 PHE G 103 ? LEU G 115 ? PHE G 103 LEU G 115 
GB 3 TYR G 120 ? GLU G 130 ? TYR G 120 GLU G 130 
HA 1 ILE H 52  ? MET H 56  ? ILE H 52  MET H 56  
HA 2 LYS H 62  ? ILE H 66  ? LYS H 62  ILE H 66  
HB 1 TRP H 84  ? LEU H 98  ? TRP H 84  LEU H 98  
HB 2 PHE H 103 ? LEU H 115 ? PHE H 103 LEU H 115 
HB 3 TYR H 120 ? GLU H 130 ? TYR H 120 GLU H 130 
IA 1 ILE I 52  ? MET I 56  ? ILE I 52  MET I 56  
IA 2 LYS I 62  ? ILE I 66  ? LYS I 62  ILE I 66  
IB 1 TRP I 84  ? LEU I 98  ? TRP I 84  LEU I 98  
IB 2 PHE I 103 ? LEU I 115 ? PHE I 103 LEU I 115 
IB 3 TYR I 120 ? GLU I 130 ? TYR I 120 GLU I 130 
JA 1 ILE J 52  ? MET J 56  ? ILE J 52  MET J 56  
JA 2 LYS J 62  ? ILE J 66  ? LYS J 62  ILE J 66  
JB 1 TRP J 84  ? LEU J 98  ? TRP J 84  LEU J 98  
JB 2 PHE J 103 ? LEU J 115 ? PHE J 103 LEU J 115 
JB 3 TYR J 120 ? LEU J 132 ? TYR J 120 LEU J 132 
KA 1 ILE K 52  ? MET K 56  ? ILE K 52  MET K 56  
KA 2 LYS K 62  ? ILE K 66  ? LYS K 62  ILE K 66  
KB 1 TRP K 84  ? LEU K 98  ? TRP K 84  LEU K 98  
KB 2 PHE K 103 ? LEU K 115 ? PHE K 103 LEU K 115 
KB 3 TYR K 120 ? LEU K 132 ? TYR K 120 LEU K 132 
LA 1 ILE L 52  ? MET L 56  ? ILE L 52  MET L 56  
LA 2 LYS L 62  ? ILE L 66  ? LYS L 62  ILE L 66  
LB 1 TRP L 84  ? LEU L 98  ? TRP L 84  LEU L 98  
LB 2 PHE L 103 ? LEU L 115 ? PHE L 103 LEU L 115 
LB 3 TYR L 120 ? GLU L 130 ? TYR L 120 GLU L 130 
MA 1 ILE M 52  ? MET M 56  ? ILE M 52  MET M 56  
MA 2 LYS M 62  ? ILE M 66  ? LYS M 62  ILE M 66  
MB 1 TRP M 84  ? LEU M 98  ? TRP M 84  LEU M 98  
MB 2 PHE M 103 ? LEU M 115 ? PHE M 103 LEU M 115 
MB 3 TYR M 120 ? GLU M 130 ? TYR M 120 GLU M 130 
NA 1 ILE N 52  ? MET N 56  ? ILE N 52  MET N 56  
NA 2 LYS N 62  ? ILE N 66  ? LYS N 62  ILE N 66  
NB 1 TRP N 84  ? LEU N 98  ? TRP N 84  LEU N 98  
NB 2 PHE N 103 ? LEU N 115 ? PHE N 103 LEU N 115 
NB 3 TYR N 120 ? LEU N 132 ? TYR N 120 LEU N 132 
OA 1 ILE O 52  ? MET O 56  ? ILE O 52  MET O 56  
OA 2 LYS O 62  ? ILE O 66  ? LYS O 62  ILE O 66  
OB 1 TRP O 84  ? LEU O 98  ? TRP O 84  LEU O 98  
OB 2 PHE O 103 ? LEU O 115 ? PHE O 103 LEU O 115 
OB 3 TYR O 120 ? LEU O 132 ? TYR O 120 LEU O 132 
PA 1 ILE P 52  ? MET P 56  ? ILE P 52  MET P 56  
PA 2 LYS P 62  ? ILE P 66  ? LYS P 62  ILE P 66  
PB 1 TRP P 84  ? LEU P 98  ? TRP P 84  LEU P 98  
PB 2 PHE P 103 ? LEU P 115 ? PHE P 103 LEU P 115 
PB 3 TYR P 120 ? LEU P 132 ? TYR P 120 LEU P 132 
QA 1 ILE Q 52  ? MET Q 56  ? ILE Q 52  MET Q 56  
QA 2 LYS Q 62  ? ILE Q 66  ? LYS Q 62  ILE Q 66  
QB 1 TRP Q 84  ? LEU Q 98  ? TRP Q 84  LEU Q 98  
QB 2 PHE Q 103 ? LEU Q 115 ? PHE Q 103 LEU Q 115 
QB 3 TYR Q 120 ? GLU Q 130 ? TYR Q 120 GLU Q 130 
RA 1 ILE R 52  ? MET R 56  ? ILE R 52  MET R 56  
RA 2 LYS R 62  ? ILE R 66  ? LYS R 62  ILE R 66  
RB 1 TRP R 84  ? LEU R 98  ? TRP R 84  LEU R 98  
RB 2 PHE R 103 ? LEU R 115 ? PHE R 103 LEU R 115 
RB 3 TYR R 120 ? GLU R 130 ? TYR R 120 GLU R 130 
SA 1 ILE S 52  ? MET S 56  ? ILE S 52  MET S 56  
SA 2 LYS S 62  ? ILE S 66  ? LYS S 62  ILE S 66  
SB 1 TRP S 84  ? LEU S 98  ? TRP S 84  LEU S 98  
SB 2 PHE S 103 ? LEU S 115 ? PHE S 103 LEU S 115 
SB 3 TYR S 120 ? LEU S 132 ? TYR S 120 LEU S 132 
TA 1 ILE T 52  ? MET T 56  ? ILE T 52  MET T 56  
TA 2 LYS T 62  ? ILE T 66  ? LYS T 62  ILE T 66  
TB 1 TRP T 84  ? LEU T 98  ? TRP T 84  LEU T 98  
TB 2 PHE T 103 ? LEU T 115 ? PHE T 103 LEU T 115 
TB 3 TYR T 120 ? LEU T 132 ? TYR T 120 LEU T 132 
UA 1 ILE U 52  ? MET U 56  ? ILE U 52  MET U 56  
UA 2 LYS U 62  ? ILE U 66  ? LYS U 62  ILE U 66  
UB 1 TRP U 84  ? LEU U 98  ? TRP U 84  LEU U 98  
UB 2 PHE U 103 ? LEU U 115 ? PHE U 103 LEU U 115 
UB 3 TYR U 120 ? GLU U 130 ? TYR U 120 GLU U 130 
VA 1 ILE V 52  ? MET V 56  ? ILE V 52  MET V 56  
VA 2 LYS V 62  ? ILE V 66  ? LYS V 62  ILE V 66  
VB 1 TRP V 84  ? LEU V 98  ? TRP V 84  LEU V 98  
VB 2 PHE V 103 ? LEU V 115 ? PHE V 103 LEU V 115 
VB 3 TYR V 120 ? LEU V 132 ? TYR V 120 LEU V 132 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ARG A 55  ? N ARG A 55  O VAL A 63  ? O VAL A 63  
AB 1 2 N ASP A 97  ? N ASP A 97  O TYR A 104 ? O TYR A 104 
AB 2 3 N VAL A 113 ? N VAL A 113 O HIS A 121 ? O HIS A 121 
BA 1 2 N ARG B 55  ? N ARG B 55  O VAL B 63  ? O VAL B 63  
BB 1 2 N ASP B 97  ? N ASP B 97  O TYR B 104 ? O TYR B 104 
BB 2 3 N VAL B 113 ? N VAL B 113 O HIS B 121 ? O HIS B 121 
CA 1 2 N ARG C 55  ? N ARG C 55  O VAL C 63  ? O VAL C 63  
CB 1 2 N ASP C 97  ? N ASP C 97  O TYR C 104 ? O TYR C 104 
CB 2 3 N VAL C 113 ? N VAL C 113 O HIS C 121 ? O HIS C 121 
DA 1 2 N ARG D 55  ? N ARG D 55  O VAL D 63  ? O VAL D 63  
DB 1 2 N ASP D 97  ? N ASP D 97  O TYR D 104 ? O TYR D 104 
DB 2 3 N VAL D 113 ? N VAL D 113 O HIS D 121 ? O HIS D 121 
EA 1 2 N ARG E 55  ? N ARG E 55  O VAL E 63  ? O VAL E 63  
EB 1 2 N ASP E 97  ? N ASP E 97  O TYR E 104 ? O TYR E 104 
EB 2 3 N VAL E 113 ? N VAL E 113 O HIS E 121 ? O HIS E 121 
FA 1 2 N ARG F 55  ? N ARG F 55  O VAL F 63  ? O VAL F 63  
FB 1 2 N ASP F 97  ? N ASP F 97  O TYR F 104 ? O TYR F 104 
FB 2 3 N VAL F 113 ? N VAL F 113 O HIS F 121 ? O HIS F 121 
GA 1 2 N ARG G 55  ? N ARG G 55  O VAL G 63  ? O VAL G 63  
GB 1 2 N ASP G 97  ? N ASP G 97  O TYR G 104 ? O TYR G 104 
GB 2 3 N VAL G 113 ? N VAL G 113 O HIS G 121 ? O HIS G 121 
HA 1 2 N ARG H 55  ? N ARG H 55  O VAL H 63  ? O VAL H 63  
HB 1 2 N ASP H 97  ? N ASP H 97  O TYR H 104 ? O TYR H 104 
HB 2 3 N VAL H 113 ? N VAL H 113 O HIS H 121 ? O HIS H 121 
IA 1 2 N ARG I 55  ? N ARG I 55  O VAL I 63  ? O VAL I 63  
IB 1 2 N ASP I 97  ? N ASP I 97  O TYR I 104 ? O TYR I 104 
IB 2 3 N VAL I 113 ? N VAL I 113 O HIS I 121 ? O HIS I 121 
JA 1 2 N ARG J 55  ? N ARG J 55  O VAL J 63  ? O VAL J 63  
JB 1 2 N ASP J 97  ? N ASP J 97  O TYR J 104 ? O TYR J 104 
JB 2 3 N VAL J 113 ? N VAL J 113 O HIS J 121 ? O HIS J 121 
KA 1 2 N ARG K 55  ? N ARG K 55  O VAL K 63  ? O VAL K 63  
KB 1 2 N ASP K 97  ? N ASP K 97  O TYR K 104 ? O TYR K 104 
KB 2 3 N VAL K 113 ? N VAL K 113 O HIS K 121 ? O HIS K 121 
LA 1 2 N ARG L 55  ? N ARG L 55  O VAL L 63  ? O VAL L 63  
LB 1 2 N ASP L 97  ? N ASP L 97  O TYR L 104 ? O TYR L 104 
LB 2 3 N VAL L 113 ? N VAL L 113 O HIS L 121 ? O HIS L 121 
MA 1 2 N ARG M 55  ? N ARG M 55  O VAL M 63  ? O VAL M 63  
MB 1 2 N ASP M 97  ? N ASP M 97  O TYR M 104 ? O TYR M 104 
MB 2 3 N VAL M 113 ? N VAL M 113 O HIS M 121 ? O HIS M 121 
NA 1 2 N ARG N 55  ? N ARG N 55  O VAL N 63  ? O VAL N 63  
NB 1 2 N ASP N 97  ? N ASP N 97  O TYR N 104 ? O TYR N 104 
NB 2 3 N VAL N 113 ? N VAL N 113 O HIS N 121 ? O HIS N 121 
OA 1 2 N ARG O 55  ? N ARG O 55  O VAL O 63  ? O VAL O 63  
OB 1 2 N ASP O 97  ? N ASP O 97  O TYR O 104 ? O TYR O 104 
OB 2 3 N VAL O 113 ? N VAL O 113 O HIS O 121 ? O HIS O 121 
PA 1 2 N ARG P 55  ? N ARG P 55  O VAL P 63  ? O VAL P 63  
PB 1 2 N ASP P 97  ? N ASP P 97  O TYR P 104 ? O TYR P 104 
PB 2 3 N VAL P 113 ? N VAL P 113 O HIS P 121 ? O HIS P 121 
QA 1 2 N ARG Q 55  ? N ARG Q 55  O VAL Q 63  ? O VAL Q 63  
QB 1 2 N ASP Q 97  ? N ASP Q 97  O TYR Q 104 ? O TYR Q 104 
QB 2 3 N VAL Q 113 ? N VAL Q 113 O HIS Q 121 ? O HIS Q 121 
RA 1 2 N ARG R 55  ? N ARG R 55  O VAL R 63  ? O VAL R 63  
RB 1 2 N ASP R 97  ? N ASP R 97  O TYR R 104 ? O TYR R 104 
RB 2 3 N VAL R 113 ? N VAL R 113 O HIS R 121 ? O HIS R 121 
SA 1 2 N ARG S 55  ? N ARG S 55  O VAL S 63  ? O VAL S 63  
SB 1 2 N ASP S 97  ? N ASP S 97  O TYR S 104 ? O TYR S 104 
SB 2 3 N VAL S 113 ? N VAL S 113 O HIS S 121 ? O HIS S 121 
TA 1 2 N ARG T 55  ? N ARG T 55  O VAL T 63  ? O VAL T 63  
TB 1 2 N ASP T 97  ? N ASP T 97  O TYR T 104 ? O TYR T 104 
TB 2 3 N VAL T 113 ? N VAL T 113 O HIS T 121 ? O HIS T 121 
UA 1 2 N ARG U 55  ? N ARG U 55  O VAL U 63  ? O VAL U 63  
UB 1 2 N ASP U 97  ? N ASP U 97  O TYR U 104 ? O TYR U 104 
UB 2 3 N VAL U 113 ? N VAL U 113 O HIS U 121 ? O HIS U 121 
VA 1 2 N ARG V 55  ? N ARG V 55  O VAL V 63  ? O VAL V 63  
VB 1 2 N ASP V 97  ? N ASP V 97  O TYR V 104 ? O TYR V 104 
VB 2 3 N VAL V 113 ? N VAL V 113 O HIS V 121 ? O HIS V 121 
# 
_database_PDB_matrix.entry_id          1H2I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H2I 
_atom_sites.fract_transf_matrix[1][1]   0.008528 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000043 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007854 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005229 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LEU A  1 24  ? 33.200  54.744  156.054 1.00 57.70  ? 24   LEU A N   1 
ATOM   2     C CA  . LEU A  1 24  ? 34.539  54.595  155.377 1.00 59.23  ? 24   LEU A CA  1 
ATOM   3     C C   . LEU A  1 24  ? 34.802  55.794  154.422 1.00 58.77  ? 24   LEU A C   1 
ATOM   4     O O   . LEU A  1 24  ? 35.484  55.712  153.363 1.00 58.37  ? 24   LEU A O   1 
ATOM   5     C CB  . LEU A  1 24  ? 34.607  53.261  154.606 1.00 59.62  ? 24   LEU A CB  1 
ATOM   6     C CG  . LEU A  1 24  ? 35.968  52.561  154.784 1.00 60.72  ? 24   LEU A CG  1 
ATOM   7     C CD1 . LEU A  1 24  ? 37.119  53.392  154.229 1.00 61.77  ? 24   LEU A CD1 1 
ATOM   8     C CD2 . LEU A  1 24  ? 36.189  52.342  156.257 1.00 60.11  ? 24   LEU A CD2 1 
ATOM   9     N N   . CYS A  1 25  ? 34.234  56.919  154.838 1.00 56.94  ? 25   CYS A N   1 
ATOM   10    C CA  . CYS A  1 25  ? 34.327  58.183  154.120 1.00 54.63  ? 25   CYS A CA  1 
ATOM   11    C C   . CYS A  1 25  ? 35.670  58.917  154.340 1.00 52.10  ? 25   CYS A C   1 
ATOM   12    O O   . CYS A  1 25  ? 36.599  58.381  154.940 1.00 52.94  ? 25   CYS A O   1 
ATOM   13    C CB  . CYS A  1 25  ? 33.189  59.063  154.601 1.00 54.67  ? 25   CYS A CB  1 
ATOM   14    S SG  . CYS A  1 25  ? 33.233  59.281  156.406 1.00 56.12  ? 25   CYS A SG  1 
ATOM   15    N N   . PHE A  1 26  ? 35.753  60.159  153.873 1.00 48.04  ? 26   PHE A N   1 
ATOM   16    C CA  . PHE A  1 26  ? 36.977  60.931  154.010 1.00 43.05  ? 26   PHE A CA  1 
ATOM   17    C C   . PHE A  1 26  ? 37.306  61.148  155.464 1.00 41.05  ? 26   PHE A C   1 
ATOM   18    O O   . PHE A  1 26  ? 36.440  61.512  156.239 1.00 39.19  ? 26   PHE A O   1 
ATOM   19    C CB  . PHE A  1 26  ? 36.837  62.282  153.326 1.00 39.03  ? 26   PHE A CB  1 
ATOM   20    C CG  . PHE A  1 26  ? 38.124  63.013  153.205 1.00 34.38  ? 26   PHE A CG  1 
ATOM   21    C CD1 . PHE A  1 26  ? 38.944  62.816  152.117 1.00 32.76  ? 26   PHE A CD1 1 
ATOM   22    C CD2 . PHE A  1 26  ? 38.558  63.840  154.215 1.00 32.25  ? 26   PHE A CD2 1 
ATOM   23    C CE1 . PHE A  1 26  ? 40.181  63.410  152.038 1.00 30.58  ? 26   PHE A CE1 1 
ATOM   24    C CE2 . PHE A  1 26  ? 39.801  64.432  154.143 1.00 31.40  ? 26   PHE A CE2 1 
ATOM   25    C CZ  . PHE A  1 26  ? 40.611  64.215  153.041 1.00 29.61  ? 26   PHE A CZ  1 
ATOM   26    N N   . GLY A  1 27  ? 38.570  60.922  155.817 1.00 40.72  ? 27   GLY A N   1 
ATOM   27    C CA  . GLY A  1 27  ? 39.010  61.118  157.185 1.00 40.76  ? 27   GLY A CA  1 
ATOM   28    C C   . GLY A  1 27  ? 39.035  59.833  157.982 1.00 42.28  ? 27   GLY A C   1 
ATOM   29    O O   . GLY A  1 27  ? 39.586  59.766  159.061 1.00 41.82  ? 27   GLY A O   1 
ATOM   30    N N   . GLN A  1 28  ? 38.430  58.786  157.439 1.00 44.71  ? 28   GLN A N   1 
ATOM   31    C CA  . GLN A  1 28  ? 38.366  57.502  158.114 1.00 44.94  ? 28   GLN A CA  1 
ATOM   32    C C   . GLN A  1 28  ? 38.986  56.351  157.356 1.00 45.98  ? 28   GLN A C   1 
ATOM   33    O O   . GLN A  1 28  ? 38.803  55.222  157.742 1.00 46.84  ? 28   GLN A O   1 
ATOM   34    C CB  . GLN A  1 28  ? 36.941  57.158  158.397 1.00 45.71  ? 28   GLN A CB  1 
ATOM   35    C CG  . GLN A  1 28  ? 36.317  58.061  159.414 1.00 49.38  ? 28   GLN A CG  1 
ATOM   36    C CD  . GLN A  1 28  ? 34.805  57.853  159.475 1.00 52.39  ? 28   GLN A CD  1 
ATOM   37    O OE1 . GLN A  1 28  ? 34.146  58.385  160.363 1.00 54.99  ? 28   GLN A OE1 1 
ATOM   38    N NE2 . GLN A  1 28  ? 34.243  57.082  158.517 1.00 53.23  ? 28   GLN A NE2 1 
ATOM   39    N N   . CYS A  1 29  ? 39.684  56.619  156.263 1.00 46.41  ? 29   CYS A N   1 
ATOM   40    C CA  . CYS A  1 29  ? 40.331  55.557  155.536 1.00 48.13  ? 29   CYS A CA  1 
ATOM   41    C C   . CYS A  1 29  ? 41.579  55.260  156.268 1.00 47.50  ? 29   CYS A C   1 
ATOM   42    O O   . CYS A  1 29  ? 41.983  56.011  157.144 1.00 47.70  ? 29   CYS A O   1 
ATOM   43    C CB  . CYS A  1 29  ? 40.730  55.999  154.150 1.00 49.90  ? 29   CYS A CB  1 
ATOM   44    S SG  . CYS A  1 29  ? 39.324  55.991  153.138 1.00 62.51  ? 29   CYS A SG  1 
ATOM   45    N N   . GLN A  1 30  ? 42.186  54.143  155.922 1.00 46.68  ? 30   GLN A N   1 
ATOM   46    C CA  . GLN A  1 30  ? 43.440  53.785  156.510 1.00 46.12  ? 30   GLN A CA  1 
ATOM   47    C C   . GLN A  1 30  ? 44.171  53.347  155.251 1.00 45.49  ? 30   GLN A C   1 
ATOM   48    O O   . GLN A  1 30  ? 43.601  52.657  154.406 1.00 45.03  ? 30   GLN A O   1 
ATOM   49    C CB  . GLN A  1 30  ? 43.275  52.662  157.511 1.00 47.82  ? 30   GLN A CB  1 
ATOM   50    C CG  . GLN A  1 30  ? 44.537  52.412  158.297 1.00 54.19  ? 30   GLN A CG  1 
ATOM   51    C CD  . GLN A  1 30  ? 44.548  51.083  159.079 1.00 57.00  ? 30   GLN A CD  1 
ATOM   52    O OE1 . GLN A  1 30  ? 45.613  50.655  159.589 1.00 57.76  ? 30   GLN A OE1 1 
ATOM   53    N NE2 . GLN A  1 30  ? 43.374  50.432  159.188 1.00 57.17  ? 30   GLN A NE2 1 
ATOM   54    N N   . TYR A  1 31  ? 45.401  53.811  155.069 1.00 44.16  ? 31   TYR A N   1 
ATOM   55    C CA  . TYR A  1 31  ? 46.120  53.439  153.877 1.00 43.28  ? 31   TYR A CA  1 
ATOM   56    C C   . TYR A  1 31  ? 46.485  51.973  153.884 1.00 44.19  ? 31   TYR A C   1 
ATOM   57    O O   . TYR A  1 31  ? 46.903  51.430  154.895 1.00 44.90  ? 31   TYR A O   1 
ATOM   58    C CB  . TYR A  1 31  ? 47.385  54.254  153.727 1.00 41.22  ? 31   TYR A CB  1 
ATOM   59    C CG  . TYR A  1 31  ? 47.139  55.627  153.162 1.00 42.01  ? 31   TYR A CG  1 
ATOM   60    C CD1 . TYR A  1 31  ? 47.081  56.756  153.995 1.00 41.07  ? 31   TYR A CD1 1 
ATOM   61    C CD2 . TYR A  1 31  ? 46.951  55.810  151.798 1.00 40.92  ? 31   TYR A CD2 1 
ATOM   62    C CE1 . TYR A  1 31  ? 46.849  57.995  153.488 1.00 39.37  ? 31   TYR A CE1 1 
ATOM   63    C CE2 . TYR A  1 31  ? 46.719  57.059  151.290 1.00 40.82  ? 31   TYR A CE2 1 
ATOM   64    C CZ  . TYR A  1 31  ? 46.673  58.144  152.139 1.00 40.27  ? 31   TYR A CZ  1 
ATOM   65    O OH  . TYR A  1 31  ? 46.484  59.396  151.607 1.00 41.60  ? 31   TYR A OH  1 
ATOM   66    N N   . THR A  1 32  ? 46.302  51.325  152.747 1.00 44.32  ? 32   THR A N   1 
ATOM   67    C CA  . THR A  1 32  ? 46.678  49.938  152.622 1.00 44.72  ? 32   THR A CA  1 
ATOM   68    C C   . THR A  1 32  ? 48.206  49.964  152.583 1.00 45.50  ? 32   THR A C   1 
ATOM   69    O O   . THR A  1 32  ? 48.814  50.992  152.230 1.00 45.05  ? 32   THR A O   1 
ATOM   70    C CB  . THR A  1 32  ? 46.167  49.338  151.308 1.00 43.16  ? 32   THR A CB  1 
ATOM   71    O OG1 . THR A  1 32  ? 46.830  49.964  150.196 1.00 43.18  ? 32   THR A OG1 1 
ATOM   72    C CG2 . THR A  1 32  ? 44.680  49.540  151.204 1.00 41.54  ? 32   THR A CG2 1 
ATOM   73    N N   . ALA A  1 33  ? 48.830  48.846  152.944 1.00 45.79  ? 33   ALA A N   1 
ATOM   74    C CA  . ALA A  1 33  ? 50.283  48.782  152.929 1.00 45.51  ? 33   ALA A CA  1 
ATOM   75    C C   . ALA A  1 33  ? 50.843  49.163  151.567 1.00 46.06  ? 33   ALA A C   1 
ATOM   76    O O   . ALA A  1 33  ? 51.831  49.887  151.484 1.00 45.76  ? 33   ALA A O   1 
ATOM   77    C CB  . ALA A  1 33  ? 50.739  47.402  153.291 1.00 44.14  ? 33   ALA A CB  1 
ATOM   78    N N   . GLU A  1 34  ? 50.201  48.687  150.498 1.00 46.57  ? 34   GLU A N   1 
ATOM   79    C CA  . GLU A  1 34  ? 50.682  48.962  149.160 1.00 46.18  ? 34   GLU A CA  1 
ATOM   80    C C   . GLU A  1 34  ? 50.621  50.463  148.798 1.00 44.93  ? 34   GLU A C   1 
ATOM   81    O O   . GLU A  1 34  ? 51.611  51.031  148.301 1.00 43.80  ? 34   GLU A O   1 
ATOM   82    C CB  . GLU A  1 34  ? 49.902  48.123  148.153 1.00 48.36  ? 34   GLU A CB  1 
ATOM   83    C CG  . GLU A  1 34  ? 50.697  47.869  146.870 1.00 53.62  ? 34   GLU A CG  1 
ATOM   84    C CD  . GLU A  1 34  ? 49.847  47.375  145.670 1.00 57.21  ? 34   GLU A CD  1 
ATOM   85    O OE1 . GLU A  1 34  ? 50.311  47.523  144.500 1.00 57.78  ? 34   GLU A OE1 1 
ATOM   86    O OE2 . GLU A  1 34  ? 48.724  46.840  145.891 1.00 60.37  ? 34   GLU A OE2 1 
ATOM   87    N N   . GLU A  1 35  ? 49.491  51.117  149.064 1.00 43.43  ? 35   GLU A N   1 
ATOM   88    C CA  . GLU A  1 35  ? 49.398  52.540  148.740 1.00 41.79  ? 35   GLU A CA  1 
ATOM   89    C C   . GLU A  1 35  ? 50.359  53.362  149.625 1.00 39.68  ? 35   GLU A C   1 
ATOM   90    O O   . GLU A  1 35  ? 51.061  54.275  149.132 1.00 37.84  ? 35   GLU A O   1 
ATOM   91    C CB  . GLU A  1 35  ? 47.940  53.051  148.864 1.00 41.66  ? 35   GLU A CB  1 
ATOM   92    C CG  . GLU A  1 35  ? 47.749  54.448  148.243 1.00 43.38  ? 35   GLU A CG  1 
ATOM   93    C CD  . GLU A  1 35  ? 46.309  54.986  148.320 1.00 44.43  ? 35   GLU A CD  1 
ATOM   94    O OE1 . GLU A  1 35  ? 46.100  56.171  147.978 1.00 42.58  ? 35   GLU A OE1 1 
ATOM   95    O OE2 . GLU A  1 35  ? 45.384  54.240  148.714 1.00 43.79  ? 35   GLU A OE2 1 
ATOM   96    N N   . TYR A  1 36  ? 50.401  53.026  150.917 1.00 37.81  ? 36   TYR A N   1 
ATOM   97    C CA  . TYR A  1 36  ? 51.279  53.715  151.855 1.00 36.68  ? 36   TYR A CA  1 
ATOM   98    C C   . TYR A  1 36  ? 52.704  53.682  151.363 1.00 37.46  ? 36   TYR A C   1 
ATOM   99    O O   . TYR A  1 36  ? 53.359  54.713  151.222 1.00 37.28  ? 36   TYR A O   1 
ATOM   100   C CB  . TYR A  1 36  ? 51.234  53.066  153.230 1.00 36.27  ? 36   TYR A CB  1 
ATOM   101   C CG  . TYR A  1 36  ? 52.467  53.390  154.015 1.00 36.90  ? 36   TYR A CG  1 
ATOM   102   C CD1 . TYR A  1 36  ? 52.653  54.658  154.577 1.00 37.35  ? 36   TYR A CD1 1 
ATOM   103   C CD2 . TYR A  1 36  ? 53.529  52.499  154.053 1.00 38.11  ? 36   TYR A CD2 1 
ATOM   104   C CE1 . TYR A  1 36  ? 53.873  55.038  155.132 1.00 36.24  ? 36   TYR A CE1 1 
ATOM   105   C CE2 . TYR A  1 36  ? 54.763  52.870  154.610 1.00 38.77  ? 36   TYR A CE2 1 
ATOM   106   C CZ  . TYR A  1 36  ? 54.933  54.145  155.136 1.00 37.76  ? 36   TYR A CZ  1 
ATOM   107   O OH  . TYR A  1 36  ? 56.187  54.529  155.568 1.00 36.02  ? 36   TYR A OH  1 
ATOM   108   N N   . GLN A  1 37  ? 53.184  52.479  151.089 1.00 38.74  ? 37   GLN A N   1 
ATOM   109   C CA  . GLN A  1 37  ? 54.542  52.296  150.608 1.00 39.81  ? 37   GLN A CA  1 
ATOM   110   C C   . GLN A  1 37  ? 54.831  53.054  149.307 1.00 39.40  ? 37   GLN A C   1 
ATOM   111   O O   . GLN A  1 37  ? 55.884  53.696  149.189 1.00 39.84  ? 37   GLN A O   1 
ATOM   112   C CB  . GLN A  1 37  ? 54.832  50.813  150.416 1.00 41.73  ? 37   GLN A CB  1 
ATOM   113   C CG  . GLN A  1 37  ? 56.301  50.524  150.159 1.00 46.78  ? 37   GLN A CG  1 
ATOM   114   C CD  . GLN A  1 37  ? 56.544  49.170  149.454 1.00 50.30  ? 37   GLN A CD  1 
ATOM   115   O OE1 . GLN A  1 37  ? 56.621  48.110  150.099 1.00 51.46  ? 37   GLN A OE1 1 
ATOM   116   N NE2 . GLN A  1 37  ? 56.652  49.205  148.118 1.00 51.42  ? 37   GLN A NE2 1 
ATOM   117   N N   . ALA A  1 38  ? 53.924  52.968  148.326 1.00 38.66  ? 38   ALA A N   1 
ATOM   118   C CA  . ALA A  1 38  ? 54.113  53.675  147.061 1.00 36.97  ? 38   ALA A CA  1 
ATOM   119   C C   . ALA A  1 38  ? 54.236  55.174  147.285 1.00 38.00  ? 38   ALA A C   1 
ATOM   120   O O   . ALA A  1 38  ? 55.115  55.821  146.707 1.00 37.26  ? 38   ALA A O   1 
ATOM   121   C CB  . ALA A  1 38  ? 52.959  53.403  146.148 1.00 36.48  ? 38   ALA A CB  1 
ATOM   122   N N   . ILE A  1 39  ? 53.356  55.719  148.137 1.00 38.14  ? 39   ILE A N   1 
ATOM   123   C CA  . ILE A  1 39  ? 53.377  57.145  148.418 1.00 38.11  ? 39   ILE A CA  1 
ATOM   124   C C   . ILE A  1 39  ? 54.641  57.565  149.198 1.00 39.34  ? 39   ILE A C   1 
ATOM   125   O O   . ILE A  1 39  ? 55.297  58.553  148.810 1.00 39.15  ? 39   ILE A O   1 
ATOM   126   C CB  . ILE A  1 39  ? 52.063  57.584  149.131 1.00 35.89  ? 39   ILE A CB  1 
ATOM   127   C CG1 . ILE A  1 39  ? 50.917  57.463  148.150 1.00 34.22  ? 39   ILE A CG1 1 
ATOM   128   C CG2 . ILE A  1 39  ? 52.150  58.994  149.615 1.00 33.20  ? 39   ILE A CG2 1 
ATOM   129   C CD1 . ILE A  1 39  ? 49.586  57.717  148.773 1.00 35.48  ? 39   ILE A CD1 1 
ATOM   130   N N   . GLN A  1 40  ? 54.991  56.831  150.269 1.00 40.03  ? 40   GLN A N   1 
ATOM   131   C CA  . GLN A  1 40  ? 56.208  57.152  151.041 1.00 39.97  ? 40   GLN A CA  1 
ATOM   132   C C   . GLN A  1 40  ? 57.373  57.349  150.075 1.00 39.47  ? 40   GLN A C   1 
ATOM   133   O O   . GLN A  1 40  ? 58.112  58.330  150.171 1.00 39.40  ? 40   GLN A O   1 
ATOM   134   C CB  . GLN A  1 40  ? 56.617  56.031  151.987 1.00 41.41  ? 40   GLN A CB  1 
ATOM   135   C CG  . GLN A  1 40  ? 56.549  56.331  153.470 1.00 45.23  ? 40   GLN A CG  1 
ATOM   136   C CD  . GLN A  1 40  ? 57.372  57.512  153.903 1.00 46.19  ? 40   GLN A CD  1 
ATOM   137   O OE1 . GLN A  1 40  ? 57.961  57.500  154.961 1.00 48.40  ? 40   GLN A OE1 1 
ATOM   138   N NE2 . GLN A  1 40  ? 57.405  58.544  153.097 1.00 51.27  ? 40   GLN A NE2 1 
ATOM   139   N N   . LYS A  1 41  ? 57.540  56.409  149.150 1.00 38.21  ? 41   LYS A N   1 
ATOM   140   C CA  . LYS A  1 41  ? 58.618  56.507  148.178 1.00 38.00  ? 41   LYS A CA  1 
ATOM   141   C C   . LYS A  1 41  ? 58.466  57.683  147.248 1.00 35.74  ? 41   LYS A C   1 
ATOM   142   O O   . LYS A  1 41  ? 59.382  58.475  147.115 1.00 34.88  ? 41   LYS A O   1 
ATOM   143   C CB  . LYS A  1 41  ? 58.722  55.232  147.350 1.00 40.54  ? 41   LYS A CB  1 
ATOM   144   C CG  . LYS A  1 41  ? 59.250  54.072  148.162 1.00 46.64  ? 41   LYS A CG  1 
ATOM   145   C CD  . LYS A  1 41  ? 59.118  52.752  147.431 1.00 50.01  ? 41   LYS A CD  1 
ATOM   146   C CE  . LYS A  1 41  ? 59.600  51.595  148.328 1.00 53.08  ? 41   LYS A CE  1 
ATOM   147   N NZ  . LYS A  1 41  ? 59.401  50.264  147.657 1.00 55.07  ? 41   LYS A NZ  1 
ATOM   148   N N   . ALA A  1 42  ? 57.306  57.805  146.616 1.00 34.02  ? 42   ALA A N   1 
ATOM   149   C CA  . ALA A  1 42  ? 57.080  58.895  145.694 1.00 31.92  ? 42   ALA A CA  1 
ATOM   150   C C   . ALA A  1 42  ? 57.349  60.261  146.318 1.00 30.73  ? 42   ALA A C   1 
ATOM   151   O O   . ALA A  1 42  ? 57.963  61.124  145.684 1.00 29.31  ? 42   ALA A O   1 
ATOM   152   C CB  . ALA A  1 42  ? 55.662  58.822  145.140 1.00 31.21  ? 42   ALA A CB  1 
ATOM   153   N N   . LEU A  1 43  ? 56.925  60.449  147.562 1.00 30.02  ? 43   LEU A N   1 
ATOM   154   C CA  . LEU A  1 43  ? 57.115  61.741  148.227 1.00 31.67  ? 43   LEU A CA  1 
ATOM   155   C C   . LEU A  1 43  ? 58.566  62.198  148.353 1.00 33.37  ? 43   LEU A C   1 
ATOM   156   O O   . LEU A  1 43  ? 58.833  63.399  148.415 1.00 35.18  ? 43   LEU A O   1 
ATOM   157   C CB  . LEU A  1 43  ? 56.444  61.746  149.615 1.00 28.63  ? 43   LEU A CB  1 
ATOM   158   C CG  . LEU A  1 43  ? 54.907  61.735  149.513 1.00 30.41  ? 43   LEU A CG  1 
ATOM   159   C CD1 . LEU A  1 43  ? 54.260  61.609  150.898 1.00 26.67  ? 43   LEU A CD1 1 
ATOM   160   C CD2 . LEU A  1 43  ? 54.438  63.018  148.783 1.00 29.57  ? 43   LEU A CD2 1 
ATOM   161   N N   . ARG A  1 44  ? 59.494  61.248  148.386 1.00 34.21  ? 44   ARG A N   1 
ATOM   162   C CA  . ARG A  1 44  ? 60.915  61.543  148.526 1.00 35.68  ? 44   ARG A CA  1 
ATOM   163   C C   . ARG A  1 44  ? 61.521  62.268  147.343 1.00 35.65  ? 44   ARG A C   1 
ATOM   164   O O   . ARG A  1 44  ? 62.436  63.042  147.517 1.00 35.61  ? 44   ARG A O   1 
ATOM   165   C CB  . ARG A  1 44  ? 61.717  60.250  148.795 1.00 36.23  ? 44   ARG A CB  1 
ATOM   166   C CG  . ARG A  1 44  ? 61.427  59.620  150.158 1.00 37.42  ? 44   ARG A CG  1 
ATOM   167   C CD  . ARG A  1 44  ? 62.452  58.593  150.556 1.00 36.55  ? 44   ARG A CD  1 
ATOM   168   N NE  . ARG A  1 44  ? 62.026  57.209  150.353 1.00 37.47  ? 44   ARG A NE  1 
ATOM   169   C CZ  . ARG A  1 44  ? 61.554  56.407  151.315 1.00 37.83  ? 44   ARG A CZ  1 
ATOM   170   N NH1 . ARG A  1 44  ? 61.433  56.854  152.549 1.00 35.43  ? 44   ARG A NH1 1 
ATOM   171   N NH2 . ARG A  1 44  ? 61.246  55.133  151.061 1.00 38.69  ? 44   ARG A NH2 1 
ATOM   172   N N   . GLN A  1 45  ? 60.991  62.053  146.149 1.00 37.45  ? 45   GLN A N   1 
ATOM   173   C CA  . GLN A  1 45  ? 61.544  62.690  144.949 1.00 40.14  ? 45   GLN A CA  1 
ATOM   174   C C   . GLN A  1 45  ? 61.641  64.210  145.028 1.00 41.11  ? 45   GLN A C   1 
ATOM   175   O O   . GLN A  1 45  ? 60.806  64.862  145.630 1.00 40.71  ? 45   GLN A O   1 
ATOM   176   C CB  . GLN A  1 45  ? 60.711  62.346  143.719 1.00 40.90  ? 45   GLN A CB  1 
ATOM   177   C CG  . GLN A  1 45  ? 60.452  60.865  143.522 1.00 44.28  ? 45   GLN A CG  1 
ATOM   178   C CD  . GLN A  1 45  ? 59.416  60.586  142.449 1.00 45.76  ? 45   GLN A CD  1 
ATOM   179   O OE1 . GLN A  1 45  ? 59.215  59.460  142.075 1.00 48.82  ? 45   GLN A OE1 1 
ATOM   180   N NE2 . GLN A  1 45  ? 58.747  61.616  141.971 1.00 49.01  ? 45   GLN A NE2 1 
ATOM   181   N N   . ARG A  1 46  ? 62.685  64.772  144.438 1.00 42.45  ? 46   ARG A N   1 
ATOM   182   C CA  . ARG A  1 46  ? 62.814  66.216  144.404 1.00 44.31  ? 46   ARG A CA  1 
ATOM   183   C C   . ARG A  1 46  ? 62.157  66.547  143.071 1.00 45.20  ? 46   ARG A C   1 
ATOM   184   O O   . ARG A  1 46  ? 62.054  65.677  142.213 1.00 46.14  ? 46   ARG A O   1 
ATOM   185   C CB  . ARG A  1 46  ? 64.272  66.627  144.351 1.00 45.57  ? 46   ARG A CB  1 
ATOM   186   C CG  . ARG A  1 46  ? 65.144  65.942  145.341 1.00 48.18  ? 46   ARG A CG  1 
ATOM   187   C CD  . ARG A  1 46  ? 65.812  66.950  146.195 1.00 51.84  ? 46   ARG A CD  1 
ATOM   188   N NE  . ARG A  1 46  ? 66.850  66.339  146.997 1.00 55.89  ? 46   ARG A NE  1 
ATOM   189   C CZ  . ARG A  1 46  ? 67.201  66.770  148.200 1.00 58.67  ? 46   ARG A CZ  1 
ATOM   190   N NH1 . ARG A  1 46  ? 66.583  67.823  148.759 1.00 59.10  ? 46   ARG A NH1 1 
ATOM   191   N NH2 . ARG A  1 46  ? 68.199  66.160  148.828 1.00 60.59  ? 46   ARG A NH2 1 
ATOM   192   N N   . LEU A  1 47  ? 61.704  67.771  142.849 1.00 45.60  ? 47   LEU A N   1 
ATOM   193   C CA  . LEU A  1 47  ? 61.098  67.978  141.551 1.00 46.66  ? 47   LEU A CA  1 
ATOM   194   C C   . LEU A  1 47  ? 61.987  68.627  140.513 1.00 45.93  ? 47   LEU A C   1 
ATOM   195   O O   . LEU A  1 47  ? 62.856  69.448  140.820 1.00 46.19  ? 47   LEU A O   1 
ATOM   196   C CB  . LEU A  1 47  ? 59.744  68.711  141.647 1.00 47.99  ? 47   LEU A CB  1 
ATOM   197   C CG  . LEU A  1 47  ? 59.235  69.497  142.845 1.00 48.44  ? 47   LEU A CG  1 
ATOM   198   C CD1 . LEU A  1 47  ? 57.780  69.653  142.693 1.00 48.47  ? 47   LEU A CD1 1 
ATOM   199   C CD2 . LEU A  1 47  ? 59.473  68.761  144.108 1.00 50.98  ? 47   LEU A CD2 1 
ATOM   200   N N   . GLY A  1 48  ? 61.757  68.227  139.273 1.00 44.53  ? 48   GLY A N   1 
ATOM   201   C CA  . GLY A  1 48  ? 62.526  68.740  138.167 1.00 44.57  ? 48   GLY A CA  1 
ATOM   202   C C   . GLY A  1 48  ? 62.344  70.207  137.897 1.00 44.93  ? 48   GLY A C   1 
ATOM   203   O O   . GLY A  1 48  ? 61.485  70.845  138.477 1.00 44.80  ? 48   GLY A O   1 
ATOM   204   N N   . PRO A  1 49  ? 63.141  70.768  136.982 1.00 45.94  ? 49   PRO A N   1 
ATOM   205   C CA  . PRO A  1 49  ? 63.100  72.179  136.601 1.00 45.98  ? 49   PRO A CA  1 
ATOM   206   C C   . PRO A  1 49  ? 61.746  72.570  136.052 1.00 45.47  ? 49   PRO A C   1 
ATOM   207   O O   . PRO A  1 49  ? 61.381  73.752  136.077 1.00 46.69  ? 49   PRO A O   1 
ATOM   208   C CB  . PRO A  1 49  ? 64.161  72.280  135.512 1.00 46.44  ? 49   PRO A CB  1 
ATOM   209   C CG  . PRO A  1 49  ? 65.038  71.134  135.756 1.00 47.61  ? 49   PRO A CG  1 
ATOM   210   C CD  . PRO A  1 49  ? 64.106  70.047  136.143 1.00 46.33  ? 49   PRO A CD  1 
ATOM   211   N N   . GLU A  1 50  ? 61.011  71.595  135.533 1.00 44.23  ? 50   GLU A N   1 
ATOM   212   C CA  . GLU A  1 50  ? 59.718  71.924  134.969 1.00 44.04  ? 50   GLU A CA  1 
ATOM   213   C C   . GLU A  1 50  ? 58.678  72.370  135.986 1.00 41.86  ? 50   GLU A C   1 
ATOM   214   O O   . GLU A  1 50  ? 57.603  72.778  135.600 1.00 41.60  ? 50   GLU A O   1 
ATOM   215   C CB  . GLU A  1 50  ? 59.161  70.785  134.101 1.00 45.85  ? 50   GLU A CB  1 
ATOM   216   C CG  . GLU A  1 50  ? 59.415  69.377  134.590 1.00 49.19  ? 50   GLU A CG  1 
ATOM   217   C CD  . GLU A  1 50  ? 60.800  68.928  134.272 1.00 49.31  ? 50   GLU A CD  1 
ATOM   218   O OE1 . GLU A  1 50  ? 61.682  69.168  135.115 1.00 51.40  ? 50   GLU A OE1 1 
ATOM   219   O OE2 . GLU A  1 50  ? 60.999  68.368  133.177 1.00 50.05  ? 50   GLU A OE2 1 
ATOM   220   N N   . TYR A  1 51  ? 59.008  72.334  137.273 1.00 40.18  ? 51   TYR A N   1 
ATOM   221   C CA  . TYR A  1 51  ? 58.077  72.753  138.322 1.00 38.67  ? 51   TYR A CA  1 
ATOM   222   C C   . TYR A  1 51  ? 58.444  74.102  138.903 1.00 40.87  ? 51   TYR A C   1 
ATOM   223   O O   . TYR A  1 51  ? 57.581  74.895  139.316 1.00 40.65  ? 51   TYR A O   1 
ATOM   224   C CB  . TYR A  1 51  ? 58.074  71.764  139.475 1.00 35.18  ? 51   TYR A CB  1 
ATOM   225   C CG  . TYR A  1 51  ? 57.355  70.490  139.178 1.00 33.69  ? 51   TYR A CG  1 
ATOM   226   C CD1 . TYR A  1 51  ? 58.043  69.341  138.804 1.00 33.88  ? 51   TYR A CD1 1 
ATOM   227   C CD2 . TYR A  1 51  ? 55.966  70.437  139.222 1.00 32.28  ? 51   TYR A CD2 1 
ATOM   228   C CE1 . TYR A  1 51  ? 57.338  68.159  138.465 1.00 33.85  ? 51   TYR A CE1 1 
ATOM   229   C CE2 . TYR A  1 51  ? 55.265  69.282  138.908 1.00 32.03  ? 51   TYR A CE2 1 
ATOM   230   C CZ  . TYR A  1 51  ? 55.954  68.151  138.526 1.00 31.71  ? 51   TYR A CZ  1 
ATOM   231   O OH  . TYR A  1 51  ? 55.274  67.023  138.208 1.00 31.49  ? 51   TYR A OH  1 
ATOM   232   N N   . ILE A  1 52  ? 59.743  74.365  138.924 1.00 43.33  ? 52   ILE A N   1 
ATOM   233   C CA  . ILE A  1 52  ? 60.257  75.581  139.519 1.00 44.27  ? 52   ILE A CA  1 
ATOM   234   C C   . ILE A  1 52  ? 60.247  76.813  138.662 1.00 46.13  ? 52   ILE A C   1 
ATOM   235   O O   . ILE A  1 52  ? 60.637  76.768  137.494 1.00 47.12  ? 52   ILE A O   1 
ATOM   236   C CB  . ILE A  1 52  ? 61.675  75.373  140.003 1.00 43.55  ? 52   ILE A CB  1 
ATOM   237   C CG1 . ILE A  1 52  ? 61.830  73.959  140.624 1.00 41.12  ? 52   ILE A CG1 1 
ATOM   238   C CG2 . ILE A  1 52  ? 62.031  76.496  140.977 1.00 42.87  ? 52   ILE A CG2 1 
ATOM   239   C CD1 . ILE A  1 52  ? 60.885  73.630  141.754 1.00 35.21  ? 52   ILE A CD1 1 
ATOM   240   N N   . SER A  1 53  ? 59.767  77.906  139.251 1.00 48.04  ? 53   SER A N   1 
ATOM   241   C CA  . SER A  1 53  ? 59.720  79.193  138.582 1.00 50.86  ? 53   SER A CA  1 
ATOM   242   C C   . SER A  1 53  ? 60.352  80.224  139.523 1.00 52.63  ? 53   SER A C   1 
ATOM   243   O O   . SER A  1 53  ? 60.682  79.900  140.675 1.00 51.71  ? 53   SER A O   1 
ATOM   244   C CB  . SER A  1 53  ? 58.275  79.571  138.159 1.00 50.72  ? 53   SER A CB  1 
ATOM   245   O OG  . SER A  1 53  ? 57.323  79.347  139.157 1.00 51.19  ? 53   SER A OG  1 
ATOM   246   N N   . SER A  1 54  ? 60.570  81.447  139.039 1.00 55.45  ? 54   SER A N   1 
ATOM   247   C CA  . SER A  1 54  ? 61.216  82.455  139.876 1.00 58.15  ? 54   SER A CA  1 
ATOM   248   C C   . SER A  1 54  ? 60.807  83.872  139.577 1.00 60.95  ? 54   SER A C   1 
ATOM   249   O O   . SER A  1 54  ? 60.304  84.187  138.499 1.00 60.54  ? 54   SER A O   1 
ATOM   250   C CB  . SER A  1 54  ? 62.740  82.349  139.752 1.00 57.65  ? 54   SER A CB  1 
ATOM   251   O OG  . SER A  1 54  ? 63.161  82.413  138.389 1.00 55.92  ? 54   SER A OG  1 
ATOM   252   N N   . ARG A  1 55  ? 61.041  84.726  140.559 1.00 64.83  ? 55   ARG A N   1 
ATOM   253   C CA  . ARG A  1 55  ? 60.727  86.133  140.448 1.00 69.03  ? 55   ARG A CA  1 
ATOM   254   C C   . ARG A  1 55  ? 61.853  86.930  141.103 1.00 71.92  ? 55   ARG A C   1 
ATOM   255   O O   . ARG A  1 55  ? 62.724  86.376  141.782 1.00 71.87  ? 55   ARG A O   1 
ATOM   256   C CB  . ARG A  1 55  ? 59.394  86.447  141.148 1.00 69.71  ? 55   ARG A CB  1 
ATOM   257   C CG  . ARG A  1 55  ? 59.374  86.132  142.633 1.00 72.04  ? 55   ARG A CG  1 
ATOM   258   C CD  . ARG A  1 55  ? 58.236  86.834  143.380 1.00 73.51  ? 55   ARG A CD  1 
ATOM   259   N NE  . ARG A  1 55  ? 58.091  86.327  144.752 1.00 75.88  ? 55   ARG A NE  1 
ATOM   260   C CZ  . ARG A  1 55  ? 57.479  85.181  145.080 1.00 76.77  ? 55   ARG A CZ  1 
ATOM   261   N NH1 . ARG A  1 55  ? 56.943  84.402  144.148 1.00 77.12  ? 55   ARG A NH1 1 
ATOM   262   N NH2 . ARG A  1 55  ? 57.393  84.803  146.345 1.00 77.20  ? 55   ARG A NH2 1 
ATOM   263   N N   . MET A  1 56  ? 61.836  88.237  140.885 1.00 76.08  ? 56   MET A N   1 
ATOM   264   C CA  . MET A  1 56  ? 62.827  89.123  141.464 1.00 79.69  ? 56   MET A CA  1 
ATOM   265   C C   . MET A  1 56  ? 62.385  89.723  142.796 1.00 81.62  ? 56   MET A C   1 
ATOM   266   O O   . MET A  1 56  ? 61.386  90.437  142.867 1.00 81.49  ? 56   MET A O   1 
ATOM   267   C CB  . MET A  1 56  ? 63.147  90.249  140.495 1.00 81.87  ? 56   MET A CB  1 
ATOM   268   C CG  . MET A  1 56  ? 64.315  89.932  139.606 1.00 84.32  ? 56   MET A CG  1 
ATOM   269   S SD  . MET A  1 56  ? 65.700  89.309  140.605 1.00 87.73  ? 56   MET A SD  1 
ATOM   270   C CE  . MET A  1 56  ? 65.827  87.536  139.957 1.00 86.23  ? 56   MET A CE  1 
ATOM   271   N N   . ALA A  1 57  ? 63.141  89.426  143.847 1.00 83.79  ? 57   ALA A N   1 
ATOM   272   C CA  . ALA A  1 57  ? 62.847  89.952  145.166 1.00 86.24  ? 57   ALA A CA  1 
ATOM   273   C C   . ALA A  1 57  ? 63.278  91.410  145.152 1.00 88.49  ? 57   ALA A C   1 
ATOM   274   O O   . ALA A  1 57  ? 64.033  91.837  144.264 1.00 88.82  ? 57   ALA A O   1 
ATOM   275   C CB  . ALA A  1 57  ? 63.623  89.199  146.221 1.00 86.08  ? 57   ALA A CB  1 
ATOM   276   N N   . GLY A  1 58  ? 62.796  92.168  146.134 1.00 90.45  ? 58   GLY A N   1 
ATOM   277   C CA  . GLY A  1 58  ? 63.138  93.575  146.218 1.00 92.52  ? 58   GLY A CA  1 
ATOM   278   C C   . GLY A  1 58  ? 64.643  93.774  146.267 1.00 94.18  ? 58   GLY A C   1 
ATOM   279   O O   . GLY A  1 58  ? 65.171  94.725  145.672 1.00 95.03  ? 58   GLY A O   1 
ATOM   280   N N   . GLY A  1 59  ? 65.340  92.874  146.967 1.00 94.98  ? 59   GLY A N   1 
ATOM   281   C CA  . GLY A  1 59  ? 66.790  92.974  147.080 1.00 94.92  ? 59   GLY A CA  1 
ATOM   282   C C   . GLY A  1 59  ? 67.504  92.634  145.784 1.00 94.72  ? 59   GLY A C   1 
ATOM   283   O O   . GLY A  1 59  ? 68.699  92.347  145.802 1.00 94.90  ? 59   GLY A O   1 
ATOM   284   N N   . GLY A  1 60  ? 66.769  92.683  144.668 1.00 94.34  ? 60   GLY A N   1 
ATOM   285   C CA  . GLY A  1 60  ? 67.335  92.362  143.368 1.00 93.37  ? 60   GLY A CA  1 
ATOM   286   C C   . GLY A  1 60  ? 67.891  90.950  143.393 1.00 93.00  ? 60   GLY A C   1 
ATOM   287   O O   . GLY A  1 60  ? 68.943  90.672  142.815 1.00 92.82  ? 60   GLY A O   1 
ATOM   288   N N   . GLN A  1 61  ? 67.188  90.050  144.080 1.00 92.41  ? 61   GLN A N   1 
ATOM   289   C CA  . GLN A  1 61  ? 67.623  88.649  144.196 1.00 90.59  ? 61   GLN A CA  1 
ATOM   290   C C   . GLN A  1 61  ? 66.542  87.625  143.829 1.00 88.07  ? 61   GLN A C   1 
ATOM   291   O O   . GLN A  1 61  ? 65.370  87.754  144.206 1.00 88.37  ? 61   GLN A O   1 
ATOM   292   C CB  . GLN A  1 61  ? 68.100  88.376  145.614 1.00 91.71  ? 61   GLN A CB  1 
ATOM   293   C CG  . GLN A  1 61  ? 67.076  88.778  146.652 1.00 93.30  ? 61   GLN A CG  1 
ATOM   294   C CD  . GLN A  1 61  ? 67.519  88.435  148.048 1.00 94.53  ? 61   GLN A CD  1 
ATOM   295   O OE1 . GLN A  1 61  ? 66.770  88.629  149.013 1.00 94.69  ? 61   GLN A OE1 1 
ATOM   296   N NE2 . GLN A  1 61  ? 68.747  87.922  148.173 1.00 95.17  ? 61   GLN A NE2 1 
ATOM   297   N N   . LYS A  1 62  ? 66.966  86.601  143.099 1.00 84.34  ? 62   LYS A N   1 
ATOM   298   C CA  . LYS A  1 62  ? 66.093  85.536  142.629 1.00 79.60  ? 62   LYS A CA  1 
ATOM   299   C C   . LYS A  1 62  ? 65.405  84.791  143.778 1.00 76.30  ? 62   LYS A C   1 
ATOM   300   O O   . LYS A  1 62  ? 66.002  84.499  144.824 1.00 75.05  ? 62   LYS A O   1 
ATOM   301   C CB  . LYS A  1 62  ? 66.932  84.562  141.797 1.00 79.74  ? 62   LYS A CB  1 
ATOM   302   C CG  . LYS A  1 62  ? 66.184  83.686  140.822 1.00 79.65  ? 62   LYS A CG  1 
ATOM   303   C CD  . LYS A  1 62  ? 67.128  82.640  140.240 1.00 78.61  ? 62   LYS A CD  1 
ATOM   304   C CE  . LYS A  1 62  ? 66.427  81.761  139.234 1.00 78.69  ? 62   LYS A CE  1 
ATOM   305   N NZ  . LYS A  1 62  ? 67.303  80.624  138.848 1.00 79.59  ? 62   LYS A NZ  1 
ATOM   306   N N   . VAL A  1 63  ? 64.129  84.500  143.572 1.00 72.60  ? 63   VAL A N   1 
ATOM   307   C CA  . VAL A  1 63  ? 63.349  83.753  144.550 1.00 68.98  ? 63   VAL A CA  1 
ATOM   308   C C   . VAL A  1 63  ? 62.633  82.653  143.801 1.00 65.32  ? 63   VAL A C   1 
ATOM   309   O O   . VAL A  1 63  ? 61.882  82.920  142.860 1.00 64.92  ? 63   VAL A O   1 
ATOM   310   C CB  . VAL A  1 63  ? 62.311  84.630  145.230 1.00 69.70  ? 63   VAL A CB  1 
ATOM   311   C CG1 . VAL A  1 63  ? 61.413  83.783  146.106 1.00 69.17  ? 63   VAL A CG1 1 
ATOM   312   C CG2 . VAL A  1 63  ? 63.015  85.687  146.047 1.00 69.84  ? 63   VAL A CG2 1 
ATOM   313   N N   . CYS A  1 64  ? 62.895  81.416  144.199 1.00 60.95  ? 64   CYS A N   1 
ATOM   314   C CA  . CYS A  1 64  ? 62.262  80.272  143.557 1.00 56.64  ? 64   CYS A CA  1 
ATOM   315   C C   . CYS A  1 64  ? 60.970  79.862  144.265 1.00 53.00  ? 64   CYS A C   1 
ATOM   316   O O   . CYS A  1 64  ? 60.828  80.002  145.482 1.00 51.26  ? 64   CYS A O   1 
ATOM   317   C CB  . CYS A  1 64  ? 63.222  79.096  143.523 1.00 56.71  ? 64   CYS A CB  1 
ATOM   318   S SG  . CYS A  1 64  ? 64.614  79.377  142.442 1.00 57.62  ? 64   CYS A SG  1 
ATOM   319   N N   . TYR A  1 65  ? 60.029  79.351  143.489 1.00 48.56  ? 65   TYR A N   1 
ATOM   320   C CA  . TYR A  1 65  ? 58.763  78.941  144.049 1.00 44.76  ? 65   TYR A CA  1 
ATOM   321   C C   . TYR A  1 65  ? 58.024  78.052  143.062 1.00 42.70  ? 65   TYR A C   1 
ATOM   322   O O   . TYR A  1 65  ? 58.416  77.924  141.902 1.00 41.24  ? 65   TYR A O   1 
ATOM   323   C CB  . TYR A  1 65  ? 57.923  80.186  144.369 1.00 43.18  ? 65   TYR A CB  1 
ATOM   324   C CG  . TYR A  1 65  ? 57.434  80.948  143.156 1.00 41.70  ? 65   TYR A CG  1 
ATOM   325   C CD1 . TYR A  1 65  ? 56.175  80.687  142.609 1.00 40.09  ? 65   TYR A CD1 1 
ATOM   326   C CD2 . TYR A  1 65  ? 58.246  81.904  142.518 1.00 40.88  ? 65   TYR A CD2 1 
ATOM   327   C CE1 . TYR A  1 65  ? 55.736  81.347  141.468 1.00 39.60  ? 65   TYR A CE1 1 
ATOM   328   C CE2 . TYR A  1 65  ? 57.801  82.575  141.356 1.00 39.32  ? 65   TYR A CE2 1 
ATOM   329   C CZ  . TYR A  1 65  ? 56.551  82.285  140.852 1.00 40.21  ? 65   TYR A CZ  1 
ATOM   330   O OH  . TYR A  1 65  ? 56.091  82.953  139.744 1.00 42.20  ? 65   TYR A OH  1 
ATOM   331   N N   . ILE A  1 66  ? 56.947  77.438  143.531 1.00 40.22  ? 66   ILE A N   1 
ATOM   332   C CA  . ILE A  1 66  ? 56.141  76.585  142.674 1.00 37.89  ? 66   ILE A CA  1 
ATOM   333   C C   . ILE A  1 66  ? 54.768  77.229  142.545 1.00 37.46  ? 66   ILE A C   1 
ATOM   334   O O   . ILE A  1 66  ? 54.159  77.665  143.536 1.00 35.52  ? 66   ILE A O   1 
ATOM   335   C CB  . ILE A  1 66  ? 55.976  75.192  143.278 1.00 36.38  ? 66   ILE A CB  1 
ATOM   336   C CG1 . ILE A  1 66  ? 57.347  74.656  143.661 1.00 35.37  ? 66   ILE A CG1 1 
ATOM   337   C CG2 . ILE A  1 66  ? 55.268  74.288  142.294 1.00 35.55  ? 66   ILE A CG2 1 
ATOM   338   C CD1 . ILE A  1 66  ? 57.321  73.434  144.531 1.00 35.70  ? 66   ILE A CD1 1 
ATOM   339   N N   . GLU A  1 67  ? 54.272  77.295  141.321 1.00 37.01  ? 67   GLU A N   1 
ATOM   340   C CA  . GLU A  1 67  ? 52.967  77.884  141.129 1.00 36.33  ? 67   GLU A CA  1 
ATOM   341   C C   . GLU A  1 67  ? 51.866  76.978  141.708 1.00 34.44  ? 67   GLU A C   1 
ATOM   342   O O   . GLU A  1 67  ? 51.938  75.746  141.607 1.00 34.61  ? 67   GLU A O   1 
ATOM   343   C CB  . GLU A  1 67  ? 52.760  78.166  139.654 1.00 37.95  ? 67   GLU A CB  1 
ATOM   344   C CG  . GLU A  1 67  ? 53.629  79.272  139.193 1.00 43.56  ? 67   GLU A CG  1 
ATOM   345   C CD  . GLU A  1 67  ? 53.463  79.555  137.725 1.00 48.53  ? 67   GLU A CD  1 
ATOM   346   O OE1 . GLU A  1 67  ? 53.633  78.605  136.923 1.00 50.96  ? 67   GLU A OE1 1 
ATOM   347   O OE2 . GLU A  1 67  ? 53.164  80.728  137.369 1.00 51.81  ? 67   GLU A OE2 1 
ATOM   348   N N   . GLY A  1 68  ? 50.867  77.609  142.334 1.00 31.31  ? 68   GLY A N   1 
ATOM   349   C CA  . GLY A  1 68  ? 49.771  76.902  142.961 1.00 27.64  ? 68   GLY A CA  1 
ATOM   350   C C   . GLY A  1 68  ? 49.150  75.830  142.109 1.00 27.54  ? 68   GLY A C   1 
ATOM   351   O O   . GLY A  1 68  ? 48.942  74.706  142.574 1.00 25.16  ? 68   GLY A O   1 
ATOM   352   N N   . HIS A  1 69  ? 48.872  76.139  140.848 1.00 26.97  ? 69   HIS A N   1 
ATOM   353   C CA  . HIS A  1 69  ? 48.252  75.130  140.041 1.00 28.97  ? 69   HIS A CA  1 
ATOM   354   C C   . HIS A  1 69  ? 49.127  73.870  139.893 1.00 30.05  ? 69   HIS A C   1 
ATOM   355   O O   . HIS A  1 69  ? 48.610  72.752  139.751 1.00 31.78  ? 69   HIS A O   1 
ATOM   356   C CB  . HIS A  1 69  ? 47.820  75.694  138.679 1.00 30.86  ? 69   HIS A CB  1 
ATOM   357   C CG  . HIS A  1 69  ? 48.947  75.961  137.726 1.00 32.26  ? 69   HIS A CG  1 
ATOM   358   N ND1 . HIS A  1 69  ? 49.614  77.166  137.675 1.00 32.99  ? 69   HIS A ND1 1 
ATOM   359   C CD2 . HIS A  1 69  ? 49.525  75.175  136.783 1.00 33.87  ? 69   HIS A CD2 1 
ATOM   360   C CE1 . HIS A  1 69  ? 50.550  77.118  136.745 1.00 33.44  ? 69   HIS A CE1 1 
ATOM   361   N NE2 . HIS A  1 69  ? 50.519  75.920  136.188 1.00 35.01  ? 69   HIS A NE2 1 
ATOM   362   N N   . ARG A  1 70  ? 50.443  74.017  139.959 1.00 29.32  ? 70   ARG A N   1 
ATOM   363   C CA  . ARG A  1 70  ? 51.290  72.845  139.846 1.00 29.25  ? 70   ARG A CA  1 
ATOM   364   C C   . ARG A  1 70  ? 51.155  72.039  141.115 1.00 26.48  ? 70   ARG A C   1 
ATOM   365   O O   . ARG A  1 70  ? 51.036  70.822  141.077 1.00 27.15  ? 70   ARG A O   1 
ATOM   366   C CB  . ARG A  1 70  ? 52.771  73.224  139.604 1.00 31.84  ? 70   ARG A CB  1 
ATOM   367   C CG  . ARG A  1 70  ? 53.029  73.980  138.304 1.00 34.69  ? 70   ARG A CG  1 
ATOM   368   C CD  . ARG A  1 70  ? 53.920  73.208  137.318 1.00 38.90  ? 70   ARG A CD  1 
ATOM   369   N NE  . ARG A  1 70  ? 53.947  73.900  136.035 1.00 39.21  ? 70   ARG A NE  1 
ATOM   370   C CZ  . ARG A  1 70  ? 54.360  75.146  135.909 1.00 37.29  ? 70   ARG A CZ  1 
ATOM   371   N NH1 . ARG A  1 70  ? 54.786  75.778  136.987 1.00 37.87  ? 70   ARG A NH1 1 
ATOM   372   N NH2 . ARG A  1 70  ? 54.283  75.770  134.737 1.00 38.31  ? 70   ARG A NH2 1 
ATOM   373   N N   . VAL A  1 71  ? 51.157  72.730  142.237 1.00 25.09  ? 71   VAL A N   1 
ATOM   374   C CA  . VAL A  1 71  ? 51.049  72.046  143.524 1.00 24.98  ? 71   VAL A CA  1 
ATOM   375   C C   . VAL A  1 71  ? 49.709  71.341  143.629 1.00 23.80  ? 71   VAL A C   1 
ATOM   376   O O   . VAL A  1 71  ? 49.616  70.226  144.109 1.00 24.51  ? 71   VAL A O   1 
ATOM   377   C CB  . VAL A  1 71  ? 51.193  73.034  144.694 1.00 24.91  ? 71   VAL A CB  1 
ATOM   378   C CG1 . VAL A  1 71  ? 50.983  72.343  146.010 1.00 21.54  ? 71   VAL A CG1 1 
ATOM   379   C CG2 . VAL A  1 71  ? 52.576  73.644  144.659 1.00 25.45  ? 71   VAL A CG2 1 
ATOM   380   N N   . ILE A  1 72  ? 48.664  71.984  143.161 1.00 23.60  ? 72   ILE A N   1 
ATOM   381   C CA  . ILE A  1 72  ? 47.350  71.339  143.188 1.00 24.54  ? 72   ILE A CA  1 
ATOM   382   C C   . ILE A  1 72  ? 47.372  70.024  142.396 1.00 24.14  ? 72   ILE A C   1 
ATOM   383   O O   . ILE A  1 72  ? 46.877  68.994  142.894 1.00 22.27  ? 72   ILE A O   1 
ATOM   384   C CB  . ILE A  1 72  ? 46.231  72.340  142.670 1.00 22.60  ? 72   ILE A CB  1 
ATOM   385   C CG1 . ILE A  1 72  ? 46.001  73.364  143.774 1.00 19.56  ? 72   ILE A CG1 1 
ATOM   386   C CG2 . ILE A  1 72  ? 44.916  71.629  142.338 1.00 18.12  ? 72   ILE A CG2 1 
ATOM   387   C CD1 . ILE A  1 72  ? 45.175  74.498  143.341 1.00 24.44  ? 72   ILE A CD1 1 
ATOM   388   N N   . ASN A  1 73  ? 47.969  70.050  141.193 1.00 24.65  ? 73   ASN A N   1 
ATOM   389   C CA  . ASN A  1 73  ? 48.040  68.815  140.402 1.00 25.57  ? 73   ASN A CA  1 
ATOM   390   C C   . ASN A  1 73  ? 48.968  67.796  141.027 1.00 26.29  ? 73   ASN A C   1 
ATOM   391   O O   . ASN A  1 73  ? 48.687  66.594  140.993 1.00 28.15  ? 73   ASN A O   1 
ATOM   392   C CB  . ASN A  1 73  ? 48.435  69.089  138.967 1.00 25.29  ? 73   ASN A CB  1 
ATOM   393   C CG  . ASN A  1 73  ? 47.265  69.634  138.145 1.00 27.04  ? 73   ASN A CG  1 
ATOM   394   O OD1 . ASN A  1 73  ? 46.108  69.423  138.495 1.00 28.18  ? 73   ASN A OD1 1 
ATOM   395   N ND2 . ASN A  1 73  ? 47.563  70.326  137.057 1.00 27.48  ? 73   ASN A ND2 1 
ATOM   396   N N   . LEU A  1 74  ? 50.070  68.247  141.618 1.00 26.04  ? 74   LEU A N   1 
ATOM   397   C CA  . LEU A  1 74  ? 50.946  67.304  142.287 1.00 25.56  ? 74   LEU A CA  1 
ATOM   398   C C   . LEU A  1 74  ? 50.130  66.574  143.379 1.00 25.60  ? 74   LEU A C   1 
ATOM   399   O O   . LEU A  1 74  ? 50.156  65.343  143.502 1.00 26.38  ? 74   LEU A O   1 
ATOM   400   C CB  . LEU A  1 74  ? 52.126  68.029  142.901 1.00 24.52  ? 74   LEU A CB  1 
ATOM   401   C CG  . LEU A  1 74  ? 53.312  68.398  141.994 1.00 26.54  ? 74   LEU A CG  1 
ATOM   402   C CD1 . LEU A  1 74  ? 54.219  69.360  142.764 1.00 25.93  ? 74   LEU A CD1 1 
ATOM   403   C CD2 . LEU A  1 74  ? 54.129  67.159  141.584 1.00 26.86  ? 74   LEU A CD2 1 
ATOM   404   N N   . ALA A  1 75  ? 49.362  67.332  144.138 1.00 24.69  ? 75   ALA A N   1 
ATOM   405   C CA  . ALA A  1 75  ? 48.584  66.722  145.197 1.00 24.27  ? 75   ALA A CA  1 
ATOM   406   C C   . ALA A  1 75  ? 47.544  65.755  144.665 1.00 24.36  ? 75   ALA A C   1 
ATOM   407   O O   . ALA A  1 75  ? 47.369  64.658  145.219 1.00 22.49  ? 75   ALA A O   1 
ATOM   408   C CB  . ALA A  1 75  ? 47.895  67.792  146.037 1.00 22.89  ? 75   ALA A CB  1 
ATOM   409   N N   . ASN A  1 76  ? 46.850  66.160  143.604 1.00 24.60  ? 76   ASN A N   1 
ATOM   410   C CA  . ASN A  1 76  ? 45.797  65.307  143.084 1.00 26.90  ? 76   ASN A CA  1 
ATOM   411   C C   . ASN A  1 76  ? 46.330  63.984  142.552 1.00 27.74  ? 76   ASN A C   1 
ATOM   412   O O   . ASN A  1 76  ? 45.699  62.933  142.731 1.00 28.59  ? 76   ASN A O   1 
ATOM   413   C CB  . ASN A  1 76  ? 44.998  66.024  142.003 1.00 26.84  ? 76   ASN A CB  1 
ATOM   414   C CG  . ASN A  1 76  ? 44.026  67.051  142.574 1.00 26.57  ? 76   ASN A CG  1 
ATOM   415   O OD1 . ASN A  1 76  ? 43.431  66.828  143.619 1.00 27.79  ? 76   ASN A OD1 1 
ATOM   416   N ND2 . ASN A  1 76  ? 43.850  68.171  141.874 1.00 27.40  ? 76   ASN A ND2 1 
ATOM   417   N N   . GLU A  1 77  ? 47.508  64.031  141.931 1.00 27.93  ? 77   GLU A N   1 
ATOM   418   C CA  . GLU A  1 77  ? 48.126  62.843  141.363 1.00 27.27  ? 77   GLU A CA  1 
ATOM   419   C C   . GLU A  1 77  ? 48.791  61.998  142.473 1.00 28.88  ? 77   GLU A C   1 
ATOM   420   O O   . GLU A  1 77  ? 48.808  60.748  142.417 1.00 30.05  ? 77   GLU A O   1 
ATOM   421   C CB  . GLU A  1 77  ? 49.136  63.252  140.291 1.00 26.19  ? 77   GLU A CB  1 
ATOM   422   C CG  . GLU A  1 77  ? 48.526  63.895  139.043 1.00 27.21  ? 77   GLU A CG  1 
ATOM   423   C CD  . GLU A  1 77  ? 47.457  62.983  138.367 1.00 31.49  ? 77   GLU A CD  1 
ATOM   424   O OE1 . GLU A  1 77  ? 46.567  63.480  137.605 1.00 31.60  ? 77   GLU A OE1 1 
ATOM   425   O OE2 . GLU A  1 77  ? 47.503  61.750  138.618 1.00 31.51  ? 77   GLU A OE2 1 
ATOM   426   N N   . MET A  1 78  ? 49.300  62.653  143.511 1.00 27.85  ? 78   MET A N   1 
ATOM   427   C CA  . MET A  1 78  ? 49.903  61.897  144.577 1.00 26.97  ? 78   MET A CA  1 
ATOM   428   C C   . MET A  1 78  ? 48.867  61.155  145.460 1.00 27.64  ? 78   MET A C   1 
ATOM   429   O O   . MET A  1 78  ? 49.064  59.967  145.785 1.00 26.20  ? 78   MET A O   1 
ATOM   430   C CB  . MET A  1 78  ? 50.733  62.824  145.437 1.00 26.85  ? 78   MET A CB  1 
ATOM   431   C CG  . MET A  1 78  ? 51.513  62.094  146.506 1.00 28.85  ? 78   MET A CG  1 
ATOM   432   S SD  . MET A  1 78  ? 52.849  61.038  145.774 1.00 32.70  ? 78   MET A SD  1 
ATOM   433   C CE  . MET A  1 78  ? 54.040  62.282  145.054 1.00 26.88  ? 78   MET A CE  1 
ATOM   434   N N   . PHE A  1 79  ? 47.769  61.838  145.839 1.00 26.49  ? 79   PHE A N   1 
ATOM   435   C CA  . PHE A  1 79  ? 46.772  61.252  146.742 1.00 24.20  ? 79   PHE A CA  1 
ATOM   436   C C   . PHE A  1 79  ? 45.424  60.965  146.117 1.00 22.91  ? 79   PHE A C   1 
ATOM   437   O O   . PHE A  1 79  ? 44.585  60.340  146.751 1.00 19.72  ? 79   PHE A O   1 
ATOM   438   C CB  . PHE A  1 79  ? 46.504  62.184  147.903 1.00 26.22  ? 79   PHE A CB  1 
ATOM   439   C CG  . PHE A  1 79  ? 47.722  62.699  148.562 1.00 28.87  ? 79   PHE A CG  1 
ATOM   440   C CD1 . PHE A  1 79  ? 48.453  61.884  149.411 1.00 30.48  ? 79   PHE A CD1 1 
ATOM   441   C CD2 . PHE A  1 79  ? 48.134  64.026  148.378 1.00 28.87  ? 79   PHE A CD2 1 
ATOM   442   C CE1 . PHE A  1 79  ? 49.585  62.377  150.083 1.00 29.89  ? 79   PHE A CE1 1 
ATOM   443   C CE2 . PHE A  1 79  ? 49.256  64.515  149.041 1.00 28.23  ? 79   PHE A CE2 1 
ATOM   444   C CZ  . PHE A  1 79  ? 49.980  63.691  149.890 1.00 28.72  ? 79   PHE A CZ  1 
ATOM   445   N N   . GLY A  1 80  ? 45.212  61.420  144.886 1.00 22.41  ? 80   GLY A N   1 
ATOM   446   C CA  . GLY A  1 80  ? 43.919  61.199  144.255 1.00 24.26  ? 80   GLY A CA  1 
ATOM   447   C C   . GLY A  1 80  ? 43.060  62.430  144.512 1.00 24.42  ? 80   GLY A C   1 
ATOM   448   O O   . GLY A  1 80  ? 43.243  63.096  145.521 1.00 23.55  ? 80   GLY A O   1 
ATOM   449   N N   . TYR A  1 81  ? 42.139  62.740  143.608 1.00 24.64  ? 81   TYR A N   1 
ATOM   450   C CA  . TYR A  1 81  ? 41.294  63.910  143.789 1.00 24.35  ? 81   TYR A CA  1 
ATOM   451   C C   . TYR A  1 81  ? 40.526  63.809  145.098 1.00 24.38  ? 81   TYR A C   1 
ATOM   452   O O   . TYR A  1 81  ? 40.157  64.821  145.673 1.00 25.01  ? 81   TYR A O   1 
ATOM   453   C CB  . TYR A  1 81  ? 40.301  64.073  142.634 1.00 23.44  ? 81   TYR A CB  1 
ATOM   454   C CG  . TYR A  1 81  ? 39.197  63.025  142.615 1.00 26.01  ? 81   TYR A CG  1 
ATOM   455   C CD1 . TYR A  1 81  ? 39.341  61.827  141.906 1.00 25.09  ? 81   TYR A CD1 1 
ATOM   456   C CD2 . TYR A  1 81  ? 38.000  63.235  143.290 1.00 25.02  ? 81   TYR A CD2 1 
ATOM   457   C CE1 . TYR A  1 81  ? 38.313  60.885  141.883 1.00 26.79  ? 81   TYR A CE1 1 
ATOM   458   C CE2 . TYR A  1 81  ? 36.983  62.287  143.257 1.00 25.75  ? 81   TYR A CE2 1 
ATOM   459   C CZ  . TYR A  1 81  ? 37.148  61.123  142.561 1.00 26.43  ? 81   TYR A CZ  1 
ATOM   460   O OH  . TYR A  1 81  ? 36.154  60.164  142.609 1.00 29.25  ? 81   TYR A OH  1 
ATOM   461   N N   . ASN A  1 82  ? 40.311  62.600  145.599 1.00 24.87  ? 82   ASN A N   1 
ATOM   462   C CA  . ASN A  1 82  ? 39.536  62.450  146.834 1.00 24.44  ? 82   ASN A CA  1 
ATOM   463   C C   . ASN A  1 82  ? 40.404  62.000  147.966 1.00 24.47  ? 82   ASN A C   1 
ATOM   464   O O   . ASN A  1 82  ? 39.905  61.465  148.948 1.00 24.56  ? 82   ASN A O   1 
ATOM   465   C CB  . ASN A  1 82  ? 38.448  61.411  146.626 1.00 25.59  ? 82   ASN A CB  1 
ATOM   466   C CG  . ASN A  1 82  ? 39.025  59.994  146.422 1.00 29.02  ? 82   ASN A CG  1 
ATOM   467   O OD1 . ASN A  1 82  ? 38.337  58.965  146.644 1.00 31.57  ? 82   ASN A OD1 1 
ATOM   468   N ND2 . ASN A  1 82  ? 40.279  59.931  146.001 1.00 25.89  ? 82   ASN A ND2 1 
ATOM   469   N N   . GLY A  1 83  ? 41.710  62.198  147.830 1.00 25.04  ? 83   GLY A N   1 
ATOM   470   C CA  . GLY A  1 83  ? 42.634  61.743  148.863 1.00 25.14  ? 83   GLY A CA  1 
ATOM   471   C C   . GLY A  1 83  ? 43.190  62.802  149.791 1.00 23.98  ? 83   GLY A C   1 
ATOM   472   O O   . GLY A  1 83  ? 43.786  62.480  150.820 1.00 24.20  ? 83   GLY A O   1 
ATOM   473   N N   . TRP A  1 84  ? 42.998  64.064  149.421 1.00 22.86  ? 84   TRP A N   1 
ATOM   474   C CA  . TRP A  1 84  ? 43.473  65.179  150.230 1.00 21.76  ? 84   TRP A CA  1 
ATOM   475   C C   . TRP A  1 84  ? 42.399  66.257  150.189 1.00 22.03  ? 84   TRP A C   1 
ATOM   476   O O   . TRP A  1 84  ? 41.562  66.278  149.277 1.00 22.17  ? 84   TRP A O   1 
ATOM   477   C CB  . TRP A  1 84  ? 44.789  65.754  149.718 1.00 19.15  ? 84   TRP A CB  1 
ATOM   478   C CG  . TRP A  1 84  ? 44.644  66.457  148.392 1.00 20.56  ? 84   TRP A CG  1 
ATOM   479   C CD1 . TRP A  1 84  ? 44.500  65.879  147.146 1.00 19.99  ? 84   TRP A CD1 1 
ATOM   480   C CD2 . TRP A  1 84  ? 44.664  67.873  148.165 1.00 18.50  ? 84   TRP A CD2 1 
ATOM   481   N NE1 . TRP A  1 84  ? 44.439  66.868  146.170 1.00 17.50  ? 84   TRP A NE1 1 
ATOM   482   C CE2 . TRP A  1 84  ? 44.532  68.093  146.778 1.00 17.94  ? 84   TRP A CE2 1 
ATOM   483   C CE3 . TRP A  1 84  ? 44.786  68.982  149.004 1.00 18.33  ? 84   TRP A CE3 1 
ATOM   484   C CZ2 . TRP A  1 84  ? 44.505  69.363  146.225 1.00 17.20  ? 84   TRP A CZ2 1 
ATOM   485   C CZ3 . TRP A  1 84  ? 44.766  70.237  148.455 1.00 16.53  ? 84   TRP A CZ3 1 
ATOM   486   C CH2 . TRP A  1 84  ? 44.627  70.421  147.084 1.00 17.13  ? 84   TRP A CH2 1 
ATOM   487   N N   . ALA A  1 85  ? 42.440  67.133  151.188 1.00 20.41  ? 85   ALA A N   1 
ATOM   488   C CA  . ALA A  1 85  ? 41.483  68.174  151.343 1.00 20.05  ? 85   ALA A CA  1 
ATOM   489   C C   . ALA A  1 85  ? 42.166  69.304  152.105 1.00 22.96  ? 85   ALA A C   1 
ATOM   490   O O   . ALA A  1 85  ? 43.240  69.095  152.711 1.00 22.10  ? 85   ALA A O   1 
ATOM   491   C CB  . ALA A  1 85  ? 40.297  67.641  152.154 1.00 17.90  ? 85   ALA A CB  1 
ATOM   492   N N   . HIS A  1 86  ? 41.556  70.499  152.062 1.00 23.47  ? 86   HIS A N   1 
ATOM   493   C CA  . HIS A  1 86  ? 42.095  71.631  152.790 1.00 23.25  ? 86   HIS A CA  1 
ATOM   494   C C   . HIS A  1 86  ? 41.011  72.618  153.139 1.00 22.92  ? 86   HIS A C   1 
ATOM   495   O O   . HIS A  1 86  ? 40.043  72.795  152.395 1.00 23.45  ? 86   HIS A O   1 
ATOM   496   C CB  . HIS A  1 86  ? 43.210  72.335  152.003 1.00 22.73  ? 86   HIS A CB  1 
ATOM   497   C CG  . HIS A  1 86  ? 42.724  73.219  150.907 1.00 22.52  ? 86   HIS A CG  1 
ATOM   498   N ND1 . HIS A  1 86  ? 42.199  72.730  149.734 1.00 24.79  ? 86   HIS A ND1 1 
ATOM   499   C CD2 . HIS A  1 86  ? 42.732  74.565  150.781 1.00 22.94  ? 86   HIS A CD2 1 
ATOM   500   C CE1 . HIS A  1 86  ? 41.909  73.737  148.927 1.00 25.44  ? 86   HIS A CE1 1 
ATOM   501   N NE2 . HIS A  1 86  ? 42.222  74.864  149.542 1.00 24.63  ? 86   HIS A NE2 1 
ATOM   502   N N   . SER A  1 87  ? 41.162  73.236  154.299 1.00 20.60  ? 87   SER A N   1 
ATOM   503   C CA  . SER A  1 87  ? 40.213  74.250  154.706 1.00 21.32  ? 87   SER A CA  1 
ATOM   504   C C   . SER A  1 87  ? 41.008  75.505  155.208 1.00 21.37  ? 87   SER A C   1 
ATOM   505   O O   . SER A  1 87  ? 42.245  75.454  155.419 1.00 18.67  ? 87   SER A O   1 
ATOM   506   C CB  . SER A  1 87  ? 39.283  73.701  155.790 1.00 20.99  ? 87   SER A CB  1 
ATOM   507   O OG  . SER A  1 87  ? 40.021  73.320  156.954 1.00 22.01  ? 87   SER A OG  1 
ATOM   508   N N   . ILE A  1 88  ? 40.305  76.629  155.336 1.00 20.51  ? 88   ILE A N   1 
ATOM   509   C CA  . ILE A  1 88  ? 40.927  77.857  155.806 1.00 22.98  ? 88   ILE A CA  1 
ATOM   510   C C   . ILE A  1 88  ? 40.494  77.984  157.274 1.00 25.85  ? 88   ILE A C   1 
ATOM   511   O O   . ILE A  1 88  ? 39.347  78.319  157.556 1.00 27.28  ? 88   ILE A O   1 
ATOM   512   C CB  . ILE A  1 88  ? 40.450  79.074  154.982 1.00 20.28  ? 88   ILE A CB  1 
ATOM   513   C CG1 . ILE A  1 88  ? 41.000  78.962  153.559 1.00 19.63  ? 88   ILE A CG1 1 
ATOM   514   C CG2 . ILE A  1 88  ? 40.907  80.337  155.627 1.00 18.89  ? 88   ILE A CG2 1 
ATOM   515   C CD1 . ILE A  1 88  ? 40.222  79.788  152.576 1.00 18.26  ? 88   ILE A CD1 1 
ATOM   516   N N   . THR A  1 89  ? 41.386  77.705  158.217 1.00 26.89  ? 89   THR A N   1 
ATOM   517   C CA  . THR A  1 89  ? 40.962  77.794  159.582 1.00 28.99  ? 89   THR A CA  1 
ATOM   518   C C   . THR A  1 89  ? 40.699  79.239  159.887 1.00 29.26  ? 89   THR A C   1 
ATOM   519   O O   . THR A  1 89  ? 39.804  79.540  160.639 1.00 29.32  ? 89   THR A O   1 
ATOM   520   C CB  . THR A  1 89  ? 42.005  77.162  160.511 1.00 29.98  ? 89   THR A CB  1 
ATOM   521   O OG1 . THR A  1 89  ? 43.293  77.575  160.077 1.00 35.44  ? 89   THR A OG1 1 
ATOM   522   C CG2 . THR A  1 89  ? 41.997  75.643  160.350 1.00 32.17  ? 89   THR A CG2 1 
ATOM   523   N N   . GLN A  1 90  ? 41.442  80.147  159.264 1.00 31.32  ? 90   GLN A N   1 
ATOM   524   C CA  . GLN A  1 90  ? 41.226  81.574  159.497 1.00 31.94  ? 90   GLN A CA  1 
ATOM   525   C C   . GLN A  1 90  ? 42.012  82.480  158.539 1.00 31.66  ? 90   GLN A C   1 
ATOM   526   O O   . GLN A  1 90  ? 43.091  82.124  158.057 1.00 33.88  ? 90   GLN A O   1 
ATOM   527   C CB  . GLN A  1 90  ? 41.626  81.927  160.910 1.00 33.25  ? 90   GLN A CB  1 
ATOM   528   C CG  . GLN A  1 90  ? 41.227  83.341  161.299 1.00 40.08  ? 90   GLN A CG  1 
ATOM   529   C CD  . GLN A  1 90  ? 41.882  83.859  162.620 1.00 42.99  ? 90   GLN A CD  1 
ATOM   530   O OE1 . GLN A  1 90  ? 41.785  83.244  163.670 1.00 44.19  ? 90   GLN A OE1 1 
ATOM   531   N NE2 . GLN A  1 90  ? 42.549  85.006  162.536 1.00 44.98  ? 90   GLN A NE2 1 
ATOM   532   N N   . GLN A  1 91  ? 41.480  83.657  158.243 1.00 29.64  ? 91   GLN A N   1 
ATOM   533   C CA  . GLN A  1 91  ? 42.219  84.581  157.386 1.00 27.09  ? 91   GLN A CA  1 
ATOM   534   C C   . GLN A  1 91  ? 42.124  85.915  158.052 1.00 27.46  ? 91   GLN A C   1 
ATOM   535   O O   . GLN A  1 91  ? 41.058  86.382  158.434 1.00 27.36  ? 91   GLN A O   1 
ATOM   536   C CB  . GLN A  1 91  ? 41.662  84.707  155.979 1.00 25.44  ? 91   GLN A CB  1 
ATOM   537   C CG  . GLN A  1 91  ? 42.533  85.649  155.169 1.00 24.77  ? 91   GLN A CG  1 
ATOM   538   C CD  . GLN A  1 91  ? 42.184  85.725  153.704 1.00 26.21  ? 91   GLN A CD  1 
ATOM   539   O OE1 . GLN A  1 91  ? 41.110  86.251  153.310 1.00 26.93  ? 91   GLN A OE1 1 
ATOM   540   N NE2 . GLN A  1 91  ? 43.100  85.215  152.862 1.00 25.17  ? 91   GLN A NE2 1 
ATOM   541   N N   . ASN A  1 92  ? 43.254  86.565  158.184 1.00 28.74  ? 92   ASN A N   1 
ATOM   542   C CA  . ASN A  1 92  ? 43.229  87.831  158.853 1.00 29.21  ? 92   ASN A CA  1 
ATOM   543   C C   . ASN A  1 92  ? 43.891  88.912  158.068 1.00 27.72  ? 92   ASN A C   1 
ATOM   544   O O   . ASN A  1 92  ? 44.985  88.730  157.586 1.00 28.80  ? 92   ASN A O   1 
ATOM   545   C CB  . ASN A  1 92  ? 43.887  87.681  160.210 1.00 33.39  ? 92   ASN A CB  1 
ATOM   546   C CG  . ASN A  1 92  ? 43.667  88.880  161.075 1.00 39.02  ? 92   ASN A CG  1 
ATOM   547   O OD1 . ASN A  1 92  ? 44.455  89.840  161.036 1.00 42.70  ? 92   ASN A OD1 1 
ATOM   548   N ND2 . ASN A  1 92  ? 42.572  88.866  161.854 1.00 40.49  ? 92   ASN A ND2 1 
ATOM   549   N N   . VAL A  1 93  ? 43.216  90.038  157.904 1.00 27.07  ? 93   VAL A N   1 
ATOM   550   C CA  . VAL A  1 93  ? 43.827  91.151  157.202 1.00 28.71  ? 93   VAL A CA  1 
ATOM   551   C C   . VAL A  1 93  ? 44.668  91.922  158.221 1.00 29.55  ? 93   VAL A C   1 
ATOM   552   O O   . VAL A  1 93  ? 44.120  92.482  159.161 1.00 30.72  ? 93   VAL A O   1 
ATOM   553   C CB  . VAL A  1 93  ? 42.787  92.095  156.620 1.00 27.75  ? 93   VAL A CB  1 
ATOM   554   C CG1 . VAL A  1 93  ? 43.483  93.330  156.072 1.00 25.97  ? 93   VAL A CG1 1 
ATOM   555   C CG2 . VAL A  1 93  ? 42.029  91.396  155.525 1.00 25.77  ? 93   VAL A CG2 1 
ATOM   556   N N   . ASP A  1 94  ? 45.985  91.940  158.042 1.00 30.08  ? 94   ASP A N   1 
ATOM   557   C CA  . ASP A  1 94  ? 46.873  92.606  158.996 1.00 32.29  ? 94   ASP A CA  1 
ATOM   558   C C   . ASP A  1 94  ? 46.827  94.115  158.942 1.00 33.54  ? 94   ASP A C   1 
ATOM   559   O O   . ASP A  1 94  ? 46.916  94.780  159.987 1.00 33.66  ? 94   ASP A O   1 
ATOM   560   C CB  . ASP A  1 94  ? 48.311  92.141  158.803 1.00 32.24  ? 94   ASP A CB  1 
ATOM   561   C CG  . ASP A  1 94  ? 48.527  90.751  159.368 1.00 32.92  ? 94   ASP A CG  1 
ATOM   562   O OD1 . ASP A  1 94  ? 49.575  90.105  159.058 1.00 32.63  ? 94   ASP A OD1 1 
ATOM   563   O OD2 . ASP A  1 94  ? 47.618  90.325  160.129 1.00 30.13  ? 94   ASP A OD2 1 
ATOM   564   N N   . PHE A  1 95  ? 46.679  94.651  157.735 1.00 33.64  ? 95   PHE A N   1 
ATOM   565   C CA  . PHE A  1 95  ? 46.609  96.090  157.574 1.00 35.16  ? 95   PHE A CA  1 
ATOM   566   C C   . PHE A  1 95  ? 46.267  96.505  156.158 1.00 36.10  ? 95   PHE A C   1 
ATOM   567   O O   . PHE A  1 95  ? 46.484  95.767  155.191 1.00 34.94  ? 95   PHE A O   1 
ATOM   568   C CB  . PHE A  1 95  ? 47.953  96.747  157.999 1.00 34.19  ? 95   PHE A CB  1 
ATOM   569   C CG  . PHE A  1 95  ? 49.111  96.376  157.123 1.00 32.86  ? 95   PHE A CG  1 
ATOM   570   C CD1 . PHE A  1 95  ? 49.351  97.056  155.948 1.00 32.02  ? 95   PHE A CD1 1 
ATOM   571   C CD2 . PHE A  1 95  ? 49.916  95.285  157.438 1.00 33.23  ? 95   PHE A CD2 1 
ATOM   572   C CE1 . PHE A  1 95  ? 50.386  96.645  155.089 1.00 32.78  ? 95   PHE A CE1 1 
ATOM   573   C CE2 . PHE A  1 95  ? 50.946  94.878  156.592 1.00 32.06  ? 95   PHE A CE2 1 
ATOM   574   C CZ  . PHE A  1 95  ? 51.179  95.558  155.423 1.00 32.44  ? 95   PHE A CZ  1 
ATOM   575   N N   . VAL A  1 96  ? 45.705  97.698  156.052 1.00 38.32  ? 96   VAL A N   1 
ATOM   576   C CA  . VAL A  1 96  ? 45.392  98.275  154.765 1.00 39.78  ? 96   VAL A CA  1 
ATOM   577   C C   . VAL A  1 96  ? 45.842  99.705  154.938 1.00 42.64  ? 96   VAL A C   1 
ATOM   578   O O   . VAL A  1 96  ? 45.149  100.495 155.558 1.00 43.61  ? 96   VAL A O   1 
ATOM   579   C CB  . VAL A  1 96  ? 43.896  98.244  154.463 1.00 37.13  ? 96   VAL A CB  1 
ATOM   580   C CG1 . VAL A  1 96  ? 43.615  98.992  153.182 1.00 36.55  ? 96   VAL A CG1 1 
ATOM   581   C CG2 . VAL A  1 96  ? 43.433  96.839  154.336 1.00 36.70  ? 96   VAL A CG2 1 
ATOM   582   N N   . ASP A  1 97  ? 47.028  100.025 154.430 1.00 46.07  ? 97   ASP A N   1 
ATOM   583   C CA  . ASP A  1 97  ? 47.556  101.385 154.530 1.00 47.52  ? 97   ASP A CA  1 
ATOM   584   C C   . ASP A  1 97  ? 47.505  102.106 153.184 1.00 50.95  ? 97   ASP A C   1 
ATOM   585   O O   . ASP A  1 97  ? 47.708  101.497 152.122 1.00 50.76  ? 97   ASP A O   1 
ATOM   586   C CB  . ASP A  1 97  ? 48.999  101.367 155.041 1.00 44.97  ? 97   ASP A CB  1 
ATOM   587   C CG  . ASP A  1 97  ? 49.111  100.883 156.485 1.00 43.89  ? 97   ASP A CG  1 
ATOM   588   O OD1 . ASP A  1 97  ? 48.108  101.001 157.219 1.00 42.91  ? 97   ASP A OD1 1 
ATOM   589   O OD2 . ASP A  1 97  ? 50.202  100.395 156.899 1.00 42.76  ? 97   ASP A OD2 1 
ATOM   590   N N   . LEU A  1 98  ? 47.197  103.404 153.250 1.00 55.24  ? 98   LEU A N   1 
ATOM   591   C CA  . LEU A  1 98  ? 47.149  104.299 152.085 1.00 59.26  ? 98   LEU A CA  1 
ATOM   592   C C   . LEU A  1 98  ? 48.279  105.284 152.393 1.00 62.19  ? 98   LEU A C   1 
ATOM   593   O O   . LEU A  1 98  ? 48.151  106.070 153.318 1.00 62.91  ? 98   LEU A O   1 
ATOM   594   C CB  . LEU A  1 98  ? 45.823  105.016 152.065 1.00 58.32  ? 98   LEU A CB  1 
ATOM   595   C CG  . LEU A  1 98  ? 45.715  106.177 151.102 1.00 59.86  ? 98   LEU A CG  1 
ATOM   596   C CD1 . LEU A  1 98  ? 45.488  105.688 149.675 1.00 59.59  ? 98   LEU A CD1 1 
ATOM   597   C CD2 . LEU A  1 98  ? 44.564  107.043 151.572 1.00 60.78  ? 98   LEU A CD2 1 
ATOM   598   N N   . ASN A  1 99  ? 49.383  105.235 151.646 1.00 65.78  ? 99   ASN A N   1 
ATOM   599   C CA  . ASN A  1 99  ? 50.525  106.099 151.961 1.00 69.31  ? 99   ASN A CA  1 
ATOM   600   C C   . ASN A  1 99  ? 50.888  107.159 150.960 1.00 71.08  ? 99   ASN A C   1 
ATOM   601   O O   . ASN A  1 99  ? 51.880  107.868 151.146 1.00 71.64  ? 99   ASN A O   1 
ATOM   602   C CB  . ASN A  1 99  ? 51.779  105.264 152.248 1.00 70.85  ? 99   ASN A CB  1 
ATOM   603   C CG  . ASN A  1 99  ? 51.724  104.562 153.620 1.00 73.24  ? 99   ASN A CG  1 
ATOM   604   O OD1 . ASN A  1 99  ? 52.515  103.646 153.900 1.00 73.87  ? 99   ASN A OD1 1 
ATOM   605   N ND2 . ASN A  1 99  ? 50.790  104.997 154.482 1.00 73.80  ? 99   ASN A ND2 1 
ATOM   606   N N   . ASN A  1 100 ? 50.085  107.275 149.911 1.00 72.18  ? 100  ASN A N   1 
ATOM   607   C CA  . ASN A  1 100 ? 50.301  108.261 148.856 1.00 72.98  ? 100  ASN A CA  1 
ATOM   608   C C   . ASN A  1 100 ? 48.922  108.183 148.255 1.00 72.39  ? 100  ASN A C   1 
ATOM   609   O O   . ASN A  1 100 ? 47.934  108.590 148.881 1.00 72.63  ? 100  ASN A O   1 
ATOM   610   C CB  . ASN A  1 100 ? 51.355  107.722 147.901 1.00 75.58  ? 100  ASN A CB  1 
ATOM   611   C CG  . ASN A  1 100 ? 51.903  106.354 148.369 1.00 79.09  ? 100  ASN A CG  1 
ATOM   612   O OD1 . ASN A  1 100 ? 52.730  106.265 149.297 1.00 80.12  ? 100  ASN A OD1 1 
ATOM   613   N ND2 . ASN A  1 100 ? 51.406  105.281 147.755 1.00 80.18  ? 100  ASN A ND2 1 
ATOM   614   N N   . GLY A  1 101 ? 48.839  107.639 147.054 1.00 71.10  ? 101  GLY A N   1 
ATOM   615   C CA  . GLY A  1 101 ? 47.537  107.457 146.446 1.00 68.76  ? 101  GLY A CA  1 
ATOM   616   C C   . GLY A  1 101 ? 47.473  105.955 146.267 1.00 66.85  ? 101  GLY A C   1 
ATOM   617   O O   . GLY A  1 101 ? 46.578  105.415 145.615 1.00 66.91  ? 101  GLY A O   1 
ATOM   618   N N   . LYS A  1 102 ? 48.451  105.282 146.869 1.00 64.58  ? 102  LYS A N   1 
ATOM   619   C CA  . LYS A  1 102 ? 48.586  103.841 146.755 1.00 62.39  ? 102  LYS A CA  1 
ATOM   620   C C   . LYS A  1 102 ? 48.349  103.051 148.044 1.00 59.50  ? 102  LYS A C   1 
ATOM   621   O O   . LYS A  1 102 ? 48.585  103.537 149.164 1.00 59.29  ? 102  LYS A O   1 
ATOM   622   C CB  . LYS A  1 102 ? 49.978  103.516 146.221 1.00 65.19  ? 102  LYS A CB  1 
ATOM   623   C CG  . LYS A  1 102 ? 50.333  104.212 144.901 1.00 67.29  ? 102  LYS A CG  1 
ATOM   624   C CD  . LYS A  1 102 ? 51.843  104.097 144.649 1.00 69.82  ? 102  LYS A CD  1 
ATOM   625   C CE  . LYS A  1 102 ? 52.239  104.602 143.267 1.00 70.86  ? 102  LYS A CE  1 
ATOM   626   N NZ  . LYS A  1 102 ? 53.703  104.374 143.055 1.00 72.24  ? 102  LYS A NZ  1 
ATOM   627   N N   . PHE A  1 103 ? 47.908  101.809 147.864 1.00 54.75  ? 103  PHE A N   1 
ATOM   628   C CA  . PHE A  1 103 ? 47.630  100.934 148.988 1.00 50.09  ? 103  PHE A CA  1 
ATOM   629   C C   . PHE A  1 103 ? 48.677  99.868  149.299 1.00 48.16  ? 103  PHE A C   1 
ATOM   630   O O   . PHE A  1 103 ? 49.271  99.273  148.406 1.00 47.49  ? 103  PHE A O   1 
ATOM   631   C CB  . PHE A  1 103 ? 46.280  100.275 148.776 1.00 46.12  ? 103  PHE A CB  1 
ATOM   632   C CG  . PHE A  1 103 ? 45.132  101.232 148.829 1.00 42.06  ? 103  PHE A CG  1 
ATOM   633   C CD1 . PHE A  1 103 ? 44.544  101.705 147.667 1.00 40.38  ? 103  PHE A CD1 1 
ATOM   634   C CD2 . PHE A  1 103 ? 44.628  101.652 150.059 1.00 40.24  ? 103  PHE A CD2 1 
ATOM   635   C CE1 . PHE A  1 103 ? 43.467  102.579 147.733 1.00 39.38  ? 103  PHE A CE1 1 
ATOM   636   C CE2 . PHE A  1 103 ? 43.561  102.518 150.129 1.00 37.41  ? 103  PHE A CE2 1 
ATOM   637   C CZ  . PHE A  1 103 ? 42.980  102.983 148.971 1.00 38.71  ? 103  PHE A CZ  1 
ATOM   638   N N   . TYR A  1 104 ? 48.883  99.650  150.590 1.00 47.24  ? 104  TYR A N   1 
ATOM   639   C CA  . TYR A  1 104 ? 49.811  98.652  151.097 1.00 47.90  ? 104  TYR A CA  1 
ATOM   640   C C   . TYR A  1 104 ? 48.989  97.715  151.985 1.00 46.02  ? 104  TYR A C   1 
ATOM   641   O O   . TYR A  1 104 ? 48.465  98.117  153.038 1.00 44.28  ? 104  TYR A O   1 
ATOM   642   C CB  . TYR A  1 104 ? 50.959  99.321  151.871 1.00 52.39  ? 104  TYR A CB  1 
ATOM   643   C CG  . TYR A  1 104 ? 51.711  100.252 150.964 1.00 58.45  ? 104  TYR A CG  1 
ATOM   644   C CD1 . TYR A  1 104 ? 51.187  101.519 150.648 1.00 60.89  ? 104  TYR A CD1 1 
ATOM   645   C CD2 . TYR A  1 104 ? 52.826  99.804  150.244 1.00 60.19  ? 104  TYR A CD2 1 
ATOM   646   C CE1 . TYR A  1 104 ? 51.733  102.296 149.624 1.00 62.24  ? 104  TYR A CE1 1 
ATOM   647   C CE2 . TYR A  1 104 ? 53.381  100.580 149.222 1.00 61.34  ? 104  TYR A CE2 1 
ATOM   648   C CZ  . TYR A  1 104 ? 52.821  101.813 148.917 1.00 62.58  ? 104  TYR A CZ  1 
ATOM   649   O OH  . TYR A  1 104 ? 53.307  102.547 147.868 1.00 65.46  ? 104  TYR A OH  1 
ATOM   650   N N   . VAL A  1 105 ? 48.871  96.467  151.521 1.00 43.14  ? 105  VAL A N   1 
ATOM   651   C CA  . VAL A  1 105 ? 48.076  95.444  152.193 1.00 39.88  ? 105  VAL A CA  1 
ATOM   652   C C   . VAL A  1 105 ? 48.782  94.122  152.536 1.00 37.67  ? 105  VAL A C   1 
ATOM   653   O O   . VAL A  1 105 ? 49.441  93.503  151.686 1.00 38.12  ? 105  VAL A O   1 
ATOM   654   C CB  . VAL A  1 105 ? 46.840  95.131  151.338 1.00 38.80  ? 105  VAL A CB  1 
ATOM   655   C CG1 . VAL A  1 105 ? 45.901  94.274  152.088 1.00 38.77  ? 105  VAL A CG1 1 
ATOM   656   C CG2 . VAL A  1 105 ? 46.144  96.419  150.958 1.00 38.42  ? 105  VAL A CG2 1 
ATOM   657   N N   . GLY A  1 106 ? 48.627  93.697  153.783 1.00 34.94  ? 106  GLY A N   1 
ATOM   658   C CA  . GLY A  1 106 ? 49.215  92.451  154.244 1.00 33.97  ? 106  GLY A CA  1 
ATOM   659   C C   . GLY A  1 106 ? 48.122  91.543  154.793 1.00 33.10  ? 106  GLY A C   1 
ATOM   660   O O   . GLY A  1 106 ? 47.320  91.935  155.656 1.00 33.78  ? 106  GLY A O   1 
ATOM   661   N N   . VAL A  1 107 ? 48.048  90.322  154.277 1.00 31.36  ? 107  VAL A N   1 
ATOM   662   C CA  . VAL A  1 107 ? 47.029  89.384  154.741 1.00 28.47  ? 107  VAL A CA  1 
ATOM   663   C C   . VAL A  1 107 ? 47.632  88.013  155.029 1.00 28.81  ? 107  VAL A C   1 
ATOM   664   O O   . VAL A  1 107 ? 48.528  87.545  154.312 1.00 29.36  ? 107  VAL A O   1 
ATOM   665   C CB  . VAL A  1 107 ? 45.921  89.241  153.696 1.00 27.14  ? 107  VAL A CB  1 
ATOM   666   C CG1 . VAL A  1 107 ? 45.019  88.127  154.073 1.00 26.38  ? 107  VAL A CG1 1 
ATOM   667   C CG2 . VAL A  1 107 ? 45.120  90.533  153.616 1.00 27.00  ? 107  VAL A CG2 1 
ATOM   668   N N   . CYS A  1 108 ? 47.173  87.365  156.089 1.00 27.83  ? 108  CYS A N   1 
ATOM   669   C CA  . CYS A  1 108 ? 47.674  86.037  156.388 1.00 26.61  ? 108  CYS A CA  1 
ATOM   670   C C   . CYS A  1 108 ? 46.520  85.066  156.410 1.00 26.95  ? 108  CYS A C   1 
ATOM   671   O O   . CYS A  1 108 ? 45.402  85.438  156.780 1.00 27.40  ? 108  CYS A O   1 
ATOM   672   C CB  . CYS A  1 108 ? 48.367  86.010  157.744 1.00 28.35  ? 108  CYS A CB  1 
ATOM   673   S SG  . CYS A  1 108 ? 47.278  86.184  159.174 1.00 25.55  ? 108  CYS A SG  1 
ATOM   674   N N   . ALA A  1 109 ? 46.788  83.818  156.023 1.00 27.05  ? 109  ALA A N   1 
ATOM   675   C CA  . ALA A  1 109 ? 45.764  82.765  156.020 1.00 25.53  ? 109  ALA A CA  1 
ATOM   676   C C   . ALA A  1 109 ? 46.314  81.503  156.690 1.00 25.92  ? 109  ALA A C   1 
ATOM   677   O O   . ALA A  1 109 ? 47.488  81.164  156.546 1.00 28.09  ? 109  ALA A O   1 
ATOM   678   C CB  . ALA A  1 109 ? 45.355  82.464  154.613 1.00 21.21  ? 109  ALA A CB  1 
ATOM   679   N N   . PHE A  1 110 ? 45.493  80.815  157.457 1.00 25.14  ? 110  PHE A N   1 
ATOM   680   C CA  . PHE A  1 110 ? 45.949  79.580  158.086 1.00 25.76  ? 110  PHE A CA  1 
ATOM   681   C C   . PHE A  1 110 ? 45.207  78.463  157.350 1.00 25.96  ? 110  PHE A C   1 
ATOM   682   O O   . PHE A  1 110 ? 43.952  78.385  157.392 1.00 27.17  ? 110  PHE A O   1 
ATOM   683   C CB  . PHE A  1 110 ? 45.624  79.587  159.586 1.00 26.20  ? 110  PHE A CB  1 
ATOM   684   C CG  . PHE A  1 110 ? 46.384  80.625  160.335 1.00 29.08  ? 110  PHE A CG  1 
ATOM   685   C CD1 . PHE A  1 110 ? 45.929  81.938  160.390 1.00 27.28  ? 110  PHE A CD1 1 
ATOM   686   C CD2 . PHE A  1 110 ? 47.629  80.327  160.887 1.00 29.84  ? 110  PHE A CD2 1 
ATOM   687   C CE1 . PHE A  1 110 ? 46.703  82.923  160.967 1.00 27.75  ? 110  PHE A CE1 1 
ATOM   688   C CE2 . PHE A  1 110 ? 48.421  81.328  161.477 1.00 29.67  ? 110  PHE A CE2 1 
ATOM   689   C CZ  . PHE A  1 110 ? 47.952  82.626  161.509 1.00 28.82  ? 110  PHE A CZ  1 
ATOM   690   N N   . VAL A  1 111 ? 45.971  77.620  156.672 1.00 22.11  ? 111  VAL A N   1 
ATOM   691   C CA  . VAL A  1 111 ? 45.390  76.561  155.884 1.00 22.84  ? 111  VAL A CA  1 
ATOM   692   C C   . VAL A  1 111 ? 45.734  75.184  156.457 1.00 23.36  ? 111  VAL A C   1 
ATOM   693   O O   . VAL A  1 111 ? 46.882  74.904  156.765 1.00 22.72  ? 111  VAL A O   1 
ATOM   694   C CB  . VAL A  1 111 ? 45.886  76.676  154.404 1.00 24.50  ? 111  VAL A CB  1 
ATOM   695   C CG1 . VAL A  1 111 ? 45.282  75.603  153.548 1.00 24.03  ? 111  VAL A CG1 1 
ATOM   696   C CG2 . VAL A  1 111 ? 45.549  78.057  153.830 1.00 21.83  ? 111  VAL A CG2 1 
ATOM   697   N N   . ARG A  1 112 ? 44.712  74.351  156.625 1.00 23.15  ? 112  ARG A N   1 
ATOM   698   C CA  . ARG A  1 112 ? 44.877  73.014  157.169 1.00 25.69  ? 112  ARG A CA  1 
ATOM   699   C C   . ARG A  1 112 ? 44.576  72.047  156.043 1.00 25.49  ? 112  ARG A C   1 
ATOM   700   O O   . ARG A  1 112 ? 43.493  72.081  155.429 1.00 26.77  ? 112  ARG A O   1 
ATOM   701   C CB  . ARG A  1 112 ? 43.892  72.738  158.350 1.00 27.27  ? 112  ARG A CB  1 
ATOM   702   C CG  . ARG A  1 112 ? 44.349  71.661  159.324 1.00 27.08  ? 112  ARG A CG  1 
ATOM   703   C CD  . ARG A  1 112 ? 43.350  71.285  160.409 1.00 31.26  ? 112  ARG A CD  1 
ATOM   704   N NE  . ARG A  1 112 ? 42.723  70.025  160.018 1.00 39.04  ? 112  ARG A NE  1 
ATOM   705   C CZ  . ARG A  1 112 ? 42.660  68.919  160.768 1.00 41.34  ? 112  ARG A CZ  1 
ATOM   706   N NH1 . ARG A  1 112 ? 43.172  68.904  162.012 1.00 42.90  ? 112  ARG A NH1 1 
ATOM   707   N NH2 . ARG A  1 112 ? 42.157  67.797  160.233 1.00 40.75  ? 112  ARG A NH2 1 
ATOM   708   N N   . VAL A  1 113 ? 45.528  71.201  155.754 1.00 24.52  ? 113  VAL A N   1 
ATOM   709   C CA  . VAL A  1 113 ? 45.289  70.236  154.720 1.00 27.14  ? 113  VAL A CA  1 
ATOM   710   C C   . VAL A  1 113 ? 45.197  68.859  155.375 1.00 25.57  ? 113  VAL A C   1 
ATOM   711   O O   . VAL A  1 113 ? 45.903  68.565  156.320 1.00 27.38  ? 113  VAL A O   1 
ATOM   712   C CB  . VAL A  1 113 ? 46.400  70.290  153.644 1.00 27.01  ? 113  VAL A CB  1 
ATOM   713   C CG1 . VAL A  1 113 ? 47.725  70.420  154.292 1.00 29.48  ? 113  VAL A CG1 1 
ATOM   714   C CG2 . VAL A  1 113 ? 46.383  69.017  152.840 1.00 30.22  ? 113  VAL A CG2 1 
ATOM   715   N N   . GLN A  1 114 ? 44.328  68.008  154.863 1.00 26.19  ? 114  GLN A N   1 
ATOM   716   C CA  . GLN A  1 114 ? 44.146  66.667  155.441 1.00 25.68  ? 114  GLN A CA  1 
ATOM   717   C C   . GLN A  1 114 ? 44.053  65.584  154.402 1.00 24.18  ? 114  GLN A C   1 
ATOM   718   O O   . GLN A  1 114 ? 43.564  65.824  153.311 1.00 23.63  ? 114  GLN A O   1 
ATOM   719   C CB  . GLN A  1 114 ? 42.878  66.632  156.233 1.00 25.27  ? 114  GLN A CB  1 
ATOM   720   C CG  . GLN A  1 114 ? 42.669  65.389  156.960 1.00 27.15  ? 114  GLN A CG  1 
ATOM   721   C CD  . GLN A  1 114 ? 41.290  65.356  157.579 1.00 28.64  ? 114  GLN A CD  1 
ATOM   722   O OE1 . GLN A  1 114 ? 40.796  66.354  158.086 1.00 29.13  ? 114  GLN A OE1 1 
ATOM   723   N NE2 . GLN A  1 114 ? 40.656  64.208  157.518 1.00 29.98  ? 114  GLN A NE2 1 
ATOM   724   N N   . LEU A  1 115 ? 44.518  64.392  154.749 1.00 24.72  ? 115  LEU A N   1 
ATOM   725   C CA  . LEU A  1 115 ? 44.471  63.240  153.851 1.00 24.58  ? 115  LEU A CA  1 
ATOM   726   C C   . LEU A  1 115 ? 43.237  62.405  154.221 1.00 25.24  ? 115  LEU A C   1 
ATOM   727   O O   . LEU A  1 115 ? 42.683  62.578  155.313 1.00 25.27  ? 115  LEU A O   1 
ATOM   728   C CB  . LEU A  1 115 ? 45.735  62.432  154.035 1.00 25.07  ? 115  LEU A CB  1 
ATOM   729   C CG  . LEU A  1 115 ? 46.932  62.683  153.116 1.00 24.17  ? 115  LEU A CG  1 
ATOM   730   C CD1 . LEU A  1 115 ? 46.939  64.044  152.541 1.00 20.61  ? 115  LEU A CD1 1 
ATOM   731   C CD2 . LEU A  1 115 ? 48.180  62.373  153.913 1.00 23.03  ? 115  LEU A CD2 1 
ATOM   732   N N   . LYS A  1 116 ? 42.796  61.516  153.329 1.00 27.10  ? 116  LYS A N   1 
ATOM   733   C CA  . LYS A  1 116 ? 41.594  60.667  153.591 1.00 27.86  ? 116  LYS A CA  1 
ATOM   734   C C   . LYS A  1 116 ? 41.782  59.841  154.868 1.00 27.79  ? 116  LYS A C   1 
ATOM   735   O O   . LYS A  1 116 ? 40.867  59.316  155.462 1.00 28.30  ? 116  LYS A O   1 
ATOM   736   C CB  . LYS A  1 116 ? 41.330  59.749  152.398 1.00 26.17  ? 116  LYS A CB  1 
ATOM   737   C CG  . LYS A  1 116 ? 42.507  58.876  152.004 1.00 27.14  ? 116  LYS A CG  1 
ATOM   738   C CD  . LYS A  1 116 ? 42.068  57.864  150.925 1.00 30.37  ? 116  LYS A CD  1 
ATOM   739   C CE  . LYS A  1 116 ? 43.229  57.120  150.290 1.00 31.37  ? 116  LYS A CE  1 
ATOM   740   N NZ  . LYS A  1 116 ? 42.846  56.310  149.050 1.00 35.44  ? 116  LYS A NZ  1 
ATOM   741   N N   . ASP A  1 117 ? 43.031  59.796  155.254 1.00 28.83  ? 117  ASP A N   1 
ATOM   742   C CA  . ASP A  1 117 ? 43.610  59.158  156.398 1.00 29.83  ? 117  ASP A CA  1 
ATOM   743   C C   . ASP A  1 117 ? 43.186  59.782  157.727 1.00 30.93  ? 117  ASP A C   1 
ATOM   744   O O   . ASP A  1 117 ? 43.016  59.116  158.738 1.00 30.46  ? 117  ASP A O   1 
ATOM   745   C CB  . ASP A  1 117 ? 45.109  59.399  156.283 1.00 32.57  ? 117  ASP A CB  1 
ATOM   746   C CG  . ASP A  1 117 ? 45.879  58.419  157.012 1.00 36.09  ? 117  ASP A CG  1 
ATOM   747   O OD1 . ASP A  1 117 ? 47.055  58.670  157.334 1.00 39.80  ? 117  ASP A OD1 1 
ATOM   748   O OD2 . ASP A  1 117 ? 45.293  57.356  157.242 1.00 41.37  ? 117  ASP A OD2 1 
ATOM   749   N N   . GLY A  1 118 ? 43.104  61.106  157.716 1.00 31.66  ? 118  GLY A N   1 
ATOM   750   C CA  . GLY A  1 118 ? 42.828  61.838  158.914 1.00 29.96  ? 118  GLY A CA  1 
ATOM   751   C C   . GLY A  1 118 ? 44.149  62.534  159.253 1.00 30.52  ? 118  GLY A C   1 
ATOM   752   O O   . GLY A  1 118 ? 44.159  63.414  160.094 1.00 32.74  ? 118  GLY A O   1 
ATOM   753   N N   . SER A  1 119 ? 45.267  62.176  158.623 1.00 28.59  ? 119  SER A N   1 
ATOM   754   C CA  . SER A  1 119 ? 46.518  62.867  158.952 1.00 29.57  ? 119  SER A CA  1 
ATOM   755   C C   . SER A  1 119 ? 46.463  64.302  158.416 1.00 28.73  ? 119  SER A C   1 
ATOM   756   O O   . SER A  1 119 ? 45.786  64.578  157.446 1.00 29.81  ? 119  SER A O   1 
ATOM   757   C CB  . SER A  1 119 ? 47.727  62.098  158.407 1.00 29.80  ? 119  SER A CB  1 
ATOM   758   O OG  . SER A  1 119 ? 47.529  61.718  157.067 1.00 34.52  ? 119  SER A OG  1 
ATOM   759   N N   . TYR A  1 120 ? 47.173  65.229  159.035 1.00 28.20  ? 120  TYR A N   1 
ATOM   760   C CA  . TYR A  1 120 ? 47.063  66.619  158.582 1.00 28.85  ? 120  TYR A CA  1 
ATOM   761   C C   . TYR A  1 120 ? 48.256  67.518  158.883 1.00 30.11  ? 120  TYR A C   1 
ATOM   762   O O   . TYR A  1 120 ? 49.122  67.195  159.726 1.00 29.16  ? 120  TYR A O   1 
ATOM   763   C CB  . TYR A  1 120 ? 45.857  67.251  159.259 1.00 28.17  ? 120  TYR A CB  1 
ATOM   764   C CG  . TYR A  1 120 ? 45.973  67.161  160.765 1.00 26.77  ? 120  TYR A CG  1 
ATOM   765   C CD1 . TYR A  1 120 ? 46.620  68.159  161.494 1.00 26.05  ? 120  TYR A CD1 1 
ATOM   766   C CD2 . TYR A  1 120 ? 45.529  66.020  161.463 1.00 26.90  ? 120  TYR A CD2 1 
ATOM   767   C CE1 . TYR A  1 120 ? 46.828  68.029  162.867 1.00 23.73  ? 120  TYR A CE1 1 
ATOM   768   C CE2 . TYR A  1 120 ? 45.729  65.883  162.838 1.00 24.48  ? 120  TYR A CE2 1 
ATOM   769   C CZ  . TYR A  1 120 ? 46.371  66.894  163.509 1.00 23.98  ? 120  TYR A CZ  1 
ATOM   770   O OH  . TYR A  1 120 ? 46.515  66.786  164.826 1.00 25.71  ? 120  TYR A OH  1 
ATOM   771   N N   . HIS A  1 121 ? 48.298  68.663  158.194 1.00 30.44  ? 121  HIS A N   1 
ATOM   772   C CA  . HIS A  1 121 ? 49.366  69.652  158.431 1.00 31.13  ? 121  HIS A CA  1 
ATOM   773   C C   . HIS A  1 121 ? 48.768  70.997  158.209 1.00 31.12  ? 121  HIS A C   1 
ATOM   774   O O   . HIS A  1 121 ? 47.950  71.167  157.320 1.00 32.08  ? 121  HIS A O   1 
ATOM   775   C CB  . HIS A  1 121 ? 50.567  69.450  157.512 1.00 30.05  ? 121  HIS A CB  1 
ATOM   776   C CG  . HIS A  1 121 ? 51.381  68.232  157.848 1.00 32.93  ? 121  HIS A CG  1 
ATOM   777   N ND1 . HIS A  1 121 ? 51.566  67.186  156.963 1.00 33.62  ? 121  HIS A ND1 1 
ATOM   778   C CD2 . HIS A  1 121 ? 52.081  67.906  158.960 1.00 31.86  ? 121  HIS A CD2 1 
ATOM   779   C CE1 . HIS A  1 121 ? 52.350  66.276  157.514 1.00 34.48  ? 121  HIS A CE1 1 
ATOM   780   N NE2 . HIS A  1 121 ? 52.680  66.690  158.725 1.00 32.72  ? 121  HIS A NE2 1 
ATOM   781   N N   . GLU A  1 122 ? 49.143  71.954  159.035 1.00 31.59  ? 122  GLU A N   1 
ATOM   782   C CA  . GLU A  1 122 ? 48.599  73.297  158.910 1.00 31.81  ? 122  GLU A CA  1 
ATOM   783   C C   . GLU A  1 122 ? 49.747  74.308  158.898 1.00 31.42  ? 122  GLU A C   1 
ATOM   784   O O   . GLU A  1 122 ? 50.765  74.118  159.584 1.00 29.63  ? 122  GLU A O   1 
ATOM   785   C CB  . GLU A  1 122 ? 47.647  73.574  160.084 1.00 31.34  ? 122  GLU A CB  1 
ATOM   786   C CG  . GLU A  1 122 ? 47.082  74.970  160.091 1.00 31.93  ? 122  GLU A CG  1 
ATOM   787   C CD  . GLU A  1 122 ? 46.132  75.205  161.254 1.00 33.48  ? 122  GLU A CD  1 
ATOM   788   O OE1 . GLU A  1 122 ? 46.137  74.427  162.241 1.00 32.42  ? 122  GLU A OE1 1 
ATOM   789   O OE2 . GLU A  1 122 ? 45.379  76.188  161.175 1.00 34.60  ? 122  GLU A OE2 1 
ATOM   790   N N   . ASP A  1 123 ? 49.587  75.385  158.130 1.00 30.38  ? 123  ASP A N   1 
ATOM   791   C CA  . ASP A  1 123 ? 50.621  76.407  158.074 1.00 29.42  ? 123  ASP A CA  1 
ATOM   792   C C   . ASP A  1 123 ? 50.057  77.778  157.761 1.00 29.53  ? 123  ASP A C   1 
ATOM   793   O O   . ASP A  1 123 ? 48.875  77.883  157.468 1.00 30.01  ? 123  ASP A O   1 
ATOM   794   C CB  . ASP A  1 123 ? 51.660  76.038  157.019 1.00 28.70  ? 123  ASP A CB  1 
ATOM   795   C CG  . ASP A  1 123 ? 53.036  76.524  157.388 1.00 27.71  ? 123  ASP A CG  1 
ATOM   796   O OD1 . ASP A  1 123 ? 53.126  77.630  157.953 1.00 27.16  ? 123  ASP A OD1 1 
ATOM   797   O OD2 . ASP A  1 123 ? 54.021  75.813  157.117 1.00 29.87  ? 123  ASP A OD2 1 
ATOM   798   N N   . VAL A  1 124 ? 50.893  78.832  157.824 1.00 29.60  ? 124  VAL A N   1 
ATOM   799   C CA  . VAL A  1 124 ? 50.432  80.188  157.491 1.00 29.37  ? 124  VAL A CA  1 
ATOM   800   C C   . VAL A  1 124 ? 50.906  80.513  156.129 1.00 29.04  ? 124  VAL A C   1 
ATOM   801   O O   . VAL A  1 124 ? 52.000  80.103  155.730 1.00 29.20  ? 124  VAL A O   1 
ATOM   802   C CB  . VAL A  1 124 ? 51.088  81.340  158.265 1.00 30.11  ? 124  VAL A CB  1 
ATOM   803   C CG1 . VAL A  1 124 ? 50.081  82.071  159.042 1.00 32.08  ? 124  VAL A CG1 1 
ATOM   804   C CG2 . VAL A  1 124 ? 52.236  80.857  159.067 1.00 32.72  ? 124  VAL A CG2 1 
ATOM   805   N N   . GLY A  1 125 ? 50.117  81.317  155.447 1.00 28.44  ? 125  GLY A N   1 
ATOM   806   C CA  . GLY A  1 125 ? 50.487  81.788  154.131 1.00 28.79  ? 125  GLY A CA  1 
ATOM   807   C C   . GLY A  1 125 ? 50.325  83.289  154.276 1.00 30.02  ? 125  GLY A C   1 
ATOM   808   O O   . GLY A  1 125 ? 49.604  83.766  155.186 1.00 29.68  ? 125  GLY A O   1 
ATOM   809   N N   . TYR A  1 126 ? 51.010  84.051  153.430 1.00 30.35  ? 126  TYR A N   1 
ATOM   810   C CA  . TYR A  1 126 ? 50.901  85.500  153.493 1.00 29.27  ? 126  TYR A CA  1 
ATOM   811   C C   . TYR A  1 126 ? 50.629  86.035  152.119 1.00 29.93  ? 126  TYR A C   1 
ATOM   812   O O   . TYR A  1 126 ? 51.113  85.498  151.125 1.00 29.71  ? 126  TYR A O   1 
ATOM   813   C CB  . TYR A  1 126 ? 52.179  86.142  154.025 1.00 29.89  ? 126  TYR A CB  1 
ATOM   814   C CG  . TYR A  1 126 ? 51.903  87.398  154.828 1.00 30.15  ? 126  TYR A CG  1 
ATOM   815   C CD1 . TYR A  1 126 ? 51.381  87.320  156.113 1.00 29.69  ? 126  TYR A CD1 1 
ATOM   816   C CD2 . TYR A  1 126 ? 52.061  88.660  154.256 1.00 29.94  ? 126  TYR A CD2 1 
ATOM   817   C CE1 . TYR A  1 126 ? 51.010  88.466  156.806 1.00 31.75  ? 126  TYR A CE1 1 
ATOM   818   C CE2 . TYR A  1 126 ? 51.706  89.819  154.930 1.00 30.06  ? 126  TYR A CE2 1 
ATOM   819   C CZ  . TYR A  1 126 ? 51.170  89.726  156.213 1.00 32.33  ? 126  TYR A CZ  1 
ATOM   820   O OH  . TYR A  1 126 ? 50.750  90.860  156.908 1.00 30.72  ? 126  TYR A OH  1 
ATOM   821   N N   . GLY A  1 127 ? 49.830  87.093  152.056 1.00 30.90  ? 127  GLY A N   1 
ATOM   822   C CA  . GLY A  1 127 ? 49.502  87.700  150.780 1.00 31.26  ? 127  GLY A CA  1 
ATOM   823   C C   . GLY A  1 127 ? 49.875  89.170  150.868 1.00 33.19  ? 127  GLY A C   1 
ATOM   824   O O   . GLY A  1 127 ? 49.614  89.835  151.871 1.00 31.24  ? 127  GLY A O   1 
ATOM   825   N N   . VAL A  1 128 ? 50.471  89.695  149.805 1.00 35.50  ? 128  VAL A N   1 
ATOM   826   C CA  . VAL A  1 128 ? 50.893  91.102  149.810 1.00 36.54  ? 128  VAL A CA  1 
ATOM   827   C C   . VAL A  1 128 ? 50.518  91.879  148.577 1.00 37.77  ? 128  VAL A C   1 
ATOM   828   O O   . VAL A  1 128 ? 50.536  91.360  147.468 1.00 37.94  ? 128  VAL A O   1 
ATOM   829   C CB  . VAL A  1 128 ? 52.401  91.233  149.916 1.00 35.16  ? 128  VAL A CB  1 
ATOM   830   C CG1 . VAL A  1 128 ? 52.736  92.686  149.943 1.00 36.97  ? 128  VAL A CG1 1 
ATOM   831   C CG2 . VAL A  1 128 ? 52.929  90.482  151.147 1.00 32.92  ? 128  VAL A CG2 1 
ATOM   832   N N   . SER A  1 129 ? 50.159  93.132  148.765 1.00 40.67  ? 129  SER A N   1 
ATOM   833   C CA  . SER A  1 129 ? 49.835  93.972  147.615 1.00 43.91  ? 129  SER A CA  1 
ATOM   834   C C   . SER A  1 129 ? 50.352  95.343  147.970 1.00 46.54  ? 129  SER A C   1 
ATOM   835   O O   . SER A  1 129 ? 49.882  95.963  148.940 1.00 46.47  ? 129  SER A O   1 
ATOM   836   C CB  . SER A  1 129 ? 48.345  94.028  147.365 1.00 43.32  ? 129  SER A CB  1 
ATOM   837   O OG  . SER A  1 129 ? 48.107  94.802  146.214 1.00 46.13  ? 129  SER A OG  1 
ATOM   838   N N   . GLU A  1 130 ? 51.356  95.800  147.224 1.00 48.85  ? 130  GLU A N   1 
ATOM   839   C CA  . GLU A  1 130 ? 51.962  97.109  147.497 1.00 51.43  ? 130  GLU A CA  1 
ATOM   840   C C   . GLU A  1 130 ? 52.012  97.964  146.251 1.00 52.85  ? 130  GLU A C   1 
ATOM   841   O O   . GLU A  1 130 ? 52.540  97.530  145.216 1.00 53.54  ? 130  GLU A O   1 
ATOM   842   C CB  . GLU A  1 130 ? 53.380  96.942  148.064 1.00 50.85  ? 130  GLU A CB  1 
ATOM   843   C CG  . GLU A  1 130 ? 53.377  96.329  149.455 1.00 53.90  ? 130  GLU A CG  1 
ATOM   844   C CD  . GLU A  1 130 ? 54.772  96.086  150.035 1.00 55.49  ? 130  GLU A CD  1 
ATOM   845   O OE1 . GLU A  1 130 ? 55.610  95.455  149.337 1.00 54.94  ? 130  GLU A OE1 1 
ATOM   846   O OE2 . GLU A  1 130 ? 55.015  96.514  151.201 1.00 55.39  ? 130  GLU A OE2 1 
ATOM   847   N N   . GLY A  1 131 ? 51.434  99.166  146.333 1.00 54.18  ? 131  GLY A N   1 
ATOM   848   C CA  . GLY A  1 131 ? 51.476  100.078 145.202 1.00 54.48  ? 131  GLY A CA  1 
ATOM   849   C C   . GLY A  1 131 ? 50.276  100.287 144.312 1.00 55.27  ? 131  GLY A C   1 
ATOM   850   O O   . GLY A  1 131 ? 50.281  101.249 143.548 1.00 56.69  ? 131  GLY A O   1 
ATOM   851   N N   . LEU A  1 132 ? 49.268  99.421  144.358 1.00 55.55  ? 132  LEU A N   1 
ATOM   852   C CA  . LEU A  1 132 ? 48.094  99.631  143.504 1.00 55.25  ? 132  LEU A CA  1 
ATOM   853   C C   . LEU A  1 132 ? 47.293  100.842 143.994 1.00 54.89  ? 132  LEU A C   1 
ATOM   854   O O   . LEU A  1 132 ? 47.438  101.276 145.143 1.00 54.54  ? 132  LEU A O   1 
ATOM   855   C CB  . LEU A  1 132 ? 47.202  98.388  143.520 1.00 55.71  ? 132  LEU A CB  1 
ATOM   856   C CG  . LEU A  1 132 ? 47.872  97.088  143.092 1.00 56.09  ? 132  LEU A CG  1 
ATOM   857   C CD1 . LEU A  1 132 ? 46.827  95.993  143.071 1.00 55.63  ? 132  LEU A CD1 1 
ATOM   858   C CD2 . LEU A  1 132 ? 48.481  97.255  141.711 1.00 55.49  ? 132  LEU A CD2 1 
ATOM   859   N N   . LYS A  1 133 ? 46.446  101.389 143.137 1.00 54.42  ? 133  LYS A N   1 
ATOM   860   C CA  . LYS A  1 133 ? 45.655  102.517 143.562 1.00 54.45  ? 133  LYS A CA  1 
ATOM   861   C C   . LYS A  1 133 ? 44.263  102.047 143.929 1.00 53.49  ? 133  LYS A C   1 
ATOM   862   O O   . LYS A  1 133 ? 43.475  102.771 144.544 1.00 53.94  ? 133  LYS A O   1 
ATOM   863   C CB  . LYS A  1 133 ? 45.607  103.571 142.452 1.00 57.42  ? 133  LYS A CB  1 
ATOM   864   C CG  . LYS A  1 133 ? 46.977  104.195 142.145 1.00 61.31  ? 133  LYS A CG  1 
ATOM   865   C CD  . LYS A  1 133 ? 46.878  105.588 141.483 1.00 65.23  ? 133  LYS A CD  1 
ATOM   866   C CE  . LYS A  1 133 ? 45.918  105.606 140.284 1.00 67.20  ? 133  LYS A CE  1 
ATOM   867   N NZ  . LYS A  1 133 ? 46.182  104.519 139.275 1.00 69.34  ? 133  LYS A NZ  1 
ATOM   868   N N   . SER A  1 134 ? 43.954  100.815 143.542 1.00 51.83  ? 134  SER A N   1 
ATOM   869   C CA  . SER A  1 134 ? 42.652  100.232 143.856 1.00 48.73  ? 134  SER A CA  1 
ATOM   870   C C   . SER A  1 134 ? 42.724  99.475  145.186 1.00 46.48  ? 134  SER A C   1 
ATOM   871   O O   . SER A  1 134 ? 43.584  98.588  145.365 1.00 46.16  ? 134  SER A O   1 
ATOM   872   C CB  . SER A  1 134 ? 42.210  99.277  142.751 1.00 48.66  ? 134  SER A CB  1 
ATOM   873   O OG  . SER A  1 134 ? 40.887  98.831  143.000 1.00 49.33  ? 134  SER A OG  1 
ATOM   874   N N   . LYS A  1 135 ? 41.843  99.853  146.114 1.00 42.97  ? 135  LYS A N   1 
ATOM   875   C CA  . LYS A  1 135 ? 41.770  99.222  147.421 1.00 41.08  ? 135  LYS A CA  1 
ATOM   876   C C   . LYS A  1 135 ? 41.249  97.791  147.140 1.00 41.48  ? 135  LYS A C   1 
ATOM   877   O O   . LYS A  1 135 ? 41.840  96.778  147.566 1.00 40.64  ? 135  LYS A O   1 
ATOM   878   C CB  . LYS A  1 135 ? 40.772  99.968  148.271 1.00 38.52  ? 135  LYS A CB  1 
ATOM   879   C CG  . LYS A  1 135 ? 40.824  99.732  149.756 1.00 38.26  ? 135  LYS A CG  1 
ATOM   880   C CD  . LYS A  1 135 ? 39.666  100.517 150.369 1.00 38.90  ? 135  LYS A CD  1 
ATOM   881   C CE  . LYS A  1 135 ? 39.957  101.021 151.750 1.00 41.43  ? 135  LYS A CE  1 
ATOM   882   N NZ  . LYS A  1 135 ? 38.866  101.944 152.172 1.00 41.80  ? 135  LYS A NZ  1 
ATOM   883   N N   . ALA A  1 136 ? 40.148  97.727  146.397 1.00 39.98  ? 136  ALA A N   1 
ATOM   884   C CA  . ALA A  1 136 ? 39.549  96.465  146.045 1.00 39.46  ? 136  ALA A CA  1 
ATOM   885   C C   . ALA A  1 136 ? 40.558  95.500  145.417 1.00 38.98  ? 136  ALA A C   1 
ATOM   886   O O   . ALA A  1 136 ? 40.736  94.370  145.858 1.00 39.46  ? 136  ALA A O   1 
ATOM   887   C CB  . ALA A  1 136 ? 38.405  96.705  145.108 1.00 39.74  ? 136  ALA A CB  1 
ATOM   888   N N   . LEU A  1 137 ? 41.229  95.934  144.379 1.00 38.51  ? 137  LEU A N   1 
ATOM   889   C CA  . LEU A  1 137 ? 42.212  95.066  143.740 1.00 38.15  ? 137  LEU A CA  1 
ATOM   890   C C   . LEU A  1 137 ? 43.334  94.670  144.680 1.00 36.93  ? 137  LEU A C   1 
ATOM   891   O O   . LEU A  1 137 ? 43.869  93.588  144.582 1.00 38.37  ? 137  LEU A O   1 
ATOM   892   C CB  . LEU A  1 137 ? 42.801  95.750  142.499 1.00 40.57  ? 137  LEU A CB  1 
ATOM   893   C CG  . LEU A  1 137 ? 41.981  95.667  141.199 1.00 43.07  ? 137  LEU A CG  1 
ATOM   894   C CD1 . LEU A  1 137 ? 41.938  94.210  140.771 1.00 45.42  ? 137  LEU A CD1 1 
ATOM   895   C CD2 . LEU A  1 137 ? 40.545  96.162  141.378 1.00 45.53  ? 137  LEU A CD2 1 
ATOM   896   N N   . SER A  1 138 ? 43.700  95.540  145.597 1.00 35.61  ? 138  SER A N   1 
ATOM   897   C CA  . SER A  1 138 ? 44.768  95.218  146.526 1.00 35.23  ? 138  SER A CA  1 
ATOM   898   C C   . SER A  1 138 ? 44.324  94.143  147.526 1.00 33.28  ? 138  SER A C   1 
ATOM   899   O O   . SER A  1 138 ? 45.031  93.167  147.762 1.00 33.18  ? 138  SER A O   1 
ATOM   900   C CB  . SER A  1 138 ? 45.208  96.489  147.256 1.00 36.82  ? 138  SER A CB  1 
ATOM   901   O OG  . SER A  1 138 ? 45.897  97.354  146.351 1.00 41.21  ? 138  SER A OG  1 
ATOM   902   N N   . LEU A  1 139 ? 43.158  94.330  148.121 1.00 30.40  ? 139  LEU A N   1 
ATOM   903   C CA  . LEU A  1 139 ? 42.640  93.362  149.066 1.00 29.84  ? 139  LEU A CA  1 
ATOM   904   C C   . LEU A  1 139 ? 42.458  91.999  148.351 1.00 29.50  ? 139  LEU A C   1 
ATOM   905   O O   . LEU A  1 139 ? 42.876  90.942  148.847 1.00 28.75  ? 139  LEU A O   1 
ATOM   906   C CB  . LEU A  1 139 ? 41.287  93.840  149.602 1.00 29.47  ? 139  LEU A CB  1 
ATOM   907   C CG  . LEU A  1 139 ? 41.127  94.188  151.072 1.00 29.19  ? 139  LEU A CG  1 
ATOM   908   C CD1 . LEU A  1 139 ? 42.352  93.762  151.884 1.00 25.09  ? 139  LEU A CD1 1 
ATOM   909   C CD2 . LEU A  1 139 ? 40.877  95.680  151.166 1.00 28.58  ? 139  LEU A CD2 1 
ATOM   910   N N   . GLU A  1 140 ? 41.843  92.034  147.178 1.00 27.98  ? 140  GLU A N   1 
ATOM   911   C CA  . GLU A  1 140 ? 41.649  90.829  146.441 1.00 28.09  ? 140  GLU A CA  1 
ATOM   912   C C   . GLU A  1 140 ? 42.943  90.068  146.238 1.00 28.87  ? 140  GLU A C   1 
ATOM   913   O O   . GLU A  1 140 ? 42.993  88.845  146.512 1.00 29.42  ? 140  GLU A O   1 
ATOM   914   C CB  . GLU A  1 140 ? 41.014  91.101  145.081 1.00 27.87  ? 140  GLU A CB  1 
ATOM   915   C CG  . GLU A  1 140 ? 41.054  89.876  144.187 1.00 27.91  ? 140  GLU A CG  1 
ATOM   916   C CD  . GLU A  1 140 ? 40.396  90.097  142.876 1.00 30.59  ? 140  GLU A CD  1 
ATOM   917   O OE1 . GLU A  1 140 ? 40.704  91.087  142.169 1.00 32.95  ? 140  GLU A OE1 1 
ATOM   918   O OE2 . GLU A  1 140 ? 39.564  89.252  142.523 1.00 33.61  ? 140  GLU A OE2 1 
ATOM   919   N N   . LYS A  1 141 ? 43.980  90.754  145.745 1.00 28.23  ? 141  LYS A N   1 
ATOM   920   C CA  . LYS A  1 141 ? 45.257  90.084  145.514 1.00 28.78  ? 141  LYS A CA  1 
ATOM   921   C C   . LYS A  1 141 ? 45.813  89.478  146.792 1.00 28.92  ? 141  LYS A C   1 
ATOM   922   O O   . LYS A  1 141 ? 46.197  88.297  146.846 1.00 29.30  ? 141  LYS A O   1 
ATOM   923   C CB  . LYS A  1 141 ? 46.288  91.057  144.939 1.00 29.73  ? 141  LYS A CB  1 
ATOM   924   C CG  . LYS A  1 141 ? 47.696  90.451  144.776 1.00 28.12  ? 141  LYS A CG  1 
ATOM   925   C CD  . LYS A  1 141 ? 48.614  91.447  144.097 1.00 26.57  ? 141  LYS A CD  1 
ATOM   926   C CE  . LYS A  1 141 ? 49.966  90.867  143.788 1.00 23.70  ? 141  LYS A CE  1 
ATOM   927   N NZ  . LYS A  1 141 ? 50.709  90.463  144.974 1.00 23.36  ? 141  LYS A NZ  1 
ATOM   928   N N   . ALA A  1 142 ? 45.832  90.282  147.841 1.00 28.20  ? 142  ALA A N   1 
ATOM   929   C CA  . ALA A  1 142 ? 46.395  89.792  149.072 1.00 27.68  ? 142  ALA A CA  1 
ATOM   930   C C   . ALA A  1 142 ? 45.625  88.648  149.699 1.00 26.38  ? 142  ALA A C   1 
ATOM   931   O O   . ALA A  1 142 ? 46.241  87.723  150.216 1.00 27.45  ? 142  ALA A O   1 
ATOM   932   C CB  . ALA A  1 142 ? 46.570  90.930  150.065 1.00 26.82  ? 142  ALA A CB  1 
ATOM   933   N N   . ARG A  1 143 ? 44.302  88.699  149.682 1.00 24.28  ? 143  ARG A N   1 
ATOM   934   C CA  . ARG A  1 143 ? 43.579  87.599  150.316 1.00 23.70  ? 143  ARG A CA  1 
ATOM   935   C C   . ARG A  1 143 ? 43.785  86.312  149.528 1.00 22.83  ? 143  ARG A C   1 
ATOM   936   O O   . ARG A  1 143 ? 44.035  85.255  150.113 1.00 23.88  ? 143  ARG A O   1 
ATOM   937   C CB  . ARG A  1 143 ? 42.080  87.899  150.461 1.00 22.16  ? 143  ARG A CB  1 
ATOM   938   C CG  . ARG A  1 143 ? 41.822  89.196  151.154 1.00 24.57  ? 143  ARG A CG  1 
ATOM   939   C CD  . ARG A  1 143 ? 40.379  89.450  151.529 1.00 25.25  ? 143  ARG A CD  1 
ATOM   940   N NE  . ARG A  1 143 ? 40.218  88.986  152.895 1.00 29.37  ? 143  ARG A NE  1 
ATOM   941   C CZ  . ARG A  1 143 ? 39.503  89.591  153.833 1.00 28.34  ? 143  ARG A CZ  1 
ATOM   942   N NH1 . ARG A  1 143 ? 38.858  90.700  153.581 1.00 27.85  ? 143  ARG A NH1 1 
ATOM   943   N NH2 . ARG A  1 143 ? 39.462  89.069  155.034 1.00 29.90  ? 143  ARG A NH2 1 
ATOM   944   N N   . LYS A  1 144 ? 43.745  86.397  148.209 1.00 20.19  ? 144  LYS A N   1 
ATOM   945   C CA  . LYS A  1 144 ? 43.895  85.194  147.452 1.00 20.48  ? 144  LYS A CA  1 
ATOM   946   C C   . LYS A  1 144 ? 45.261  84.589  147.581 1.00 22.95  ? 144  LYS A C   1 
ATOM   947   O O   . LYS A  1 144 ? 45.387  83.373  147.759 1.00 27.68  ? 144  LYS A O   1 
ATOM   948   C CB  . LYS A  1 144 ? 43.543  85.405  145.972 1.00 16.79  ? 144  LYS A CB  1 
ATOM   949   C CG  . LYS A  1 144 ? 42.089  85.738  145.768 1.00 15.22  ? 144  LYS A CG  1 
ATOM   950   C CD  . LYS A  1 144 ? 41.677  85.791  144.345 1.00 12.08  ? 144  LYS A CD  1 
ATOM   951   C CE  . LYS A  1 144 ? 40.263  86.268  144.231 1.00 13.81  ? 144  LYS A CE  1 
ATOM   952   N NZ  . LYS A  1 144 ? 39.767  86.229  142.834 1.00 18.01  ? 144  LYS A NZ  1 
ATOM   953   N N   . GLU A  1 145 ? 46.294  85.399  147.538 1.00 23.95  ? 145  GLU A N   1 
ATOM   954   C CA  . GLU A  1 145 ? 47.608  84.812  147.595 1.00 25.20  ? 145  GLU A CA  1 
ATOM   955   C C   . GLU A  1 145 ? 47.911  84.248  148.942 1.00 25.62  ? 145  GLU A C   1 
ATOM   956   O O   . GLU A  1 145 ? 48.683  83.301  149.051 1.00 26.67  ? 145  GLU A O   1 
ATOM   957   C CB  . GLU A  1 145 ? 48.687  85.814  147.199 1.00 26.87  ? 145  GLU A CB  1 
ATOM   958   C CG  . GLU A  1 145 ? 48.718  86.097  145.723 1.00 29.16  ? 145  GLU A CG  1 
ATOM   959   C CD  . GLU A  1 145 ? 49.645  87.275  145.367 1.00 34.75  ? 145  GLU A CD  1 
ATOM   960   O OE1 . GLU A  1 145 ? 50.444  87.742  146.277 1.00 34.11  ? 145  GLU A OE1 1 
ATOM   961   O OE2 . GLU A  1 145 ? 49.560  87.711  144.169 1.00 35.12  ? 145  GLU A OE2 1 
ATOM   962   N N   . ALA A  1 146 ? 47.292  84.807  149.970 1.00 25.28  ? 146  ALA A N   1 
ATOM   963   C CA  . ALA A  1 146 ? 47.561  84.321  151.301 1.00 25.75  ? 146  ALA A CA  1 
ATOM   964   C C   . ALA A  1 146 ? 47.064  82.895  151.357 1.00 26.38  ? 146  ALA A C   1 
ATOM   965   O O   . ALA A  1 146 ? 47.765  82.014  151.857 1.00 28.26  ? 146  ALA A O   1 
ATOM   966   C CB  . ALA A  1 146 ? 46.842  85.170  152.344 1.00 25.18  ? 146  ALA A CB  1 
ATOM   967   N N   . VAL A  1 147 ? 45.869  82.655  150.820 1.00 24.63  ? 147  VAL A N   1 
ATOM   968   C CA  . VAL A  1 147 ? 45.325  81.324  150.862 1.00 23.00  ? 147  VAL A CA  1 
ATOM   969   C C   . VAL A  1 147 ? 46.204  80.353  150.059 1.00 24.24  ? 147  VAL A C   1 
ATOM   970   O O   . VAL A  1 147 ? 46.614  79.307  150.576 1.00 23.98  ? 147  VAL A O   1 
ATOM   971   C CB  . VAL A  1 147 ? 43.867  81.327  150.335 1.00 21.59  ? 147  VAL A CB  1 
ATOM   972   C CG1 . VAL A  1 147 ? 43.350  79.867  150.128 1.00 16.04  ? 147  VAL A CG1 1 
ATOM   973   C CG2 . VAL A  1 147 ? 42.997  82.071  151.324 1.00 14.96  ? 147  VAL A CG2 1 
ATOM   974   N N   . THR A  1 148 ? 46.524  80.708  148.822 1.00 22.99  ? 148  THR A N   1 
ATOM   975   C CA  . THR A  1 148 ? 47.329  79.812  148.016 1.00 25.13  ? 148  THR A CA  1 
ATOM   976   C C   . THR A  1 148 ? 48.691  79.562  148.665 1.00 25.36  ? 148  THR A C   1 
ATOM   977   O O   . THR A  1 148 ? 49.205  78.454  148.722 1.00 25.22  ? 148  THR A O   1 
ATOM   978   C CB  . THR A  1 148 ? 47.531  80.402  146.606 1.00 26.21  ? 148  THR A CB  1 
ATOM   979   O OG1 . THR A  1 148 ? 46.268  80.493  145.923 1.00 29.25  ? 148  THR A OG1 1 
ATOM   980   C CG2 . THR A  1 148 ? 48.455  79.549  145.805 1.00 25.55  ? 148  THR A CG2 1 
ATOM   981   N N   . ASP A  1 149 ? 49.278  80.617  149.179 1.00 26.22  ? 149  ASP A N   1 
ATOM   982   C CA  . ASP A  1 149 ? 50.577  80.497  149.808 1.00 26.53  ? 149  ASP A CA  1 
ATOM   983   C C   . ASP A  1 149 ? 50.501  79.534  150.996 1.00 24.64  ? 149  ASP A C   1 
ATOM   984   O O   . ASP A  1 149 ? 51.356  78.706  151.176 1.00 21.76  ? 149  ASP A O   1 
ATOM   985   C CB  . ASP A  1 149 ? 51.037  81.888  150.245 1.00 28.63  ? 149  ASP A CB  1 
ATOM   986   C CG  . ASP A  1 149 ? 52.480  81.906  150.705 1.00 34.09  ? 149  ASP A CG  1 
ATOM   987   O OD1 . ASP A  1 149 ? 52.715  82.439  151.832 1.00 35.88  ? 149  ASP A OD1 1 
ATOM   988   O OD2 . ASP A  1 149 ? 53.364  81.392  149.946 1.00 35.46  ? 149  ASP A OD2 1 
ATOM   989   N N   . GLY A  1 150 ? 49.445  79.660  151.788 1.00 25.10  ? 150  GLY A N   1 
ATOM   990   C CA  . GLY A  1 150 ? 49.254  78.791  152.928 1.00 25.59  ? 150  GLY A CA  1 
ATOM   991   C C   . GLY A  1 150 ? 49.016  77.351  152.474 1.00 27.27  ? 150  GLY A C   1 
ATOM   992   O O   . GLY A  1 150 ? 49.551  76.413  153.072 1.00 28.59  ? 150  GLY A O   1 
ATOM   993   N N   . LEU A  1 151 ? 48.223  77.146  151.430 1.00 25.71  ? 151  LEU A N   1 
ATOM   994   C CA  . LEU A  1 151 ? 48.000  75.787  150.980 1.00 27.65  ? 151  LEU A CA  1 
ATOM   995   C C   . LEU A  1 151 ? 49.329  75.157  150.577 1.00 28.46  ? 151  LEU A C   1 
ATOM   996   O O   . LEU A  1 151 ? 49.608  73.999  150.921 1.00 26.77  ? 151  LEU A O   1 
ATOM   997   C CB  . LEU A  1 151 ? 47.052  75.763  149.788 1.00 29.00  ? 151  LEU A CB  1 
ATOM   998   C CG  . LEU A  1 151 ? 46.852  74.429  149.068 1.00 29.94  ? 151  LEU A CG  1 
ATOM   999   C CD1 . LEU A  1 151 ? 46.402  73.399  150.079 1.00 29.53  ? 151  LEU A CD1 1 
ATOM   1000  C CD2 . LEU A  1 151 ? 45.783  74.563  147.966 1.00 29.57  ? 151  LEU A CD2 1 
ATOM   1001  N N   . LYS A  1 152 ? 50.158  75.926  149.863 1.00 29.04  ? 152  LYS A N   1 
ATOM   1002  C CA  . LYS A  1 152 ? 51.441  75.399  149.410 1.00 29.25  ? 152  LYS A CA  1 
ATOM   1003  C C   . LYS A  1 152 ? 52.340  75.067  150.562 1.00 29.92  ? 152  LYS A C   1 
ATOM   1004  O O   . LYS A  1 152 ? 52.962  73.989  150.566 1.00 29.63  ? 152  LYS A O   1 
ATOM   1005  C CB  . LYS A  1 152 ? 52.170  76.352  148.471 1.00 28.79  ? 152  LYS A CB  1 
ATOM   1006  C CG  . LYS A  1 152 ? 51.556  76.424  147.059 1.00 29.69  ? 152  LYS A CG  1 
ATOM   1007  C CD  . LYS A  1 152 ? 52.430  77.239  146.095 1.00 30.07  ? 152  LYS A CD  1 
ATOM   1008  C CE  . LYS A  1 152 ? 52.658  78.638  146.586 1.00 30.53  ? 152  LYS A CE  1 
ATOM   1009  N NZ  . LYS A  1 152 ? 53.712  79.237  145.784 1.00 32.81  ? 152  LYS A NZ  1 
ATOM   1010  N N   . ARG A  1 153 ? 52.417  75.962  151.543 1.00 29.62  ? 153  ARG A N   1 
ATOM   1011  C CA  . ARG A  1 153 ? 53.280  75.660  152.684 1.00 30.27  ? 153  ARG A CA  1 
ATOM   1012  C C   . ARG A  1 153 ? 52.770  74.408  153.442 1.00 29.99  ? 153  ARG A C   1 
ATOM   1013  O O   . ARG A  1 153 ? 53.568  73.524  153.757 1.00 30.12  ? 153  ARG A O   1 
ATOM   1014  C CB  . ARG A  1 153 ? 53.403  76.848  153.636 1.00 28.93  ? 153  ARG A CB  1 
ATOM   1015  C CG  . ARG A  1 153 ? 53.995  78.052  152.996 1.00 30.12  ? 153  ARG A CG  1 
ATOM   1016  C CD  . ARG A  1 153 ? 54.149  79.151  154.035 1.00 31.20  ? 153  ARG A CD  1 
ATOM   1017  N NE  . ARG A  1 153 ? 55.523  79.170  154.528 1.00 31.05  ? 153  ARG A NE  1 
ATOM   1018  C CZ  . ARG A  1 153 ? 55.867  79.030  155.793 1.00 29.96  ? 153  ARG A CZ  1 
ATOM   1019  N NH1 . ARG A  1 153 ? 54.956  78.856  156.741 1.00 30.48  ? 153  ARG A NH1 1 
ATOM   1020  N NH2 . ARG A  1 153 ? 57.140  79.068  156.093 1.00 31.49  ? 153  ARG A NH2 1 
ATOM   1021  N N   . ALA A  1 154 ? 51.470  74.323  153.737 1.00 29.04  ? 154  ALA A N   1 
ATOM   1022  C CA  . ALA A  1 154 ? 50.947  73.138  154.418 1.00 27.93  ? 154  ALA A CA  1 
ATOM   1023  C C   . ALA A  1 154 ? 51.325  71.863  153.665 1.00 27.29  ? 154  ALA A C   1 
ATOM   1024  O O   . ALA A  1 154 ? 51.831  70.921  154.253 1.00 25.02  ? 154  ALA A O   1 
ATOM   1025  C CB  . ALA A  1 154 ? 49.452  73.207  154.547 1.00 27.48  ? 154  ALA A CB  1 
ATOM   1026  N N   . LEU A  1 155 ? 51.102  71.858  152.361 1.00 27.10  ? 155  LEU A N   1 
ATOM   1027  C CA  . LEU A  1 155 ? 51.417  70.682  151.572 1.00 28.83  ? 155  LEU A CA  1 
ATOM   1028  C C   . LEU A  1 155 ? 52.920  70.283  151.613 1.00 30.95  ? 155  LEU A C   1 
ATOM   1029  O O   . LEU A  1 155 ? 53.237  69.092  151.554 1.00 32.32  ? 155  LEU A O   1 
ATOM   1030  C CB  . LEU A  1 155 ? 50.947  70.890  150.128 1.00 27.10  ? 155  LEU A CB  1 
ATOM   1031  C CG  . LEU A  1 155 ? 49.720  70.185  149.502 1.00 28.03  ? 155  LEU A CG  1 
ATOM   1032  C CD1 . LEU A  1 155 ? 48.977  69.291  150.441 1.00 27.07  ? 155  LEU A CD1 1 
ATOM   1033  C CD2 . LEU A  1 155 ? 48.792  71.226  148.991 1.00 27.66  ? 155  LEU A CD2 1 
ATOM   1034  N N   . ARG A  1 156 ? 53.845  71.249  151.717 1.00 32.27  ? 156  ARG A N   1 
ATOM   1035  C CA  . ARG A  1 156 ? 55.288  70.930  151.773 1.00 31.58  ? 156  ARG A CA  1 
ATOM   1036  C C   . ARG A  1 156 ? 55.563  69.874  152.864 1.00 31.86  ? 156  ARG A C   1 
ATOM   1037  O O   . ARG A  1 156 ? 56.448  69.031  152.733 1.00 29.75  ? 156  ARG A O   1 
ATOM   1038  C CB  . ARG A  1 156 ? 56.145  72.154  152.146 1.00 31.14  ? 156  ARG A CB  1 
ATOM   1039  C CG  . ARG A  1 156 ? 56.152  73.347  151.186 1.00 35.29  ? 156  ARG A CG  1 
ATOM   1040  C CD  . ARG A  1 156 ? 57.381  74.271  151.468 1.00 38.34  ? 156  ARG A CD  1 
ATOM   1041  N NE  . ARG A  1 156 ? 57.264  75.707  151.137 1.00 39.39  ? 156  ARG A NE  1 
ATOM   1042  C CZ  . ARG A  1 156 ? 56.872  76.198  149.956 1.00 42.44  ? 156  ARG A CZ  1 
ATOM   1043  N NH1 . ARG A  1 156 ? 56.526  75.385  148.931 1.00 43.22  ? 156  ARG A NH1 1 
ATOM   1044  N NH2 . ARG A  1 156 ? 56.848  77.521  149.778 1.00 41.16  ? 156  ARG A NH2 1 
ATOM   1045  N N   . SER A  1 157 ? 54.811  69.944  153.956 1.00 32.13  ? 157  SER A N   1 
ATOM   1046  C CA  . SER A  1 157 ? 55.020  69.026  155.067 1.00 33.47  ? 157  SER A CA  1 
ATOM   1047  C C   . SER A  1 157 ? 54.977  67.551  154.705 1.00 33.51  ? 157  SER A C   1 
ATOM   1048  O O   . SER A  1 157 ? 55.540  66.733  155.398 1.00 33.41  ? 157  SER A O   1 
ATOM   1049  C CB  . SER A  1 157 ? 54.006  69.288  156.162 1.00 33.29  ? 157  SER A CB  1 
ATOM   1050  O OG  . SER A  1 157 ? 54.065  70.644  156.545 1.00 36.98  ? 157  SER A OG  1 
ATOM   1051  N N   . PHE A  1 158 ? 54.308  67.203  153.623 1.00 33.00  ? 158  PHE A N   1 
ATOM   1052  C CA  . PHE A  1 158 ? 54.261  65.808  153.251 1.00 33.09  ? 158  PHE A CA  1 
ATOM   1053  C C   . PHE A  1 158 ? 55.554  65.286  152.618 1.00 33.74  ? 158  PHE A C   1 
ATOM   1054  O O   . PHE A  1 158 ? 55.773  64.085  152.618 1.00 35.57  ? 158  PHE A O   1 
ATOM   1055  C CB  . PHE A  1 158 ? 53.068  65.557  152.327 1.00 29.99  ? 158  PHE A CB  1 
ATOM   1056  C CG  . PHE A  1 158 ? 51.756  65.620  153.033 1.00 29.44  ? 158  PHE A CG  1 
ATOM   1057  C CD1 . PHE A  1 158 ? 50.888  66.695  152.854 1.00 29.69  ? 158  PHE A CD1 1 
ATOM   1058  C CD2 . PHE A  1 158 ? 51.390  64.618  153.922 1.00 27.93  ? 158  PHE A CD2 1 
ATOM   1059  C CE1 . PHE A  1 158 ? 49.674  66.758  153.559 1.00 28.97  ? 158  PHE A CE1 1 
ATOM   1060  C CE2 . PHE A  1 158 ? 50.174  64.695  154.621 1.00 27.92  ? 158  PHE A CE2 1 
ATOM   1061  C CZ  . PHE A  1 158 ? 49.324  65.763  154.434 1.00 24.91  ? 158  PHE A CZ  1 
ATOM   1062  N N   . GLY A  1 159 ? 56.409  66.165  152.087 1.00 33.01  ? 159  GLY A N   1 
ATOM   1063  C CA  . GLY A  1 159 ? 57.632  65.688  151.470 1.00 32.47  ? 159  GLY A CA  1 
ATOM   1064  C C   . GLY A  1 159 ? 58.183  66.505  150.314 1.00 33.63  ? 159  GLY A C   1 
ATOM   1065  O O   . GLY A  1 159 ? 57.592  67.509  149.891 1.00 34.06  ? 159  GLY A O   1 
ATOM   1066  N N   . ASN A  1 160 ? 59.316  66.066  149.773 1.00 33.92  ? 160  ASN A N   1 
ATOM   1067  C CA  . ASN A  1 160 ? 59.952  66.810  148.688 1.00 35.71  ? 160  ASN A CA  1 
ATOM   1068  C C   . ASN A  1 160 ? 59.060  66.928  147.461 1.00 34.75  ? 160  ASN A C   1 
ATOM   1069  O O   . ASN A  1 160 ? 58.958  67.981  146.855 1.00 32.84  ? 160  ASN A O   1 
ATOM   1070  C CB  . ASN A  1 160 ? 61.284  66.162  148.272 1.00 37.34  ? 160  ASN A CB  1 
ATOM   1071  C CG  . ASN A  1 160 ? 62.248  66.074  149.403 1.00 38.99  ? 160  ASN A CG  1 
ATOM   1072  O OD1 . ASN A  1 160 ? 62.513  67.061  150.089 1.00 42.43  ? 160  ASN A OD1 1 
ATOM   1073  N ND2 . ASN A  1 160 ? 62.776  64.893  149.621 1.00 39.63  ? 160  ASN A ND2 1 
ATOM   1074  N N   . ALA A  1 161 ? 58.417  65.833  147.095 1.00 34.31  ? 161  ALA A N   1 
ATOM   1075  C CA  . ALA A  1 161 ? 57.577  65.843  145.906 1.00 33.19  ? 161  ALA A CA  1 
ATOM   1076  C C   . ALA A  1 161 ? 56.475  66.864  145.973 1.00 32.47  ? 161  ALA A C   1 
ATOM   1077  O O   . ALA A  1 161 ? 55.955  67.232  144.948 1.00 33.10  ? 161  ALA A O   1 
ATOM   1078  C CB  . ALA A  1 161 ? 57.000  64.461  145.665 1.00 33.63  ? 161  ALA A CB  1 
ATOM   1079  N N   . LEU A  1 162 ? 56.102  67.319  147.170 1.00 32.93  ? 162  LEU A N   1 
ATOM   1080  C CA  . LEU A  1 162 ? 55.055  68.332  147.294 1.00 33.52  ? 162  LEU A CA  1 
ATOM   1081  C C   . LEU A  1 162 ? 55.620  69.709  147.621 1.00 33.86  ? 162  LEU A C   1 
ATOM   1082  O O   . LEU A  1 162 ? 54.901  70.577  148.082 1.00 34.61  ? 162  LEU A O   1 
ATOM   1083  C CB  . LEU A  1 162 ? 54.016  67.943  148.340 1.00 33.20  ? 162  LEU A CB  1 
ATOM   1084  C CG  . LEU A  1 162 ? 52.792  67.169  147.834 1.00 34.88  ? 162  LEU A CG  1 
ATOM   1085  C CD1 . LEU A  1 162 ? 51.990  68.063  146.911 1.00 36.36  ? 162  LEU A CD1 1 
ATOM   1086  C CD2 . LEU A  1 162 ? 53.213  65.955  147.050 1.00 35.54  ? 162  LEU A CD2 1 
ATOM   1087  N N   . GLY A  1 163 ? 56.912  69.901  147.402 1.00 33.62  ? 163  GLY A N   1 
ATOM   1088  C CA  . GLY A  1 163 ? 57.491  71.205  147.638 1.00 33.87  ? 163  GLY A CA  1 
ATOM   1089  C C   . GLY A  1 163 ? 58.519  71.359  148.737 1.00 35.55  ? 163  GLY A C   1 
ATOM   1090  O O   . GLY A  1 163 ? 59.145  72.417  148.820 1.00 35.37  ? 163  GLY A O   1 
ATOM   1091  N N   . ASN A  1 164 ? 58.730  70.341  149.565 1.00 36.96  ? 164  ASN A N   1 
ATOM   1092  C CA  . ASN A  1 164 ? 59.685  70.514  150.642 1.00 39.64  ? 164  ASN A CA  1 
ATOM   1093  C C   . ASN A  1 164 ? 61.147  70.741  150.211 1.00 41.75  ? 164  ASN A C   1 
ATOM   1094  O O   . ASN A  1 164 ? 61.948  71.253  150.992 1.00 42.48  ? 164  ASN A O   1 
ATOM   1095  C CB  . ASN A  1 164 ? 59.587  69.365  151.630 1.00 38.76  ? 164  ASN A CB  1 
ATOM   1096  C CG  . ASN A  1 164 ? 60.345  69.642  152.905 1.00 39.95  ? 164  ASN A CG  1 
ATOM   1097  O OD1 . ASN A  1 164 ? 61.132  68.813  153.345 1.00 42.37  ? 164  ASN A OD1 1 
ATOM   1098  N ND2 . ASN A  1 164 ? 60.125  70.810  153.505 1.00 38.30  ? 164  ASN A ND2 1 
ATOM   1099  N N   . CYS A  1 165 ? 61.504  70.388  148.982 1.00 43.69  ? 165  CYS A N   1 
ATOM   1100  C CA  . CYS A  1 165 ? 62.873  70.619  148.520 1.00 45.79  ? 165  CYS A CA  1 
ATOM   1101  C C   . CYS A  1 165 ? 63.122  72.104  148.220 1.00 47.52  ? 165  CYS A C   1 
ATOM   1102  O O   . CYS A  1 165 ? 64.182  72.651  148.554 1.00 50.01  ? 165  CYS A O   1 
ATOM   1103  C CB  . CYS A  1 165 ? 63.163  69.774  147.280 1.00 46.56  ? 165  CYS A CB  1 
ATOM   1104  S SG  . CYS A  1 165 ? 61.931  69.870  145.931 1.00 49.41  ? 165  CYS A SG  1 
ATOM   1105  N N   . ILE A  1 166 ? 62.117  72.758  147.649 1.00 47.96  ? 166  ILE A N   1 
ATOM   1106  C CA  . ILE A  1 166 ? 62.138  74.166  147.257 1.00 48.71  ? 166  ILE A CA  1 
ATOM   1107  C C   . ILE A  1 166 ? 62.956  75.191  148.039 1.00 50.52  ? 166  ILE A C   1 
ATOM   1108  O O   . ILE A  1 166 ? 63.393  76.205  147.479 1.00 50.71  ? 166  ILE A O   1 
ATOM   1109  C CB  . ILE A  1 166 ? 60.688  74.676  147.158 1.00 48.46  ? 166  ILE A CB  1 
ATOM   1110  C CG1 . ILE A  1 166 ? 60.467  75.354  145.812 1.00 48.50  ? 166  ILE A CG1 1 
ATOM   1111  C CG2 . ILE A  1 166 ? 60.361  75.608  148.290 1.00 47.78  ? 166  ILE A CG2 1 
ATOM   1112  C CD1 . ILE A  1 166 ? 61.148  76.651  145.658 1.00 49.48  ? 166  ILE A CD1 1 
ATOM   1113  N N   . LEU A  1 167 ? 63.161  74.973  149.326 1.00 52.23  ? 167  LEU A N   1 
ATOM   1114  C CA  . LEU A  1 167 ? 63.911  75.964  150.080 1.00 56.15  ? 167  LEU A CA  1 
ATOM   1115  C C   . LEU A  1 167 ? 65.286  75.451  150.568 1.00 58.12  ? 167  LEU A C   1 
ATOM   1116  O O   . LEU A  1 167 ? 66.007  76.107  151.338 1.00 57.21  ? 167  LEU A O   1 
ATOM   1117  C CB  . LEU A  1 167 ? 63.020  76.506  151.219 1.00 57.03  ? 167  LEU A CB  1 
ATOM   1118  C CG  . LEU A  1 167 ? 62.257  75.552  152.145 1.00 57.73  ? 167  LEU A CG  1 
ATOM   1119  C CD1 . LEU A  1 167 ? 61.571  74.416  151.367 1.00 56.81  ? 167  LEU A CD1 1 
ATOM   1120  C CD2 . LEU A  1 167 ? 63.253  74.983  153.159 1.00 59.48  ? 167  LEU A CD2 1 
ATOM   1121  N N   . ASP A  1 168 ? 65.635  74.271  150.063 1.00 60.07  ? 168  ASP A N   1 
ATOM   1122  C CA  . ASP A  1 168 ? 66.899  73.610  150.336 1.00 62.04  ? 168  ASP A CA  1 
ATOM   1123  C C   . ASP A  1 168 ? 67.984  74.178  149.401 1.00 63.02  ? 168  ASP A C   1 
ATOM   1124  O O   . ASP A  1 168 ? 68.079  73.786  148.240 1.00 62.56  ? 168  ASP A O   1 
ATOM   1125  C CB  . ASP A  1 168 ? 66.736  72.114  150.074 1.00 62.34  ? 168  ASP A CB  1 
ATOM   1126  C CG  . ASP A  1 168 ? 68.045  71.347  150.202 1.00 63.50  ? 168  ASP A CG  1 
ATOM   1127  O OD1 . ASP A  1 168 ? 68.030  70.127  149.950 1.00 63.14  ? 168  ASP A OD1 1 
ATOM   1128  O OD2 . ASP A  1 168 ? 69.087  71.953  150.555 1.00 64.92  ? 168  ASP A OD2 1 
ATOM   1129  N N   . LYS A  1 169 ? 68.819  75.070  149.923 1.00 64.60  ? 169  LYS A N   1 
ATOM   1130  C CA  . LYS A  1 169 ? 69.861  75.715  149.127 1.00 65.62  ? 169  LYS A CA  1 
ATOM   1131  C C   . LYS A  1 169 ? 70.713  74.801  148.248 1.00 65.31  ? 169  LYS A C   1 
ATOM   1132  O O   . LYS A  1 169 ? 71.097  75.188  147.143 1.00 64.72  ? 169  LYS A O   1 
ATOM   1133  C CB  . LYS A  1 169 ? 70.743  76.559  150.046 1.00 67.28  ? 169  LYS A CB  1 
ATOM   1134  C CG  . LYS A  1 169 ? 69.972  77.698  150.709 1.00 70.75  ? 169  LYS A CG  1 
ATOM   1135  C CD  . LYS A  1 169 ? 70.758  78.346  151.835 1.00 73.50  ? 169  LYS A CD  1 
ATOM   1136  C CE  . LYS A  1 169 ? 69.868  79.292  152.633 1.00 76.22  ? 169  LYS A CE  1 
ATOM   1137  N NZ  . LYS A  1 169 ? 70.608  79.968  153.760 1.00 78.45  ? 169  LYS A NZ  1 
ATOM   1138  N N   . ASP A  1 170 ? 70.996  73.591  148.717 1.00 65.40  ? 170  ASP A N   1 
ATOM   1139  C CA  . ASP A  1 170 ? 71.807  72.665  147.925 1.00 65.97  ? 170  ASP A CA  1 
ATOM   1140  C C   . ASP A  1 170 ? 71.025  72.166  146.718 1.00 65.47  ? 170  ASP A C   1 
ATOM   1141  O O   . ASP A  1 170 ? 71.605  71.828  145.674 1.00 66.98  ? 170  ASP A O   1 
ATOM   1142  C CB  . ASP A  1 170 ? 72.275  71.451  148.759 1.00 66.43  ? 170  ASP A CB  1 
ATOM   1143  C CG  . ASP A  1 170 ? 73.221  71.847  149.899 1.00 67.65  ? 170  ASP A CG  1 
ATOM   1144  O OD1 . ASP A  1 170 ? 74.232  72.544  149.628 1.00 66.43  ? 170  ASP A OD1 1 
ATOM   1145  O OD2 . ASP A  1 170 ? 72.944  71.460  151.067 1.00 68.62  ? 170  ASP A OD2 1 
ATOM   1146  N N   . TYR A  1 171 ? 69.707  72.109  146.867 1.00 63.82  ? 171  TYR A N   1 
ATOM   1147  C CA  . TYR A  1 171 ? 68.846  71.654  145.793 1.00 62.02  ? 171  TYR A CA  1 
ATOM   1148  C C   . TYR A  1 171 ? 68.759  72.781  144.769 1.00 61.42  ? 171  TYR A C   1 
ATOM   1149  O O   . TYR A  1 171 ? 68.850  72.564  143.559 1.00 60.70  ? 171  TYR A O   1 
ATOM   1150  C CB  . TYR A  1 171 ? 67.462  71.293  146.365 1.00 60.97  ? 171  TYR A CB  1 
ATOM   1151  C CG  . TYR A  1 171 ? 66.321  71.262  145.357 1.00 59.41  ? 171  TYR A CG  1 
ATOM   1152  C CD1 . TYR A  1 171 ? 66.106  70.154  144.519 1.00 58.30  ? 171  TYR A CD1 1 
ATOM   1153  C CD2 . TYR A  1 171 ? 65.485  72.373  145.204 1.00 59.52  ? 171  TYR A CD2 1 
ATOM   1154  C CE1 . TYR A  1 171 ? 65.094  70.167  143.550 1.00 56.95  ? 171  TYR A CE1 1 
ATOM   1155  C CE2 . TYR A  1 171 ? 64.475  72.397  144.245 1.00 58.42  ? 171  TYR A CE2 1 
ATOM   1156  C CZ  . TYR A  1 171 ? 64.287  71.301  143.423 1.00 57.69  ? 171  TYR A CZ  1 
ATOM   1157  O OH  . TYR A  1 171 ? 63.305  71.366  142.474 1.00 56.50  ? 171  TYR A OH  1 
ATOM   1158  N N   . LEU A  1 172 ? 68.605  73.997  145.266 1.00 61.46  ? 172  LEU A N   1 
ATOM   1159  C CA  . LEU A  1 172 ? 68.499  75.153  144.390 1.00 61.83  ? 172  LEU A CA  1 
ATOM   1160  C C   . LEU A  1 172 ? 69.769  75.294  143.553 1.00 63.11  ? 172  LEU A C   1 
ATOM   1161  O O   . LEU A  1 172 ? 69.738  75.491  142.322 1.00 61.42  ? 172  LEU A O   1 
ATOM   1162  C CB  . LEU A  1 172 ? 68.275  76.409  145.234 1.00 59.88  ? 172  LEU A CB  1 
ATOM   1163  C CG  . LEU A  1 172 ? 66.896  76.455  145.888 1.00 59.33  ? 172  LEU A CG  1 
ATOM   1164  C CD1 . LEU A  1 172 ? 66.761  77.659  146.773 1.00 58.96  ? 172  LEU A CD1 1 
ATOM   1165  C CD2 . LEU A  1 172 ? 65.841  76.486  144.801 1.00 58.59  ? 172  LEU A CD2 1 
ATOM   1166  N N   . ARG A  1 173 ? 70.890  75.179  144.256 1.00 65.07  ? 173  ARG A N   1 
ATOM   1167  C CA  . ARG A  1 173 ? 72.208  75.288  143.666 1.00 66.35  ? 173  ARG A CA  1 
ATOM   1168  C C   . ARG A  1 173 ? 72.354  74.318  142.519 1.00 66.86  ? 173  ARG A C   1 
ATOM   1169  O O   . ARG A  1 173 ? 72.716  74.723  141.411 1.00 67.86  ? 173  ARG A O   1 
ATOM   1170  C CB  . ARG A  1 173 ? 73.256  75.001  144.729 1.00 67.89  ? 173  ARG A CB  1 
ATOM   1171  C CG  . ARG A  1 173 ? 74.662  75.488  144.432 1.00 69.53  ? 173  ARG A CG  1 
ATOM   1172  C CD  . ARG A  1 173 ? 75.398  75.736  145.773 1.00 71.72  ? 173  ARG A CD  1 
ATOM   1173  N NE  . ARG A  1 173 ? 75.288  74.609  146.709 1.00 72.32  ? 173  ARG A NE  1 
ATOM   1174  C CZ  . ARG A  1 173 ? 75.717  73.375  146.437 1.00 73.48  ? 173  ARG A CZ  1 
ATOM   1175  N NH1 . ARG A  1 173 ? 76.284  73.113  145.260 1.00 73.34  ? 173  ARG A NH1 1 
ATOM   1176  N NH2 . ARG A  1 173 ? 75.581  72.400  147.334 1.00 73.12  ? 173  ARG A NH2 1 
ATOM   1177  N N   . SER A  1 174 ? 72.060  73.043  142.771 1.00 67.23  ? 174  SER A N   1 
ATOM   1178  C CA  . SER A  1 174 ? 72.187  72.027  141.734 1.00 67.51  ? 174  SER A CA  1 
ATOM   1179  C C   . SER A  1 174 ? 71.111  72.133  140.645 1.00 66.97  ? 174  SER A C   1 
ATOM   1180  O O   . SER A  1 174 ? 71.206  71.500  139.607 1.00 68.52  ? 174  SER A O   1 
ATOM   1181  C CB  . SER A  1 174 ? 72.216  70.637  142.375 1.00 67.44  ? 174  SER A CB  1 
ATOM   1182  O OG  . SER A  1 174 ? 71.113  69.884  141.959 1.00 68.14  ? 174  SER A OG  1 
ATOM   1183  N N   . LEU A  1 175 ? 70.105  72.959  140.869 1.00 66.00  ? 175  LEU A N   1 
ATOM   1184  C CA  . LEU A  1 175 ? 69.070  73.137  139.877 1.00 65.96  ? 175  LEU A CA  1 
ATOM   1185  C C   . LEU A  1 175 ? 69.607  74.129  138.870 1.00 67.33  ? 175  LEU A C   1 
ATOM   1186  O O   . LEU A  1 175 ? 69.329  74.025  137.686 1.00 67.42  ? 175  LEU A O   1 
ATOM   1187  C CB  . LEU A  1 175 ? 67.813  73.730  140.509 1.00 65.52  ? 175  LEU A CB  1 
ATOM   1188  C CG  . LEU A  1 175 ? 66.476  72.993  140.583 1.00 62.82  ? 175  LEU A CG  1 
ATOM   1189  C CD1 . LEU A  1 175 ? 65.412  73.984  140.995 1.00 61.68  ? 175  LEU A CD1 1 
ATOM   1190  C CD2 . LEU A  1 175 ? 66.126  72.403  139.261 1.00 61.34  ? 175  LEU A CD2 1 
ATOM   1191  N N   . ASN A  1 176 ? 70.355  75.114  139.362 1.00 69.66  ? 176  ASN A N   1 
ATOM   1192  C CA  . ASN A  1 176 ? 70.963  76.160  138.531 1.00 71.43  ? 176  ASN A CA  1 
ATOM   1193  C C   . ASN A  1 176 ? 71.972  75.613  137.558 1.00 72.74  ? 176  ASN A C   1 
ATOM   1194  O O   . ASN A  1 176 ? 72.148  76.165  136.481 1.00 73.34  ? 176  ASN A O   1 
ATOM   1195  C CB  . ASN A  1 176 ? 71.652  77.194  139.401 1.00 71.63  ? 176  ASN A CB  1 
ATOM   1196  C CG  . ASN A  1 176 ? 70.818  78.437  139.577 1.00 73.63  ? 176  ASN A CG  1 
ATOM   1197  O OD1 . ASN A  1 176 ? 70.720  79.256  138.667 1.00 74.60  ? 176  ASN A OD1 1 
ATOM   1198  N ND2 . ASN A  1 176 ? 70.192  78.581  140.743 1.00 74.49  ? 176  ASN A ND2 1 
ATOM   1199  N N   . LYS A  1 177 ? 72.637  74.531  137.949 1.00 74.46  ? 177  LYS A N   1 
ATOM   1200  C CA  . LYS A  1 177 ? 73.634  73.883  137.103 1.00 76.71  ? 177  LYS A CA  1 
ATOM   1201  C C   . LYS A  1 177 ? 72.972  73.059  136.009 1.00 78.08  ? 177  LYS A C   1 
ATOM   1202  O O   . LYS A  1 177 ? 73.513  72.039  135.568 1.00 78.87  ? 177  LYS A O   1 
ATOM   1203  C CB  . LYS A  1 177 ? 74.552  72.987  137.945 1.00 76.84  ? 177  LYS A CB  1 
ATOM   1204  C CG  . LYS A  1 177 ? 75.410  73.770  138.913 1.00 77.61  ? 177  LYS A CG  1 
ATOM   1205  C CD  . LYS A  1 177 ? 76.188  72.870  139.846 1.00 79.27  ? 177  LYS A CD  1 
ATOM   1206  C CE  . LYS A  1 177 ? 76.933  73.702  140.892 1.00 80.41  ? 177  LYS A CE  1 
ATOM   1207  N NZ  . LYS A  1 177 ? 77.658  72.857  141.906 1.00 81.75  ? 177  LYS A NZ  1 
ATOM   1208  N N   . LEU A  1 178 ? 71.793  73.506  135.581 1.00 79.68  ? 178  LEU A N   1 
ATOM   1209  C CA  . LEU A  1 178 ? 71.051  72.832  134.519 1.00 80.58  ? 178  LEU A CA  1 
ATOM   1210  C C   . LEU A  1 178 ? 70.903  73.810  133.397 1.00 81.36  ? 178  LEU A C   1 
ATOM   1211  O O   . LEU A  1 178 ? 70.993  75.023  133.605 1.00 81.06  ? 178  LEU A O   1 
ATOM   1212  C CB  . LEU A  1 178 ? 69.650  72.410  134.967 1.00 80.53  ? 178  LEU A CB  1 
ATOM   1213  C CG  . LEU A  1 178 ? 69.543  71.324  136.031 1.00 81.18  ? 178  LEU A CG  1 
ATOM   1214  C CD1 . LEU A  1 178 ? 68.207  70.619  135.850 1.00 80.76  ? 178  LEU A CD1 1 
ATOM   1215  C CD2 . LEU A  1 178 ? 70.700  70.326  135.906 1.00 80.75  ? 178  LEU A CD2 1 
ATOM   1216  N N   . PRO A  1 179 ? 70.674  73.299  132.183 1.00 82.57  ? 179  PRO A N   1 
ATOM   1217  C CA  . PRO A  1 179 ? 70.510  74.181  131.022 1.00 83.43  ? 179  PRO A CA  1 
ATOM   1218  C C   . PRO A  1 179 ? 69.278  75.049  131.285 1.00 83.82  ? 179  PRO A C   1 
ATOM   1219  O O   . PRO A  1 179 ? 68.558  74.815  132.257 1.00 83.50  ? 179  PRO A O   1 
ATOM   1220  C CB  . PRO A  1 179 ? 70.289  73.191  129.866 1.00 83.34  ? 179  PRO A CB  1 
ATOM   1221  C CG  . PRO A  1 179 ? 70.977  71.925  130.332 1.00 83.18  ? 179  PRO A CG  1 
ATOM   1222  C CD  . PRO A  1 179 ? 70.581  71.878  131.796 1.00 83.16  ? 179  PRO A CD  1 
ATOM   1223  N N   . ARG A  1 180 ? 69.027  76.049  130.450 1.00 84.47  ? 180  ARG A N   1 
ATOM   1224  C CA  . ARG A  1 180 ? 67.827  76.843  130.669 1.00 85.19  ? 180  ARG A CA  1 
ATOM   1225  C C   . ARG A  1 180 ? 66.632  75.881  130.664 1.00 84.27  ? 180  ARG A C   1 
ATOM   1226  O O   . ARG A  1 180 ? 66.754  74.659  130.493 1.00 84.48  ? 180  ARG A O   1 
ATOM   1227  C CB  . ARG A  1 180 ? 67.565  77.838  129.538 1.00 87.48  ? 180  ARG A CB  1 
ATOM   1228  C CG  . ARG A  1 180 ? 68.734  78.633  128.984 1.00 90.60  ? 180  ARG A CG  1 
ATOM   1229  C CD  . ARG A  1 180 ? 68.213  79.403  127.757 1.00 92.80  ? 180  ARG A CD  1 
ATOM   1230  N NE  . ARG A  1 180 ? 69.163  80.357  127.180 1.00 94.89  ? 180  ARG A NE  1 
ATOM   1231  C CZ  . ARG A  1 180 ? 68.823  81.300  126.296 1.00 96.02  ? 180  ARG A CZ  1 
ATOM   1232  N NH1 . ARG A  1 180 ? 67.552  81.412  125.894 1.00 96.32  ? 180  ARG A NH1 1 
ATOM   1233  N NH2 . ARG A  1 180 ? 69.749  82.132  125.808 1.00 95.70  ? 180  ARG A NH2 1 
ATOM   1234  N N   . GLN A  1 181 ? 65.464  76.471  130.834 1.00 83.01  ? 181  GLN A N   1 
ATOM   1235  C CA  . GLN A  1 181 ? 64.204  75.755  130.815 1.00 81.62  ? 181  GLN A CA  1 
ATOM   1236  C C   . GLN A  1 181 ? 63.349  76.682  129.961 1.00 80.61  ? 181  GLN A C   1 
ATOM   1237  O O   . GLN A  1 181 ? 63.234  77.877  130.248 1.00 80.59  ? 181  GLN A O   1 
ATOM   1238  C CB  . GLN A  1 181 ? 63.644  75.622  132.254 1.00 81.14  ? 181  GLN A CB  1 
ATOM   1239  C CG  . GLN A  1 181 ? 62.090  75.440  132.429 1.00 79.80  ? 181  GLN A CG  1 
ATOM   1240  C CD  . GLN A  1 181 ? 61.560  74.025  132.144 1.00 78.65  ? 181  GLN A CD  1 
ATOM   1241  O OE1 . GLN A  1 181 ? 62.112  73.020  132.597 1.00 78.17  ? 181  GLN A OE1 1 
ATOM   1242  N NE2 . GLN A  1 181 ? 60.467  73.956  131.405 1.00 78.07  ? 181  GLN A NE2 1 
ATOM   1243  N N   . LEU A  1 182 ? 62.801  76.173  128.870 1.00 79.39  ? 182  LEU A N   1 
ATOM   1244  C CA  . LEU A  1 182 ? 61.959  77.046  128.073 1.00 78.55  ? 182  LEU A CA  1 
ATOM   1245  C C   . LEU A  1 182 ? 60.500  76.705  128.352 1.00 76.85  ? 182  LEU A C   1 
ATOM   1246  O O   . LEU A  1 182 ? 60.175  75.598  128.782 1.00 76.53  ? 182  LEU A O   1 
ATOM   1247  C CB  . LEU A  1 182 ? 62.307  76.948  126.589 1.00 79.35  ? 182  LEU A CB  1 
ATOM   1248  C CG  . LEU A  1 182 ? 62.267  75.594  125.902 1.00 80.76  ? 182  LEU A CG  1 
ATOM   1249  C CD1 . LEU A  1 182 ? 62.991  75.800  124.571 1.00 81.17  ? 182  LEU A CD1 1 
ATOM   1250  C CD2 . LEU A  1 182 ? 62.933  74.473  126.747 1.00 80.84  ? 182  LEU A CD2 1 
ATOM   1251  N N   . PRO A  1 183 ? 59.602  77.668  128.134 1.00 75.69  ? 183  PRO A N   1 
ATOM   1252  C CA  . PRO A  1 183 ? 58.184  77.421  128.390 1.00 74.96  ? 183  PRO A CA  1 
ATOM   1253  C C   . PRO A  1 183 ? 57.735  76.083  127.788 1.00 74.74  ? 183  PRO A C   1 
ATOM   1254  O O   . PRO A  1 183 ? 58.052  75.815  126.606 1.00 74.61  ? 183  PRO A O   1 
ATOM   1255  C CB  . PRO A  1 183 ? 57.509  78.602  127.702 1.00 75.03  ? 183  PRO A CB  1 
ATOM   1256  C CG  . PRO A  1 183 ? 58.588  79.654  127.651 1.00 74.82  ? 183  PRO A CG  1 
ATOM   1257  C CD  . PRO A  1 183 ? 59.790  78.878  127.313 1.00 75.14  ? 183  PRO A CD  1 
ATOM   1258  N N   . LEU A  1 184 ? 57.027  75.241  128.567 1.00 73.48  ? 184  LEU A N   1 
ATOM   1259  C CA  . LEU A  1 184 ? 56.545  73.971  127.989 1.00 71.86  ? 184  LEU A CA  1 
ATOM   1260  C C   . LEU A  1 184 ? 55.286  74.233  127.154 1.00 69.53  ? 184  LEU A C   1 
ATOM   1261  O O   . LEU A  1 184 ? 54.519  75.168  127.431 1.00 68.86  ? 184  LEU A O   1 
ATOM   1262  C CB  . LEU A  1 184 ? 56.262  72.875  129.039 1.00 72.30  ? 184  LEU A CB  1 
ATOM   1263  C CG  . LEU A  1 184 ? 56.679  71.471  128.492 1.00 73.23  ? 184  LEU A CG  1 
ATOM   1264  C CD1 . LEU A  1 184 ? 56.078  70.367  129.391 1.00 72.68  ? 184  LEU A CD1 1 
ATOM   1265  C CD2 . LEU A  1 184 ? 56.249  71.268  127.002 1.00 70.45  ? 184  LEU A CD2 1 
ATOM   1266  N N   . GLU A  1 185 ? 55.102  73.420  126.117 1.00 66.44  ? 185  GLU A N   1 
ATOM   1267  C CA  . GLU A  1 185 ? 53.981  73.602  125.211 1.00 64.35  ? 185  GLU A CA  1 
ATOM   1268  C C   . GLU A  1 185 ? 52.809  72.717  125.598 1.00 60.49  ? 185  GLU A C   1 
ATOM   1269  O O   . GLU A  1 185 ? 52.980  71.492  125.717 1.00 59.64  ? 185  GLU A O   1 
ATOM   1270  C CB  . GLU A  1 185 ? 54.402  73.268  123.760 1.00 66.88  ? 185  GLU A CB  1 
ATOM   1271  C CG  . GLU A  1 185 ? 55.592  74.061  123.208 1.00 71.16  ? 185  GLU A CG  1 
ATOM   1272  C CD  . GLU A  1 185 ? 55.360  75.599  123.101 1.00 74.73  ? 185  GLU A CD  1 
ATOM   1273  O OE1 . GLU A  1 185 ? 54.471  76.060  122.335 1.00 76.00  ? 185  GLU A OE1 1 
ATOM   1274  O OE2 . GLU A  1 185 ? 56.092  76.364  123.780 1.00 77.10  ? 185  GLU A OE2 1 
ATOM   1275  N N   . VAL A  1 186 ? 51.630  73.313  125.793 1.00 55.19  ? 186  VAL A N   1 
ATOM   1276  C CA  . VAL A  1 186 ? 50.478  72.482  126.120 1.00 51.15  ? 186  VAL A CA  1 
ATOM   1277  C C   . VAL A  1 186 ? 49.721  72.142  124.847 1.00 49.05  ? 186  VAL A C   1 
ATOM   1278  O O   . VAL A  1 186 ? 49.477  72.998  124.014 1.00 46.88  ? 186  VAL A O   1 
ATOM   1279  C CB  . VAL A  1 186 ? 49.484  73.133  127.112 1.00 49.14  ? 186  VAL A CB  1 
ATOM   1280  C CG1 . VAL A  1 186 ? 48.316  72.204  127.318 1.00 47.06  ? 186  VAL A CG1 1 
ATOM   1281  C CG2 . VAL A  1 186 ? 50.141  73.385  128.418 1.00 47.22  ? 186  VAL A CG2 1 
ATOM   1282  N N   . ASP A  1 187 ? 49.357  70.869  124.737 1.00 47.95  ? 187  ASP A N   1 
ATOM   1283  C CA  . ASP A  1 187 ? 48.639  70.310  123.598 1.00 46.51  ? 187  ASP A CA  1 
ATOM   1284  C C   . ASP A  1 187 ? 47.141  70.160  123.926 1.00 44.71  ? 187  ASP A C   1 
ATOM   1285  O O   . ASP A  1 187 ? 46.785  69.346  124.790 1.00 44.76  ? 187  ASP A O   1 
ATOM   1286  C CB  . ASP A  1 187 ? 49.213  68.922  123.290 1.00 47.73  ? 187  ASP A CB  1 
ATOM   1287  C CG  . ASP A  1 187 ? 48.421  68.177  122.217 1.00 50.02  ? 187  ASP A CG  1 
ATOM   1288  O OD1 . ASP A  1 187 ? 48.640  66.954  122.065 1.00 52.10  ? 187  ASP A OD1 1 
ATOM   1289  O OD2 . ASP A  1 187 ? 47.595  68.800  121.511 1.00 50.45  ? 187  ASP A OD2 1 
ATOM   1290  N N   . LEU A  1 188 ? 46.280  70.913  123.232 1.00 41.00  ? 188  LEU A N   1 
ATOM   1291  C CA  . LEU A  1 188 ? 44.835  70.845  123.451 1.00 37.56  ? 188  LEU A CA  1 
ATOM   1292  C C   . LEU A  1 188 ? 44.130  69.962  122.437 1.00 37.46  ? 188  LEU A C   1 
ATOM   1293  O O   . LEU A  1 188 ? 42.910  69.985  122.312 1.00 38.15  ? 188  LEU A O   1 
ATOM   1294  C CB  . LEU A  1 188 ? 44.244  72.238  123.396 1.00 34.88  ? 188  LEU A CB  1 
ATOM   1295  C CG  . LEU A  1 188 ? 45.045  73.216  124.254 1.00 32.95  ? 188  LEU A CG  1 
ATOM   1296  C CD1 . LEU A  1 188 ? 44.554  74.660  124.022 1.00 31.49  ? 188  LEU A CD1 1 
ATOM   1297  C CD2 . LEU A  1 188 ? 44.931  72.786  125.690 1.00 30.43  ? 188  LEU A CD2 1 
ATOM   1298  N N   . THR A  1 189 ? 44.899  69.167  121.714 1.00 37.83  ? 189  THR A N   1 
ATOM   1299  C CA  . THR A  1 189 ? 44.327  68.292  120.708 1.00 38.18  ? 189  THR A CA  1 
ATOM   1300  C C   . THR A  1 189 ? 43.154  67.515  121.310 1.00 38.87  ? 189  THR A C   1 
ATOM   1301  O O   . THR A  1 189 ? 42.088  67.414  120.696 1.00 39.26  ? 189  THR A O   1 
ATOM   1302  C CB  . THR A  1 189 ? 45.434  67.349  120.105 1.00 37.76  ? 189  THR A CB  1 
ATOM   1303  O OG1 . THR A  1 189 ? 46.070  68.031  119.017 1.00 38.34  ? 189  THR A OG1 1 
ATOM   1304  C CG2 . THR A  1 189 ? 44.870  66.065  119.574 1.00 36.22  ? 189  THR A CG2 1 
ATOM   1305  N N   . LYS A  1 190 ? 43.333  67.027  122.531 1.00 38.95  ? 190  LYS A N   1 
ATOM   1306  C CA  . LYS A  1 190 ? 42.306  66.259  123.204 1.00 38.62  ? 190  LYS A CA  1 
ATOM   1307  C C   . LYS A  1 190 ? 41.726  66.976  124.427 1.00 37.70  ? 190  LYS A C   1 
ATOM   1308  O O   . LYS A  1 190 ? 41.499  66.353  125.484 1.00 36.21  ? 190  LYS A O   1 
ATOM   1309  C CB  . LYS A  1 190 ? 42.885  64.916  123.612 1.00 41.52  ? 190  LYS A CB  1 
ATOM   1310  C CG  . LYS A  1 190 ? 43.284  64.048  122.445 1.00 46.00  ? 190  LYS A CG  1 
ATOM   1311  C CD  . LYS A  1 190 ? 43.738  62.655  122.906 1.00 51.33  ? 190  LYS A CD  1 
ATOM   1312  C CE  . LYS A  1 190 ? 43.908  61.649  121.701 1.00 54.86  ? 190  LYS A CE  1 
ATOM   1313  N NZ  . LYS A  1 190 ? 44.287  60.198  122.078 1.00 56.26  ? 190  LYS A NZ  1 
ATOM   1314  N N   . ALA A  1 191 ? 41.472  68.280  124.271 1.00 36.25  ? 191  ALA A N   1 
ATOM   1315  C CA  . ALA A  1 191 ? 40.923  69.104  125.353 1.00 35.19  ? 191  ALA A CA  1 
ATOM   1316  C C   . ALA A  1 191 ? 39.426  68.882  125.492 1.00 35.55  ? 191  ALA A C   1 
ATOM   1317  O O   . ALA A  1 191 ? 38.710  68.759  124.492 1.00 37.33  ? 191  ALA A O   1 
ATOM   1318  C CB  . ALA A  1 191 ? 41.188  70.582  125.085 1.00 33.56  ? 191  ALA A CB  1 
ATOM   1319  N N   . LYS A  1 192 ? 38.950  68.859  126.733 1.00 34.53  ? 192  LYS A N   1 
ATOM   1320  C CA  . LYS A  1 192 ? 37.539  68.651  127.026 1.00 31.46  ? 192  LYS A CA  1 
ATOM   1321  C C   . LYS A  1 192 ? 36.803  69.755  126.332 1.00 31.82  ? 192  LYS A C   1 
ATOM   1322  O O   . LYS A  1 192 ? 37.156  70.935  126.485 1.00 32.03  ? 192  LYS A O   1 
ATOM   1323  C CB  . LYS A  1 192 ? 37.312  68.725  128.531 1.00 29.58  ? 192  LYS A CB  1 
ATOM   1324  C CG  . LYS A  1 192 ? 35.923  68.397  128.994 1.00 28.65  ? 192  LYS A CG  1 
ATOM   1325  C CD  . LYS A  1 192 ? 35.895  68.167  130.493 1.00 25.84  ? 192  LYS A CD  1 
ATOM   1326  C CE  . LYS A  1 192 ? 34.457  67.995  130.909 1.00 28.50  ? 192  LYS A CE  1 
ATOM   1327  N NZ  . LYS A  1 192 ? 33.762  66.922  130.151 1.00 29.02  ? 192  LYS A NZ  1 
ATOM   1328  N N   . ARG A  1 193 ? 35.812  69.372  125.537 1.00 31.90  ? 193  ARG A N   1 
ATOM   1329  C CA  . ARG A  1 193 ? 35.025  70.339  124.822 1.00 32.86  ? 193  ARG A CA  1 
ATOM   1330  C C   . ARG A  1 193 ? 33.548  70.271  125.153 1.00 33.82  ? 193  ARG A C   1 
ATOM   1331  O O   . ARG A  1 193 ? 32.797  71.159  124.789 1.00 34.47  ? 193  ARG A O   1 
ATOM   1332  C CB  . ARG A  1 193 ? 35.231  70.144  123.348 1.00 33.13  ? 193  ARG A CB  1 
ATOM   1333  C CG  . ARG A  1 193 ? 36.602  70.545  122.919 1.00 37.74  ? 193  ARG A CG  1 
ATOM   1334  C CD  . ARG A  1 193 ? 37.072  69.712  121.739 1.00 40.20  ? 193  ARG A CD  1 
ATOM   1335  N NE  . ARG A  1 193 ? 38.435  70.037  121.310 1.00 43.77  ? 193  ARG A NE  1 
ATOM   1336  C CZ  . ARG A  1 193 ? 38.795  71.194  120.742 1.00 45.63  ? 193  ARG A CZ  1 
ATOM   1337  N NH1 . ARG A  1 193 ? 37.886  72.150  120.525 1.00 43.76  ? 193  ARG A NH1 1 
ATOM   1338  N NH2 . ARG A  1 193 ? 40.075  71.398  120.398 1.00 46.33  ? 193  ARG A NH2 1 
ATOM   1339  N N   . GLN A  1 194 ? 33.132  69.222  125.846 1.00 34.76  ? 194  GLN A N   1 
ATOM   1340  C CA  . GLN A  1 194 ? 31.744  69.018  126.193 1.00 34.90  ? 194  GLN A CA  1 
ATOM   1341  C C   . GLN A  1 194 ? 31.731  68.740  127.676 1.00 33.81  ? 194  GLN A C   1 
ATOM   1342  O O   . GLN A  1 194 ? 32.763  68.306  128.211 1.00 33.41  ? 194  GLN A O   1 
ATOM   1343  C CB  . GLN A  1 194 ? 31.215  67.765  125.529 1.00 39.48  ? 194  GLN A CB  1 
ATOM   1344  C CG  . GLN A  1 194 ? 31.028  67.807  124.080 1.00 48.81  ? 194  GLN A CG  1 
ATOM   1345  C CD  . GLN A  1 194 ? 29.925  66.796  123.637 1.00 55.78  ? 194  GLN A CD  1 
ATOM   1346  O OE1 . GLN A  1 194 ? 29.765  66.490  122.420 1.00 57.53  ? 194  GLN A OE1 1 
ATOM   1347  N NE2 . GLN A  1 194 ? 29.156  66.282  124.623 1.00 55.30  ? 194  GLN A NE2 1 
ATOM   1348  N N   . ASP A  1 195 ? 30.568  68.922  128.327 1.00 31.44  ? 195  ASP A N   1 
ATOM   1349  C CA  . ASP A  1 195 ? 30.461  68.659  129.758 1.00 30.38  ? 195  ASP A CA  1 
ATOM   1350  C C   . ASP A  1 195 ? 30.394  67.179  130.072 1.00 30.12  ? 195  ASP A C   1 
ATOM   1351  O O   . ASP A  1 195 ? 31.091  66.691  130.970 1.00 29.71  ? 195  ASP A O   1 
ATOM   1352  C CB  . ASP A  1 195 ? 29.226  69.325  130.370 1.00 28.88  ? 195  ASP A CB  1 
ATOM   1353  C CG  . ASP A  1 195 ? 29.271  70.857  130.301 1.00 29.89  ? 195  ASP A CG  1 
ATOM   1354  O OD1 . ASP A  1 195 ? 28.187  71.505  130.324 1.00 28.88  ? 195  ASP A OD1 1 
ATOM   1355  O OD2 . ASP A  1 195 ? 30.379  71.421  130.221 1.00 31.15  ? 195  ASP A OD2 1 
ATOM   1356  N N   . LEU A  1 196 ? 29.555  66.479  129.314 1.00 31.02  ? 196  LEU A N   1 
ATOM   1357  C CA  . LEU A  1 196 ? 29.272  65.054  129.489 1.00 31.83  ? 196  LEU A CA  1 
ATOM   1358  C C   . LEU A  1 196 ? 30.508  64.141  129.554 1.00 32.39  ? 196  LEU A C   1 
ATOM   1359  O O   . LEU A  1 196 ? 31.418  64.255  128.728 1.00 34.06  ? 196  LEU A O   1 
ATOM   1360  C CB  . LEU A  1 196 ? 28.290  64.637  128.382 1.00 32.96  ? 196  LEU A CB  1 
ATOM   1361  C CG  . LEU A  1 196 ? 27.403  63.362  128.423 1.00 37.37  ? 196  LEU A CG  1 
ATOM   1362  C CD1 . LEU A  1 196 ? 28.229  62.163  128.034 1.00 36.98  ? 196  LEU A CD1 1 
ATOM   1363  C CD2 . LEU A  1 196 ? 26.744  63.103  129.844 1.00 38.05  ? 196  LEU A CD2 1 
ATOM   1364  N N   . GLU A  1 197 ? 30.566  63.292  130.577 1.00 31.12  ? 197  GLU A N   1 
ATOM   1365  C CA  . GLU A  1 197 ? 31.668  62.348  130.768 1.00 31.45  ? 197  GLU A CA  1 
ATOM   1366  C C   . GLU A  1 197 ? 31.038  60.959  130.804 1.00 31.61  ? 197  GLU A C   1 
ATOM   1367  O O   . GLU A  1 197 ? 30.708  60.429  131.895 1.00 32.48  ? 197  GLU A O   1 
ATOM   1368  C CB  . GLU A  1 197 ? 32.374  62.576  132.096 1.00 30.83  ? 197  GLU A CB  1 
ATOM   1369  C CG  . GLU A  1 197 ? 33.229  63.782  132.154 1.00 30.50  ? 197  GLU A CG  1 
ATOM   1370  C CD  . GLU A  1 197 ? 34.471  63.668  131.310 1.00 31.65  ? 197  GLU A CD  1 
ATOM   1371  O OE1 . GLU A  1 197 ? 34.856  62.506  130.947 1.00 30.46  ? 197  GLU A OE1 1 
ATOM   1372  O OE2 . GLU A  1 197 ? 35.046  64.763  131.052 1.00 29.91  ? 197  GLU A OE2 1 
ATOM   1373  N N   . PRO A  1 198 ? 30.868  60.345  129.619 1.00 30.59  ? 198  PRO A N   1 
ATOM   1374  C CA  . PRO A  1 198 ? 30.255  59.014  129.517 1.00 29.50  ? 198  PRO A CA  1 
ATOM   1375  C C   . PRO A  1 198 ? 30.850  57.965  130.424 1.00 29.77  ? 198  PRO A C   1 
ATOM   1376  O O   . PRO A  1 198 ? 30.128  57.276  131.153 1.00 30.21  ? 198  PRO A O   1 
ATOM   1377  C CB  . PRO A  1 198 ? 30.413  58.672  128.038 1.00 28.72  ? 198  PRO A CB  1 
ATOM   1378  C CG  . PRO A  1 198 ? 30.382  60.031  127.348 1.00 27.34  ? 198  PRO A CG  1 
ATOM   1379  C CD  . PRO A  1 198 ? 31.275  60.852  128.290 1.00 29.04  ? 198  PRO A CD  1 
ATOM   1380  N N   . SER A  1 199 ? 32.164  57.815  130.390 1.00 29.48  ? 199  SER A N   1 
ATOM   1381  C CA  . SER A  1 199 ? 32.789  56.802  131.231 1.00 30.28  ? 199  SER A CA  1 
ATOM   1382  C C   . SER A  1 199 ? 32.424  57.055  132.655 1.00 28.71  ? 199  SER A C   1 
ATOM   1383  O O   . SER A  1 199 ? 32.079  56.119  133.391 1.00 30.63  ? 199  SER A O   1 
ATOM   1384  C CB  . SER A  1 199 ? 34.289  56.867  131.069 1.00 32.84  ? 199  SER A CB  1 
ATOM   1385  O OG  . SER A  1 199 ? 34.625  58.269  130.948 1.00 44.61  ? 199  SER A OG  1 
ATOM   1386  N N   . VAL A  1 200 ? 32.478  58.323  133.044 1.00 26.91  ? 200  VAL A N   1 
ATOM   1387  C CA  . VAL A  1 200 ? 32.163  58.682  134.402 1.00 25.95  ? 200  VAL A CA  1 
ATOM   1388  C C   . VAL A  1 200 ? 30.744  58.328  134.774 1.00 27.09  ? 200  VAL A C   1 
ATOM   1389  O O   . VAL A  1 200 ? 30.526  57.700  135.807 1.00 26.49  ? 200  VAL A O   1 
ATOM   1390  C CB  . VAL A  1 200 ? 32.404  60.192  134.688 1.00 25.68  ? 200  VAL A CB  1 
ATOM   1391  C CG1 . VAL A  1 200 ? 31.856  60.575  136.111 1.00 21.50  ? 200  VAL A CG1 1 
ATOM   1392  C CG2 . VAL A  1 200 ? 33.920  60.485  134.619 1.00 23.38  ? 200  VAL A CG2 1 
ATOM   1393  N N   . GLU A  1 201 ? 29.785  58.736  133.945 1.00 27.63  ? 201  GLU A N   1 
ATOM   1394  C CA  . GLU A  1 201 ? 28.376  58.486  134.222 1.00 29.39  ? 201  GLU A CA  1 
ATOM   1395  C C   . GLU A  1 201 ? 28.111  56.994  134.349 1.00 30.72  ? 201  GLU A C   1 
ATOM   1396  O O   . GLU A  1 201 ? 27.293  56.527  135.155 1.00 29.44  ? 201  GLU A O   1 
ATOM   1397  C CB  . GLU A  1 201 ? 27.510  59.165  133.130 1.00 29.81  ? 201  GLU A CB  1 
ATOM   1398  C CG  . GLU A  1 201 ? 25.992  58.826  133.106 1.00 34.28  ? 201  GLU A CG  1 
ATOM   1399  C CD  . GLU A  1 201 ? 25.239  58.948  134.482 1.00 38.55  ? 201  GLU A CD  1 
ATOM   1400  O OE1 . GLU A  1 201 ? 24.071  58.458  134.577 1.00 39.20  ? 201  GLU A OE1 1 
ATOM   1401  O OE2 . GLU A  1 201 ? 25.789  59.540  135.458 1.00 41.23  ? 201  GLU A OE2 1 
ATOM   1402  N N   . GLU A  1 202 ? 28.845  56.212  133.589 1.00 34.27  ? 202  GLU A N   1 
ATOM   1403  C CA  . GLU A  1 202 ? 28.622  54.781  133.683 1.00 37.21  ? 202  GLU A CA  1 
ATOM   1404  C C   . GLU A  1 202 ? 29.060  54.305  135.050 1.00 35.54  ? 202  GLU A C   1 
ATOM   1405  O O   . GLU A  1 202 ? 28.289  53.663  135.773 1.00 35.40  ? 202  GLU A O   1 
ATOM   1406  C CB  . GLU A  1 202 ? 29.414  54.043  132.608 1.00 41.58  ? 202  GLU A CB  1 
ATOM   1407  C CG  . GLU A  1 202 ? 28.759  52.723  132.141 1.00 47.56  ? 202  GLU A CG  1 
ATOM   1408  C CD  . GLU A  1 202 ? 29.740  51.781  131.432 1.00 50.88  ? 202  GLU A CD  1 
ATOM   1409  O OE1 . GLU A  1 202 ? 29.274  50.681  131.026 1.00 52.90  ? 202  GLU A OE1 1 
ATOM   1410  O OE2 . GLU A  1 202 ? 30.956  52.139  131.304 1.00 50.99  ? 202  GLU A OE2 1 
ATOM   1411  N N   . ALA A  1 203 ? 30.296  54.639  135.413 1.00 33.99  ? 203  ALA A N   1 
ATOM   1412  C CA  . ALA A  1 203 ? 30.795  54.197  136.702 1.00 32.43  ? 203  ALA A CA  1 
ATOM   1413  C C   . ALA A  1 203 ? 29.901  54.653  137.820 1.00 32.85  ? 203  ALA A C   1 
ATOM   1414  O O   . ALA A  1 203 ? 29.651  53.911  138.760 1.00 34.38  ? 203  ALA A O   1 
ATOM   1415  C CB  . ALA A  1 203 ? 32.168  54.694  136.920 1.00 31.78  ? 203  ALA A CB  1 
ATOM   1416  N N   . ARG A  1 204 ? 29.385  55.868  137.712 1.00 34.03  ? 204  ARG A N   1 
ATOM   1417  C CA  . ARG A  1 204 ? 28.542  56.400  138.759 1.00 33.95  ? 204  ARG A CA  1 
ATOM   1418  C C   . ARG A  1 204 ? 27.186  55.773  138.678 1.00 35.86  ? 204  ARG A C   1 
ATOM   1419  O O   . ARG A  1 204 ? 26.550  55.573  139.698 1.00 35.79  ? 204  ARG A O   1 
ATOM   1420  C CB  . ARG A  1 204 ? 28.430  57.918  138.652 1.00 33.50  ? 204  ARG A CB  1 
ATOM   1421  C CG  . ARG A  1 204 ? 27.410  58.525  139.595 1.00 30.31  ? 204  ARG A CG  1 
ATOM   1422  C CD  . ARG A  1 204 ? 27.307  60.041  139.580 1.00 27.02  ? 204  ARG A CD  1 
ATOM   1423  N NE  . ARG A  1 204 ? 27.700  60.726  138.342 1.00 28.02  ? 204  ARG A NE  1 
ATOM   1424  C CZ  . ARG A  1 204 ? 28.926  61.200  138.083 1.00 25.12  ? 204  ARG A CZ  1 
ATOM   1425  N NH1 . ARG A  1 204 ? 29.173  61.819  136.951 1.00 24.36  ? 204  ARG A NH1 1 
ATOM   1426  N NH2 . ARG A  1 204 ? 29.909  61.050  138.945 1.00 25.45  ? 204  ARG A NH2 1 
ATOM   1427  N N   . TYR A  1 205 ? 26.724  55.452  137.478 1.00 38.20  ? 205  TYR A N   1 
ATOM   1428  C CA  . TYR A  1 205 ? 25.407  54.827  137.400 1.00 41.67  ? 205  TYR A CA  1 
ATOM   1429  C C   . TYR A  1 205 ? 25.475  53.462  138.023 1.00 42.46  ? 205  TYR A C   1 
ATOM   1430  O O   . TYR A  1 205 ? 24.557  53.052  138.707 1.00 42.75  ? 205  TYR A O   1 
ATOM   1431  C CB  . TYR A  1 205 ? 24.898  54.692  135.971 1.00 42.85  ? 205  TYR A CB  1 
ATOM   1432  C CG  . TYR A  1 205 ? 23.549  54.009  135.917 1.00 45.08  ? 205  TYR A CG  1 
ATOM   1433  C CD1 . TYR A  1 205 ? 22.500  54.424  136.763 1.00 45.19  ? 205  TYR A CD1 1 
ATOM   1434  C CD2 . TYR A  1 205 ? 23.312  52.934  135.031 1.00 45.47  ? 205  TYR A CD2 1 
ATOM   1435  C CE1 . TYR A  1 205 ? 21.233  53.784  136.734 1.00 46.73  ? 205  TYR A CE1 1 
ATOM   1436  C CE2 . TYR A  1 205 ? 22.060  52.283  134.991 1.00 47.00  ? 205  TYR A CE2 1 
ATOM   1437  C CZ  . TYR A  1 205 ? 21.021  52.711  135.842 1.00 48.31  ? 205  TYR A CZ  1 
ATOM   1438  O OH  . TYR A  1 205 ? 19.782  52.080  135.781 1.00 49.18  ? 205  TYR A OH  1 
ATOM   1439  N N   . ASN A  1 206 ? 26.569  52.757  137.798 1.00 45.40  ? 206  ASN A N   1 
ATOM   1440  C CA  . ASN A  1 206 ? 26.700  51.440  138.398 1.00 50.14  ? 206  ASN A CA  1 
ATOM   1441  C C   . ASN A  1 206 ? 27.006  51.436  139.890 1.00 51.87  ? 206  ASN A C   1 
ATOM   1442  O O   . ASN A  1 206 ? 27.201  50.391  140.462 1.00 51.95  ? 206  ASN A O   1 
ATOM   1443  C CB  . ASN A  1 206 ? 27.773  50.630  137.678 1.00 50.91  ? 206  ASN A CB  1 
ATOM   1444  C CG  . ASN A  1 206 ? 27.403  50.342  136.247 1.00 53.09  ? 206  ASN A CG  1 
ATOM   1445  O OD1 . ASN A  1 206 ? 26.250  49.999  135.949 1.00 53.97  ? 206  ASN A OD1 1 
ATOM   1446  N ND2 . ASN A  1 206 ? 28.380  50.464  135.342 1.00 54.15  ? 206  ASN A ND2 1 
ATOM   1447  N N   . SER A  1 207 ? 27.023  52.583  140.542 1.00 55.38  ? 207  SER A N   1 
ATOM   1448  C CA  . SER A  1 207 ? 27.375  52.586  141.959 1.00 58.83  ? 207  SER A CA  1 
ATOM   1449  C C   . SER A  1 207 ? 26.236  52.654  143.002 1.00 61.40  ? 207  SER A C   1 
ATOM   1450  O O   . SER A  1 207 ? 26.410  52.152  144.119 1.00 62.38  ? 207  SER A O   1 
ATOM   1451  C CB  . SER A  1 207 ? 28.384  53.706  142.218 1.00 57.97  ? 207  SER A CB  1 
ATOM   1452  O OG  . SER A  1 207 ? 27.746  54.973  142.145 1.00 59.56  ? 207  SER A OG  1 
ATOM   1453  N N   . CYS A  1 208 ? 25.087  53.243  142.647 1.00 63.92  ? 208  CYS A N   1 
ATOM   1454  C CA  . CYS A  1 208 ? 23.924  53.376  143.554 1.00 65.84  ? 208  CYS A CA  1 
ATOM   1455  C C   . CYS A  1 208 ? 23.097  52.096  143.843 1.00 68.49  ? 208  CYS A C   1 
ATOM   1456  O O   . CYS A  1 208 ? 22.238  52.095  144.746 1.00 67.49  ? 208  CYS A O   1 
ATOM   1457  C CB  . CYS A  1 208 ? 22.964  54.433  143.002 1.00 64.92  ? 208  CYS A CB  1 
ATOM   1458  S SG  . CYS A  1 208 ? 23.661  55.644  141.824 1.00 63.29  ? 208  CYS A SG  1 
ATOM   1459  N N   . ARG A  1 209 ? 23.337  51.036  143.056 1.00 72.49  ? 209  ARG A N   1 
ATOM   1460  C CA  . ARG A  1 209 ? 22.630  49.740  143.186 1.00 76.31  ? 209  ARG A CA  1 
ATOM   1461  C C   . ARG A  1 209 ? 23.252  48.932  144.328 1.00 77.27  ? 209  ARG A C   1 
ATOM   1462  O O   . ARG A  1 209 ? 24.358  48.375  144.179 1.00 78.30  ? 209  ARG A O   1 
ATOM   1463  C CB  . ARG A  1 209 ? 22.750  48.888  141.901 1.00 79.07  ? 209  ARG A CB  1 
ATOM   1464  C CG  . ARG A  1 209 ? 22.353  49.538  140.564 1.00 83.15  ? 209  ARG A CG  1 
ATOM   1465  C CD  . ARG A  1 209 ? 23.078  48.816  139.405 1.00 87.42  ? 209  ARG A CD  1 
ATOM   1466  N NE  . ARG A  1 209 ? 22.529  49.079  138.065 1.00 91.50  ? 209  ARG A NE  1 
ATOM   1467  C CZ  . ARG A  1 209 ? 23.003  48.550  136.926 1.00 92.37  ? 209  ARG A CZ  1 
ATOM   1468  N NH1 . ARG A  1 209 ? 24.047  47.724  136.949 1.00 93.09  ? 209  ARG A NH1 1 
ATOM   1469  N NH2 . ARG A  1 209 ? 22.429  48.832  135.757 1.00 91.93  ? 209  ARG A NH2 1 
ATOM   1470  N N   . LEU B  1 24  ? 24.250  56.030  154.534 1.00 56.07  ? 24   LEU B N   1 
ATOM   1471  C CA  . LEU B  1 24  ? 24.950  56.089  153.206 1.00 55.82  ? 24   LEU B CA  1 
ATOM   1472  C C   . LEU B  1 24  ? 24.587  57.341  152.366 1.00 54.05  ? 24   LEU B C   1 
ATOM   1473  O O   . LEU B  1 24  ? 24.589  57.348  151.106 1.00 53.34  ? 24   LEU B O   1 
ATOM   1474  C CB  . LEU B  1 24  ? 24.648  54.826  152.405 1.00 57.88  ? 24   LEU B CB  1 
ATOM   1475  C CG  . LEU B  1 24  ? 25.939  54.250  151.771 1.00 60.37  ? 24   LEU B CG  1 
ATOM   1476  C CD1 . LEU B  1 24  ? 26.486  55.182  150.721 1.00 61.64  ? 24   LEU B CD1 1 
ATOM   1477  C CD2 . LEU B  1 24  ? 26.994  54.023  152.855 1.00 60.19  ? 24   LEU B CD2 1 
ATOM   1478  N N   . CYS B  1 25  ? 24.288  58.402  153.107 1.00 50.86  ? 25   CYS B N   1 
ATOM   1479  C CA  . CYS B  1 25  ? 23.911  59.694  152.571 1.00 46.78  ? 25   CYS B CA  1 
ATOM   1480  C C   . CYS B  1 25  ? 25.156  60.514  152.136 1.00 43.49  ? 25   CYS B C   1 
ATOM   1481  O O   . CYS B  1 25  ? 26.281  60.008  152.143 1.00 43.74  ? 25   CYS B O   1 
ATOM   1482  C CB  . CYS B  1 25  ? 23.154  60.424  153.667 1.00 46.19  ? 25   CYS B CB  1 
ATOM   1483  S SG  . CYS B  1 25  ? 24.160  60.506  155.132 1.00 48.38  ? 25   CYS B SG  1 
ATOM   1484  N N   . PHE B  1 26  ? 24.930  61.773  151.765 1.00 38.45  ? 26   PHE B N   1 
ATOM   1485  C CA  . PHE B  1 26  ? 25.985  62.670  151.331 1.00 32.56  ? 26   PHE B CA  1 
ATOM   1486  C C   . PHE B  1 26  ? 27.037  62.854  152.418 1.00 30.74  ? 26   PHE B C   1 
ATOM   1487  O O   . PHE B  1 26  ? 26.684  63.095  153.562 1.00 29.69  ? 26   PHE B O   1 
ATOM   1488  C CB  . PHE B  1 26  ? 25.400  64.047  150.957 1.00 27.52  ? 26   PHE B CB  1 
ATOM   1489  C CG  . PHE B  1 26  ? 26.368  64.919  150.265 1.00 22.92  ? 26   PHE B CG  1 
ATOM   1490  C CD1 . PHE B  1 26  ? 26.505  64.860  148.905 1.00 21.86  ? 26   PHE B CD1 1 
ATOM   1491  C CD2 . PHE B  1 26  ? 27.269  65.703  150.986 1.00 24.22  ? 26   PHE B CD2 1 
ATOM   1492  C CE1 . PHE B  1 26  ? 27.536  65.562  148.237 1.00 20.56  ? 26   PHE B CE1 1 
ATOM   1493  C CE2 . PHE B  1 26  ? 28.291  66.399  150.326 1.00 21.89  ? 26   PHE B CE2 1 
ATOM   1494  C CZ  . PHE B  1 26  ? 28.413  66.314  148.941 1.00 19.97  ? 26   PHE B CZ  1 
ATOM   1495  N N   . GLY B  1 27  ? 28.315  62.747  152.040 1.00 28.94  ? 27   GLY B N   1 
ATOM   1496  C CA  . GLY B  1 27  ? 29.384  62.916  152.987 1.00 29.40  ? 27   GLY B CA  1 
ATOM   1497  C C   . GLY B  1 27  ? 29.872  61.604  153.546 1.00 31.63  ? 27   GLY B C   1 
ATOM   1498  O O   . GLY B  1 27  ? 30.913  61.551  154.199 1.00 31.91  ? 27   GLY B O   1 
ATOM   1499  N N   . GLN B  1 28  ? 29.119  60.543  153.300 1.00 34.66  ? 28   GLN B N   1 
ATOM   1500  C CA  . GLN B  1 28  ? 29.461  59.226  153.774 1.00 38.51  ? 28   GLN B CA  1 
ATOM   1501  C C   . GLN B  1 28  ? 29.615  58.166  152.708 1.00 41.25  ? 28   GLN B C   1 
ATOM   1502  O O   . GLN B  1 28  ? 29.665  56.984  153.030 1.00 43.95  ? 28   GLN B O   1 
ATOM   1503  C CB  . GLN B  1 28  ? 28.433  58.754  154.747 1.00 40.17  ? 28   GLN B CB  1 
ATOM   1504  C CG  . GLN B  1 28  ? 28.465  59.485  156.035 1.00 43.99  ? 28   GLN B CG  1 
ATOM   1505  C CD  . GLN B  1 28  ? 27.232  59.190  156.846 1.00 46.30  ? 28   GLN B CD  1 
ATOM   1506  O OE1 . GLN B  1 28  ? 27.144  59.624  157.999 1.00 48.55  ? 28   GLN B OE1 1 
ATOM   1507  N NE2 . GLN B  1 28  ? 26.259  58.442  156.253 1.00 45.96  ? 28   GLN B NE2 1 
ATOM   1508  N N   . CYS B  1 29  ? 29.621  58.557  151.444 1.00 42.23  ? 29   CYS B N   1 
ATOM   1509  C CA  . CYS B  1 29  ? 29.848  57.594  150.393 1.00 44.47  ? 29   CYS B CA  1 
ATOM   1510  C C   . CYS B  1 29  ? 31.320  57.362  150.297 1.00 44.79  ? 29   CYS B C   1 
ATOM   1511  O O   . CYS B  1 29  ? 32.094  58.121  150.840 1.00 48.49  ? 29   CYS B O   1 
ATOM   1512  C CB  . CYS B  1 29  ? 29.390  58.109  149.071 1.00 43.97  ? 29   CYS B CB  1 
ATOM   1513  S SG  . CYS B  1 29  ? 27.660  57.939  148.995 1.00 52.11  ? 29   CYS B SG  1 
ATOM   1514  N N   . GLN B  1 30  ? 31.720  56.291  149.642 1.00 43.55  ? 30   GLN B N   1 
ATOM   1515  C CA  . GLN B  1 30  ? 33.123  56.049  149.472 1.00 42.25  ? 30   GLN B CA  1 
ATOM   1516  C C   . GLN B  1 30  ? 33.098  55.767  147.991 1.00 39.25  ? 30   GLN B C   1 
ATOM   1517  O O   . GLN B  1 30  ? 32.172  55.142  147.513 1.00 39.44  ? 30   GLN B O   1 
ATOM   1518  C CB  . GLN B  1 30  ? 33.561  54.859  150.299 1.00 45.85  ? 30   GLN B CB  1 
ATOM   1519  C CG  . GLN B  1 30  ? 35.059  54.717  150.326 1.00 53.83  ? 30   GLN B CG  1 
ATOM   1520  C CD  . GLN B  1 30  ? 35.545  53.343  150.807 1.00 57.11  ? 30   GLN B CD  1 
ATOM   1521  O OE1 . GLN B  1 30  ? 36.729  53.003  150.602 1.00 58.81  ? 30   GLN B OE1 1 
ATOM   1522  N NE2 . GLN B  1 30  ? 34.647  52.550  151.450 1.00 57.85  ? 30   GLN B NE2 1 
ATOM   1523  N N   . TYR B  1 31  ? 34.046  56.295  147.242 1.00 36.44  ? 31   TYR B N   1 
ATOM   1524  C CA  . TYR B  1 31  ? 33.979  56.061  145.824 1.00 36.29  ? 31   TYR B CA  1 
ATOM   1525  C C   . TYR B  1 31  ? 34.322  54.619  145.512 1.00 36.88  ? 31   TYR B C   1 
ATOM   1526  O O   . TYR B  1 31  ? 35.180  54.030  146.168 1.00 38.65  ? 31   TYR B O   1 
ATOM   1527  C CB  . TYR B  1 31  ? 34.933  56.985  145.066 1.00 34.46  ? 31   TYR B CB  1 
ATOM   1528  C CG  . TYR B  1 31  ? 34.389  58.365  144.816 1.00 33.73  ? 31   TYR B CG  1 
ATOM   1529  C CD1 . TYR B  1 31  ? 34.670  59.422  145.702 1.00 32.36  ? 31   TYR B CD1 1 
ATOM   1530  C CD2 . TYR B  1 31  ? 33.581  58.627  143.704 1.00 29.98  ? 31   TYR B CD2 1 
ATOM   1531  C CE1 . TYR B  1 31  ? 34.156  60.697  145.489 1.00 28.02  ? 31   TYR B CE1 1 
ATOM   1532  C CE2 . TYR B  1 31  ? 33.076  59.899  143.485 1.00 29.00  ? 31   TYR B CE2 1 
ATOM   1533  C CZ  . TYR B  1 31  ? 33.371  60.925  144.394 1.00 28.37  ? 31   TYR B CZ  1 
ATOM   1534  O OH  . TYR B  1 31  ? 32.854  62.155  144.215 1.00 23.17  ? 31   TYR B OH  1 
ATOM   1535  N N   . THR B  1 32  ? 33.634  54.051  144.533 1.00 35.35  ? 32   THR B N   1 
ATOM   1536  C CA  . THR B  1 32  ? 33.921  52.704  144.095 1.00 34.80  ? 32   THR B CA  1 
ATOM   1537  C C   . THR B  1 32  ? 35.192  52.869  143.233 1.00 37.74  ? 32   THR B C   1 
ATOM   1538  O O   . THR B  1 32  ? 35.421  53.948  142.658 1.00 38.61  ? 32   THR B O   1 
ATOM   1539  C CB  . THR B  1 32  ? 32.783  52.145  143.201 1.00 31.85  ? 32   THR B CB  1 
ATOM   1540  O OG1 . THR B  1 32  ? 32.616  52.983  142.038 1.00 28.90  ? 32   THR B OG1 1 
ATOM   1541  C CG2 . THR B  1 32  ? 31.509  52.065  143.972 1.00 25.10  ? 32   THR B CG2 1 
ATOM   1542  N N   . ALA B  1 33  ? 36.016  51.825  143.146 1.00 38.58  ? 33   ALA B N   1 
ATOM   1543  C CA  . ALA B  1 33  ? 37.221  51.891  142.344 1.00 38.75  ? 33   ALA B CA  1 
ATOM   1544  C C   . ALA B  1 33  ? 36.911  52.384  140.920 1.00 39.61  ? 33   ALA B C   1 
ATOM   1545  O O   . ALA B  1 33  ? 37.639  53.182  140.326 1.00 37.19  ? 33   ALA B O   1 
ATOM   1546  C CB  . ALA B  1 33  ? 37.827  50.514  142.272 1.00 39.20  ? 33   ALA B CB  1 
ATOM   1547  N N   . GLU B  1 34  ? 35.814  51.896  140.367 1.00 41.09  ? 34   GLU B N   1 
ATOM   1548  C CA  . GLU B  1 34  ? 35.500  52.274  139.005 1.00 43.13  ? 34   GLU B CA  1 
ATOM   1549  C C   . GLU B  1 34  ? 35.179  53.769  138.843 1.00 40.28  ? 34   GLU B C   1 
ATOM   1550  O O   . GLU B  1 34  ? 35.703  54.418  137.938 1.00 40.82  ? 34   GLU B O   1 
ATOM   1551  C CB  . GLU B  1 34  ? 34.371  51.380  138.465 1.00 48.49  ? 34   GLU B CB  1 
ATOM   1552  C CG  . GLU B  1 34  ? 34.432  51.175  136.945 1.00 56.47  ? 34   GLU B CG  1 
ATOM   1553  C CD  . GLU B  1 34  ? 33.077  50.765  136.315 1.00 61.89  ? 34   GLU B CD  1 
ATOM   1554  O OE1 . GLU B  1 34  ? 32.855  51.082  135.095 1.00 64.03  ? 34   GLU B OE1 1 
ATOM   1555  O OE2 . GLU B  1 34  ? 32.249  50.138  137.040 1.00 64.51  ? 34   GLU B OE2 1 
ATOM   1556  N N   . GLU B  1 35  ? 34.348  54.331  139.712 1.00 36.98  ? 35   GLU B N   1 
ATOM   1557  C CA  . GLU B  1 35  ? 34.032  55.762  139.593 1.00 34.43  ? 35   GLU B CA  1 
ATOM   1558  C C   . GLU B  1 35  ? 35.275  56.617  139.957 1.00 33.12  ? 35   GLU B C   1 
ATOM   1559  O O   . GLU B  1 35  ? 35.547  57.617  139.282 1.00 32.16  ? 35   GLU B O   1 
ATOM   1560  C CB  . GLU B  1 35  ? 32.845  56.149  140.484 1.00 32.59  ? 35   GLU B CB  1 
ATOM   1561  C CG  . GLU B  1 35  ? 32.365  57.569  140.249 1.00 31.58  ? 35   GLU B CG  1 
ATOM   1562  C CD  . GLU B  1 35  ? 31.130  58.001  141.093 1.00 33.00  ? 35   GLU B CD  1 
ATOM   1563  O OE1 . GLU B  1 35  ? 30.694  59.152  140.910 1.00 28.28  ? 35   GLU B OE1 1 
ATOM   1564  O OE2 . GLU B  1 35  ? 30.593  57.226  141.935 1.00 32.13  ? 35   GLU B OE2 1 
ATOM   1565  N N   . TYR B  1 36  ? 36.022  56.214  140.994 1.00 29.81  ? 36   TYR B N   1 
ATOM   1566  C CA  . TYR B  1 36  ? 37.246  56.915  141.382 1.00 28.79  ? 36   TYR B CA  1 
ATOM   1567  C C   . TYR B  1 36  ? 38.198  57.006  140.221 1.00 30.68  ? 36   TYR B C   1 
ATOM   1568  O O   . TYR B  1 36  ? 38.764  58.062  139.937 1.00 30.35  ? 36   TYR B O   1 
ATOM   1569  C CB  . TYR B  1 36  ? 37.984  56.197  142.528 1.00 26.62  ? 36   TYR B CB  1 
ATOM   1570  C CG  . TYR B  1 36  ? 39.432  56.567  142.569 1.00 25.63  ? 36   TYR B CG  1 
ATOM   1571  C CD1 . TYR B  1 36  ? 39.833  57.842  142.985 1.00 25.99  ? 36   TYR B CD1 1 
ATOM   1572  C CD2 . TYR B  1 36  ? 40.408  55.722  142.018 1.00 25.70  ? 36   TYR B CD2 1 
ATOM   1573  C CE1 . TYR B  1 36  ? 41.166  58.276  142.841 1.00 23.58  ? 36   TYR B CE1 1 
ATOM   1574  C CE2 . TYR B  1 36  ? 41.732  56.140  141.856 1.00 24.16  ? 36   TYR B CE2 1 
ATOM   1575  C CZ  . TYR B  1 36  ? 42.118  57.424  142.261 1.00 25.06  ? 36   TYR B CZ  1 
ATOM   1576  O OH  . TYR B  1 36  ? 43.431  57.852  141.976 1.00 23.29  ? 36   TYR B OH  1 
ATOM   1577  N N   . GLN B  1 37  ? 38.384  55.887  139.538 1.00 32.65  ? 37   GLN B N   1 
ATOM   1578  C CA  . GLN B  1 37  ? 39.316  55.852  138.426 1.00 34.42  ? 37   GLN B CA  1 
ATOM   1579  C C   . GLN B  1 37  ? 38.860  56.711  137.263 1.00 32.27  ? 37   GLN B C   1 
ATOM   1580  O O   . GLN B  1 37  ? 39.661  57.449  136.634 1.00 32.30  ? 37   GLN B O   1 
ATOM   1581  C CB  . GLN B  1 37  ? 39.523  54.422  137.957 1.00 38.90  ? 37   GLN B CB  1 
ATOM   1582  C CG  . GLN B  1 37  ? 40.646  54.324  136.984 1.00 48.36  ? 37   GLN B CG  1 
ATOM   1583  C CD  . GLN B  1 37  ? 40.580  53.060  136.150 1.00 54.36  ? 37   GLN B CD  1 
ATOM   1584  O OE1 . GLN B  1 37  ? 41.015  51.972  136.585 1.00 56.96  ? 37   GLN B OE1 1 
ATOM   1585  N NE2 . GLN B  1 37  ? 40.020  53.192  134.931 1.00 57.46  ? 37   GLN B NE2 1 
ATOM   1586  N N   . ALA B  1 38  ? 37.566  56.660  136.985 1.00 29.28  ? 38   ALA B N   1 
ATOM   1587  C CA  . ALA B  1 38  ? 37.063  57.438  135.855 1.00 28.46  ? 38   ALA B CA  1 
ATOM   1588  C C   . ALA B  1 38  ? 37.236  58.937  136.103 1.00 28.41  ? 38   ALA B C   1 
ATOM   1589  O O   . ALA B  1 38  ? 37.671  59.709  135.190 1.00 27.78  ? 38   ALA B O   1 
ATOM   1590  C CB  . ALA B  1 38  ? 35.609  57.118  135.577 1.00 26.89  ? 38   ALA B CB  1 
ATOM   1591  N N   . ILE B  1 39  ? 36.908  59.349  137.328 1.00 24.76  ? 39   ILE B N   1 
ATOM   1592  C CA  . ILE B  1 39  ? 37.037  60.730  137.687 1.00 24.42  ? 39   ILE B CA  1 
ATOM   1593  C C   . ILE B  1 39  ? 38.489  61.205  137.717 1.00 25.41  ? 39   ILE B C   1 
ATOM   1594  O O   . ILE B  1 39  ? 38.797  62.268  137.161 1.00 25.07  ? 39   ILE B O   1 
ATOM   1595  C CB  . ILE B  1 39  ? 36.318  60.989  139.025 1.00 25.03  ? 39   ILE B CB  1 
ATOM   1596  C CG1 . ILE B  1 39  ? 34.798  60.871  138.799 1.00 24.61  ? 39   ILE B CG1 1 
ATOM   1597  C CG2 . ILE B  1 39  ? 36.652  62.346  139.562 1.00 24.33  ? 39   ILE B CG2 1 
ATOM   1598  C CD1 . ILE B  1 39  ? 33.963  60.984  140.041 1.00 21.55  ? 39   ILE B CD1 1 
ATOM   1599  N N   . GLN B  1 40  ? 39.387  60.429  138.333 1.00 27.30  ? 40   GLN B N   1 
ATOM   1600  C CA  . GLN B  1 40  ? 40.797  60.822  138.389 1.00 28.57  ? 40   GLN B CA  1 
ATOM   1601  C C   . GLN B  1 40  ? 41.250  61.158  136.979 1.00 29.06  ? 40   GLN B C   1 
ATOM   1602  O O   . GLN B  1 40  ? 41.891  62.179  136.748 1.00 29.64  ? 40   GLN B O   1 
ATOM   1603  C CB  . GLN B  1 40  ? 41.691  59.693  138.889 1.00 30.95  ? 40   GLN B CB  1 
ATOM   1604  C CG  . GLN B  1 40  ? 42.403  59.905  140.210 1.00 36.45  ? 40   GLN B CG  1 
ATOM   1605  C CD  . GLN B  1 40  ? 43.307  61.103  140.255 1.00 38.81  ? 40   GLN B CD  1 
ATOM   1606  O OE1 . GLN B  1 40  ? 44.380  61.074  140.872 1.00 40.15  ? 40   GLN B OE1 1 
ATOM   1607  N NE2 . GLN B  1 40  ? 42.877  62.184  139.623 1.00 44.01  ? 40   GLN B NE2 1 
ATOM   1608  N N   . LYS B  1 41  ? 40.933  60.287  136.026 1.00 29.82  ? 41   LYS B N   1 
ATOM   1609  C CA  . LYS B  1 41  ? 41.359  60.542  134.651 1.00 31.08  ? 41   LYS B CA  1 
ATOM   1610  C C   . LYS B  1 41  ? 40.672  61.744  134.048 1.00 29.92  ? 41   LYS B C   1 
ATOM   1611  O O   . LYS B  1 41  ? 41.322  62.638  133.506 1.00 30.96  ? 41   LYS B O   1 
ATOM   1612  C CB  . LYS B  1 41  ? 41.113  59.330  133.756 1.00 32.18  ? 41   LYS B CB  1 
ATOM   1613  C CG  . LYS B  1 41  ? 42.070  58.197  134.010 1.00 38.51  ? 41   LYS B CG  1 
ATOM   1614  C CD  . LYS B  1 41  ? 41.612  56.883  133.358 1.00 41.42  ? 41   LYS B CD  1 
ATOM   1615  C CE  . LYS B  1 41  ? 42.553  55.705  133.738 1.00 44.37  ? 41   LYS B CE  1 
ATOM   1616  N NZ  . LYS B  1 41  ? 42.035  54.393  133.218 1.00 44.89  ? 41   LYS B NZ  1 
ATOM   1617  N N   . ALA B  1 42  ? 39.356  61.787  134.148 1.00 28.78  ? 42   ALA B N   1 
ATOM   1618  C CA  . ALA B  1 42  ? 38.652  62.898  133.554 1.00 28.29  ? 42   ALA B CA  1 
ATOM   1619  C C   . ALA B  1 42  ? 39.141  64.277  134.090 1.00 28.52  ? 42   ALA B C   1 
ATOM   1620  O O   . ALA B  1 42  ? 39.233  65.255  133.337 1.00 26.86  ? 42   ALA B O   1 
ATOM   1621  C CB  . ALA B  1 42  ? 37.164  62.722  133.779 1.00 26.80  ? 42   ALA B CB  1 
ATOM   1622  N N   . LEU B  1 43  ? 39.468  64.341  135.380 1.00 27.03  ? 43   LEU B N   1 
ATOM   1623  C CA  . LEU B  1 43  ? 39.891  65.601  135.967 1.00 26.34  ? 43   LEU B CA  1 
ATOM   1624  C C   . LEU B  1 43  ? 41.152  66.177  135.328 1.00 27.68  ? 43   LEU B C   1 
ATOM   1625  O O   . LEU B  1 43  ? 41.342  67.405  135.296 1.00 29.11  ? 43   LEU B O   1 
ATOM   1626  C CB  . LEU B  1 43  ? 40.058  65.444  137.503 1.00 21.69  ? 43   LEU B CB  1 
ATOM   1627  C CG  . LEU B  1 43  ? 38.718  65.376  138.256 1.00 21.78  ? 43   LEU B CG  1 
ATOM   1628  C CD1 . LEU B  1 43  ? 38.933  65.063  139.721 1.00 19.62  ? 43   LEU B CD1 1 
ATOM   1629  C CD2 . LEU B  1 43  ? 37.959  66.691  138.107 1.00 19.49  ? 43   LEU B CD2 1 
ATOM   1630  N N   . ARG B  1 44  ? 41.995  65.293  134.801 1.00 27.98  ? 44   ARG B N   1 
ATOM   1631  C CA  . ARG B  1 44  ? 43.252  65.695  134.182 1.00 27.37  ? 44   ARG B CA  1 
ATOM   1632  C C   . ARG B  1 44  ? 43.073  66.518  132.910 1.00 26.67  ? 44   ARG B C   1 
ATOM   1633  O O   . ARG B  1 44  ? 43.948  67.296  132.569 1.00 27.80  ? 44   ARG B O   1 
ATOM   1634  C CB  . ARG B  1 44  ? 44.139  64.455  133.871 1.00 27.00  ? 44   ARG B CB  1 
ATOM   1635  C CG  . ARG B  1 44  ? 44.607  63.687  135.120 1.00 27.88  ? 44   ARG B CG  1 
ATOM   1636  C CD  . ARG B  1 44  ? 45.760  62.772  134.895 1.00 22.34  ? 44   ARG B CD  1 
ATOM   1637  N NE  . ARG B  1 44  ? 45.316  61.398  134.810 1.00 25.13  ? 44   ARG B NE  1 
ATOM   1638  C CZ  . ARG B  1 44  ? 45.522  60.490  135.760 1.00 27.13  ? 44   ARG B CZ  1 
ATOM   1639  N NH1 . ARG B  1 44  ? 46.163  60.810  136.865 1.00 28.44  ? 44   ARG B NH1 1 
ATOM   1640  N NH2 . ARG B  1 44  ? 45.096  59.248  135.614 1.00 30.73  ? 44   ARG B NH2 1 
ATOM   1641  N N   . GLN B  1 45  ? 41.957  66.375  132.219 1.00 24.99  ? 45   GLN B N   1 
ATOM   1642  C CA  . GLN B  1 45  ? 41.794  67.109  130.969 1.00 27.13  ? 45   GLN B CA  1 
ATOM   1643  C C   . GLN B  1 45  ? 41.835  68.589  131.113 1.00 27.63  ? 45   GLN B C   1 
ATOM   1644  O O   . GLN B  1 45  ? 41.332  69.109  132.084 1.00 27.84  ? 45   GLN B O   1 
ATOM   1645  C CB  . GLN B  1 45  ? 40.484  66.776  130.287 1.00 27.17  ? 45   GLN B CB  1 
ATOM   1646  C CG  . GLN B  1 45  ? 40.197  65.303  130.173 1.00 33.50  ? 45   GLN B CG  1 
ATOM   1647  C CD  . GLN B  1 45  ? 38.748  64.995  129.759 1.00 34.83  ? 45   GLN B CD  1 
ATOM   1648  O OE1 . GLN B  1 45  ? 38.422  63.904  129.394 1.00 41.59  ? 45   GLN B OE1 1 
ATOM   1649  N NE2 . GLN B  1 45  ? 37.906  65.959  129.825 1.00 37.66  ? 45   GLN B NE2 1 
ATOM   1650  N N   . ARG B  1 46  ? 42.444  69.272  130.152 1.00 29.31  ? 46   ARG B N   1 
ATOM   1651  C CA  . ARG B  1 46  ? 42.468  70.731  130.180 1.00 32.10  ? 46   ARG B CA  1 
ATOM   1652  C C   . ARG B  1 46  ? 41.213  71.095  129.417 1.00 32.80  ? 46   ARG B C   1 
ATOM   1653  O O   . ARG B  1 46  ? 40.724  70.268  128.632 1.00 33.44  ? 46   ARG B O   1 
ATOM   1654  C CB  . ARG B  1 46  ? 43.646  71.283  129.408 1.00 34.38  ? 46   ARG B CB  1 
ATOM   1655  C CG  . ARG B  1 46  ? 44.939  70.658  129.723 1.00 40.86  ? 46   ARG B CG  1 
ATOM   1656  C CD  . ARG B  1 46  ? 45.921  71.661  130.281 1.00 43.29  ? 46   ARG B CD  1 
ATOM   1657  N NE  . ARG B  1 46  ? 47.253  71.067  130.341 1.00 47.63  ? 46   ARG B NE  1 
ATOM   1658  C CZ  . ARG B  1 46  ? 48.205  71.477  131.173 1.00 50.02  ? 46   ARG B CZ  1 
ATOM   1659  N NH1 . ARG B  1 46  ? 47.969  72.486  132.029 1.00 51.50  ? 46   ARG B NH1 1 
ATOM   1660  N NH2 . ARG B  1 46  ? 49.397  70.890  131.139 1.00 50.14  ? 46   ARG B NH2 1 
ATOM   1661  N N   . LEU B  1 47  ? 40.679  72.307  129.580 1.00 32.77  ? 47   LEU B N   1 
ATOM   1662  C CA  . LEU B  1 47  ? 39.461  72.560  128.820 1.00 33.42  ? 47   LEU B CA  1 
ATOM   1663  C C   . LEU B  1 47  ? 39.614  73.334  127.550 1.00 31.06  ? 47   LEU B C   1 
ATOM   1664  O O   . LEU B  1 47  ? 40.443  74.226  127.438 1.00 29.25  ? 47   LEU B O   1 
ATOM   1665  C CB  . LEU B  1 47  ? 38.324  73.165  129.676 1.00 35.75  ? 47   LEU B CB  1 
ATOM   1666  C CG  . LEU B  1 47  ? 38.434  73.772  131.069 1.00 38.84  ? 47   LEU B CG  1 
ATOM   1667  C CD1 . LEU B  1 47  ? 37.106  73.688  131.712 1.00 38.32  ? 47   LEU B CD1 1 
ATOM   1668  C CD2 . LEU B  1 47  ? 39.387  73.008  131.934 1.00 42.75  ? 47   LEU B CD2 1 
ATOM   1669  N N   . GLY B  1 48  ? 38.801  72.949  126.579 1.00 29.92  ? 48   GLY B N   1 
ATOM   1670  C CA  . GLY B  1 48  ? 38.829  73.607  125.297 1.00 31.25  ? 48   GLY B CA  1 
ATOM   1671  C C   . GLY B  1 48  ? 38.437  75.072  125.285 1.00 32.09  ? 48   GLY B C   1 
ATOM   1672  O O   . GLY B  1 48  ? 37.972  75.648  126.278 1.00 32.20  ? 48   GLY B O   1 
ATOM   1673  N N   . PRO B  1 49  ? 38.604  75.718  124.127 1.00 32.78  ? 49   PRO B N   1 
ATOM   1674  C CA  . PRO B  1 49  ? 38.279  77.142  123.941 1.00 32.19  ? 49   PRO B CA  1 
ATOM   1675  C C   . PRO B  1 49  ? 36.816  77.436  124.232 1.00 32.75  ? 49   PRO B C   1 
ATOM   1676  O O   . PRO B  1 49  ? 36.460  78.581  124.547 1.00 32.51  ? 49   PRO B O   1 
ATOM   1677  C CB  . PRO B  1 49  ? 38.580  77.381  122.481 1.00 31.30  ? 49   PRO B CB  1 
ATOM   1678  C CG  . PRO B  1 49  ? 39.539  76.325  122.167 1.00 34.46  ? 49   PRO B CG  1 
ATOM   1679  C CD  . PRO B  1 49  ? 39.070  75.119  122.875 1.00 31.56  ? 49   PRO B CD  1 
ATOM   1680  N N   . GLU B  1 50  ? 35.968  76.417  124.110 1.00 31.30  ? 50   GLU B N   1 
ATOM   1681  C CA  . GLU B  1 50  ? 34.570  76.658  124.336 1.00 33.12  ? 50   GLU B CA  1 
ATOM   1682  C C   . GLU B  1 50  ? 34.206  77.009  125.770 1.00 32.21  ? 50   GLU B C   1 
ATOM   1683  O O   . GLU B  1 50  ? 33.114  77.493  126.024 1.00 31.70  ? 50   GLU B O   1 
ATOM   1684  C CB  . GLU B  1 50  ? 33.689  75.504  123.798 1.00 34.29  ? 50   GLU B CB  1 
ATOM   1685  C CG  . GLU B  1 50  ? 34.215  74.121  123.906 1.00 39.09  ? 50   GLU B CG  1 
ATOM   1686  C CD  . GLU B  1 50  ? 35.281  73.800  122.875 1.00 40.12  ? 50   GLU B CD  1 
ATOM   1687  O OE1 . GLU B  1 50  ? 36.456  74.124  123.107 1.00 43.61  ? 50   GLU B OE1 1 
ATOM   1688  O OE2 . GLU B  1 50  ? 34.950  73.223  121.831 1.00 40.26  ? 50   GLU B OE2 1 
ATOM   1689  N N   . TYR B  1 51  ? 35.143  76.824  126.689 1.00 31.66  ? 51   TYR B N   1 
ATOM   1690  C CA  . TYR B  1 51  ? 34.927  77.122  128.098 1.00 30.37  ? 51   TYR B CA  1 
ATOM   1691  C C   . TYR B  1 51  ? 35.481  78.487  128.524 1.00 32.49  ? 51   TYR B C   1 
ATOM   1692  O O   . TYR B  1 51  ? 34.962  79.143  129.460 1.00 33.02  ? 51   TYR B O   1 
ATOM   1693  C CB  . TYR B  1 51  ? 35.626  76.076  128.945 1.00 26.71  ? 51   TYR B CB  1 
ATOM   1694  C CG  . TYR B  1 51  ? 34.926  74.765  128.976 1.00 24.58  ? 51   TYR B CG  1 
ATOM   1695  C CD1 . TYR B  1 51  ? 35.333  73.695  128.193 1.00 23.38  ? 51   TYR B CD1 1 
ATOM   1696  C CD2 . TYR B  1 51  ? 33.799  74.613  129.753 1.00 25.05  ? 51   TYR B CD2 1 
ATOM   1697  C CE1 . TYR B  1 51  ? 34.610  72.508  128.185 1.00 22.28  ? 51   TYR B CE1 1 
ATOM   1698  C CE2 . TYR B  1 51  ? 33.075  73.451  129.760 1.00 24.22  ? 51   TYR B CE2 1 
ATOM   1699  C CZ  . TYR B  1 51  ? 33.464  72.410  128.986 1.00 23.04  ? 51   TYR B CZ  1 
ATOM   1700  O OH  . TYR B  1 51  ? 32.628  71.338  129.074 1.00 23.78  ? 51   TYR B OH  1 
ATOM   1701  N N   . ILE B  1 52  ? 36.537  78.922  127.841 1.00 33.22  ? 52   ILE B N   1 
ATOM   1702  C CA  . ILE B  1 52  ? 37.223  80.145  128.232 1.00 33.42  ? 52   ILE B CA  1 
ATOM   1703  C C   . ILE B  1 52  ? 36.680  81.425  127.688 1.00 35.34  ? 52   ILE B C   1 
ATOM   1704  O O   . ILE B  1 52  ? 36.315  81.523  126.526 1.00 36.69  ? 52   ILE B O   1 
ATOM   1705  C CB  . ILE B  1 52  ? 38.696  80.053  127.857 1.00 31.84  ? 52   ILE B CB  1 
ATOM   1706  C CG1 . ILE B  1 52  ? 39.219  78.637  128.191 1.00 32.13  ? 52   ILE B CG1 1 
ATOM   1707  C CG2 . ILE B  1 52  ? 39.480  81.187  128.509 1.00 31.12  ? 52   ILE B CG2 1 
ATOM   1708  C CD1 . ILE B  1 52  ? 39.046  78.181  129.611 1.00 27.97  ? 52   ILE B CD1 1 
ATOM   1709  N N   . SER B  1 53  ? 36.577  82.416  128.544 1.00 36.98  ? 53   SER B N   1 
ATOM   1710  C CA  . SER B  1 53  ? 36.135  83.704  128.071 1.00 40.68  ? 53   SER B CA  1 
ATOM   1711  C C   . SER B  1 53  ? 37.107  84.739  128.611 1.00 43.22  ? 53   SER B C   1 
ATOM   1712  O O   . SER B  1 53  ? 38.001  84.401  129.393 1.00 42.56  ? 53   SER B O   1 
ATOM   1713  C CB  . SER B  1 53  ? 34.674  83.996  128.445 1.00 39.46  ? 53   SER B CB  1 
ATOM   1714  O OG  . SER B  1 53  ? 34.381  83.662  129.750 1.00 40.87  ? 53   SER B OG  1 
ATOM   1715  N N   . SER B  1 54  ? 36.982  85.989  128.189 1.00 47.62  ? 54   SER B N   1 
ATOM   1716  C CA  . SER B  1 54  ? 37.949  86.971  128.665 1.00 53.10  ? 54   SER B CA  1 
ATOM   1717  C C   . SER B  1 54  ? 37.399  88.354  128.793 1.00 56.82  ? 54   SER B C   1 
ATOM   1718  O O   . SER B  1 54  ? 36.350  88.648  128.236 1.00 57.59  ? 54   SER B O   1 
ATOM   1719  C CB  . SER B  1 54  ? 39.166  87.002  127.744 1.00 52.67  ? 54   SER B CB  1 
ATOM   1720  O OG  . SER B  1 54  ? 38.787  87.247  126.398 1.00 51.86  ? 54   SER B OG  1 
ATOM   1721  N N   . ARG B  1 55  ? 38.107  89.194  129.546 1.00 61.65  ? 55   ARG B N   1 
ATOM   1722  C CA  . ARG B  1 55  ? 37.689  90.575  129.753 1.00 66.89  ? 55   ARG B CA  1 
ATOM   1723  C C   . ARG B  1 55  ? 38.928  91.424  129.771 1.00 70.35  ? 55   ARG B C   1 
ATOM   1724  O O   . ARG B  1 55  ? 40.046  90.897  129.790 1.00 70.13  ? 55   ARG B O   1 
ATOM   1725  C CB  . ARG B  1 55  ? 36.925  90.752  131.085 1.00 67.36  ? 55   ARG B CB  1 
ATOM   1726  C CG  . ARG B  1 55  ? 37.718  90.372  132.318 1.00 69.81  ? 55   ARG B CG  1 
ATOM   1727  C CD  . ARG B  1 55  ? 37.113  90.917  133.610 1.00 71.64  ? 55   ARG B CD  1 
ATOM   1728  N NE  . ARG B  1 55  ? 37.741  90.332  134.803 1.00 74.73  ? 55   ARG B NE  1 
ATOM   1729  C CZ  . ARG B  1 55  ? 37.462  89.116  135.296 1.00 76.81  ? 55   ARG B CZ  1 
ATOM   1730  N NH1 . ARG B  1 55  ? 36.556  88.329  134.719 1.00 77.57  ? 55   ARG B NH1 1 
ATOM   1731  N NH2 . ARG B  1 55  ? 38.100  88.666  136.368 1.00 77.53  ? 55   ARG B NH2 1 
ATOM   1732  N N   . MET B  1 56  ? 38.720  92.742  129.760 1.00 75.38  ? 56   MET B N   1 
ATOM   1733  C CA  . MET B  1 56  ? 39.820  93.697  129.795 1.00 79.53  ? 56   MET B CA  1 
ATOM   1734  C C   . MET B  1 56  ? 40.131  94.182  131.201 1.00 81.81  ? 56   MET B C   1 
ATOM   1735  O O   . MET B  1 56  ? 39.283  94.785  131.868 1.00 81.44  ? 56   MET B O   1 
ATOM   1736  C CB  . MET B  1 56  ? 39.531  94.902  128.902 1.00 80.88  ? 56   MET B CB  1 
ATOM   1737  C CG  . MET B  1 56  ? 40.036  94.735  127.475 1.00 83.41  ? 56   MET B CG  1 
ATOM   1738  S SD  . MET B  1 56  ? 41.791  94.228  127.405 1.00 87.19  ? 56   MET B SD  1 
ATOM   1739  C CE  . MET B  1 56  ? 41.626  92.484  126.776 1.00 86.27  ? 56   MET B CE  1 
ATOM   1740  N N   . ALA B  1 57  ? 41.356  93.897  131.644 1.00 84.54  ? 57   ALA B N   1 
ATOM   1741  C CA  . ALA B  1 57  ? 41.815  94.320  132.962 1.00 86.98  ? 57   ALA B CA  1 
ATOM   1742  C C   . ALA B  1 57  ? 42.103  95.821  132.865 1.00 88.70  ? 57   ALA B C   1 
ATOM   1743  O O   . ALA B  1 57  ? 42.243  96.366  131.756 1.00 88.74  ? 57   ALA B O   1 
ATOM   1744  C CB  . ALA B  1 57  ? 43.090  93.562  133.360 1.00 87.14  ? 57   ALA B CB  1 
ATOM   1745  N N   . GLY B  1 58  ? 42.188  96.478  134.023 1.00 90.10  ? 58   GLY B N   1 
ATOM   1746  C CA  . GLY B  1 58  ? 42.456  97.903  134.053 1.00 90.40  ? 58   GLY B CA  1 
ATOM   1747  C C   . GLY B  1 58  ? 43.747  98.219  133.322 1.00 90.92  ? 58   GLY B C   1 
ATOM   1748  O O   . GLY B  1 58  ? 43.836  99.246  132.633 1.00 91.34  ? 58   GLY B O   1 
ATOM   1749  N N   . GLY B  1 59  ? 44.740  97.336  133.458 1.00 90.35  ? 59   GLY B N   1 
ATOM   1750  C CA  . GLY B  1 59  ? 46.020  97.552  132.805 1.00 89.92  ? 59   GLY B CA  1 
ATOM   1751  C C   . GLY B  1 59  ? 45.949  97.349  131.304 1.00 89.97  ? 59   GLY B C   1 
ATOM   1752  O O   . GLY B  1 59  ? 46.973  97.153  130.641 1.00 89.90  ? 59   GLY B O   1 
ATOM   1753  N N   . GLY B  1 60  ? 44.732  97.406  130.766 1.00 89.87  ? 60   GLY B N   1 
ATOM   1754  C CA  . GLY B  1 60  ? 44.534  97.203  129.339 1.00 89.24  ? 60   GLY B CA  1 
ATOM   1755  C C   . GLY B  1 60  ? 45.070  95.838  128.942 1.00 88.47  ? 60   GLY B C   1 
ATOM   1756  O O   . GLY B  1 60  ? 45.681  95.679  127.877 1.00 88.62  ? 60   GLY B O   1 
ATOM   1757  N N   . GLN B  1 61  ? 44.841  94.848  129.803 1.00 86.89  ? 61   GLN B N   1 
ATOM   1758  C CA  . GLN B  1 61  ? 45.338  93.506  129.539 1.00 84.93  ? 61   GLN B CA  1 
ATOM   1759  C C   . GLN B  1 61  ? 44.290  92.414  129.703 1.00 81.58  ? 61   GLN B C   1 
ATOM   1760  O O   . GLN B  1 61  ? 43.500  92.418  130.656 1.00 81.33  ? 61   GLN B O   1 
ATOM   1761  C CB  . GLN B  1 61  ? 46.522  93.214  130.451 1.00 87.12  ? 61   GLN B CB  1 
ATOM   1762  C CG  . GLN B  1 61  ? 46.210  93.482  131.904 1.00 89.60  ? 61   GLN B CG  1 
ATOM   1763  C CD  . GLN B  1 61  ? 47.345  93.067  132.807 1.00 92.03  ? 61   GLN B CD  1 
ATOM   1764  O OE1 . GLN B  1 61  ? 47.225  93.131  134.037 1.00 93.25  ? 61   GLN B OE1 1 
ATOM   1765  N NE2 . GLN B  1 61  ? 48.467  92.631  132.204 1.00 92.69  ? 61   GLN B NE2 1 
ATOM   1766  N N   . LYS B  1 62  ? 44.320  91.476  128.757 1.00 77.03  ? 62   LYS B N   1 
ATOM   1767  C CA  . LYS B  1 62  ? 43.406  90.343  128.710 1.00 71.95  ? 62   LYS B CA  1 
ATOM   1768  C C   . LYS B  1 62  ? 43.447  89.468  129.980 1.00 68.01  ? 62   LYS B C   1 
ATOM   1769  O O   . LYS B  1 62  ? 44.511  89.157  130.522 1.00 66.96  ? 62   LYS B O   1 
ATOM   1770  C CB  . LYS B  1 62  ? 43.735  89.493  127.481 1.00 71.24  ? 62   LYS B CB  1 
ATOM   1771  C CG  . LYS B  1 62  ? 42.625  88.600  127.007 1.00 71.67  ? 62   LYS B CG  1 
ATOM   1772  C CD  . LYS B  1 62  ? 43.125  87.710  125.884 1.00 72.27  ? 62   LYS B CD  1 
ATOM   1773  C CE  . LYS B  1 62  ? 42.043  86.804  125.344 1.00 73.06  ? 62   LYS B CE  1 
ATOM   1774  N NZ  . LYS B  1 62  ? 42.620  85.764  124.444 1.00 74.98  ? 62   LYS B NZ  1 
ATOM   1775  N N   . VAL B  1 63  ? 42.266  89.092  130.451 1.00 63.17  ? 63   VAL B N   1 
ATOM   1776  C CA  . VAL B  1 63  ? 42.147  88.234  131.614 1.00 58.11  ? 63   VAL B CA  1 
ATOM   1777  C C   . VAL B  1 63  ? 41.181  87.124  131.260 1.00 53.81  ? 63   VAL B C   1 
ATOM   1778  O O   . VAL B  1 63  ? 40.026  87.369  130.915 1.00 52.02  ? 63   VAL B O   1 
ATOM   1779  C CB  . VAL B  1 63  ? 41.604  88.993  132.808 1.00 59.11  ? 63   VAL B CB  1 
ATOM   1780  C CG1 . VAL B  1 63  ? 41.343  88.044  133.958 1.00 58.40  ? 63   VAL B CG1 1 
ATOM   1781  C CG2 . VAL B  1 63  ? 42.597  90.065  133.205 1.00 60.38  ? 63   VAL B CG2 1 
ATOM   1782  N N   . CYS B  1 64  ? 41.681  85.902  131.316 1.00 49.42  ? 64   CYS B N   1 
ATOM   1783  C CA  . CYS B  1 64  ? 40.872  84.742  131.017 1.00 44.75  ? 64   CYS B CA  1 
ATOM   1784  C C   . CYS B  1 64  ? 40.188  84.185  132.262 1.00 41.20  ? 64   CYS B C   1 
ATOM   1785  O O   . CYS B  1 64  ? 40.710  84.220  133.383 1.00 37.70  ? 64   CYS B O   1 
ATOM   1786  C CB  . CYS B  1 64  ? 41.738  83.658  130.395 1.00 46.25  ? 64   CYS B CB  1 
ATOM   1787  S SG  . CYS B  1 64  ? 42.334  84.019  128.716 1.00 48.41  ? 64   CYS B SG  1 
ATOM   1788  N N   . TYR B  1 65  ? 38.990  83.666  132.055 1.00 38.92  ? 65   TYR B N   1 
ATOM   1789  C CA  . TYR B  1 65  ? 38.244  83.091  133.154 1.00 34.75  ? 65   TYR B CA  1 
ATOM   1790  C C   . TYR B  1 65  ? 37.155  82.215  132.622 1.00 32.46  ? 65   TYR B C   1 
ATOM   1791  O O   . TYR B  1 65  ? 36.856  82.259  131.432 1.00 29.38  ? 65   TYR B O   1 
ATOM   1792  C CB  . TYR B  1 65  ? 37.645  84.212  133.988 1.00 34.07  ? 65   TYR B CB  1 
ATOM   1793  C CG  . TYR B  1 65  ? 36.554  84.961  133.291 1.00 33.90  ? 65   TYR B CG  1 
ATOM   1794  C CD1 . TYR B  1 65  ? 35.214  84.621  133.501 1.00 33.69  ? 65   TYR B CD1 1 
ATOM   1795  C CD2 . TYR B  1 65  ? 36.846  86.027  132.423 1.00 34.17  ? 65   TYR B CD2 1 
ATOM   1796  C CE1 . TYR B  1 65  ? 34.179  85.324  132.870 1.00 33.78  ? 65   TYR B CE1 1 
ATOM   1797  C CE2 . TYR B  1 65  ? 35.809  86.750  131.781 1.00 34.02  ? 65   TYR B CE2 1 
ATOM   1798  C CZ  . TYR B  1 65  ? 34.480  86.384  132.015 1.00 35.58  ? 65   TYR B CZ  1 
ATOM   1799  O OH  . TYR B  1 65  ? 33.433  87.037  131.397 1.00 37.36  ? 65   TYR B OH  1 
ATOM   1800  N N   . ILE B  1 66  ? 36.572  81.411  133.513 1.00 31.74  ? 66   ILE B N   1 
ATOM   1801  C CA  . ILE B  1 66  ? 35.457  80.548  133.138 1.00 29.86  ? 66   ILE B CA  1 
ATOM   1802  C C   . ILE B  1 66  ? 34.194  81.086  133.783 1.00 30.35  ? 66   ILE B C   1 
ATOM   1803  O O   . ILE B  1 66  ? 34.201  81.473  134.949 1.00 30.57  ? 66   ILE B O   1 
ATOM   1804  C CB  . ILE B  1 66  ? 35.680  79.129  133.607 1.00 28.66  ? 66   ILE B CB  1 
ATOM   1805  C CG1 . ILE B  1 66  ? 37.091  78.679  133.193 1.00 26.24  ? 66   ILE B CG1 1 
ATOM   1806  C CG2 . ILE B  1 66  ? 34.538  78.215  133.037 1.00 27.99  ? 66   ILE B CG2 1 
ATOM   1807  C CD1 . ILE B  1 66  ? 37.587  77.366  133.808 1.00 21.29  ? 66   ILE B CD1 1 
ATOM   1808  N N   . GLU B  1 67  ? 33.099  81.115  133.042 1.00 30.47  ? 67   GLU B N   1 
ATOM   1809  C CA  . GLU B  1 67  ? 31.885  81.639  133.641 1.00 30.64  ? 67   GLU B CA  1 
ATOM   1810  C C   . GLU B  1 67  ? 31.278  80.637  134.632 1.00 29.55  ? 67   GLU B C   1 
ATOM   1811  O O   . GLU B  1 67  ? 31.306  79.416  134.417 1.00 29.34  ? 67   GLU B O   1 
ATOM   1812  C CB  . GLU B  1 67  ? 30.886  82.025  132.560 1.00 32.69  ? 67   GLU B CB  1 
ATOM   1813  C CG  . GLU B  1 67  ? 31.320  83.223  131.771 1.00 37.11  ? 67   GLU B CG  1 
ATOM   1814  C CD  . GLU B  1 67  ? 30.375  83.532  130.604 1.00 42.35  ? 67   GLU B CD  1 
ATOM   1815  O OE1 . GLU B  1 67  ? 30.131  82.669  129.716 1.00 43.41  ? 67   GLU B OE1 1 
ATOM   1816  O OE2 . GLU B  1 67  ? 29.853  84.666  130.565 1.00 47.77  ? 67   GLU B OE2 1 
ATOM   1817  N N   . GLY B  1 68  ? 30.724  81.175  135.715 1.00 27.64  ? 68   GLY B N   1 
ATOM   1818  C CA  . GLY B  1 68  ? 30.156  80.348  136.744 1.00 25.06  ? 68   GLY B CA  1 
ATOM   1819  C C   . GLY B  1 68  ? 29.238  79.243  136.249 1.00 24.36  ? 68   GLY B C   1 
ATOM   1820  O O   . GLY B  1 68  ? 29.318  78.105  136.693 1.00 24.50  ? 68   GLY B O   1 
ATOM   1821  N N   . HIS B  1 69  ? 28.362  79.554  135.318 1.00 21.95  ? 69   HIS B N   1 
ATOM   1822  C CA  . HIS B  1 69  ? 27.441  78.542  134.924 1.00 22.39  ? 69   HIS B CA  1 
ATOM   1823  C C   . HIS B  1 69  ? 28.152  77.369  134.219 1.00 23.90  ? 69   HIS B C   1 
ATOM   1824  O O   . HIS B  1 69  ? 27.695  76.212  134.279 1.00 23.23  ? 69   HIS B O   1 
ATOM   1825  C CB  . HIS B  1 69  ? 26.304  79.159  134.084 1.00 21.08  ? 69   HIS B CB  1 
ATOM   1826  C CG  . HIS B  1 69  ? 26.711  79.575  132.709 1.00 20.90  ? 69   HIS B CG  1 
ATOM   1827  N ND1 . HIS B  1 69  ? 27.288  80.796  132.439 1.00 22.57  ? 69   HIS B ND1 1 
ATOM   1828  C CD2 . HIS B  1 69  ? 26.649  78.918  131.526 1.00 20.53  ? 69   HIS B CD2 1 
ATOM   1829  C CE1 . HIS B  1 69  ? 27.561  80.880  131.147 1.00 21.62  ? 69   HIS B CE1 1 
ATOM   1830  N NE2 . HIS B  1 69  ? 27.182  79.751  130.570 1.00 21.41  ? 69   HIS B NE2 1 
ATOM   1831  N N   . ARG B  1 70  ? 29.285  77.639  133.589 1.00 22.09  ? 70   ARG B N   1 
ATOM   1832  C CA  . ARG B  1 70  ? 29.970  76.563  132.939 1.00 23.84  ? 70   ARG B CA  1 
ATOM   1833  C C   . ARG B  1 70  ? 30.584  75.678  134.021 1.00 23.99  ? 70   ARG B C   1 
ATOM   1834  O O   . ARG B  1 70  ? 30.580  74.442  133.911 1.00 26.11  ? 70   ARG B O   1 
ATOM   1835  C CB  . ARG B  1 70  ? 31.077  77.084  132.033 1.00 26.41  ? 70   ARG B CB  1 
ATOM   1836  C CG  . ARG B  1 70  ? 30.601  77.918  130.883 1.00 30.77  ? 70   ARG B CG  1 
ATOM   1837  C CD  . ARG B  1 70  ? 30.969  77.315  129.489 1.00 37.24  ? 70   ARG B CD  1 
ATOM   1838  N NE  . ARG B  1 70  ? 30.242  78.040  128.443 1.00 39.29  ? 70   ARG B NE  1 
ATOM   1839  C CZ  . ARG B  1 70  ? 30.397  79.333  128.273 1.00 38.36  ? 70   ARG B CZ  1 
ATOM   1840  N NH1 . ARG B  1 70  ? 31.260  79.947  129.060 1.00 39.34  ? 70   ARG B NH1 1 
ATOM   1841  N NH2 . ARG B  1 70  ? 29.655  80.002  127.402 1.00 39.01  ? 70   ARG B NH2 1 
ATOM   1842  N N   . VAL B  1 71  ? 31.125  76.307  135.061 1.00 21.77  ? 71   VAL B N   1 
ATOM   1843  C CA  . VAL B  1 71  ? 31.764  75.560  136.131 1.00 21.13  ? 71   VAL B CA  1 
ATOM   1844  C C   . VAL B  1 71  ? 30.745  74.684  136.855 1.00 21.01  ? 71   VAL B C   1 
ATOM   1845  O O   . VAL B  1 71  ? 31.023  73.512  137.162 1.00 20.25  ? 71   VAL B O   1 
ATOM   1846  C CB  . VAL B  1 71  ? 32.450  76.509  137.128 1.00 20.89  ? 71   VAL B CB  1 
ATOM   1847  C CG1 . VAL B  1 71  ? 32.958  75.733  138.333 1.00 18.22  ? 71   VAL B CG1 1 
ATOM   1848  C CG2 . VAL B  1 71  ? 33.643  77.212  136.411 1.00 20.45  ? 71   VAL B CG2 1 
ATOM   1849  N N   . ILE B  1 72  ? 29.559  75.235  137.101 1.00 19.58  ? 72   ILE B N   1 
ATOM   1850  C CA  . ILE B  1 72  ? 28.513  74.473  137.771 1.00 19.90  ? 72   ILE B CA  1 
ATOM   1851  C C   . ILE B  1 72  ? 28.177  73.249  136.939 1.00 20.09  ? 72   ILE B C   1 
ATOM   1852  O O   . ILE B  1 72  ? 28.103  72.147  137.471 1.00 20.13  ? 72   ILE B O   1 
ATOM   1853  C CB  . ILE B  1 72  ? 27.263  75.334  138.030 1.00 19.37  ? 72   ILE B CB  1 
ATOM   1854  C CG1 . ILE B  1 72  ? 27.533  76.246  139.215 1.00 18.22  ? 72   ILE B CG1 1 
ATOM   1855  C CG2 . ILE B  1 72  ? 26.071  74.479  138.309 1.00 15.86  ? 72   ILE B CG2 1 
ATOM   1856  C CD1 . ILE B  1 72  ? 26.540  77.400  139.247 1.00 23.69  ? 72   ILE B CD1 1 
ATOM   1857  N N   . ASN B  1 73  ? 28.013  73.419  135.627 1.00 20.65  ? 73   ASN B N   1 
ATOM   1858  C CA  . ASN B  1 73  ? 27.732  72.234  134.787 1.00 21.55  ? 73   ASN B CA  1 
ATOM   1859  C C   . ASN B  1 73  ? 28.918  71.242  134.699 1.00 21.14  ? 73   ASN B C   1 
ATOM   1860  O O   . ASN B  1 73  ? 28.720  70.035  134.611 1.00 21.40  ? 73   ASN B O   1 
ATOM   1861  C CB  . ASN B  1 73  ? 27.275  72.643  133.396 1.00 19.41  ? 73   ASN B CB  1 
ATOM   1862  C CG  . ASN B  1 73  ? 25.842  73.136  133.400 1.00 20.85  ? 73   ASN B CG  1 
ATOM   1863  O OD1 . ASN B  1 73  ? 25.058  72.810  134.294 1.00 21.55  ? 73   ASN B OD1 1 
ATOM   1864  N ND2 . ASN B  1 73  ? 25.492  73.916  132.410 1.00 21.61  ? 73   ASN B ND2 1 
ATOM   1865  N N   . LEU B  1 74  ? 30.148  71.745  134.718 1.00 20.26  ? 74   LEU B N   1 
ATOM   1866  C CA  . LEU B  1 74  ? 31.260  70.852  134.684 1.00 19.35  ? 74   LEU B CA  1 
ATOM   1867  C C   . LEU B  1 74  ? 31.146  70.005  135.955 1.00 20.27  ? 74   LEU B C   1 
ATOM   1868  O O   . LEU B  1 74  ? 31.201  68.772  135.898 1.00 21.44  ? 74   LEU B O   1 
ATOM   1869  C CB  . LEU B  1 74  ? 32.562  71.631  134.703 1.00 19.67  ? 74   LEU B CB  1 
ATOM   1870  C CG  . LEU B  1 74  ? 33.087  72.129  133.353 1.00 19.14  ? 74   LEU B CG  1 
ATOM   1871  C CD1 . LEU B  1 74  ? 34.120  73.237  133.599 1.00 15.70  ? 74   LEU B CD1 1 
ATOM   1872  C CD2 . LEU B  1 74  ? 33.683  70.985  132.573 1.00 15.65  ? 74   LEU B CD2 1 
ATOM   1873  N N   . ALA B  1 75  ? 30.949  70.656  137.096 1.00 20.41  ? 75   ALA B N   1 
ATOM   1874  C CA  . ALA B  1 75  ? 30.852  69.941  138.362 1.00 20.03  ? 75   ALA B CA  1 
ATOM   1875  C C   . ALA B  1 75  ? 29.692  68.913  138.393 1.00 20.06  ? 75   ALA B C   1 
ATOM   1876  O O   . ALA B  1 75  ? 29.846  67.763  138.821 1.00 18.66  ? 75   ALA B O   1 
ATOM   1877  C CB  . ALA B  1 75  ? 30.695  70.942  139.491 1.00 21.37  ? 75   ALA B CB  1 
ATOM   1878  N N   . ASN B  1 76  ? 28.534  69.335  137.946 1.00 18.34  ? 76   ASN B N   1 
ATOM   1879  C CA  . ASN B  1 76  ? 27.438  68.420  137.945 1.00 21.63  ? 76   ASN B CA  1 
ATOM   1880  C C   . ASN B  1 76  ? 27.710  67.189  137.078 1.00 20.14  ? 76   ASN B C   1 
ATOM   1881  O O   . ASN B  1 76  ? 27.360  66.065  137.455 1.00 18.87  ? 76   ASN B O   1 
ATOM   1882  C CB  . ASN B  1 76  ? 26.128  69.140  137.503 1.00 24.06  ? 76   ASN B CB  1 
ATOM   1883  C CG  . ASN B  1 76  ? 25.558  70.061  138.600 1.00 23.28  ? 76   ASN B CG  1 
ATOM   1884  O OD1 . ASN B  1 76  ? 25.614  69.733  139.784 1.00 26.04  ? 76   ASN B OD1 1 
ATOM   1885  N ND2 . ASN B  1 76  ? 25.006  71.176  138.211 1.00 22.63  ? 76   ASN B ND2 1 
ATOM   1886  N N   . GLU B  1 77  ? 28.338  67.391  135.928 1.00 20.41  ? 77   GLU B N   1 
ATOM   1887  C CA  . GLU B  1 77  ? 28.605  66.272  135.030 1.00 21.81  ? 77   GLU B CA  1 
ATOM   1888  C C   . GLU B  1 77  ? 29.775  65.416  135.526 1.00 23.04  ? 77   GLU B C   1 
ATOM   1889  O O   . GLU B  1 77  ? 29.822  64.196  135.312 1.00 22.59  ? 77   GLU B O   1 
ATOM   1890  C CB  . GLU B  1 77  ? 28.890  66.784  133.632 1.00 21.21  ? 77   GLU B CB  1 
ATOM   1891  C CG  . GLU B  1 77  ? 27.691  67.453  132.981 1.00 23.54  ? 77   GLU B CG  1 
ATOM   1892  C CD  . GLU B  1 77  ? 26.498  66.537  132.844 1.00 25.39  ? 77   GLU B CD  1 
ATOM   1893  O OE1 . GLU B  1 77  ? 25.372  67.056  132.712 1.00 28.55  ? 77   GLU B OE1 1 
ATOM   1894  O OE2 . GLU B  1 77  ? 26.680  65.305  132.876 1.00 26.51  ? 77   GLU B OE2 1 
ATOM   1895  N N   . MET B  1 78  ? 30.725  66.053  136.214 1.00 23.72  ? 78   MET B N   1 
ATOM   1896  C CA  . MET B  1 78  ? 31.873  65.317  136.746 1.00 22.70  ? 78   MET B CA  1 
ATOM   1897  C C   . MET B  1 78  ? 31.504  64.470  137.977 1.00 22.23  ? 78   MET B C   1 
ATOM   1898  O O   . MET B  1 78  ? 31.907  63.318  138.069 1.00 22.83  ? 78   MET B O   1 
ATOM   1899  C CB  . MET B  1 78  ? 32.988  66.300  137.111 1.00 23.33  ? 78   MET B CB  1 
ATOM   1900  C CG  . MET B  1 78  ? 34.289  65.656  137.464 1.00 23.55  ? 78   MET B CG  1 
ATOM   1901  S SD  . MET B  1 78  ? 35.046  64.660  136.141 1.00 28.49  ? 78   MET B SD  1 
ATOM   1902  C CE  . MET B  1 78  ? 35.600  65.918  134.971 1.00 22.84  ? 78   MET B CE  1 
ATOM   1903  N N   . PHE B  1 79  ? 30.727  65.029  138.910 1.00 20.18  ? 79   PHE B N   1 
ATOM   1904  C CA  . PHE B  1 79  ? 30.373  64.313  140.118 1.00 17.45  ? 79   PHE B CA  1 
ATOM   1905  C C   . PHE B  1 79  ? 28.923  63.907  140.294 1.00 16.80  ? 79   PHE B C   1 
ATOM   1906  O O   . PHE B  1 79  ? 28.611  63.184  141.261 1.00 16.14  ? 79   PHE B O   1 
ATOM   1907  C CB  . PHE B  1 79  ? 30.743  65.162  141.329 1.00 17.48  ? 79   PHE B CB  1 
ATOM   1908  C CG  . PHE B  1 79  ? 32.130  65.715  141.292 1.00 15.89  ? 79   PHE B CG  1 
ATOM   1909  C CD1 . PHE B  1 79  ? 33.235  64.886  141.443 1.00 15.69  ? 79   PHE B CD1 1 
ATOM   1910  C CD2 . PHE B  1 79  ? 32.341  67.089  141.147 1.00 15.92  ? 79   PHE B CD2 1 
ATOM   1911  C CE1 . PHE B  1 79  ? 34.518  65.419  141.456 1.00 15.56  ? 79   PHE B CE1 1 
ATOM   1912  C CE2 . PHE B  1 79  ? 33.612  67.630  141.153 1.00 12.48  ? 79   PHE B CE2 1 
ATOM   1913  C CZ  . PHE B  1 79  ? 34.698  66.812  141.306 1.00 15.91  ? 79   PHE B CZ  1 
ATOM   1914  N N   . GLY B  1 80  ? 28.033  64.349  139.411 1.00 14.52  ? 80   GLY B N   1 
ATOM   1915  C CA  . GLY B  1 80  ? 26.635  64.018  139.615 1.00 14.88  ? 80   GLY B CA  1 
ATOM   1916  C C   . GLY B  1 80  ? 25.994  65.164  140.383 1.00 16.66  ? 80   GLY B C   1 
ATOM   1917  O O   . GLY B  1 80  ? 26.658  65.824  141.148 1.00 18.58  ? 80   GLY B O   1 
ATOM   1918  N N   . TYR B  1 81  ? 24.712  65.420  140.179 1.00 18.72  ? 81   TYR B N   1 
ATOM   1919  C CA  . TYR B  1 81  ? 24.041  66.539  140.830 1.00 18.57  ? 81   TYR B CA  1 
ATOM   1920  C C   . TYR B  1 81  ? 24.076  66.319  142.297 1.00 20.91  ? 81   TYR B C   1 
ATOM   1921  O O   . TYR B  1 81  ? 24.033  67.275  143.094 1.00 22.72  ? 81   TYR B O   1 
ATOM   1922  C CB  . TYR B  1 81  ? 22.586  66.688  140.392 1.00 16.88  ? 81   TYR B CB  1 
ATOM   1923  C CG  . TYR B  1 81  ? 21.700  65.537  140.817 1.00 18.44  ? 81   TYR B CG  1 
ATOM   1924  C CD1 . TYR B  1 81  ? 21.576  64.373  140.035 1.00 16.93  ? 81   TYR B CD1 1 
ATOM   1925  C CD2 . TYR B  1 81  ? 20.992  65.605  142.001 1.00 18.99  ? 81   TYR B CD2 1 
ATOM   1926  C CE1 . TYR B  1 81  ? 20.769  63.315  140.438 1.00 16.26  ? 81   TYR B CE1 1 
ATOM   1927  C CE2 . TYR B  1 81  ? 20.177  64.568  142.408 1.00 20.13  ? 81   TYR B CE2 1 
ATOM   1928  C CZ  . TYR B  1 81  ? 20.071  63.417  141.623 1.00 20.26  ? 81   TYR B CZ  1 
ATOM   1929  O OH  . TYR B  1 81  ? 19.267  62.369  142.031 1.00 20.29  ? 81   TYR B OH  1 
ATOM   1930  N N   . ASN B  1 82  ? 24.205  65.068  142.681 1.00 22.32  ? 82   ASN B N   1 
ATOM   1931  C CA  . ASN B  1 82  ? 24.223  64.773  144.116 1.00 24.22  ? 82   ASN B CA  1 
ATOM   1932  C C   . ASN B  1 82  ? 25.614  64.353  144.587 1.00 23.54  ? 82   ASN B C   1 
ATOM   1933  O O   . ASN B  1 82  ? 25.743  63.742  145.638 1.00 23.60  ? 82   ASN B O   1 
ATOM   1934  C CB  . ASN B  1 82  ? 23.257  63.623  144.398 1.00 25.05  ? 82   ASN B CB  1 
ATOM   1935  C CG  . ASN B  1 82  ? 23.779  62.285  143.838 1.00 27.28  ? 82   ASN B CG  1 
ATOM   1936  O OD1 . ASN B  1 82  ? 23.393  61.212  144.284 1.00 30.57  ? 82   ASN B OD1 1 
ATOM   1937  N ND2 . ASN B  1 82  ? 24.652  62.358  142.852 1.00 25.82  ? 82   ASN B ND2 1 
ATOM   1938  N N   . GLY B  1 83  ? 26.655  64.647  143.811 1.00 23.29  ? 83   GLY B N   1 
ATOM   1939  C CA  . GLY B  1 83  ? 27.982  64.207  144.211 1.00 20.73  ? 83   GLY B CA  1 
ATOM   1940  C C   . GLY B  1 83  ? 28.878  65.291  144.755 1.00 20.36  ? 83   GLY B C   1 
ATOM   1941  O O   . GLY B  1 83  ? 29.999  64.975  145.208 1.00 22.40  ? 83   GLY B O   1 
ATOM   1942  N N   . TRP B  1 84  ? 28.437  66.548  144.687 1.00 16.58  ? 84   TRP B N   1 
ATOM   1943  C CA  . TRP B  1 84  ? 29.248  67.661  145.195 1.00 15.32  ? 84   TRP B CA  1 
ATOM   1944  C C   . TRP B  1 84  ? 28.306  68.679  145.826 1.00 14.56  ? 84   TRP B C   1 
ATOM   1945  O O   . TRP B  1 84  ? 27.102  68.710  145.531 1.00 12.12  ? 84   TRP B O   1 
ATOM   1946  C CB  . TRP B  1 84  ? 30.098  68.331  144.095 1.00 15.07  ? 84   TRP B CB  1 
ATOM   1947  C CG  . TRP B  1 84  ? 29.291  69.123  143.107 1.00 17.77  ? 84   TRP B CG  1 
ATOM   1948  C CD1 . TRP B  1 84  ? 28.525  68.630  142.093 1.00 19.92  ? 84   TRP B CD1 1 
ATOM   1949  C CD2 . TRP B  1 84  ? 29.126  70.547  143.079 1.00 17.83  ? 84   TRP B CD2 1 
ATOM   1950  N NE1 . TRP B  1 84  ? 27.892  69.660  141.432 1.00 20.80  ? 84   TRP B NE1 1 
ATOM   1951  C CE2 . TRP B  1 84  ? 28.246  70.845  142.018 1.00 18.24  ? 84   TRP B CE2 1 
ATOM   1952  C CE3 . TRP B  1 84  ? 29.649  71.607  143.847 1.00 16.61  ? 84   TRP B CE3 1 
ATOM   1953  C CZ2 . TRP B  1 84  ? 27.864  72.146  141.700 1.00 18.30  ? 84   TRP B CZ2 1 
ATOM   1954  C CZ3 . TRP B  1 84  ? 29.268  72.921  143.528 1.00 16.71  ? 84   TRP B CZ3 1 
ATOM   1955  C CH2 . TRP B  1 84  ? 28.385  73.171  142.462 1.00 18.43  ? 84   TRP B CH2 1 
ATOM   1956  N N   . ALA B  1 85  ? 28.856  69.466  146.743 1.00 12.94  ? 85   ALA B N   1 
ATOM   1957  C CA  . ALA B  1 85  ? 28.095  70.449  147.430 1.00 13.35  ? 85   ALA B CA  1 
ATOM   1958  C C   . ALA B  1 85  ? 28.974  71.620  147.775 1.00 15.15  ? 85   ALA B C   1 
ATOM   1959  O O   . ALA B  1 85  ? 30.201  71.512  147.724 1.00 12.95  ? 85   ALA B O   1 
ATOM   1960  C CB  . ALA B  1 85  ? 27.539  69.847  148.705 1.00 13.67  ? 85   ALA B CB  1 
ATOM   1961  N N   . HIS B  1 86  ? 28.346  72.746  148.128 1.00 17.12  ? 86   HIS B N   1 
ATOM   1962  C CA  . HIS B  1 86  ? 29.120  73.891  148.582 1.00 18.76  ? 86   HIS B CA  1 
ATOM   1963  C C   . HIS B  1 86  ? 28.335  74.757  149.566 1.00 18.10  ? 86   HIS B C   1 
ATOM   1964  O O   . HIS B  1 86  ? 27.092  74.830  149.507 1.00 18.21  ? 86   HIS B O   1 
ATOM   1965  C CB  . HIS B  1 86  ? 29.638  74.722  147.427 1.00 17.60  ? 86   HIS B CB  1 
ATOM   1966  C CG  . HIS B  1 86  ? 28.615  75.612  146.822 1.00 20.99  ? 86   HIS B CG  1 
ATOM   1967  N ND1 . HIS B  1 86  ? 27.588  75.133  146.027 1.00 20.28  ? 86   HIS B ND1 1 
ATOM   1968  C CD2 . HIS B  1 86  ? 28.481  76.966  146.864 1.00 19.93  ? 86   HIS B CD2 1 
ATOM   1969  C CE1 . HIS B  1 86  ? 26.870  76.161  145.602 1.00 22.04  ? 86   HIS B CE1 1 
ATOM   1970  N NE2 . HIS B  1 86  ? 27.390  77.282  146.094 1.00 21.61  ? 86   HIS B NE2 1 
ATOM   1971  N N   . SER B  1 87  ? 29.066  75.351  150.509 1.00 16.68  ? 87   SER B N   1 
ATOM   1972  C CA  . SER B  1 87  ? 28.465  76.221  151.495 1.00 15.87  ? 87   SER B CA  1 
ATOM   1973  C C   . SER B  1 87  ? 29.351  77.459  151.644 1.00 16.88  ? 87   SER B C   1 
ATOM   1974  O O   . SER B  1 87  ? 30.539  77.479  151.209 1.00 15.72  ? 87   SER B O   1 
ATOM   1975  C CB  . SER B  1 87  ? 28.306  75.507  152.837 1.00 13.60  ? 87   SER B CB  1 
ATOM   1976  O OG  . SER B  1 87  ? 29.564  75.198  153.387 1.00 15.71  ? 87   SER B OG  1 
ATOM   1977  N N   . ILE B  1 88  ? 28.759  78.521  152.201 1.00 17.00  ? 88   ILE B N   1 
ATOM   1978  C CA  . ILE B  1 88  ? 29.504  79.753  152.396 1.00 17.48  ? 88   ILE B CA  1 
ATOM   1979  C C   . ILE B  1 88  ? 29.905  79.761  153.864 1.00 19.77  ? 88   ILE B C   1 
ATOM   1980  O O   . ILE B  1 88  ? 29.053  79.943  154.752 1.00 21.15  ? 88   ILE B O   1 
ATOM   1981  C CB  . ILE B  1 88  ? 28.631  80.975  152.052 1.00 15.40  ? 88   ILE B CB  1 
ATOM   1982  C CG1 . ILE B  1 88  ? 28.341  80.983  150.547 1.00 12.00  ? 88   ILE B CG1 1 
ATOM   1983  C CG2 . ILE B  1 88  ? 29.337  82.260  152.521 1.00 14.97  ? 88   ILE B CG2 1 
ATOM   1984  C CD1 . ILE B  1 88  ? 27.091  81.736  150.169 1.00 11.81  ? 88   ILE B CD1 1 
ATOM   1985  N N   . THR B  1 89  ? 31.175  79.546  154.142 1.00 20.46  ? 89   THR B N   1 
ATOM   1986  C CA  . THR B  1 89  ? 31.559  79.541  155.532 1.00 26.27  ? 89   THR B CA  1 
ATOM   1987  C C   . THR B  1 89  ? 31.438  80.966  156.045 1.00 28.45  ? 89   THR B C   1 
ATOM   1988  O O   . THR B  1 89  ? 30.973  81.209  157.158 1.00 30.05  ? 89   THR B O   1 
ATOM   1989  C CB  . THR B  1 89  ? 32.959  78.948  155.747 1.00 26.30  ? 89   THR B CB  1 
ATOM   1990  O OG1 . THR B  1 89  ? 33.852  79.531  154.808 1.00 33.53  ? 89   THR B OG1 1 
ATOM   1991  C CG2 . THR B  1 89  ? 32.952  77.447  155.435 1.00 26.85  ? 89   THR B CG2 1 
ATOM   1992  N N   . GLN B  1 90  ? 31.777  81.933  155.214 1.00 30.26  ? 90   GLN B N   1 
ATOM   1993  C CA  . GLN B  1 90  ? 31.626  83.300  155.668 1.00 31.05  ? 90   GLN B CA  1 
ATOM   1994  C C   . GLN B  1 90  ? 31.706  84.318  154.547 1.00 28.61  ? 90   GLN B C   1 
ATOM   1995  O O   . GLN B  1 90  ? 32.399  84.088  153.567 1.00 30.26  ? 90   GLN B O   1 
ATOM   1996  C CB  . GLN B  1 90  ? 32.694  83.621  156.683 1.00 34.12  ? 90   GLN B CB  1 
ATOM   1997  C CG  . GLN B  1 90  ? 32.411  84.929  157.395 1.00 42.76  ? 90   GLN B CG  1 
ATOM   1998  C CD  . GLN B  1 90  ? 33.626  85.458  158.170 1.00 47.79  ? 90   GLN B CD  1 
ATOM   1999  O OE1 . GLN B  1 90  ? 34.170  84.771  159.051 1.00 51.13  ? 90   GLN B OE1 1 
ATOM   2000  N NE2 . GLN B  1 90  ? 34.059  86.688  157.840 1.00 49.72  ? 90   GLN B NE2 1 
ATOM   2001  N N   . GLN B  1 91  ? 30.989  85.427  154.672 1.00 24.70  ? 91   GLN B N   1 
ATOM   2002  C CA  . GLN B  1 91  ? 31.084  86.470  153.665 1.00 23.40  ? 91   GLN B CA  1 
ATOM   2003  C C   . GLN B  1 91  ? 31.307  87.750  154.398 1.00 23.05  ? 91   GLN B C   1 
ATOM   2004  O O   . GLN B  1 91  ? 30.538  88.104  155.284 1.00 22.33  ? 91   GLN B O   1 
ATOM   2005  C CB  . GLN B  1 91  ? 29.853  86.636  152.787 1.00 19.50  ? 91   GLN B CB  1 
ATOM   2006  C CG  . GLN B  1 91  ? 30.136  87.714  151.768 1.00 18.81  ? 91   GLN B CG  1 
ATOM   2007  C CD  . GLN B  1 91  ? 29.085  87.857  150.684 1.00 20.34  ? 91   GLN B CD  1 
ATOM   2008  O OE1 . GLN B  1 91  ? 27.950  88.310  150.939 1.00 21.63  ? 91   GLN B OE1 1 
ATOM   2009  N NE2 . GLN B  1 91  ? 29.455  87.472  149.450 1.00 19.42  ? 91   GLN B NE2 1 
ATOM   2010  N N   . ASN B  1 92  ? 32.345  88.466  154.015 1.00 24.03  ? 92   ASN B N   1 
ATOM   2011  C CA  . ASN B  1 92  ? 32.622  89.694  154.703 1.00 26.32  ? 92   ASN B CA  1 
ATOM   2012  C C   . ASN B  1 92  ? 32.749  90.915  153.782 1.00 24.83  ? 92   ASN B C   1 
ATOM   2013  O O   . ASN B  1 92  ? 33.508  90.898  152.800 1.00 26.22  ? 92   ASN B O   1 
ATOM   2014  C CB  . ASN B  1 92  ? 33.882  89.500  155.533 1.00 30.22  ? 92   ASN B CB  1 
ATOM   2015  C CG  . ASN B  1 92  ? 34.162  90.676  156.439 1.00 35.78  ? 92   ASN B CG  1 
ATOM   2016  O OD1 . ASN B  1 92  ? 34.785  91.688  156.023 1.00 36.01  ? 92   ASN B OD1 1 
ATOM   2017  N ND2 . ASN B  1 92  ? 33.696  90.568  157.707 1.00 39.28  ? 92   ASN B ND2 1 
ATOM   2018  N N   . VAL B  1 93  ? 31.992  91.963  154.083 1.00 21.22  ? 93   VAL B N   1 
ATOM   2019  C CA  . VAL B  1 93  ? 32.085  93.187  153.301 1.00 21.39  ? 93   VAL B CA  1 
ATOM   2020  C C   . VAL B  1 93  ? 33.319  93.989  153.766 1.00 20.70  ? 93   VAL B C   1 
ATOM   2021  O O   . VAL B  1 93  ? 33.342  94.485  154.888 1.00 20.98  ? 93   VAL B O   1 
ATOM   2022  C CB  . VAL B  1 93  ? 30.837  94.071  153.470 1.00 19.02  ? 93   VAL B CB  1 
ATOM   2023  C CG1 . VAL B  1 93  ? 31.090  95.387  152.785 1.00 20.79  ? 93   VAL B CG1 1 
ATOM   2024  C CG2 . VAL B  1 93  ? 29.631  93.408  152.840 1.00 16.55  ? 93   VAL B CG2 1 
ATOM   2025  N N   . ASP B  1 94  ? 34.324  94.138  152.915 1.00 20.33  ? 94   ASP B N   1 
ATOM   2026  C CA  . ASP B  1 94  ? 35.533  94.824  153.323 1.00 22.32  ? 94   ASP B CA  1 
ATOM   2027  C C   . ASP B  1 94  ? 35.379  96.320  153.442 1.00 25.47  ? 94   ASP B C   1 
ATOM   2028  O O   . ASP B  1 94  ? 35.973  96.957  154.319 1.00 27.64  ? 94   ASP B O   1 
ATOM   2029  C CB  . ASP B  1 94  ? 36.674  94.520  152.351 1.00 22.02  ? 94   ASP B CB  1 
ATOM   2030  C CG  . ASP B  1 94  ? 37.296  93.132  152.595 1.00 24.26  ? 94   ASP B CG  1 
ATOM   2031  O OD1 . ASP B  1 94  ? 38.040  92.627  151.715 1.00 23.26  ? 94   ASP B OD1 1 
ATOM   2032  O OD2 . ASP B  1 94  ? 37.024  92.544  153.681 1.00 23.94  ? 94   ASP B OD2 1 
ATOM   2033  N N   . PHE B  1 95  ? 34.598  96.906  152.556 1.00 25.29  ? 95   PHE B N   1 
ATOM   2034  C CA  . PHE B  1 95  ? 34.419  98.324  152.624 1.00 26.95  ? 95   PHE B CA  1 
ATOM   2035  C C   . PHE B  1 95  ? 33.375  98.756  151.610 1.00 28.79  ? 95   PHE B C   1 
ATOM   2036  O O   . PHE B  1 95  ? 33.159  98.078  150.582 1.00 28.80  ? 95   PHE B O   1 
ATOM   2037  C CB  . PHE B  1 95  ? 35.768  99.060  152.346 1.00 26.86  ? 95   PHE B CB  1 
ATOM   2038  C CG  . PHE B  1 95  ? 36.308  98.862  150.932 1.00 27.33  ? 95   PHE B CG  1 
ATOM   2039  C CD1 . PHE B  1 95  ? 35.821  99.613  149.854 1.00 27.03  ? 95   PHE B CD1 1 
ATOM   2040  C CD2 . PHE B  1 95  ? 37.204  97.829  150.657 1.00 26.82  ? 95   PHE B CD2 1 
ATOM   2041  C CE1 . PHE B  1 95  ? 36.214  99.320  148.518 1.00 25.43  ? 95   PHE B CE1 1 
ATOM   2042  C CE2 . PHE B  1 95  ? 37.601  97.527  149.324 1.00 25.24  ? 95   PHE B CE2 1 
ATOM   2043  C CZ  . PHE B  1 95  ? 37.103  98.268  148.265 1.00 25.52  ? 95   PHE B CZ  1 
ATOM   2044  N N   . VAL B  1 96  ? 32.733  99.877  151.931 1.00 29.06  ? 96   VAL B N   1 
ATOM   2045  C CA  . VAL B  1 96  ? 31.769  100.521 151.074 1.00 29.60  ? 96   VAL B CA  1 
ATOM   2046  C C   . VAL B  1 96  ? 32.167  102.008 151.087 1.00 30.49  ? 96   VAL B C   1 
ATOM   2047  O O   . VAL B  1 96  ? 31.843  102.743 152.000 1.00 29.03  ? 96   VAL B O   1 
ATOM   2048  C CB  . VAL B  1 96  ? 30.340  100.338 151.577 1.00 28.54  ? 96   VAL B CB  1 
ATOM   2049  C CG1 . VAL B  1 96  ? 29.381  101.103 150.678 1.00 29.72  ? 96   VAL B CG1 1 
ATOM   2050  C CG2 . VAL B  1 96  ? 29.983  98.883  151.542 1.00 28.15  ? 96   VAL B CG2 1 
ATOM   2051  N N   . ASP B  1 97  ? 32.919  102.423 150.076 1.00 31.93  ? 97   ASP B N   1 
ATOM   2052  C CA  . ASP B  1 97  ? 33.367  103.800 149.961 1.00 32.29  ? 97   ASP B CA  1 
ATOM   2053  C C   . ASP B  1 97  ? 32.582  104.606 148.937 1.00 33.48  ? 97   ASP B C   1 
ATOM   2054  O O   . ASP B  1 97  ? 32.273  104.110 147.863 1.00 31.17  ? 97   ASP B O   1 
ATOM   2055  C CB  . ASP B  1 97  ? 34.846  103.820 149.584 1.00 30.66  ? 97   ASP B CB  1 
ATOM   2056  C CG  . ASP B  1 97  ? 35.738  103.309 150.702 1.00 31.71  ? 97   ASP B CG  1 
ATOM   2057  O OD1 . ASP B  1 97  ? 35.299  103.273 151.872 1.00 33.52  ? 97   ASP B OD1 1 
ATOM   2058  O OD2 . ASP B  1 97  ? 36.897  102.955 150.417 1.00 31.22  ? 97   ASP B OD2 1 
ATOM   2059  N N   . LEU B  1 98  ? 32.246  105.850 149.300 1.00 38.07  ? 98   LEU B N   1 
ATOM   2060  C CA  . LEU B  1 98  ? 31.539  106.794 148.416 1.00 41.94  ? 98   LEU B CA  1 
ATOM   2061  C C   . LEU B  1 98  ? 32.569  107.862 148.126 1.00 44.86  ? 98   LEU B C   1 
ATOM   2062  O O   . LEU B  1 98  ? 32.818  108.661 148.981 1.00 46.04  ? 98   LEU B O   1 
ATOM   2063  C CB  . LEU B  1 98  ? 30.377  107.399 149.149 1.00 40.05  ? 98   LEU B CB  1 
ATOM   2064  C CG  . LEU B  1 98  ? 29.776  108.648 148.532 1.00 41.51  ? 98   LEU B CG  1 
ATOM   2065  C CD1 . LEU B  1 98  ? 28.835  108.273 147.420 1.00 41.73  ? 98   LEU B CD1 1 
ATOM   2066  C CD2 . LEU B  1 98  ? 29.027  109.405 149.615 1.00 42.68  ? 98   LEU B CD2 1 
ATOM   2067  N N   . ASN B  1 99  ? 33.161  107.888 146.935 1.00 50.95  ? 99   ASN B N   1 
ATOM   2068  C CA  . ASN B  1 99  ? 34.222  108.859 146.665 1.00 58.60  ? 99   ASN B CA  1 
ATOM   2069  C C   . ASN B  1 99  ? 33.944  110.055 145.764 1.00 61.43  ? 99   ASN B C   1 
ATOM   2070  O O   . ASN B  1 99  ? 34.834  110.915 145.558 1.00 65.64  ? 99   ASN B O   1 
ATOM   2071  C CB  . ASN B  1 99  ? 35.482  108.136 146.167 1.00 61.47  ? 99   ASN B CB  1 
ATOM   2072  C CG  . ASN B  1 99  ? 36.233  107.377 147.318 1.00 65.86  ? 99   ASN B CG  1 
ATOM   2073  O OD1 . ASN B  1 99  ? 37.120  106.517 147.064 1.00 66.62  ? 99   ASN B OD1 1 
ATOM   2074  N ND2 . ASN B  1 99  ? 35.889  107.710 148.586 1.00 66.09  ? 99   ASN B ND2 1 
ATOM   2075  N N   . ASN B  1 100 ? 32.721  110.146 145.261 1.00 60.50  ? 100  ASN B N   1 
ATOM   2076  C CA  . ASN B  1 100 ? 32.316  111.241 144.374 1.00 59.94  ? 100  ASN B CA  1 
ATOM   2077  C C   . ASN B  1 100 ? 30.827  111.068 144.547 1.00 58.07  ? 100  ASN B C   1 
ATOM   2078  O O   . ASN B  1 100 ? 30.272  111.350 145.648 1.00 59.03  ? 100  ASN B O   1 
ATOM   2079  C CB  . ASN B  1 100 ? 32.760  110.865 142.981 1.00 64.66  ? 100  ASN B CB  1 
ATOM   2080  C CG  . ASN B  1 100 ? 33.512  109.474 142.972 1.00 68.31  ? 100  ASN B CG  1 
ATOM   2081  O OD1 . ASN B  1 100 ? 34.703  109.378 143.327 1.00 70.56  ? 100  ASN B OD1 1 
ATOM   2082  N ND2 . ASN B  1 100 ? 32.797  108.411 142.604 1.00 68.12  ? 100  ASN B ND2 1 
ATOM   2083  N N   . GLY B  1 101 ? 30.167  110.598 143.500 1.00 53.15  ? 101  GLY B N   1 
ATOM   2084  C CA  . GLY B  1 101 ? 28.764  110.306 143.671 1.00 49.76  ? 101  GLY B CA  1 
ATOM   2085  C C   . GLY B  1 101 ? 28.650  108.812 143.443 1.00 48.37  ? 101  GLY B C   1 
ATOM   2086  O O   . GLY B  1 101 ? 27.561  108.263 143.295 1.00 48.10  ? 101  GLY B O   1 
ATOM   2087  N N   . LYS B  1 102 ? 29.807  108.158 143.411 1.00 46.50  ? 102  LYS B N   1 
ATOM   2088  C CA  . LYS B  1 102 ? 29.901  106.745 143.115 1.00 43.88  ? 102  LYS B CA  1 
ATOM   2089  C C   . LYS B  1 102 ? 30.457  105.877 144.232 1.00 41.90  ? 102  LYS B C   1 
ATOM   2090  O O   . LYS B  1 102 ? 31.266  106.323 145.050 1.00 42.53  ? 102  LYS B O   1 
ATOM   2091  C CB  . LYS B  1 102 ? 30.762  106.566 141.886 1.00 45.73  ? 102  LYS B CB  1 
ATOM   2092  C CG  . LYS B  1 102 ? 30.338  107.384 140.693 1.00 47.97  ? 102  LYS B CG  1 
ATOM   2093  C CD  . LYS B  1 102 ? 31.516  107.440 139.683 1.00 53.54  ? 102  LYS B CD  1 
ATOM   2094  C CE  . LYS B  1 102 ? 31.133  108.065 138.332 1.00 54.56  ? 102  LYS B CE  1 
ATOM   2095  N NZ  . LYS B  1 102 ? 32.277  107.998 137.372 1.00 57.17  ? 102  LYS B NZ  1 
ATOM   2096  N N   . PHE B  1 103 ? 30.037  104.610 144.227 1.00 38.49  ? 103  PHE B N   1 
ATOM   2097  C CA  . PHE B  1 103 ? 30.454  103.623 145.239 1.00 34.74  ? 103  PHE B CA  1 
ATOM   2098  C C   . PHE B  1 103 ? 31.546  102.628 144.818 1.00 32.16  ? 103  PHE B C   1 
ATOM   2099  O O   . PHE B  1 103 ? 31.608  102.178 143.673 1.00 30.55  ? 103  PHE B O   1 
ATOM   2100  C CB  . PHE B  1 103 ? 29.245  102.844 145.747 1.00 33.24  ? 103  PHE B CB  1 
ATOM   2101  C CG  . PHE B  1 103 ? 28.248  103.692 146.499 1.00 34.29  ? 103  PHE B CG  1 
ATOM   2102  C CD1 . PHE B  1 103 ? 27.071  104.124 145.889 1.00 33.93  ? 103  PHE B CD1 1 
ATOM   2103  C CD2 . PHE B  1 103 ? 28.495  104.071 147.831 1.00 33.59  ? 103  PHE B CD2 1 
ATOM   2104  C CE1 . PHE B  1 103 ? 26.161  104.916 146.598 1.00 32.20  ? 103  PHE B CE1 1 
ATOM   2105  C CE2 . PHE B  1 103 ? 27.598  104.852 148.529 1.00 31.08  ? 103  PHE B CE2 1 
ATOM   2106  C CZ  . PHE B  1 103 ? 26.434  105.273 147.915 1.00 31.34  ? 103  PHE B CZ  1 
ATOM   2107  N N   . TYR B  1 104 ? 32.415  102.315 145.772 1.00 30.36  ? 104  TYR B N   1 
ATOM   2108  C CA  . TYR B  1 104 ? 33.539  101.410 145.580 1.00 28.48  ? 104  TYR B CA  1 
ATOM   2109  C C   . TYR B  1 104 ? 33.381  100.401 146.674 1.00 28.03  ? 104  TYR B C   1 
ATOM   2110  O O   . TYR B  1 104 ? 33.458  100.745 147.867 1.00 29.09  ? 104  TYR B O   1 
ATOM   2111  C CB  . TYR B  1 104 ? 34.857  102.167 145.705 1.00 31.26  ? 104  TYR B CB  1 
ATOM   2112  C CG  . TYR B  1 104 ? 34.935  103.236 144.643 1.00 33.68  ? 104  TYR B CG  1 
ATOM   2113  C CD1 . TYR B  1 104 ? 34.242  104.459 144.778 1.00 34.23  ? 104  TYR B CD1 1 
ATOM   2114  C CD2 . TYR B  1 104 ? 35.517  102.948 143.421 1.00 35.01  ? 104  TYR B CD2 1 
ATOM   2115  C CE1 . TYR B  1 104 ? 34.109  105.337 143.708 1.00 34.37  ? 104  TYR B CE1 1 
ATOM   2116  C CE2 . TYR B  1 104 ? 35.417  103.819 142.341 1.00 35.49  ? 104  TYR B CE2 1 
ATOM   2117  C CZ  . TYR B  1 104 ? 34.711  105.007 142.484 1.00 36.79  ? 104  TYR B CZ  1 
ATOM   2118  O OH  . TYR B  1 104 ? 34.655  105.843 141.387 1.00 37.39  ? 104  TYR B OH  1 
ATOM   2119  N N   . VAL B  1 105 ? 33.132  99.153  146.262 1.00 25.35  ? 105  VAL B N   1 
ATOM   2120  C CA  . VAL B  1 105 ? 32.865  98.061  147.191 1.00 23.13  ? 105  VAL B CA  1 
ATOM   2121  C C   . VAL B  1 105 ? 33.675  96.783  147.015 1.00 23.47  ? 105  VAL B C   1 
ATOM   2122  O O   . VAL B  1 105 ? 33.784  96.228  145.935 1.00 24.69  ? 105  VAL B O   1 
ATOM   2123  C CB  . VAL B  1 105 ? 31.368  97.705  147.160 1.00 20.30  ? 105  VAL B CB  1 
ATOM   2124  C CG1 . VAL B  1 105 ? 31.015  96.726  148.246 1.00 18.88  ? 105  VAL B CG1 1 
ATOM   2125  C CG2 . VAL B  1 105 ? 30.562  98.941  147.310 1.00 20.40  ? 105  VAL B CG2 1 
ATOM   2126  N N   . GLY B  1 106 ? 34.237  96.301  148.109 1.00 24.67  ? 106  GLY B N   1 
ATOM   2127  C CA  . GLY B  1 106 ? 35.039  95.089  148.055 1.00 23.94  ? 106  GLY B CA  1 
ATOM   2128  C C   . GLY B  1 106 ? 34.497  94.052  149.016 1.00 25.02  ? 106  GLY B C   1 
ATOM   2129  O O   . GLY B  1 106 ? 34.343  94.298  150.240 1.00 25.92  ? 106  GLY B O   1 
ATOM   2130  N N   . VAL B  1 107 ? 34.182  92.878  148.477 1.00 24.48  ? 107  VAL B N   1 
ATOM   2131  C CA  . VAL B  1 107 ? 33.612  91.830  149.315 1.00 23.00  ? 107  VAL B CA  1 
ATOM   2132  C C   . VAL B  1 107 ? 34.327  90.520  149.134 1.00 22.23  ? 107  VAL B C   1 
ATOM   2133  O O   . VAL B  1 107 ? 34.695  90.152  148.012 1.00 21.37  ? 107  VAL B O   1 
ATOM   2134  C CB  . VAL B  1 107 ? 32.126  91.633  148.988 1.00 22.33  ? 107  VAL B CB  1 
ATOM   2135  C CG1 . VAL B  1 107 ? 31.600  90.458  149.760 1.00 22.39  ? 107  VAL B CG1 1 
ATOM   2136  C CG2 . VAL B  1 107 ? 31.333  92.877  149.362 1.00 22.04  ? 107  VAL B CG2 1 
ATOM   2137  N N   . CYS B  1 108 ? 34.569  89.818  150.233 1.00 21.25  ? 108  CYS B N   1 
ATOM   2138  C CA  . CYS B  1 108 ? 35.189  88.502  150.120 1.00 20.33  ? 108  CYS B CA  1 
ATOM   2139  C C   . CYS B  1 108 ? 34.263  87.419  150.656 1.00 20.45  ? 108  CYS B C   1 
ATOM   2140  O O   . CYS B  1 108 ? 33.465  87.678  151.566 1.00 19.64  ? 108  CYS B O   1 
ATOM   2141  C CB  . CYS B  1 108 ? 36.500  88.460  150.868 1.00 19.83  ? 108  CYS B CB  1 
ATOM   2142  S SG  . CYS B  1 108 ? 36.438  88.542  152.658 1.00 23.69  ? 108  CYS B SG  1 
ATOM   2143  N N   . ALA B  1 109 ? 34.328  86.220  150.067 1.00 21.81  ? 109  ALA B N   1 
ATOM   2144  C CA  . ALA B  1 109 ? 33.506  85.069  150.547 1.00 21.90  ? 109  ALA B CA  1 
ATOM   2145  C C   . ALA B  1 109 ? 34.406  83.854  150.683 1.00 22.02  ? 109  ALA B C   1 
ATOM   2146  O O   . ALA B  1 109 ? 35.350  83.677  149.907 1.00 23.87  ? 109  ALA B O   1 
ATOM   2147  C CB  . ALA B  1 109 ? 32.376  84.745  149.573 1.00 20.71  ? 109  ALA B CB  1 
ATOM   2148  N N   . PHE B  1 110 ? 34.146  83.023  151.679 1.00 20.29  ? 110  PHE B N   1 
ATOM   2149  C CA  . PHE B  1 110 ? 34.944  81.807  151.845 1.00 18.76  ? 110  PHE B CA  1 
ATOM   2150  C C   . PHE B  1 110 ? 33.987  80.683  151.539 1.00 19.18  ? 110  PHE B C   1 
ATOM   2151  O O   . PHE B  1 110 ? 32.990  80.482  152.270 1.00 19.47  ? 110  PHE B O   1 
ATOM   2152  C CB  . PHE B  1 110 ? 35.470  81.682  153.273 1.00 17.81  ? 110  PHE B CB  1 
ATOM   2153  C CG  . PHE B  1 110 ? 36.432  82.739  153.617 1.00 16.84  ? 110  PHE B CG  1 
ATOM   2154  C CD1 . PHE B  1 110 ? 35.987  84.017  154.029 1.00 19.02  ? 110  PHE B CD1 1 
ATOM   2155  C CD2 . PHE B  1 110 ? 37.769  82.539  153.418 1.00 17.10  ? 110  PHE B CD2 1 
ATOM   2156  C CE1 . PHE B  1 110 ? 36.876  85.050  154.208 1.00 17.34  ? 110  PHE B CE1 1 
ATOM   2157  C CE2 . PHE B  1 110 ? 38.690  83.570  153.597 1.00 16.31  ? 110  PHE B CE2 1 
ATOM   2158  C CZ  . PHE B  1 110 ? 38.244  84.824  153.986 1.00 19.12  ? 110  PHE B CZ  1 
ATOM   2159  N N   . VAL B  1 111 ? 34.279  79.964  150.459 1.00 17.16  ? 111  VAL B N   1 
ATOM   2160  C CA  . VAL B  1 111 ? 33.400  78.881  150.022 1.00 17.37  ? 111  VAL B CA  1 
ATOM   2161  C C   . VAL B  1 111 ? 34.051  77.503  150.162 1.00 19.71  ? 111  VAL B C   1 
ATOM   2162  O O   . VAL B  1 111 ? 35.198  77.299  149.704 1.00 17.61  ? 111  VAL B O   1 
ATOM   2163  C CB  . VAL B  1 111 ? 33.002  79.092  148.548 1.00 17.41  ? 111  VAL B CB  1 
ATOM   2164  C CG1 . VAL B  1 111 ? 32.052  77.956  148.072 1.00 13.09  ? 111  VAL B CG1 1 
ATOM   2165  C CG2 . VAL B  1 111 ? 32.420  80.493  148.368 1.00 13.60  ? 111  VAL B CG2 1 
ATOM   2166  N N   . ARG B  1 112 ? 33.319  76.587  150.818 1.00 20.20  ? 112  ARG B N   1 
ATOM   2167  C CA  . ARG B  1 112 ? 33.775  75.194  151.054 1.00 19.83  ? 112  ARG B CA  1 
ATOM   2168  C C   . ARG B  1 112 ? 32.975  74.246  150.178 1.00 19.02  ? 112  ARG B C   1 
ATOM   2169  O O   . ARG B  1 112 ? 31.744  74.161  150.281 1.00 17.36  ? 112  ARG B O   1 
ATOM   2170  C CB  . ARG B  1 112 ? 33.553  74.762  152.516 1.00 21.52  ? 112  ARG B CB  1 
ATOM   2171  C CG  . ARG B  1 112 ? 34.452  73.678  152.942 1.00 22.76  ? 112  ARG B CG  1 
ATOM   2172  C CD  . ARG B  1 112 ? 34.213  73.193  154.354 1.00 25.49  ? 112  ARG B CD  1 
ATOM   2173  N NE  . ARG B  1 112 ? 33.557  71.904  154.248 1.00 30.52  ? 112  ARG B NE  1 
ATOM   2174  C CZ  . ARG B  1 112 ? 33.969  70.772  154.810 1.00 32.41  ? 112  ARG B CZ  1 
ATOM   2175  N NH1 . ARG B  1 112 ? 35.093  70.746  155.572 1.00 34.86  ? 112  ARG B NH1 1 
ATOM   2176  N NH2 . ARG B  1 112 ? 33.253  69.666  154.577 1.00 28.32  ? 112  ARG B NH2 1 
ATOM   2177  N N   . VAL B  1 113 ? 33.665  73.533  149.320 1.00 18.11  ? 113  VAL B N   1 
ATOM   2178  C CA  . VAL B  1 113 ? 32.970  72.619  148.469 1.00 19.67  ? 113  VAL B CA  1 
ATOM   2179  C C   . VAL B  1 113 ? 33.314  71.215  148.942 1.00 20.20  ? 113  VAL B C   1 
ATOM   2180  O O   . VAL B  1 113 ? 34.430  70.941  149.382 1.00 18.99  ? 113  VAL B O   1 
ATOM   2181  C CB  . VAL B  1 113 ? 33.335  72.847  146.978 1.00 20.37  ? 113  VAL B CB  1 
ATOM   2182  C CG1 . VAL B  1 113 ? 34.743  73.084  146.855 1.00 25.15  ? 113  VAL B CG1 1 
ATOM   2183  C CG2 . VAL B  1 113 ? 33.027  71.603  146.193 1.00 24.91  ? 113  VAL B CG2 1 
ATOM   2184  N N   . GLN B  1 114 ? 32.344  70.316  148.861 1.00 21.10  ? 114  GLN B N   1 
ATOM   2185  C CA  . GLN B  1 114 ? 32.532  68.950  149.351 1.00 21.05  ? 114  GLN B CA  1 
ATOM   2186  C C   . GLN B  1 114 ? 31.947  67.897  148.448 1.00 20.58  ? 114  GLN B C   1 
ATOM   2187  O O   . GLN B  1 114 ? 30.888  68.091  147.847 1.00 21.80  ? 114  GLN B O   1 
ATOM   2188  C CB  . GLN B  1 114 ? 31.863  68.817  150.703 1.00 21.41  ? 114  GLN B CB  1 
ATOM   2189  C CG  . GLN B  1 114 ? 32.070  67.511  151.319 1.00 24.83  ? 114  GLN B CG  1 
ATOM   2190  C CD  . GLN B  1 114 ? 31.248  67.358  152.554 1.00 27.12  ? 114  GLN B CD  1 
ATOM   2191  O OE1 . GLN B  1 114 ? 31.089  68.284  153.327 1.00 29.54  ? 114  GLN B OE1 1 
ATOM   2192  N NE2 . GLN B  1 114 ? 30.720  66.172  152.760 1.00 32.49  ? 114  GLN B NE2 1 
ATOM   2193  N N   . LEU B  1 115 ? 32.608  66.757  148.378 1.00 20.09  ? 115  LEU B N   1 
ATOM   2194  C CA  . LEU B  1 115 ? 32.127  65.635  147.537 1.00 19.29  ? 115  LEU B CA  1 
ATOM   2195  C C   . LEU B  1 115 ? 31.299  64.692  148.424 1.00 20.96  ? 115  LEU B C   1 
ATOM   2196  O O   . LEU B  1 115 ? 31.394  64.786  149.671 1.00 18.77  ? 115  LEU B O   1 
ATOM   2197  C CB  . LEU B  1 115 ? 33.330  64.881  146.966 1.00 15.72  ? 115  LEU B CB  1 
ATOM   2198  C CG  . LEU B  1 115 ? 33.841  65.338  145.614 1.00 13.86  ? 115  LEU B CG  1 
ATOM   2199  C CD1 . LEU B  1 115 ? 33.456  66.752  145.323 1.00 13.71  ? 115  LEU B CD1 1 
ATOM   2200  C CD2 . LEU B  1 115 ? 35.289  65.120  145.564 1.00 11.22  ? 115  LEU B CD2 1 
ATOM   2201  N N   . LYS B  1 116 ? 30.528  63.774  147.816 1.00 22.68  ? 116  LYS B N   1 
ATOM   2202  C CA  . LYS B  1 116 ? 29.693  62.810  148.604 1.00 24.64  ? 116  LYS B CA  1 
ATOM   2203  C C   . LYS B  1 116 ? 30.587  61.966  149.516 1.00 24.62  ? 116  LYS B C   1 
ATOM   2204  O O   . LYS B  1 116 ? 30.201  61.398  150.506 1.00 24.62  ? 116  LYS B O   1 
ATOM   2205  C CB  . LYS B  1 116 ? 28.865  61.910  147.682 1.00 23.09  ? 116  LYS B CB  1 
ATOM   2206  C CG  . LYS B  1 116 ? 29.662  61.120  146.673 1.00 25.93  ? 116  LYS B CG  1 
ATOM   2207  C CD  . LYS B  1 116 ? 28.742  60.279  145.794 1.00 26.18  ? 116  LYS B CD  1 
ATOM   2208  C CE  . LYS B  1 116 ? 29.481  59.721  144.630 1.00 28.19  ? 116  LYS B CE  1 
ATOM   2209  N NZ  . LYS B  1 116 ? 28.573  58.931  143.735 1.00 34.25  ? 116  LYS B NZ  1 
ATOM   2210  N N   . ASP B  1 117 ? 31.824  61.969  149.136 1.00 26.66  ? 117  ASP B N   1 
ATOM   2211  C CA  . ASP B  1 117 ? 32.961  61.340  149.769 1.00 28.00  ? 117  ASP B CA  1 
ATOM   2212  C C   . ASP B  1 117 ? 33.269  61.879  151.181 1.00 28.91  ? 117  ASP B C   1 
ATOM   2213  O O   . ASP B  1 117 ? 33.725  61.162  152.052 1.00 28.12  ? 117  ASP B O   1 
ATOM   2214  C CB  . ASP B  1 117 ? 34.179  61.745  148.941 1.00 27.81  ? 117  ASP B CB  1 
ATOM   2215  C CG  . ASP B  1 117 ? 35.186  60.801  149.039 1.00 29.60  ? 117  ASP B CG  1 
ATOM   2216  O OD1 . ASP B  1 117 ? 36.316  61.065  148.640 1.00 33.07  ? 117  ASP B OD1 1 
ATOM   2217  O OD2 . ASP B  1 117 ? 34.792  59.741  149.517 1.00 35.15  ? 117  ASP B OD2 1 
ATOM   2218  N N   . GLY B  1 118 ? 33.140  63.204  151.329 1.00 28.99  ? 118  GLY B N   1 
ATOM   2219  C CA  . GLY B  1 118 ? 33.487  63.889  152.552 1.00 24.71  ? 118  GLY B CA  1 
ATOM   2220  C C   . GLY B  1 118 ? 34.753  64.698  152.214 1.00 24.06  ? 118  GLY B C   1 
ATOM   2221  O O   . GLY B  1 118 ? 35.168  65.567  152.984 1.00 23.25  ? 118  GLY B O   1 
ATOM   2222  N N   . SER B  1 119 ? 35.379  64.418  151.073 1.00 21.28  ? 119  SER B N   1 
ATOM   2223  C CA  . SER B  1 119 ? 36.566  65.173  150.719 1.00 22.18  ? 119  SER B CA  1 
ATOM   2224  C C   . SER B  1 119 ? 36.142  66.601  150.406 1.00 21.07  ? 119  SER B C   1 
ATOM   2225  O O   . SER B  1 119 ? 35.026  66.824  149.964 1.00 21.11  ? 119  SER B O   1 
ATOM   2226  C CB  . SER B  1 119 ? 37.288  64.530  149.539 1.00 23.94  ? 119  SER B CB  1 
ATOM   2227  O OG  . SER B  1 119 ? 36.441  64.469  148.438 1.00 27.70  ? 119  SER B OG  1 
ATOM   2228  N N   . TYR B  1 120 ? 37.040  67.564  150.616 1.00 20.36  ? 120  TYR B N   1 
ATOM   2229  C CA  . TYR B  1 120 ? 36.682  68.968  150.467 1.00 19.98  ? 120  TYR B CA  1 
ATOM   2230  C C   . TYR B  1 120 ? 37.827  69.941  150.234 1.00 19.76  ? 120  TYR B C   1 
ATOM   2231  O O   . TYR B  1 120 ? 38.967  69.660  150.541 1.00 18.07  ? 120  TYR B O   1 
ATOM   2232  C CB  . TYR B  1 120 ? 35.957  69.402  151.751 1.00 19.52  ? 120  TYR B CB  1 
ATOM   2233  C CG  . TYR B  1 120 ? 36.849  69.284  152.976 1.00 17.85  ? 120  TYR B CG  1 
ATOM   2234  C CD1 . TYR B  1 120 ? 37.715  70.340  153.356 1.00 18.26  ? 120  TYR B CD1 1 
ATOM   2235  C CD2 . TYR B  1 120 ? 36.949  68.086  153.672 1.00 16.79  ? 120  TYR B CD2 1 
ATOM   2236  C CE1 . TYR B  1 120 ? 38.638  70.207  154.386 1.00 13.03  ? 120  TYR B CE1 1 
ATOM   2237  C CE2 . TYR B  1 120 ? 37.898  67.917  154.691 1.00 14.54  ? 120  TYR B CE2 1 
ATOM   2238  C CZ  . TYR B  1 120 ? 38.726  68.998  155.042 1.00 16.99  ? 120  TYR B CZ  1 
ATOM   2239  O OH  . TYR B  1 120 ? 39.641  68.903  156.070 1.00 19.37  ? 120  TYR B OH  1 
ATOM   2240  N N   . HIS B  1 121 ? 37.483  71.111  149.696 1.00 21.51  ? 121  HIS B N   1 
ATOM   2241  C CA  . HIS B  1 121 ? 38.431  72.191  149.454 1.00 21.13  ? 121  HIS B CA  1 
ATOM   2242  C C   . HIS B  1 121 ? 37.744  73.529  149.722 1.00 21.36  ? 121  HIS B C   1 
ATOM   2243  O O   . HIS B  1 121 ? 36.560  73.722  149.424 1.00 19.45  ? 121  HIS B O   1 
ATOM   2244  C CB  . HIS B  1 121 ? 38.959  72.135  148.024 1.00 21.32  ? 121  HIS B CB  1 
ATOM   2245  C CG  . HIS B  1 121 ? 39.865  70.965  147.757 1.00 23.76  ? 121  HIS B CG  1 
ATOM   2246  N ND1 . HIS B  1 121 ? 39.553  69.955  146.863 1.00 26.36  ? 121  HIS B ND1 1 
ATOM   2247  C CD2 . HIS B  1 121 ? 41.057  70.623  148.294 1.00 23.22  ? 121  HIS B CD2 1 
ATOM   2248  C CE1 . HIS B  1 121 ? 40.510  69.044  146.869 1.00 25.21  ? 121  HIS B CE1 1 
ATOM   2249  N NE2 . HIS B  1 121 ? 41.435  69.427  147.729 1.00 23.15  ? 121  HIS B NE2 1 
ATOM   2250  N N   . GLU B  1 122 ? 38.478  74.453  150.314 1.00 22.46  ? 122  GLU B N   1 
ATOM   2251  C CA  . GLU B  1 122 ? 37.911  75.777  150.594 1.00 24.98  ? 122  GLU B CA  1 
ATOM   2252  C C   . GLU B  1 122 ? 38.812  76.901  150.076 1.00 25.66  ? 122  GLU B C   1 
ATOM   2253  O O   . GLU B  1 122 ? 40.046  76.802  150.094 1.00 26.05  ? 122  GLU B O   1 
ATOM   2254  C CB  . GLU B  1 122 ? 37.711  75.961  152.100 1.00 24.98  ? 122  GLU B CB  1 
ATOM   2255  C CG  . GLU B  1 122 ? 37.094  77.282  152.503 1.00 24.03  ? 122  GLU B CG  1 
ATOM   2256  C CD  . GLU B  1 122 ? 36.873  77.337  154.012 1.00 26.24  ? 122  GLU B CD  1 
ATOM   2257  O OE1 . GLU B  1 122 ? 37.461  76.483  154.737 1.00 26.51  ? 122  GLU B OE1 1 
ATOM   2258  O OE2 . GLU B  1 122 ? 36.137  78.227  154.475 1.00 23.31  ? 122  GLU B OE2 1 
ATOM   2259  N N   . ASP B  1 123 ? 38.211  77.975  149.598 1.00 25.31  ? 123  ASP B N   1 
ATOM   2260  C CA  . ASP B  1 123 ? 39.017  79.083  149.130 1.00 24.53  ? 123  ASP B CA  1 
ATOM   2261  C C   . ASP B  1 123 ? 38.271  80.407  149.281 1.00 24.22  ? 123  ASP B C   1 
ATOM   2262  O O   . ASP B  1 123 ? 37.092  80.414  149.658 1.00 25.04  ? 123  ASP B O   1 
ATOM   2263  C CB  . ASP B  1 123 ? 39.371  78.867  147.668 1.00 25.77  ? 123  ASP B CB  1 
ATOM   2264  C CG  . ASP B  1 123 ? 40.724  79.394  147.343 1.00 27.79  ? 123  ASP B CG  1 
ATOM   2265  O OD1 . ASP B  1 123 ? 41.112  80.470  147.906 1.00 25.91  ? 123  ASP B OD1 1 
ATOM   2266  O OD2 . ASP B  1 123 ? 41.412  78.724  146.548 1.00 31.80  ? 123  ASP B OD2 1 
ATOM   2267  N N   . VAL B  1 124 ? 38.957  81.521  149.012 1.00 23.70  ? 124  VAL B N   1 
ATOM   2268  C CA  . VAL B  1 124 ? 38.325  82.844  149.054 1.00 22.93  ? 124  VAL B CA  1 
ATOM   2269  C C   . VAL B  1 124 ? 37.982  83.291  147.675 1.00 21.09  ? 124  VAL B C   1 
ATOM   2270  O O   . VAL B  1 124 ? 38.724  83.026  146.719 1.00 19.30  ? 124  VAL B O   1 
ATOM   2271  C CB  . VAL B  1 124 ? 39.212  84.011  149.473 1.00 23.76  ? 124  VAL B CB  1 
ATOM   2272  C CG1 . VAL B  1 124 ? 38.696  84.620  150.732 1.00 26.01  ? 124  VAL B CG1 1 
ATOM   2273  C CG2 . VAL B  1 124 ? 40.635  83.614  149.506 1.00 25.73  ? 124  VAL B CG2 1 
ATOM   2274  N N   . GLY B  1 125 ? 36.888  84.028  147.588 1.00 21.16  ? 125  GLY B N   1 
ATOM   2275  C CA  . GLY B  1 125 ? 36.470  84.595  146.321 1.00 22.37  ? 125  GLY B CA  1 
ATOM   2276  C C   . GLY B  1 125 ? 36.381  86.071  146.661 1.00 23.39  ? 125  GLY B C   1 
ATOM   2277  O O   . GLY B  1 125 ? 36.211  86.428  147.843 1.00 23.10  ? 125  GLY B O   1 
ATOM   2278  N N   . TYR B  1 126 ? 36.523  86.940  145.669 1.00 24.30  ? 126  TYR B N   1 
ATOM   2279  C CA  . TYR B  1 126 ? 36.409  88.367  145.943 1.00 23.92  ? 126  TYR B CA  1 
ATOM   2280  C C   . TYR B  1 126 ? 35.438  88.948  144.966 1.00 23.41  ? 126  TYR B C   1 
ATOM   2281  O O   . TYR B  1 126 ? 35.354  88.486  143.861 1.00 25.57  ? 126  TYR B O   1 
ATOM   2282  C CB  . TYR B  1 126 ? 37.750  89.053  145.803 1.00 24.64  ? 126  TYR B CB  1 
ATOM   2283  C CG  . TYR B  1 126 ? 37.850  90.257  146.708 1.00 26.96  ? 126  TYR B CG  1 
ATOM   2284  C CD1 . TYR B  1 126 ? 38.047  90.096  148.064 1.00 25.45  ? 126  TYR B CD1 1 
ATOM   2285  C CD2 . TYR B  1 126 ? 37.645  91.558  146.220 1.00 27.78  ? 126  TYR B CD2 1 
ATOM   2286  C CE1 . TYR B  1 126 ? 38.040  91.166  148.912 1.00 28.04  ? 126  TYR B CE1 1 
ATOM   2287  C CE2 . TYR B  1 126 ? 37.621  92.645  147.075 1.00 27.34  ? 126  TYR B CE2 1 
ATOM   2288  C CZ  . TYR B  1 126 ? 37.821  92.440  148.421 1.00 29.11  ? 126  TYR B CZ  1 
ATOM   2289  O OH  . TYR B  1 126 ? 37.802  93.501  149.295 1.00 32.64  ? 126  TYR B OH  1 
ATOM   2290  N N   . GLY B  1 127 ? 34.685  89.942  145.391 1.00 25.15  ? 127  GLY B N   1 
ATOM   2291  C CA  . GLY B  1 127 ? 33.695  90.579  144.534 1.00 26.00  ? 127  GLY B CA  1 
ATOM   2292  C C   . GLY B  1 127 ? 33.947  92.073  144.540 1.00 27.33  ? 127  GLY B C   1 
ATOM   2293  O O   . GLY B  1 127 ? 34.190  92.693  145.584 1.00 26.65  ? 127  GLY B O   1 
ATOM   2294  N N   . VAL B  1 128 ? 33.898  92.671  143.365 1.00 29.52  ? 128  VAL B N   1 
ATOM   2295  C CA  . VAL B  1 128 ? 34.151  94.107  143.275 1.00 30.79  ? 128  VAL B CA  1 
ATOM   2296  C C   . VAL B  1 128 ? 33.095  94.913  142.518 1.00 31.19  ? 128  VAL B C   1 
ATOM   2297  O O   . VAL B  1 128 ? 32.517  94.429  141.521 1.00 30.20  ? 128  VAL B O   1 
ATOM   2298  C CB  . VAL B  1 128 ? 35.506  94.367  142.586 1.00 30.13  ? 128  VAL B CB  1 
ATOM   2299  C CG1 . VAL B  1 128 ? 35.793  95.850  142.591 1.00 31.46  ? 128  VAL B CG1 1 
ATOM   2300  C CG2 . VAL B  1 128 ? 36.598  93.600  143.299 1.00 29.22  ? 128  VAL B CG2 1 
ATOM   2301  N N   . SER B  1 129 ? 32.827  96.127  142.999 1.00 31.26  ? 129  SER B N   1 
ATOM   2302  C CA  . SER B  1 129 ? 31.907  96.998  142.280 1.00 32.70  ? 129  SER B CA  1 
ATOM   2303  C C   . SER B  1 129 ? 32.487  98.388  142.416 1.00 33.42  ? 129  SER B C   1 
ATOM   2304  O O   . SER B  1 129 ? 32.634  98.904  143.519 1.00 32.54  ? 129  SER B O   1 
ATOM   2305  C CB  . SER B  1 129 ? 30.502  96.915  142.849 1.00 31.68  ? 129  SER B CB  1 
ATOM   2306  O OG  . SER B  1 129 ? 29.604  97.639  142.032 1.00 35.73  ? 129  SER B OG  1 
ATOM   2307  N N   . GLU B  1 130 ? 32.863  98.978  141.294 1.00 34.91  ? 130  GLU B N   1 
ATOM   2308  C CA  . GLU B  1 130 ? 33.447  100.299 141.347 1.00 37.68  ? 130  GLU B CA  1 
ATOM   2309  C C   . GLU B  1 130 ? 32.752  101.196 140.382 1.00 38.70  ? 130  GLU B C   1 
ATOM   2310  O O   . GLU B  1 130 ? 32.553  100.819 139.245 1.00 40.20  ? 130  GLU B O   1 
ATOM   2311  C CB  . GLU B  1 130 ? 34.972  100.230 141.052 1.00 38.06  ? 130  GLU B CB  1 
ATOM   2312  C CG  . GLU B  1 130 ? 35.764  99.579  142.198 1.00 38.81  ? 130  GLU B CG  1 
ATOM   2313  C CD  . GLU B  1 130 ? 37.240  99.418  141.945 1.00 38.63  ? 130  GLU B CD  1 
ATOM   2314  O OE1 . GLU B  1 130 ? 37.593  98.946  140.841 1.00 38.78  ? 130  GLU B OE1 1 
ATOM   2315  O OE2 . GLU B  1 130 ? 38.036  99.727  142.873 1.00 38.38  ? 130  GLU B OE2 1 
ATOM   2316  N N   . GLY B  1 131 ? 32.321  102.363 140.843 1.00 40.35  ? 131  GLY B N   1 
ATOM   2317  C CA  . GLY B  1 131 ? 31.714  103.303 139.912 1.00 41.37  ? 131  GLY B CA  1 
ATOM   2318  C C   . GLY B  1 131 ? 30.221  103.496 139.819 1.00 41.98  ? 131  GLY B C   1 
ATOM   2319  O O   . GLY B  1 131 ? 29.797  104.507 139.267 1.00 44.34  ? 131  GLY B O   1 
ATOM   2320  N N   . LEU B  1 132 ? 29.413  102.564 140.318 1.00 42.22  ? 132  LEU B N   1 
ATOM   2321  C CA  . LEU B  1 132 ? 27.954  102.730 140.241 1.00 40.67  ? 132  LEU B CA  1 
ATOM   2322  C C   . LEU B  1 132 ? 27.478  103.800 141.209 1.00 41.38  ? 132  LEU B C   1 
ATOM   2323  O O   . LEU B  1 132 ? 28.178  104.151 142.167 1.00 42.22  ? 132  LEU B O   1 
ATOM   2324  C CB  . LEU B  1 132 ? 27.261  101.423 140.569 1.00 39.86  ? 132  LEU B CB  1 
ATOM   2325  C CG  . LEU B  1 132 ? 27.642  100.209 139.719 1.00 38.01  ? 132  LEU B CG  1 
ATOM   2326  C CD1 . LEU B  1 132 ? 26.826  99.023  140.143 1.00 36.44  ? 132  LEU B CD1 1 
ATOM   2327  C CD2 . LEU B  1 132 ? 27.396  100.514 138.253 1.00 35.48  ? 132  LEU B CD2 1 
ATOM   2328  N N   . LYS B  1 133 ? 26.289  104.329 140.985 1.00 41.88  ? 133  LYS B N   1 
ATOM   2329  C CA  . LYS B  1 133 ? 25.820  105.367 141.879 1.00 42.60  ? 133  LYS B CA  1 
ATOM   2330  C C   . LYS B  1 133 ? 24.866  104.765 142.873 1.00 42.10  ? 133  LYS B C   1 
ATOM   2331  O O   . LYS B  1 133 ? 24.509  105.393 143.871 1.00 42.28  ? 133  LYS B O   1 
ATOM   2332  C CB  . LYS B  1 133 ? 25.163  106.495 141.095 1.00 46.25  ? 133  LYS B CB  1 
ATOM   2333  C CG  . LYS B  1 133 ? 26.163  107.287 140.205 1.00 52.42  ? 133  LYS B CG  1 
ATOM   2334  C CD  . LYS B  1 133 ? 25.642  108.686 139.745 1.00 55.61  ? 133  LYS B CD  1 
ATOM   2335  C CE  . LYS B  1 133 ? 24.183  108.638 139.259 1.00 58.50  ? 133  LYS B CE  1 
ATOM   2336  N NZ  . LYS B  1 133 ? 23.953  107.591 138.204 1.00 60.87  ? 133  LYS B NZ  1 
ATOM   2337  N N   . SER B  1 134 ? 24.449  103.532 142.597 1.00 40.17  ? 134  SER B N   1 
ATOM   2338  C CA  . SER B  1 134 ? 23.561  102.821 143.496 1.00 37.11  ? 134  SER B CA  1 
ATOM   2339  C C   . SER B  1 134 ? 24.331  101.989 144.510 1.00 36.04  ? 134  SER B C   1 
ATOM   2340  O O   . SER B  1 134 ? 25.124  101.113 144.157 1.00 34.64  ? 134  SER B O   1 
ATOM   2341  C CB  . SER B  1 134 ? 22.640  101.897 142.733 1.00 38.20  ? 134  SER B CB  1 
ATOM   2342  O OG  . SER B  1 134 ? 21.794  101.224 143.673 1.00 40.93  ? 134  SER B OG  1 
ATOM   2343  N N   . LYS B  1 135 ? 24.105  102.278 145.777 1.00 35.67  ? 135  LYS B N   1 
ATOM   2344  C CA  . LYS B  1 135 ? 24.764  101.554 146.847 1.00 35.17  ? 135  LYS B CA  1 
ATOM   2345  C C   . LYS B  1 135 ? 24.269  100.102 146.768 1.00 35.57  ? 135  LYS B C   1 
ATOM   2346  O O   . LYS B  1 135 ? 25.065  99.148  146.774 1.00 35.01  ? 135  LYS B O   1 
ATOM   2347  C CB  . LYS B  1 135 ? 24.347  102.157 148.161 1.00 33.86  ? 135  LYS B CB  1 
ATOM   2348  C CG  . LYS B  1 135 ? 25.203  101.826 149.354 1.00 36.39  ? 135  LYS B CG  1 
ATOM   2349  C CD  . LYS B  1 135 ? 24.558  102.524 150.555 1.00 38.66  ? 135  LYS B CD  1 
ATOM   2350  C CE  . LYS B  1 135 ? 25.530  102.894 151.656 1.00 40.05  ? 135  LYS B CE  1 
ATOM   2351  N NZ  . LYS B  1 135 ? 24.796  103.691 152.717 1.00 41.03  ? 135  LYS B NZ  1 
ATOM   2352  N N   . ALA B  1 136 ? 22.947  99.951  146.667 1.00 35.18  ? 136  ALA B N   1 
ATOM   2353  C CA  . ALA B  1 136 ? 22.321  98.637  146.622 1.00 33.62  ? 136  ALA B CA  1 
ATOM   2354  C C   . ALA B  1 136 ? 22.867  97.821  145.465 1.00 33.37  ? 136  ALA B C   1 
ATOM   2355  O O   . ALA B  1 136 ? 23.322  96.693  145.641 1.00 32.00  ? 136  ALA B O   1 
ATOM   2356  C CB  . ALA B  1 136 ? 20.842  98.770  146.487 1.00 33.37  ? 136  ALA B CB  1 
ATOM   2357  N N   . LEU B  1 137 ? 22.828  98.384  144.276 1.00 32.43  ? 137  LEU B N   1 
ATOM   2358  C CA  . LEU B  1 137 ? 23.332  97.649  143.147 1.00 33.62  ? 137  LEU B CA  1 
ATOM   2359  C C   . LEU B  1 137 ? 24.822  97.281  143.284 1.00 34.51  ? 137  LEU B C   1 
ATOM   2360  O O   . LEU B  1 137 ? 25.252  96.235  142.768 1.00 34.84  ? 137  LEU B O   1 
ATOM   2361  C CB  . LEU B  1 137 ? 23.110  98.442  141.863 1.00 35.91  ? 137  LEU B CB  1 
ATOM   2362  C CG  . LEU B  1 137 ? 21.721  98.349  141.194 1.00 38.70  ? 137  LEU B CG  1 
ATOM   2363  C CD1 . LEU B  1 137 ? 21.473  96.974  140.700 1.00 41.95  ? 137  LEU B CD1 1 
ATOM   2364  C CD2 . LEU B  1 137 ? 20.641  98.640  142.163 1.00 41.64  ? 137  LEU B CD2 1 
ATOM   2365  N N   . SER B  1 138 ? 25.611  98.125  143.956 1.00 33.61  ? 138  SER B N   1 
ATOM   2366  C CA  . SER B  1 138 ? 27.029  97.857  144.125 1.00 31.88  ? 138  SER B CA  1 
ATOM   2367  C C   . SER B  1 138 ? 27.196  96.697  145.112 1.00 31.56  ? 138  SER B C   1 
ATOM   2368  O O   . SER B  1 138 ? 27.919  95.739  144.847 1.00 29.76  ? 138  SER B O   1 
ATOM   2369  C CB  . SER B  1 138 ? 27.734  99.105  144.644 1.00 32.52  ? 138  SER B CB  1 
ATOM   2370  O OG  . SER B  1 138 ? 27.862  100.063 143.595 1.00 35.41  ? 138  SER B OG  1 
ATOM   2371  N N   . LEU B  1 139 ? 26.508  96.770  146.243 1.00 29.25  ? 139  LEU B N   1 
ATOM   2372  C CA  . LEU B  1 139 ? 26.627  95.707  147.214 1.00 29.65  ? 139  LEU B CA  1 
ATOM   2373  C C   . LEU B  1 139 ? 26.183  94.379  146.574 1.00 29.09  ? 139  LEU B C   1 
ATOM   2374  O O   . LEU B  1 139 ? 26.837  93.333  146.691 1.00 28.37  ? 139  LEU B O   1 
ATOM   2375  C CB  . LEU B  1 139 ? 25.749  96.010  148.438 1.00 29.56  ? 139  LEU B CB  1 
ATOM   2376  C CG  . LEU B  1 139 ? 26.364  96.336  149.811 1.00 30.18  ? 139  LEU B CG  1 
ATOM   2377  C CD1 . LEU B  1 139 ? 27.842  96.054  149.787 1.00 28.54  ? 139  LEU B CD1 1 
ATOM   2378  C CD2 . LEU B  1 139 ? 26.058  97.783  150.208 1.00 26.21  ? 139  LEU B CD2 1 
ATOM   2379  N N   . GLU B  1 140 ? 25.071  94.428  145.871 1.00 28.26  ? 140  GLU B N   1 
ATOM   2380  C CA  . GLU B  1 140 ? 24.559  93.218  145.281 1.00 28.43  ? 140  GLU B CA  1 
ATOM   2381  C C   . GLU B  1 140 ? 25.562  92.581  144.353 1.00 29.22  ? 140  GLU B C   1 
ATOM   2382  O O   . GLU B  1 140 ? 25.760  91.366  144.382 1.00 29.70  ? 140  GLU B O   1 
ATOM   2383  C CB  . GLU B  1 140 ? 23.271  93.494  144.506 1.00 28.39  ? 140  GLU B CB  1 
ATOM   2384  C CG  . GLU B  1 140 ? 22.885  92.357  143.593 1.00 28.60  ? 140  GLU B CG  1 
ATOM   2385  C CD  . GLU B  1 140 ? 21.608  92.593  142.821 1.00 28.44  ? 140  GLU B CD  1 
ATOM   2386  O OE1 . GLU B  1 140 ? 21.437  93.666  142.216 1.00 31.38  ? 140  GLU B OE1 1 
ATOM   2387  O OE2 . GLU B  1 140 ? 20.772  91.691  142.781 1.00 28.62  ? 140  GLU B OE2 1 
ATOM   2388  N N   . LYS B  1 141 ? 26.197  93.393  143.517 1.00 28.78  ? 141  LYS B N   1 
ATOM   2389  C CA  . LYS B  1 141 ? 27.124  92.830  142.565 1.00 28.02  ? 141  LYS B CA  1 
ATOM   2390  C C   . LYS B  1 141 ? 28.310  92.194  143.259 1.00 28.30  ? 141  LYS B C   1 
ATOM   2391  O O   . LYS B  1 141 ? 28.724  91.066  142.934 1.00 27.31  ? 141  LYS B O   1 
ATOM   2392  C CB  . LYS B  1 141 ? 27.598  93.912  141.600 1.00 27.83  ? 141  LYS B CB  1 
ATOM   2393  C CG  . LYS B  1 141 ? 28.681  93.465  140.639 1.00 27.64  ? 141  LYS B CG  1 
ATOM   2394  C CD  . LYS B  1 141 ? 29.135  94.593  139.751 1.00 28.83  ? 141  LYS B CD  1 
ATOM   2395  C CE  . LYS B  1 141 ? 30.187  94.148  138.735 1.00 28.30  ? 141  LYS B CE  1 
ATOM   2396  N NZ  . LYS B  1 141 ? 31.494  93.764  139.321 1.00 24.86  ? 141  LYS B NZ  1 
ATOM   2397  N N   . ALA B  1 142 ? 28.842  92.913  144.237 1.00 26.46  ? 142  ALA B N   1 
ATOM   2398  C CA  . ALA B  1 142 ? 30.014  92.451  144.912 1.00 24.06  ? 142  ALA B CA  1 
ATOM   2399  C C   . ALA B  1 142 ? 29.757  91.219  145.760 1.00 24.22  ? 142  ALA B C   1 
ATOM   2400  O O   . ALA B  1 142 ? 30.622  90.333  145.846 1.00 23.04  ? 142  ALA B O   1 
ATOM   2401  C CB  . ALA B  1 142 ? 30.591  93.577  145.751 1.00 22.88  ? 142  ALA B CB  1 
ATOM   2402  N N   . ARG B  1 143 ? 28.596  91.147  146.401 1.00 23.42  ? 143  ARG B N   1 
ATOM   2403  C CA  . ARG B  1 143 ? 28.375  89.999  147.254 1.00 23.17  ? 143  ARG B CA  1 
ATOM   2404  C C   . ARG B  1 143 ? 28.199  88.776  146.408 1.00 22.54  ? 143  ARG B C   1 
ATOM   2405  O O   . ARG B  1 143 ? 28.786  87.741  146.709 1.00 23.56  ? 143  ARG B O   1 
ATOM   2406  C CB  . ARG B  1 143 ? 27.160  90.185  148.174 1.00 23.58  ? 143  ARG B CB  1 
ATOM   2407  C CG  . ARG B  1 143 ? 27.245  91.396  149.039 1.00 26.69  ? 143  ARG B CG  1 
ATOM   2408  C CD  . ARG B  1 143 ? 26.178  91.457  150.141 1.00 26.66  ? 143  ARG B CD  1 
ATOM   2409  N NE  . ARG B  1 143 ? 26.797  90.921  151.326 1.00 28.95  ? 143  ARG B NE  1 
ATOM   2410  C CZ  . ARG B  1 143 ? 26.648  91.397  152.531 1.00 27.48  ? 143  ARG B CZ  1 
ATOM   2411  N NH1 . ARG B  1 143 ? 25.894  92.422  152.719 1.00 27.43  ? 143  ARG B NH1 1 
ATOM   2412  N NH2 . ARG B  1 143 ? 27.291  90.840  153.530 1.00 32.36  ? 143  ARG B NH2 1 
ATOM   2413  N N   . LYS B  1 144 ? 27.420  88.884  145.337 1.00 21.55  ? 144  LYS B N   1 
ATOM   2414  C CA  . LYS B  1 144 ? 27.200  87.728  144.479 1.00 21.35  ? 144  LYS B CA  1 
ATOM   2415  C C   . LYS B  1 144 ? 28.470  87.267  143.769 1.00 22.26  ? 144  LYS B C   1 
ATOM   2416  O O   . LYS B  1 144 ? 28.768  86.056  143.705 1.00 24.05  ? 144  LYS B O   1 
ATOM   2417  C CB  . LYS B  1 144 ? 26.109  87.995  143.437 1.00 19.27  ? 144  LYS B CB  1 
ATOM   2418  C CG  . LYS B  1 144 ? 24.747  88.278  144.044 1.00 18.91  ? 144  LYS B CG  1 
ATOM   2419  C CD  . LYS B  1 144 ? 23.664  88.458  142.988 1.00 15.86  ? 144  LYS B CD  1 
ATOM   2420  C CE  . LYS B  1 144 ? 22.349  88.623  143.688 1.00 16.94  ? 144  LYS B CE  1 
ATOM   2421  N NZ  . LYS B  1 144 ? 21.237  88.777  142.751 1.00 15.38  ? 144  LYS B NZ  1 
ATOM   2422  N N   . GLU B  1 145 ? 29.252  88.197  143.249 1.00 21.64  ? 145  GLU B N   1 
ATOM   2423  C CA  . GLU B  1 145 ? 30.445  87.745  142.562 1.00 22.22  ? 145  GLU B CA  1 
ATOM   2424  C C   . GLU B  1 145 ? 31.460  87.106  143.490 1.00 22.45  ? 145  GLU B C   1 
ATOM   2425  O O   . GLU B  1 145 ? 32.159  86.201  143.054 1.00 22.86  ? 145  GLU B O   1 
ATOM   2426  C CB  . GLU B  1 145 ? 31.102  88.870  141.804 1.00 23.82  ? 145  GLU B CB  1 
ATOM   2427  C CG  . GLU B  1 145 ? 30.322  89.295  140.591 1.00 28.53  ? 145  GLU B CG  1 
ATOM   2428  C CD  . GLU B  1 145 ? 30.964  90.482  139.805 1.00 30.93  ? 145  GLU B CD  1 
ATOM   2429  O OE1 . GLU B  1 145 ? 32.110  90.943  140.196 1.00 30.68  ? 145  GLU B OE1 1 
ATOM   2430  O OE2 . GLU B  1 145 ? 30.296  90.919  138.801 1.00 29.72  ? 145  GLU B OE2 1 
ATOM   2431  N N   . ALA B  1 146 ? 31.541  87.563  144.746 1.00 20.07  ? 146  ALA B N   1 
ATOM   2432  C CA  . ALA B  1 146 ? 32.475  87.003  145.686 1.00 18.36  ? 146  ALA B CA  1 
ATOM   2433  C C   . ALA B  1 146 ? 32.121  85.523  145.881 1.00 19.60  ? 146  ALA B C   1 
ATOM   2434  O O   . ALA B  1 146 ? 32.983  84.649  145.857 1.00 18.96  ? 146  ALA B O   1 
ATOM   2435  C CB  . ALA B  1 146 ? 32.385  87.740  147.009 1.00 18.06  ? 146  ALA B CB  1 
ATOM   2436  N N   . VAL B  1 147 ? 30.839  85.224  146.052 1.00 20.67  ? 147  VAL B N   1 
ATOM   2437  C CA  . VAL B  1 147 ? 30.456  83.842  146.272 1.00 17.83  ? 147  VAL B CA  1 
ATOM   2438  C C   . VAL B  1 147 ? 30.816  82.997  145.055 1.00 20.01  ? 147  VAL B C   1 
ATOM   2439  O O   . VAL B  1 147 ? 31.480  81.966  145.198 1.00 20.28  ? 147  VAL B O   1 
ATOM   2440  C CB  . VAL B  1 147 ? 28.973  83.724  146.551 1.00 16.46  ? 147  VAL B CB  1 
ATOM   2441  C CG1 . VAL B  1 147 ? 28.594  82.248  146.565 1.00 15.84  ? 147  VAL B CG1 1 
ATOM   2442  C CG2 . VAL B  1 147 ? 28.651  84.347  147.886 1.00 14.15  ? 147  VAL B CG2 1 
ATOM   2443  N N   . THR B  1 148 ? 30.405  83.445  143.864 1.00 18.00  ? 148  THR B N   1 
ATOM   2444  C CA  . THR B  1 148 ? 30.696  82.693  142.664 1.00 17.71  ? 148  THR B CA  1 
ATOM   2445  C C   . THR B  1 148 ? 32.240  82.533  142.460 1.00 18.32  ? 148  THR B C   1 
ATOM   2446  O O   . THR B  1 148 ? 32.771  81.465  142.106 1.00 19.12  ? 148  THR B O   1 
ATOM   2447  C CB  . THR B  1 148 ? 30.037  83.385  141.388 1.00 18.34  ? 148  THR B CB  1 
ATOM   2448  O OG1 . THR B  1 148 ? 28.597  83.390  141.490 1.00 19.45  ? 148  THR B OG1 1 
ATOM   2449  C CG2 . THR B  1 148 ? 30.426  82.647  140.140 1.00 14.74  ? 148  THR B CG2 1 
ATOM   2450  N N   . ASP B  1 149 ? 32.964  83.595  142.707 1.00 16.26  ? 149  ASP B N   1 
ATOM   2451  C CA  . ASP B  1 149 ? 34.381  83.552  142.508 1.00 16.31  ? 149  ASP B CA  1 
ATOM   2452  C C   . ASP B  1 149 ? 34.958  82.527  143.466 1.00 18.49  ? 149  ASP B C   1 
ATOM   2453  O O   . ASP B  1 149 ? 35.841  81.759  143.121 1.00 18.10  ? 149  ASP B O   1 
ATOM   2454  C CB  . ASP B  1 149 ? 34.952  84.945  142.768 1.00 15.93  ? 149  ASP B CB  1 
ATOM   2455  C CG  . ASP B  1 149 ? 36.418  85.070  142.381 1.00 16.79  ? 149  ASP B CG  1 
ATOM   2456  O OD1 . ASP B  1 149 ? 37.227  85.574  143.225 1.00 14.30  ? 149  ASP B OD1 1 
ATOM   2457  O OD2 . ASP B  1 149 ? 36.757  84.661  141.228 1.00 18.15  ? 149  ASP B OD2 1 
ATOM   2458  N N   . GLY B  1 150 ? 34.467  82.525  144.698 1.00 20.73  ? 150  GLY B N   1 
ATOM   2459  C CA  . GLY B  1 150 ? 34.939  81.550  145.661 1.00 22.24  ? 150  GLY B CA  1 
ATOM   2460  C C   . GLY B  1 150 ? 34.577  80.113  145.286 1.00 22.79  ? 150  GLY B C   1 
ATOM   2461  O O   . GLY B  1 150 ? 35.362  79.162  145.438 1.00 23.52  ? 150  GLY B O   1 
ATOM   2462  N N   . LEU B  1 151 ? 33.377  79.933  144.780 1.00 21.93  ? 151  LEU B N   1 
ATOM   2463  C CA  . LEU B  1 151 ? 32.990  78.594  144.386 1.00 22.65  ? 151  LEU B CA  1 
ATOM   2464  C C   . LEU B  1 151 ? 33.936  78.136  143.285 1.00 23.62  ? 151  LEU B C   1 
ATOM   2465  O O   . LEU B  1 151 ? 34.432  77.006  143.302 1.00 24.23  ? 151  LEU B O   1 
ATOM   2466  C CB  . LEU B  1 151 ? 31.568  78.595  143.858 1.00 19.77  ? 151  LEU B CB  1 
ATOM   2467  C CG  . LEU B  1 151 ? 31.100  77.274  143.258 1.00 18.00  ? 151  LEU B CG  1 
ATOM   2468  C CD1 . LEU B  1 151 ? 31.338  76.172  144.225 1.00 15.30  ? 151  LEU B CD1 1 
ATOM   2469  C CD2 . LEU B  1 151 ? 29.614  77.390  142.890 1.00 16.74  ? 151  LEU B CD2 1 
ATOM   2470  N N   . LYS B  1 152 ? 34.180  79.005  142.312 1.00 21.91  ? 152  LYS B N   1 
ATOM   2471  C CA  . LYS B  1 152 ? 35.071  78.618  141.236 1.00 21.18  ? 152  LYS B CA  1 
ATOM   2472  C C   . LYS B  1 152 ? 36.474  78.298  141.729 1.00 21.79  ? 152  LYS B C   1 
ATOM   2473  O O   . LYS B  1 152 ? 37.050  77.279  141.310 1.00 22.15  ? 152  LYS B O   1 
ATOM   2474  C CB  . LYS B  1 152 ? 35.164  79.702  140.167 1.00 20.26  ? 152  LYS B CB  1 
ATOM   2475  C CG  . LYS B  1 152 ? 33.943  79.787  139.288 1.00 20.44  ? 152  LYS B CG  1 
ATOM   2476  C CD  . LYS B  1 152 ? 34.192  80.715  138.113 1.00 20.04  ? 152  LYS B CD  1 
ATOM   2477  C CE  . LYS B  1 152 ? 34.465  82.145  138.509 1.00 18.41  ? 152  LYS B CE  1 
ATOM   2478  N NZ  . LYS B  1 152 ? 34.918  82.903  137.320 1.00 17.57  ? 152  LYS B NZ  1 
ATOM   2479  N N   . ARG B  1 153 ? 37.031  79.132  142.608 1.00 20.70  ? 153  ARG B N   1 
ATOM   2480  C CA  . ARG B  1 153 ? 38.376  78.846  143.087 1.00 21.21  ? 153  ARG B CA  1 
ATOM   2481  C C   . ARG B  1 153 ? 38.427  77.556  143.913 1.00 20.43  ? 153  ARG B C   1 
ATOM   2482  O O   . ARG B  1 153 ? 39.376  76.791  143.786 1.00 20.85  ? 153  ARG B O   1 
ATOM   2483  C CB  . ARG B  1 153 ? 38.955  79.998  143.918 1.00 21.53  ? 153  ARG B CB  1 
ATOM   2484  C CG  . ARG B  1 153 ? 39.157  81.299  143.149 1.00 22.25  ? 153  ARG B CG  1 
ATOM   2485  C CD  . ARG B  1 153 ? 39.700  82.378  144.067 1.00 20.06  ? 153  ARG B CD  1 
ATOM   2486  N NE  . ARG B  1 153 ? 41.120  82.475  143.814 1.00 24.62  ? 153  ARG B NE  1 
ATOM   2487  C CZ  . ARG B  1 153 ? 42.097  82.247  144.696 1.00 24.07  ? 153  ARG B CZ  1 
ATOM   2488  N NH1 . ARG B  1 153 ? 41.851  81.902  145.939 1.00 24.67  ? 153  ARG B NH1 1 
ATOM   2489  N NH2 . ARG B  1 153 ? 43.357  82.354  144.311 1.00 23.94  ? 153  ARG B NH2 1 
ATOM   2490  N N   . ALA B  1 154 ? 37.449  77.320  144.774 1.00 18.31  ? 154  ALA B N   1 
ATOM   2491  C CA  . ALA B  1 154 ? 37.436  76.069  145.533 1.00 18.03  ? 154  ALA B CA  1 
ATOM   2492  C C   . ALA B  1 154 ? 37.426  74.844  144.570 1.00 18.14  ? 154  ALA B C   1 
ATOM   2493  O O   . ALA B  1 154 ? 38.235  73.914  144.707 1.00 17.70  ? 154  ALA B O   1 
ATOM   2494  C CB  . ALA B  1 154 ? 36.208  76.013  146.436 1.00 16.88  ? 154  ALA B CB  1 
ATOM   2495  N N   . LEU B  1 155 ? 36.542  74.876  143.574 1.00 16.55  ? 155  LEU B N   1 
ATOM   2496  C CA  . LEU B  1 155 ? 36.449  73.784  142.621 1.00 18.34  ? 155  LEU B CA  1 
ATOM   2497  C C   . LEU B  1 155 ? 37.755  73.520  141.817 1.00 19.82  ? 155  LEU B C   1 
ATOM   2498  O O   . LEU B  1 155 ? 38.037  72.374  141.488 1.00 20.34  ? 155  LEU B O   1 
ATOM   2499  C CB  . LEU B  1 155 ? 35.281  74.038  141.679 1.00 16.07  ? 155  LEU B CB  1 
ATOM   2500  C CG  . LEU B  1 155 ? 33.939  73.289  141.779 1.00 18.79  ? 155  LEU B CG  1 
ATOM   2501  C CD1 . LEU B  1 155 ? 33.853  72.343  142.935 1.00 16.10  ? 155  LEU B CD1 1 
ATOM   2502  C CD2 . LEU B  1 155 ? 32.800  74.285  141.848 1.00 19.21  ? 155  LEU B CD2 1 
ATOM   2503  N N   . ARG B  1 156 ? 38.535  74.562  141.508 1.00 20.51  ? 156  ARG B N   1 
ATOM   2504  C CA  . ARG B  1 156 ? 39.786  74.406  140.770 1.00 21.35  ? 156  ARG B CA  1 
ATOM   2505  C C   . ARG B  1 156 ? 40.631  73.353  141.445 1.00 22.61  ? 156  ARG B C   1 
ATOM   2506  O O   . ARG B  1 156 ? 41.378  72.660  140.750 1.00 21.91  ? 156  ARG B O   1 
ATOM   2507  C CB  . ARG B  1 156 ? 40.670  75.666  140.770 1.00 23.24  ? 156  ARG B CB  1 
ATOM   2508  C CG  . ARG B  1 156 ? 40.144  76.876  140.043 1.00 29.57  ? 156  ARG B CG  1 
ATOM   2509  C CD  . ARG B  1 156 ? 41.265  77.911  139.803 1.00 34.51  ? 156  ARG B CD  1 
ATOM   2510  N NE  . ARG B  1 156 ? 40.908  79.345  139.705 1.00 35.07  ? 156  ARG B NE  1 
ATOM   2511  C CZ  . ARG B  1 156 ? 39.935  79.853  138.947 1.00 38.46  ? 156  ARG B CZ  1 
ATOM   2512  N NH1 . ARG B  1 156 ? 39.135  79.060  138.149 1.00 37.08  ? 156  ARG B NH1 1 
ATOM   2513  N NH2 . ARG B  1 156 ? 39.748  81.183  139.005 1.00 37.97  ? 156  ARG B NH2 1 
ATOM   2514  N N   . SER B  1 157 ? 40.546  73.263  142.784 1.00 22.33  ? 157  SER B N   1 
ATOM   2515  C CA  . SER B  1 157 ? 41.366  72.313  143.535 1.00 22.37  ? 157  SER B CA  1 
ATOM   2516  C C   . SER B  1 157 ? 41.219  70.863  143.076 1.00 21.60  ? 157  SER B C   1 
ATOM   2517  O O   . SER B  1 157 ? 42.140  70.069  143.241 1.00 21.79  ? 157  SER B O   1 
ATOM   2518  C CB  . SER B  1 157 ? 41.056  72.366  145.024 1.00 20.92  ? 157  SER B CB  1 
ATOM   2519  O OG  . SER B  1 157 ? 41.352  73.614  145.555 1.00 22.35  ? 157  SER B OG  1 
ATOM   2520  N N   . PHE B  1 158 ? 40.091  70.516  142.481 1.00 20.53  ? 158  PHE B N   1 
ATOM   2521  C CA  . PHE B  1 158 ? 39.929  69.140  142.060 1.00 22.61  ? 158  PHE B CA  1 
ATOM   2522  C C   . PHE B  1 158 ? 40.681  68.757  140.795 1.00 23.98  ? 158  PHE B C   1 
ATOM   2523  O O   . PHE B  1 158 ? 40.866  67.567  140.533 1.00 25.68  ? 158  PHE B O   1 
ATOM   2524  C CB  . PHE B  1 158 ? 38.458  68.792  141.913 1.00 21.36  ? 158  PHE B CB  1 
ATOM   2525  C CG  . PHE B  1 158 ? 37.724  68.705  143.219 1.00 20.96  ? 158  PHE B CG  1 
ATOM   2526  C CD1 . PHE B  1 158 ? 36.767  69.664  143.571 1.00 20.24  ? 158  PHE B CD1 1 
ATOM   2527  C CD2 . PHE B  1 158 ? 38.008  67.685  144.111 1.00 18.82  ? 158  PHE B CD2 1 
ATOM   2528  C CE1 . PHE B  1 158 ? 36.123  69.583  144.793 1.00 20.89  ? 158  PHE B CE1 1 
ATOM   2529  C CE2 . PHE B  1 158 ? 37.364  67.604  145.326 1.00 17.05  ? 158  PHE B CE2 1 
ATOM   2530  C CZ  . PHE B  1 158 ? 36.434  68.534  145.674 1.00 17.65  ? 158  PHE B CZ  1 
ATOM   2531  N N   . GLY B  1 159 ? 41.131  69.737  140.013 1.00 23.86  ? 159  GLY B N   1 
ATOM   2532  C CA  . GLY B  1 159 ? 41.869  69.399  138.809 1.00 23.91  ? 159  GLY B CA  1 
ATOM   2533  C C   . GLY B  1 159 ? 41.720  70.327  137.634 1.00 25.14  ? 159  GLY B C   1 
ATOM   2534  O O   . GLY B  1 159 ? 40.968  71.315  137.680 1.00 27.79  ? 159  GLY B O   1 
ATOM   2535  N N   . ASN B  1 160 ? 42.406  70.008  136.550 1.00 24.47  ? 160  ASN B N   1 
ATOM   2536  C CA  . ASN B  1 160 ? 42.332  70.861  135.384 1.00 25.40  ? 160  ASN B CA  1 
ATOM   2537  C C   . ASN B  1 160 ? 40.916  70.976  134.827 1.00 23.27  ? 160  ASN B C   1 
ATOM   2538  O O   . ASN B  1 160 ? 40.476  72.075  134.503 1.00 21.27  ? 160  ASN B O   1 
ATOM   2539  C CB  . ASN B  1 160 ? 43.260  70.351  134.281 1.00 28.07  ? 160  ASN B CB  1 
ATOM   2540  C CG  . ASN B  1 160 ? 44.692  70.282  134.719 1.00 31.92  ? 160  ASN B CG  1 
ATOM   2541  O OD1 . ASN B  1 160 ? 45.237  71.226  135.336 1.00 31.99  ? 160  ASN B OD1 1 
ATOM   2542  N ND2 . ASN B  1 160 ? 45.338  69.168  134.386 1.00 32.09  ? 160  ASN B ND2 1 
ATOM   2543  N N   . ALA B  1 161 ? 40.229  69.841  134.695 1.00 21.28  ? 161  ALA B N   1 
ATOM   2544  C CA  . ALA B  1 161 ? 38.881  69.852  134.140 1.00 19.97  ? 161  ALA B CA  1 
ATOM   2545  C C   . ALA B  1 161 ? 37.941  70.776  134.888 1.00 20.39  ? 161  ALA B C   1 
ATOM   2546  O O   . ALA B  1 161 ? 36.982  71.205  134.336 1.00 21.53  ? 161  ALA B O   1 
ATOM   2547  C CB  . ALA B  1 161 ? 38.306  68.474  134.101 1.00 18.84  ? 161  ALA B CB  1 
ATOM   2548  N N   . LEU B  1 162 ? 38.207  71.095  136.149 1.00 21.82  ? 162  LEU B N   1 
ATOM   2549  C CA  . LEU B  1 162 ? 37.334  72.012  136.878 1.00 22.75  ? 162  LEU B CA  1 
ATOM   2550  C C   . LEU B  1 162 ? 37.931  73.432  136.963 1.00 24.29  ? 162  LEU B C   1 
ATOM   2551  O O   . LEU B  1 162 ? 37.512  74.228  137.807 1.00 24.61  ? 162  LEU B O   1 
ATOM   2552  C CB  . LEU B  1 162 ? 37.042  71.486  138.284 1.00 21.83  ? 162  LEU B CB  1 
ATOM   2553  C CG  . LEU B  1 162 ? 35.781  70.632  138.490 1.00 21.71  ? 162  LEU B CG  1 
ATOM   2554  C CD1 . LEU B  1 162 ? 34.603  71.495  138.274 1.00 23.62  ? 162  LEU B CD1 1 
ATOM   2555  C CD2 . LEU B  1 162 ? 35.696  69.509  137.500 1.00 23.33  ? 162  LEU B CD2 1 
ATOM   2556  N N   . GLY B  1 163 ? 38.922  73.728  136.112 1.00 24.42  ? 163  GLY B N   1 
ATOM   2557  C CA  . GLY B  1 163 ? 39.504  75.044  136.073 1.00 24.22  ? 163  GLY B CA  1 
ATOM   2558  C C   . GLY B  1 163 ? 40.928  75.241  136.515 1.00 26.76  ? 163  GLY B C   1 
ATOM   2559  O O   . GLY B  1 163 ? 41.443  76.321  136.380 1.00 28.35  ? 163  GLY B O   1 
ATOM   2560  N N   . ASN B  1 164 ? 41.612  74.234  137.024 1.00 28.81  ? 164  ASN B N   1 
ATOM   2561  C CA  . ASN B  1 164 ? 42.977  74.474  137.473 1.00 28.68  ? 164  ASN B CA  1 
ATOM   2562  C C   . ASN B  1 164 ? 43.958  74.841  136.346 1.00 30.72  ? 164  ASN B C   1 
ATOM   2563  O O   . ASN B  1 164 ? 45.049  75.364  136.562 1.00 32.19  ? 164  ASN B O   1 
ATOM   2564  C CB  . ASN B  1 164 ? 43.470  73.263  138.232 1.00 28.78  ? 164  ASN B CB  1 
ATOM   2565  C CG  . ASN B  1 164 ? 44.781  73.512  138.887 1.00 30.73  ? 164  ASN B CG  1 
ATOM   2566  O OD1 . ASN B  1 164 ? 45.710  72.723  138.727 1.00 33.74  ? 164  ASN B OD1 1 
ATOM   2567  N ND2 . ASN B  1 164 ? 44.887  74.618  139.642 1.00 30.59  ? 164  ASN B ND2 1 
ATOM   2568  N N   . CYS B  1 165 ? 43.597  74.571  135.118 1.00 32.18  ? 165  CYS B N   1 
ATOM   2569  C CA  . CYS B  1 165 ? 44.516  74.932  134.067 1.00 35.80  ? 165  CYS B CA  1 
ATOM   2570  C C   . CYS B  1 165 ? 44.518  76.473  133.857 1.00 37.64  ? 165  CYS B C   1 
ATOM   2571  O O   . CYS B  1 165 ? 45.558  77.092  133.588 1.00 38.16  ? 165  CYS B O   1 
ATOM   2572  C CB  . CYS B  1 165 ? 44.144  74.185  132.757 1.00 33.92  ? 165  CYS B CB  1 
ATOM   2573  S SG  . CYS B  1 165 ? 42.383  74.294  132.238 1.00 39.57  ? 165  CYS B SG  1 
ATOM   2574  N N   . ILE B  1 166 ? 43.343  77.068  134.023 1.00 38.14  ? 166  ILE B N   1 
ATOM   2575  C CA  . ILE B  1 166 ? 43.080  78.477  133.773 1.00 38.93  ? 166  ILE B CA  1 
ATOM   2576  C C   . ILE B  1 166 ? 44.119  79.547  134.047 1.00 40.56  ? 166  ILE B C   1 
ATOM   2577  O O   . ILE B  1 166 ? 44.163  80.583  133.397 1.00 40.55  ? 166  ILE B O   1 
ATOM   2578  C CB  . ILE B  1 166 ? 41.747  78.864  134.444 1.00 38.15  ? 166  ILE B CB  1 
ATOM   2579  C CG1 . ILE B  1 166 ? 40.829  79.535  133.421 1.00 37.12  ? 166  ILE B CG1 1 
ATOM   2580  C CG2 . ILE B  1 166 ? 41.980  79.713  135.637 1.00 35.89  ? 166  ILE B CG2 1 
ATOM   2581  C CD1 . ILE B  1 166 ? 41.236  80.890  133.055 1.00 37.40  ? 166  ILE B CD1 1 
ATOM   2582  N N   . LEU B  1 167 ? 44.987  79.309  134.994 1.00 42.89  ? 167  LEU B N   1 
ATOM   2583  C CA  . LEU B  1 167 ? 45.965  80.323  135.298 1.00 44.79  ? 167  LEU B CA  1 
ATOM   2584  C C   . LEU B  1 167 ? 47.391  79.889  134.926 1.00 46.51  ? 167  LEU B C   1 
ATOM   2585  O O   . LEU B  1 167 ? 48.362  80.555  135.266 1.00 46.39  ? 167  LEU B O   1 
ATOM   2586  C CB  . LEU B  1 167 ? 45.807  80.718  136.782 1.00 45.43  ? 167  LEU B CB  1 
ATOM   2587  C CG  . LEU B  1 167 ? 45.706  79.629  137.869 1.00 47.14  ? 167  LEU B CG  1 
ATOM   2588  C CD1 . LEU B  1 167 ? 44.827  78.423  137.490 1.00 45.92  ? 167  LEU B CD1 1 
ATOM   2589  C CD2 . LEU B  1 167 ? 47.116  79.131  138.142 1.00 50.85  ? 167  LEU B CD2 1 
ATOM   2590  N N   . ASP B  1 168 ? 47.490  78.778  134.189 1.00 48.35  ? 168  ASP B N   1 
ATOM   2591  C CA  . ASP B  1 168 ? 48.753  78.204  133.716 1.00 49.43  ? 168  ASP B CA  1 
ATOM   2592  C C   . ASP B  1 168 ? 49.109  78.935  132.433 1.00 50.48  ? 168  ASP B C   1 
ATOM   2593  O O   . ASP B  1 168 ? 48.481  78.733  131.403 1.00 51.13  ? 168  ASP B O   1 
ATOM   2594  C CB  . ASP B  1 168 ? 48.556  76.708  133.447 1.00 48.92  ? 168  ASP B CB  1 
ATOM   2595  C CG  . ASP B  1 168 ? 49.787  76.035  132.881 1.00 48.92  ? 168  ASP B CG  1 
ATOM   2596  O OD1 . ASP B  1 168 ? 49.709  74.789  132.695 1.00 50.51  ? 168  ASP B OD1 1 
ATOM   2597  O OD2 . ASP B  1 168 ? 50.804  76.728  132.627 1.00 47.87  ? 168  ASP B OD2 1 
ATOM   2598  N N   . LYS B  1 169 ? 50.117  79.796  132.499 1.00 52.72  ? 169  LYS B N   1 
ATOM   2599  C CA  . LYS B  1 169 ? 50.517  80.581  131.329 1.00 54.14  ? 169  LYS B CA  1 
ATOM   2600  C C   . LYS B  1 169 ? 50.830  79.791  130.063 1.00 53.35  ? 169  LYS B C   1 
ATOM   2601  O O   . LYS B  1 169 ? 50.594  80.310  128.959 1.00 53.05  ? 169  LYS B O   1 
ATOM   2602  C CB  . LYS B  1 169 ? 51.692  81.472  131.678 1.00 56.16  ? 169  LYS B CB  1 
ATOM   2603  C CG  . LYS B  1 169 ? 51.347  82.471  132.773 1.00 60.28  ? 169  LYS B CG  1 
ATOM   2604  C CD  . LYS B  1 169 ? 52.580  83.144  133.360 1.00 62.17  ? 169  LYS B CD  1 
ATOM   2605  C CE  . LYS B  1 169 ? 52.185  83.942  134.599 1.00 64.84  ? 169  LYS B CE  1 
ATOM   2606  N NZ  . LYS B  1 169 ? 53.371  84.565  135.282 1.00 67.09  ? 169  LYS B NZ  1 
ATOM   2607  N N   . ASP B  1 170 ? 51.331  78.556  130.200 1.00 51.74  ? 170  ASP B N   1 
ATOM   2608  C CA  . ASP B  1 170 ? 51.646  77.753  129.015 1.00 51.50  ? 170  ASP B CA  1 
ATOM   2609  C C   . ASP B  1 170 ? 50.384  77.237  128.344 1.00 49.80  ? 170  ASP B C   1 
ATOM   2610  O O   . ASP B  1 170 ? 50.363  76.992  127.131 1.00 50.69  ? 170  ASP B O   1 
ATOM   2611  C CB  . ASP B  1 170 ? 52.535  76.576  129.374 1.00 54.16  ? 170  ASP B CB  1 
ATOM   2612  C CG  . ASP B  1 170 ? 53.894  77.014  129.889 1.00 56.85  ? 170  ASP B CG  1 
ATOM   2613  O OD1 . ASP B  1 170 ? 54.556  77.823  129.187 1.00 57.63  ? 170  ASP B OD1 1 
ATOM   2614  O OD2 . ASP B  1 170 ? 54.291  76.545  130.991 1.00 57.64  ? 170  ASP B OD2 1 
ATOM   2615  N N   . TYR B  1 171 ? 49.333  77.084  129.145 1.00 47.20  ? 171  TYR B N   1 
ATOM   2616  C CA  . TYR B  1 171 ? 48.037  76.616  128.671 1.00 44.71  ? 171  TYR B CA  1 
ATOM   2617  C C   . TYR B  1 171 ? 47.381  77.785  127.968 1.00 45.51  ? 171  TYR B C   1 
ATOM   2618  O O   . TYR B  1 171 ? 46.845  77.648  126.864 1.00 46.00  ? 171  TYR B O   1 
ATOM   2619  C CB  . TYR B  1 171 ? 47.184  76.164  129.865 1.00 41.16  ? 171  TYR B CB  1 
ATOM   2620  C CG  . TYR B  1 171 ? 45.671  76.095  129.622 1.00 37.70  ? 171  TYR B CG  1 
ATOM   2621  C CD1 . TYR B  1 171 ? 45.093  75.041  128.892 1.00 36.11  ? 171  TYR B CD1 1 
ATOM   2622  C CD2 . TYR B  1 171 ? 44.833  77.124  130.054 1.00 34.38  ? 171  TYR B CD2 1 
ATOM   2623  C CE1 . TYR B  1 171 ? 43.731  75.029  128.594 1.00 32.26  ? 171  TYR B CE1 1 
ATOM   2624  C CE2 . TYR B  1 171 ? 43.485  77.123  129.752 1.00 31.56  ? 171  TYR B CE2 1 
ATOM   2625  C CZ  . TYR B  1 171 ? 42.941  76.080  129.021 1.00 32.94  ? 171  TYR B CZ  1 
ATOM   2626  O OH  . TYR B  1 171 ? 41.603  76.106  128.695 1.00 31.26  ? 171  TYR B OH  1 
ATOM   2627  N N   . LEU B  1 172 ? 47.416  78.940  128.609 1.00 45.92  ? 172  LEU B N   1 
ATOM   2628  C CA  . LEU B  1 172 ? 46.824  80.116  128.006 1.00 48.85  ? 172  LEU B CA  1 
ATOM   2629  C C   . LEU B  1 172 ? 47.477  80.400  126.649 1.00 51.39  ? 172  LEU B C   1 
ATOM   2630  O O   . LEU B  1 172 ? 46.796  80.639  125.632 1.00 52.05  ? 172  LEU B O   1 
ATOM   2631  C CB  . LEU B  1 172 ? 47.003  81.318  128.919 1.00 47.44  ? 172  LEU B CB  1 
ATOM   2632  C CG  . LEU B  1 172 ? 46.182  81.250  130.208 1.00 48.08  ? 172  LEU B CG  1 
ATOM   2633  C CD1 . LEU B  1 172 ? 46.485  82.457  131.082 1.00 46.54  ? 172  LEU B CD1 1 
ATOM   2634  C CD2 . LEU B  1 172 ? 44.712  81.210  129.863 1.00 45.92  ? 172  LEU B CD2 1 
ATOM   2635  N N   . ARG B  1 173 ? 48.807  80.343  126.638 1.00 53.56  ? 173  ARG B N   1 
ATOM   2636  C CA  . ARG B  1 173 ? 49.591  80.606  125.449 1.00 54.81  ? 173  ARG B CA  1 
ATOM   2637  C C   . ARG B  1 173 ? 49.122  79.711  124.303 1.00 55.44  ? 173  ARG B C   1 
ATOM   2638  O O   . ARG B  1 173 ? 48.750  80.192  123.230 1.00 56.34  ? 173  ARG B O   1 
ATOM   2639  C CB  . ARG B  1 173 ? 51.051  80.352  125.785 1.00 57.38  ? 173  ARG B CB  1 
ATOM   2640  C CG  . ARG B  1 173 ? 52.076  81.003  124.855 1.00 62.00  ? 173  ARG B CG  1 
ATOM   2641  C CD  . ARG B  1 173 ? 53.410  81.250  125.596 1.00 64.15  ? 173  ARG B CD  1 
ATOM   2642  N NE  . ARG B  1 173 ? 53.826  80.072  126.354 1.00 66.74  ? 173  ARG B NE  1 
ATOM   2643  C CZ  . ARG B  1 173 ? 54.089  78.887  125.801 1.00 69.10  ? 173  ARG B CZ  1 
ATOM   2644  N NH1 . ARG B  1 173 ? 53.980  78.727  124.479 1.00 70.53  ? 173  ARG B NH1 1 
ATOM   2645  N NH2 . ARG B  1 173 ? 54.468  77.859  126.563 1.00 68.68  ? 173  ARG B NH2 1 
ATOM   2646  N N   . SER B  1 174 ? 49.089  78.407  124.545 1.00 54.93  ? 174  SER B N   1 
ATOM   2647  C CA  . SER B  1 174 ? 48.699  77.482  123.507 1.00 54.19  ? 174  SER B CA  1 
ATOM   2648  C C   . SER B  1 174 ? 47.216  77.550  123.168 1.00 55.05  ? 174  SER B C   1 
ATOM   2649  O O   . SER B  1 174 ? 46.757  76.963  122.181 1.00 55.56  ? 174  SER B O   1 
ATOM   2650  C CB  . SER B  1 174 ? 49.159  76.067  123.896 1.00 52.71  ? 174  SER B CB  1 
ATOM   2651  O OG  . SER B  1 174 ? 48.075  75.208  124.012 1.00 51.76  ? 174  SER B OG  1 
ATOM   2652  N N   . LEU B  1 175 ? 46.461  78.284  123.968 1.00 55.64  ? 175  LEU B N   1 
ATOM   2653  C CA  . LEU B  1 175 ? 45.037  78.423  123.702 1.00 57.25  ? 175  LEU B CA  1 
ATOM   2654  C C   . LEU B  1 175 ? 44.886  79.523  122.638 1.00 59.15  ? 175  LEU B C   1 
ATOM   2655  O O   . LEU B  1 175 ? 44.009  79.452  121.762 1.00 59.06  ? 175  LEU B O   1 
ATOM   2656  C CB  . LEU B  1 175 ? 44.298  78.858  124.965 1.00 56.06  ? 175  LEU B CB  1 
ATOM   2657  C CG  . LEU B  1 175 ? 43.216  78.026  125.651 1.00 54.93  ? 175  LEU B CG  1 
ATOM   2658  C CD1 . LEU B  1 175 ? 42.480  78.961  126.612 1.00 53.20  ? 175  LEU B CD1 1 
ATOM   2659  C CD2 . LEU B  1 175 ? 42.251  77.414  124.663 1.00 53.85  ? 175  LEU B CD2 1 
ATOM   2660  N N   . ASN B  1 176 ? 45.741  80.543  122.744 1.00 60.74  ? 176  ASN B N   1 
ATOM   2661  C CA  . ASN B  1 176 ? 45.751  81.668  121.822 1.00 62.35  ? 176  ASN B CA  1 
ATOM   2662  C C   . ASN B  1 176 ? 46.088  81.240  120.420 1.00 62.59  ? 176  ASN B C   1 
ATOM   2663  O O   . ASN B  1 176 ? 45.605  81.826  119.465 1.00 62.23  ? 176  ASN B O   1 
ATOM   2664  C CB  . ASN B  1 176 ? 46.757  82.706  122.285 1.00 64.92  ? 176  ASN B CB  1 
ATOM   2665  C CG  . ASN B  1 176 ? 46.095  83.858  122.991 1.00 67.62  ? 176  ASN B CG  1 
ATOM   2666  O OD1 . ASN B  1 176 ? 45.463  84.707  122.348 1.00 70.12  ? 176  ASN B OD1 1 
ATOM   2667  N ND2 . ASN B  1 176 ? 46.208  83.895  124.320 1.00 67.92  ? 176  ASN B ND2 1 
ATOM   2668  N N   . LYS B  1 177 ? 46.928  80.219  120.309 1.00 63.32  ? 177  LYS B N   1 
ATOM   2669  C CA  . LYS B  1 177 ? 47.332  79.679  119.016 1.00 64.98  ? 177  LYS B CA  1 
ATOM   2670  C C   . LYS B  1 177 ? 46.218  78.797  118.445 1.00 65.96  ? 177  LYS B C   1 
ATOM   2671  O O   . LYS B  1 177 ? 46.462  77.951  117.591 1.00 67.15  ? 177  LYS B O   1 
ATOM   2672  C CB  . LYS B  1 177 ? 48.628  78.850  119.157 1.00 64.13  ? 177  LYS B CB  1 
ATOM   2673  C CG  . LYS B  1 177 ? 49.822  79.648  119.635 1.00 64.92  ? 177  LYS B CG  1 
ATOM   2674  C CD  . LYS B  1 177 ? 51.056  78.774  119.864 1.00 66.35  ? 177  LYS B CD  1 
ATOM   2675  C CE  . LYS B  1 177 ? 52.223  79.620  120.445 1.00 68.19  ? 177  LYS B CE  1 
ATOM   2676  N NZ  . LYS B  1 177 ? 53.464  78.851  120.799 1.00 68.54  ? 177  LYS B NZ  1 
ATOM   2677  N N   . LEU B  1 178 ? 44.999  78.947  118.951 1.00 66.91  ? 178  LEU B N   1 
ATOM   2678  C CA  . LEU B  1 178 ? 43.901  78.147  118.434 1.00 67.84  ? 178  LEU B CA  1 
ATOM   2679  C C   . LEU B  1 178 ? 42.978  79.012  117.584 1.00 70.38  ? 178  LEU B C   1 
ATOM   2680  O O   . LEU B  1 178 ? 42.972  80.242  117.708 1.00 69.87  ? 178  LEU B O   1 
ATOM   2681  C CB  . LEU B  1 178 ? 43.118  77.480  119.566 1.00 66.02  ? 178  LEU B CB  1 
ATOM   2682  C CG  . LEU B  1 178 ? 43.516  76.042  119.931 1.00 65.38  ? 178  LEU B CG  1 
ATOM   2683  C CD1 . LEU B  1 178 ? 42.393  75.409  120.726 1.00 64.19  ? 178  LEU B CD1 1 
ATOM   2684  C CD2 . LEU B  1 178 ? 43.779  75.210  118.697 1.00 62.99  ? 178  LEU B CD2 1 
ATOM   2685  N N   . PRO B  1 179 ? 42.192  78.374  116.696 1.00 73.19  ? 179  PRO B N   1 
ATOM   2686  C CA  . PRO B  1 179 ? 41.247  79.034  115.794 1.00 75.85  ? 179  PRO B CA  1 
ATOM   2687  C C   . PRO B  1 179 ? 40.265  79.951  116.484 1.00 78.84  ? 179  PRO B C   1 
ATOM   2688  O O   . PRO B  1 179 ? 39.735  79.618  117.537 1.00 79.52  ? 179  PRO B O   1 
ATOM   2689  C CB  . PRO B  1 179 ? 40.512  77.867  115.144 1.00 75.48  ? 179  PRO B CB  1 
ATOM   2690  C CG  . PRO B  1 179 ? 41.523  76.754  115.165 1.00 74.97  ? 179  PRO B CG  1 
ATOM   2691  C CD  . PRO B  1 179 ? 42.110  76.908  116.543 1.00 74.15  ? 179  PRO B CD  1 
ATOM   2692  N N   . ARG B  1 180 ? 40.039  81.114  115.884 1.00 82.72  ? 180  ARG B N   1 
ATOM   2693  C CA  . ARG B  1 180 ? 39.051  82.076  116.373 1.00 85.94  ? 180  ARG B CA  1 
ATOM   2694  C C   . ARG B  1 180 ? 37.844  81.135  116.396 1.00 87.13  ? 180  ARG B C   1 
ATOM   2695  O O   . ARG B  1 180 ? 37.742  80.237  115.547 1.00 87.21  ? 180  ARG B O   1 
ATOM   2696  C CB  . ARG B  1 180 ? 38.848  83.171  115.310 1.00 88.21  ? 180  ARG B CB  1 
ATOM   2697  C CG  . ARG B  1 180 ? 38.080  84.446  115.715 1.00 91.36  ? 180  ARG B CG  1 
ATOM   2698  C CD  . ARG B  1 180 ? 37.728  85.263  114.436 1.00 93.71  ? 180  ARG B CD  1 
ATOM   2699  N NE  . ARG B  1 180 ? 37.364  86.669  114.671 1.00 95.77  ? 180  ARG B NE  1 
ATOM   2700  C CZ  . ARG B  1 180 ? 36.993  87.524  113.710 1.00 96.80  ? 180  ARG B CZ  1 
ATOM   2701  N NH1 . ARG B  1 180 ? 36.930  87.126  112.437 1.00 96.98  ? 180  ARG B NH1 1 
ATOM   2702  N NH2 . ARG B  1 180 ? 36.686  88.783  114.017 1.00 96.62  ? 180  ARG B NH2 1 
ATOM   2703  N N   . GLN B  1 181 ? 36.941  81.294  117.354 1.00 88.22  ? 181  GLN B N   1 
ATOM   2704  C CA  . GLN B  1 181 ? 35.812  80.375  117.381 1.00 88.88  ? 181  GLN B CA  1 
ATOM   2705  C C   . GLN B  1 181 ? 34.466  81.058  117.550 1.00 88.89  ? 181  GLN B C   1 
ATOM   2706  O O   . GLN B  1 181 ? 34.254  81.841  118.487 1.00 89.10  ? 181  GLN B O   1 
ATOM   2707  C CB  . GLN B  1 181 ? 36.009  79.312  118.480 1.00 89.76  ? 181  GLN B CB  1 
ATOM   2708  C CG  . GLN B  1 181 ? 35.832  79.804  119.928 1.00 89.11  ? 181  GLN B CG  1 
ATOM   2709  C CD  . GLN B  1 181 ? 35.039  78.814  120.778 1.00 88.71  ? 181  GLN B CD  1 
ATOM   2710  O OE1 . GLN B  1 181 ? 34.774  77.680  120.368 1.00 87.08  ? 181  GLN B OE1 1 
ATOM   2711  N NE2 . GLN B  1 181 ? 34.663  79.243  121.966 1.00 89.67  ? 181  GLN B NE2 1 
ATOM   2712  N N   . LEU B  1 182 ? 33.560  80.737  116.632 1.00 88.51  ? 182  LEU B N   1 
ATOM   2713  C CA  . LEU B  1 182 ? 32.205  81.291  116.631 1.00 88.32  ? 182  LEU B CA  1 
ATOM   2714  C C   . LEU B  1 182 ? 31.331  80.777  117.786 1.00 87.14  ? 182  LEU B C   1 
ATOM   2715  O O   . LEU B  1 182 ? 31.267  79.574  118.047 1.00 86.69  ? 182  LEU B O   1 
ATOM   2716  C CB  . LEU B  1 182 ? 31.523  80.992  115.280 1.00 89.45  ? 182  LEU B CB  1 
ATOM   2717  C CG  . LEU B  1 182 ? 31.394  79.540  114.785 1.00 90.14  ? 182  LEU B CG  1 
ATOM   2718  C CD1 . LEU B  1 182 ? 30.578  79.532  113.486 1.00 89.92  ? 182  LEU B CD1 1 
ATOM   2719  C CD2 . LEU B  1 182 ? 32.794  78.905  114.577 1.00 89.93  ? 182  LEU B CD2 1 
ATOM   2720  N N   . PRO B  1 183 ? 30.632  81.686  118.478 1.00 86.28  ? 183  PRO B N   1 
ATOM   2721  C CA  . PRO B  1 183 ? 29.796  81.215  119.581 1.00 85.46  ? 183  PRO B CA  1 
ATOM   2722  C C   . PRO B  1 183 ? 28.801  80.237  118.986 1.00 84.80  ? 183  PRO B C   1 
ATOM   2723  O O   . PRO B  1 183 ? 28.304  80.461  117.876 1.00 84.32  ? 183  PRO B O   1 
ATOM   2724  C CB  . PRO B  1 183 ? 29.127  82.486  120.062 1.00 85.64  ? 183  PRO B CB  1 
ATOM   2725  C CG  . PRO B  1 183 ? 28.875  83.195  118.765 1.00 86.25  ? 183  PRO B CG  1 
ATOM   2726  C CD  . PRO B  1 183 ? 30.199  83.024  118.033 1.00 86.51  ? 183  PRO B CD  1 
ATOM   2727  N N   . LEU B  1 184 ? 28.525  79.159  119.718 1.00 83.87  ? 184  LEU B N   1 
ATOM   2728  C CA  . LEU B  1 184 ? 27.600  78.132  119.257 1.00 82.63  ? 184  LEU B CA  1 
ATOM   2729  C C   . LEU B  1 184 ? 26.124  78.449  119.513 1.00 80.79  ? 184  LEU B C   1 
ATOM   2730  O O   . LEU B  1 184 ? 25.767  79.081  120.511 1.00 80.17  ? 184  LEU B O   1 
ATOM   2731  C CB  . LEU B  1 184 ? 27.938  76.774  119.902 1.00 84.17  ? 184  LEU B CB  1 
ATOM   2732  C CG  . LEU B  1 184 ? 28.504  75.629  119.024 1.00 85.73  ? 184  LEU B CG  1 
ATOM   2733  C CD1 . LEU B  1 184 ? 28.377  74.284  119.787 1.00 85.51  ? 184  LEU B CD1 1 
ATOM   2734  C CD2 . LEU B  1 184 ? 27.753  75.540  117.672 1.00 86.15  ? 184  LEU B CD2 1 
ATOM   2735  N N   . GLU B  1 185 ? 25.278  78.001  118.585 1.00 78.25  ? 185  GLU B N   1 
ATOM   2736  C CA  . GLU B  1 185 ? 23.836  78.176  118.685 1.00 75.42  ? 185  GLU B CA  1 
ATOM   2737  C C   . GLU B  1 185 ? 23.297  77.138  119.658 1.00 71.45  ? 185  GLU B C   1 
ATOM   2738  O O   . GLU B  1 185 ? 23.751  76.004  119.661 1.00 71.40  ? 185  GLU B O   1 
ATOM   2739  C CB  . GLU B  1 185 ? 23.169  77.953  117.324 1.00 77.53  ? 185  GLU B CB  1 
ATOM   2740  C CG  . GLU B  1 185 ? 23.288  79.101  116.344 1.00 81.55  ? 185  GLU B CG  1 
ATOM   2741  C CD  . GLU B  1 185 ? 22.623  80.393  116.845 1.00 84.66  ? 185  GLU B CD  1 
ATOM   2742  O OE1 . GLU B  1 185 ? 21.388  80.384  117.109 1.00 85.90  ? 185  GLU B OE1 1 
ATOM   2743  O OE2 . GLU B  1 185 ? 23.341  81.421  116.967 1.00 86.52  ? 185  GLU B OE2 1 
ATOM   2744  N N   . VAL B  1 186 ? 22.329  77.517  120.479 1.00 67.18  ? 186  VAL B N   1 
ATOM   2745  C CA  . VAL B  1 186 ? 21.739  76.566  121.405 1.00 63.30  ? 186  VAL B CA  1 
ATOM   2746  C C   . VAL B  1 186 ? 20.422  76.074  120.783 1.00 61.48  ? 186  VAL B C   1 
ATOM   2747  O O   . VAL B  1 186 ? 19.615  76.876  120.317 1.00 60.76  ? 186  VAL B O   1 
ATOM   2748  C CB  . VAL B  1 186 ? 21.490  77.214  122.794 1.00 61.90  ? 186  VAL B CB  1 
ATOM   2749  C CG1 . VAL B  1 186 ? 20.464  76.443  123.555 1.00 61.73  ? 186  VAL B CG1 1 
ATOM   2750  C CG2 . VAL B  1 186 ? 22.776  77.242  123.595 1.00 61.36  ? 186  VAL B CG2 1 
ATOM   2751  N N   . ASP B  1 187 ? 20.228  74.757  120.755 1.00 58.93  ? 187  ASP B N   1 
ATOM   2752  C CA  . ASP B  1 187 ? 19.026  74.178  120.196 1.00 57.37  ? 187  ASP B CA  1 
ATOM   2753  C C   . ASP B  1 187 ? 17.894  73.985  121.185 1.00 55.48  ? 187  ASP B C   1 
ATOM   2754  O O   . ASP B  1 187 ? 17.828  72.961  121.884 1.00 55.10  ? 187  ASP B O   1 
ATOM   2755  C CB  . ASP B  1 187 ? 19.318  72.822  119.593 1.00 60.18  ? 187  ASP B CB  1 
ATOM   2756  C CG  . ASP B  1 187 ? 18.060  72.160  119.057 1.00 62.31  ? 187  ASP B CG  1 
ATOM   2757  O OD1 . ASP B  1 187 ? 18.027  70.911  118.934 1.00 64.28  ? 187  ASP B OD1 1 
ATOM   2758  O OD2 . ASP B  1 187 ? 17.100  72.912  118.750 1.00 63.26  ? 187  ASP B OD2 1 
ATOM   2759  N N   . LEU B  1 188 ? 16.966  74.928  121.197 1.00 52.73  ? 188  LEU B N   1 
ATOM   2760  C CA  . LEU B  1 188 ? 15.847  74.861  122.108 1.00 50.99  ? 188  LEU B CA  1 
ATOM   2761  C C   . LEU B  1 188 ? 14.829  73.786  121.756 1.00 50.66  ? 188  LEU B C   1 
ATOM   2762  O O   . LEU B  1 188 ? 13.766  73.654  122.394 1.00 50.90  ? 188  LEU B O   1 
ATOM   2763  C CB  . LEU B  1 188 ? 15.194  76.221  122.173 1.00 49.63  ? 188  LEU B CB  1 
ATOM   2764  C CG  . LEU B  1 188 ? 16.192  77.186  122.803 1.00 49.86  ? 188  LEU B CG  1 
ATOM   2765  C CD1 . LEU B  1 188 ? 15.692  78.614  122.794 1.00 50.29  ? 188  LEU B CD1 1 
ATOM   2766  C CD2 . LEU B  1 188 ? 16.427  76.736  124.212 1.00 49.87  ? 188  LEU B CD2 1 
ATOM   2767  N N   . THR B  1 189 ? 15.172  72.963  120.780 1.00 49.75  ? 189  THR B N   1 
ATOM   2768  C CA  . THR B  1 189 ? 14.233  71.946  120.362 1.00 49.79  ? 189  THR B CA  1 
ATOM   2769  C C   . THR B  1 189 ? 13.878  71.023  121.507 1.00 49.06  ? 189  THR B C   1 
ATOM   2770  O O   . THR B  1 189 ? 12.719  70.783  121.777 1.00 49.77  ? 189  THR B O   1 
ATOM   2771  C CB  . THR B  1 189 ? 14.763  71.186  119.081 1.00 50.56  ? 189  THR B CB  1 
ATOM   2772  O OG1 . THR B  1 189 ? 13.847  71.434  118.003 1.00 49.64  ? 189  THR B OG1 1 
ATOM   2773  C CG2 . THR B  1 189 ? 14.910  69.668  119.294 1.00 50.33  ? 189  THR B CG2 1 
ATOM   2774  N N   . LYS B  1 190 ? 14.869  70.569  122.242 1.00 48.64  ? 190  LYS B N   1 
ATOM   2775  C CA  . LYS B  1 190 ? 14.583  69.661  123.338 1.00 47.42  ? 190  LYS B CA  1 
ATOM   2776  C C   . LYS B  1 190 ? 14.683  70.286  124.752 1.00 44.58  ? 190  LYS B C   1 
ATOM   2777  O O   . LYS B  1 190 ? 15.124  69.629  125.712 1.00 43.76  ? 190  LYS B O   1 
ATOM   2778  C CB  . LYS B  1 190 ? 15.513  68.462  123.178 1.00 51.17  ? 190  LYS B CB  1 
ATOM   2779  C CG  . LYS B  1 190 ? 15.546  67.997  121.729 1.00 54.81  ? 190  LYS B CG  1 
ATOM   2780  C CD  . LYS B  1 190 ? 16.430  66.803  121.506 1.00 59.08  ? 190  LYS B CD  1 
ATOM   2781  C CE  . LYS B  1 190 ? 15.635  65.722  120.757 1.00 61.31  ? 190  LYS B CE  1 
ATOM   2782  N NZ  . LYS B  1 190 ? 16.492  64.545  120.409 1.00 62.25  ? 190  LYS B NZ  1 
ATOM   2783  N N   . ALA B  1 191 ? 14.282  71.553  124.870 1.00 40.80  ? 191  ALA B N   1 
ATOM   2784  C CA  . ALA B  1 191 ? 14.304  72.256  126.149 1.00 36.88  ? 191  ALA B CA  1 
ATOM   2785  C C   . ALA B  1 191 ? 13.095  71.817  126.972 1.00 35.28  ? 191  ALA B C   1 
ATOM   2786  O O   . ALA B  1 191 ? 12.044  71.536  126.416 1.00 34.25  ? 191  ALA B O   1 
ATOM   2787  C CB  . ALA B  1 191 ? 14.240  73.735  125.921 1.00 35.83  ? 191  ALA B CB  1 
ATOM   2788  N N   . LYS B  1 192 ? 13.249  71.762  128.298 1.00 34.25  ? 192  LYS B N   1 
ATOM   2789  C CA  . LYS B  1 192 ? 12.162  71.379  129.206 1.00 31.52  ? 192  LYS B CA  1 
ATOM   2790  C C   . LYS B  1 192 ? 11.110  72.404  128.923 1.00 33.36  ? 192  LYS B C   1 
ATOM   2791  O O   . LYS B  1 192 ? 11.408  73.608  128.917 1.00 32.52  ? 192  LYS B O   1 
ATOM   2792  C CB  . LYS B  1 192 ? 12.583  71.533  130.657 1.00 27.87  ? 192  LYS B CB  1 
ATOM   2793  C CG  . LYS B  1 192 ? 11.681  70.933  131.671 1.00 23.53  ? 192  LYS B CG  1 
ATOM   2794  C CD  . LYS B  1 192 ? 12.245  71.244  133.012 1.00 23.79  ? 192  LYS B CD  1 
ATOM   2795  C CE  . LYS B  1 192 ? 11.647  70.454  134.153 1.00 22.27  ? 192  LYS B CE  1 
ATOM   2796  N NZ  . LYS B  1 192 ? 10.377  69.888  133.842 1.00 22.10  ? 192  LYS B NZ  1 
ATOM   2797  N N   . ARG B  1 193 ? 9.881   71.947  128.716 1.00 34.78  ? 193  ARG B N   1 
ATOM   2798  C CA  . ARG B  1 193 ? 8.843   72.888  128.410 1.00 36.48  ? 193  ARG B CA  1 
ATOM   2799  C C   . ARG B  1 193 ? 7.683   72.928  129.377 1.00 37.26  ? 193  ARG B C   1 
ATOM   2800  O O   . ARG B  1 193 ? 6.838   73.808  129.280 1.00 36.57  ? 193  ARG B O   1 
ATOM   2801  C CB  . ARG B  1 193 ? 8.447   72.693  126.935 1.00 38.53  ? 193  ARG B CB  1 
ATOM   2802  C CG  . ARG B  1 193 ? 9.440   73.472  126.059 1.00 39.80  ? 193  ARG B CG  1 
ATOM   2803  C CD  . ARG B  1 193 ? 9.591   73.003  124.653 1.00 43.68  ? 193  ARG B CD  1 
ATOM   2804  N NE  . ARG B  1 193 ? 8.707   73.623  123.651 1.00 47.00  ? 193  ARG B NE  1 
ATOM   2805  C CZ  . ARG B  1 193 ? 7.896   74.636  123.880 1.00 48.04  ? 193  ARG B CZ  1 
ATOM   2806  N NH1 . ARG B  1 193 ? 7.866   75.169  125.078 1.00 49.42  ? 193  ARG B NH1 1 
ATOM   2807  N NH2 . ARG B  1 193 ? 7.066   75.066  122.937 1.00 52.85  ? 193  ARG B NH2 1 
ATOM   2808  N N   . GLN B  1 194 ? 7.726   72.043  130.381 1.00 39.53  ? 194  GLN B N   1 
ATOM   2809  C CA  . GLN B  1 194 ? 6.703   71.912  131.454 1.00 40.10  ? 194  GLN B CA  1 
ATOM   2810  C C   . GLN B  1 194 ? 7.343   71.350  132.730 1.00 37.70  ? 194  GLN B C   1 
ATOM   2811  O O   . GLN B  1 194 ? 8.411   70.786  132.664 1.00 38.86  ? 194  GLN B O   1 
ATOM   2812  C CB  . GLN B  1 194 ? 5.629   70.953  130.971 1.00 44.52  ? 194  GLN B CB  1 
ATOM   2813  C CG  . GLN B  1 194 ? 6.150   70.036  129.894 1.00 52.31  ? 194  GLN B CG  1 
ATOM   2814  C CD  . GLN B  1 194 ? 5.180   68.914  129.587 1.00 57.60  ? 194  GLN B CD  1 
ATOM   2815  O OE1 . GLN B  1 194 ? 4.745   68.733  128.424 1.00 60.42  ? 194  GLN B OE1 1 
ATOM   2816  N NE2 . GLN B  1 194 ? 4.833   68.134  130.626 1.00 58.30  ? 194  GLN B NE2 1 
ATOM   2817  N N   . ASP B  1 195 ? 6.710   71.456  133.887 1.00 35.35  ? 195  ASP B N   1 
ATOM   2818  C CA  . ASP B  1 195 ? 7.351   70.921  135.109 1.00 33.42  ? 195  ASP B CA  1 
ATOM   2819  C C   . ASP B  1 195 ? 7.433   69.394  135.268 1.00 32.00  ? 195  ASP B C   1 
ATOM   2820  O O   . ASP B  1 195 ? 8.470   68.830  135.598 1.00 28.81  ? 195  ASP B O   1 
ATOM   2821  C CB  . ASP B  1 195 ? 6.667   71.462  136.351 1.00 34.02  ? 195  ASP B CB  1 
ATOM   2822  C CG  . ASP B  1 195 ? 6.563   73.001  136.364 1.00 37.23  ? 195  ASP B CG  1 
ATOM   2823  O OD1 . ASP B  1 195 ? 5.624   73.501  137.026 1.00 41.67  ? 195  ASP B OD1 1 
ATOM   2824  O OD2 . ASP B  1 195 ? 7.370   73.731  135.759 1.00 36.83  ? 195  ASP B OD2 1 
ATOM   2825  N N   . LEU B  1 196 ? 6.325   68.729  135.012 1.00 32.84  ? 196  LEU B N   1 
ATOM   2826  C CA  . LEU B  1 196 ? 6.243   67.301  135.195 1.00 32.76  ? 196  LEU B CA  1 
ATOM   2827  C C   . LEU B  1 196 ? 7.381   66.608  134.511 1.00 33.21  ? 196  LEU B C   1 
ATOM   2828  O O   . LEU B  1 196 ? 7.713   66.947  133.388 1.00 34.80  ? 196  LEU B O   1 
ATOM   2829  C CB  . LEU B  1 196 ? 4.880   66.823  134.704 1.00 34.09  ? 196  LEU B CB  1 
ATOM   2830  C CG  . LEU B  1 196 ? 4.266   65.422  134.943 1.00 35.29  ? 196  LEU B CG  1 
ATOM   2831  C CD1 . LEU B  1 196 ? 4.697   64.524  133.799 1.00 35.90  ? 196  LEU B CD1 1 
ATOM   2832  C CD2 . LEU B  1 196 ? 4.621   64.828  136.334 1.00 34.60  ? 196  LEU B CD2 1 
ATOM   2833  N N   . GLU B  1 197 ? 8.000   65.673  135.233 1.00 33.02  ? 197  GLU B N   1 
ATOM   2834  C CA  . GLU B  1 197 ? 9.122   64.857  134.788 1.00 32.14  ? 197  GLU B CA  1 
ATOM   2835  C C   . GLU B  1 197 ? 8.696   63.381  134.948 1.00 32.88  ? 197  GLU B C   1 
ATOM   2836  O O   . GLU B  1 197 ? 9.035   62.707  135.932 1.00 32.28  ? 197  GLU B O   1 
ATOM   2837  C CB  . GLU B  1 197 ? 10.314  65.164  135.660 1.00 31.31  ? 197  GLU B CB  1 
ATOM   2838  C CG  . GLU B  1 197 ? 10.935  66.477  135.368 1.00 30.94  ? 197  GLU B CG  1 
ATOM   2839  C CD  . GLU B  1 197 ? 11.679  66.482  134.043 1.00 33.00  ? 197  GLU B CD  1 
ATOM   2840  O OE1 . GLU B  1 197 ? 11.894  65.354  133.496 1.00 32.49  ? 197  GLU B OE1 1 
ATOM   2841  O OE2 . GLU B  1 197 ? 12.057  67.603  133.574 1.00 31.13  ? 197  GLU B OE2 1 
ATOM   2842  N N   . PRO B  1 198 ? 7.942   62.865  133.970 1.00 33.37  ? 198  PRO B N   1 
ATOM   2843  C CA  . PRO B  1 198 ? 7.393   61.498  133.896 1.00 33.72  ? 198  PRO B CA  1 
ATOM   2844  C C   . PRO B  1 198 ? 8.335   60.416  134.369 1.00 34.07  ? 198  PRO B C   1 
ATOM   2845  O O   . PRO B  1 198 ? 8.084   59.750  135.399 1.00 34.12  ? 198  PRO B O   1 
ATOM   2846  C CB  . PRO B  1 198 ? 7.025   61.345  132.437 1.00 33.23  ? 198  PRO B CB  1 
ATOM   2847  C CG  . PRO B  1 198 ? 6.610   62.772  132.084 1.00 34.92  ? 198  PRO B CG  1 
ATOM   2848  C CD  . PRO B  1 198 ? 7.706   63.593  132.713 1.00 33.58  ? 198  PRO B CD  1 
ATOM   2849  N N   . SER B  1 199 ? 9.421   60.241  133.621 1.00 32.82  ? 199  SER B N   1 
ATOM   2850  C CA  . SER B  1 199 ? 10.440  59.258  133.977 1.00 33.01  ? 199  SER B CA  1 
ATOM   2851  C C   . SER B  1 199 ? 10.953  59.424  135.426 1.00 32.56  ? 199  SER B C   1 
ATOM   2852  O O   . SER B  1 199 ? 11.126  58.449  136.179 1.00 33.72  ? 199  SER B O   1 
ATOM   2853  C CB  . SER B  1 199 ? 11.611  59.389  133.042 1.00 33.49  ? 199  SER B CB  1 
ATOM   2854  O OG  . SER B  1 199 ? 12.603  58.505  133.469 1.00 38.51  ? 199  SER B OG  1 
ATOM   2855  N N   . VAL B  1 200 ? 11.206  60.660  135.825 1.00 31.27  ? 200  VAL B N   1 
ATOM   2856  C CA  . VAL B  1 200 ? 11.676  60.892  137.175 1.00 31.84  ? 200  VAL B CA  1 
ATOM   2857  C C   . VAL B  1 200 ? 10.620  60.475  138.197 1.00 33.42  ? 200  VAL B C   1 
ATOM   2858  O O   . VAL B  1 200 ? 10.943  59.918  139.248 1.00 32.14  ? 200  VAL B O   1 
ATOM   2859  C CB  . VAL B  1 200 ? 12.010  62.391  137.436 1.00 30.04  ? 200  VAL B CB  1 
ATOM   2860  C CG1 . VAL B  1 200 ? 12.241  62.599  138.922 1.00 26.85  ? 200  VAL B CG1 1 
ATOM   2861  C CG2 . VAL B  1 200 ? 13.201  62.814  136.619 1.00 27.25  ? 200  VAL B CG2 1 
ATOM   2862  N N   . GLU B  1 201 ? 9.360   60.796  137.913 1.00 35.22  ? 201  GLU B N   1 
ATOM   2863  C CA  . GLU B  1 201 ? 8.299   60.445  138.840 1.00 37.02  ? 201  GLU B CA  1 
ATOM   2864  C C   . GLU B  1 201 ? 8.249   58.898  138.894 1.00 37.06  ? 201  GLU B C   1 
ATOM   2865  O O   . GLU B  1 201 ? 8.281   58.291  139.970 1.00 35.96  ? 201  GLU B O   1 
ATOM   2866  C CB  . GLU B  1 201 ? 6.979   61.108  138.381 1.00 39.48  ? 201  GLU B CB  1 
ATOM   2867  C CG  . GLU B  1 201 ? 5.730   60.771  139.212 1.00 44.80  ? 201  GLU B CG  1 
ATOM   2868  C CD  . GLU B  1 201 ? 5.782   61.149  140.744 1.00 49.28  ? 201  GLU B CD  1 
ATOM   2869  O OE1 . GLU B  1 201 ? 4.859   60.682  141.473 1.00 49.48  ? 201  GLU B OE1 1 
ATOM   2870  O OE2 . GLU B  1 201 ? 6.700   61.906  141.215 1.00 51.49  ? 201  GLU B OE2 1 
ATOM   2871  N N   . GLU B  1 202 ? 8.267   58.249  137.745 1.00 37.71  ? 202  GLU B N   1 
ATOM   2872  C CA  . GLU B  1 202 ? 8.239   56.806  137.764 1.00 41.03  ? 202  GLU B CA  1 
ATOM   2873  C C   . GLU B  1 202 ? 9.303   56.256  138.717 1.00 42.03  ? 202  GLU B C   1 
ATOM   2874  O O   . GLU B  1 202 ? 8.994   55.510  139.671 1.00 40.98  ? 202  GLU B O   1 
ATOM   2875  C CB  . GLU B  1 202 ? 8.473   56.256  136.370 1.00 44.59  ? 202  GLU B CB  1 
ATOM   2876  C CG  . GLU B  1 202 ? 7.685   54.973  136.117 1.00 51.49  ? 202  GLU B CG  1 
ATOM   2877  C CD  . GLU B  1 202 ? 8.405   53.959  135.212 1.00 55.72  ? 202  GLU B CD  1 
ATOM   2878  O OE1 . GLU B  1 202 ? 8.243   52.744  135.486 1.00 56.40  ? 202  GLU B OE1 1 
ATOM   2879  O OE2 . GLU B  1 202 ? 9.103   54.364  134.238 1.00 58.65  ? 202  GLU B OE2 1 
ATOM   2880  N N   . ALA B  1 203 ? 10.559  56.649  138.482 1.00 42.66  ? 203  ALA B N   1 
ATOM   2881  C CA  . ALA B  1 203 ? 11.663  56.171  139.321 1.00 42.31  ? 203  ALA B CA  1 
ATOM   2882  C C   . ALA B  1 203 ? 11.497  56.430  140.805 1.00 42.87  ? 203  ALA B C   1 
ATOM   2883  O O   . ALA B  1 203 ? 11.846  55.587  141.622 1.00 41.88  ? 203  ALA B O   1 
ATOM   2884  C CB  . ALA B  1 203 ? 12.922  56.761  138.865 1.00 41.49  ? 203  ALA B CB  1 
ATOM   2885  N N   . ARG B  1 204 ? 10.975  57.612  141.139 1.00 45.24  ? 204  ARG B N   1 
ATOM   2886  C CA  . ARG B  1 204 ? 10.774  58.035  142.527 1.00 47.68  ? 204  ARG B CA  1 
ATOM   2887  C C   . ARG B  1 204 ? 9.716   57.219  143.228 1.00 51.05  ? 204  ARG B C   1 
ATOM   2888  O O   . ARG B  1 204 ? 9.793   56.996  144.428 1.00 51.69  ? 204  ARG B O   1 
ATOM   2889  C CB  . ARG B  1 204 ? 10.355  59.494  142.602 1.00 44.95  ? 204  ARG B CB  1 
ATOM   2890  C CG  . ARG B  1 204 ? 10.866  60.163  143.821 1.00 42.00  ? 204  ARG B CG  1 
ATOM   2891  C CD  . ARG B  1 204 ? 10.072  61.370  144.221 1.00 41.15  ? 204  ARG B CD  1 
ATOM   2892  N NE  . ARG B  1 204 ? 9.799   62.423  143.221 1.00 39.68  ? 204  ARG B NE  1 
ATOM   2893  C CZ  . ARG B  1 204 ? 10.693  63.111  142.516 1.00 37.58  ? 204  ARG B CZ  1 
ATOM   2894  N NH1 . ARG B  1 204 ? 10.259  64.055  141.675 1.00 36.30  ? 204  ARG B NH1 1 
ATOM   2895  N NH2 . ARG B  1 204 ? 11.992  62.828  142.607 1.00 35.96  ? 204  ARG B NH2 1 
ATOM   2896  N N   . TYR B  1 205 ? 8.708   56.795  142.480 1.00 55.15  ? 205  TYR B N   1 
ATOM   2897  C CA  . TYR B  1 205 ? 7.653   55.996  143.059 1.00 58.79  ? 205  TYR B CA  1 
ATOM   2898  C C   . TYR B  1 205 ? 8.165   54.572  143.305 1.00 60.26  ? 205  TYR B C   1 
ATOM   2899  O O   . TYR B  1 205 ? 7.805   53.953  144.296 1.00 60.90  ? 205  TYR B O   1 
ATOM   2900  C CB  . TYR B  1 205 ? 6.432   55.991  142.133 1.00 61.05  ? 205  TYR B CB  1 
ATOM   2901  C CG  . TYR B  1 205 ? 5.263   55.268  142.729 1.00 64.06  ? 205  TYR B CG  1 
ATOM   2902  C CD1 . TYR B  1 205 ? 4.723   55.689  143.959 1.00 64.83  ? 205  TYR B CD1 1 
ATOM   2903  C CD2 . TYR B  1 205 ? 4.727   54.119  142.108 1.00 65.32  ? 205  TYR B CD2 1 
ATOM   2904  C CE1 . TYR B  1 205 ? 3.682   54.992  144.577 1.00 66.28  ? 205  TYR B CE1 1 
ATOM   2905  C CE2 . TYR B  1 205 ? 3.672   53.403  142.711 1.00 66.92  ? 205  TYR B CE2 1 
ATOM   2906  C CZ  . TYR B  1 205 ? 3.153   53.847  143.952 1.00 67.72  ? 205  TYR B CZ  1 
ATOM   2907  O OH  . TYR B  1 205 ? 2.110   53.163  144.569 1.00 68.73  ? 205  TYR B OH  1 
ATOM   2908  N N   . ASN B  1 206 ? 9.004   54.054  142.411 1.00 62.29  ? 206  ASN B N   1 
ATOM   2909  C CA  . ASN B  1 206 ? 9.561   52.714  142.585 1.00 64.34  ? 206  ASN B CA  1 
ATOM   2910  C C   . ASN B  1 206 ? 10.641  52.698  143.630 1.00 66.42  ? 206  ASN B C   1 
ATOM   2911  O O   . ASN B  1 206 ? 11.013  51.651  144.117 1.00 66.84  ? 206  ASN B O   1 
ATOM   2912  C CB  . ASN B  1 206 ? 10.187  52.205  141.300 1.00 64.16  ? 206  ASN B CB  1 
ATOM   2913  C CG  . ASN B  1 206 ? 9.200   52.093  140.208 1.00 64.49  ? 206  ASN B CG  1 
ATOM   2914  O OD1 . ASN B  1 206 ? 8.014   51.936  140.484 1.00 64.15  ? 206  ASN B OD1 1 
ATOM   2915  N ND2 . ASN B  1 206 ? 9.662   52.171  138.946 1.00 64.49  ? 206  ASN B ND2 1 
ATOM   2916  N N   . SER B  1 207 ? 11.170  53.865  143.946 1.00 69.38  ? 207  SER B N   1 
ATOM   2917  C CA  . SER B  1 207 ? 12.233  53.957  144.917 1.00 72.60  ? 207  SER B CA  1 
ATOM   2918  C C   . SER B  1 207 ? 11.704  53.730  146.307 1.00 75.87  ? 207  SER B C   1 
ATOM   2919  O O   . SER B  1 207 ? 12.378  53.107  147.124 1.00 76.53  ? 207  SER B O   1 
ATOM   2920  C CB  . SER B  1 207 ? 12.899  55.331  144.874 1.00 71.53  ? 207  SER B CB  1 
ATOM   2921  O OG  . SER B  1 207 ? 12.279  56.219  145.787 1.00 70.12  ? 207  SER B OG  1 
ATOM   2922  N N   . CYS B  1 208 ? 10.503  54.237  146.582 1.00 79.99  ? 208  CYS B N   1 
ATOM   2923  C CA  . CYS B  1 208 ? 9.899   54.117  147.923 1.00 84.08  ? 208  CYS B CA  1 
ATOM   2924  C C   . CYS B  1 208 ? 9.783   52.661  148.370 1.00 86.49  ? 208  CYS B C   1 
ATOM   2925  O O   . CYS B  1 208 ? 9.573   52.387  149.562 1.00 87.04  ? 208  CYS B O   1 
ATOM   2926  C CB  . CYS B  1 208 ? 8.507   54.769  147.952 1.00 84.64  ? 208  CYS B CB  1 
ATOM   2927  S SG  . CYS B  1 208 ? 8.397   56.424  147.189 1.00 83.86  ? 208  CYS B SG  1 
ATOM   2928  N N   . ARG B  1 209 ? 9.927   51.756  147.392 1.00 89.30  ? 209  ARG B N   1 
ATOM   2929  C CA  . ARG B  1 209 ? 9.857   50.293  147.563 1.00 91.70  ? 209  ARG B CA  1 
ATOM   2930  C C   . ARG B  1 209 ? 11.263  49.660  147.575 1.00 91.49  ? 209  ARG B C   1 
ATOM   2931  O O   . ARG B  1 209 ? 11.587  48.793  146.745 1.00 90.84  ? 209  ARG B O   1 
ATOM   2932  C CB  . ARG B  1 209 ? 9.045   49.660  146.413 1.00 94.26  ? 209  ARG B CB  1 
ATOM   2933  C CG  . ARG B  1 209 ? 7.678   50.289  146.143 1.00 97.69  ? 209  ARG B CG  1 
ATOM   2934  C CD  . ARG B  1 209 ? 7.193   49.847  144.774 1.00 101.23 ? 209  ARG B CD  1 
ATOM   2935  N NE  . ARG B  1 209 ? 5.857   50.343  144.434 1.00 104.99 ? 209  ARG B NE  1 
ATOM   2936  C CZ  . ARG B  1 209 ? 5.182   49.975  143.338 1.00 106.79 ? 209  ARG B CZ  1 
ATOM   2937  N NH1 . ARG B  1 209 ? 5.726   49.109  142.479 1.00 107.26 ? 209  ARG B NH1 1 
ATOM   2938  N NH2 . ARG B  1 209 ? 3.958   50.455  143.097 1.00 107.17 ? 209  ARG B NH2 1 
ATOM   2939  N N   . LEU C  1 24  ? 15.569  56.794  158.259 1.00 56.41  ? 24   LEU C N   1 
ATOM   2940  C CA  . LEU C  1 24  ? 15.468  56.950  156.765 1.00 56.28  ? 24   LEU C CA  1 
ATOM   2941  C C   . LEU C  1 24  ? 14.687  58.218  156.344 1.00 55.82  ? 24   LEU C C   1 
ATOM   2942  O O   . LEU C  1 24  ? 14.031  58.286  155.273 1.00 55.41  ? 24   LEU C O   1 
ATOM   2943  C CB  . LEU C  1 24  ? 14.812  55.708  156.152 1.00 57.27  ? 24   LEU C CB  1 
ATOM   2944  C CG  . LEU C  1 24  ? 15.557  55.282  154.870 1.00 58.77  ? 24   LEU C CG  1 
ATOM   2945  C CD1 . LEU C  1 24  ? 15.471  56.363  153.797 1.00 58.48  ? 24   LEU C CD1 1 
ATOM   2946  C CD2 . LEU C  1 24  ? 17.027  55.004  155.212 1.00 57.42  ? 24   LEU C CD2 1 
ATOM   2947  N N   . CYS C  1 25  ? 14.782  59.223  157.215 1.00 54.02  ? 25   CYS C N   1 
ATOM   2948  C CA  . CYS C  1 25  ? 14.123  60.518  157.061 1.00 50.97  ? 25   CYS C CA  1 
ATOM   2949  C C   . CYS C  1 25  ? 14.903  61.476  156.125 1.00 48.70  ? 25   CYS C C   1 
ATOM   2950  O O   . CYS C  1 25  ? 15.945  61.110  155.558 1.00 48.36  ? 25   CYS C O   1 
ATOM   2951  C CB  . CYS C  1 25  ? 14.047  61.140  158.442 1.00 51.38  ? 25   CYS C CB  1 
ATOM   2952  S SG  . CYS C  1 25  ? 15.716  61.332  159.140 1.00 52.21  ? 25   CYS C SG  1 
ATOM   2953  N N   . PHE C  1 26  ? 14.417  62.712  156.009 1.00 43.87  ? 26   PHE C N   1 
ATOM   2954  C CA  . PHE C  1 26  ? 15.073  63.698  155.170 1.00 38.98  ? 26   PHE C CA  1 
ATOM   2955  C C   . PHE C  1 26  ? 16.530  63.894  155.551 1.00 36.95  ? 26   PHE C C   1 
ATOM   2956  O O   . PHE C  1 26  ? 16.848  64.023  156.709 1.00 36.35  ? 26   PHE C O   1 
ATOM   2957  C CB  . PHE C  1 26  ? 14.353  65.027  155.270 1.00 36.80  ? 26   PHE C CB  1 
ATOM   2958  C CG  . PHE C  1 26  ? 14.772  65.991  154.237 1.00 32.16  ? 26   PHE C CG  1 
ATOM   2959  C CD1 . PHE C  1 26  ? 14.151  65.989  153.007 1.00 29.64  ? 26   PHE C CD1 1 
ATOM   2960  C CD2 . PHE C  1 26  ? 15.839  66.859  154.472 1.00 29.92  ? 26   PHE C CD2 1 
ATOM   2961  C CE1 . PHE C  1 26  ? 14.577  66.841  151.994 1.00 29.73  ? 26   PHE C CE1 1 
ATOM   2962  C CE2 . PHE C  1 26  ? 16.282  67.713  153.474 1.00 30.10  ? 26   PHE C CE2 1 
ATOM   2963  C CZ  . PHE C  1 26  ? 15.645  67.705  152.224 1.00 31.05  ? 26   PHE C CZ  1 
ATOM   2964  N N   . GLY C  1 27  ? 17.409  63.925  154.559 1.00 36.82  ? 27   GLY C N   1 
ATOM   2965  C CA  . GLY C  1 27  ? 18.823  64.103  154.829 1.00 36.51  ? 27   GLY C CA  1 
ATOM   2966  C C   . GLY C  1 27  ? 19.578  62.781  154.911 1.00 38.07  ? 27   GLY C C   1 
ATOM   2967  O O   . GLY C  1 27  ? 20.823  62.733  154.870 1.00 37.47  ? 27   GLY C O   1 
ATOM   2968  N N   . GLN C  1 28  ? 18.829  61.688  155.009 1.00 39.11  ? 28   GLN C N   1 
ATOM   2969  C CA  . GLN C  1 28  ? 19.442  60.386  155.116 1.00 40.18  ? 28   GLN C CA  1 
ATOM   2970  C C   . GLN C  1 28  ? 19.071  59.402  154.055 1.00 40.01  ? 28   GLN C C   1 
ATOM   2971  O O   . GLN C  1 28  ? 19.339  58.219  154.210 1.00 40.63  ? 28   GLN C O   1 
ATOM   2972  C CB  . GLN C  1 28  ? 19.110  59.774  156.441 1.00 42.72  ? 28   GLN C CB  1 
ATOM   2973  C CG  . GLN C  1 28  ? 19.742  60.457  157.608 1.00 46.79  ? 28   GLN C CG  1 
ATOM   2974  C CD  . GLN C  1 28  ? 19.150  59.941  158.924 1.00 50.39  ? 28   GLN C CD  1 
ATOM   2975  O OE1 . GLN C  1 28  ? 19.643  60.277  160.001 1.00 53.31  ? 28   GLN C OE1 1 
ATOM   2976  N NE2 . GLN C  1 28  ? 18.075  59.121  158.837 1.00 51.17  ? 28   GLN C NE2 1 
ATOM   2977  N N   . CYS C  1 29  ? 18.404  59.857  153.010 1.00 38.69  ? 29   CYS C N   1 
ATOM   2978  C CA  . CYS C  1 29  ? 18.067  58.964  151.949 1.00 39.25  ? 29   CYS C CA  1 
ATOM   2979  C C   . CYS C  1 29  ? 19.274  58.864  151.077 1.00 39.93  ? 29   CYS C C   1 
ATOM   2980  O O   . CYS C  1 29  ? 20.213  59.629  151.211 1.00 42.36  ? 29   CYS C O   1 
ATOM   2981  C CB  . CYS C  1 29  ? 16.952  59.516  151.124 1.00 39.80  ? 29   CYS C CB  1 
ATOM   2982  S SG  . CYS C  1 29  ? 15.405  59.438  151.948 1.00 47.11  ? 29   CYS C SG  1 
ATOM   2983  N N   . GLN C  1 30  ? 19.270  57.889  150.192 1.00 40.19  ? 30   GLN C N   1 
ATOM   2984  C CA  . GLN C  1 30  ? 20.345  57.747  149.251 1.00 38.76  ? 30   GLN C CA  1 
ATOM   2985  C C   . GLN C  1 30  ? 19.547  57.537  147.984 1.00 37.75  ? 30   GLN C C   1 
ATOM   2986  O O   . GLN C  1 30  ? 18.556  56.832  147.982 1.00 39.19  ? 30   GLN C O   1 
ATOM   2987  C CB  . GLN C  1 30  ? 21.196  56.549  149.569 1.00 40.01  ? 30   GLN C CB  1 
ATOM   2988  C CG  . GLN C  1 30  ? 22.479  56.501  148.752 1.00 44.23  ? 30   GLN C CG  1 
ATOM   2989  C CD  . GLN C  1 30  ? 23.235  55.146  148.852 1.00 46.82  ? 30   GLN C CD  1 
ATOM   2990  O OE1 . GLN C  1 30  ? 24.153  54.904  148.063 1.00 47.29  ? 30   GLN C OE1 1 
ATOM   2991  N NE2 . GLN C  1 30  ? 22.850  54.273  149.821 1.00 46.48  ? 30   GLN C NE2 1 
ATOM   2992  N N   . TYR C  1 31  ? 19.917  58.207  146.911 1.00 36.82  ? 31   TYR C N   1 
ATOM   2993  C CA  . TYR C  1 31  ? 19.157  58.019  145.693 1.00 35.64  ? 31   TYR C CA  1 
ATOM   2994  C C   . TYR C  1 31  ? 19.372  56.636  145.140 1.00 36.40  ? 31   TYR C C   1 
ATOM   2995  O O   . TYR C  1 31  ? 20.500  56.133  145.151 1.00 37.84  ? 31   TYR C O   1 
ATOM   2996  C CB  . TYR C  1 31  ? 19.548  59.047  144.625 1.00 31.52  ? 31   TYR C CB  1 
ATOM   2997  C CG  . TYR C  1 31  ? 18.914  60.386  144.874 1.00 30.11  ? 31   TYR C CG  1 
ATOM   2998  C CD1 . TYR C  1 31  ? 19.622  61.441  145.516 1.00 28.25  ? 31   TYR C CD1 1 
ATOM   2999  C CD2 . TYR C  1 31  ? 17.606  60.615  144.494 1.00 27.77  ? 31   TYR C CD2 1 
ATOM   3000  C CE1 . TYR C  1 31  ? 19.027  62.656  145.751 1.00 24.03  ? 31   TYR C CE1 1 
ATOM   3001  C CE2 . TYR C  1 31  ? 17.015  61.839  144.721 1.00 26.77  ? 31   TYR C CE2 1 
ATOM   3002  C CZ  . TYR C  1 31  ? 17.728  62.851  145.347 1.00 25.65  ? 31   TYR C CZ  1 
ATOM   3003  O OH  . TYR C  1 31  ? 17.093  64.054  145.544 1.00 23.95  ? 31   TYR C OH  1 
ATOM   3004  N N   . THR C  1 32  ? 18.289  56.020  144.683 1.00 35.35  ? 32   THR C N   1 
ATOM   3005  C CA  . THR C  1 32  ? 18.385  54.734  144.032 1.00 35.98  ? 32   THR C CA  1 
ATOM   3006  C C   . THR C  1 32  ? 19.010  55.021  142.664 1.00 36.52  ? 32   THR C C   1 
ATOM   3007  O O   . THR C  1 32  ? 18.915  56.144  142.153 1.00 37.93  ? 32   THR C O   1 
ATOM   3008  C CB  . THR C  1 32  ? 17.004  54.117  143.810 1.00 37.03  ? 32   THR C CB  1 
ATOM   3009  O OG1 . THR C  1 32  ? 16.240  54.919  142.882 1.00 39.66  ? 32   THR C OG1 1 
ATOM   3010  C CG2 . THR C  1 32  ? 16.277  54.002  145.159 1.00 36.72  ? 32   THR C CG2 1 
ATOM   3011  N N   . ALA C  1 33  ? 19.647  54.030  142.053 1.00 35.72  ? 33   ALA C N   1 
ATOM   3012  C CA  . ALA C  1 33  ? 20.257  54.247  140.739 1.00 35.23  ? 33   ALA C CA  1 
ATOM   3013  C C   . ALA C  1 33  ? 19.240  54.784  139.715 1.00 36.18  ? 33   ALA C C   1 
ATOM   3014  O O   . ALA C  1 33  ? 19.544  55.675  138.907 1.00 34.37  ? 33   ALA C O   1 
ATOM   3015  C CB  . ALA C  1 33  ? 20.859  52.973  140.240 1.00 33.87  ? 33   ALA C CB  1 
ATOM   3016  N N   . GLU C  1 34  ? 18.017  54.259  139.773 1.00 36.80  ? 34   GLU C N   1 
ATOM   3017  C CA  . GLU C  1 34  ? 17.013  54.687  138.824 1.00 36.60  ? 34   GLU C CA  1 
ATOM   3018  C C   . GLU C  1 34  ? 16.634  56.160  139.020 1.00 33.55  ? 34   GLU C C   1 
ATOM   3019  O O   . GLU C  1 34  ? 16.596  56.900  138.049 1.00 32.69  ? 34   GLU C O   1 
ATOM   3020  C CB  . GLU C  1 34  ? 15.785  53.770  138.895 1.00 40.66  ? 34   GLU C CB  1 
ATOM   3021  C CG  . GLU C  1 34  ? 14.982  53.739  137.585 1.00 46.52  ? 34   GLU C CG  1 
ATOM   3022  C CD  . GLU C  1 34  ? 13.531  53.166  137.727 1.00 51.34  ? 34   GLU C CD  1 
ATOM   3023  O OE1 . GLU C  1 34  ? 12.681  53.472  136.828 1.00 50.25  ? 34   GLU C OE1 1 
ATOM   3024  O OE2 . GLU C  1 34  ? 13.249  52.415  138.719 1.00 54.58  ? 34   GLU C OE2 1 
ATOM   3025  N N   . GLU C  1 35  ? 16.387  56.603  140.253 1.00 29.95  ? 35   GLU C N   1 
ATOM   3026  C CA  . GLU C  1 35  ? 16.005  58.000  140.428 1.00 29.12  ? 35   GLU C CA  1 
ATOM   3027  C C   . GLU C  1 35  ? 17.205  58.918  140.110 1.00 28.20  ? 35   GLU C C   1 
ATOM   3028  O O   . GLU C  1 35  ? 17.082  59.955  139.426 1.00 26.55  ? 35   GLU C O   1 
ATOM   3029  C CB  . GLU C  1 35  ? 15.477  58.265  141.847 1.00 30.16  ? 35   GLU C CB  1 
ATOM   3030  C CG  . GLU C  1 35  ? 14.793  59.638  141.994 1.00 29.41  ? 35   GLU C CG  1 
ATOM   3031  C CD  . GLU C  1 35  ? 14.182  59.882  143.381 1.00 31.12  ? 35   GLU C CD  1 
ATOM   3032  O OE1 . GLU C  1 35  ? 13.707  61.031  143.625 1.00 29.33  ? 35   GLU C OE1 1 
ATOM   3033  O OE2 . GLU C  1 35  ? 14.178  58.926  144.211 1.00 29.72  ? 35   GLU C OE2 1 
ATOM   3034  N N   . TYR C  1 36  ? 18.374  58.516  140.578 1.00 26.29  ? 36   TYR C N   1 
ATOM   3035  C CA  . TYR C  1 36  ? 19.574  59.288  140.314 1.00 25.34  ? 36   TYR C CA  1 
ATOM   3036  C C   . TYR C  1 36  ? 19.758  59.532  138.816 1.00 27.57  ? 36   TYR C C   1 
ATOM   3037  O O   . TYR C  1 36  ? 20.057  60.669  138.342 1.00 29.40  ? 36   TYR C O   1 
ATOM   3038  C CB  . TYR C  1 36  ? 20.817  58.556  140.820 1.00 22.72  ? 36   TYR C CB  1 
ATOM   3039  C CG  . TYR C  1 36  ? 22.048  59.063  140.142 1.00 20.43  ? 36   TYR C CG  1 
ATOM   3040  C CD1 . TYR C  1 36  ? 22.543  60.346  140.409 1.00 20.79  ? 36   TYR C CD1 1 
ATOM   3041  C CD2 . TYR C  1 36  ? 22.607  58.365  139.085 1.00 20.27  ? 36   TYR C CD2 1 
ATOM   3042  C CE1 . TYR C  1 36  ? 23.545  60.918  139.623 1.00 15.98  ? 36   TYR C CE1 1 
ATOM   3043  C CE2 . TYR C  1 36  ? 23.598  58.933  138.295 1.00 18.17  ? 36   TYR C CE2 1 
ATOM   3044  C CZ  . TYR C  1 36  ? 24.064  60.218  138.561 1.00 18.33  ? 36   TYR C CZ  1 
ATOM   3045  O OH  . TYR C  1 36  ? 25.016  60.817  137.722 1.00 15.98  ? 36   TYR C OH  1 
ATOM   3046  N N   . GLN C  1 37  ? 19.582  58.469  138.046 1.00 27.53  ? 37   GLN C N   1 
ATOM   3047  C CA  . GLN C  1 37  ? 19.810  58.596  136.633 1.00 27.11  ? 37   GLN C CA  1 
ATOM   3048  C C   . GLN C  1 37  ? 18.786  59.486  135.966 1.00 26.42  ? 37   GLN C C   1 
ATOM   3049  O O   . GLN C  1 37  ? 19.129  60.322  135.116 1.00 25.34  ? 37   GLN C O   1 
ATOM   3050  C CB  . GLN C  1 37  ? 19.801  57.223  135.994 1.00 30.04  ? 37   GLN C CB  1 
ATOM   3051  C CG  . GLN C  1 37  ? 20.221  57.261  134.577 1.00 37.25  ? 37   GLN C CG  1 
ATOM   3052  C CD  . GLN C  1 37  ? 19.766  56.043  133.815 1.00 41.76  ? 37   GLN C CD  1 
ATOM   3053  O OE1 . GLN C  1 37  ? 20.436  55.013  133.780 1.00 45.05  ? 37   GLN C OE1 1 
ATOM   3054  N NE2 . GLN C  1 37  ? 18.599  56.158  133.195 1.00 47.36  ? 37   GLN C NE2 1 
ATOM   3055  N N   . ALA C  1 38  ? 17.523  59.321  136.359 1.00 25.05  ? 38   ALA C N   1 
ATOM   3056  C CA  . ALA C  1 38  ? 16.452  60.083  135.755 1.00 23.46  ? 38   ALA C CA  1 
ATOM   3057  C C   . ALA C  1 38  ? 16.675  61.549  136.059 1.00 25.35  ? 38   ALA C C   1 
ATOM   3058  O O   . ALA C  1 38  ? 16.517  62.400  135.156 1.00 26.77  ? 38   ALA C O   1 
ATOM   3059  C CB  . ALA C  1 38  ? 15.108  59.622  136.288 1.00 20.95  ? 38   ALA C CB  1 
ATOM   3060  N N   . ILE C  1 39  ? 17.053  61.859  137.308 1.00 23.83  ? 39   ILE C N   1 
ATOM   3061  C CA  . ILE C  1 39  ? 17.276  63.254  137.657 1.00 25.52  ? 39   ILE C CA  1 
ATOM   3062  C C   . ILE C  1 39  ? 18.539  63.848  137.016 1.00 27.24  ? 39   ILE C C   1 
ATOM   3063  O O   . ILE C  1 39  ? 18.521  64.993  136.561 1.00 28.52  ? 39   ILE C O   1 
ATOM   3064  C CB  . ILE C  1 39  ? 17.321  63.441  139.175 1.00 24.71  ? 39   ILE C CB  1 
ATOM   3065  C CG1 . ILE C  1 39  ? 15.940  63.171  139.756 1.00 21.35  ? 39   ILE C CG1 1 
ATOM   3066  C CG2 . ILE C  1 39  ? 17.809  64.852  139.522 1.00 22.87  ? 39   ILE C CG2 1 
ATOM   3067  C CD1 . ILE C  1 39  ? 15.951  63.168  141.211 1.00 21.25  ? 39   ILE C CD1 1 
ATOM   3068  N N   . GLN C  1 40  ? 19.627  63.090  136.972 1.00 27.73  ? 40   GLN C N   1 
ATOM   3069  C CA  . GLN C  1 40  ? 20.819  63.626  136.318 1.00 30.39  ? 40   GLN C CA  1 
ATOM   3070  C C   . GLN C  1 40  ? 20.451  64.090  134.902 1.00 31.03  ? 40   GLN C C   1 
ATOM   3071  O O   . GLN C  1 40  ? 20.886  65.165  134.448 1.00 32.22  ? 40   GLN C O   1 
ATOM   3072  C CB  . GLN C  1 40  ? 21.919  62.561  136.161 1.00 32.49  ? 40   GLN C CB  1 
ATOM   3073  C CG  . GLN C  1 40  ? 23.229  62.764  136.901 1.00 37.01  ? 40   GLN C CG  1 
ATOM   3074  C CD  . GLN C  1 40  ? 23.941  64.048  136.578 1.00 37.57  ? 40   GLN C CD  1 
ATOM   3075  O OE1 . GLN C  1 40  ? 25.159  64.103  136.504 1.00 35.57  ? 40   GLN C OE1 1 
ATOM   3076  N NE2 . GLN C  1 40  ? 23.179  65.100  136.394 1.00 44.05  ? 40   GLN C NE2 1 
ATOM   3077  N N   . LYS C  1 41  ? 19.656  63.271  134.204 1.00 30.63  ? 41   LYS C N   1 
ATOM   3078  C CA  . LYS C  1 41  ? 19.307  63.598  132.840 1.00 30.78  ? 41   LYS C CA  1 
ATOM   3079  C C   . LYS C  1 41  ? 18.381  64.786  132.754 1.00 28.96  ? 41   LYS C C   1 
ATOM   3080  O O   . LYS C  1 41  ? 18.625  65.714  131.978 1.00 26.35  ? 41   LYS C O   1 
ATOM   3081  C CB  . LYS C  1 41  ? 18.685  62.391  132.140 1.00 33.28  ? 41   LYS C CB  1 
ATOM   3082  C CG  . LYS C  1 41  ? 19.708  61.357  131.680 1.00 38.42  ? 41   LYS C CG  1 
ATOM   3083  C CD  . LYS C  1 41  ? 19.038  60.072  131.204 1.00 42.23  ? 41   LYS C CD  1 
ATOM   3084  C CE  . LYS C  1 41  ? 20.062  58.984  130.889 1.00 45.08  ? 41   LYS C CE  1 
ATOM   3085  N NZ  . LYS C  1 41  ? 19.380  57.664  130.665 1.00 51.36  ? 41   LYS C NZ  1 
ATOM   3086  N N   . ALA C  1 42  ? 17.339  64.760  133.581 1.00 27.69  ? 42   ALA C N   1 
ATOM   3087  C CA  . ALA C  1 42  ? 16.338  65.819  133.581 1.00 26.82  ? 42   ALA C CA  1 
ATOM   3088  C C   . ALA C  1 42  ? 16.961  67.188  133.891 1.00 26.74  ? 42   ALA C C   1 
ATOM   3089  O O   . ALA C  1 42  ? 16.554  68.206  133.315 1.00 27.46  ? 42   ALA C O   1 
ATOM   3090  C CB  . ALA C  1 42  ? 15.231  65.473  134.573 1.00 23.14  ? 42   ALA C CB  1 
ATOM   3091  N N   . LEU C  1 43  ? 17.961  67.209  134.777 1.00 25.86  ? 43   LEU C N   1 
ATOM   3092  C CA  . LEU C  1 43  ? 18.636  68.463  135.138 1.00 25.75  ? 43   LEU C CA  1 
ATOM   3093  C C   . LEU C  1 43  ? 19.428  69.157  134.002 1.00 27.49  ? 43   LEU C C   1 
ATOM   3094  O O   . LEU C  1 43  ? 19.622  70.397  134.024 1.00 29.16  ? 43   LEU C O   1 
ATOM   3095  C CB  . LEU C  1 43  ? 19.551  68.252  136.342 1.00 19.84  ? 43   LEU C CB  1 
ATOM   3096  C CG  . LEU C  1 43  ? 18.772  68.044  137.635 1.00 17.31  ? 43   LEU C CG  1 
ATOM   3097  C CD1 . LEU C  1 43  ? 19.765  67.714  138.727 1.00 15.23  ? 43   LEU C CD1 1 
ATOM   3098  C CD2 . LEU C  1 43  ? 17.919  69.273  137.975 1.00 11.49  ? 43   LEU C CD2 1 
ATOM   3099  N N   . ARG C  1 44  ? 19.872  68.379  133.016 1.00 27.34  ? 44   ARG C N   1 
ATOM   3100  C CA  . ARG C  1 44  ? 20.585  68.929  131.877 1.00 27.19  ? 44   ARG C CA  1 
ATOM   3101  C C   . ARG C  1 44  ? 19.721  69.820  130.962 1.00 27.77  ? 44   ARG C C   1 
ATOM   3102  O O   . ARG C  1 44  ? 20.264  70.710  130.312 1.00 26.82  ? 44   ARG C O   1 
ATOM   3103  C CB  . ARG C  1 44  ? 21.159  67.796  131.027 1.00 28.08  ? 44   ARG C CB  1 
ATOM   3104  C CG  . ARG C  1 44  ? 22.268  67.039  131.705 1.00 31.52  ? 44   ARG C CG  1 
ATOM   3105  C CD  . ARG C  1 44  ? 23.068  66.180  130.733 1.00 29.27  ? 44   ARG C CD  1 
ATOM   3106  N NE  . ARG C  1 44  ? 22.688  64.770  130.807 1.00 30.14  ? 44   ARG C NE  1 
ATOM   3107  C CZ  . ARG C  1 44  ? 23.367  63.849  131.488 1.00 30.09  ? 44   ARG C CZ  1 
ATOM   3108  N NH1 . ARG C  1 44  ? 24.467  64.211  132.146 1.00 29.04  ? 44   ARG C NH1 1 
ATOM   3109  N NH2 . ARG C  1 44  ? 22.954  62.567  131.508 1.00 29.39  ? 44   ARG C NH2 1 
ATOM   3110  N N   . GLN C  1 45  ? 18.400  69.609  130.922 1.00 28.11  ? 45   GLN C N   1 
ATOM   3111  C CA  . GLN C  1 45  ? 17.544  70.374  130.012 1.00 31.12  ? 45   GLN C CA  1 
ATOM   3112  C C   . GLN C  1 45  ? 17.593  71.880  130.210 1.00 32.29  ? 45   GLN C C   1 
ATOM   3113  O O   . GLN C  1 45  ? 17.665  72.337  131.328 1.00 35.11  ? 45   GLN C O   1 
ATOM   3114  C CB  . GLN C  1 45  ? 16.092  69.927  130.154 1.00 31.07  ? 45   GLN C CB  1 
ATOM   3115  C CG  . GLN C  1 45  ? 15.858  68.436  130.065 1.00 33.23  ? 45   GLN C CG  1 
ATOM   3116  C CD  . GLN C  1 45  ? 14.449  68.071  130.426 1.00 36.49  ? 45   GLN C CD  1 
ATOM   3117  O OE1 . GLN C  1 45  ? 14.019  66.970  130.195 1.00 44.08  ? 45   GLN C OE1 1 
ATOM   3118  N NE2 . GLN C  1 45  ? 13.724  68.994  131.011 1.00 40.63  ? 45   GLN C NE2 1 
ATOM   3119  N N   . ARG C  1 46  ? 17.587  72.664  129.143 1.00 32.76  ? 46   ARG C N   1 
ATOM   3120  C CA  . ARG C  1 46  ? 17.521  74.109  129.325 1.00 32.22  ? 46   ARG C CA  1 
ATOM   3121  C C   . ARG C  1 46  ? 16.022  74.367  129.357 1.00 32.76  ? 46   ARG C C   1 
ATOM   3122  O O   . ARG C  1 46  ? 15.234  73.546  128.884 1.00 32.42  ? 46   ARG C O   1 
ATOM   3123  C CB  . ARG C  1 46  ? 18.083  74.817  128.136 1.00 32.69  ? 46   ARG C CB  1 
ATOM   3124  C CG  . ARG C  1 46  ? 19.312  74.206  127.638 1.00 38.08  ? 46   ARG C CG  1 
ATOM   3125  C CD  . ARG C  1 46  ? 20.376  75.250  127.515 1.00 41.77  ? 46   ARG C CD  1 
ATOM   3126  N NE  . ARG C  1 46  ? 21.541  74.812  126.748 1.00 45.40  ? 46   ARG C NE  1 
ATOM   3127  C CZ  . ARG C  1 46  ? 22.779  75.220  127.037 1.00 49.22  ? 46   ARG C CZ  1 
ATOM   3128  N NH1 . ARG C  1 46  ? 23.000  76.064  128.081 1.00 49.75  ? 46   ARG C NH1 1 
ATOM   3129  N NH2 . ARG C  1 46  ? 23.791  74.805  126.273 1.00 49.37  ? 46   ARG C NH2 1 
ATOM   3130  N N   . LEU C  1 47  ? 15.583  75.495  129.878 1.00 33.41  ? 47   LEU C N   1 
ATOM   3131  C CA  . LEU C  1 47  ? 14.147  75.676  129.882 1.00 34.51  ? 47   LEU C CA  1 
ATOM   3132  C C   . LEU C  1 47  ? 13.586  76.512  128.762 1.00 33.73  ? 47   LEU C C   1 
ATOM   3133  O O   . LEU C  1 47  ? 14.231  77.444  128.291 1.00 34.16  ? 47   LEU C O   1 
ATOM   3134  C CB  . LEU C  1 47  ? 13.643  76.188  131.236 1.00 36.46  ? 47   LEU C CB  1 
ATOM   3135  C CG  . LEU C  1 47  ? 14.445  76.744  132.388 1.00 37.69  ? 47   LEU C CG  1 
ATOM   3136  C CD1 . LEU C  1 47  ? 13.696  76.542  133.660 1.00 40.83  ? 47   LEU C CD1 1 
ATOM   3137  C CD2 . LEU C  1 47  ? 15.663  75.987  132.542 1.00 42.96  ? 47   LEU C CD2 1 
ATOM   3138  N N   . GLY C  1 48  ? 12.383  76.138  128.332 1.00 33.12  ? 48   GLY C N   1 
ATOM   3139  C CA  . GLY C  1 48  ? 11.686  76.822  127.257 1.00 32.57  ? 48   GLY C CA  1 
ATOM   3140  C C   . GLY C  1 48  ? 11.297  78.231  127.597 1.00 34.03  ? 48   GLY C C   1 
ATOM   3141  O O   . GLY C  1 48  ? 11.423  78.662  128.761 1.00 35.20  ? 48   GLY C O   1 
ATOM   3142  N N   . PRO C  1 49  ? 10.781  78.976  126.606 1.00 34.83  ? 49   PRO C N   1 
ATOM   3143  C CA  . PRO C  1 49  ? 10.358  80.374  126.756 1.00 33.85  ? 49   PRO C CA  1 
ATOM   3144  C C   . PRO C  1 49  ? 9.320   80.554  127.811 1.00 32.42  ? 49   PRO C C   1 
ATOM   3145  O O   . PRO C  1 49  ? 9.221   81.628  128.400 1.00 34.12  ? 49   PRO C O   1 
ATOM   3146  C CB  . PRO C  1 49  ? 9.802   80.735  125.380 1.00 34.05  ? 49   PRO C CB  1 
ATOM   3147  C CG  . PRO C  1 49  ? 10.419  79.749  124.481 1.00 37.28  ? 49   PRO C CG  1 
ATOM   3148  C CD  . PRO C  1 49  ? 10.425  78.474  125.273 1.00 34.80  ? 49   PRO C CD  1 
ATOM   3149  N N   . GLU C  1 50  ? 8.537   79.516  128.043 1.00 31.67  ? 50   GLU C N   1 
ATOM   3150  C CA  . GLU C  1 50  ? 7.482   79.620  129.026 1.00 34.18  ? 50   GLU C CA  1 
ATOM   3151  C C   . GLU C  1 50  ? 7.958   79.807  130.450 1.00 34.21  ? 50   GLU C C   1 
ATOM   3152  O O   . GLU C  1 50  ? 7.157   80.079  131.343 1.00 35.85  ? 50   GLU C O   1 
ATOM   3153  C CB  . GLU C  1 50  ? 6.489   78.444  128.961 1.00 36.15  ? 50   GLU C CB  1 
ATOM   3154  C CG  . GLU C  1 50  ? 7.042   77.090  128.628 1.00 41.34  ? 50   GLU C CG  1 
ATOM   3155  C CD  . GLU C  1 50  ? 7.305   76.930  127.166 1.00 43.53  ? 50   GLU C CD  1 
ATOM   3156  O OE1 . GLU C  1 50  ? 8.443   77.244  126.753 1.00 49.18  ? 50   GLU C OE1 1 
ATOM   3157  O OE2 . GLU C  1 50  ? 6.369   76.511  126.444 1.00 43.46  ? 50   GLU C OE2 1 
ATOM   3158  N N   . TYR C  1 51  ? 9.263   79.718  130.671 1.00 33.09  ? 51   TYR C N   1 
ATOM   3159  C CA  . TYR C  1 51  ? 9.802   79.914  132.001 1.00 31.33  ? 51   TYR C CA  1 
ATOM   3160  C C   . TYR C  1 51  ? 10.411  81.263  132.201 1.00 33.87  ? 51   TYR C C   1 
ATOM   3161  O O   . TYR C  1 51  ? 10.391  81.805  133.317 1.00 36.48  ? 51   TYR C O   1 
ATOM   3162  C CB  . TYR C  1 51  ? 10.880  78.897  132.279 1.00 26.14  ? 51   TYR C CB  1 
ATOM   3163  C CG  . TYR C  1 51  ? 10.331  77.549  132.577 1.00 22.87  ? 51   TYR C CG  1 
ATOM   3164  C CD1 . TYR C  1 51  ? 10.247  76.576  131.586 1.00 20.75  ? 51   TYR C CD1 1 
ATOM   3165  C CD2 . TYR C  1 51  ? 9.844   77.246  133.841 1.00 19.34  ? 51   TYR C CD2 1 
ATOM   3166  C CE1 . TYR C  1 51  ? 9.687   75.337  131.850 1.00 19.28  ? 51   TYR C CE1 1 
ATOM   3167  C CE2 . TYR C  1 51  ? 9.284   76.005  134.114 1.00 17.38  ? 51   TYR C CE2 1 
ATOM   3168  C CZ  . TYR C  1 51  ? 9.209   75.073  133.119 1.00 17.87  ? 51   TYR C CZ  1 
ATOM   3169  O OH  . TYR C  1 51  ? 8.645   73.885  133.378 1.00 21.69  ? 51   TYR C OH  1 
ATOM   3170  N N   . ILE C  1 52  ? 10.931  81.810  131.109 1.00 35.77  ? 52   ILE C N   1 
ATOM   3171  C CA  . ILE C  1 52  ? 11.657  83.059  131.146 1.00 37.27  ? 52   ILE C CA  1 
ATOM   3172  C C   . ILE C  1 52  ? 10.852  84.319  131.045 1.00 39.79  ? 52   ILE C C   1 
ATOM   3173  O O   . ILE C  1 52  ? 9.969   84.414  130.207 1.00 41.24  ? 52   ILE C O   1 
ATOM   3174  C CB  . ILE C  1 52  ? 12.700  83.090  130.011 1.00 35.10  ? 52   ILE C CB  1 
ATOM   3175  C CG1 . ILE C  1 52  ? 13.419  81.739  129.899 1.00 30.56  ? 52   ILE C CG1 1 
ATOM   3176  C CG2 . ILE C  1 52  ? 13.652  84.242  130.247 1.00 37.78  ? 52   ILE C CG2 1 
ATOM   3177  C CD1 . ILE C  1 52  ? 14.017  81.224  131.188 1.00 27.10  ? 52   ILE C CD1 1 
ATOM   3178  N N   . SER C  1 53  ? 11.138  85.270  131.920 1.00 43.12  ? 53   SER C N   1 
ATOM   3179  C CA  . SER C  1 53  ? 10.489  86.567  131.864 1.00 46.85  ? 53   SER C CA  1 
ATOM   3180  C C   . SER C  1 53  ? 11.591  87.643  131.901 1.00 48.67  ? 53   SER C C   1 
ATOM   3181  O O   . SER C  1 53  ? 12.782  87.314  132.058 1.00 47.85  ? 53   SER C O   1 
ATOM   3182  C CB  . SER C  1 53  ? 9.419   86.716  132.969 1.00 46.07  ? 53   SER C CB  1 
ATOM   3183  O OG  . SER C  1 53  ? 9.837   86.249  134.198 1.00 50.78  ? 53   SER C OG  1 
ATOM   3184  N N   . SER C  1 54  ? 11.223  88.904  131.694 1.00 52.80  ? 54   SER C N   1 
ATOM   3185  C CA  . SER C  1 54  ? 12.229  89.972  131.682 1.00 57.44  ? 54   SER C CA  1 
ATOM   3186  C C   . SER C  1 54  ? 11.771  91.323  132.184 1.00 60.68  ? 54   SER C C   1 
ATOM   3187  O O   . SER C  1 54  ? 10.589  91.617  132.187 1.00 60.71  ? 54   SER C O   1 
ATOM   3188  C CB  . SER C  1 54  ? 12.768  90.152  130.277 1.00 57.11  ? 54   SER C CB  1 
ATOM   3189  O OG  . SER C  1 54  ? 11.705  90.363  129.374 1.00 55.35  ? 54   SER C OG  1 
ATOM   3190  N N   . ARG C  1 55  ? 12.729  92.149  132.588 1.00 65.53  ? 55   ARG C N   1 
ATOM   3191  C CA  . ARG C  1 55  ? 12.429  93.470  133.103 1.00 71.01  ? 55   ARG C CA  1 
ATOM   3192  C C   . ARG C  1 55  ? 13.463  94.413  132.540 1.00 74.67  ? 55   ARG C C   1 
ATOM   3193  O O   . ARG C  1 55  ? 14.445  93.970  131.947 1.00 75.30  ? 55   ARG C O   1 
ATOM   3194  C CB  . ARG C  1 55  ? 12.497  93.483  134.635 1.00 72.31  ? 55   ARG C CB  1 
ATOM   3195  C CG  . ARG C  1 55  ? 13.852  93.090  135.211 1.00 75.24  ? 55   ARG C CG  1 
ATOM   3196  C CD  . ARG C  1 55  ? 14.027  93.544  136.657 1.00 78.68  ? 55   ARG C CD  1 
ATOM   3197  N NE  . ARG C  1 55  ? 15.218  92.952  137.270 1.00 82.25  ? 55   ARG C NE  1 
ATOM   3198  C CZ  . ARG C  1 55  ? 15.282  91.690  137.717 1.00 84.96  ? 55   ARG C CZ  1 
ATOM   3199  N NH1 . ARG C  1 55  ? 14.224  90.879  137.635 1.00 85.38  ? 55   ARG C NH1 1 
ATOM   3200  N NH2 . ARG C  1 55  ? 16.414  91.216  138.229 1.00 86.08  ? 55   ARG C NH2 1 
ATOM   3201  N N   . MET C  1 56  ? 13.236  95.711  132.720 1.00 79.16  ? 56   MET C N   1 
ATOM   3202  C CA  . MET C  1 56  ? 14.164  96.729  132.247 1.00 83.47  ? 56   MET C CA  1 
ATOM   3203  C C   . MET C  1 56  ? 15.160  97.157  133.314 1.00 85.52  ? 56   MET C C   1 
ATOM   3204  O O   . MET C  1 56  ? 14.783  97.642  134.382 1.00 86.05  ? 56   MET C O   1 
ATOM   3205  C CB  . MET C  1 56  ? 13.405  97.960  131.748 1.00 85.53  ? 56   MET C CB  1 
ATOM   3206  C CG  . MET C  1 56  ? 13.111  97.918  130.262 1.00 87.92  ? 56   MET C CG  1 
ATOM   3207  S SD  . MET C  1 56  ? 14.601  97.506  129.291 1.00 90.97  ? 56   MET C SD  1 
ATOM   3208  C CE  . MET C  1 56  ? 14.107  95.810  128.641 1.00 89.30  ? 56   MET C CE  1 
ATOM   3209  N N   . ALA C  1 57  ? 16.440  96.968  133.017 1.00 87.93  ? 57   ALA C N   1 
ATOM   3210  C CA  . ALA C  1 57  ? 17.491  97.361  133.942 1.00 90.48  ? 57   ALA C CA  1 
ATOM   3211  C C   . ALA C  1 57  ? 17.623  98.878  133.847 1.00 92.13  ? 57   ALA C C   1 
ATOM   3212  O O   . ALA C  1 57  ? 17.127  99.490  132.892 1.00 92.80  ? 57   ALA C O   1 
ATOM   3213  C CB  . ALA C  1 57  ? 18.817  96.693  133.559 1.00 90.66  ? 57   ALA C CB  1 
ATOM   3214  N N   . GLY C  1 58  ? 18.283  99.476  134.837 1.00 93.41  ? 58   GLY C N   1 
ATOM   3215  C CA  . GLY C  1 58  ? 18.486  100.913 134.839 1.00 94.03  ? 58   GLY C CA  1 
ATOM   3216  C C   . GLY C  1 58  ? 19.199  101.365 133.580 1.00 94.47  ? 58   GLY C C   1 
ATOM   3217  O O   . GLY C  1 58  ? 18.899  102.438 133.045 1.00 94.79  ? 58   GLY C O   1 
ATOM   3218  N N   . GLY C  1 59  ? 20.139  100.553 133.099 1.00 94.51  ? 59   GLY C N   1 
ATOM   3219  C CA  . GLY C  1 59  ? 20.856  100.906 131.886 1.00 94.88  ? 59   GLY C CA  1 
ATOM   3220  C C   . GLY C  1 59  ? 19.996  100.763 130.633 1.00 94.92  ? 59   GLY C C   1 
ATOM   3221  O O   . GLY C  1 59  ? 20.526  100.653 129.522 1.00 95.22  ? 59   GLY C O   1 
ATOM   3222  N N   . GLY C  1 60  ? 18.671  100.769 130.809 1.00 94.57  ? 60   GLY C N   1 
ATOM   3223  C CA  . GLY C  1 60  ? 17.753  100.625 129.686 1.00 93.46  ? 60   GLY C CA  1 
ATOM   3224  C C   . GLY C  1 60  ? 18.048  99.344  128.930 1.00 92.50  ? 60   GLY C C   1 
ATOM   3225  O O   . GLY C  1 60  ? 18.003  99.303  127.696 1.00 92.12  ? 60   GLY C O   1 
ATOM   3226  N N   . GLN C  1 61  ? 18.358  98.290  129.684 1.00 91.65  ? 61   GLN C N   1 
ATOM   3227  C CA  . GLN C  1 61  ? 18.690  96.994  129.094 1.00 89.98  ? 61   GLN C CA  1 
ATOM   3228  C C   . GLN C  1 61  ? 17.918  95.826  129.694 1.00 86.69  ? 61   GLN C C   1 
ATOM   3229  O O   . GLN C  1 61  ? 17.732  95.735  130.914 1.00 87.02  ? 61   GLN C O   1 
ATOM   3230  C CB  . GLN C  1 61  ? 20.183  96.735  129.244 1.00 92.62  ? 61   GLN C CB  1 
ATOM   3231  C CG  . GLN C  1 61  ? 20.672  96.915  130.667 1.00 96.21  ? 61   GLN C CG  1 
ATOM   3232  C CD  . GLN C  1 61  ? 22.136  96.579  130.801 1.00 99.18  ? 61   GLN C CD  1 
ATOM   3233  O OE1 . GLN C  1 61  ? 22.685  96.573  131.913 1.00 100.00 ? 61   GLN C OE1 1 
ATOM   3234  N NE2 . GLN C  1 61  ? 22.791  96.292  129.661 1.00 100.52 ? 61   GLN C NE2 1 
ATOM   3235  N N   . LYS C  1 62  ? 17.486  94.932  128.810 1.00 82.20  ? 62   LYS C N   1 
ATOM   3236  C CA  . LYS C  1 62  ? 16.722  93.743  129.174 1.00 77.12  ? 62   LYS C CA  1 
ATOM   3237  C C   . LYS C  1 62  ? 17.462  92.807  130.133 1.00 72.53  ? 62   LYS C C   1 
ATOM   3238  O O   . LYS C  1 62  ? 18.649  92.547  129.984 1.00 72.95  ? 62   LYS C O   1 
ATOM   3239  C CB  . LYS C  1 62  ? 16.375  92.982  127.908 1.00 78.28  ? 62   LYS C CB  1 
ATOM   3240  C CG  . LYS C  1 62  ? 15.231  92.011  128.039 1.00 80.46  ? 62   LYS C CG  1 
ATOM   3241  C CD  . LYS C  1 62  ? 15.086  91.235  126.725 1.00 82.28  ? 62   LYS C CD  1 
ATOM   3242  C CE  . LYS C  1 62  ? 13.912  90.257  126.735 1.00 83.25  ? 62   LYS C CE  1 
ATOM   3243  N NZ  . LYS C  1 62  ? 13.944  89.317  125.555 1.00 83.79  ? 62   LYS C NZ  1 
ATOM   3244  N N   . VAL C  1 63  ? 16.747  92.311  131.126 1.00 66.46  ? 63   VAL C N   1 
ATOM   3245  C CA  . VAL C  1 63  ? 17.314  91.392  132.081 1.00 59.74  ? 63   VAL C CA  1 
ATOM   3246  C C   . VAL C  1 63  ? 16.344  90.215  132.169 1.00 56.22  ? 63   VAL C C   1 
ATOM   3247  O O   . VAL C  1 63  ? 15.151  90.386  132.457 1.00 54.87  ? 63   VAL C O   1 
ATOM   3248  C CB  . VAL C  1 63  ? 17.462  92.045  133.448 1.00 59.74  ? 63   VAL C CB  1 
ATOM   3249  C CG1 . VAL C  1 63  ? 17.939  91.035  134.469 1.00 57.44  ? 63   VAL C CG1 1 
ATOM   3250  C CG2 . VAL C  1 63  ? 18.435  93.177  133.343 1.00 60.20  ? 63   VAL C CG2 1 
ATOM   3251  N N   . CYS C  1 64  ? 16.848  89.020  131.885 1.00 50.72  ? 64   CYS C N   1 
ATOM   3252  C CA  . CYS C  1 64  ? 16.027  87.838  131.969 1.00 46.05  ? 64   CYS C CA  1 
ATOM   3253  C C   . CYS C  1 64  ? 16.119  87.204  133.341 1.00 44.00  ? 64   CYS C C   1 
ATOM   3254  O O   . CYS C  1 64  ? 17.148  87.303  134.023 1.00 43.11  ? 64   CYS C O   1 
ATOM   3255  C CB  . CYS C  1 64  ? 16.455  86.848  130.919 1.00 44.61  ? 64   CYS C CB  1 
ATOM   3256  S SG  . CYS C  1 64  ? 15.965  87.401  129.298 1.00 43.87  ? 64   CYS C SG  1 
ATOM   3257  N N   . TYR C  1 65  ? 15.036  86.556  133.747 1.00 41.05  ? 65   TYR C N   1 
ATOM   3258  C CA  . TYR C  1 65  ? 14.998  85.890  135.034 1.00 38.56  ? 65   TYR C CA  1 
ATOM   3259  C C   . TYR C  1 65  ? 13.783  84.948  135.078 1.00 37.42  ? 65   TYR C C   1 
ATOM   3260  O O   . TYR C  1 65  ? 12.880  85.017  134.222 1.00 34.25  ? 65   TYR C O   1 
ATOM   3261  C CB  . TYR C  1 65  ? 14.901  86.916  136.163 1.00 37.74  ? 65   TYR C CB  1 
ATOM   3262  C CG  . TYR C  1 65  ? 13.575  87.625  136.216 1.00 39.59  ? 65   TYR C CG  1 
ATOM   3263  C CD1 . TYR C  1 65  ? 12.575  87.190  137.058 1.00 41.18  ? 65   TYR C CD1 1 
ATOM   3264  C CD2 . TYR C  1 65  ? 13.310  88.728  135.406 1.00 41.46  ? 65   TYR C CD2 1 
ATOM   3265  C CE1 . TYR C  1 65  ? 11.332  87.826  137.106 1.00 42.63  ? 65   TYR C CE1 1 
ATOM   3266  C CE2 . TYR C  1 65  ? 12.066  89.379  135.437 1.00 41.39  ? 65   TYR C CE2 1 
ATOM   3267  C CZ  . TYR C  1 65  ? 11.086  88.921  136.290 1.00 43.14  ? 65   TYR C CZ  1 
ATOM   3268  O OH  . TYR C  1 65  ? 9.850   89.535  136.344 1.00 44.66  ? 65   TYR C OH  1 
ATOM   3269  N N   . ILE C  1 66  ? 13.778  84.065  136.078 1.00 34.60  ? 66   ILE C N   1 
ATOM   3270  C CA  . ILE C  1 66  ? 12.694  83.122  136.269 1.00 31.83  ? 66   ILE C CA  1 
ATOM   3271  C C   . ILE C  1 66  ? 12.006  83.536  137.540 1.00 31.41  ? 66   ILE C C   1 
ATOM   3272  O O   . ILE C  1 66  ? 12.679  83.863  138.517 1.00 29.53  ? 66   ILE C O   1 
ATOM   3273  C CB  . ILE C  1 66  ? 13.227  81.696  136.432 1.00 31.50  ? 66   ILE C CB  1 
ATOM   3274  C CG1 . ILE C  1 66  ? 14.206  81.411  135.303 1.00 30.80  ? 66   ILE C CG1 1 
ATOM   3275  C CG2 . ILE C  1 66  ? 12.069  80.704  136.418 1.00 30.87  ? 66   ILE C CG2 1 
ATOM   3276  C CD1 . ILE C  1 66  ? 15.020  80.225  135.495 1.00 33.48  ? 66   ILE C CD1 1 
ATOM   3277  N N   . GLU C  1 67  ? 10.677  83.497  137.540 1.00 32.63  ? 67   GLU C N   1 
ATOM   3278  C CA  . GLU C  1 67  ? 9.920   83.910  138.720 1.00 35.04  ? 67   GLU C CA  1 
ATOM   3279  C C   . GLU C  1 67  ? 9.975   82.867  139.775 1.00 33.60  ? 67   GLU C C   1 
ATOM   3280  O O   . GLU C  1 67  ? 9.933   81.680  139.477 1.00 35.64  ? 67   GLU C O   1 
ATOM   3281  C CB  . GLU C  1 67  ? 8.477   84.248  138.358 1.00 39.44  ? 67   GLU C CB  1 
ATOM   3282  C CG  . GLU C  1 67  ? 8.390   85.550  137.556 1.00 46.73  ? 67   GLU C CG  1 
ATOM   3283  C CD  . GLU C  1 67  ? 6.981   85.873  137.074 1.00 50.43  ? 67   GLU C CD  1 
ATOM   3284  O OE1 . GLU C  1 67  ? 6.345   85.027  136.404 1.00 51.42  ? 67   GLU C OE1 1 
ATOM   3285  O OE2 . GLU C  1 67  ? 6.510   86.994  137.366 1.00 55.34  ? 67   GLU C OE2 1 
ATOM   3286  N N   . GLY C  1 68  ? 10.092  83.308  141.010 1.00 31.00  ? 68   GLY C N   1 
ATOM   3287  C CA  . GLY C  1 68  ? 10.208  82.373  142.097 1.00 31.58  ? 68   GLY C CA  1 
ATOM   3288  C C   . GLY C  1 68  ? 9.216   81.229  142.101 1.00 32.00  ? 68   GLY C C   1 
ATOM   3289  O O   . GLY C  1 68  ? 9.596   80.064  142.354 1.00 32.44  ? 68   GLY C O   1 
ATOM   3290  N N   . HIS C  1 69  ? 7.956   81.522  141.797 1.00 31.14  ? 69   HIS C N   1 
ATOM   3291  C CA  . HIS C  1 69  ? 6.992   80.447  141.858 1.00 31.20  ? 69   HIS C CA  1 
ATOM   3292  C C   . HIS C  1 69  ? 7.242   79.363  140.808 1.00 31.78  ? 69   HIS C C   1 
ATOM   3293  O O   . HIS C  1 69  ? 6.897   78.174  141.024 1.00 32.19  ? 69   HIS C O   1 
ATOM   3294  C CB  . HIS C  1 69  ? 5.568   80.974  141.777 1.00 29.24  ? 69   HIS C CB  1 
ATOM   3295  C CG  . HIS C  1 69  ? 5.189   81.513  140.437 1.00 29.31  ? 69   HIS C CG  1 
ATOM   3296  N ND1 . HIS C  1 69  ? 5.377   82.833  140.081 1.00 30.08  ? 69   HIS C ND1 1 
ATOM   3297  C CD2 . HIS C  1 69  ? 4.602   80.912  139.372 1.00 28.65  ? 69   HIS C CD2 1 
ATOM   3298  C CE1 . HIS C  1 69  ? 4.916   83.023  138.857 1.00 28.29  ? 69   HIS C CE1 1 
ATOM   3299  N NE2 . HIS C  1 69  ? 4.439   81.873  138.407 1.00 28.31  ? 69   HIS C NE2 1 
ATOM   3300  N N   . ARG C  1 70  ? 7.853   79.737  139.694 1.00 29.42  ? 70   ARG C N   1 
ATOM   3301  C CA  . ARG C  1 70  ? 8.145   78.733  138.680 1.00 30.37  ? 70   ARG C CA  1 
ATOM   3302  C C   . ARG C  1 70  ? 9.287   77.844  139.193 1.00 28.47  ? 70   ARG C C   1 
ATOM   3303  O O   . ARG C  1 70  ? 9.293   76.633  138.995 1.00 26.77  ? 70   ARG C O   1 
ATOM   3304  C CB  . ARG C  1 70  ? 8.581   79.387  137.338 1.00 34.25  ? 70   ARG C CB  1 
ATOM   3305  C CG  . ARG C  1 70  ? 7.550   80.297  136.668 1.00 37.11  ? 70   ARG C CG  1 
ATOM   3306  C CD  . ARG C  1 70  ? 7.063   79.732  135.322 1.00 42.17  ? 70   ARG C CD  1 
ATOM   3307  N NE  . ARG C  1 70  ? 5.876   80.461  134.875 1.00 44.12  ? 70   ARG C NE  1 
ATOM   3308  C CZ  . ARG C  1 70  ? 5.881   81.772  134.690 1.00 44.22  ? 70   ARG C CZ  1 
ATOM   3309  N NH1 . ARG C  1 70  ? 7.018   82.454  134.896 1.00 47.56  ? 70   ARG C NH1 1 
ATOM   3310  N NH2 . ARG C  1 70  ? 4.762   82.403  134.372 1.00 42.12  ? 70   ARG C NH2 1 
ATOM   3311  N N   . VAL C  1 71  ? 10.267  78.472  139.833 1.00 26.32  ? 71   VAL C N   1 
ATOM   3312  C CA  . VAL C  1 71  ? 11.414  77.739  140.341 1.00 24.65  ? 71   VAL C CA  1 
ATOM   3313  C C   . VAL C  1 71  ? 10.964  76.764  141.418 1.00 24.34  ? 71   VAL C C   1 
ATOM   3314  O O   . VAL C  1 71  ? 11.448  75.606  141.487 1.00 23.48  ? 71   VAL C O   1 
ATOM   3315  C CB  . VAL C  1 71  ? 12.449  78.678  140.937 1.00 23.12  ? 71   VAL C CB  1 
ATOM   3316  C CG1 . VAL C  1 71  ? 13.557  77.894  141.516 1.00 22.71  ? 71   VAL C CG1 1 
ATOM   3317  C CG2 . VAL C  1 71  ? 12.975  79.593  139.887 1.00 24.04  ? 71   VAL C CG2 1 
ATOM   3318  N N   . ILE C  1 72  ? 10.046  77.233  142.259 1.00 22.85  ? 72   ILE C N   1 
ATOM   3319  C CA  . ILE C  1 72  ? 9.532   76.376  143.320 1.00 23.80  ? 72   ILE C CA  1 
ATOM   3320  C C   . ILE C  1 72  ? 8.882   75.130  142.757 1.00 23.90  ? 72   ILE C C   1 
ATOM   3321  O O   . ILE C  1 72  ? 9.163   74.025  143.232 1.00 22.81  ? 72   ILE C O   1 
ATOM   3322  C CB  . ILE C  1 72  ? 8.546   77.139  144.230 1.00 22.88  ? 72   ILE C CB  1 
ATOM   3323  C CG1 . ILE C  1 72  ? 9.361   78.023  145.178 1.00 23.68  ? 72   ILE C CG1 1 
ATOM   3324  C CG2 . ILE C  1 72  ? 7.690   76.181  145.007 1.00 18.01  ? 72   ILE C CG2 1 
ATOM   3325  C CD1 . ILE C  1 72  ? 8.515   79.071  145.920 1.00 26.63  ? 72   ILE C CD1 1 
ATOM   3326  N N   . ASN C  1 73  ? 8.061   75.305  141.714 1.00 24.46  ? 73   ASN C N   1 
ATOM   3327  C CA  . ASN C  1 73  ? 7.403   74.161  141.107 1.00 23.99  ? 73   ASN C CA  1 
ATOM   3328  C C   . ASN C  1 73  ? 8.417   73.318  140.366 1.00 24.63  ? 73   ASN C C   1 
ATOM   3329  O O   . ASN C  1 73  ? 8.300   72.083  140.330 1.00 27.10  ? 73   ASN C O   1 
ATOM   3330  C CB  . ASN C  1 73  ? 6.292   74.589  140.169 1.00 23.43  ? 73   ASN C CB  1 
ATOM   3331  C CG  . ASN C  1 73  ? 5.038   74.950  140.915 1.00 26.10  ? 73   ASN C CG  1 
ATOM   3332  O OD1 . ASN C  1 73  ? 4.842   74.521  142.050 1.00 27.55  ? 73   ASN C OD1 1 
ATOM   3333  N ND2 . ASN C  1 73  ? 4.177   75.745  140.292 1.00 28.41  ? 73   ASN C ND2 1 
ATOM   3334  N N   . LEU C  1 74  ? 9.430   73.946  139.792 1.00 22.47  ? 74   LEU C N   1 
ATOM   3335  C CA  . LEU C  1 74  ? 10.414  73.156  139.089 1.00 22.33  ? 74   LEU C CA  1 
ATOM   3336  C C   . LEU C  1 74  ? 11.025  72.201  140.103 1.00 21.97  ? 74   LEU C C   1 
ATOM   3337  O O   . LEU C  1 74  ? 11.099  70.992  139.879 1.00 22.17  ? 74   LEU C O   1 
ATOM   3338  C CB  . LEU C  1 74  ? 11.503  74.046  138.462 1.00 20.77  ? 74   LEU C CB  1 
ATOM   3339  C CG  . LEU C  1 74  ? 11.209  74.589  137.065 1.00 20.31  ? 74   LEU C CG  1 
ATOM   3340  C CD1 . LEU C  1 74  ? 12.156  75.741  136.722 1.00 17.89  ? 74   LEU C CD1 1 
ATOM   3341  C CD2 . LEU C  1 74  ? 11.317  73.425  136.019 1.00 18.94  ? 74   LEU C CD2 1 
ATOM   3342  N N   . ALA C  1 75  ? 11.430  72.752  141.233 1.00 21.46  ? 75   ALA C N   1 
ATOM   3343  C CA  . ALA C  1 75  ? 12.051  71.954  142.275 1.00 21.88  ? 75   ALA C CA  1 
ATOM   3344  C C   . ALA C  1 75  ? 11.109  70.842  142.801 1.00 23.92  ? 75   ALA C C   1 
ATOM   3345  O O   . ALA C  1 75  ? 11.518  69.675  142.955 1.00 21.37  ? 75   ALA C O   1 
ATOM   3346  C CB  . ALA C  1 75  ? 12.446  72.855  143.403 1.00 22.02  ? 75   ALA C CB  1 
ATOM   3347  N N   . ASN C  1 76  ? 9.856   71.203  143.097 1.00 24.42  ? 76   ASN C N   1 
ATOM   3348  C CA  . ASN C  1 76  ? 8.933   70.203  143.599 1.00 26.87  ? 76   ASN C CA  1 
ATOM   3349  C C   . ASN C  1 76  ? 8.737   69.037  142.615 1.00 26.91  ? 76   ASN C C   1 
ATOM   3350  O O   . ASN C  1 76  ? 8.688   67.868  143.013 1.00 25.78  ? 76   ASN C O   1 
ATOM   3351  C CB  . ASN C  1 76  ? 7.598   70.840  143.931 1.00 27.30  ? 76   ASN C CB  1 
ATOM   3352  C CG  . ASN C  1 76  ? 7.644   71.593  145.222 1.00 28.31  ? 76   ASN C CG  1 
ATOM   3353  O OD1 . ASN C  1 76  ? 8.338   71.180  146.158 1.00 31.14  ? 76   ASN C OD1 1 
ATOM   3354  N ND2 . ASN C  1 76  ? 6.916   72.698  145.302 1.00 29.20  ? 76   ASN C ND2 1 
ATOM   3355  N N   . GLU C  1 77  ? 8.675   69.346  141.328 1.00 27.08  ? 77   GLU C N   1 
ATOM   3356  C CA  . GLU C  1 77  ? 8.479   68.291  140.356 1.00 28.23  ? 77   GLU C CA  1 
ATOM   3357  C C   . GLU C  1 77  ? 9.752   67.499  140.107 1.00 27.64  ? 77   GLU C C   1 
ATOM   3358  O O   . GLU C  1 77  ? 9.699   66.307  139.861 1.00 29.51  ? 77   GLU C O   1 
ATOM   3359  C CB  . GLU C  1 77  ? 7.947   68.887  139.049 1.00 29.26  ? 77   GLU C CB  1 
ATOM   3360  C CG  . GLU C  1 77  ? 6.569   69.514  139.193 1.00 32.78  ? 77   GLU C CG  1 
ATOM   3361  C CD  . GLU C  1 77  ? 5.522   68.502  139.647 1.00 34.55  ? 77   GLU C CD  1 
ATOM   3362  O OE1 . GLU C  1 77  ? 4.463   68.920  140.177 1.00 36.88  ? 77   GLU C OE1 1 
ATOM   3363  O OE2 . GLU C  1 77  ? 5.777   67.288  139.462 1.00 35.02  ? 77   GLU C OE2 1 
ATOM   3364  N N   . MET C  1 78  ? 10.905  68.158  140.202 1.00 26.87  ? 78   MET C N   1 
ATOM   3365  C CA  . MET C  1 78  ? 12.168  67.502  139.956 1.00 24.39  ? 78   MET C CA  1 
ATOM   3366  C C   . MET C  1 78  ? 12.540  66.564  141.114 1.00 24.70  ? 78   MET C C   1 
ATOM   3367  O O   . MET C  1 78  ? 12.963  65.441  140.888 1.00 23.87  ? 78   MET C O   1 
ATOM   3368  C CB  . MET C  1 78  ? 13.250  68.574  139.756 1.00 24.72  ? 78   MET C CB  1 
ATOM   3369  C CG  . MET C  1 78  ? 14.621  68.065  139.361 1.00 25.21  ? 78   MET C CG  1 
ATOM   3370  S SD  . MET C  1 78  ? 14.653  67.232  137.779 1.00 29.82  ? 78   MET C SD  1 
ATOM   3371  C CE  . MET C  1 78  ? 14.274  68.638  136.653 1.00 25.29  ? 78   MET C CE  1 
ATOM   3372  N N   . PHE C  1 79  ? 12.356  67.008  142.355 1.00 23.57  ? 79   PHE C N   1 
ATOM   3373  C CA  . PHE C  1 79  ? 12.752  66.209  143.499 1.00 23.39  ? 79   PHE C CA  1 
ATOM   3374  C C   . PHE C  1 79  ? 11.638  65.678  144.372 1.00 23.74  ? 79   PHE C C   1 
ATOM   3375  O O   . PHE C  1 79  ? 11.919  64.919  145.298 1.00 22.94  ? 79   PHE C O   1 
ATOM   3376  C CB  . PHE C  1 79  ? 13.658  67.043  144.421 1.00 23.54  ? 79   PHE C CB  1 
ATOM   3377  C CG  . PHE C  1 79  ? 14.818  67.714  143.729 1.00 21.85  ? 79   PHE C CG  1 
ATOM   3378  C CD1 . PHE C  1 79  ? 15.894  66.979  143.265 1.00 21.33  ? 79   PHE C CD1 1 
ATOM   3379  C CD2 . PHE C  1 79  ? 14.845  69.110  143.583 1.00 22.81  ? 79   PHE C CD2 1 
ATOM   3380  C CE1 . PHE C  1 79  ? 16.987  67.617  142.675 1.00 21.20  ? 79   PHE C CE1 1 
ATOM   3381  C CE2 . PHE C  1 79  ? 15.916  69.742  142.995 1.00 22.02  ? 79   PHE C CE2 1 
ATOM   3382  C CZ  . PHE C  1 79  ? 16.997  68.989  142.540 1.00 22.19  ? 79   PHE C CZ  1 
ATOM   3383  N N   . GLY C  1 80  ? 10.398  66.098  144.125 1.00 24.26  ? 80   GLY C N   1 
ATOM   3384  C CA  . GLY C  1 80  ? 9.301   65.675  144.983 1.00 25.17  ? 80   GLY C CA  1 
ATOM   3385  C C   . GLY C  1 80  ? 9.124   66.734  146.052 1.00 26.68  ? 80   GLY C C   1 
ATOM   3386  O O   . GLY C  1 80  ? 10.096  67.368  146.451 1.00 29.38  ? 80   GLY C O   1 
ATOM   3387  N N   . TYR C  1 81  ? 7.905   66.950  146.526 1.00 27.60  ? 81   TYR C N   1 
ATOM   3388  C CA  . TYR C  1 81  ? 7.687   67.964  147.564 1.00 26.83  ? 81   TYR C CA  1 
ATOM   3389  C C   . TYR C  1 81  ? 8.534   67.699  148.796 1.00 25.96  ? 81   TYR C C   1 
ATOM   3390  O O   . TYR C  1 81  ? 8.814   68.608  149.574 1.00 25.94  ? 81   TYR C O   1 
ATOM   3391  C CB  . TYR C  1 81  ? 6.205   68.012  147.995 1.00 27.94  ? 81   TYR C CB  1 
ATOM   3392  C CG  . TYR C  1 81  ? 5.717   66.779  148.755 1.00 27.72  ? 81   TYR C CG  1 
ATOM   3393  C CD1 . TYR C  1 81  ? 5.186   65.674  148.078 1.00 27.08  ? 81   TYR C CD1 1 
ATOM   3394  C CD2 . TYR C  1 81  ? 5.803   66.729  150.140 1.00 26.91  ? 81   TYR C CD2 1 
ATOM   3395  C CE1 . TYR C  1 81  ? 4.761   64.553  148.782 1.00 31.95  ? 81   TYR C CE1 1 
ATOM   3396  C CE2 . TYR C  1 81  ? 5.382   65.621  150.853 1.00 29.85  ? 81   TYR C CE2 1 
ATOM   3397  C CZ  . TYR C  1 81  ? 4.863   64.527  150.181 1.00 32.20  ? 81   TYR C CZ  1 
ATOM   3398  O OH  . TYR C  1 81  ? 4.487   63.398  150.901 1.00 34.06  ? 81   TYR C OH  1 
ATOM   3399  N N   . ASN C  1 82  ? 8.925   66.448  148.971 1.00 25.96  ? 82   ASN C N   1 
ATOM   3400  C CA  . ASN C  1 82  ? 9.715   66.066  150.140 1.00 27.63  ? 82   ASN C CA  1 
ATOM   3401  C C   . ASN C  1 82  ? 11.153  65.706  149.770 1.00 26.73  ? 82   ASN C C   1 
ATOM   3402  O O   . ASN C  1 82  ? 11.852  65.060  150.550 1.00 26.68  ? 82   ASN C O   1 
ATOM   3403  C CB  . ASN C  1 82  ? 9.080   64.856  150.840 1.00 29.18  ? 82   ASN C CB  1 
ATOM   3404  C CG  . ASN C  1 82  ? 9.194   63.547  150.010 1.00 31.02  ? 82   ASN C CG  1 
ATOM   3405  O OD1 . ASN C  1 82  ? 9.089   62.446  150.573 1.00 34.11  ? 82   ASN C OD1 1 
ATOM   3406  N ND2 . ASN C  1 82  ? 9.393   63.664  148.690 1.00 26.68  ? 82   ASN C ND2 1 
ATOM   3407  N N   . GLY C  1 83  ? 11.582  66.108  148.576 1.00 26.13  ? 83   GLY C N   1 
ATOM   3408  C CA  . GLY C  1 83  ? 12.924  65.789  148.141 1.00 24.66  ? 83   GLY C CA  1 
ATOM   3409  C C   . GLY C  1 83  ? 13.928  66.935  148.223 1.00 25.00  ? 83   GLY C C   1 
ATOM   3410  O O   . GLY C  1 83  ? 15.120  66.735  147.943 1.00 25.52  ? 83   GLY C O   1 
ATOM   3411  N N   . TRP C  1 84  ? 13.482  68.138  148.566 1.00 22.47  ? 84   TRP C N   1 
ATOM   3412  C CA  . TRP C  1 84  ? 14.414  69.237  148.667 1.00 21.95  ? 84   TRP C CA  1 
ATOM   3413  C C   . TRP C  1 84  ? 13.942  70.137  149.795 1.00 23.31  ? 84   TRP C C   1 
ATOM   3414  O O   . TRP C  1 84  ? 12.779  70.111  150.170 1.00 27.87  ? 84   TRP C O   1 
ATOM   3415  C CB  . TRP C  1 84  ? 14.482  70.030  147.367 1.00 21.50  ? 84   TRP C CB  1 
ATOM   3416  C CG  . TRP C  1 84  ? 13.200  70.809  147.034 1.00 21.58  ? 84   TRP C CG  1 
ATOM   3417  C CD1 . TRP C  1 84  ? 12.039  70.304  146.501 1.00 22.52  ? 84   TRP C CD1 1 
ATOM   3418  C CD2 . TRP C  1 84  ? 12.966  72.211  147.217 1.00 19.75  ? 84   TRP C CD2 1 
ATOM   3419  N NE1 . TRP C  1 84  ? 11.113  71.303  146.339 1.00 19.88  ? 84   TRP C NE1 1 
ATOM   3420  C CE2 . TRP C  1 84  ? 11.657  72.481  146.776 1.00 20.13  ? 84   TRP C CE2 1 
ATOM   3421  C CE3 . TRP C  1 84  ? 13.743  73.272  147.698 1.00 18.18  ? 84   TRP C CE3 1 
ATOM   3422  C CZ2 . TRP C  1 84  ? 11.100  73.774  146.829 1.00 18.67  ? 84   TRP C CZ2 1 
ATOM   3423  C CZ3 . TRP C  1 84  ? 13.192  74.548  147.740 1.00 15.05  ? 84   TRP C CZ3 1 
ATOM   3424  C CH2 . TRP C  1 84  ? 11.896  74.782  147.312 1.00 17.13  ? 84   TRP C CH2 1 
ATOM   3425  N N   . ALA C  1 85  ? 14.839  70.917  150.359 1.00 21.09  ? 85   ALA C N   1 
ATOM   3426  C CA  . ALA C  1 85  ? 14.486  71.777  151.437 1.00 20.61  ? 85   ALA C CA  1 
ATOM   3427  C C   . ALA C  1 85  ? 15.385  73.016  151.371 1.00 21.52  ? 85   ALA C C   1 
ATOM   3428  O O   . ALA C  1 85  ? 16.362  73.035  150.632 1.00 19.43  ? 85   ALA C O   1 
ATOM   3429  C CB  . ALA C  1 85  ? 14.718  71.042  152.739 1.00 19.88  ? 85   ALA C CB  1 
ATOM   3430  N N   . HIS C  1 86  ? 15.037  74.062  152.118 1.00 22.10  ? 86   HIS C N   1 
ATOM   3431  C CA  . HIS C  1 86  ? 15.878  75.244  152.168 1.00 22.76  ? 86   HIS C CA  1 
ATOM   3432  C C   . HIS C  1 86  ? 15.721  75.980  153.492 1.00 21.62  ? 86   HIS C C   1 
ATOM   3433  O O   . HIS C  1 86  ? 14.681  75.942  154.120 1.00 21.49  ? 86   HIS C O   1 
ATOM   3434  C CB  . HIS C  1 86  ? 15.638  76.186  150.997 1.00 21.29  ? 86   HIS C CB  1 
ATOM   3435  C CG  . HIS C  1 86  ? 14.392  76.995  151.109 1.00 24.04  ? 86   HIS C CG  1 
ATOM   3436  N ND1 . HIS C  1 86  ? 13.135  76.495  150.826 1.00 25.53  ? 86   HIS C ND1 1 
ATOM   3437  C CD2 . HIS C  1 86  ? 14.212  78.300  151.404 1.00 25.33  ? 86   HIS C CD2 1 
ATOM   3438  C CE1 . HIS C  1 86  ? 12.243  77.456  150.930 1.00 24.11  ? 86   HIS C CE1 1 
ATOM   3439  N NE2 . HIS C  1 86  ? 12.870  78.562  151.282 1.00 25.57  ? 86   HIS C NE2 1 
ATOM   3440  N N   . SER C  1 87  ? 16.804  76.592  153.935 1.00 20.48  ? 87   SER C N   1 
ATOM   3441  C CA  . SER C  1 87  ? 16.778  77.354  155.157 1.00 20.97  ? 87   SER C CA  1 
ATOM   3442  C C   . SER C  1 87  ? 17.543  78.658  154.912 1.00 20.79  ? 87   SER C C   1 
ATOM   3443  O O   . SER C  1 87  ? 18.308  78.778  153.919 1.00 19.77  ? 87   SER C O   1 
ATOM   3444  C CB  . SER C  1 87  ? 17.378  76.555  156.306 1.00 19.54  ? 87   SER C CB  1 
ATOM   3445  O OG  . SER C  1 87  ? 18.688  76.166  155.989 1.00 22.22  ? 87   SER C OG  1 
ATOM   3446  N N   . ILE C  1 88  ? 17.283  79.651  155.761 1.00 20.44  ? 88   ILE C N   1 
ATOM   3447  C CA  . ILE C  1 88  ? 17.947  80.941  155.635 1.00 21.22  ? 88   ILE C CA  1 
ATOM   3448  C C   . ILE C  1 88  ? 19.065  80.931  156.663 1.00 22.21  ? 88   ILE C C   1 
ATOM   3449  O O   . ILE C  1 88  ? 18.789  81.051  157.836 1.00 24.89  ? 88   ILE C O   1 
ATOM   3450  C CB  . ILE C  1 88  ? 16.972  82.067  155.928 1.00 18.51  ? 88   ILE C CB  1 
ATOM   3451  C CG1 . ILE C  1 88  ? 15.932  82.108  154.821 1.00 17.42  ? 88   ILE C CG1 1 
ATOM   3452  C CG2 . ILE C  1 88  ? 17.715  83.367  156.059 1.00 17.75  ? 88   ILE C CG2 1 
ATOM   3453  C CD1 . ILE C  1 88  ? 14.659  82.812  155.196 1.00 17.16  ? 88   ILE C CD1 1 
ATOM   3454  N N   . THR C  1 89  ? 20.318  80.779  156.250 1.00 22.74  ? 89   THR C N   1 
ATOM   3455  C CA  . THR C  1 89  ? 21.361  80.720  157.232 1.00 24.95  ? 89   THR C CA  1 
ATOM   3456  C C   . THR C  1 89  ? 21.510  82.075  157.850 1.00 25.00  ? 89   THR C C   1 
ATOM   3457  O O   . THR C  1 89  ? 21.832  82.176  159.016 1.00 27.12  ? 89   THR C O   1 
ATOM   3458  C CB  . THR C  1 89  ? 22.672  80.181  156.643 1.00 24.44  ? 89   THR C CB  1 
ATOM   3459  O OG1 . THR C  1 89  ? 22.908  80.840  155.416 1.00 32.81  ? 89   THR C OG1 1 
ATOM   3460  C CG2 . THR C  1 89  ? 22.530  78.704  156.287 1.00 27.21  ? 89   THR C CG2 1 
ATOM   3461  N N   . GLN C  1 90  ? 21.211  83.121  157.105 1.00 25.83  ? 90   GLN C N   1 
ATOM   3462  C CA  . GLN C  1 90  ? 21.316  84.454  157.657 1.00 27.26  ? 90   GLN C CA  1 
ATOM   3463  C C   . GLN C  1 90  ? 20.776  85.508  156.714 1.00 27.80  ? 90   GLN C C   1 
ATOM   3464  O O   . GLN C  1 90  ? 20.857  85.351  155.498 1.00 29.81  ? 90   GLN C O   1 
ATOM   3465  C CB  . GLN C  1 90  ? 22.750  84.785  157.944 1.00 28.84  ? 90   GLN C CB  1 
ATOM   3466  C CG  . GLN C  1 90  ? 22.858  86.045  158.727 1.00 34.72  ? 90   GLN C CG  1 
ATOM   3467  C CD  . GLN C  1 90  ? 24.282  86.604  158.779 1.00 37.85  ? 90   GLN C CD  1 
ATOM   3468  O OE1 . GLN C  1 90  ? 25.220  85.913  159.184 1.00 38.65  ? 90   GLN C OE1 1 
ATOM   3469  N NE2 . GLN C  1 90  ? 24.441  87.882  158.363 1.00 41.10  ? 90   GLN C NE2 1 
ATOM   3470  N N   . GLN C  1 91  ? 20.198  86.574  157.258 1.00 27.65  ? 91   GLN C N   1 
ATOM   3471  C CA  . GLN C  1 91  ? 19.698  87.686  156.429 1.00 26.27  ? 91   GLN C CA  1 
ATOM   3472  C C   . GLN C  1 91  ? 20.225  88.930  157.054 1.00 26.86  ? 91   GLN C C   1 
ATOM   3473  O O   . GLN C  1 91  ? 20.066  89.150  158.260 1.00 27.65  ? 91   GLN C O   1 
ATOM   3474  C CB  . GLN C  1 91  ? 18.179  87.800  156.381 1.00 23.78  ? 91   GLN C CB  1 
ATOM   3475  C CG  . GLN C  1 91  ? 17.816  88.987  155.498 1.00 23.87  ? 91   GLN C CG  1 
ATOM   3476  C CD  . GLN C  1 91  ? 16.370  89.065  155.064 1.00 24.89  ? 91   GLN C CD  1 
ATOM   3477  O OE1 . GLN C  1 91  ? 15.489  89.395  155.852 1.00 27.87  ? 91   GLN C OE1 1 
ATOM   3478  N NE2 . GLN C  1 91  ? 16.119  88.775  153.790 1.00 24.52  ? 91   GLN C NE2 1 
ATOM   3479  N N   . ASN C  1 92  ? 20.852  89.766  156.257 1.00 28.47  ? 92   ASN C N   1 
ATOM   3480  C CA  . ASN C  1 92  ? 21.405  90.980  156.833 1.00 29.24  ? 92   ASN C CA  1 
ATOM   3481  C C   . ASN C  1 92  ? 20.982  92.183  156.051 1.00 30.27  ? 92   ASN C C   1 
ATOM   3482  O O   . ASN C  1 92  ? 21.016  92.189  154.823 1.00 31.83  ? 92   ASN C O   1 
ATOM   3483  C CB  . ASN C  1 92  ? 22.899  90.860  156.869 1.00 31.07  ? 92   ASN C CB  1 
ATOM   3484  C CG  . ASN C  1 92  ? 23.541  91.979  157.592 1.00 35.25  ? 92   ASN C CG  1 
ATOM   3485  O OD1 . ASN C  1 92  ? 23.746  93.066  157.031 1.00 37.91  ? 92   ASN C OD1 1 
ATOM   3486  N ND2 . ASN C  1 92  ? 23.897  91.738  158.864 1.00 37.72  ? 92   ASN C ND2 1 
ATOM   3487  N N   . VAL C  1 93  ? 20.502  93.193  156.764 1.00 31.54  ? 93   VAL C N   1 
ATOM   3488  C CA  . VAL C  1 93  ? 20.094  94.453  156.139 1.00 30.61  ? 93   VAL C CA  1 
ATOM   3489  C C   . VAL C  1 93  ? 21.353  95.294  155.994 1.00 31.20  ? 93   VAL C C   1 
ATOM   3490  O O   . VAL C  1 93  ? 21.930  95.719  156.981 1.00 31.09  ? 93   VAL C O   1 
ATOM   3491  C CB  . VAL C  1 93  ? 19.083  95.229  157.024 1.00 28.89  ? 93   VAL C CB  1 
ATOM   3492  C CG1 . VAL C  1 93  ? 18.870  96.625  156.452 1.00 28.83  ? 93   VAL C CG1 1 
ATOM   3493  C CG2 . VAL C  1 93  ? 17.778  94.500  157.054 1.00 26.66  ? 93   VAL C CG2 1 
ATOM   3494  N N   . ASP C  1 94  ? 21.780  95.539  154.768 1.00 32.88  ? 94   ASP C N   1 
ATOM   3495  C CA  . ASP C  1 94  ? 22.996  96.318  154.565 1.00 35.69  ? 94   ASP C CA  1 
ATOM   3496  C C   . ASP C  1 94  ? 22.860  97.780  154.902 1.00 37.46  ? 94   ASP C C   1 
ATOM   3497  O O   . ASP C  1 94  ? 23.751  98.367  155.521 1.00 37.41  ? 94   ASP C O   1 
ATOM   3498  C CB  . ASP C  1 94  ? 23.472  96.165  153.121 1.00 36.01  ? 94   ASP C CB  1 
ATOM   3499  C CG  . ASP C  1 94  ? 24.097  94.824  152.873 1.00 33.81  ? 94   ASP C CG  1 
ATOM   3500  O OD1 . ASP C  1 94  ? 24.252  94.448  151.690 1.00 32.28  ? 94   ASP C OD1 1 
ATOM   3501  O OD2 . ASP C  1 94  ? 24.421  94.170  153.892 1.00 32.66  ? 94   ASP C OD2 1 
ATOM   3502  N N   . PHE C  1 95  ? 21.746  98.372  154.485 1.00 39.98  ? 95   PHE C N   1 
ATOM   3503  C CA  . PHE C  1 95  ? 21.521  99.778  154.764 1.00 42.44  ? 95   PHE C CA  1 
ATOM   3504  C C   . PHE C  1 95  ? 20.092  100.201 154.527 1.00 44.15  ? 95   PHE C C   1 
ATOM   3505  O O   . PHE C  1 95  ? 19.346  99.571  153.779 1.00 44.44  ? 95   PHE C O   1 
ATOM   3506  C CB  . PHE C  1 95  ? 22.454  100.635 153.906 1.00 41.06  ? 95   PHE C CB  1 
ATOM   3507  C CG  . PHE C  1 95  ? 22.185  100.537 152.447 1.00 40.92  ? 95   PHE C CG  1 
ATOM   3508  C CD1 . PHE C  1 95  ? 21.238  101.346 151.849 1.00 40.29  ? 95   PHE C CD1 1 
ATOM   3509  C CD2 . PHE C  1 95  ? 22.820  99.577  151.682 1.00 41.42  ? 95   PHE C CD2 1 
ATOM   3510  C CE1 . PHE C  1 95  ? 20.910  101.191 150.492 1.00 41.67  ? 95   PHE C CE1 1 
ATOM   3511  C CE2 . PHE C  1 95  ? 22.505  99.409  150.320 1.00 42.72  ? 95   PHE C CE2 1 
ATOM   3512  C CZ  . PHE C  1 95  ? 21.549  100.211 149.727 1.00 42.47  ? 95   PHE C CZ  1 
ATOM   3513  N N   . VAL C  1 96  ? 19.707  101.268 155.211 1.00 46.96  ? 96   VAL C N   1 
ATOM   3514  C CA  . VAL C  1 96  ? 18.386  101.864 155.050 1.00 47.57  ? 96   VAL C CA  1 
ATOM   3515  C C   . VAL C  1 96  ? 18.705  103.346 155.005 1.00 48.11  ? 96   VAL C C   1 
ATOM   3516  O O   . VAL C  1 96  ? 18.977  103.950 156.031 1.00 47.28  ? 96   VAL C O   1 
ATOM   3517  C CB  . VAL C  1 96  ? 17.468  101.550 156.233 1.00 46.73  ? 96   VAL C CB  1 
ATOM   3518  C CG1 . VAL C  1 96  ? 16.162  102.275 156.069 1.00 47.72  ? 96   VAL C CG1 1 
ATOM   3519  C CG2 . VAL C  1 96  ? 17.192  100.084 156.283 1.00 46.54  ? 96   VAL C CG2 1 
ATOM   3520  N N   . ASP C  1 97  ? 18.742  103.900 153.800 1.00 49.62  ? 97   ASP C N   1 
ATOM   3521  C CA  . ASP C  1 97  ? 19.021  105.315 153.612 1.00 51.82  ? 97   ASP C CA  1 
ATOM   3522  C C   . ASP C  1 97  ? 17.780  106.113 153.192 1.00 55.48  ? 97   ASP C C   1 
ATOM   3523  O O   . ASP C  1 97  ? 16.942  105.644 152.387 1.00 55.72  ? 97   ASP C O   1 
ATOM   3524  C CB  . ASP C  1 97  ? 20.096  105.499 152.554 1.00 49.25  ? 97   ASP C CB  1 
ATOM   3525  C CG  . ASP C  1 97  ? 21.440  104.937 152.982 1.00 48.89  ? 97   ASP C CG  1 
ATOM   3526  O OD1 . ASP C  1 97  ? 21.648  104.727 154.207 1.00 46.67  ? 97   ASP C OD1 1 
ATOM   3527  O OD2 . ASP C  1 97  ? 22.297  104.712 152.084 1.00 47.23  ? 97   ASP C OD2 1 
ATOM   3528  N N   . LEU C  1 98  ? 17.667  107.322 153.750 1.00 59.74  ? 98   LEU C N   1 
ATOM   3529  C CA  . LEU C  1 98  ? 16.564  108.264 153.450 1.00 63.21  ? 98   LEU C CA  1 
ATOM   3530  C C   . LEU C  1 98  ? 17.278  109.425 152.775 1.00 65.22  ? 98   LEU C C   1 
ATOM   3531  O O   . LEU C  1 98  ? 17.990  110.156 153.438 1.00 65.75  ? 98   LEU C O   1 
ATOM   3532  C CB  . LEU C  1 98  ? 15.930  108.734 154.746 1.00 62.19  ? 98   LEU C CB  1 
ATOM   3533  C CG  . LEU C  1 98  ? 15.019  109.939 154.631 1.00 62.46  ? 98   LEU C CG  1 
ATOM   3534  C CD1 . LEU C  1 98  ? 13.639  109.506 154.164 1.00 62.24  ? 98   LEU C CD1 1 
ATOM   3535  C CD2 . LEU C  1 98  ? 14.956  110.615 155.986 1.00 62.33  ? 98   LEU C CD2 1 
ATOM   3536  N N   . ASN C  1 99  ? 17.099  109.600 151.472 1.00 68.59  ? 99   ASN C N   1 
ATOM   3537  C CA  . ASN C  1 99  ? 17.840  110.644 150.769 1.00 72.83  ? 99   ASN C CA  1 
ATOM   3538  C C   . ASN C  1 99  ? 17.078  111.824 150.224 1.00 73.89  ? 99   ASN C C   1 
ATOM   3539  O O   . ASN C  1 99  ? 17.654  112.687 149.556 1.00 74.30  ? 99   ASN C O   1 
ATOM   3540  C CB  . ASN C  1 99  ? 18.643  110.031 149.616 1.00 76.25  ? 99   ASN C CB  1 
ATOM   3541  C CG  . ASN C  1 99  ? 19.878  109.253 150.099 1.00 80.08  ? 99   ASN C CG  1 
ATOM   3542  O OD1 . ASN C  1 99  ? 20.497  108.488 149.326 1.00 80.44  ? 99   ASN C OD1 1 
ATOM   3543  N ND2 . ASN C  1 99  ? 20.254  109.460 151.377 1.00 82.24  ? 99   ASN C ND2 1 
ATOM   3544  N N   . ASN C  1 100 ? 15.788  111.863 150.504 1.00 74.14  ? 100  ASN C N   1 
ATOM   3545  C CA  . ASN C  1 100 ? 14.908  112.935 150.041 1.00 74.61  ? 100  ASN C CA  1 
ATOM   3546  C C   . ASN C  1 100 ? 13.756  112.622 150.967 1.00 73.25  ? 100  ASN C C   1 
ATOM   3547  O O   . ASN C  1 100 ? 13.872  112.789 152.185 1.00 73.71  ? 100  ASN C O   1 
ATOM   3548  C CB  . ASN C  1 100 ? 14.548  112.637 148.604 1.00 77.58  ? 100  ASN C CB  1 
ATOM   3549  C CG  . ASN C  1 100 ? 15.237  111.343 148.112 1.00 80.87  ? 100  ASN C CG  1 
ATOM   3550  O OD1 . ASN C  1 100 ? 16.431  111.348 147.756 1.00 81.40  ? 100  ASN C OD1 1 
ATOM   3551  N ND2 . ASN C  1 100 ? 14.498  110.226 148.134 1.00 82.42  ? 100  ASN C ND2 1 
ATOM   3552  N N   . GLY C  1 101 ? 12.658  112.137 150.408 1.00 71.10  ? 101  GLY C N   1 
ATOM   3553  C CA  . GLY C  1 101 ? 11.545  111.727 151.244 1.00 68.14  ? 101  GLY C CA  1 
ATOM   3554  C C   . GLY C  1 101 ? 11.378  110.255 150.936 1.00 66.04  ? 101  GLY C C   1 
ATOM   3555  O O   . GLY C  1 101 ? 10.391  109.625 151.316 1.00 66.61  ? 101  GLY C O   1 
ATOM   3556  N N   . LYS C  1 102 ? 12.375  109.717 150.235 1.00 63.20  ? 102  LYS C N   1 
ATOM   3557  C CA  . LYS C  1 102 ? 12.383  108.339 149.799 1.00 59.75  ? 102  LYS C CA  1 
ATOM   3558  C C   . LYS C  1 102 ? 13.478  107.480 150.421 1.00 56.82  ? 102  LYS C C   1 
ATOM   3559  O O   . LYS C  1 102 ? 14.550  107.960 150.785 1.00 56.40  ? 102  LYS C O   1 
ATOM   3560  C CB  . LYS C  1 102 ? 12.508  108.299 148.290 1.00 61.12  ? 102  LYS C CB  1 
ATOM   3561  C CG  . LYS C  1 102 ? 11.482  109.136 147.566 1.00 62.09  ? 102  LYS C CG  1 
ATOM   3562  C CD  . LYS C  1 102 ? 11.902  109.303 146.114 1.00 63.82  ? 102  LYS C CD  1 
ATOM   3563  C CE  . LYS C  1 102 ? 10.810  109.944 145.283 1.00 64.63  ? 102  LYS C CE  1 
ATOM   3564  N NZ  . LYS C  1 102 ? 11.207  109.976 143.842 1.00 67.23  ? 102  LYS C NZ  1 
ATOM   3565  N N   . PHE C  1 103 ? 13.179  106.190 150.530 1.00 53.28  ? 103  PHE C N   1 
ATOM   3566  C CA  . PHE C  1 103 ? 14.093  105.212 151.105 1.00 48.95  ? 103  PHE C CA  1 
ATOM   3567  C C   . PHE C  1 103 ? 14.852  104.342 150.096 1.00 46.08  ? 103  PHE C C   1 
ATOM   3568  O O   . PHE C  1 103 ? 14.345  103.963 149.017 1.00 45.76  ? 103  PHE C O   1 
ATOM   3569  C CB  . PHE C  1 103 ? 13.327  104.329 152.071 1.00 47.91  ? 103  PHE C CB  1 
ATOM   3570  C CG  . PHE C  1 103 ? 12.852  105.048 153.300 1.00 47.48  ? 103  PHE C CG  1 
ATOM   3571  C CD1 . PHE C  1 103 ? 11.528  105.487 153.406 1.00 47.47  ? 103  PHE C CD1 1 
ATOM   3572  C CD2 . PHE C  1 103 ? 13.722  105.268 154.363 1.00 46.13  ? 103  PHE C CD2 1 
ATOM   3573  C CE1 . PHE C  1 103 ? 11.094  106.122 154.558 1.00 46.53  ? 103  PHE C CE1 1 
ATOM   3574  C CE2 . PHE C  1 103 ? 13.297  105.903 155.512 1.00 45.88  ? 103  PHE C CE2 1 
ATOM   3575  C CZ  . PHE C  1 103 ? 11.988  106.329 155.613 1.00 46.33  ? 103  PHE C CZ  1 
ATOM   3576  N N   . TYR C  1 104 ? 16.095  104.060 150.450 1.00 42.50  ? 104  TYR C N   1 
ATOM   3577  C CA  . TYR C  1 104 ? 16.966  103.231 149.622 1.00 39.59  ? 104  TYR C CA  1 
ATOM   3578  C C   . TYR C  1 104 ? 17.441  102.111 150.521 1.00 37.15  ? 104  TYR C C   1 
ATOM   3579  O O   . TYR C  1 104 ? 18.130  102.342 151.521 1.00 36.09  ? 104  TYR C O   1 
ATOM   3580  C CB  . TYR C  1 104 ? 18.122  104.061 149.095 1.00 40.51  ? 104  TYR C CB  1 
ATOM   3581  C CG  . TYR C  1 104 ? 17.618  105.153 148.213 1.00 40.61  ? 104  TYR C CG  1 
ATOM   3582  C CD1 . TYR C  1 104 ? 17.066  106.314 148.768 1.00 42.06  ? 104  TYR C CD1 1 
ATOM   3583  C CD2 . TYR C  1 104 ? 17.504  104.952 146.848 1.00 41.59  ? 104  TYR C CD2 1 
ATOM   3584  C CE1 . TYR C  1 104 ? 16.384  107.244 147.994 1.00 42.19  ? 104  TYR C CE1 1 
ATOM   3585  C CE2 . TYR C  1 104 ? 16.818  105.870 146.046 1.00 44.47  ? 104  TYR C CE2 1 
ATOM   3586  C CZ  . TYR C  1 104 ? 16.252  107.013 146.634 1.00 44.37  ? 104  TYR C CZ  1 
ATOM   3587  O OH  . TYR C  1 104 ? 15.496  107.858 145.860 1.00 46.26  ? 104  TYR C OH  1 
ATOM   3588  N N   . VAL C  1 105 ? 17.028  100.899 150.171 1.00 34.62  ? 105  VAL C N   1 
ATOM   3589  C CA  . VAL C  1 105 ? 17.331  99.728  150.998 1.00 32.79  ? 105  VAL C CA  1 
ATOM   3590  C C   . VAL C  1 105 ? 17.964  98.541  150.276 1.00 31.37  ? 105  VAL C C   1 
ATOM   3591  O O   . VAL C  1 105 ? 17.505  98.116  149.205 1.00 29.79  ? 105  VAL C O   1 
ATOM   3592  C CB  . VAL C  1 105 ? 16.031  99.227  151.702 1.00 31.68  ? 105  VAL C CB  1 
ATOM   3593  C CG1 . VAL C  1 105 ? 16.348  98.148  152.694 1.00 27.64  ? 105  VAL C CG1 1 
ATOM   3594  C CG2 . VAL C  1 105 ? 15.344  100.390 152.341 1.00 31.06  ? 105  VAL C CG2 1 
ATOM   3595  N N   . GLY C  1 106 ? 19.012  98.019  150.905 1.00 30.35  ? 106  GLY C N   1 
ATOM   3596  C CA  . GLY C  1 106 ? 19.732  96.862  150.398 1.00 29.22  ? 106  GLY C CA  1 
ATOM   3597  C C   . GLY C  1 106 ? 19.780  95.737  151.425 1.00 28.52  ? 106  GLY C C   1 
ATOM   3598  O O   . GLY C  1 106 ? 20.269  95.906  152.560 1.00 26.34  ? 106  GLY C O   1 
ATOM   3599  N N   . VAL C  1 107 ? 19.252  94.581  151.042 1.00 26.79  ? 107  VAL C N   1 
ATOM   3600  C CA  . VAL C  1 107 ? 19.278  93.445  151.946 1.00 25.48  ? 107  VAL C CA  1 
ATOM   3601  C C   . VAL C  1 107 ? 19.870  92.204  151.285 1.00 26.08  ? 107  VAL C C   1 
ATOM   3602  O O   . VAL C  1 107 ? 19.674  91.953  150.072 1.00 25.14  ? 107  VAL C O   1 
ATOM   3603  C CB  . VAL C  1 107 ? 17.887  93.126  152.442 1.00 26.00  ? 107  VAL C CB  1 
ATOM   3604  C CG1 . VAL C  1 107 ? 17.903  91.903  153.250 1.00 26.52  ? 107  VAL C CG1 1 
ATOM   3605  C CG2 . VAL C  1 107 ? 17.377  94.268  153.281 1.00 29.23  ? 107  VAL C CG2 1 
ATOM   3606  N N   . CYS C  1 108 ? 20.629  91.428  152.071 1.00 25.47  ? 108  CYS C N   1 
ATOM   3607  C CA  . CYS C  1 108 ? 21.200  90.193  151.546 1.00 24.35  ? 108  CYS C CA  1 
ATOM   3608  C C   . CYS C  1 108 ? 20.719  88.998  152.380 1.00 24.23  ? 108  CYS C C   1 
ATOM   3609  O O   . CYS C  1 108 ? 20.514  89.108  153.596 1.00 22.22  ? 108  CYS C O   1 
ATOM   3610  C CB  . CYS C  1 108 ? 22.722  90.260  151.536 1.00 22.10  ? 108  CYS C CB  1 
ATOM   3611  S SG  . CYS C  1 108 ? 23.562  90.081  153.153 1.00 23.69  ? 108  CYS C SG  1 
ATOM   3612  N N   . ALA C  1 109 ? 20.532  87.860  151.715 1.00 24.90  ? 109  ALA C N   1 
ATOM   3613  C CA  . ALA C  1 109 ? 20.122  86.627  152.396 1.00 24.30  ? 109  ALA C CA  1 
ATOM   3614  C C   . ALA C  1 109 ? 20.998  85.461  151.927 1.00 24.24  ? 109  ALA C C   1 
ATOM   3615  O O   . ALA C  1 109 ? 21.358  85.358  150.734 1.00 23.57  ? 109  ALA C O   1 
ATOM   3616  C CB  . ALA C  1 109 ? 18.653  86.319  152.092 1.00 23.45  ? 109  ALA C CB  1 
ATOM   3617  N N   . PHE C  1 110 ? 21.365  84.600  152.873 1.00 23.16  ? 110  PHE C N   1 
ATOM   3618  C CA  . PHE C  1 110 ? 22.146  83.408  152.560 1.00 20.92  ? 110  PHE C CA  1 
ATOM   3619  C C   . PHE C  1 110 ? 21.191  82.233  152.675 1.00 20.34  ? 110  PHE C C   1 
ATOM   3620  O O   . PHE C  1 110 ? 20.675  81.954  153.751 1.00 21.56  ? 110  PHE C O   1 
ATOM   3621  C CB  . PHE C  1 110 ? 23.332  83.300  153.514 1.00 19.25  ? 110  PHE C CB  1 
ATOM   3622  C CG  . PHE C  1 110 ? 24.313  84.401  153.321 1.00 21.97  ? 110  PHE C CG  1 
ATOM   3623  C CD1 . PHE C  1 110 ? 24.134  85.622  153.971 1.00 21.39  ? 110  PHE C CD1 1 
ATOM   3624  C CD2 . PHE C  1 110 ? 25.373  84.271  152.420 1.00 21.96  ? 110  PHE C CD2 1 
ATOM   3625  C CE1 . PHE C  1 110 ? 24.970  86.678  153.740 1.00 21.00  ? 110  PHE C CE1 1 
ATOM   3626  C CE2 . PHE C  1 110 ? 26.225  85.335  152.179 1.00 21.34  ? 110  PHE C CE2 1 
ATOM   3627  C CZ  . PHE C  1 110 ? 26.017  86.550  152.846 1.00 22.81  ? 110  PHE C CZ  1 
ATOM   3628  N N   . VAL C  1 111 ? 20.919  81.576  151.564 1.00 18.57  ? 111  VAL C N   1 
ATOM   3629  C CA  . VAL C  1 111 ? 19.965  80.462  151.558 1.00 18.78  ? 111  VAL C CA  1 
ATOM   3630  C C   . VAL C  1 111 ? 20.669  79.138  151.221 1.00 20.57  ? 111  VAL C C   1 
ATOM   3631  O O   . VAL C  1 111 ? 21.445  79.069  150.259 1.00 21.57  ? 111  VAL C O   1 
ATOM   3632  C CB  . VAL C  1 111 ? 18.885  80.739  150.525 1.00 16.71  ? 111  VAL C CB  1 
ATOM   3633  C CG1 . VAL C  1 111 ? 17.918  79.621  150.443 1.00 13.62  ? 111  VAL C CG1 1 
ATOM   3634  C CG2 . VAL C  1 111 ? 18.216  82.088  150.851 1.00 16.59  ? 111  VAL C CG2 1 
ATOM   3635  N N   . ARG C  1 112 ? 20.424  78.115  152.037 1.00 19.99  ? 112  ARG C N   1 
ATOM   3636  C CA  . ARG C  1 112 ? 21.025  76.784  151.860 1.00 20.45  ? 112  ARG C CA  1 
ATOM   3637  C C   . ARG C  1 112 ? 19.929  75.829  151.440 1.00 20.63  ? 112  ARG C C   1 
ATOM   3638  O O   . ARG C  1 112 ? 18.945  75.635  152.157 1.00 22.04  ? 112  ARG C O   1 
ATOM   3639  C CB  . ARG C  1 112 ? 21.601  76.233  153.175 1.00 19.99  ? 112  ARG C CB  1 
ATOM   3640  C CG  . ARG C  1 112 ? 22.698  75.231  152.966 1.00 24.45  ? 112  ARG C CG  1 
ATOM   3641  C CD  . ARG C  1 112 ? 23.355  74.620  154.238 1.00 24.23  ? 112  ARG C CD  1 
ATOM   3642  N NE  . ARG C  1 112 ? 22.797  73.293  154.390 1.00 29.29  ? 112  ARG C NE  1 
ATOM   3643  C CZ  . ARG C  1 112 ? 23.484  72.176  154.586 1.00 30.23  ? 112  ARG C CZ  1 
ATOM   3644  N NH1 . ARG C  1 112 ? 24.809  72.195  154.675 1.00 32.39  ? 112  ARG C NH1 1 
ATOM   3645  N NH2 . ARG C  1 112 ? 22.836  71.023  154.654 1.00 30.45  ? 112  ARG C NH2 1 
ATOM   3646  N N   . VAL C  1 113 ? 20.070  75.228  150.281 1.00 19.74  ? 113  VAL C N   1 
ATOM   3647  C CA  . VAL C  1 113 ? 19.058  74.272  149.875 1.00 18.38  ? 113  VAL C CA  1 
ATOM   3648  C C   . VAL C  1 113 ? 19.659  72.875  150.040 1.00 17.83  ? 113  VAL C C   1 
ATOM   3649  O O   . VAL C  1 113 ? 20.858  72.661  149.911 1.00 18.63  ? 113  VAL C O   1 
ATOM   3650  C CB  . VAL C  1 113 ? 18.596  74.558  148.434 1.00 18.49  ? 113  VAL C CB  1 
ATOM   3651  C CG1 . VAL C  1 113 ? 19.758  74.857  147.584 1.00 23.16  ? 113  VAL C CG1 1 
ATOM   3652  C CG2 . VAL C  1 113 ? 17.969  73.367  147.850 1.00 22.50  ? 113  VAL C CG2 1 
ATOM   3653  N N   . GLN C  1 114 ? 18.847  71.908  150.376 1.00 18.54  ? 114  GLN C N   1 
ATOM   3654  C CA  . GLN C  1 114 ? 19.369  70.559  150.554 1.00 20.29  ? 114  GLN C CA  1 
ATOM   3655  C C   . GLN C  1 114 ? 18.419  69.516  149.992 1.00 21.10  ? 114  GLN C C   1 
ATOM   3656  O O   . GLN C  1 114 ? 17.193  69.718  149.996 1.00 22.27  ? 114  GLN C O   1 
ATOM   3657  C CB  . GLN C  1 114 ? 19.567  70.283  152.024 1.00 21.89  ? 114  GLN C CB  1 
ATOM   3658  C CG  . GLN C  1 114 ? 20.127  68.928  152.331 1.00 22.67  ? 114  GLN C CG  1 
ATOM   3659  C CD  . GLN C  1 114 ? 20.089  68.652  153.802 1.00 22.99  ? 114  GLN C CD  1 
ATOM   3660  O OE1 . GLN C  1 114 ? 20.333  69.512  154.573 1.00 25.30  ? 114  GLN C OE1 1 
ATOM   3661  N NE2 . GLN C  1 114 ? 19.770  67.441  154.186 1.00 28.73  ? 114  GLN C NE2 1 
ATOM   3662  N N   . LEU C  1 115 ? 18.974  68.403  149.515 1.00 20.31  ? 115  LEU C N   1 
ATOM   3663  C CA  . LEU C  1 115 ? 18.158  67.330  148.961 1.00 19.79  ? 115  LEU C CA  1 
ATOM   3664  C C   . LEU C  1 115 ? 17.990  66.279  150.037 1.00 22.39  ? 115  LEU C C   1 
ATOM   3665  O O   . LEU C  1 115 ? 18.725  66.311  151.035 1.00 22.48  ? 115  LEU C O   1 
ATOM   3666  C CB  . LEU C  1 115 ? 18.864  66.748  147.784 1.00 19.19  ? 115  LEU C CB  1 
ATOM   3667  C CG  . LEU C  1 115 ? 18.543  67.258  146.382 1.00 18.66  ? 115  LEU C CG  1 
ATOM   3668  C CD1 . LEU C  1 115 ? 17.988  68.658  146.380 1.00 16.76  ? 115  LEU C CD1 1 
ATOM   3669  C CD2 . LEU C  1 115 ? 19.775  67.099  145.547 1.00 16.36  ? 115  LEU C CD2 1 
ATOM   3670  N N   . LYS C  1 116 ? 17.055  65.335  149.846 1.00 25.10  ? 116  LYS C N   1 
ATOM   3671  C CA  . LYS C  1 116 ? 16.768  64.290  150.864 1.00 26.44  ? 116  LYS C CA  1 
ATOM   3672  C C   . LYS C  1 116 ? 17.991  63.453  151.120 1.00 26.17  ? 116  LYS C C   1 
ATOM   3673  O O   . LYS C  1 116 ? 18.136  62.792  152.112 1.00 26.29  ? 116  LYS C O   1 
ATOM   3674  C CB  . LYS C  1 116 ? 15.592  63.418  150.422 1.00 26.48  ? 116  LYS C CB  1 
ATOM   3675  C CG  . LYS C  1 116 ? 15.761  62.722  149.115 1.00 29.25  ? 116  LYS C CG  1 
ATOM   3676  C CD  . LYS C  1 116 ? 14.518  61.862  148.817 1.00 30.31  ? 116  LYS C CD  1 
ATOM   3677  C CE  . LYS C  1 116 ? 14.501  61.307  147.394 1.00 32.40  ? 116  LYS C CE  1 
ATOM   3678  N NZ  . LYS C  1 116 ? 13.264  60.482  147.071 1.00 33.50  ? 116  LYS C NZ  1 
ATOM   3679  N N   . ASP C  1 117 ? 18.878  63.586  150.175 1.00 27.59  ? 117  ASP C N   1 
ATOM   3680  C CA  . ASP C  1 117 ? 20.187  63.004  150.053 1.00 28.83  ? 117  ASP C CA  1 
ATOM   3681  C C   . ASP C  1 117 ? 21.171  63.497  151.121 1.00 28.72  ? 117  ASP C C   1 
ATOM   3682  O O   . ASP C  1 117 ? 22.058  62.781  151.565 1.00 26.58  ? 117  ASP C O   1 
ATOM   3683  C CB  . ASP C  1 117 ? 20.738  63.535  148.731 1.00 31.96  ? 117  ASP C CB  1 
ATOM   3684  C CG  . ASP C  1 117 ? 21.760  62.696  148.211 1.00 35.75  ? 117  ASP C CG  1 
ATOM   3685  O OD1 . ASP C  1 117 ? 22.550  63.152  147.380 1.00 38.30  ? 117  ASP C OD1 1 
ATOM   3686  O OD2 . ASP C  1 117 ? 21.734  61.532  148.651 1.00 41.87  ? 117  ASP C OD2 1 
ATOM   3687  N N   . GLY C  1 118 ? 21.050  64.789  151.436 1.00 28.10  ? 118  GLY C N   1 
ATOM   3688  C CA  . GLY C  1 118 ? 21.971  65.418  152.341 1.00 25.17  ? 118  GLY C CA  1 
ATOM   3689  C C   . GLY C  1 118 ? 22.869  66.328  151.493 1.00 24.59  ? 118  GLY C C   1 
ATOM   3690  O O   . GLY C  1 118 ? 23.601  67.149  152.055 1.00 22.48  ? 118  GLY C O   1 
ATOM   3691  N N   . SER C  1 119 ? 22.811  66.188  150.156 1.00 22.49  ? 119  SER C N   1 
ATOM   3692  C CA  . SER C  1 119 ? 23.613  67.033  149.297 1.00 22.24  ? 119  SER C CA  1 
ATOM   3693  C C   . SER C  1 119 ? 23.020  68.460  149.383 1.00 21.64  ? 119  SER C C   1 
ATOM   3694  O O   . SER C  1 119 ? 21.811  68.617  149.648 1.00 21.14  ? 119  SER C O   1 
ATOM   3695  C CB  . SER C  1 119 ? 23.659  66.479  147.854 1.00 22.92  ? 119  SER C CB  1 
ATOM   3696  O OG  . SER C  1 119 ? 22.394  66.239  147.343 1.00 25.83  ? 119  SER C OG  1 
ATOM   3697  N N   . TYR C  1 120 ? 23.851  69.487  149.143 1.00 18.40  ? 120  TYR C N   1 
ATOM   3698  C CA  . TYR C  1 120 ? 23.403  70.850  149.313 1.00 17.60  ? 120  TYR C CA  1 
ATOM   3699  C C   . TYR C  1 120 ? 24.218  71.939  148.568 1.00 18.13  ? 120  TYR C C   1 
ATOM   3700  O O   . TYR C  1 120 ? 25.381  71.751  148.203 1.00 17.30  ? 120  TYR C O   1 
ATOM   3701  C CB  . TYR C  1 120 ? 23.467  71.161  150.822 1.00 17.21  ? 120  TYR C CB  1 
ATOM   3702  C CG  . TYR C  1 120 ? 24.881  71.031  151.390 1.00 16.31  ? 120  TYR C CG  1 
ATOM   3703  C CD1 . TYR C  1 120 ? 25.775  72.120  151.372 1.00 18.47  ? 120  TYR C CD1 1 
ATOM   3704  C CD2 . TYR C  1 120 ? 25.375  69.811  151.806 1.00 16.09  ? 120  TYR C CD2 1 
ATOM   3705  C CE1 . TYR C  1 120 ? 27.107  71.997  151.737 1.00 17.09  ? 120  TYR C CE1 1 
ATOM   3706  C CE2 . TYR C  1 120 ? 26.713  69.660  152.175 1.00 17.11  ? 120  TYR C CE2 1 
ATOM   3707  C CZ  . TYR C  1 120 ? 27.584  70.766  152.132 1.00 18.47  ? 120  TYR C CZ  1 
ATOM   3708  O OH  . TYR C  1 120 ? 28.944  70.652  152.396 1.00 16.44  ? 120  TYR C OH  1 
ATOM   3709  N N   . HIS C  1 121 ? 23.601  73.101  148.412 1.00 16.92  ? 121  HIS C N   1 
ATOM   3710  C CA  . HIS C  1 121 ? 24.254  74.236  147.822 1.00 18.41  ? 121  HIS C CA  1 
ATOM   3711  C C   . HIS C  1 121 ? 23.730  75.493  148.519 1.00 20.61  ? 121  HIS C C   1 
ATOM   3712  O O   . HIS C  1 121 ? 22.523  75.599  148.911 1.00 17.91  ? 121  HIS C O   1 
ATOM   3713  C CB  . HIS C  1 121 ? 23.959  74.286  146.346 1.00 20.27  ? 121  HIS C CB  1 
ATOM   3714  C CG  . HIS C  1 121 ? 24.628  73.194  145.565 1.00 21.03  ? 121  HIS C CG  1 
ATOM   3715  N ND1 . HIS C  1 121 ? 23.926  72.234  144.868 1.00 20.38  ? 121  HIS C ND1 1 
ATOM   3716  C CD2 . HIS C  1 121 ? 25.938  72.940  145.340 1.00 20.31  ? 121  HIS C CD2 1 
ATOM   3717  C CE1 . HIS C  1 121 ? 24.772  71.445  144.241 1.00 21.56  ? 121  HIS C CE1 1 
ATOM   3718  N NE2 . HIS C  1 121 ? 26.000  71.853  144.510 1.00 19.73  ? 121  HIS C NE2 1 
ATOM   3719  N N   . GLU C  1 122 ? 24.630  76.444  148.709 1.00 21.12  ? 122  GLU C N   1 
ATOM   3720  C CA  . GLU C  1 122 ? 24.232  77.685  149.387 1.00 22.50  ? 122  GLU C CA  1 
ATOM   3721  C C   . GLU C  1 122 ? 24.644  78.907  148.576 1.00 21.44  ? 122  GLU C C   1 
ATOM   3722  O O   . GLU C  1 122 ? 25.701  78.893  147.927 1.00 22.71  ? 122  GLU C O   1 
ATOM   3723  C CB  . GLU C  1 122 ? 24.871  77.722  150.775 1.00 22.75  ? 122  GLU C CB  1 
ATOM   3724  C CG  . GLU C  1 122 ? 24.550  78.949  151.580 1.00 25.39  ? 122  GLU C CG  1 
ATOM   3725  C CD  . GLU C  1 122 ? 25.202  78.951  152.974 1.00 26.47  ? 122  GLU C CD  1 
ATOM   3726  O OE1 . GLU C  1 122 ? 26.126  78.146  153.227 1.00 27.35  ? 122  GLU C OE1 1 
ATOM   3727  O OE2 . GLU C  1 122 ? 24.800  79.781  153.817 1.00 25.99  ? 122  GLU C OE2 1 
ATOM   3728  N N   . ASP C  1 123 ? 23.822  79.942  148.555 1.00 19.38  ? 123  ASP C N   1 
ATOM   3729  C CA  . ASP C  1 123 ? 24.234  81.126  147.808 1.00 20.59  ? 123  ASP C CA  1 
ATOM   3730  C C   . ASP C  1 123 ? 23.677  82.405  148.439 1.00 20.17  ? 123  ASP C C   1 
ATOM   3731  O O   . ASP C  1 123 ? 22.949  82.335  149.404 1.00 20.36  ? 123  ASP C O   1 
ATOM   3732  C CB  . ASP C  1 123 ? 23.746  81.016  146.374 1.00 22.55  ? 123  ASP C CB  1 
ATOM   3733  C CG  . ASP C  1 123 ? 24.676  81.673  145.415 1.00 24.05  ? 123  ASP C CG  1 
ATOM   3734  O OD1 . ASP C  1 123 ? 25.170  82.753  145.804 1.00 24.45  ? 123  ASP C OD1 1 
ATOM   3735  O OD2 . ASP C  1 123 ? 24.925  81.124  144.301 1.00 25.19  ? 123  ASP C OD2 1 
ATOM   3736  N N   . VAL C  1 124 ? 24.027  83.576  147.915 1.00 20.43  ? 124  VAL C N   1 
ATOM   3737  C CA  . VAL C  1 124 ? 23.491  84.841  148.448 1.00 20.31  ? 124  VAL C CA  1 
ATOM   3738  C C   . VAL C  1 124 ? 22.450  85.314  147.506 1.00 19.40  ? 124  VAL C C   1 
ATOM   3739  O O   . VAL C  1 124 ? 22.571  85.153  146.298 1.00 21.43  ? 124  VAL C O   1 
ATOM   3740  C CB  . VAL C  1 124 ? 24.434  86.106  148.400 1.00 20.52  ? 124  VAL C CB  1 
ATOM   3741  C CG1 . VAL C  1 124 ? 24.685  86.591  149.743 1.00 23.89  ? 124  VAL C CG1 1 
ATOM   3742  C CG2 . VAL C  1 124 ? 25.676  85.869  147.630 1.00 24.30  ? 124  VAL C CG2 1 
ATOM   3743  N N   . GLY C  1 125 ? 21.457  85.960  148.055 1.00 19.71  ? 125  GLY C N   1 
ATOM   3744  C CA  . GLY C  1 125 ? 20.445  86.573  147.234 1.00 21.68  ? 125  GLY C CA  1 
ATOM   3745  C C   . GLY C  1 125 ? 20.473  88.028  147.683 1.00 23.16  ? 125  GLY C C   1 
ATOM   3746  O O   . GLY C  1 125 ? 20.947  88.329  148.793 1.00 24.46  ? 125  GLY C O   1 
ATOM   3747  N N   . TYR C  1 126 ? 20.008  88.950  146.851 1.00 24.14  ? 126  TYR C N   1 
ATOM   3748  C CA  . TYR C  1 126 ? 19.985  90.344  147.278 1.00 23.74  ? 126  TYR C CA  1 
ATOM   3749  C C   . TYR C  1 126 ? 18.598  90.878  147.022 1.00 23.20  ? 126  TYR C C   1 
ATOM   3750  O O   . TYR C  1 126 ? 17.930  90.426  146.125 1.00 22.25  ? 126  TYR C O   1 
ATOM   3751  C CB  . TYR C  1 126 ? 20.992  91.192  146.514 1.00 24.21  ? 126  TYR C CB  1 
ATOM   3752  C CG  . TYR C  1 126 ? 21.511  92.340  147.362 1.00 24.11  ? 126  TYR C CG  1 
ATOM   3753  C CD1 . TYR C  1 126 ? 22.400  92.098  148.409 1.00 22.54  ? 126  TYR C CD1 1 
ATOM   3754  C CD2 . TYR C  1 126 ? 21.045  93.645  147.172 1.00 23.17  ? 126  TYR C CD2 1 
ATOM   3755  C CE1 . TYR C  1 126 ? 22.815  93.091  149.244 1.00 22.04  ? 126  TYR C CE1 1 
ATOM   3756  C CE2 . TYR C  1 126 ? 21.441  94.664  148.005 1.00 22.03  ? 126  TYR C CE2 1 
ATOM   3757  C CZ  . TYR C  1 126 ? 22.339  94.384  149.059 1.00 24.46  ? 126  TYR C CZ  1 
ATOM   3758  O OH  . TYR C  1 126 ? 22.759  95.376  149.949 1.00 21.54  ? 126  TYR C OH  1 
ATOM   3759  N N   . GLY C  1 127 ? 18.171  91.821  147.846 1.00 24.40  ? 127  GLY C N   1 
ATOM   3760  C CA  . GLY C  1 127 ? 16.864  92.453  147.708 1.00 24.39  ? 127  GLY C CA  1 
ATOM   3761  C C   . GLY C  1 127 ? 17.036  93.977  147.727 1.00 26.56  ? 127  GLY C C   1 
ATOM   3762  O O   . GLY C  1 127 ? 17.760  94.574  148.560 1.00 26.75  ? 127  GLY C O   1 
ATOM   3763  N N   . VAL C  1 128 ? 16.359  94.637  146.812 1.00 26.71  ? 128  VAL C N   1 
ATOM   3764  C CA  . VAL C  1 128 ? 16.487  96.072  146.737 1.00 27.87  ? 128  VAL C CA  1 
ATOM   3765  C C   . VAL C  1 128 ? 15.171  96.824  146.695 1.00 30.31  ? 128  VAL C C   1 
ATOM   3766  O O   . VAL C  1 128 ? 14.178  96.374  146.116 1.00 31.89  ? 128  VAL C O   1 
ATOM   3767  C CB  . VAL C  1 128 ? 17.269  96.458  145.458 1.00 27.94  ? 128  VAL C CB  1 
ATOM   3768  C CG1 . VAL C  1 128 ? 17.415  97.982  145.365 1.00 25.26  ? 128  VAL C CG1 1 
ATOM   3769  C CG2 . VAL C  1 128 ? 18.634  95.736  145.445 1.00 25.62  ? 128  VAL C CG2 1 
ATOM   3770  N N   . SER C  1 129 ? 15.162  97.985  147.320 1.00 33.34  ? 129  SER C N   1 
ATOM   3771  C CA  . SER C  1 129 ? 13.987  98.858  147.284 1.00 35.64  ? 129  SER C CA  1 
ATOM   3772  C C   . SER C  1 129 ? 14.514  100.290 147.222 1.00 36.36  ? 129  SER C C   1 
ATOM   3773  O O   . SER C  1 129 ? 15.195  100.765 148.142 1.00 34.97  ? 129  SER C O   1 
ATOM   3774  C CB  . SER C  1 129 ? 13.083  98.663  148.512 1.00 35.68  ? 129  SER C CB  1 
ATOM   3775  O OG  . SER C  1 129 ? 11.860  99.372  148.334 1.00 35.90  ? 129  SER C OG  1 
ATOM   3776  N N   . GLU C  1 130 ? 14.246  100.957 146.107 1.00 37.92  ? 130  GLU C N   1 
ATOM   3777  C CA  . GLU C  1 130 ? 14.727  102.317 145.928 1.00 40.45  ? 130  GLU C CA  1 
ATOM   3778  C C   . GLU C  1 130 ? 13.617  103.262 145.490 1.00 42.16  ? 130  GLU C C   1 
ATOM   3779  O O   . GLU C  1 130 ? 12.981  103.039 144.456 1.00 41.02  ? 130  GLU C O   1 
ATOM   3780  C CB  . GLU C  1 130 ? 15.854  102.348 144.890 1.00 40.19  ? 130  GLU C CB  1 
ATOM   3781  C CG  . GLU C  1 130 ? 17.137  101.687 145.386 1.00 41.82  ? 130  GLU C CG  1 
ATOM   3782  C CD  . GLU C  1 130 ? 18.265  101.655 144.351 1.00 43.32  ? 130  GLU C CD  1 
ATOM   3783  O OE1 . GLU C  1 130 ? 18.010  101.255 143.179 1.00 45.14  ? 130  GLU C OE1 1 
ATOM   3784  O OE2 . GLU C  1 130 ? 19.416  102.004 144.716 1.00 41.12  ? 130  GLU C OE2 1 
ATOM   3785  N N   . GLY C  1 131 ? 13.393  104.316 146.286 1.00 43.66  ? 131  GLY C N   1 
ATOM   3786  C CA  . GLY C  1 131 ? 12.377  105.295 145.945 1.00 44.42  ? 131  GLY C CA  1 
ATOM   3787  C C   . GLY C  1 131 ? 11.053  105.348 146.693 1.00 45.36  ? 131  GLY C C   1 
ATOM   3788  O O   . GLY C  1 131 ? 10.381  106.367 146.581 1.00 47.06  ? 131  GLY C O   1 
ATOM   3789  N N   . LEU C  1 132 ? 10.660  104.307 147.431 1.00 45.44  ? 132  LEU C N   1 
ATOM   3790  C CA  . LEU C  1 132 ? 9.380   104.319 148.136 1.00 45.07  ? 132  LEU C CA  1 
ATOM   3791  C C   . LEU C  1 132 ? 9.438   105.325 149.258 1.00 45.66  ? 132  LEU C C   1 
ATOM   3792  O O   . LEU C  1 132 ? 10.518  105.710 149.675 1.00 45.18  ? 132  LEU C O   1 
ATOM   3793  C CB  . LEU C  1 132 ? 9.049   102.931 148.705 1.00 43.62  ? 132  LEU C CB  1 
ATOM   3794  C CG  . LEU C  1 132 ? 8.905   101.835 147.662 1.00 43.44  ? 132  LEU C CG  1 
ATOM   3795  C CD1 . LEU C  1 132 ? 8.455   100.564 148.352 1.00 42.79  ? 132  LEU C CD1 1 
ATOM   3796  C CD2 . LEU C  1 132 ? 7.920   102.270 146.574 1.00 42.67  ? 132  LEU C CD2 1 
ATOM   3797  N N   . LYS C  1 133 ? 8.285   105.762 149.749 1.00 46.84  ? 133  LYS C N   1 
ATOM   3798  C CA  . LYS C  1 133 ? 8.309   106.718 150.833 1.00 48.07  ? 133  LYS C CA  1 
ATOM   3799  C C   . LYS C  1 133 ? 8.032   105.982 152.114 1.00 48.22  ? 133  LYS C C   1 
ATOM   3800  O O   . LYS C  1 133 ? 8.181   106.536 153.212 1.00 49.16  ? 133  LYS C O   1 
ATOM   3801  C CB  . LYS C  1 133 ? 7.289   107.839 150.605 1.00 49.60  ? 133  LYS C CB  1 
ATOM   3802  C CG  . LYS C  1 133 ? 7.578   108.701 149.374 1.00 52.59  ? 133  LYS C CG  1 
ATOM   3803  C CD  . LYS C  1 133 ? 6.873   110.067 149.422 1.00 55.36  ? 133  LYS C CD  1 
ATOM   3804  C CE  . LYS C  1 133 ? 5.367   109.952 149.761 1.00 57.96  ? 133  LYS C CE  1 
ATOM   3805  N NZ  . LYS C  1 133 ? 4.586   109.006 148.877 1.00 58.80  ? 133  LYS C NZ  1 
ATOM   3806  N N   . SER C  1 134 ? 7.615   104.724 151.982 1.00 48.28  ? 134  SER C N   1 
ATOM   3807  C CA  . SER C  1 134 ? 7.342   103.897 153.166 1.00 47.13  ? 134  SER C CA  1 
ATOM   3808  C C   . SER C  1 134 ? 8.569   103.080 153.568 1.00 46.98  ? 134  SER C C   1 
ATOM   3809  O O   . SER C  1 134 ? 9.096   102.285 152.790 1.00 45.96  ? 134  SER C O   1 
ATOM   3810  C CB  . SER C  1 134 ? 6.177   102.941 152.925 1.00 45.19  ? 134  SER C CB  1 
ATOM   3811  O OG  . SER C  1 134 ? 5.901   102.257 154.133 1.00 43.40  ? 134  SER C OG  1 
ATOM   3812  N N   . LYS C  1 135 ? 9.041   103.307 154.778 1.00 47.94  ? 135  LYS C N   1 
ATOM   3813  C CA  . LYS C  1 135 ? 10.186  102.574 155.285 1.00 49.56  ? 135  LYS C CA  1 
ATOM   3814  C C   . LYS C  1 135 ? 9.749   101.100 155.384 1.00 50.43  ? 135  LYS C C   1 
ATOM   3815  O O   . LYS C  1 135 ? 10.425  100.184 154.899 1.00 52.02  ? 135  LYS C O   1 
ATOM   3816  C CB  . LYS C  1 135 ? 10.530  103.103 156.666 1.00 50.67  ? 135  LYS C CB  1 
ATOM   3817  C CG  . LYS C  1 135 ? 11.888  102.744 157.214 1.00 51.85  ? 135  LYS C CG  1 
ATOM   3818  C CD  . LYS C  1 135 ? 11.914  103.261 158.635 1.00 53.86  ? 135  LYS C CD  1 
ATOM   3819  C CE  . LYS C  1 135 ? 13.284  103.711 159.071 1.00 56.92  ? 135  LYS C CE  1 
ATOM   3820  N NZ  . LYS C  1 135 ? 13.255  104.420 160.391 1.00 57.72  ? 135  LYS C NZ  1 
ATOM   3821  N N   . ALA C  1 136 ? 8.607   100.877 156.016 1.00 49.06  ? 136  ALA C N   1 
ATOM   3822  C CA  . ALA C  1 136 ? 8.099   99.534  156.153 1.00 48.25  ? 136  ALA C CA  1 
ATOM   3823  C C   . ALA C  1 136 ? 7.984   98.832  154.799 1.00 46.84  ? 136  ALA C C   1 
ATOM   3824  O O   . ALA C  1 136 ? 8.484   97.736  154.621 1.00 47.67  ? 136  ALA C O   1 
ATOM   3825  C CB  . ALA C  1 136 ? 6.750   99.566  156.839 1.00 48.90  ? 136  ALA C CB  1 
ATOM   3826  N N   . LEU C  1 137 ? 7.320   99.448  153.845 1.00 45.46  ? 137  LEU C N   1 
ATOM   3827  C CA  . LEU C  1 137 ? 7.186   98.808  152.545 1.00 46.24  ? 137  LEU C CA  1 
ATOM   3828  C C   . LEU C  1 137 ? 8.537   98.545  151.858 1.00 45.66  ? 137  LEU C C   1 
ATOM   3829  O O   . LEU C  1 137 ? 8.710   97.549  151.152 1.00 45.72  ? 137  LEU C O   1 
ATOM   3830  C CB  . LEU C  1 137 ? 6.286   99.632  151.630 1.00 47.63  ? 137  LEU C CB  1 
ATOM   3831  C CG  . LEU C  1 137 ? 4.772   99.444  151.803 1.00 50.08  ? 137  LEU C CG  1 
ATOM   3832  C CD1 . LEU C  1 137 ? 4.383   98.074  151.328 1.00 53.21  ? 137  LEU C CD1 1 
ATOM   3833  C CD2 . LEU C  1 137 ? 4.371   99.574  153.262 1.00 51.85  ? 137  LEU C CD2 1 
ATOM   3834  N N   . SER C  1 138 ? 9.492   99.435  152.072 1.00 43.76  ? 138  SER C N   1 
ATOM   3835  C CA  . SER C  1 138 ? 10.810  99.274  151.496 1.00 41.61  ? 138  SER C CA  1 
ATOM   3836  C C   . SER C  1 138 ? 11.504  98.050  152.115 1.00 41.81  ? 138  SER C C   1 
ATOM   3837  O O   . SER C  1 138 ? 11.984  97.167  151.396 1.00 41.31  ? 138  SER C O   1 
ATOM   3838  C CB  . SER C  1 138 ? 11.622  100.535 151.741 1.00 39.28  ? 138  SER C CB  1 
ATOM   3839  O OG  . SER C  1 138 ? 11.199  101.576 150.859 1.00 41.10  ? 138  SER C OG  1 
ATOM   3840  N N   . LEU C  1 139 ? 11.538  97.994  153.446 1.00 39.84  ? 139  LEU C N   1 
ATOM   3841  C CA  . LEU C  1 139 ? 12.148  96.888  154.154 1.00 37.34  ? 139  LEU C CA  1 
ATOM   3842  C C   . LEU C  1 139 ? 11.462  95.578  153.765 1.00 36.04  ? 139  LEU C C   1 
ATOM   3843  O O   . LEU C  1 139 ? 12.102  94.564  153.492 1.00 36.34  ? 139  LEU C O   1 
ATOM   3844  C CB  . LEU C  1 139 ? 12.011  97.107  155.644 1.00 36.68  ? 139  LEU C CB  1 
ATOM   3845  C CG  . LEU C  1 139 ? 13.271  97.285  156.490 1.00 38.47  ? 139  LEU C CG  1 
ATOM   3846  C CD1 . LEU C  1 139 ? 14.513  97.093  155.697 1.00 36.51  ? 139  LEU C CD1 1 
ATOM   3847  C CD2 . LEU C  1 139 ? 13.250  98.650  157.112 1.00 40.14  ? 139  LEU C CD2 1 
ATOM   3848  N N   . GLU C  1 140 ? 10.148  95.588  153.719 1.00 35.26  ? 140  GLU C N   1 
ATOM   3849  C CA  . GLU C  1 140 ? 9.446   94.363  153.372 1.00 35.09  ? 140  GLU C CA  1 
ATOM   3850  C C   . GLU C  1 140 ? 9.834   93.815  151.991 1.00 33.55  ? 140  GLU C C   1 
ATOM   3851  O O   . GLU C  1 140 ? 10.108  92.638  151.841 1.00 34.11  ? 140  GLU C O   1 
ATOM   3852  C CB  . GLU C  1 140 ? 7.943   94.567  153.435 1.00 34.85  ? 140  GLU C CB  1 
ATOM   3853  C CG  . GLU C  1 140 ? 7.215   93.456  152.732 1.00 37.03  ? 140  GLU C CG  1 
ATOM   3854  C CD  . GLU C  1 140 ? 5.708   93.612  152.749 1.00 38.78  ? 140  GLU C CD  1 
ATOM   3855  O OE1 . GLU C  1 140 ? 5.187   94.692  152.346 1.00 36.64  ? 140  GLU C OE1 1 
ATOM   3856  O OE2 . GLU C  1 140 ? 5.049   92.627  153.157 1.00 40.50  ? 140  GLU C OE2 1 
ATOM   3857  N N   . LYS C  1 141 ? 9.855   94.675  150.983 1.00 32.78  ? 141  LYS C N   1 
ATOM   3858  C CA  . LYS C  1 141 ? 10.218  94.279  149.624 1.00 30.22  ? 141  LYS C CA  1 
ATOM   3859  C C   . LYS C  1 141 ? 11.640  93.747  149.523 1.00 29.46  ? 141  LYS C C   1 
ATOM   3860  O O   . LYS C  1 141 ? 11.884  92.725  148.892 1.00 30.01  ? 141  LYS C O   1 
ATOM   3861  C CB  . LYS C  1 141 ? 10.082  95.456  148.679 1.00 29.94  ? 141  LYS C CB  1 
ATOM   3862  C CG  . LYS C  1 141 ? 10.484  95.141  147.257 1.00 30.94  ? 141  LYS C CG  1 
ATOM   3863  C CD  . LYS C  1 141 ? 10.438  96.391  146.368 1.00 29.76  ? 141  LYS C CD  1 
ATOM   3864  C CE  . LYS C  1 141 ? 10.720  96.062  144.910 1.00 28.59  ? 141  LYS C CE  1 
ATOM   3865  N NZ  . LYS C  1 141 ? 12.136  95.671  144.736 1.00 26.47  ? 141  LYS C NZ  1 
ATOM   3866  N N   . ALA C  1 142 ? 12.579  94.446  150.126 1.00 28.34  ? 142  ALA C N   1 
ATOM   3867  C CA  . ALA C  1 142 ? 13.952  94.012  150.092 1.00 28.71  ? 142  ALA C CA  1 
ATOM   3868  C C   . ALA C  1 142 ? 14.205  92.704  150.859 1.00 29.85  ? 142  ALA C C   1 
ATOM   3869  O O   . ALA C  1 142 ? 14.985  91.874  150.390 1.00 29.51  ? 142  ALA C O   1 
ATOM   3870  C CB  . ALA C  1 142 ? 14.887  95.112  150.638 1.00 26.53  ? 142  ALA C CB  1 
ATOM   3871  N N   . ARG C  1 143 ? 13.584  92.504  152.027 1.00 30.26  ? 143  ARG C N   1 
ATOM   3872  C CA  . ARG C  1 143 ? 13.894  91.275  152.765 1.00 30.74  ? 143  ARG C CA  1 
ATOM   3873  C C   . ARG C  1 143 ? 13.317  90.096  152.012 1.00 30.97  ? 143  ARG C C   1 
ATOM   3874  O O   . ARG C  1 143 ? 13.997  89.073  151.837 1.00 32.02  ? 143  ARG C O   1 
ATOM   3875  C CB  . ARG C  1 143 ? 13.374  91.292  154.223 1.00 30.06  ? 143  ARG C CB  1 
ATOM   3876  C CG  . ARG C  1 143 ? 13.748  92.529  155.005 1.00 31.57  ? 143  ARG C CG  1 
ATOM   3877  C CD  . ARG C  1 143 ? 13.445  92.491  156.497 1.00 28.89  ? 143  ARG C CD  1 
ATOM   3878  N NE  . ARG C  1 143 ? 14.595  91.893  157.152 1.00 32.12  ? 143  ARG C NE  1 
ATOM   3879  C CZ  . ARG C  1 143 ? 15.159  92.330  158.266 1.00 29.94  ? 143  ARG C CZ  1 
ATOM   3880  N NH1 . ARG C  1 143 ? 14.686  93.387  158.874 1.00 26.88  ? 143  ARG C NH1 1 
ATOM   3881  N NH2 . ARG C  1 143 ? 16.207  91.692  158.759 1.00 31.78  ? 143  ARG C NH2 1 
ATOM   3882  N N   . LYS C  1 144 ? 12.095  90.238  151.520 1.00 29.95  ? 144  LYS C N   1 
ATOM   3883  C CA  . LYS C  1 144 ? 11.468  89.125  150.807 1.00 29.70  ? 144  LYS C CA  1 
ATOM   3884  C C   . LYS C  1 144 ? 12.188  88.767  149.512 1.00 29.19  ? 144  LYS C C   1 
ATOM   3885  O O   . LYS C  1 144 ? 12.406  87.589  149.218 1.00 29.55  ? 144  LYS C O   1 
ATOM   3886  C CB  . LYS C  1 144 ? 9.982   89.420  150.516 1.00 28.69  ? 144  LYS C CB  1 
ATOM   3887  C CG  . LYS C  1 144 ? 9.158   89.541  151.747 1.00 28.49  ? 144  LYS C CG  1 
ATOM   3888  C CD  . LYS C  1 144 ? 7.701   89.516  151.489 1.00 28.08  ? 144  LYS C CD  1 
ATOM   3889  C CE  . LYS C  1 144 ? 6.983   89.725  152.812 1.00 28.66  ? 144  LYS C CE  1 
ATOM   3890  N NZ  . LYS C  1 144 ? 5.531   89.745  152.651 1.00 30.24  ? 144  LYS C NZ  1 
ATOM   3891  N N   . GLU C  1 145 ? 12.573  89.765  148.739 1.00 27.86  ? 145  GLU C N   1 
ATOM   3892  C CA  . GLU C  1 145 ? 13.239  89.441  147.497 1.00 28.12  ? 145  GLU C CA  1 
ATOM   3893  C C   . GLU C  1 145 ? 14.616  88.860  147.695 1.00 26.70  ? 145  GLU C C   1 
ATOM   3894  O O   . GLU C  1 145 ? 15.050  88.038  146.876 1.00 25.60  ? 145  GLU C O   1 
ATOM   3895  C CB  . GLU C  1 145 ? 13.320  90.645  146.592 1.00 30.96  ? 145  GLU C CB  1 
ATOM   3896  C CG  . GLU C  1 145 ? 11.995  90.989  145.985 1.00 31.99  ? 145  GLU C CG  1 
ATOM   3897  C CD  . GLU C  1 145 ? 12.055  92.309  145.236 1.00 36.42  ? 145  GLU C CD  1 
ATOM   3898  O OE1 . GLU C  1 145 ? 13.192  92.885  145.100 1.00 38.37  ? 145  GLU C OE1 1 
ATOM   3899  O OE2 . GLU C  1 145 ? 10.970  92.749  144.778 1.00 37.09  ? 145  GLU C OE2 1 
ATOM   3900  N N   . ALA C  1 146 ? 15.285  89.263  148.773 1.00 24.02  ? 146  ALA C N   1 
ATOM   3901  C CA  . ALA C  1 146 ? 16.600  88.735  149.071 1.00 23.68  ? 146  ALA C CA  1 
ATOM   3902  C C   . ALA C  1 146 ? 16.485  87.194  149.295 1.00 25.25  ? 146  ALA C C   1 
ATOM   3903  O O   . ALA C  1 146 ? 17.279  86.398  148.768 1.00 26.73  ? 146  ALA C O   1 
ATOM   3904  C CB  . ALA C  1 146 ? 17.179  89.396  150.295 1.00 21.16  ? 146  ALA C CB  1 
ATOM   3905  N N   . VAL C  1 147 ? 15.482  86.769  150.043 1.00 23.91  ? 147  VAL C N   1 
ATOM   3906  C CA  . VAL C  1 147 ? 15.308  85.362  150.294 1.00 22.16  ? 147  VAL C CA  1 
ATOM   3907  C C   . VAL C  1 147 ? 14.988  84.587  149.012 1.00 23.60  ? 147  VAL C C   1 
ATOM   3908  O O   . VAL C  1 147 ? 15.654  83.578  148.700 1.00 24.58  ? 147  VAL C O   1 
ATOM   3909  C CB  . VAL C  1 147 ? 14.201  85.138  151.312 1.00 21.06  ? 147  VAL C CB  1 
ATOM   3910  C CG1 . VAL C  1 147 ? 13.835  83.659  151.373 1.00 19.28  ? 147  VAL C CG1 1 
ATOM   3911  C CG2 . VAL C  1 147 ? 14.688  85.626  152.692 1.00 19.12  ? 147  VAL C CG2 1 
ATOM   3912  N N   . THR C  1 148 ? 14.005  85.048  148.262 1.00 21.57  ? 148  THR C N   1 
ATOM   3913  C CA  . THR C  1 148 ? 13.651  84.373  147.038 1.00 22.52  ? 148  THR C CA  1 
ATOM   3914  C C   . THR C  1 148 ? 14.814  84.359  146.032 1.00 22.67  ? 148  THR C C   1 
ATOM   3915  O O   . THR C  1 148 ? 15.049  83.371  145.314 1.00 21.76  ? 148  THR C O   1 
ATOM   3916  C CB  . THR C  1 148 ? 12.441  85.074  146.398 1.00 24.42  ? 148  THR C CB  1 
ATOM   3917  O OG1 . THR C  1 148 ? 11.324  85.010  147.306 1.00 27.45  ? 148  THR C OG1 1 
ATOM   3918  C CG2 . THR C  1 148 ? 12.068  84.412  145.085 1.00 23.58  ? 148  THR C CG2 1 
ATOM   3919  N N   . ASP C  1 149 ? 15.540  85.469  145.980 1.00 22.88  ? 149  ASP C N   1 
ATOM   3920  C CA  . ASP C  1 149 ? 16.657  85.583  145.066 1.00 21.83  ? 149  ASP C CA  1 
ATOM   3921  C C   . ASP C  1 149 ? 17.707  84.556  145.456 1.00 22.07  ? 149  ASP C C   1 
ATOM   3922  O O   . ASP C  1 149 ? 18.280  83.885  144.589 1.00 21.38  ? 149  ASP C O   1 
ATOM   3923  C CB  . ASP C  1 149 ? 17.250  86.984  145.146 1.00 20.24  ? 149  ASP C CB  1 
ATOM   3924  C CG  . ASP C  1 149 ? 18.244  87.262  144.034 1.00 19.85  ? 149  ASP C CG  1 
ATOM   3925  O OD1 . ASP C  1 149 ? 19.306  87.816  144.355 1.00 20.13  ? 149  ASP C OD1 1 
ATOM   3926  O OD2 . ASP C  1 149 ? 17.969  86.953  142.840 1.00 21.83  ? 149  ASP C OD2 1 
ATOM   3927  N N   . GLY C  1 150 ? 17.952  84.437  146.765 1.00 20.80  ? 150  GLY C N   1 
ATOM   3928  C CA  . GLY C  1 150 ? 18.934  83.493  147.243 1.00 20.05  ? 150  GLY C CA  1 
ATOM   3929  C C   . GLY C  1 150 ? 18.474  82.052  147.001 1.00 21.05  ? 150  GLY C C   1 
ATOM   3930  O O   . GLY C  1 150 ? 19.251  81.180  146.654 1.00 21.33  ? 150  GLY C O   1 
ATOM   3931  N N   . LEU C  1 151 ? 17.199  81.784  147.182 1.00 19.84  ? 151  LEU C N   1 
ATOM   3932  C CA  . LEU C  1 151 ? 16.732  80.437  146.954 1.00 19.79  ? 151  LEU C CA  1 
ATOM   3933  C C   . LEU C  1 151 ? 16.921  80.142  145.496 1.00 21.49  ? 151  LEU C C   1 
ATOM   3934  O O   . LEU C  1 151 ? 17.353  79.064  145.133 1.00 24.27  ? 151  LEU C O   1 
ATOM   3935  C CB  . LEU C  1 151 ? 15.250  80.302  147.312 1.00 17.54  ? 151  LEU C CB  1 
ATOM   3936  C CG  . LEU C  1 151 ? 14.548  79.020  146.889 1.00 13.72  ? 151  LEU C CG  1 
ATOM   3937  C CD1 . LEU C  1 151 ? 15.266  77.805  147.424 1.00 12.69  ? 151  LEU C CD1 1 
ATOM   3938  C CD2 . LEU C  1 151 ? 13.124  79.068  147.385 1.00 14.23  ? 151  LEU C CD2 1 
ATOM   3939  N N   . LYS C  1 152 ? 16.583  81.082  144.634 1.00 21.45  ? 152  LYS C N   1 
ATOM   3940  C CA  . LYS C  1 152 ? 16.770  80.802  143.229 1.00 21.58  ? 152  LYS C CA  1 
ATOM   3941  C C   . LYS C  1 152 ? 18.229  80.587  142.866 1.00 22.08  ? 152  LYS C C   1 
ATOM   3942  O O   . LYS C  1 152 ? 18.554  79.703  142.040 1.00 23.53  ? 152  LYS C O   1 
ATOM   3943  C CB  . LYS C  1 152 ? 16.200  81.919  142.356 1.00 20.49  ? 152  LYS C CB  1 
ATOM   3944  C CG  . LYS C  1 152 ? 14.686  81.977  142.341 1.00 19.54  ? 152  LYS C CG  1 
ATOM   3945  C CD  . LYS C  1 152 ? 14.172  82.902  141.227 1.00 20.49  ? 152  LYS C CD  1 
ATOM   3946  C CE  . LYS C  1 152 ? 14.520  84.373  141.480 1.00 22.13  ? 152  LYS C CE  1 
ATOM   3947  N NZ  . LYS C  1 152 ? 14.420  85.183  140.250 1.00 18.87  ? 152  LYS C NZ  1 
ATOM   3948  N N   . ARG C  1 153 ? 19.126  81.368  143.452 1.00 21.19  ? 153  ARG C N   1 
ATOM   3949  C CA  . ARG C  1 153 ? 20.530  81.174  143.073 1.00 21.98  ? 153  ARG C CA  1 
ATOM   3950  C C   . ARG C  1 153 ? 21.077  79.847  143.590 1.00 20.66  ? 153  ARG C C   1 
ATOM   3951  O O   . ARG C  1 153 ? 21.850  79.177  142.891 1.00 18.76  ? 153  ARG C O   1 
ATOM   3952  C CB  . ARG C  1 153 ? 21.426  82.321  143.556 1.00 23.13  ? 153  ARG C CB  1 
ATOM   3953  C CG  . ARG C  1 153 ? 21.140  83.670  142.931 1.00 25.52  ? 153  ARG C CG  1 
ATOM   3954  C CD  . ARG C  1 153 ? 22.072  84.730  143.521 1.00 27.00  ? 153  ARG C CD  1 
ATOM   3955  N NE  . ARG C  1 153 ? 23.126  85.006  142.559 1.00 30.10  ? 153  ARG C NE  1 
ATOM   3956  C CZ  . ARG C  1 153 ? 24.410  84.790  142.763 1.00 28.41  ? 153  ARG C CZ  1 
ATOM   3957  N NH1 . ARG C  1 153 ? 24.819  84.297  143.898 1.00 29.29  ? 153  ARG C NH1 1 
ATOM   3958  N NH2 . ARG C  1 153 ? 25.282  85.047  141.811 1.00 30.89  ? 153  ARG C NH2 1 
ATOM   3959  N N   . ALA C  1 154 ? 20.690  79.476  144.806 1.00 18.93  ? 154  ALA C N   1 
ATOM   3960  C CA  . ALA C  1 154 ? 21.154  78.208  145.374 1.00 20.00  ? 154  ALA C CA  1 
ATOM   3961  C C   . ALA C  1 154 ? 20.677  77.038  144.478 1.00 20.56  ? 154  ALA C C   1 
ATOM   3962  O O   . ALA C  1 154 ? 21.478  76.173  144.085 1.00 22.20  ? 154  ALA C O   1 
ATOM   3963  C CB  . ALA C  1 154 ? 20.639  78.023  146.762 1.00 15.26  ? 154  ALA C CB  1 
ATOM   3964  N N   . LEU C  1 155 ? 19.403  77.039  144.125 1.00 17.65  ? 155  LEU C N   1 
ATOM   3965  C CA  . LEU C  1 155 ? 18.863  75.988  143.295 1.00 17.56  ? 155  LEU C CA  1 
ATOM   3966  C C   . LEU C  1 155 ? 19.557  75.886  141.883 1.00 19.34  ? 155  LEU C C   1 
ATOM   3967  O O   . LEU C  1 155 ? 19.665  74.784  141.346 1.00 19.04  ? 155  LEU C O   1 
ATOM   3968  C CB  . LEU C  1 155 ? 17.370  76.240  143.192 1.00 13.95  ? 155  LEU C CB  1 
ATOM   3969  C CG  . LEU C  1 155 ? 16.311  75.359  143.834 1.00 13.27  ? 155  LEU C CG  1 
ATOM   3970  C CD1 . LEU C  1 155 ? 16.825  74.294  144.722 1.00 12.37  ? 155  LEU C CD1 1 
ATOM   3971  C CD2 . LEU C  1 155 ? 15.422  76.223  144.543 1.00 14.84  ? 155  LEU C CD2 1 
ATOM   3972  N N   . ARG C  1 156 ? 20.018  77.002  141.295 1.00 19.29  ? 156  ARG C N   1 
ATOM   3973  C CA  . ARG C  1 156 ? 20.675  76.968  139.985 1.00 21.48  ? 156  ARG C CA  1 
ATOM   3974  C C   . ARG C  1 156 ? 21.814  75.951  139.999 1.00 21.83  ? 156  ARG C C   1 
ATOM   3975  O O   . ARG C  1 156 ? 22.145  75.398  138.976 1.00 22.64  ? 156  ARG C O   1 
ATOM   3976  C CB  . ARG C  1 156 ? 21.371  78.308  139.617 1.00 23.06  ? 156  ARG C CB  1 
ATOM   3977  C CG  . ARG C  1 156 ? 20.531  79.535  139.480 1.00 27.98  ? 156  ARG C CG  1 
ATOM   3978  C CD  . ARG C  1 156 ? 21.249  80.583  138.630 1.00 32.59  ? 156  ARG C CD  1 
ATOM   3979  N NE  . ARG C  1 156 ? 20.885  81.999  138.838 1.00 36.19  ? 156  ARG C NE  1 
ATOM   3980  C CZ  . ARG C  1 156 ? 19.656  82.507  138.726 1.00 39.30  ? 156  ARG C CZ  1 
ATOM   3981  N NH1 . ARG C  1 156 ? 18.571  81.751  138.397 1.00 38.03  ? 156  ARG C NH1 1 
ATOM   3982  N NH2 . ARG C  1 156 ? 19.505  83.804  138.971 1.00 41.07  ? 156  ARG C NH2 1 
ATOM   3983  N N   . SER C  1 157 ? 22.454  75.759  141.147 1.00 21.64  ? 157  SER C N   1 
ATOM   3984  C CA  . SER C  1 157 ? 23.608  74.865  141.232 1.00 21.94  ? 157  SER C CA  1 
ATOM   3985  C C   . SER C  1 157 ? 23.325  73.427  140.840 1.00 22.72  ? 157  SER C C   1 
ATOM   3986  O O   . SER C  1 157 ? 24.231  72.700  140.466 1.00 22.99  ? 157  SER C O   1 
ATOM   3987  C CB  . SER C  1 157 ? 24.174  74.869  142.642 1.00 20.64  ? 157  SER C CB  1 
ATOM   3988  O OG  . SER C  1 157 ? 24.583  76.160  142.990 1.00 18.90  ? 157  SER C OG  1 
ATOM   3989  N N   . PHE C  1 158 ? 22.072  73.010  140.935 1.00 23.19  ? 158  PHE C N   1 
ATOM   3990  C CA  . PHE C  1 158 ? 21.744  71.654  140.557 1.00 24.65  ? 158  PHE C CA  1 
ATOM   3991  C C   . PHE C  1 158 ? 21.709  71.424  139.030 1.00 25.71  ? 158  PHE C C   1 
ATOM   3992  O O   . PHE C  1 158 ? 21.830  70.281  138.585 1.00 27.65  ? 158  PHE C O   1 
ATOM   3993  C CB  . PHE C  1 158 ? 20.414  71.238  141.181 1.00 23.87  ? 158  PHE C CB  1 
ATOM   3994  C CG  . PHE C  1 158 ? 20.486  71.024  142.657 1.00 23.50  ? 158  PHE C CG  1 
ATOM   3995  C CD1 . PHE C  1 158 ? 19.897  71.915  143.539 1.00 23.95  ? 158  PHE C CD1 1 
ATOM   3996  C CD2 . PHE C  1 158 ? 21.183  69.941  143.174 1.00 23.25  ? 158  PHE C CD2 1 
ATOM   3997  C CE1 . PHE C  1 158 ? 20.004  71.733  144.927 1.00 25.01  ? 158  PHE C CE1 1 
ATOM   3998  C CE2 . PHE C  1 158 ? 21.294  69.758  144.548 1.00 22.71  ? 158  PHE C CE2 1 
ATOM   3999  C CZ  . PHE C  1 158 ? 20.708  70.652  145.430 1.00 23.08  ? 158  PHE C CZ  1 
ATOM   4000  N N   . GLY C  1 159 ? 21.536  72.476  138.227 1.00 24.10  ? 159  GLY C N   1 
ATOM   4001  C CA  . GLY C  1 159 ? 21.550  72.271  136.794 1.00 23.09  ? 159  GLY C CA  1 
ATOM   4002  C C   . GLY C  1 159 ? 20.786  73.257  135.941 1.00 23.39  ? 159  GLY C C   1 
ATOM   4003  O O   . GLY C  1 159 ? 20.153  74.186  136.451 1.00 21.87  ? 159  GLY C O   1 
ATOM   4004  N N   . ASN C  1 160 ? 20.817  73.042  134.628 1.00 22.72  ? 160  ASN C N   1 
ATOM   4005  C CA  . ASN C  1 160 ? 20.132  73.930  133.733 1.00 22.63  ? 160  ASN C CA  1 
ATOM   4006  C C   . ASN C  1 160 ? 18.643  73.956  134.039 1.00 23.90  ? 160  ASN C C   1 
ATOM   4007  O O   . ASN C  1 160 ? 18.049  75.040  134.150 1.00 23.37  ? 160  ASN C O   1 
ATOM   4008  C CB  . ASN C  1 160 ? 20.347  73.490  132.302 1.00 24.02  ? 160  ASN C CB  1 
ATOM   4009  C CG  . ASN C  1 160 ? 21.802  73.621  131.864 1.00 26.59  ? 160  ASN C CG  1 
ATOM   4010  O OD1 . ASN C  1 160 ? 22.487  74.599  132.175 1.00 26.32  ? 160  ASN C OD1 1 
ATOM   4011  N ND2 . ASN C  1 160 ? 22.275  72.630  131.131 1.00 26.48  ? 160  ASN C ND2 1 
ATOM   4012  N N   . ALA C  1 161 ? 18.044  72.769  134.195 1.00 23.50  ? 161  ALA C N   1 
ATOM   4013  C CA  . ALA C  1 161 ? 16.622  72.674  134.461 1.00 22.90  ? 161  ALA C CA  1 
ATOM   4014  C C   . ALA C  1 161 ? 16.149  73.479  135.679 1.00 23.37  ? 161  ALA C C   1 
ATOM   4015  O O   . ALA C  1 161 ? 14.972  73.782  135.788 1.00 23.78  ? 161  ALA C O   1 
ATOM   4016  C CB  . ALA C  1 161 ? 16.237  71.221  134.617 1.00 25.40  ? 161  ALA C CB  1 
ATOM   4017  N N   . LEU C  1 162 ? 17.038  73.804  136.614 1.00 23.15  ? 162  LEU C N   1 
ATOM   4018  C CA  . LEU C  1 162 ? 16.626  74.605  137.765 1.00 23.10  ? 162  LEU C CA  1 
ATOM   4019  C C   . LEU C  1 162 ? 17.119  76.041  137.631 1.00 23.66  ? 162  LEU C C   1 
ATOM   4020  O O   . LEU C  1 162 ? 17.135  76.778  138.594 1.00 25.44  ? 162  LEU C O   1 
ATOM   4021  C CB  . LEU C  1 162 ? 17.148  74.013  139.066 1.00 22.76  ? 162  LEU C CB  1 
ATOM   4022  C CG  . LEU C  1 162 ? 16.211  73.040  139.770 1.00 24.11  ? 162  LEU C CG  1 
ATOM   4023  C CD1 . LEU C  1 162 ? 15.088  73.810  140.305 1.00 25.35  ? 162  LEU C CD1 1 
ATOM   4024  C CD2 . LEU C  1 162 ? 15.629  71.993  138.795 1.00 25.91  ? 162  LEU C CD2 1 
ATOM   4025  N N   . GLY C  1 163 ? 17.553  76.437  136.445 1.00 22.91  ? 163  GLY C N   1 
ATOM   4026  C CA  . GLY C  1 163 ? 17.971  77.811  136.298 1.00 24.18  ? 163  GLY C CA  1 
ATOM   4027  C C   . GLY C  1 163 ? 19.372  78.137  135.852 1.00 24.59  ? 163  GLY C C   1 
ATOM   4028  O O   . GLY C  1 163 ? 19.616  79.249  135.461 1.00 26.68  ? 163  GLY C O   1 
ATOM   4029  N N   . ASN C  1 164 ? 20.286  77.186  135.876 1.00 25.64  ? 164  ASN C N   1 
ATOM   4030  C CA  . ASN C  1 164 ? 21.652  77.468  135.494 1.00 25.11  ? 164  ASN C CA  1 
ATOM   4031  C C   . ASN C  1 164 ? 21.826  77.950  134.067 1.00 26.43  ? 164  ASN C C   1 
ATOM   4032  O O   . ASN C  1 164 ? 22.840  78.531  133.730 1.00 29.01  ? 164  ASN C O   1 
ATOM   4033  C CB  . ASN C  1 164 ? 22.522  76.248  135.700 1.00 26.41  ? 164  ASN C CB  1 
ATOM   4034  C CG  . ASN C  1 164 ? 23.980  76.588  135.690 1.00 25.95  ? 164  ASN C CG  1 
ATOM   4035  O OD1 . ASN C  1 164 ? 24.789  75.932  135.060 1.00 26.15  ? 164  ASN C OD1 1 
ATOM   4036  N ND2 . ASN C  1 164 ? 24.321  77.629  136.408 1.00 28.22  ? 164  ASN C ND2 1 
ATOM   4037  N N   . CYS C  1 165 ? 20.866  77.718  133.206 1.00 26.37  ? 165  CYS C N   1 
ATOM   4038  C CA  . CYS C  1 165 ? 21.039  78.190  131.854 1.00 30.06  ? 165  CYS C CA  1 
ATOM   4039  C C   . CYS C  1 165 ? 20.823  79.715  131.770 1.00 32.38  ? 165  CYS C C   1 
ATOM   4040  O O   . CYS C  1 165 ? 21.487  80.432  131.012 1.00 35.31  ? 165  CYS C O   1 
ATOM   4041  C CB  . CYS C  1 165 ? 20.056  77.465  130.916 1.00 30.15  ? 165  CYS C CB  1 
ATOM   4042  S SG  . CYS C  1 165 ? 18.255  77.479  131.405 1.00 30.27  ? 165  CYS C SG  1 
ATOM   4043  N N   . ILE C  1 166 ? 19.920  80.202  132.597 1.00 33.19  ? 166  ILE C N   1 
ATOM   4044  C CA  . ILE C  1 166 ? 19.525  81.599  132.616 1.00 35.47  ? 166  ILE C CA  1 
ATOM   4045  C C   . ILE C  1 166 ? 20.546  82.697  132.362 1.00 37.75  ? 166  ILE C C   1 
ATOM   4046  O O   . ILE C  1 166 ? 20.198  83.757  131.839 1.00 36.46  ? 166  ILE C O   1 
ATOM   4047  C CB  . ILE C  1 166 ? 18.790  81.889  133.933 1.00 36.18  ? 166  ILE C CB  1 
ATOM   4048  C CG1 . ILE C  1 166 ? 17.455  82.548  133.635 1.00 37.90  ? 166  ILE C CG1 1 
ATOM   4049  C CG2 . ILE C  1 166 ? 19.615  82.732  134.872 1.00 34.25  ? 166  ILE C CG2 1 
ATOM   4050  C CD1 . ILE C  1 166 ? 17.565  83.975  133.333 1.00 41.85  ? 166  ILE C CD1 1 
ATOM   4051  N N   . LEU C  1 167 ? 21.807  82.453  132.702 1.00 40.01  ? 167  LEU C N   1 
ATOM   4052  C CA  . LEU C  1 167 ? 22.781  83.512  132.534 1.00 42.75  ? 167  LEU C CA  1 
ATOM   4053  C C   . LEU C  1 167 ? 23.818  83.214  131.442 1.00 42.49  ? 167  LEU C C   1 
ATOM   4054  O O   . LEU C  1 167 ? 24.824  83.896  131.291 1.00 42.28  ? 167  LEU C O   1 
ATOM   4055  C CB  . LEU C  1 167 ? 23.388  83.852  133.926 1.00 44.80  ? 167  LEU C CB  1 
ATOM   4056  C CG  . LEU C  1 167 ? 23.942  82.752  134.843 1.00 46.90  ? 167  LEU C CG  1 
ATOM   4057  C CD1 . LEU C  1 167 ? 23.005  81.515  134.859 1.00 46.53  ? 167  LEU C CD1 1 
ATOM   4058  C CD2 . LEU C  1 167 ? 25.349  82.356  134.333 1.00 49.72  ? 167  LEU C CD2 1 
ATOM   4059  N N   . ASP C  1 168 ? 23.504  82.201  130.654 1.00 42.97  ? 168  ASP C N   1 
ATOM   4060  C CA  . ASP C  1 168 ? 24.315  81.755  129.545 1.00 44.16  ? 168  ASP C CA  1 
ATOM   4061  C C   . ASP C  1 168 ? 23.920  82.577  128.316 1.00 45.18  ? 168  ASP C C   1 
ATOM   4062  O O   . ASP C  1 168 ? 22.891  82.317  127.692 1.00 44.18  ? 168  ASP C O   1 
ATOM   4063  C CB  . ASP C  1 168 ? 24.048  80.263  129.302 1.00 44.96  ? 168  ASP C CB  1 
ATOM   4064  C CG  . ASP C  1 168 ? 24.767  79.713  128.072 1.00 48.11  ? 168  ASP C CG  1 
ATOM   4065  O OD1 . ASP C  1 168 ? 24.614  78.505  127.807 1.00 48.19  ? 168  ASP C OD1 1 
ATOM   4066  O OD2 . ASP C  1 168 ? 25.487  80.462  127.367 1.00 50.75  ? 168  ASP C OD2 1 
ATOM   4067  N N   . LYS C  1 169 ? 24.746  83.558  127.959 1.00 46.71  ? 169  LYS C N   1 
ATOM   4068  C CA  . LYS C  1 169 ? 24.460  84.416  126.816 1.00 47.82  ? 169  LYS C CA  1 
ATOM   4069  C C   . LYS C  1 169 ? 24.061  83.708  125.510 1.00 46.59  ? 169  LYS C C   1 
ATOM   4070  O O   . LYS C  1 169 ? 23.230  84.206  124.777 1.00 45.87  ? 169  LYS C O   1 
ATOM   4071  C CB  . LYS C  1 169 ? 25.646  85.353  126.589 1.00 50.14  ? 169  LYS C CB  1 
ATOM   4072  C CG  . LYS C  1 169 ? 25.853  86.324  127.773 1.00 54.31  ? 169  LYS C CG  1 
ATOM   4073  C CD  . LYS C  1 169 ? 27.237  86.996  127.709 1.00 57.58  ? 169  LYS C CD  1 
ATOM   4074  C CE  . LYS C  1 169 ? 27.575  87.727  129.002 1.00 58.73  ? 169  LYS C CE  1 
ATOM   4075  N NZ  . LYS C  1 169 ? 28.952  88.321  128.972 1.00 60.57  ? 169  LYS C NZ  1 
ATOM   4076  N N   . ASP C  1 170 ? 24.619  82.541  125.227 1.00 46.46  ? 170  ASP C N   1 
ATOM   4077  C CA  . ASP C  1 170 ? 24.290  81.840  123.986 1.00 45.76  ? 170  ASP C CA  1 
ATOM   4078  C C   . ASP C  1 170 ? 22.897  81.273  124.028 1.00 44.80  ? 170  ASP C C   1 
ATOM   4079  O O   . ASP C  1 170 ? 22.243  81.110  123.001 1.00 43.19  ? 170  ASP C O   1 
ATOM   4080  C CB  . ASP C  1 170 ? 25.283  80.710  123.729 1.00 48.53  ? 170  ASP C CB  1 
ATOM   4081  C CG  . ASP C  1 170 ? 26.708  81.218  123.541 1.00 51.90  ? 170  ASP C CG  1 
ATOM   4082  O OD1 . ASP C  1 170 ? 26.922  82.125  122.673 1.00 53.04  ? 170  ASP C OD1 1 
ATOM   4083  O OD2 . ASP C  1 170 ? 27.595  80.704  124.276 1.00 53.71  ? 170  ASP C OD2 1 
ATOM   4084  N N   . TYR C  1 171 ? 22.456  80.941  125.238 1.00 43.97  ? 171  TYR C N   1 
ATOM   4085  C CA  . TYR C  1 171 ? 21.125  80.394  125.466 1.00 40.28  ? 171  TYR C CA  1 
ATOM   4086  C C   . TYR C  1 171 ? 20.151  81.548  125.346 1.00 41.44  ? 171  TYR C C   1 
ATOM   4087  O O   . TYR C  1 171 ? 19.099  81.423  124.700 1.00 41.71  ? 171  TYR C O   1 
ATOM   4088  C CB  . TYR C  1 171 ? 21.047  79.797  126.860 1.00 38.09  ? 171  TYR C CB  1 
ATOM   4089  C CG  . TYR C  1 171 ? 19.652  79.642  127.432 1.00 34.09  ? 171  TYR C CG  1 
ATOM   4090  C CD1 . TYR C  1 171 ? 18.840  78.580  127.068 1.00 31.13  ? 171  TYR C CD1 1 
ATOM   4091  C CD2 . TYR C  1 171 ? 19.138  80.584  128.323 1.00 33.35  ? 171  TYR C CD2 1 
ATOM   4092  C CE1 . TYR C  1 171 ? 17.569  78.455  127.573 1.00 30.08  ? 171  TYR C CE1 1 
ATOM   4093  C CE2 . TYR C  1 171 ? 17.858  80.474  128.815 1.00 31.54  ? 171  TYR C CE2 1 
ATOM   4094  C CZ  . TYR C  1 171 ? 17.075  79.404  128.440 1.00 30.99  ? 171  TYR C CZ  1 
ATOM   4095  O OH  . TYR C  1 171 ? 15.779  79.284  128.918 1.00 30.92  ? 171  TYR C OH  1 
ATOM   4096  N N   . LEU C  1 172 ? 20.491  82.677  125.970 1.00 41.52  ? 172  LEU C N   1 
ATOM   4097  C CA  . LEU C  1 172 ? 19.627  83.856  125.904 1.00 42.22  ? 172  LEU C CA  1 
ATOM   4098  C C   . LEU C  1 172 ? 19.449  84.274  124.444 1.00 43.49  ? 172  LEU C C   1 
ATOM   4099  O O   . LEU C  1 172 ? 18.354  84.602  123.997 1.00 42.41  ? 172  LEU C O   1 
ATOM   4100  C CB  . LEU C  1 172 ? 20.246  85.018  126.684 1.00 39.86  ? 172  LEU C CB  1 
ATOM   4101  C CG  . LEU C  1 172 ? 20.243  84.830  128.192 1.00 39.96  ? 172  LEU C CG  1 
ATOM   4102  C CD1 . LEU C  1 172 ? 20.963  85.980  128.893 1.00 35.96  ? 172  LEU C CD1 1 
ATOM   4103  C CD2 . LEU C  1 172 ? 18.803  84.678  128.638 1.00 38.25  ? 172  LEU C CD2 1 
ATOM   4104  N N   . ARG C  1 173 ? 20.556  84.255  123.714 1.00 46.06  ? 173  ARG C N   1 
ATOM   4105  C CA  . ARG C  1 173 ? 20.584  84.642  122.316 1.00 48.18  ? 173  ARG C CA  1 
ATOM   4106  C C   . ARG C  1 173 ? 19.646  83.767  121.509 1.00 48.09  ? 173  ARG C C   1 
ATOM   4107  O O   . ARG C  1 173 ? 18.790  84.247  120.767 1.00 49.54  ? 173  ARG C O   1 
ATOM   4108  C CB  . ARG C  1 173 ? 22.012  84.518  121.789 1.00 50.37  ? 173  ARG C CB  1 
ATOM   4109  C CG  . ARG C  1 173 ? 22.355  85.312  120.513 1.00 54.00  ? 173  ARG C CG  1 
ATOM   4110  C CD  . ARG C  1 173 ? 23.879  85.639  120.481 1.00 56.95  ? 173  ARG C CD  1 
ATOM   4111  N NE  . ARG C  1 173 ? 24.706  84.472  120.811 1.00 60.76  ? 173  ARG C NE  1 
ATOM   4112  C CZ  . ARG C  1 173 ? 24.685  83.338  120.114 1.00 63.19  ? 173  ARG C CZ  1 
ATOM   4113  N NH1 . ARG C  1 173 ? 23.883  83.235  119.044 1.00 65.28  ? 173  ARG C NH1 1 
ATOM   4114  N NH2 . ARG C  1 173 ? 25.433  82.306  120.497 1.00 62.83  ? 173  ARG C NH2 1 
ATOM   4115  N N   . SER C  1 174 ? 19.784  82.473  121.662 1.00 47.44  ? 174  SER C N   1 
ATOM   4116  C CA  . SER C  1 174 ? 18.927  81.596  120.909 1.00 48.47  ? 174  SER C CA  1 
ATOM   4117  C C   . SER C  1 174 ? 17.467  81.596  121.412 1.00 47.77  ? 174  SER C C   1 
ATOM   4118  O O   . SER C  1 174 ? 16.563  81.065  120.759 1.00 48.40  ? 174  SER C O   1 
ATOM   4119  C CB  . SER C  1 174 ? 19.544  80.184  120.884 1.00 49.09  ? 174  SER C CB  1 
ATOM   4120  O OG  . SER C  1 174 ? 18.704  79.259  121.529 1.00 51.52  ? 174  SER C OG  1 
ATOM   4121  N N   . LEU C  1 175 ? 17.233  82.203  122.565 1.00 47.43  ? 175  LEU C N   1 
ATOM   4122  C CA  . LEU C  1 175 ? 15.882  82.291  123.104 1.00 47.45  ? 175  LEU C CA  1 
ATOM   4123  C C   . LEU C  1 175 ? 15.164  83.421  122.407 1.00 49.26  ? 175  LEU C C   1 
ATOM   4124  O O   . LEU C  1 175 ? 13.972  83.343  122.178 1.00 49.49  ? 175  LEU C O   1 
ATOM   4125  C CB  . LEU C  1 175 ? 15.881  82.615  124.583 1.00 45.15  ? 175  LEU C CB  1 
ATOM   4126  C CG  . LEU C  1 175 ? 15.381  81.609  125.614 1.00 43.08  ? 175  LEU C CG  1 
ATOM   4127  C CD1 . LEU C  1 175 ? 15.307  82.365  126.920 1.00 42.05  ? 175  LEU C CD1 1 
ATOM   4128  C CD2 . LEU C  1 175 ? 14.037  81.016  125.263 1.00 40.81  ? 175  LEU C CD2 1 
ATOM   4129  N N   . ASN C  1 176 ? 15.899  84.486  122.105 1.00 52.16  ? 176  ASN C N   1 
ATOM   4130  C CA  . ASN C  1 176 ? 15.381  85.662  121.399 1.00 54.69  ? 176  ASN C CA  1 
ATOM   4131  C C   . ASN C  1 176 ? 14.953  85.371  119.968 1.00 56.45  ? 176  ASN C C   1 
ATOM   4132  O O   . ASN C  1 176 ? 14.057  86.008  119.456 1.00 56.06  ? 176  ASN C O   1 
ATOM   4133  C CB  . ASN C  1 176 ? 16.450  86.729  121.356 1.00 57.03  ? 176  ASN C CB  1 
ATOM   4134  C CG  . ASN C  1 176 ? 16.231  87.790  122.381 1.00 58.92  ? 176  ASN C CG  1 
ATOM   4135  O OD1 . ASN C  1 176 ? 15.351  88.625  122.224 1.00 61.43  ? 176  ASN C OD1 1 
ATOM   4136  N ND2 . ASN C  1 176 ? 17.018  87.766  123.453 1.00 60.16  ? 176  ASN C ND2 1 
ATOM   4137  N N   . LYS C  1 177 ? 15.625  84.426  119.321 1.00 58.78  ? 177  LYS C N   1 
ATOM   4138  C CA  . LYS C  1 177 ? 15.309  84.043  117.965 1.00 61.68  ? 177  LYS C CA  1 
ATOM   4139  C C   . LYS C  1 177 ? 14.027  83.195  117.931 1.00 63.85  ? 177  LYS C C   1 
ATOM   4140  O O   . LYS C  1 177 ? 13.895  82.263  117.109 1.00 66.39  ? 177  LYS C O   1 
ATOM   4141  C CB  . LYS C  1 177 ? 16.489  83.265  117.372 1.00 63.70  ? 177  LYS C CB  1 
ATOM   4142  C CG  . LYS C  1 177 ? 17.747  84.104  117.198 1.00 66.60  ? 177  LYS C CG  1 
ATOM   4143  C CD  . LYS C  1 177 ? 18.944  83.277  116.694 1.00 69.68  ? 177  LYS C CD  1 
ATOM   4144  C CE  . LYS C  1 177 ? 20.211  84.141  116.618 1.00 71.44  ? 177  LYS C CE  1 
ATOM   4145  N NZ  . LYS C  1 177 ? 21.457  83.364  116.304 1.00 71.12  ? 177  LYS C NZ  1 
ATOM   4146  N N   . LEU C  1 178 ? 13.072  83.525  118.807 1.00 63.98  ? 178  LEU C N   1 
ATOM   4147  C CA  . LEU C  1 178 ? 11.789  82.804  118.866 1.00 64.18  ? 178  LEU C CA  1 
ATOM   4148  C C   . LEU C  1 178 ? 10.672  83.828  118.933 1.00 65.17  ? 178  LEU C C   1 
ATOM   4149  O O   . LEU C  1 178 ? 10.845  84.887  119.532 1.00 64.70  ? 178  LEU C O   1 
ATOM   4150  C CB  . LEU C  1 178 ? 11.683  81.890  120.103 1.00 62.50  ? 178  LEU C CB  1 
ATOM   4151  C CG  . LEU C  1 178 ? 12.627  80.719  120.403 1.00 61.64  ? 178  LEU C CG  1 
ATOM   4152  C CD1 . LEU C  1 178 ? 12.139  80.054  121.657 1.00 60.08  ? 178  LEU C CD1 1 
ATOM   4153  C CD2 . LEU C  1 178 ? 12.683  79.722  119.280 1.00 61.20  ? 178  LEU C CD2 1 
ATOM   4154  N N   . PRO C  1 179 ? 9.513   83.524  118.317 1.00 66.44  ? 179  PRO C N   1 
ATOM   4155  C CA  . PRO C  1 179 ? 8.320   84.376  118.263 1.00 67.55  ? 179  PRO C CA  1 
ATOM   4156  C C   . PRO C  1 179 ? 7.845   84.748  119.642 1.00 69.49  ? 179  PRO C C   1 
ATOM   4157  O O   . PRO C  1 179 ? 7.921   83.930  120.547 1.00 69.88  ? 179  PRO C O   1 
ATOM   4158  C CB  . PRO C  1 179 ? 7.301   83.493  117.572 1.00 66.87  ? 179  PRO C CB  1 
ATOM   4159  C CG  . PRO C  1 179 ? 8.133   82.633  116.707 1.00 66.40  ? 179  PRO C CG  1 
ATOM   4160  C CD  . PRO C  1 179 ? 9.283   82.270  117.581 1.00 66.42  ? 179  PRO C CD  1 
ATOM   4161  N N   . ARG C  1 180 ? 7.368   85.972  119.820 1.00 72.18  ? 180  ARG C N   1 
ATOM   4162  C CA  . ARG C  1 180 ? 6.858   86.330  121.126 1.00 75.48  ? 180  ARG C CA  1 
ATOM   4163  C C   . ARG C  1 180 ? 5.769   85.294  121.327 1.00 76.28  ? 180  ARG C C   1 
ATOM   4164  O O   . ARG C  1 180 ? 5.247   84.715  120.371 1.00 76.05  ? 180  ARG C O   1 
ATOM   4165  C CB  . ARG C  1 180 ? 6.211   87.721  121.135 1.00 78.87  ? 180  ARG C CB  1 
ATOM   4166  C CG  . ARG C  1 180 ? 4.682   87.695  121.492 1.00 83.18  ? 180  ARG C CG  1 
ATOM   4167  C CD  . ARG C  1 180 ? 3.839   88.827  120.839 1.00 86.21  ? 180  ARG C CD  1 
ATOM   4168  N NE  . ARG C  1 180 ? 4.169   89.026  119.420 1.00 89.17  ? 180  ARG C NE  1 
ATOM   4169  C CZ  . ARG C  1 180 ? 3.341   89.522  118.497 1.00 90.96  ? 180  ARG C CZ  1 
ATOM   4170  N NH1 . ARG C  1 180 ? 2.096   89.877  118.824 1.00 92.38  ? 180  ARG C NH1 1 
ATOM   4171  N NH2 . ARG C  1 180 ? 3.768   89.682  117.242 1.00 91.52  ? 180  ARG C NH2 1 
ATOM   4172  N N   . GLN C  1 181 ? 5.428   85.063  122.578 1.00 77.93  ? 181  GLN C N   1 
ATOM   4173  C CA  . GLN C  1 181 ? 4.388   84.113  122.894 1.00 79.50  ? 181  GLN C CA  1 
ATOM   4174  C C   . GLN C  1 181 ? 3.261   84.871  123.586 1.00 79.33  ? 181  GLN C C   1 
ATOM   4175  O O   . GLN C  1 181 ? 3.491   85.660  124.509 1.00 80.17  ? 181  GLN C O   1 
ATOM   4176  C CB  . GLN C  1 181 ? 4.928   83.027  123.822 1.00 81.58  ? 181  GLN C CB  1 
ATOM   4177  C CG  . GLN C  1 181 ? 5.565   83.563  125.122 1.00 83.91  ? 181  GLN C CG  1 
ATOM   4178  C CD  . GLN C  1 181 ? 5.772   82.480  126.180 1.00 84.97  ? 181  GLN C CD  1 
ATOM   4179  O OE1 . GLN C  1 181 ? 4.822   81.995  126.820 1.00 85.15  ? 181  GLN C OE1 1 
ATOM   4180  N NE2 . GLN C  1 181 ? 7.020   82.096  126.363 1.00 85.72  ? 181  GLN C NE2 1 
ATOM   4181  N N   . LEU C  1 182 ? 2.044   84.640  123.117 1.00 78.00  ? 182  LEU C N   1 
ATOM   4182  C CA  . LEU C  1 182 ? 0.873   85.261  123.687 1.00 76.58  ? 182  LEU C CA  1 
ATOM   4183  C C   . LEU C  1 182 ? 0.725   84.705  125.114 1.00 75.49  ? 182  LEU C C   1 
ATOM   4184  O O   . LEU C  1 182 ? 1.167   83.585  125.412 1.00 74.85  ? 182  LEU C O   1 
ATOM   4185  C CB  . LEU C  1 182 ? -0.333  84.979  122.780 1.00 76.85  ? 182  LEU C CB  1 
ATOM   4186  C CG  . LEU C  1 182 ? -0.321  83.800  121.781 1.00 77.74  ? 182  LEU C CG  1 
ATOM   4187  C CD1 . LEU C  1 182 ? -1.304  84.123  120.675 1.00 78.07  ? 182  LEU C CD1 1 
ATOM   4188  C CD2 . LEU C  1 182 ? 1.038   83.551  121.140 1.00 77.55  ? 182  LEU C CD2 1 
ATOM   4189  N N   . PRO C  1 183 ? 0.128   85.494  126.021 1.00 74.72  ? 183  PRO C N   1 
ATOM   4190  C CA  . PRO C  1 183 ? -0.069  85.108  127.427 1.00 73.66  ? 183  PRO C CA  1 
ATOM   4191  C C   . PRO C  1 183 ? -0.803  83.805  127.615 1.00 71.92  ? 183  PRO C C   1 
ATOM   4192  O O   . PRO C  1 183 ? -1.774  83.529  126.919 1.00 71.33  ? 183  PRO C O   1 
ATOM   4193  C CB  . PRO C  1 183 ? -0.846  86.288  128.007 1.00 74.55  ? 183  PRO C CB  1 
ATOM   4194  C CG  . PRO C  1 183 ? -0.458  87.435  127.106 1.00 74.90  ? 183  PRO C CG  1 
ATOM   4195  C CD  . PRO C  1 183 ? -0.516  86.787  125.750 1.00 74.63  ? 183  PRO C CD  1 
ATOM   4196  N N   . LEU C  1 184 ? -0.350  83.006  128.567 1.00 70.91  ? 184  LEU C N   1 
ATOM   4197  C CA  . LEU C  1 184 ? -1.014  81.733  128.793 1.00 70.88  ? 184  LEU C CA  1 
ATOM   4198  C C   . LEU C  1 184 ? -2.301  81.889  129.587 1.00 69.22  ? 184  LEU C C   1 
ATOM   4199  O O   . LEU C  1 184 ? -2.386  82.692  130.495 1.00 69.10  ? 184  LEU C O   1 
ATOM   4200  C CB  . LEU C  1 184 ? -0.093  80.750  129.537 1.00 71.96  ? 184  LEU C CB  1 
ATOM   4201  C CG  . LEU C  1 184 ? -0.308  79.261  129.176 1.00 73.13  ? 184  LEU C CG  1 
ATOM   4202  C CD1 . LEU C  1 184 ? -1.775  78.879  129.256 1.00 73.80  ? 184  LEU C CD1 1 
ATOM   4203  C CD2 . LEU C  1 184 ? 0.175   78.974  127.746 1.00 74.26  ? 184  LEU C CD2 1 
ATOM   4204  N N   . GLU C  1 185 ? -3.326  81.141  129.224 1.00 67.89  ? 185  GLU C N   1 
ATOM   4205  C CA  . GLU C  1 185 ? -4.550  81.197  130.007 1.00 66.50  ? 185  GLU C CA  1 
ATOM   4206  C C   . GLU C  1 185 ? -4.402  80.007  130.950 1.00 63.19  ? 185  GLU C C   1 
ATOM   4207  O O   . GLU C  1 185 ? -3.951  78.931  130.524 1.00 62.17  ? 185  GLU C O   1 
ATOM   4208  C CB  . GLU C  1 185 ? -5.804  80.971  129.141 1.00 70.14  ? 185  GLU C CB  1 
ATOM   4209  C CG  . GLU C  1 185 ? -6.037  81.972  128.016 1.00 75.98  ? 185  GLU C CG  1 
ATOM   4210  C CD  . GLU C  1 185 ? -6.095  83.424  128.519 1.00 79.86  ? 185  GLU C CD  1 
ATOM   4211  O OE1 . GLU C  1 185 ? -6.889  83.713  129.459 1.00 81.64  ? 185  GLU C OE1 1 
ATOM   4212  O OE2 . GLU C  1 185 ? -5.347  84.275  127.965 1.00 81.18  ? 185  GLU C OE2 1 
ATOM   4213  N N   . VAL C  1 186 ? -4.761  80.189  132.219 1.00 59.04  ? 186  VAL C N   1 
ATOM   4214  C CA  . VAL C  1 186 ? -4.703  79.080  133.165 1.00 54.51  ? 186  VAL C CA  1 
ATOM   4215  C C   . VAL C  1 186 ? -6.120  78.466  133.243 1.00 52.07  ? 186  VAL C C   1 
ATOM   4216  O O   . VAL C  1 186 ? -7.152  79.157  133.188 1.00 50.45  ? 186  VAL C O   1 
ATOM   4217  C CB  . VAL C  1 186 ? -4.246  79.530  134.580 1.00 54.31  ? 186  VAL C CB  1 
ATOM   4218  C CG1 . VAL C  1 186 ? -3.916  78.309  135.419 1.00 53.05  ? 186  VAL C CG1 1 
ATOM   4219  C CG2 . VAL C  1 186 ? -3.045  80.464  134.485 1.00 52.79  ? 186  VAL C CG2 1 
ATOM   4220  N N   . ASP C  1 187 ? -6.158  77.154  133.369 1.00 49.35  ? 187  ASP C N   1 
ATOM   4221  C CA  . ASP C  1 187 ? -7.413  76.456  133.429 1.00 47.02  ? 187  ASP C CA  1 
ATOM   4222  C C   . ASP C  1 187 ? -7.867  76.144  134.849 1.00 45.57  ? 187  ASP C C   1 
ATOM   4223  O O   . ASP C  1 187 ? -7.425  75.171  135.456 1.00 46.18  ? 187  ASP C O   1 
ATOM   4224  C CB  . ASP C  1 187 ? -7.300  75.170  132.632 1.00 47.31  ? 187  ASP C CB  1 
ATOM   4225  C CG  . ASP C  1 187 ? -8.622  74.564  132.371 1.00 47.82  ? 187  ASP C CG  1 
ATOM   4226  O OD1 . ASP C  1 187 ? -8.681  73.354  132.088 1.00 48.09  ? 187  ASP C OD1 1 
ATOM   4227  O OD2 . ASP C  1 187 ? -9.614  75.320  132.445 1.00 48.77  ? 187  ASP C OD2 1 
ATOM   4228  N N   . LEU C  1 188 ? -8.778  76.953  135.372 1.00 42.95  ? 188  LEU C N   1 
ATOM   4229  C CA  . LEU C  1 188 ? -9.269  76.738  136.720 1.00 40.66  ? 188  LEU C CA  1 
ATOM   4230  C C   . LEU C  1 188 ? -10.327 75.654  136.816 1.00 40.77  ? 188  LEU C C   1 
ATOM   4231  O O   . LEU C  1 188 ? -10.802 75.329  137.894 1.00 39.97  ? 188  LEU C O   1 
ATOM   4232  C CB  . LEU C  1 188 ? -9.796  78.046  137.269 1.00 38.35  ? 188  LEU C CB  1 
ATOM   4233  C CG  . LEU C  1 188 ? -8.579  78.945  137.427 1.00 37.32  ? 188  LEU C CG  1 
ATOM   4234  C CD1 . LEU C  1 188 ? -8.958  80.187  138.139 1.00 37.31  ? 188  LEU C CD1 1 
ATOM   4235  C CD2 . LEU C  1 188 ? -7.494  78.210  138.212 1.00 36.08  ? 188  LEU C CD2 1 
ATOM   4236  N N   . THR C  1 189 ? -10.671 75.069  135.680 1.00 41.04  ? 189  THR C N   1 
ATOM   4237  C CA  . THR C  1 189 ? -11.666 74.026  135.645 1.00 41.57  ? 189  THR C CA  1 
ATOM   4238  C C   . THR C  1 189 ? -11.582 73.106  136.844 1.00 42.40  ? 189  THR C C   1 
ATOM   4239  O O   . THR C  1 189 ? -12.514 73.031  137.627 1.00 43.45  ? 189  THR C O   1 
ATOM   4240  C CB  . THR C  1 189 ? -11.533 73.232  134.361 1.00 42.29  ? 189  THR C CB  1 
ATOM   4241  O OG1 . THR C  1 189 ? -12.136 73.983  133.300 1.00 43.18  ? 189  THR C OG1 1 
ATOM   4242  C CG2 . THR C  1 189 ? -12.209 71.853  134.483 1.00 42.73  ? 189  THR C CG2 1 
ATOM   4243  N N   . LYS C  1 190 ? -10.458 72.423  137.013 1.00 43.46  ? 190  LYS C N   1 
ATOM   4244  C CA  . LYS C  1 190 ? -10.296 71.504  138.125 1.00 43.01  ? 190  LYS C CA  1 
ATOM   4245  C C   . LYS C  1 190 ? -9.649  72.086  139.384 1.00 42.25  ? 190  LYS C C   1 
ATOM   4246  O O   . LYS C  1 190 ? -9.016  71.331  140.140 1.00 42.61  ? 190  LYS C O   1 
ATOM   4247  C CB  . LYS C  1 190 ? -9.458  70.324  137.695 1.00 44.98  ? 190  LYS C CB  1 
ATOM   4248  C CG  . LYS C  1 190 ? -10.115 69.375  136.765 1.00 47.95  ? 190  LYS C CG  1 
ATOM   4249  C CD  . LYS C  1 190 ? -9.231  68.139  136.669 1.00 50.37  ? 190  LYS C CD  1 
ATOM   4250  C CE  . LYS C  1 190 ? -10.016 66.910  136.245 1.00 53.00  ? 190  LYS C CE  1 
ATOM   4251  N NZ  . LYS C  1 190 ? -9.147  65.663  136.292 1.00 56.31  ? 190  LYS C NZ  1 
ATOM   4252  N N   . ALA C  1 191 ? -9.807  73.389  139.632 1.00 40.58  ? 191  ALA C N   1 
ATOM   4253  C CA  . ALA C  1 191 ? -9.202  74.023  140.808 1.00 39.03  ? 191  ALA C CA  1 
ATOM   4254  C C   . ALA C  1 191 ? -9.723  73.464  142.118 1.00 38.87  ? 191  ALA C C   1 
ATOM   4255  O O   . ALA C  1 191 ? -10.867 73.104  142.209 1.00 38.26  ? 191  ALA C O   1 
ATOM   4256  C CB  . ALA C  1 191 ? -9.421  75.507  140.770 1.00 38.03  ? 191  ALA C CB  1 
ATOM   4257  N N   . LYS C  1 192 ? -8.863  73.399  143.129 1.00 40.28  ? 192  LYS C N   1 
ATOM   4258  C CA  . LYS C  1 192 ? -9.238  72.883  144.438 1.00 41.17  ? 192  LYS C CA  1 
ATOM   4259  C C   . LYS C  1 192 ? -10.257 73.858  145.024 1.00 43.60  ? 192  LYS C C   1 
ATOM   4260  O O   . LYS C  1 192 ? -10.020 75.080  145.060 1.00 43.06  ? 192  LYS C O   1 
ATOM   4261  C CB  . LYS C  1 192 ? -8.003  72.781  145.344 1.00 40.52  ? 192  LYS C CB  1 
ATOM   4262  C CG  . LYS C  1 192 ? -8.296  72.370  146.796 1.00 40.05  ? 192  LYS C CG  1 
ATOM   4263  C CD  . LYS C  1 192 ? -7.077  72.474  147.703 1.00 38.43  ? 192  LYS C CD  1 
ATOM   4264  C CE  . LYS C  1 192 ? -6.668  71.136  148.263 1.00 38.78  ? 192  LYS C CE  1 
ATOM   4265  N NZ  . LYS C  1 192 ? -7.649  70.527  149.200 1.00 36.21  ? 192  LYS C NZ  1 
ATOM   4266  N N   . ARG C  1 193 ? -11.392 73.313  145.467 1.00 45.51  ? 193  ARG C N   1 
ATOM   4267  C CA  . ARG C  1 193 ? -12.471 74.125  146.014 1.00 47.27  ? 193  ARG C CA  1 
ATOM   4268  C C   . ARG C  1 193 ? -12.835 73.840  147.483 1.00 48.61  ? 193  ARG C C   1 
ATOM   4269  O O   . ARG C  1 193 ? -13.584 74.600  148.096 1.00 48.39  ? 193  ARG C O   1 
ATOM   4270  C CB  . ARG C  1 193 ? -13.672 73.992  145.078 1.00 47.03  ? 193  ARG C CB  1 
ATOM   4271  C CG  . ARG C  1 193 ? -13.414 74.748  143.779 1.00 47.59  ? 193  ARG C CG  1 
ATOM   4272  C CD  . ARG C  1 193 ? -14.526 74.630  142.761 1.00 47.93  ? 193  ARG C CD  1 
ATOM   4273  N NE  . ARG C  1 193 ? -14.333 75.503  141.592 1.00 48.80  ? 193  ARG C NE  1 
ATOM   4274  C CZ  . ARG C  1 193 ? -14.627 76.809  141.541 1.00 49.18  ? 193  ARG C CZ  1 
ATOM   4275  N NH1 . ARG C  1 193 ? -15.140 77.460  142.588 1.00 48.71  ? 193  ARG C NH1 1 
ATOM   4276  N NH2 . ARG C  1 193 ? -14.410 77.475  140.417 1.00 48.95  ? 193  ARG C NH2 1 
ATOM   4277  N N   . GLN C  1 194 ? -12.271 72.759  148.032 1.00 50.18  ? 194  GLN C N   1 
ATOM   4278  C CA  . GLN C  1 194 ? -12.459 72.327  149.421 1.00 50.81  ? 194  GLN C CA  1 
ATOM   4279  C C   . GLN C  1 194 ? -11.072 72.037  149.996 1.00 49.07  ? 194  GLN C C   1 
ATOM   4280  O O   . GLN C  1 194 ? -10.123 71.780  149.259 1.00 48.79  ? 194  GLN C O   1 
ATOM   4281  C CB  . GLN C  1 194 ? -13.135 70.972  149.534 1.00 55.05  ? 194  GLN C CB  1 
ATOM   4282  C CG  . GLN C  1 194 ? -14.466 70.683  148.929 1.00 60.54  ? 194  GLN C CG  1 
ATOM   4283  C CD  . GLN C  1 194 ? -14.770 69.191  149.185 1.00 64.32  ? 194  GLN C CD  1 
ATOM   4284  O OE1 . GLN C  1 194 ? -15.924 68.720  149.078 1.00 66.15  ? 194  GLN C OE1 1 
ATOM   4285  N NE2 . GLN C  1 194 ? -13.708 68.437  149.537 1.00 64.48  ? 194  GLN C NE2 1 
ATOM   4286  N N   . ASP C  1 195 ? -10.980 71.991  151.317 1.00 46.37  ? 195  ASP C N   1 
ATOM   4287  C CA  . ASP C  1 195 ? -9.739  71.682  151.954 1.00 43.99  ? 195  ASP C CA  1 
ATOM   4288  C C   . ASP C  1 195 ? -9.496  70.177  151.877 1.00 43.79  ? 195  ASP C C   1 
ATOM   4289  O O   . ASP C  1 195 ? -8.417  69.743  151.520 1.00 43.67  ? 195  ASP C O   1 
ATOM   4290  C CB  . ASP C  1 195 ? -9.791  72.131  153.397 1.00 44.67  ? 195  ASP C CB  1 
ATOM   4291  C CG  . ASP C  1 195 ? -9.765  73.651  153.546 1.00 46.57  ? 195  ASP C CG  1 
ATOM   4292  O OD1 . ASP C  1 195 ? -9.925  74.116  154.699 1.00 48.81  ? 195  ASP C OD1 1 
ATOM   4293  O OD2 . ASP C  1 195 ? -9.580  74.381  152.538 1.00 45.95  ? 195  ASP C OD2 1 
ATOM   4294  N N   . LEU C  1 196 ? -10.511 69.380  152.188 1.00 43.53  ? 196  LEU C N   1 
ATOM   4295  C CA  . LEU C  1 196 ? -10.400 67.924  152.181 1.00 43.69  ? 196  LEU C CA  1 
ATOM   4296  C C   . LEU C  1 196 ? -9.692  67.294  150.957 1.00 43.31  ? 196  LEU C C   1 
ATOM   4297  O O   . LEU C  1 196 ? -9.904  67.710  149.806 1.00 44.81  ? 196  LEU C O   1 
ATOM   4298  C CB  . LEU C  1 196 ? -11.811 67.348  152.328 1.00 45.22  ? 196  LEU C CB  1 
ATOM   4299  C CG  . LEU C  1 196 ? -12.202 66.117  153.191 1.00 47.45  ? 196  LEU C CG  1 
ATOM   4300  C CD1 . LEU C  1 196 ? -11.995 64.777  152.475 1.00 48.44  ? 196  LEU C CD1 1 
ATOM   4301  C CD2 . LEU C  1 196 ? -11.411 66.153  154.503 1.00 48.01  ? 196  LEU C CD2 1 
ATOM   4302  N N   . GLU C  1 197 ? -8.844  66.302  151.207 1.00 41.20  ? 197  GLU C N   1 
ATOM   4303  C CA  . GLU C  1 197 ? -8.138  65.578  150.137 1.00 41.52  ? 197  GLU C CA  1 
ATOM   4304  C C   . GLU C  1 197 ? -8.383  64.110  150.412 1.00 43.08  ? 197  GLU C C   1 
ATOM   4305  O O   . GLU C  1 197 ? -7.581  63.449  151.075 1.00 43.41  ? 197  GLU C O   1 
ATOM   4306  C CB  . GLU C  1 197 ? -6.622  65.780  150.171 1.00 38.90  ? 197  GLU C CB  1 
ATOM   4307  C CG  . GLU C  1 197 ? -6.118  67.047  149.579 1.00 35.37  ? 197  GLU C CG  1 
ATOM   4308  C CD  . GLU C  1 197 ? -6.505  67.228  148.147 1.00 35.11  ? 197  GLU C CD  1 
ATOM   4309  O OE1 . GLU C  1 197 ? -6.629  66.233  147.385 1.00 34.01  ? 197  GLU C OE1 1 
ATOM   4310  O OE2 . GLU C  1 197 ? -6.672  68.397  147.787 1.00 35.14  ? 197  GLU C OE2 1 
ATOM   4311  N N   . PRO C  1 198 ? -9.486  63.570  149.897 1.00 43.74  ? 198  PRO C N   1 
ATOM   4312  C CA  . PRO C  1 198 ? -9.786  62.163  150.140 1.00 43.35  ? 198  PRO C CA  1 
ATOM   4313  C C   . PRO C  1 198 ? -8.697  61.159  149.778 1.00 43.53  ? 198  PRO C C   1 
ATOM   4314  O O   . PRO C  1 198 ? -8.277  60.368  150.623 1.00 43.70  ? 198  PRO C O   1 
ATOM   4315  C CB  . PRO C  1 198 ? -11.082 61.960  149.367 1.00 43.46  ? 198  PRO C CB  1 
ATOM   4316  C CG  . PRO C  1 198 ? -11.733 63.297  149.440 1.00 43.09  ? 198  PRO C CG  1 
ATOM   4317  C CD  . PRO C  1 198 ? -10.584 64.236  149.178 1.00 43.82  ? 198  PRO C CD  1 
ATOM   4318  N N   . SER C  1 199 ? -8.226  61.160  148.543 1.00 44.03  ? 199  SER C N   1 
ATOM   4319  C CA  . SER C  1 199 ? -7.189  60.186  148.208 1.00 45.82  ? 199  SER C CA  1 
ATOM   4320  C C   . SER C  1 199 ? -6.025  60.303  149.172 1.00 46.23  ? 199  SER C C   1 
ATOM   4321  O O   . SER C  1 199 ? -5.402  59.278  149.506 1.00 47.24  ? 199  SER C O   1 
ATOM   4322  C CB  . SER C  1 199 ? -6.686  60.406  146.799 1.00 46.80  ? 199  SER C CB  1 
ATOM   4323  O OG  . SER C  1 199 ? -6.432  61.790  146.662 1.00 52.96  ? 199  SER C OG  1 
ATOM   4324  N N   . VAL C  1 200 ? -5.721  61.537  149.606 1.00 46.06  ? 200  VAL C N   1 
ATOM   4325  C CA  . VAL C  1 200 ? -4.629  61.770  150.555 1.00 46.36  ? 200  VAL C CA  1 
ATOM   4326  C C   . VAL C  1 200 ? -4.934  61.162  151.911 1.00 47.91  ? 200  VAL C C   1 
ATOM   4327  O O   . VAL C  1 200 ? -4.075  60.491  152.481 1.00 49.34  ? 200  VAL C O   1 
ATOM   4328  C CB  . VAL C  1 200 ? -4.313  63.293  150.789 1.00 45.57  ? 200  VAL C CB  1 
ATOM   4329  C CG1 . VAL C  1 200 ? -3.346  63.466  151.973 1.00 42.03  ? 200  VAL C CG1 1 
ATOM   4330  C CG2 . VAL C  1 200 ? -3.696  63.889  149.549 1.00 45.61  ? 200  VAL C CG2 1 
ATOM   4331  N N   . GLU C  1 201 ? -6.148  61.386  152.427 1.00 48.81  ? 201  GLU C N   1 
ATOM   4332  C CA  . GLU C  1 201 ? -6.523  60.879  153.747 1.00 49.85  ? 201  GLU C CA  1 
ATOM   4333  C C   . GLU C  1 201 ? -6.450  59.373  153.816 1.00 50.41  ? 201  GLU C C   1 
ATOM   4334  O O   . GLU C  1 201 ? -6.032  58.818  154.831 1.00 48.82  ? 201  GLU C O   1 
ATOM   4335  C CB  . GLU C  1 201 ? -7.914  61.375  154.150 1.00 50.72  ? 201  GLU C CB  1 
ATOM   4336  C CG  . GLU C  1 201 ? -8.211  61.202  155.659 1.00 53.38  ? 201  GLU C CG  1 
ATOM   4337  C CD  . GLU C  1 201 ? -7.131  61.811  156.625 1.00 55.09  ? 201  GLU C CD  1 
ATOM   4338  O OE1 . GLU C  1 201 ? -6.683  61.039  157.505 1.00 56.58  ? 201  GLU C OE1 1 
ATOM   4339  O OE2 . GLU C  1 201 ? -6.755  63.033  156.535 1.00 53.97  ? 201  GLU C OE2 1 
ATOM   4340  N N   . GLU C  1 202 ? -6.854  58.711  152.738 1.00 52.13  ? 202  GLU C N   1 
ATOM   4341  C CA  . GLU C  1 202 ? -6.767  57.261  152.697 1.00 55.60  ? 202  GLU C CA  1 
ATOM   4342  C C   . GLU C  1 202 ? -5.334  56.884  152.957 1.00 55.98  ? 202  GLU C C   1 
ATOM   4343  O O   . GLU C  1 202 ? -4.968  56.414  154.044 1.00 56.18  ? 202  GLU C O   1 
ATOM   4344  C CB  . GLU C  1 202 ? -7.103  56.705  151.320 1.00 58.32  ? 202  GLU C CB  1 
ATOM   4345  C CG  . GLU C  1 202 ? -8.543  56.327  151.123 1.00 63.89  ? 202  GLU C CG  1 
ATOM   4346  C CD  . GLU C  1 202 ? -8.687  55.163  150.150 1.00 66.84  ? 202  GLU C CD  1 
ATOM   4347  O OE1 . GLU C  1 202 ? -8.336  54.007  150.546 1.00 67.39  ? 202  GLU C OE1 1 
ATOM   4348  O OE2 . GLU C  1 202 ? -9.139  55.424  148.994 1.00 67.92  ? 202  GLU C OE2 1 
ATOM   4349  N N   . ALA C  1 203 ? -4.529  57.106  151.915 1.00 56.37  ? 203  ALA C N   1 
ATOM   4350  C CA  . ALA C  1 203 ? -3.109  56.786  151.927 1.00 55.62  ? 203  ALA C CA  1 
ATOM   4351  C C   . ALA C  1 203 ? -2.526  57.071  153.286 1.00 55.29  ? 203  ALA C C   1 
ATOM   4352  O O   . ALA C  1 203 ? -1.816  56.251  153.837 1.00 54.18  ? 203  ALA C O   1 
ATOM   4353  C CB  . ALA C  1 203 ? -2.382  57.574  150.850 1.00 54.01  ? 203  ALA C CB  1 
ATOM   4354  N N   . ARG C  1 204 ? -2.857  58.224  153.847 1.00 56.81  ? 204  ARG C N   1 
ATOM   4355  C CA  . ARG C  1 204 ? -2.308  58.561  155.144 1.00 58.30  ? 204  ARG C CA  1 
ATOM   4356  C C   . ARG C  1 204 ? -2.710  57.462  156.089 1.00 61.74  ? 204  ARG C C   1 
ATOM   4357  O O   . ARG C  1 204 ? -1.864  56.680  156.540 1.00 63.19  ? 204  ARG C O   1 
ATOM   4358  C CB  . ARG C  1 204 ? -2.831  59.902  155.650 1.00 54.78  ? 204  ARG C CB  1 
ATOM   4359  C CG  . ARG C  1 204 ? -1.744  60.669  156.352 1.00 51.67  ? 204  ARG C CG  1 
ATOM   4360  C CD  . ARG C  1 204 ? -2.221  61.791  157.251 1.00 48.49  ? 204  ARG C CD  1 
ATOM   4361  N NE  . ARG C  1 204 ? -3.084  62.795  156.633 1.00 45.73  ? 204  ARG C NE  1 
ATOM   4362  C CZ  . ARG C  1 204 ? -2.890  63.393  155.463 1.00 44.58  ? 204  ARG C CZ  1 
ATOM   4363  N NH1 . ARG C  1 204 ? -3.776  64.297  155.063 1.00 44.46  ? 204  ARG C NH1 1 
ATOM   4364  N NH2 . ARG C  1 204 ? -1.858  63.079  154.683 1.00 43.30  ? 204  ARG C NH2 1 
ATOM   4365  N N   . TYR C  1 205 ? -4.014  57.382  156.347 1.00 64.57  ? 205  TYR C N   1 
ATOM   4366  C CA  . TYR C  1 205 ? -4.563  56.399  157.250 1.00 66.90  ? 205  TYR C CA  1 
ATOM   4367  C C   . TYR C  1 205 ? -3.959  54.993  157.103 1.00 68.83  ? 205  TYR C C   1 
ATOM   4368  O O   . TYR C  1 205 ? -3.718  54.316  158.108 1.00 69.18  ? 205  TYR C O   1 
ATOM   4369  C CB  . TYR C  1 205 ? -6.082  56.391  157.101 1.00 67.44  ? 205  TYR C CB  1 
ATOM   4370  C CG  . TYR C  1 205 ? -6.795  55.575  158.151 1.00 68.36  ? 205  TYR C CG  1 
ATOM   4371  C CD1 . TYR C  1 205 ? -6.612  55.831  159.510 1.00 67.46  ? 205  TYR C CD1 1 
ATOM   4372  C CD2 . TYR C  1 205 ? -7.591  54.494  157.780 1.00 68.85  ? 205  TYR C CD2 1 
ATOM   4373  C CE1 . TYR C  1 205 ? -7.190  55.021  160.465 1.00 68.30  ? 205  TYR C CE1 1 
ATOM   4374  C CE2 . TYR C  1 205 ? -8.178  53.681  158.723 1.00 69.23  ? 205  TYR C CE2 1 
ATOM   4375  C CZ  . TYR C  1 205 ? -7.975  53.940  160.063 1.00 69.15  ? 205  TYR C CZ  1 
ATOM   4376  O OH  . TYR C  1 205 ? -8.557  53.092  160.989 1.00 70.17  ? 205  TYR C OH  1 
ATOM   4377  N N   . ASN C  1 206 ? -3.671  54.552  155.881 1.00 71.60  ? 206  ASN C N   1 
ATOM   4378  C CA  . ASN C  1 206 ? -3.081  53.213  155.710 1.00 74.48  ? 206  ASN C CA  1 
ATOM   4379  C C   . ASN C  1 206 ? -1.584  53.208  155.922 1.00 76.82  ? 206  ASN C C   1 
ATOM   4380  O O   . ASN C  1 206 ? -0.917  52.307  155.430 1.00 77.60  ? 206  ASN C O   1 
ATOM   4381  C CB  . ASN C  1 206 ? -3.302  52.638  154.304 1.00 74.23  ? 206  ASN C CB  1 
ATOM   4382  C CG  . ASN C  1 206 ? -4.746  52.630  153.889 1.00 75.12  ? 206  ASN C CG  1 
ATOM   4383  O OD1 . ASN C  1 206 ? -5.653  52.583  154.729 1.00 75.92  ? 206  ASN C OD1 1 
ATOM   4384  N ND2 . ASN C  1 206 ? -4.978  52.654  152.579 1.00 75.09  ? 206  ASN C ND2 1 
ATOM   4385  N N   . SER C  1 207 ? -1.036  54.199  156.617 1.00 79.69  ? 207  SER C N   1 
ATOM   4386  C CA  . SER C  1 207 ? 0.409   54.226  156.810 1.00 82.47  ? 207  SER C CA  1 
ATOM   4387  C C   . SER C  1 207 ? 0.802   54.057  158.270 1.00 85.21  ? 207  SER C C   1 
ATOM   4388  O O   . SER C  1 207 ? 1.894   53.566  158.556 1.00 85.78  ? 207  SER C O   1 
ATOM   4389  C CB  . SER C  1 207 ? 1.012   55.519  156.243 1.00 81.26  ? 207  SER C CB  1 
ATOM   4390  O OG  . SER C  1 207 ? 0.792   56.610  157.108 1.00 80.08  ? 207  SER C OG  1 
ATOM   4391  N N   . CYS C  1 208 ? -0.075  54.451  159.194 1.00 88.45  ? 208  CYS C N   1 
ATOM   4392  C CA  . CYS C  1 208 ? 0.216   54.295  160.624 1.00 91.73  ? 208  CYS C CA  1 
ATOM   4393  C C   . CYS C  1 208 ? 0.150   52.797  160.964 1.00 94.44  ? 208  CYS C C   1 
ATOM   4394  O O   . CYS C  1 208 ? 0.040   52.415  162.141 1.00 95.34  ? 208  CYS C O   1 
ATOM   4395  C CB  . CYS C  1 208 ? -0.819  55.029  161.484 1.00 91.60  ? 208  CYS C CB  1 
ATOM   4396  S SG  . CYS C  1 208 ? -1.153  56.758  161.082 1.00 90.42  ? 208  CYS C SG  1 
ATOM   4397  N N   . ARG C  1 209 ? 0.182   51.968  159.914 1.00 96.49  ? 209  ARG C N   1 
ATOM   4398  C CA  . ARG C  1 209 ? 0.144   50.500  160.010 1.00 97.71  ? 209  ARG C CA  1 
ATOM   4399  C C   . ARG C  1 209 ? 1.479   49.916  159.521 1.00 97.60  ? 209  ARG C C   1 
ATOM   4400  O O   . ARG C  1 209 ? 1.582   49.424  158.388 1.00 97.14  ? 209  ARG C O   1 
ATOM   4401  C CB  . ARG C  1 209 ? -0.981  49.932  159.134 1.00 99.05  ? 209  ARG C CB  1 
ATOM   4402  C CG  . ARG C  1 209 ? -2.379  50.426  159.453 1.00 100.59 ? 209  ARG C CG  1 
ATOM   4403  C CD  . ARG C  1 209 ? -3.286  50.000  158.332 1.00 101.80 ? 209  ARG C CD  1 
ATOM   4404  N NE  . ARG C  1 209 ? -4.678  50.332  158.583 1.00 104.15 ? 209  ARG C NE  1 
ATOM   4405  C CZ  . ARG C  1 209 ? -5.641  50.192  157.672 1.00 105.54 ? 209  ARG C CZ  1 
ATOM   4406  N NH1 . ARG C  1 209 ? -5.338  49.729  156.457 1.00 105.47 ? 209  ARG C NH1 1 
ATOM   4407  N NH2 . ARG C  1 209 ? -6.903  50.502  157.974 1.00 105.78 ? 209  ARG C NH2 1 
ATOM   4408  N N   . LEU D  1 24  ? 10.114  56.618  165.857 1.00 60.53  ? 24   LEU D N   1 
ATOM   4409  C CA  . LEU D  1 24  ? 9.235   56.871  164.657 1.00 60.53  ? 24   LEU D CA  1 
ATOM   4410  C C   . LEU D  1 24  ? 8.302   58.105  164.826 1.00 60.32  ? 24   LEU D C   1 
ATOM   4411  O O   . LEU D  1 24  ? 7.167   58.198  164.274 1.00 59.93  ? 24   LEU D O   1 
ATOM   4412  C CB  . LEU D  1 24  ? 8.410   55.620  164.353 1.00 61.14  ? 24   LEU D CB  1 
ATOM   4413  C CG  . LEU D  1 24  ? 8.397   55.336  162.840 1.00 62.91  ? 24   LEU D CG  1 
ATOM   4414  C CD1 . LEU D  1 24  ? 7.719   56.458  162.072 1.00 62.79  ? 24   LEU D CD1 1 
ATOM   4415  C CD2 . LEU D  1 24  ? 9.839   55.200  162.353 1.00 63.03  ? 24   LEU D CD2 1 
ATOM   4416  N N   . CYS D  1 25  ? 8.823   59.052  165.608 1.00 58.73  ? 25   CYS D N   1 
ATOM   4417  C CA  . CYS D  1 25  ? 8.174   60.314  165.942 1.00 56.03  ? 25   CYS D CA  1 
ATOM   4418  C C   . CYS D  1 25  ? 8.319   61.367  164.821 1.00 53.21  ? 25   CYS D C   1 
ATOM   4419  O O   . CYS D  1 25  ? 8.910   61.107  163.782 1.00 53.63  ? 25   CYS D O   1 
ATOM   4420  C CB  . CYS D  1 25  ? 8.849   60.841  167.186 1.00 56.82  ? 25   CYS D CB  1 
ATOM   4421  S SG  . CYS D  1 25  ? 10.667  60.949  166.925 1.00 57.02  ? 25   CYS D SG  1 
ATOM   4422  N N   . PHE D  1 26  ? 7.819   62.568  165.076 1.00 49.64  ? 26   PHE D N   1 
ATOM   4423  C CA  . PHE D  1 26  ? 7.882   63.652  164.123 1.00 46.34  ? 26   PHE D CA  1 
ATOM   4424  C C   . PHE D  1 26  ? 9.299   63.929  163.726 1.00 45.74  ? 26   PHE D C   1 
ATOM   4425  O O   . PHE D  1 26  ? 10.170  64.005  164.571 1.00 45.01  ? 26   PHE D O   1 
ATOM   4426  C CB  . PHE D  1 26  ? 7.315   64.925  164.714 1.00 45.32  ? 26   PHE D CB  1 
ATOM   4427  C CG  . PHE D  1 26  ? 7.048   65.966  163.696 1.00 43.96  ? 26   PHE D CG  1 
ATOM   4428  C CD1 . PHE D  1 26  ? 5.857   65.967  162.976 1.00 43.72  ? 26   PHE D CD1 1 
ATOM   4429  C CD2 . PHE D  1 26  ? 8.012   66.920  163.405 1.00 44.10  ? 26   PHE D CD2 1 
ATOM   4430  C CE1 . PHE D  1 26  ? 5.617   66.921  161.954 1.00 45.25  ? 26   PHE D CE1 1 
ATOM   4431  C CE2 . PHE D  1 26  ? 7.801   67.871  162.401 1.00 44.60  ? 26   PHE D CE2 1 
ATOM   4432  C CZ  . PHE D  1 26  ? 6.593   67.876  161.666 1.00 45.24  ? 26   PHE D CZ  1 
ATOM   4433  N N   . GLY D  1 27  ? 9.517   64.098  162.427 1.00 45.72  ? 27   GLY D N   1 
ATOM   4434  C CA  . GLY D  1 27  ? 10.840  64.371  161.917 1.00 45.35  ? 27   GLY D CA  1 
ATOM   4435  C C   . GLY D  1 27  ? 11.578  63.121  161.484 1.00 46.47  ? 27   GLY D C   1 
ATOM   4436  O O   . GLY D  1 27  ? 12.616  63.196  160.843 1.00 45.04  ? 27   GLY D O   1 
ATOM   4437  N N   . GLN D  1 28  ? 11.037  61.960  161.835 1.00 49.28  ? 28   GLN D N   1 
ATOM   4438  C CA  . GLN D  1 28  ? 11.654  60.685  161.486 1.00 51.02  ? 28   GLN D CA  1 
ATOM   4439  C C   . GLN D  1 28  ? 10.790  59.730  160.683 1.00 51.03  ? 28   GLN D C   1 
ATOM   4440  O O   . GLN D  1 28  ? 11.126  58.563  160.547 1.00 51.18  ? 28   GLN D O   1 
ATOM   4441  C CB  . GLN D  1 28  ? 12.085  59.988  162.739 1.00 52.04  ? 28   GLN D CB  1 
ATOM   4442  C CG  . GLN D  1 28  ? 13.212  60.673  163.410 1.00 55.64  ? 28   GLN D CG  1 
ATOM   4443  C CD  . GLN D  1 28  ? 13.461  60.084  164.782 1.00 58.98  ? 28   GLN D CD  1 
ATOM   4444  O OE1 . GLN D  1 28  ? 14.459  60.405  165.433 1.00 60.01  ? 28   GLN D OE1 1 
ATOM   4445  N NE2 . GLN D  1 28  ? 12.544  59.209  165.238 1.00 61.13  ? 28   GLN D NE2 1 
ATOM   4446  N N   . CYS D  1 29  ? 9.666   60.197  160.182 1.00 51.24  ? 29   CYS D N   1 
ATOM   4447  C CA  . CYS D  1 29  ? 8.843   59.325  159.383 1.00 53.19  ? 29   CYS D CA  1 
ATOM   4448  C C   . CYS D  1 29  ? 9.401   59.385  158.011 1.00 52.23  ? 29   CYS D C   1 
ATOM   4449  O O   . CYS D  1 29  ? 10.237  60.227  157.708 1.00 54.41  ? 29   CYS D O   1 
ATOM   4450  C CB  . CYS D  1 29  ? 7.417   59.812  159.319 1.00 55.41  ? 29   CYS D CB  1 
ATOM   4451  S SG  . CYS D  1 29  ? 6.592   59.510  160.830 1.00 64.54  ? 29   CYS D SG  1 
ATOM   4452  N N   . GLN D  1 30  ? 8.945   58.483  157.178 1.00 50.28  ? 30   GLN D N   1 
ATOM   4453  C CA  . GLN D  1 30  ? 9.373   58.471  155.815 1.00 49.60  ? 30   GLN D CA  1 
ATOM   4454  C C   . GLN D  1 30  ? 8.029   58.254  155.144 1.00 48.52  ? 30   GLN D C   1 
ATOM   4455  O O   . GLN D  1 30  ? 7.245   57.418  155.578 1.00 50.23  ? 30   GLN D O   1 
ATOM   4456  C CB  . GLN D  1 30  ? 10.328  57.314  155.544 1.00 50.88  ? 30   GLN D CB  1 
ATOM   4457  C CG  . GLN D  1 30  ? 10.919  57.393  154.144 1.00 55.14  ? 30   GLN D CG  1 
ATOM   4458  C CD  . GLN D  1 30  ? 11.697  56.142  153.699 1.00 57.14  ? 30   GLN D CD  1 
ATOM   4459  O OE1 . GLN D  1 30  ? 12.052  56.008  152.505 1.00 55.94  ? 30   GLN D OE1 1 
ATOM   4460  N NE2 . GLN D  1 30  ? 11.981  55.234  154.653 1.00 57.18  ? 30   GLN D NE2 1 
ATOM   4461  N N   . TYR D  1 31  ? 7.717   59.028  154.122 1.00 45.61  ? 31   TYR D N   1 
ATOM   4462  C CA  . TYR D  1 31  ? 6.440   58.853  153.493 1.00 41.88  ? 31   TYR D CA  1 
ATOM   4463  C C   . TYR D  1 31  ? 6.421   57.556  152.771 1.00 42.08  ? 31   TYR D C   1 
ATOM   4464  O O   . TYR D  1 31  ? 7.423   57.141  152.204 1.00 41.73  ? 31   TYR D O   1 
ATOM   4465  C CB  . TYR D  1 31  ? 6.143   59.969  152.508 1.00 39.52  ? 31   TYR D CB  1 
ATOM   4466  C CG  . TYR D  1 31  ? 5.684   61.231  153.148 1.00 37.09  ? 31   TYR D CG  1 
ATOM   4467  C CD1 . TYR D  1 31  ? 6.558   62.292  153.347 1.00 36.87  ? 31   TYR D CD1 1 
ATOM   4468  C CD2 . TYR D  1 31  ? 4.375   61.375  153.544 1.00 36.01  ? 31   TYR D CD2 1 
ATOM   4469  C CE1 . TYR D  1 31  ? 6.126   63.464  153.925 1.00 35.98  ? 31   TYR D CE1 1 
ATOM   4470  C CE2 . TYR D  1 31  ? 3.923   62.539  154.120 1.00 36.00  ? 31   TYR D CE2 1 
ATOM   4471  C CZ  . TYR D  1 31  ? 4.802   63.585  154.309 1.00 36.65  ? 31   TYR D CZ  1 
ATOM   4472  O OH  . TYR D  1 31  ? 4.344   64.757  154.865 1.00 36.43  ? 31   TYR D OH  1 
ATOM   4473  N N   . THR D  1 32  ? 5.254   56.920  152.809 1.00 43.32  ? 32   THR D N   1 
ATOM   4474  C CA  . THR D  1 32  ? 5.011   55.662  152.115 1.00 42.59  ? 32   THR D CA  1 
ATOM   4475  C C   . THR D  1 32  ? 4.782   56.081  150.655 1.00 41.73  ? 32   THR D C   1 
ATOM   4476  O O   . THR D  1 32  ? 4.374   57.217  150.379 1.00 40.51  ? 32   THR D O   1 
ATOM   4477  C CB  . THR D  1 32  ? 3.738   54.989  152.639 1.00 42.96  ? 32   THR D CB  1 
ATOM   4478  O OG1 . THR D  1 32  ? 2.613   55.843  152.356 1.00 45.55  ? 32   THR D OG1 1 
ATOM   4479  C CG2 . THR D  1 32  ? 3.838   54.765  154.148 1.00 41.35  ? 32   THR D CG2 1 
ATOM   4480  N N   . ALA D  1 33  ? 5.045   55.178  149.723 1.00 40.99  ? 33   ALA D N   1 
ATOM   4481  C CA  . ALA D  1 33  ? 4.858   55.498  148.326 1.00 41.12  ? 33   ALA D CA  1 
ATOM   4482  C C   . ALA D  1 33  ? 3.460   56.005  148.053 1.00 42.02  ? 33   ALA D C   1 
ATOM   4483  O O   . ALA D  1 33  ? 3.256   56.925  147.269 1.00 41.53  ? 33   ALA D O   1 
ATOM   4484  C CB  . ALA D  1 33  ? 5.117   54.290  147.496 1.00 41.01  ? 33   ALA D CB  1 
ATOM   4485  N N   . GLU D  1 34  ? 2.491   55.382  148.698 1.00 44.04  ? 34   GLU D N   1 
ATOM   4486  C CA  . GLU D  1 34  ? 1.114   55.762  148.501 1.00 45.38  ? 34   GLU D CA  1 
ATOM   4487  C C   . GLU D  1 34  ? 0.821   57.192  148.974 1.00 42.87  ? 34   GLU D C   1 
ATOM   4488  O O   . GLU D  1 34  ? 0.238   57.986  148.221 1.00 41.39  ? 34   GLU D O   1 
ATOM   4489  C CB  . GLU D  1 34  ? 0.166   54.752  149.184 1.00 49.97  ? 34   GLU D CB  1 
ATOM   4490  C CG  . GLU D  1 34  ? -1.218  54.710  148.490 1.00 60.02  ? 34   GLU D CG  1 
ATOM   4491  C CD  . GLU D  1 34  ? -2.349  54.012  149.292 1.00 65.52  ? 34   GLU D CD  1 
ATOM   4492  O OE1 . GLU D  1 34  ? -3.557  54.307  149.012 1.00 66.38  ? 34   GLU D OE1 1 
ATOM   4493  O OE2 . GLU D  1 34  ? -2.027  53.171  150.184 1.00 69.13  ? 34   GLU D OE2 1 
ATOM   4494  N N   . GLU D  1 35  ? 1.220   57.531  150.203 1.00 40.31  ? 35   GLU D N   1 
ATOM   4495  C CA  . GLU D  1 35  ? 0.951   58.889  150.698 1.00 37.93  ? 35   GLU D CA  1 
ATOM   4496  C C   . GLU D  1 35  ? 1.780   59.908  149.886 1.00 37.15  ? 35   GLU D C   1 
ATOM   4497  O O   . GLU D  1 35  ? 1.262   60.936  149.450 1.00 37.81  ? 35   GLU D O   1 
ATOM   4498  C CB  . GLU D  1 35  ? 1.229   58.999  152.208 1.00 35.00  ? 35   GLU D CB  1 
ATOM   4499  C CG  . GLU D  1 35  ? 0.725   60.292  152.790 1.00 31.67  ? 35   GLU D CG  1 
ATOM   4500  C CD  . GLU D  1 35  ? 0.999   60.459  154.282 1.00 32.60  ? 35   GLU D CD  1 
ATOM   4501  O OE1 . GLU D  1 35  ? 0.647   61.563  154.802 1.00 29.22  ? 35   GLU D OE1 1 
ATOM   4502  O OE2 . GLU D  1 35  ? 1.558   59.505  154.919 1.00 30.11  ? 35   GLU D OE2 1 
ATOM   4503  N N   . TYR D  1 36  ? 3.048   59.603  149.649 1.00 35.32  ? 36   TYR D N   1 
ATOM   4504  C CA  . TYR D  1 36  ? 3.887   60.480  148.857 1.00 35.35  ? 36   TYR D CA  1 
ATOM   4505  C C   . TYR D  1 36  ? 3.224   60.831  147.542 1.00 35.30  ? 36   TYR D C   1 
ATOM   4506  O O   . TYR D  1 36  ? 3.090   61.992  147.164 1.00 36.40  ? 36   TYR D O   1 
ATOM   4507  C CB  . TYR D  1 36  ? 5.224   59.813  148.524 1.00 34.01  ? 36   TYR D CB  1 
ATOM   4508  C CG  . TYR D  1 36  ? 5.866   60.477  147.334 1.00 32.72  ? 36   TYR D CG  1 
ATOM   4509  C CD1 . TYR D  1 36  ? 6.357   61.789  147.417 1.00 32.02  ? 36   TYR D CD1 1 
ATOM   4510  C CD2 . TYR D  1 36  ? 5.844   59.870  146.096 1.00 31.93  ? 36   TYR D CD2 1 
ATOM   4511  C CE1 . TYR D  1 36  ? 6.781   62.468  146.284 1.00 31.07  ? 36   TYR D CE1 1 
ATOM   4512  C CE2 . TYR D  1 36  ? 6.274   60.538  144.969 1.00 32.30  ? 36   TYR D CE2 1 
ATOM   4513  C CZ  . TYR D  1 36  ? 6.730   61.846  145.062 1.00 31.80  ? 36   TYR D CZ  1 
ATOM   4514  O OH  . TYR D  1 36  ? 7.017   62.550  143.904 1.00 32.94  ? 36   TYR D OH  1 
ATOM   4515  N N   . GLN D  1 37  ? 2.836   59.799  146.824 1.00 36.57  ? 37   GLN D N   1 
ATOM   4516  C CA  . GLN D  1 37  ? 2.203   59.987  145.528 1.00 37.21  ? 37   GLN D CA  1 
ATOM   4517  C C   . GLN D  1 37  ? 0.918   60.813  145.568 1.00 33.81  ? 37   GLN D C   1 
ATOM   4518  O O   . GLN D  1 37  ? 0.716   61.692  144.729 1.00 33.34  ? 37   GLN D O   1 
ATOM   4519  C CB  . GLN D  1 37  ? 1.943   58.627  144.879 1.00 40.59  ? 37   GLN D CB  1 
ATOM   4520  C CG  . GLN D  1 37  ? 1.540   58.751  143.410 1.00 47.68  ? 37   GLN D CG  1 
ATOM   4521  C CD  . GLN D  1 37  ? 0.726   57.547  142.923 1.00 50.21  ? 37   GLN D CD  1 
ATOM   4522  O OE1 . GLN D  1 37  ? 1.287   56.507  142.570 1.00 50.05  ? 37   GLN D OE1 1 
ATOM   4523  N NE2 . GLN D  1 37  ? -0.616  57.684  142.930 1.00 52.22  ? 37   GLN D NE2 1 
ATOM   4524  N N   . ALA D  1 38  ? 0.072   60.560  146.558 1.00 31.23  ? 38   ALA D N   1 
ATOM   4525  C CA  . ALA D  1 38  ? -1.185  61.287  146.657 1.00 30.05  ? 38   ALA D CA  1 
ATOM   4526  C C   . ALA D  1 38  ? -0.924  62.770  146.879 1.00 30.99  ? 38   ALA D C   1 
ATOM   4527  O O   . ALA D  1 38  ? -1.562  63.634  146.249 1.00 31.63  ? 38   ALA D O   1 
ATOM   4528  C CB  . ALA D  1 38  ? -2.027  60.724  147.797 1.00 28.01  ? 38   ALA D CB  1 
ATOM   4529  N N   . ILE D  1 39  ? 0.034   63.063  147.771 1.00 31.17  ? 39   ILE D N   1 
ATOM   4530  C CA  . ILE D  1 39  ? 0.363   64.433  148.097 1.00 28.77  ? 39   ILE D CA  1 
ATOM   4531  C C   . ILE D  1 39  ? 1.038   65.113  146.936 1.00 27.88  ? 39   ILE D C   1 
ATOM   4532  O O   . ILE D  1 39  ? 0.676   66.241  146.619 1.00 27.39  ? 39   ILE D O   1 
ATOM   4533  C CB  . ILE D  1 39  ? 1.226   64.512  149.394 1.00 30.55  ? 39   ILE D CB  1 
ATOM   4534  C CG1 . ILE D  1 39  ? 0.370   64.071  150.597 1.00 28.77  ? 39   ILE D CG1 1 
ATOM   4535  C CG2 . ILE D  1 39  ? 1.722   65.977  149.646 1.00 27.55  ? 39   ILE D CG2 1 
ATOM   4536  C CD1 . ILE D  1 39  ? 1.168   63.995  151.916 1.00 29.60  ? 39   ILE D CD1 1 
ATOM   4537  N N   . GLN D  1 40  ? 1.991   64.446  146.285 1.00 27.35  ? 40   GLN D N   1 
ATOM   4538  C CA  . GLN D  1 40  ? 2.655   65.074  145.145 1.00 29.05  ? 40   GLN D CA  1 
ATOM   4539  C C   . GLN D  1 40  ? 1.590   65.587  144.198 1.00 29.23  ? 40   GLN D C   1 
ATOM   4540  O O   . GLN D  1 40  ? 1.671   66.710  143.703 1.00 29.80  ? 40   GLN D O   1 
ATOM   4541  C CB  . GLN D  1 40  ? 3.546   64.092  144.378 1.00 29.40  ? 40   GLN D CB  1 
ATOM   4542  C CG  . GLN D  1 40  ? 5.030   64.390  144.403 1.00 33.96  ? 40   GLN D CG  1 
ATOM   4543  C CD  . GLN D  1 40  ? 5.424   65.729  143.835 1.00 35.20  ? 40   GLN D CD  1 
ATOM   4544  O OE1 . GLN D  1 40  ? 6.336   65.813  143.025 1.00 36.67  ? 40   GLN D OE1 1 
ATOM   4545  N NE2 . GLN D  1 40  ? 4.742   66.782  144.244 1.00 40.96  ? 40   GLN D NE2 1 
ATOM   4546  N N   . LYS D  1 41  ? 0.580   64.752  143.954 1.00 30.70  ? 41   LYS D N   1 
ATOM   4547  C CA  . LYS D  1 41  ? -0.487  65.130  143.049 1.00 32.35  ? 41   LYS D CA  1 
ATOM   4548  C C   . LYS D  1 41  ? -1.361  66.233  143.601 1.00 31.50  ? 41   LYS D C   1 
ATOM   4549  O O   . LYS D  1 41  ? -1.613  67.228  142.931 1.00 32.99  ? 41   LYS D O   1 
ATOM   4550  C CB  . LYS D  1 41  ? -1.335  63.917  142.706 1.00 32.65  ? 41   LYS D CB  1 
ATOM   4551  C CG  . LYS D  1 41  ? -0.621  62.976  141.768 1.00 36.44  ? 41   LYS D CG  1 
ATOM   4552  C CD  . LYS D  1 41  ? -1.340  61.651  141.629 1.00 38.35  ? 41   LYS D CD  1 
ATOM   4553  C CE  . LYS D  1 41  ? -0.592  60.698  140.692 1.00 40.14  ? 41   LYS D CE  1 
ATOM   4554  N NZ  . LYS D  1 41  ? -1.330  59.378  140.677 1.00 43.83  ? 41   LYS D NZ  1 
ATOM   4555  N N   . ALA D  1 42  ? -1.809  66.071  144.830 1.00 29.92  ? 42   ALA D N   1 
ATOM   4556  C CA  . ALA D  1 42  ? -2.681  67.074  145.393 1.00 31.27  ? 42   ALA D CA  1 
ATOM   4557  C C   . ALA D  1 42  ? -2.070  68.497  145.396 1.00 32.27  ? 42   ALA D C   1 
ATOM   4558  O O   . ALA D  1 42  ? -2.766  69.495  145.112 1.00 30.37  ? 42   ALA D O   1 
ATOM   4559  C CB  . ALA D  1 42  ? -3.080  66.649  146.794 1.00 31.24  ? 42   ALA D CB  1 
ATOM   4560  N N   . LEU D  1 43  ? -0.768  68.565  145.689 1.00 32.09  ? 43   LEU D N   1 
ATOM   4561  C CA  . LEU D  1 43  ? -0.044  69.830  145.760 1.00 32.78  ? 43   LEU D CA  1 
ATOM   4562  C C   . LEU D  1 43  ? -0.056  70.618  144.453 1.00 33.89  ? 43   LEU D C   1 
ATOM   4563  O O   . LEU D  1 43  ? 0.009   71.865  144.470 1.00 35.29  ? 43   LEU D O   1 
ATOM   4564  C CB  . LEU D  1 43  ? 1.410   69.602  146.240 1.00 29.29  ? 43   LEU D CB  1 
ATOM   4565  C CG  . LEU D  1 43  ? 1.480   69.270  147.749 1.00 30.03  ? 43   LEU D CG  1 
ATOM   4566  C CD1 . LEU D  1 43  ? 2.922   68.908  148.098 1.00 28.33  ? 43   LEU D CD1 1 
ATOM   4567  C CD2 . LEU D  1 43  ? 0.945   70.418  148.641 1.00 22.32  ? 43   LEU D CD2 1 
ATOM   4568  N N   . ARG D  1 44  ? -0.152  69.912  143.331 1.00 33.82  ? 44   ARG D N   1 
ATOM   4569  C CA  . ARG D  1 44  ? -0.187  70.584  142.043 1.00 35.33  ? 44   ARG D CA  1 
ATOM   4570  C C   . ARG D  1 44  ? -1.412  71.458  141.795 1.00 35.79  ? 44   ARG D C   1 
ATOM   4571  O O   . ARG D  1 44  ? -1.318  72.426  141.077 1.00 37.22  ? 44   ARG D O   1 
ATOM   4572  C CB  . ARG D  1 44  ? -0.062  69.569  140.906 1.00 35.49  ? 44   ARG D CB  1 
ATOM   4573  C CG  . ARG D  1 44  ? 1.295   68.887  140.879 1.00 37.57  ? 44   ARG D CG  1 
ATOM   4574  C CD  . ARG D  1 44  ? 1.553   68.209  139.573 1.00 35.86  ? 44   ARG D CD  1 
ATOM   4575  N NE  . ARG D  1 44  ? 1.331   66.768  139.662 1.00 38.62  ? 44   ARG D NE  1 
ATOM   4576  C CZ  . ARG D  1 44  ? 2.285   65.851  139.781 1.00 37.63  ? 44   ARG D CZ  1 
ATOM   4577  N NH1 . ARG D  1 44  ? 3.540   66.218  139.839 1.00 39.89  ? 44   ARG D NH1 1 
ATOM   4578  N NH2 . ARG D  1 44  ? 1.992   64.563  139.798 1.00 38.59  ? 44   ARG D NH2 1 
ATOM   4579  N N   . GLN D  1 45  ? -2.546  71.150  142.403 1.00 37.25  ? 45   GLN D N   1 
ATOM   4580  C CA  . GLN D  1 45  ? -3.773  71.918  142.167 1.00 38.85  ? 45   GLN D CA  1 
ATOM   4581  C C   . GLN D  1 45  ? -3.675  73.388  142.457 1.00 38.11  ? 45   GLN D C   1 
ATOM   4582  O O   . GLN D  1 45  ? -3.054  73.748  143.424 1.00 38.73  ? 45   GLN D O   1 
ATOM   4583  C CB  . GLN D  1 45  ? -4.893  71.378  143.033 1.00 41.15  ? 45   GLN D CB  1 
ATOM   4584  C CG  . GLN D  1 45  ? -5.068  69.860  142.975 1.00 46.78  ? 45   GLN D CG  1 
ATOM   4585  C CD  . GLN D  1 45  ? -6.098  69.350  143.979 1.00 49.39  ? 45   GLN D CD  1 
ATOM   4586  O OE1 . GLN D  1 45  ? -6.540  68.215  143.901 1.00 53.82  ? 45   GLN D OE1 1 
ATOM   4587  N NE2 . GLN D  1 45  ? -6.473  70.191  144.931 1.00 52.08  ? 45   GLN D NE2 1 
ATOM   4588  N N   . ARG D  1 46  ? -4.274  74.238  141.630 1.00 37.97  ? 46   ARG D N   1 
ATOM   4589  C CA  . ARG D  1 46  ? -4.284  75.671  141.933 1.00 39.66  ? 46   ARG D CA  1 
ATOM   4590  C C   . ARG D  1 46  ? -5.538  75.831  142.789 1.00 40.81  ? 46   ARG D C   1 
ATOM   4591  O O   . ARG D  1 46  ? -6.437  74.971  142.735 1.00 39.53  ? 46   ARG D O   1 
ATOM   4592  C CB  . ARG D  1 46  ? -4.459  76.516  140.690 1.00 39.54  ? 46   ARG D CB  1 
ATOM   4593  C CG  . ARG D  1 46  ? -3.644  76.076  139.566 1.00 43.30  ? 46   ARG D CG  1 
ATOM   4594  C CD  . ARG D  1 46  ? -2.718  77.139  139.141 1.00 42.75  ? 46   ARG D CD  1 
ATOM   4595  N NE  . ARG D  1 46  ? -2.119  76.814  137.860 1.00 46.23  ? 46   ARG D NE  1 
ATOM   4596  C CZ  . ARG D  1 46  ? -0.993  77.383  137.437 1.00 49.96  ? 46   ARG D CZ  1 
ATOM   4597  N NH1 . ARG D  1 46  ? -0.386  78.295  138.221 1.00 50.99  ? 46   ARG D NH1 1 
ATOM   4598  N NH2 . ARG D  1 46  ? -0.466  77.049  136.254 1.00 48.32  ? 46   ARG D NH2 1 
ATOM   4599  N N   . LEU D  1 47  ? -5.642  76.893  143.582 1.00 41.68  ? 47   LEU D N   1 
ATOM   4600  C CA  . LEU D  1 47  ? -6.857  76.960  144.364 1.00 43.85  ? 47   LEU D CA  1 
ATOM   4601  C C   . LEU D  1 47  ? -7.950  77.831  143.774 1.00 44.38  ? 47   LEU D C   1 
ATOM   4602  O O   . LEU D  1 47  ? -7.683  78.816  143.071 1.00 43.78  ? 47   LEU D O   1 
ATOM   4603  C CB  . LEU D  1 47  ? -6.597  77.319  145.832 1.00 44.96  ? 47   LEU D CB  1 
ATOM   4604  C CG  . LEU D  1 47  ? -5.326  77.922  146.410 1.00 48.12  ? 47   LEU D CG  1 
ATOM   4605  C CD1 . LEU D  1 47  ? -5.309  77.686  147.886 1.00 48.25  ? 47   LEU D CD1 1 
ATOM   4606  C CD2 . LEU D  1 47  ? -4.130  77.228  145.839 1.00 51.99  ? 47   LEU D CD2 1 
ATOM   4607  N N   . GLY D  1 48  ? -9.188  77.403  144.031 1.00 43.91  ? 48   GLY D N   1 
ATOM   4608  C CA  . GLY D  1 48  ? -10.355 78.115  143.548 1.00 44.33  ? 48   GLY D CA  1 
ATOM   4609  C C   . GLY D  1 48  ? -10.566 79.494  144.166 1.00 44.64  ? 48   GLY D C   1 
ATOM   4610  O O   . GLY D  1 48  ? -9.879  79.897  145.105 1.00 44.47  ? 48   GLY D O   1 
ATOM   4611  N N   . PRO D  1 49  ? -11.544 80.242  143.648 1.00 45.29  ? 49   PRO D N   1 
ATOM   4612  C CA  . PRO D  1 49  ? -11.864 81.586  144.127 1.00 45.30  ? 49   PRO D CA  1 
ATOM   4613  C C   . PRO D  1 49  ? -12.242 81.580  145.606 1.00 45.68  ? 49   PRO D C   1 
ATOM   4614  O O   . PRO D  1 49  ? -12.113 82.595  146.293 1.00 46.47  ? 49   PRO D O   1 
ATOM   4615  C CB  . PRO D  1 49  ? -13.056 82.005  143.245 1.00 45.26  ? 49   PRO D CB  1 
ATOM   4616  C CG  . PRO D  1 49  ? -12.995 81.116  142.064 1.00 45.15  ? 49   PRO D CG  1 
ATOM   4617  C CD  . PRO D  1 49  ? -12.521 79.803  142.631 1.00 45.33  ? 49   PRO D CD  1 
ATOM   4618  N N   . GLU D  1 50  ? -12.709 80.446  146.108 1.00 45.28  ? 50   GLU D N   1 
ATOM   4619  C CA  . GLU D  1 50  ? -13.116 80.430  147.498 1.00 45.71  ? 50   GLU D CA  1 
ATOM   4620  C C   . GLU D  1 50  ? -11.989 80.600  148.497 1.00 44.74  ? 50   GLU D C   1 
ATOM   4621  O O   . GLU D  1 50  ? -12.231 80.734  149.690 1.00 44.47  ? 50   GLU D O   1 
ATOM   4622  C CB  . GLU D  1 50  ? -13.935 79.167  147.822 1.00 47.12  ? 50   GLU D CB  1 
ATOM   4623  C CG  . GLU D  1 50  ? -13.557 77.897  147.095 1.00 49.30  ? 50   GLU D CG  1 
ATOM   4624  C CD  . GLU D  1 50  ? -14.077 77.854  145.656 1.00 50.16  ? 50   GLU D CD  1 
ATOM   4625  O OE1 . GLU D  1 50  ? -13.407 78.386  144.755 1.00 49.34  ? 50   GLU D OE1 1 
ATOM   4626  O OE2 . GLU D  1 50  ? -15.169 77.298  145.423 1.00 50.61  ? 50   GLU D OE2 1 
ATOM   4627  N N   . TYR D  1 51  ? -10.759 80.628  148.007 1.00 44.00  ? 51   TYR D N   1 
ATOM   4628  C CA  . TYR D  1 51  ? -9.599  80.779  148.866 1.00 43.02  ? 51   TYR D CA  1 
ATOM   4629  C C   . TYR D  1 51  ? -9.006  82.155  148.798 1.00 44.27  ? 51   TYR D C   1 
ATOM   4630  O O   . TYR D  1 51  ? -8.468  82.663  149.786 1.00 45.17  ? 51   TYR D O   1 
ATOM   4631  C CB  . TYR D  1 51  ? -8.523  79.794  148.458 1.00 40.74  ? 51   TYR D CB  1 
ATOM   4632  C CG  . TYR D  1 51  ? -8.804  78.384  148.868 1.00 39.06  ? 51   TYR D CG  1 
ATOM   4633  C CD1 . TYR D  1 51  ? -9.339  77.461  147.959 1.00 37.83  ? 51   TYR D CD1 1 
ATOM   4634  C CD2 . TYR D  1 51  ? -8.545  77.968  150.177 1.00 36.50  ? 51   TYR D CD2 1 
ATOM   4635  C CE1 . TYR D  1 51  ? -9.613  76.145  148.348 1.00 36.47  ? 51   TYR D CE1 1 
ATOM   4636  C CE2 . TYR D  1 51  ? -8.808  76.680  150.576 1.00 37.19  ? 51   TYR D CE2 1 
ATOM   4637  C CZ  . TYR D  1 51  ? -9.347  75.777  149.658 1.00 37.50  ? 51   TYR D CZ  1 
ATOM   4638  O OH  . TYR D  1 51  ? -9.654  74.528  150.079 1.00 39.74  ? 51   TYR D OH  1 
ATOM   4639  N N   . ILE D  1 52  ? -9.122  82.764  147.628 1.00 45.28  ? 52   ILE D N   1 
ATOM   4640  C CA  . ILE D  1 52  ? -8.542  84.065  147.394 1.00 48.13  ? 52   ILE D CA  1 
ATOM   4641  C C   . ILE D  1 52  ? -9.317  85.293  147.864 1.00 51.49  ? 52   ILE D C   1 
ATOM   4642  O O   . ILE D  1 52  ? -10.504 85.429  147.596 1.00 53.38  ? 52   ILE D O   1 
ATOM   4643  C CB  . ILE D  1 52  ? -8.270  84.251  145.918 1.00 46.09  ? 52   ILE D CB  1 
ATOM   4644  C CG1 . ILE D  1 52  ? -7.700  82.965  145.332 1.00 46.70  ? 52   ILE D CG1 1 
ATOM   4645  C CG2 . ILE D  1 52  ? -7.335  85.413  145.732 1.00 45.59  ? 52   ILE D CG2 1 
ATOM   4646  C CD1 . ILE D  1 52  ? -6.481  82.393  146.089 1.00 45.91  ? 52   ILE D CD1 1 
ATOM   4647  N N   . SER D  1 53  ? -8.647  86.193  148.568 1.00 53.59  ? 53   SER D N   1 
ATOM   4648  C CA  . SER D  1 53  ? -9.288  87.416  149.000 1.00 56.62  ? 53   SER D CA  1 
ATOM   4649  C C   . SER D  1 53  ? -8.386  88.568  148.567 1.00 58.36  ? 53   SER D C   1 
ATOM   4650  O O   . SER D  1 53  ? -7.273  88.337  148.105 1.00 59.06  ? 53   SER D O   1 
ATOM   4651  C CB  . SER D  1 53  ? -9.556  87.404  150.523 1.00 57.15  ? 53   SER D CB  1 
ATOM   4652  O OG  . SER D  1 53  ? -8.551  86.789  151.286 1.00 57.92  ? 53   SER D OG  1 
ATOM   4653  N N   . SER D  1 54  ? -8.855  89.804  148.666 1.00 61.08  ? 54   SER D N   1 
ATOM   4654  C CA  . SER D  1 54  ? -8.020  90.930  148.247 1.00 63.58  ? 54   SER D CA  1 
ATOM   4655  C C   . SER D  1 54  ? -8.189  92.196  149.062 1.00 65.68  ? 54   SER D C   1 
ATOM   4656  O O   . SER D  1 54  ? -9.159  92.359  149.793 1.00 65.28  ? 54   SER D O   1 
ATOM   4657  C CB  . SER D  1 54  ? -8.278  91.252  146.789 1.00 63.06  ? 54   SER D CB  1 
ATOM   4658  O OG  . SER D  1 54  ? -9.655  91.404  146.570 1.00 62.68  ? 54   SER D OG  1 
ATOM   4659  N N   . ARG D  1 55  ? -7.218  93.088  148.932 1.00 69.04  ? 55   ARG D N   1 
ATOM   4660  C CA  . ARG D  1 55  ? -7.232  94.357  149.640 1.00 72.42  ? 55   ARG D CA  1 
ATOM   4661  C C   . ARG D  1 55  ? -6.686  95.410  148.703 1.00 74.66  ? 55   ARG D C   1 
ATOM   4662  O O   . ARG D  1 55  ? -6.149  95.082  147.642 1.00 74.77  ? 55   ARG D O   1 
ATOM   4663  C CB  . ARG D  1 55  ? -6.370  94.298  150.909 1.00 72.58  ? 55   ARG D CB  1 
ATOM   4664  C CG  . ARG D  1 55  ? -4.920  93.990  150.647 1.00 74.75  ? 55   ARG D CG  1 
ATOM   4665  C CD  . ARG D  1 55  ? -4.029  94.340  151.823 1.00 76.35  ? 55   ARG D CD  1 
ATOM   4666  N NE  . ARG D  1 55  ? -2.674  93.803  151.660 1.00 79.20  ? 55   ARG D NE  1 
ATOM   4667  C CZ  . ARG D  1 55  ? -2.327  92.532  151.891 1.00 80.28  ? 55   ARG D CZ  1 
ATOM   4668  N NH1 . ARG D  1 55  ? -3.239  91.651  152.304 1.00 80.82  ? 55   ARG D NH1 1 
ATOM   4669  N NH2 . ARG D  1 55  ? -1.066  92.133  151.723 1.00 80.28  ? 55   ARG D NH2 1 
ATOM   4670  N N   . MET D  1 56  ? -6.835  96.674  149.093 1.00 78.19  ? 56   MET D N   1 
ATOM   4671  C CA  . MET D  1 56  ? -6.349  97.796  148.289 1.00 81.10  ? 56   MET D CA  1 
ATOM   4672  C C   . MET D  1 56  ? -4.963  98.239  148.693 1.00 82.58  ? 56   MET D C   1 
ATOM   4673  O O   . MET D  1 56  ? -4.744  98.658  149.828 1.00 83.22  ? 56   MET D O   1 
ATOM   4674  C CB  . MET D  1 56  ? -7.294  98.988  148.389 1.00 82.05  ? 56   MET D CB  1 
ATOM   4675  C CG  . MET D  1 56  ? -8.338  98.995  147.315 1.00 84.25  ? 56   MET D CG  1 
ATOM   4676  S SD  . MET D  1 56  ? -7.560  98.764  145.692 1.00 87.78  ? 56   MET D SD  1 
ATOM   4677  C CE  . MET D  1 56  ? -8.262  97.060  145.177 1.00 85.98  ? 56   MET D CE  1 
ATOM   4678  N N   . ALA D  1 57  ? -4.026  98.138  147.759 1.00 84.37  ? 57   ALA D N   1 
ATOM   4679  C CA  . ALA D  1 57  ? -2.657  98.547  148.025 1.00 86.31  ? 57   ALA D CA  1 
ATOM   4680  C C   . ALA D  1 57  ? -2.646  100.075 148.010 1.00 87.83  ? 57   ALA D C   1 
ATOM   4681  O O   . ALA D  1 57  ? -3.593  100.708 147.516 1.00 88.19  ? 57   ALA D O   1 
ATOM   4682  C CB  . ALA D  1 57  ? -1.729  97.997  146.946 1.00 85.97  ? 57   ALA D CB  1 
ATOM   4683  N N   . GLY D  1 58  ? -1.585  100.662 148.558 1.00 89.01  ? 58   GLY D N   1 
ATOM   4684  C CA  . GLY D  1 58  ? -1.479  102.109 148.577 1.00 89.65  ? 58   GLY D CA  1 
ATOM   4685  C C   . GLY D  1 58  ? -1.581  102.692 147.176 1.00 89.74  ? 58   GLY D C   1 
ATOM   4686  O O   . GLY D  1 58  ? -2.179  103.753 146.987 1.00 90.56  ? 58   GLY D O   1 
ATOM   4687  N N   . GLY D  1 59  ? -1.009  102.002 146.193 1.00 89.12  ? 59   GLY D N   1 
ATOM   4688  C CA  . GLY D  1 59  ? -1.057  102.496 144.827 1.00 88.91  ? 59   GLY D CA  1 
ATOM   4689  C C   . GLY D  1 59  ? -2.433  102.369 144.199 1.00 88.72  ? 59   GLY D C   1 
ATOM   4690  O O   . GLY D  1 59  ? -2.566  102.403 142.964 1.00 88.78  ? 59   GLY D O   1 
ATOM   4691  N N   . GLY D  1 60  ? -3.452  102.233 145.050 1.00 88.13  ? 60   GLY D N   1 
ATOM   4692  C CA  . GLY D  1 60  ? -4.818  102.089 144.577 1.00 87.56  ? 60   GLY D CA  1 
ATOM   4693  C C   . GLY D  1 60  ? -4.913  100.867 143.683 1.00 87.10  ? 60   GLY D C   1 
ATOM   4694  O O   . GLY D  1 60  ? -5.629  100.871 142.677 1.00 87.55  ? 60   GLY D O   1 
ATOM   4695  N N   . GLN D  1 61  ? -4.186  99.813  144.049 1.00 86.07  ? 61   GLN D N   1 
ATOM   4696  C CA  . GLN D  1 61  ? -4.175  98.586  143.258 1.00 84.26  ? 61   GLN D CA  1 
ATOM   4697  C C   . GLN D  1 61  ? -4.443  97.317  144.072 1.00 82.02  ? 61   GLN D C   1 
ATOM   4698  O O   . GLN D  1 61  ? -3.916  97.128  145.177 1.00 81.34  ? 61   GLN D O   1 
ATOM   4699  C CB  . GLN D  1 61  ? -2.843  98.462  142.554 1.00 85.84  ? 61   GLN D CB  1 
ATOM   4700  C CG  . GLN D  1 61  ? -1.687  98.555  143.508 1.00 87.71  ? 61   GLN D CG  1 
ATOM   4701  C CD  . GLN D  1 61  ? -0.381  98.335  142.810 1.00 89.45  ? 61   GLN D CD  1 
ATOM   4702  O OE1 . GLN D  1 61  ? 0.674   98.313  143.445 1.00 91.75  ? 61   GLN D OE1 1 
ATOM   4703  N NE2 . GLN D  1 61  ? -0.435  98.165  141.485 1.00 89.54  ? 61   GLN D NE2 1 
ATOM   4704  N N   . LYS D  1 62  ? -5.273  96.456  143.491 1.00 79.17  ? 62   LYS D N   1 
ATOM   4705  C CA  . LYS D  1 62  ? -5.687  95.199  144.091 1.00 75.17  ? 62   LYS D CA  1 
ATOM   4706  C C   . LYS D  1 62  ? -4.486  94.298  144.403 1.00 72.29  ? 62   LYS D C   1 
ATOM   4707  O O   . LYS D  1 62  ? -3.519  94.200  143.627 1.00 71.45  ? 62   LYS D O   1 
ATOM   4708  C CB  . LYS D  1 62  ? -6.656  94.491  143.134 1.00 75.30  ? 62   LYS D CB  1 
ATOM   4709  C CG  . LYS D  1 62  ? -7.514  93.395  143.735 1.00 74.92  ? 62   LYS D CG  1 
ATOM   4710  C CD  . LYS D  1 62  ? -8.252  92.660  142.617 1.00 74.61  ? 62   LYS D CD  1 
ATOM   4711  C CE  . LYS D  1 62  ? -9.188  91.608  143.168 1.00 75.43  ? 62   LYS D CE  1 
ATOM   4712  N NZ  . LYS D  1 62  ? -9.779  90.755  142.093 1.00 76.11  ? 62   LYS D NZ  1 
ATOM   4713  N N   . VAL D  1 63  ? -4.564  93.658  145.564 1.00 68.44  ? 63   VAL D N   1 
ATOM   4714  C CA  . VAL D  1 63  ? -3.548  92.730  146.019 1.00 64.06  ? 63   VAL D CA  1 
ATOM   4715  C C   . VAL D  1 63  ? -4.252  91.479  146.516 1.00 61.27  ? 63   VAL D C   1 
ATOM   4716  O O   . VAL D  1 63  ? -5.044  91.533  147.448 1.00 60.46  ? 63   VAL D O   1 
ATOM   4717  C CB  . VAL D  1 63  ? -2.743  93.319  147.154 1.00 64.37  ? 63   VAL D CB  1 
ATOM   4718  C CG1 . VAL D  1 63  ? -1.807  92.276  147.724 1.00 63.79  ? 63   VAL D CG1 1 
ATOM   4719  C CG2 . VAL D  1 63  ? -1.978  94.511  146.641 1.00 64.81  ? 63   VAL D CG2 1 
ATOM   4720  N N   . CYS D  1 64  ? -3.975  90.351  145.878 1.00 57.96  ? 64   CYS D N   1 
ATOM   4721  C CA  . CYS D  1 64  ? -4.597  89.103  146.277 1.00 54.32  ? 64   CYS D CA  1 
ATOM   4722  C C   . CYS D  1 64  ? -3.775  88.396  147.308 1.00 52.05  ? 64   CYS D C   1 
ATOM   4723  O O   . CYS D  1 64  ? -2.550  88.502  147.316 1.00 52.82  ? 64   CYS D O   1 
ATOM   4724  C CB  . CYS D  1 64  ? -4.754  88.199  145.080 1.00 54.56  ? 64   CYS D CB  1 
ATOM   4725  S SG  . CYS D  1 64  ? -5.780  88.913  143.831 1.00 56.18  ? 64   CYS D SG  1 
ATOM   4726  N N   . TYR D  1 65  ? -4.450  87.672  148.182 1.00 48.98  ? 65   TYR D N   1 
ATOM   4727  C CA  . TYR D  1 65  ? -3.757  86.929  149.206 1.00 46.95  ? 65   TYR D CA  1 
ATOM   4728  C C   . TYR D  1 65  ? -4.675  85.858  149.784 1.00 45.21  ? 65   TYR D C   1 
ATOM   4729  O O   . TYR D  1 65  ? -5.860  85.831  149.492 1.00 43.91  ? 65   TYR D O   1 
ATOM   4730  C CB  . TYR D  1 65  ? -3.270  87.894  150.280 1.00 46.72  ? 65   TYR D CB  1 
ATOM   4731  C CG  . TYR D  1 65  ? -4.380  88.479  151.111 1.00 48.71  ? 65   TYR D CG  1 
ATOM   4732  C CD1 . TYR D  1 65  ? -4.775  87.881  152.317 1.00 48.40  ? 65   TYR D CD1 1 
ATOM   4733  C CD2 . TYR D  1 65  ? -5.058  89.620  150.688 1.00 48.94  ? 65   TYR D CD2 1 
ATOM   4734  C CE1 . TYR D  1 65  ? -5.804  88.402  153.056 1.00 48.07  ? 65   TYR D CE1 1 
ATOM   4735  C CE2 . TYR D  1 65  ? -6.087  90.158  151.432 1.00 48.52  ? 65   TYR D CE2 1 
ATOM   4736  C CZ  . TYR D  1 65  ? -6.458  89.548  152.608 1.00 49.24  ? 65   TYR D CZ  1 
ATOM   4737  O OH  . TYR D  1 65  ? -7.495  90.094  153.335 1.00 48.98  ? 65   TYR D OH  1 
ATOM   4738  N N   . ILE D  1 66  ? -4.116  84.961  150.584 1.00 44.05  ? 66   ILE D N   1 
ATOM   4739  C CA  . ILE D  1 66  ? -4.894  83.910  151.207 1.00 43.50  ? 66   ILE D CA  1 
ATOM   4740  C C   . ILE D  1 66  ? -4.828  84.173  152.696 1.00 44.44  ? 66   ILE D C   1 
ATOM   4741  O O   . ILE D  1 66  ? -3.752  84.461  153.220 1.00 43.43  ? 66   ILE D O   1 
ATOM   4742  C CB  . ILE D  1 66  ? -4.301  82.520  150.926 1.00 42.61  ? 66   ILE D CB  1 
ATOM   4743  C CG1 . ILE D  1 66  ? -4.134  82.348  149.412 1.00 41.08  ? 66   ILE D CG1 1 
ATOM   4744  C CG2 . ILE D  1 66  ? -5.190  81.430  151.546 1.00 42.69  ? 66   ILE D CG2 1 
ATOM   4745  C CD1 . ILE D  1 66  ? -3.321  81.196  149.004 1.00 40.19  ? 66   ILE D CD1 1 
ATOM   4746  N N   . GLU D  1 67  ? -5.979  84.070  153.366 1.00 45.54  ? 67   GLU D N   1 
ATOM   4747  C CA  . GLU D  1 67  ? -6.040  84.309  154.791 1.00 45.98  ? 67   GLU D CA  1 
ATOM   4748  C C   . GLU D  1 67  ? -5.418  83.174  155.560 1.00 45.42  ? 67   GLU D C   1 
ATOM   4749  O O   . GLU D  1 67  ? -5.621  81.989  155.227 1.00 45.56  ? 67   GLU D O   1 
ATOM   4750  C CB  . GLU D  1 67  ? -7.476  84.554  155.219 1.00 47.31  ? 67   GLU D CB  1 
ATOM   4751  C CG  . GLU D  1 67  ? -7.992  85.879  154.694 1.00 52.47  ? 67   GLU D CG  1 
ATOM   4752  C CD  . GLU D  1 67  ? -9.408  86.180  155.129 1.00 55.63  ? 67   GLU D CD  1 
ATOM   4753  O OE1 . GLU D  1 67  ? -10.331 85.385  154.823 1.00 58.76  ? 67   GLU D OE1 1 
ATOM   4754  O OE2 . GLU D  1 67  ? -9.594  87.221  155.788 1.00 58.46  ? 67   GLU D OE2 1 
ATOM   4755  N N   . GLY D  1 68  ? -4.662  83.560  156.587 1.00 43.69  ? 68   GLY D N   1 
ATOM   4756  C CA  . GLY D  1 68  ? -3.952  82.601  157.400 1.00 42.25  ? 68   GLY D CA  1 
ATOM   4757  C C   . GLY D  1 68  ? -4.731  81.378  157.795 1.00 41.93  ? 68   GLY D C   1 
ATOM   4758  O O   . GLY D  1 68  ? -4.244  80.246  157.672 1.00 42.77  ? 68   GLY D O   1 
ATOM   4759  N N   . HIS D  1 69  ? -5.960  81.576  158.241 1.00 40.84  ? 69   HIS D N   1 
ATOM   4760  C CA  . HIS D  1 69  ? -6.706  80.412  158.692 1.00 39.98  ? 69   HIS D CA  1 
ATOM   4761  C C   . HIS D  1 69  ? -6.975  79.443  157.564 1.00 39.37  ? 69   HIS D C   1 
ATOM   4762  O O   . HIS D  1 69  ? -7.011  78.233  157.785 1.00 40.04  ? 69   HIS D O   1 
ATOM   4763  C CB  . HIS D  1 69  ? -8.004  80.813  159.429 1.00 40.03  ? 69   HIS D CB  1 
ATOM   4764  C CG  . HIS D  1 69  ? -9.062  81.409  158.550 1.00 39.10  ? 69   HIS D CG  1 
ATOM   4765  N ND1 . HIS D  1 69  ? -9.110  82.753  158.238 1.00 39.24  ? 69   HIS D ND1 1 
ATOM   4766  C CD2 . HIS D  1 69  ? -10.058 80.821  157.838 1.00 38.59  ? 69   HIS D CD2 1 
ATOM   4767  C CE1 . HIS D  1 69  ? -10.078 82.965  157.357 1.00 38.19  ? 69   HIS D CE1 1 
ATOM   4768  N NE2 . HIS D  1 69  ? -10.667 81.810  157.096 1.00 38.12  ? 69   HIS D NE2 1 
ATOM   4769  N N   . ARG D  1 70  ? -7.115  79.937  156.342 1.00 38.46  ? 70   ARG D N   1 
ATOM   4770  C CA  . ARG D  1 70  ? -7.371  79.012  155.251 1.00 39.36  ? 70   ARG D CA  1 
ATOM   4771  C C   . ARG D  1 70  ? -6.102  78.197  155.010 1.00 39.17  ? 70   ARG D C   1 
ATOM   4772  O O   . ARG D  1 70  ? -6.156  76.985  154.773 1.00 40.03  ? 70   ARG D O   1 
ATOM   4773  C CB  . ARG D  1 70  ? -7.735  79.761  153.985 1.00 40.89  ? 70   ARG D CB  1 
ATOM   4774  C CG  . ARG D  1 70  ? -8.992  80.560  154.085 1.00 44.30  ? 70   ARG D CG  1 
ATOM   4775  C CD  . ARG D  1 70  ? -10.127 80.047  153.161 1.00 49.13  ? 70   ARG D CD  1 
ATOM   4776  N NE  . ARG D  1 70  ? -11.367 80.799  153.412 1.00 52.45  ? 70   ARG D NE  1 
ATOM   4777  C CZ  . ARG D  1 70  ? -11.462 82.136  153.330 1.00 54.37  ? 70   ARG D CZ  1 
ATOM   4778  N NH1 . ARG D  1 70  ? -10.403 82.861  152.986 1.00 54.90  ? 70   ARG D NH1 1 
ATOM   4779  N NH2 . ARG D  1 70  ? -12.589 82.769  153.655 1.00 55.77  ? 70   ARG D NH2 1 
ATOM   4780  N N   . VAL D  1 71  ? -4.954  78.873  155.095 1.00 37.59  ? 71   VAL D N   1 
ATOM   4781  C CA  . VAL D  1 71  ? -3.688  78.226  154.860 1.00 35.25  ? 71   VAL D CA  1 
ATOM   4782  C C   . VAL D  1 71  ? -3.488  77.158  155.904 1.00 34.67  ? 71   VAL D C   1 
ATOM   4783  O O   . VAL D  1 71  ? -3.114  76.023  155.575 1.00 35.58  ? 71   VAL D O   1 
ATOM   4784  C CB  . VAL D  1 71  ? -2.530  79.231  154.889 1.00 33.81  ? 71   VAL D CB  1 
ATOM   4785  C CG1 . VAL D  1 71  ? -1.195  78.483  154.805 1.00 32.75  ? 71   VAL D CG1 1 
ATOM   4786  C CG2 . VAL D  1 71  ? -2.650  80.174  153.719 1.00 32.59  ? 71   VAL D CG2 1 
ATOM   4787  N N   . ILE D  1 72  ? -3.761  77.502  157.157 1.00 32.79  ? 72   ILE D N   1 
ATOM   4788  C CA  . ILE D  1 72  ? -3.608  76.523  158.222 1.00 31.83  ? 72   ILE D CA  1 
ATOM   4789  C C   . ILE D  1 72  ? -4.423  75.250  157.965 1.00 32.75  ? 72   ILE D C   1 
ATOM   4790  O O   . ILE D  1 72  ? -3.894  74.124  158.133 1.00 31.39  ? 72   ILE D O   1 
ATOM   4791  C CB  . ILE D  1 72  ? -3.964  77.129  159.585 1.00 28.84  ? 72   ILE D CB  1 
ATOM   4792  C CG1 . ILE D  1 72  ? -2.848  78.087  159.992 1.00 28.89  ? 72   ILE D CG1 1 
ATOM   4793  C CG2 . ILE D  1 72  ? -4.084  76.039  160.619 1.00 24.61  ? 72   ILE D CG2 1 
ATOM   4794  C CD1 . ILE D  1 72  ? -3.134  78.918  161.198 1.00 29.02  ? 72   ILE D CD1 1 
ATOM   4795  N N   . ASN D  1 73  ? -5.673  75.424  157.513 1.00 32.71  ? 73   ASN D N   1 
ATOM   4796  C CA  . ASN D  1 73  ? -6.511  74.263  157.244 1.00 34.64  ? 73   ASN D CA  1 
ATOM   4797  C C   . ASN D  1 73  ? -6.077  73.520  156.017 1.00 34.81  ? 73   ASN D C   1 
ATOM   4798  O O   . ASN D  1 73  ? -6.184  72.284  155.968 1.00 35.67  ? 73   ASN D O   1 
ATOM   4799  C CB  . ASN D  1 73  ? -7.984  74.648  157.120 1.00 37.65  ? 73   ASN D CB  1 
ATOM   4800  C CG  . ASN D  1 73  ? -8.639  74.886  158.484 1.00 38.09  ? 73   ASN D CG  1 
ATOM   4801  O OD1 . ASN D  1 73  ? -8.202  74.293  159.516 1.00 37.42  ? 73   ASN D OD1 1 
ATOM   4802  N ND2 . ASN D  1 73  ? -9.675  75.744  158.507 1.00 33.84  ? 73   ASN D ND2 1 
ATOM   4803  N N   . LEU D  1 74  ? -5.584  74.246  155.016 1.00 33.95  ? 74   LEU D N   1 
ATOM   4804  C CA  . LEU D  1 74  ? -5.079  73.561  153.827 1.00 33.40  ? 74   LEU D CA  1 
ATOM   4805  C C   . LEU D  1 74  ? -3.964  72.615  154.298 1.00 33.66  ? 74   LEU D C   1 
ATOM   4806  O O   . LEU D  1 74  ? -3.943  71.438  153.962 1.00 33.19  ? 74   LEU D O   1 
ATOM   4807  C CB  . LEU D  1 74  ? -4.514  74.568  152.824 1.00 32.16  ? 74   LEU D CB  1 
ATOM   4808  C CG  . LEU D  1 74  ? -5.517  75.212  151.867 1.00 31.07  ? 74   LEU D CG  1 
ATOM   4809  C CD1 . LEU D  1 74  ? -4.909  76.439  151.228 1.00 27.48  ? 74   LEU D CD1 1 
ATOM   4810  C CD2 . LEU D  1 74  ? -5.940  74.188  150.821 1.00 29.11  ? 74   LEU D CD2 1 
ATOM   4811  N N   . ALA D  1 75  ? -3.053  73.144  155.099 1.00 34.44  ? 75   ALA D N   1 
ATOM   4812  C CA  . ALA D  1 75  ? -1.939  72.360  155.597 1.00 37.16  ? 75   ALA D CA  1 
ATOM   4813  C C   . ALA D  1 75  ? -2.388  71.145  156.418 1.00 38.49  ? 75   ALA D C   1 
ATOM   4814  O O   . ALA D  1 75  ? -1.923  70.022  156.186 1.00 37.64  ? 75   ALA D O   1 
ATOM   4815  C CB  . ALA D  1 75  ? -1.004  73.252  156.430 1.00 37.11  ? 75   ALA D CB  1 
ATOM   4816  N N   . ASN D  1 76  ? -3.288  71.361  157.376 1.00 39.57  ? 76   ASN D N   1 
ATOM   4817  C CA  . ASN D  1 76  ? -3.744  70.253  158.196 1.00 40.38  ? 76   ASN D CA  1 
ATOM   4818  C C   . ASN D  1 76  ? -4.378  69.176  157.332 1.00 40.29  ? 76   ASN D C   1 
ATOM   4819  O O   . ASN D  1 76  ? -4.133  67.985  157.523 1.00 40.61  ? 76   ASN D O   1 
ATOM   4820  C CB  . ASN D  1 76  ? -4.724  70.731  159.269 1.00 41.17  ? 76   ASN D CB  1 
ATOM   4821  C CG  . ASN D  1 76  ? -4.043  71.506  160.371 1.00 42.17  ? 76   ASN D CG  1 
ATOM   4822  O OD1 . ASN D  1 76  ? -2.982  71.113  160.863 1.00 44.54  ? 76   ASN D OD1 1 
ATOM   4823  N ND2 . ASN D  1 76  ? -4.659  72.601  160.785 1.00 43.55  ? 76   ASN D ND2 1 
ATOM   4824  N N   . GLU D  1 77  ? -5.161  69.583  156.354 1.00 39.50  ? 77   GLU D N   1 
ATOM   4825  C CA  . GLU D  1 77  ? -5.790  68.584  155.532 1.00 41.29  ? 77   GLU D CA  1 
ATOM   4826  C C   . GLU D  1 77  ? -4.822  67.906  154.588 1.00 41.55  ? 77   GLU D C   1 
ATOM   4827  O O   . GLU D  1 77  ? -4.976  66.719  154.272 1.00 43.13  ? 77   GLU D O   1 
ATOM   4828  C CB  . GLU D  1 77  ? -6.966  69.198  154.747 1.00 43.09  ? 77   GLU D CB  1 
ATOM   4829  C CG  . GLU D  1 77  ? -8.139  69.654  155.627 1.00 45.21  ? 77   GLU D CG  1 
ATOM   4830  C CD  . GLU D  1 77  ? -8.674  68.535  156.559 1.00 46.58  ? 77   GLU D CD  1 
ATOM   4831  O OE1 . GLU D  1 77  ? -9.277  68.865  157.623 1.00 46.82  ? 77   GLU D OE1 1 
ATOM   4832  O OE2 . GLU D  1 77  ? -8.474  67.338  156.226 1.00 45.07  ? 77   GLU D OE2 1 
ATOM   4833  N N   . MET D  1 78  ? -3.817  68.651  154.134 1.00 41.27  ? 78   MET D N   1 
ATOM   4834  C CA  . MET D  1 78  ? -2.855  68.104  153.184 1.00 38.68  ? 78   MET D CA  1 
ATOM   4835  C C   . MET D  1 78  ? -1.912  67.127  153.858 1.00 36.82  ? 78   MET D C   1 
ATOM   4836  O O   . MET D  1 78  ? -1.721  66.030  153.344 1.00 36.84  ? 78   MET D O   1 
ATOM   4837  C CB  . MET D  1 78  ? -2.059  69.235  152.514 1.00 38.48  ? 78   MET D CB  1 
ATOM   4838  C CG  . MET D  1 78  ? -1.163  68.784  151.360 1.00 38.32  ? 78   MET D CG  1 
ATOM   4839  S SD  . MET D  1 78  ? -2.047  68.088  149.867 1.00 38.47  ? 78   MET D SD  1 
ATOM   4840  C CE  . MET D  1 78  ? -2.830  69.522  149.209 1.00 34.72  ? 78   MET D CE  1 
ATOM   4841  N N   . PHE D  1 79  ? -1.375  67.492  155.025 1.00 34.82  ? 79   PHE D N   1 
ATOM   4842  C CA  . PHE D  1 79  ? -0.403  66.635  155.718 1.00 33.86  ? 79   PHE D CA  1 
ATOM   4843  C C   . PHE D  1 79  ? -0.859  65.963  156.993 1.00 35.08  ? 79   PHE D C   1 
ATOM   4844  O O   . PHE D  1 79  ? -0.119  65.137  157.526 1.00 34.95  ? 79   PHE D O   1 
ATOM   4845  C CB  . PHE D  1 79  ? 0.855   67.436  156.095 1.00 32.97  ? 79   PHE D CB  1 
ATOM   4846  C CG  . PHE D  1 79  ? 1.446   68.254  154.967 1.00 31.09  ? 79   PHE D CG  1 
ATOM   4847  C CD1 . PHE D  1 79  ? 2.115   67.644  153.927 1.00 30.17  ? 79   PHE D CD1 1 
ATOM   4848  C CD2 . PHE D  1 79  ? 1.309   69.635  154.945 1.00 31.00  ? 79   PHE D CD2 1 
ATOM   4849  C CE1 . PHE D  1 79  ? 2.633   68.394  152.879 1.00 29.26  ? 79   PHE D CE1 1 
ATOM   4850  C CE2 . PHE D  1 79  ? 1.820   70.393  153.898 1.00 30.43  ? 79   PHE D CE2 1 
ATOM   4851  C CZ  . PHE D  1 79  ? 2.480   69.774  152.863 1.00 29.48  ? 79   PHE D CZ  1 
ATOM   4852  N N   . GLY D  1 80  ? -2.037  66.324  157.511 1.00 35.37  ? 80   GLY D N   1 
ATOM   4853  C CA  . GLY D  1 80  ? -2.472  65.739  158.768 1.00 36.24  ? 80   GLY D CA  1 
ATOM   4854  C C   . GLY D  1 80  ? -2.119  66.700  159.895 1.00 37.72  ? 80   GLY D C   1 
ATOM   4855  O O   . GLY D  1 80  ? -1.102  67.398  159.813 1.00 39.18  ? 80   GLY D O   1 
ATOM   4856  N N   . TYR D  1 81  ? -2.927  66.763  160.952 1.00 36.98  ? 81   TYR D N   1 
ATOM   4857  C CA  . TYR D  1 81  ? -2.615  67.706  162.028 1.00 35.73  ? 81   TYR D CA  1 
ATOM   4858  C C   . TYR D  1 81  ? -1.227  67.417  162.588 1.00 35.09  ? 81   TYR D C   1 
ATOM   4859  O O   . TYR D  1 81  ? -0.585  68.287  163.181 1.00 34.37  ? 81   TYR D O   1 
ATOM   4860  C CB  . TYR D  1 81  ? -3.639  67.608  163.168 1.00 34.18  ? 81   TYR D CB  1 
ATOM   4861  C CG  . TYR D  1 81  ? -3.560  66.293  163.948 1.00 31.90  ? 81   TYR D CG  1 
ATOM   4862  C CD1 . TYR D  1 81  ? -4.247  65.171  163.527 1.00 31.11  ? 81   TYR D CD1 1 
ATOM   4863  C CD2 . TYR D  1 81  ? -2.803  66.194  165.106 1.00 30.72  ? 81   TYR D CD2 1 
ATOM   4864  C CE1 . TYR D  1 81  ? -4.182  63.990  164.237 1.00 31.04  ? 81   TYR D CE1 1 
ATOM   4865  C CE2 . TYR D  1 81  ? -2.732  65.035  165.814 1.00 30.90  ? 81   TYR D CE2 1 
ATOM   4866  C CZ  . TYR D  1 81  ? -3.417  63.925  165.379 1.00 31.25  ? 81   TYR D CZ  1 
ATOM   4867  O OH  . TYR D  1 81  ? -3.272  62.737  166.055 1.00 30.38  ? 81   TYR D OH  1 
ATOM   4868  N N   . ASN D  1 82  ? -0.775  66.194  162.413 1.00 34.21  ? 82   ASN D N   1 
ATOM   4869  C CA  . ASN D  1 82  ? 0.520   65.844  162.966 1.00 36.41  ? 82   ASN D CA  1 
ATOM   4870  C C   . ASN D  1 82  ? 1.556   65.604  161.864 1.00 36.62  ? 82   ASN D C   1 
ATOM   4871  O O   . ASN D  1 82  ? 2.558   64.872  162.097 1.00 34.05  ? 82   ASN D O   1 
ATOM   4872  C CB  . ASN D  1 82  ? 0.398   64.559  163.787 1.00 37.20  ? 82   ASN D CB  1 
ATOM   4873  C CG  . ASN D  1 82  ? 0.112   63.347  162.909 1.00 38.64  ? 82   ASN D CG  1 
ATOM   4874  O OD1 . ASN D  1 82  ? 0.398   62.189  163.280 1.00 38.64  ? 82   ASN D OD1 1 
ATOM   4875  N ND2 . ASN D  1 82  ? -0.459  63.609  161.721 1.00 37.92  ? 82   ASN D ND2 1 
ATOM   4876  N N   . GLY D  1 83  ? 1.295   66.190  160.678 1.00 36.60  ? 83   GLY D N   1 
ATOM   4877  C CA  . GLY D  1 83  ? 2.168   65.996  159.521 1.00 35.96  ? 83   GLY D CA  1 
ATOM   4878  C C   . GLY D  1 83  ? 3.069   67.149  159.167 1.00 35.51  ? 83   GLY D C   1 
ATOM   4879  O O   . GLY D  1 83  ? 3.984   66.994  158.372 1.00 34.67  ? 83   GLY D O   1 
ATOM   4880  N N   . TRP D  1 84  ? 2.793   68.315  159.738 1.00 35.68  ? 84   TRP D N   1 
ATOM   4881  C CA  . TRP D  1 84  ? 3.603   69.495  159.481 1.00 34.77  ? 84   TRP D CA  1 
ATOM   4882  C C   . TRP D  1 84  ? 3.742   70.243  160.788 1.00 34.88  ? 84   TRP D C   1 
ATOM   4883  O O   . TRP D  1 84  ? 2.952   70.032  161.708 1.00 35.43  ? 84   TRP D O   1 
ATOM   4884  C CB  . TRP D  1 84  ? 2.953   70.390  158.440 1.00 33.73  ? 84   TRP D CB  1 
ATOM   4885  C CG  . TRP D  1 84  ? 1.709   71.051  158.906 1.00 34.87  ? 84   TRP D CG  1 
ATOM   4886  C CD1 . TRP D  1 84  ? 0.471   70.477  159.076 1.00 36.17  ? 84   TRP D CD1 1 
ATOM   4887  C CD2 . TRP D  1 84  ? 1.555   72.426  159.276 1.00 34.46  ? 84   TRP D CD2 1 
ATOM   4888  N NE1 . TRP D  1 84  ? -0.447  71.419  159.514 1.00 34.22  ? 84   TRP D NE1 1 
ATOM   4889  C CE2 . TRP D  1 84  ? 0.190   72.625  159.639 1.00 32.76  ? 84   TRP D CE2 1 
ATOM   4890  C CE3 . TRP D  1 84  ? 2.428   73.527  159.310 1.00 33.12  ? 84   TRP D CE3 1 
ATOM   4891  C CZ2 . TRP D  1 84  ? -0.306  73.852  160.062 1.00 32.01  ? 84   TRP D CZ2 1 
ATOM   4892  C CZ3 . TRP D  1 84  ? 1.919   74.766  159.733 1.00 32.67  ? 84   TRP D CZ3 1 
ATOM   4893  C CH2 . TRP D  1 84  ? 0.564   74.912  160.090 1.00 31.17  ? 84   TRP D CH2 1 
ATOM   4894  N N   . ALA D  1 85  ? 4.759   71.095  160.872 1.00 33.71  ? 85   ALA D N   1 
ATOM   4895  C CA  . ALA D  1 85  ? 5.037   71.890  162.065 1.00 31.54  ? 85   ALA D CA  1 
ATOM   4896  C C   . ALA D  1 85  ? 5.719   73.171  161.635 1.00 31.25  ? 85   ALA D C   1 
ATOM   4897  O O   . ALA D  1 85  ? 6.165   73.300  160.499 1.00 30.01  ? 85   ALA D O   1 
ATOM   4898  C CB  . ALA D  1 85  ? 5.969   71.129  162.984 1.00 30.09  ? 85   ALA D CB  1 
ATOM   4899  N N   . HIS D  1 86  ? 5.791   74.138  162.532 1.00 30.75  ? 86   HIS D N   1 
ATOM   4900  C CA  . HIS D  1 86  ? 6.516   75.347  162.192 1.00 30.78  ? 86   HIS D CA  1 
ATOM   4901  C C   . HIS D  1 86  ? 7.006   75.982  163.466 1.00 30.59  ? 86   HIS D C   1 
ATOM   4902  O O   . HIS D  1 86  ? 6.404   75.800  164.528 1.00 30.57  ? 86   HIS D O   1 
ATOM   4903  C CB  . HIS D  1 86  ? 5.675   76.339  161.382 1.00 29.82  ? 86   HIS D CB  1 
ATOM   4904  C CG  . HIS D  1 86  ? 4.654   77.075  162.188 1.00 31.35  ? 86   HIS D CG  1 
ATOM   4905  N ND1 . HIS D  1 86  ? 3.497   76.486  162.649 1.00 30.22  ? 86   HIS D ND1 1 
ATOM   4906  C CD2 . HIS D  1 86  ? 4.597   78.366  162.579 1.00 30.99  ? 86   HIS D CD2 1 
ATOM   4907  C CE1 . HIS D  1 86  ? 2.770   77.381  163.283 1.00 30.93  ? 86   HIS D CE1 1 
ATOM   4908  N NE2 . HIS D  1 86  ? 3.414   78.530  163.254 1.00 31.74  ? 86   HIS D NE2 1 
ATOM   4909  N N   . SER D  1 87  ? 8.121   76.694  163.349 1.00 29.63  ? 87   SER D N   1 
ATOM   4910  C CA  . SER D  1 87  ? 8.704   77.377  164.471 1.00 27.51  ? 87   SER D CA  1 
ATOM   4911  C C   . SER D  1 87  ? 9.197   78.733  163.965 1.00 27.28  ? 87   SER D C   1 
ATOM   4912  O O   . SER D  1 87  ? 9.345   78.951  162.759 1.00 25.66  ? 87   SER D O   1 
ATOM   4913  C CB  . SER D  1 87  ? 9.848   76.561  165.012 1.00 27.80  ? 87   SER D CB  1 
ATOM   4914  O OG  . SER D  1 87  ? 10.833  76.394  164.011 1.00 30.74  ? 87   SER D OG  1 
ATOM   4915  N N   . ILE D  1 88  ? 9.405   79.661  164.890 1.00 26.82  ? 88   ILE D N   1 
ATOM   4916  C CA  . ILE D  1 88  ? 9.878   80.985  164.553 1.00 26.39  ? 88   ILE D CA  1 
ATOM   4917  C C   . ILE D  1 88  ? 11.368  80.969  164.842 1.00 27.47  ? 88   ILE D C   1 
ATOM   4918  O O   . ILE D  1 88  ? 11.783  80.948  166.009 1.00 28.75  ? 88   ILE D O   1 
ATOM   4919  C CB  . ILE D  1 88  ? 9.147   82.067  165.424 1.00 25.48  ? 88   ILE D CB  1 
ATOM   4920  C CG1 . ILE D  1 88  ? 7.666   82.082  165.069 1.00 23.72  ? 88   ILE D CG1 1 
ATOM   4921  C CG2 . ILE D  1 88  ? 9.756   83.448  165.179 1.00 23.63  ? 88   ILE D CG2 1 
ATOM   4922  C CD1 . ILE D  1 88  ? 6.781   82.626  166.118 1.00 25.81  ? 88   ILE D CD1 1 
ATOM   4923  N N   . THR D  1 89  ? 12.193  80.984  163.809 1.00 28.29  ? 89   THR D N   1 
ATOM   4924  C CA  . THR D  1 89  ? 13.621  80.957  164.096 1.00 31.43  ? 89   THR D CA  1 
ATOM   4925  C C   . THR D  1 89  ? 14.034  82.294  164.696 1.00 31.48  ? 89   THR D C   1 
ATOM   4926  O O   . THR D  1 89  ? 14.896  82.354  165.579 1.00 29.58  ? 89   THR D O   1 
ATOM   4927  C CB  . THR D  1 89  ? 14.438  80.603  162.859 1.00 31.85  ? 89   THR D CB  1 
ATOM   4928  O OG1 . THR D  1 89  ? 13.957  81.385  161.774 1.00 38.27  ? 89   THR D OG1 1 
ATOM   4929  C CG2 . THR D  1 89  ? 14.230  79.132  162.492 1.00 34.49  ? 89   THR D CG2 1 
ATOM   4930  N N   . GLN D  1 90  ? 13.365  83.357  164.266 1.00 32.05  ? 90   GLN D N   1 
ATOM   4931  C CA  . GLN D  1 90  ? 13.675  84.670  164.800 1.00 32.39  ? 90   GLN D CA  1 
ATOM   4932  C C   . GLN D  1 90  ? 12.655  85.714  164.401 1.00 31.99  ? 90   GLN D C   1 
ATOM   4933  O O   . GLN D  1 90  ? 12.026  85.607  163.355 1.00 31.70  ? 90   GLN D O   1 
ATOM   4934  C CB  . GLN D  1 90  ? 15.027  85.132  164.301 1.00 32.30  ? 90   GLN D CB  1 
ATOM   4935  C CG  . GLN D  1 90  ? 15.532  86.309  165.063 1.00 36.47  ? 90   GLN D CG  1 
ATOM   4936  C CD  . GLN D  1 90  ? 16.743  86.966  164.406 1.00 39.80  ? 90   GLN D CD  1 
ATOM   4937  O OE1 . GLN D  1 90  ? 17.785  86.343  164.237 1.00 41.34  ? 90   GLN D OE1 1 
ATOM   4938  N NE2 . GLN D  1 90  ? 16.600  88.241  164.031 1.00 41.10  ? 90   GLN D NE2 1 
ATOM   4939  N N   . GLN D  1 91  ? 12.470  86.709  165.257 1.00 32.81  ? 91   GLN D N   1 
ATOM   4940  C CA  . GLN D  1 91  ? 11.568  87.830  164.954 1.00 33.99  ? 91   GLN D CA  1 
ATOM   4941  C C   . GLN D  1 91  ? 12.289  89.086  165.349 1.00 33.97  ? 91   GLN D C   1 
ATOM   4942  O O   . GLN D  1 91  ? 12.789  89.243  166.475 1.00 33.85  ? 91   GLN D O   1 
ATOM   4943  C CB  . GLN D  1 91  ? 10.231  87.790  165.691 1.00 34.41  ? 91   GLN D CB  1 
ATOM   4944  C CG  . GLN D  1 91  ? 9.404   88.952  165.182 1.00 36.24  ? 91   GLN D CG  1 
ATOM   4945  C CD  . GLN D  1 91  ? 7.994   88.974  165.695 1.00 37.24  ? 91   GLN D CD  1 
ATOM   4946  O OE1 . GLN D  1 91  ? 7.766   89.155  166.902 1.00 39.93  ? 91   GLN D OE1 1 
ATOM   4947  N NE2 . GLN D  1 91  ? 7.031   88.801  164.792 1.00 34.81  ? 91   GLN D NE2 1 
ATOM   4948  N N   . ASN D  1 92  ? 12.325  90.009  164.423 1.00 34.59  ? 92   ASN D N   1 
ATOM   4949  C CA  . ASN D  1 92  ? 13.062  91.211  164.685 1.00 34.99  ? 92   ASN D CA  1 
ATOM   4950  C C   . ASN D  1 92  ? 12.243  92.427  164.329 1.00 34.32  ? 92   ASN D C   1 
ATOM   4951  O O   . ASN D  1 92  ? 11.646  92.514  163.238 1.00 33.52  ? 92   ASN D O   1 
ATOM   4952  C CB  . ASN D  1 92  ? 14.371  91.183  163.886 1.00 36.99  ? 92   ASN D CB  1 
ATOM   4953  C CG  . ASN D  1 92  ? 15.307  92.298  164.279 1.00 41.02  ? 92   ASN D CG  1 
ATOM   4954  O OD1 . ASN D  1 92  ? 15.229  93.448  163.780 1.00 41.50  ? 92   ASN D OD1 1 
ATOM   4955  N ND2 . ASN D  1 92  ? 16.208  91.980  165.206 1.00 43.95  ? 92   ASN D ND2 1 
ATOM   4956  N N   . VAL D  1 93  ? 12.202  93.361  165.275 1.00 33.25  ? 93   VAL D N   1 
ATOM   4957  C CA  . VAL D  1 93  ? 11.494  94.616  165.070 1.00 31.90  ? 93   VAL D CA  1 
ATOM   4958  C C   . VAL D  1 93  ? 12.448  95.563  164.359 1.00 31.89  ? 93   VAL D C   1 
ATOM   4959  O O   . VAL D  1 93  ? 13.457  95.963  164.907 1.00 31.51  ? 93   VAL D O   1 
ATOM   4960  C CB  . VAL D  1 93  ? 11.047  95.240  166.413 1.00 30.33  ? 93   VAL D CB  1 
ATOM   4961  C CG1 . VAL D  1 93  ? 10.461  96.618  166.159 1.00 29.33  ? 93   VAL D CG1 1 
ATOM   4962  C CG2 . VAL D  1 93  ? 10.027  94.349  167.081 1.00 27.63  ? 93   VAL D CG2 1 
ATOM   4963  N N   . ASP D  1 94  ? 12.124  95.932  163.137 1.00 33.72  ? 94   ASP D N   1 
ATOM   4964  C CA  . ASP D  1 94  ? 12.999  96.808  162.376 1.00 37.49  ? 94   ASP D CA  1 
ATOM   4965  C C   . ASP D  1 94  ? 12.996  98.251  162.829 1.00 41.22  ? 94   ASP D C   1 
ATOM   4966  O O   . ASP D  1 94  ? 14.017  98.929  162.797 1.00 41.31  ? 94   ASP D O   1 
ATOM   4967  C CB  . ASP D  1 94  ? 12.644  96.765  160.899 1.00 36.83  ? 94   ASP D CB  1 
ATOM   4968  C CG  . ASP D  1 94  ? 13.092  95.493  160.242 1.00 37.97  ? 94   ASP D CG  1 
ATOM   4969  O OD1 . ASP D  1 94  ? 12.607  95.168  159.137 1.00 39.09  ? 94   ASP D OD1 1 
ATOM   4970  O OD2 . ASP D  1 94  ? 13.927  94.806  160.847 1.00 38.58  ? 94   ASP D OD2 1 
ATOM   4971  N N   . PHE D  1 95  ? 11.835  98.741  163.237 1.00 45.26  ? 95   PHE D N   1 
ATOM   4972  C CA  . PHE D  1 95  ? 11.758  100.113 163.691 1.00 47.45  ? 95   PHE D CA  1 
ATOM   4973  C C   . PHE D  1 95  ? 10.406  100.443 164.261 1.00 48.82  ? 95   PHE D C   1 
ATOM   4974  O O   . PHE D  1 95  ? 9.401   99.840  163.890 1.00 48.52  ? 95   PHE D O   1 
ATOM   4975  C CB  . PHE D  1 95  ? 12.040  101.036 162.527 1.00 47.10  ? 95   PHE D CB  1 
ATOM   4976  C CG  . PHE D  1 95  ? 11.007  100.960 161.458 1.00 47.53  ? 95   PHE D CG  1 
ATOM   4977  C CD1 . PHE D  1 95  ? 9.845   101.705 161.540 1.00 47.65  ? 95   PHE D CD1 1 
ATOM   4978  C CD2 . PHE D  1 95  ? 11.199  100.147 160.348 1.00 47.43  ? 95   PHE D CD2 1 
ATOM   4979  C CE1 . PHE D  1 95  ? 8.874   101.645 160.516 1.00 47.85  ? 95   PHE D CE1 1 
ATOM   4980  C CE2 . PHE D  1 95  ? 10.244  100.079 159.334 1.00 47.40  ? 95   PHE D CE2 1 
ATOM   4981  C CZ  . PHE D  1 95  ? 9.083   100.831 159.417 1.00 48.09  ? 95   PHE D CZ  1 
ATOM   4982  N N   . VAL D  1 96  ? 10.409  101.393 165.189 1.00 51.05  ? 96   VAL D N   1 
ATOM   4983  C CA  . VAL D  1 96  ? 9.192   101.891 165.813 1.00 53.11  ? 96   VAL D CA  1 
ATOM   4984  C C   . VAL D  1 96  ? 9.351   103.388 165.734 1.00 55.13  ? 96   VAL D C   1 
ATOM   4985  O O   . VAL D  1 96  ? 10.077  103.969 166.527 1.00 55.03  ? 96   VAL D O   1 
ATOM   4986  C CB  . VAL D  1 96  ? 9.082   101.467 167.279 1.00 51.66  ? 96   VAL D CB  1 
ATOM   4987  C CG1 . VAL D  1 96  ? 7.904   102.126 167.910 1.00 51.13  ? 96   VAL D CG1 1 
ATOM   4988  C CG2 . VAL D  1 96  ? 8.901   99.979  167.354 1.00 51.95  ? 96   VAL D CG2 1 
ATOM   4989  N N   . ASP D  1 97  ? 8.710   103.999 164.746 1.00 58.08  ? 97   ASP D N   1 
ATOM   4990  C CA  . ASP D  1 97  ? 8.787   105.447 164.564 1.00 61.16  ? 97   ASP D CA  1 
ATOM   4991  C C   . ASP D  1 97  ? 7.487   106.173 164.942 1.00 63.31  ? 97   ASP D C   1 
ATOM   4992  O O   . ASP D  1 97  ? 6.383   105.689 164.664 1.00 63.02  ? 97   ASP D O   1 
ATOM   4993  C CB  . ASP D  1 97  ? 9.138   105.788 163.107 1.00 61.05  ? 97   ASP D CB  1 
ATOM   4994  C CG  . ASP D  1 97  ? 10.551  105.364 162.716 1.00 60.93  ? 97   ASP D CG  1 
ATOM   4995  O OD1 . ASP D  1 97  ? 11.408  105.167 163.607 1.00 61.21  ? 97   ASP D OD1 1 
ATOM   4996  O OD2 . ASP D  1 97  ? 10.813  105.251 161.503 1.00 60.63  ? 97   ASP D OD2 1 
ATOM   4997  N N   . LEU D  1 98  ? 7.641   107.333 165.582 1.00 66.22  ? 98   LEU D N   1 
ATOM   4998  C CA  . LEU D  1 98  ? 6.526   108.207 165.994 1.00 69.54  ? 98   LEU D CA  1 
ATOM   4999  C C   . LEU D  1 98  ? 6.743   109.467 165.161 1.00 71.94  ? 98   LEU D C   1 
ATOM   5000  O O   . LEU D  1 98  ? 7.672   110.228 165.432 1.00 72.37  ? 98   LEU D O   1 
ATOM   5001  C CB  . LEU D  1 98  ? 6.662   108.550 167.464 1.00 69.83  ? 98   LEU D CB  1 
ATOM   5002  C CG  . LEU D  1 98  ? 5.793   109.675 168.001 1.00 70.00  ? 98   LEU D CG  1 
ATOM   5003  C CD1 . LEU D  1 98  ? 4.403   109.158 168.303 1.00 69.10  ? 98   LEU D CD1 1 
ATOM   5004  C CD2 . LEU D  1 98  ? 6.448   110.232 169.251 1.00 70.24  ? 98   LEU D CD2 1 
ATOM   5005  N N   . ASN D  1 99  ? 5.897   109.705 164.162 1.00 74.99  ? 99   ASN D N   1 
ATOM   5006  C CA  . ASN D  1 99  ? 6.128   110.842 163.273 1.00 78.20  ? 99   ASN D CA  1 
ATOM   5007  C C   . ASN D  1 99  ? 5.143   111.971 163.334 1.00 79.48  ? 99   ASN D C   1 
ATOM   5008  O O   . ASN D  1 99  ? 5.242   112.928 162.562 1.00 80.74  ? 99   ASN D O   1 
ATOM   5009  C CB  . ASN D  1 99  ? 6.225   110.363 161.814 1.00 80.74  ? 99   ASN D CB  1 
ATOM   5010  C CG  . ASN D  1 99  ? 7.568   109.648 161.499 1.00 82.81  ? 99   ASN D CG  1 
ATOM   5011  O OD1 . ASN D  1 99  ? 7.709   108.975 160.455 1.00 82.56  ? 99   ASN D OD1 1 
ATOM   5012  N ND2 . ASN D  1 99  ? 8.560   109.811 162.397 1.00 83.56  ? 99   ASN D ND2 1 
ATOM   5013  N N   . ASN D  1 100 ? 4.195   111.866 164.246 1.00 80.06  ? 100  ASN D N   1 
ATOM   5014  C CA  . ASN D  1 100 ? 3.165   112.879 164.418 1.00 81.05  ? 100  ASN D CA  1 
ATOM   5015  C C   . ASN D  1 100 ? 2.683   112.439 165.786 1.00 80.48  ? 100  ASN D C   1 
ATOM   5016  O O   . ASN D  1 100 ? 3.414   112.552 166.773 1.00 80.67  ? 100  ASN D O   1 
ATOM   5017  C CB  . ASN D  1 100 ? 2.091   112.663 163.351 1.00 83.48  ? 100  ASN D CB  1 
ATOM   5018  C CG  . ASN D  1 100 ? 2.424   111.460 162.418 1.00 85.51  ? 100  ASN D CG  1 
ATOM   5019  O OD1 . ASN D  1 100 ? 3.215   111.574 161.457 1.00 85.99  ? 100  ASN D OD1 1 
ATOM   5020  N ND2 . ASN D  1 100 ? 1.840   110.303 162.726 1.00 86.24  ? 100  ASN D ND2 1 
ATOM   5021  N N   . GLY D  1 101 ? 1.468   111.913 165.843 1.00 79.24  ? 101  GLY D N   1 
ATOM   5022  C CA  . GLY D  1 101 ? 0.957   111.392 167.092 1.00 77.02  ? 101  GLY D CA  1 
ATOM   5023  C C   . GLY D  1 101 ? 0.710   109.933 166.779 1.00 76.14  ? 101  GLY D C   1 
ATOM   5024  O O   . GLY D  1 101 ? 0.097   109.202 167.560 1.00 75.90  ? 101  GLY D O   1 
ATOM   5025  N N   . LYS D  1 102 ? 1.208   109.518 165.611 1.00 74.85  ? 102  LYS D N   1 
ATOM   5026  C CA  . LYS D  1 102 ? 1.039   108.158 165.121 1.00 73.15  ? 102  LYS D CA  1 
ATOM   5027  C C   . LYS D  1 102 ? 2.328   107.349 164.998 1.00 71.30  ? 102  LYS D C   1 
ATOM   5028  O O   . LYS D  1 102 ? 3.419   107.896 164.804 1.00 71.47  ? 102  LYS D O   1 
ATOM   5029  C CB  . LYS D  1 102 ? 0.340   108.199 163.772 1.00 74.07  ? 102  LYS D CB  1 
ATOM   5030  C CG  . LYS D  1 102 ? -0.952  109.000 163.768 1.00 74.85  ? 102  LYS D CG  1 
ATOM   5031  C CD  . LYS D  1 102 ? -1.371  109.275 162.335 1.00 76.15  ? 102  LYS D CD  1 
ATOM   5032  C CE  . LYS D  1 102 ? -2.745  109.897 162.262 1.00 77.05  ? 102  LYS D CE  1 
ATOM   5033  N NZ  . LYS D  1 102 ? -3.170  110.043 160.832 1.00 77.81  ? 102  LYS D NZ  1 
ATOM   5034  N N   . PHE D  1 103 ? 2.176   106.033 165.099 1.00 68.70  ? 103  PHE D N   1 
ATOM   5035  C CA  . PHE D  1 103 ? 3.302   105.122 165.019 1.00 65.66  ? 103  PHE D CA  1 
ATOM   5036  C C   . PHE D  1 103 ? 3.413   104.367 163.717 1.00 63.11  ? 103  PHE D C   1 
ATOM   5037  O O   . PHE D  1 103 ? 2.416   103.978 163.114 1.00 61.59  ? 103  PHE D O   1 
ATOM   5038  C CB  . PHE D  1 103 ? 3.250   104.118 166.166 1.00 65.61  ? 103  PHE D CB  1 
ATOM   5039  C CG  . PHE D  1 103 ? 3.483   104.730 167.513 1.00 65.83  ? 103  PHE D CG  1 
ATOM   5040  C CD1 . PHE D  1 103 ? 2.419   104.978 168.377 1.00 66.48  ? 103  PHE D CD1 1 
ATOM   5041  C CD2 . PHE D  1 103 ? 4.771   105.036 167.930 1.00 65.37  ? 103  PHE D CD2 1 
ATOM   5042  C CE1 . PHE D  1 103 ? 2.638   105.516 169.641 1.00 66.70  ? 103  PHE D CE1 1 
ATOM   5043  C CE2 . PHE D  1 103 ? 5.000   105.573 169.191 1.00 66.43  ? 103  PHE D CE2 1 
ATOM   5044  C CZ  . PHE D  1 103 ? 3.930   105.814 170.050 1.00 66.26  ? 103  PHE D CZ  1 
ATOM   5045  N N   . TYR D  1 104 ? 4.664   104.172 163.313 1.00 61.80  ? 104  TYR D N   1 
ATOM   5046  C CA  . TYR D  1 104 ? 5.025   103.441 162.107 1.00 60.14  ? 104  TYR D CA  1 
ATOM   5047  C C   . TYR D  1 104 ? 5.936   102.316 162.554 1.00 57.10  ? 104  TYR D C   1 
ATOM   5048  O O   . TYR D  1 104 ? 7.005   102.541 163.136 1.00 56.05  ? 104  TYR D O   1 
ATOM   5049  C CB  . TYR D  1 104 ? 5.701   104.386 161.118 1.00 62.79  ? 104  TYR D CB  1 
ATOM   5050  C CG  . TYR D  1 104 ? 4.742   105.489 160.766 1.00 65.46  ? 104  TYR D CG  1 
ATOM   5051  C CD1 . TYR D  1 104 ? 4.547   106.573 161.633 1.00 65.75  ? 104  TYR D CD1 1 
ATOM   5052  C CD2 . TYR D  1 104 ? 3.897   105.361 159.665 1.00 66.77  ? 104  TYR D CD2 1 
ATOM   5053  C CE1 . TYR D  1 104 ? 3.530   107.482 161.433 1.00 66.84  ? 104  TYR D CE1 1 
ATOM   5054  C CE2 . TYR D  1 104 ? 2.873   106.272 159.444 1.00 68.81  ? 104  TYR D CE2 1 
ATOM   5055  C CZ  . TYR D  1 104 ? 2.687   107.331 160.341 1.00 68.89  ? 104  TYR D CZ  1 
ATOM   5056  O OH  . TYR D  1 104 ? 1.617   108.196 160.164 1.00 70.73  ? 104  TYR D OH  1 
ATOM   5057  N N   . VAL D  1 105 ? 5.476   101.097 162.311 1.00 54.02  ? 105  VAL D N   1 
ATOM   5058  C CA  . VAL D  1 105 ? 6.214   99.920  162.731 1.00 51.04  ? 105  VAL D CA  1 
ATOM   5059  C C   . VAL D  1 105 ? 6.410   98.852  161.653 1.00 49.17  ? 105  VAL D C   1 
ATOM   5060  O O   . VAL D  1 105 ? 5.462   98.483  160.941 1.00 48.14  ? 105  VAL D O   1 
ATOM   5061  C CB  . VAL D  1 105 ? 5.512   99.272  163.936 1.00 50.59  ? 105  VAL D CB  1 
ATOM   5062  C CG1 . VAL D  1 105 ? 6.340   98.137  164.474 1.00 49.68  ? 105  VAL D CG1 1 
ATOM   5063  C CG2 . VAL D  1 105 ? 5.274   100.317 165.012 1.00 50.90  ? 105  VAL D CG2 1 
ATOM   5064  N N   . GLY D  1 106 ? 7.651   98.368  161.557 1.00 46.63  ? 106  GLY D N   1 
ATOM   5065  C CA  . GLY D  1 106 ? 8.005   97.313  160.632 1.00 43.61  ? 106  GLY D CA  1 
ATOM   5066  C C   . GLY D  1 106 ? 8.613   96.143  161.382 1.00 42.79  ? 106  GLY D C   1 
ATOM   5067  O O   . GLY D  1 106 ? 9.579   96.317  162.129 1.00 44.21  ? 106  GLY D O   1 
ATOM   5068  N N   . VAL D  1 107 ? 8.048   94.951  161.224 1.00 41.43  ? 107  VAL D N   1 
ATOM   5069  C CA  . VAL D  1 107 ? 8.600   93.771  161.905 1.00 40.61  ? 107  VAL D CA  1 
ATOM   5070  C C   . VAL D  1 107 ? 8.753   92.596  160.938 1.00 40.02  ? 107  VAL D C   1 
ATOM   5071  O O   . VAL D  1 107 ? 7.927   92.409  160.028 1.00 40.70  ? 107  VAL D O   1 
ATOM   5072  C CB  . VAL D  1 107 ? 7.691   93.328  163.068 1.00 41.51  ? 107  VAL D CB  1 
ATOM   5073  C CG1 . VAL D  1 107 ? 8.107   91.961  163.620 1.00 38.64  ? 107  VAL D CG1 1 
ATOM   5074  C CG2 . VAL D  1 107 ? 7.774   94.364  164.170 1.00 41.93  ? 107  VAL D CG2 1 
ATOM   5075  N N   . CYS D  1 108 ? 9.811   91.808  161.106 1.00 36.87  ? 108  CYS D N   1 
ATOM   5076  C CA  . CYS D  1 108 ? 9.990   90.653  160.231 1.00 32.79  ? 108  CYS D CA  1 
ATOM   5077  C C   . CYS D  1 108 ? 10.103  89.416  161.084 1.00 31.90  ? 108  CYS D C   1 
ATOM   5078  O O   . CYS D  1 108 ? 10.562  89.446  162.234 1.00 30.64  ? 108  CYS D O   1 
ATOM   5079  C CB  . CYS D  1 108 ? 11.236  90.806  159.332 1.00 30.62  ? 108  CYS D CB  1 
ATOM   5080  S SG  . CYS D  1 108 ? 12.824  90.778  160.153 1.00 31.27  ? 108  CYS D SG  1 
ATOM   5081  N N   . ALA D  1 109 ? 9.647   88.314  160.528 1.00 32.07  ? 109  ALA D N   1 
ATOM   5082  C CA  . ALA D  1 109 ? 9.756   87.036  161.223 1.00 31.31  ? 109  ALA D CA  1 
ATOM   5083  C C   . ALA D  1 109 ? 10.285  85.959  160.249 1.00 30.47  ? 109  ALA D C   1 
ATOM   5084  O O   . ALA D  1 109 ? 9.940   85.956  159.058 1.00 30.29  ? 109  ALA D O   1 
ATOM   5085  C CB  . ALA D  1 109 ? 8.420   86.626  161.755 1.00 30.25  ? 109  ALA D CB  1 
ATOM   5086  N N   . PHE D  1 110 ? 11.137  85.072  160.750 1.00 28.56  ? 110  PHE D N   1 
ATOM   5087  C CA  . PHE D  1 110 ? 11.668  83.991  159.946 1.00 26.20  ? 110  PHE D CA  1 
ATOM   5088  C C   . PHE D  1 110 ? 10.990  82.759  160.458 1.00 25.85  ? 110  PHE D C   1 
ATOM   5089  O O   . PHE D  1 110 ? 11.210  82.362  161.610 1.00 27.11  ? 110  PHE D O   1 
ATOM   5090  C CB  . PHE D  1 110 ? 13.169  83.891  160.123 1.00 25.72  ? 110  PHE D CB  1 
ATOM   5091  C CG  . PHE D  1 110 ? 13.880  85.067  159.570 1.00 29.08  ? 110  PHE D CG  1 
ATOM   5092  C CD1 . PHE D  1 110 ? 14.062  86.210  160.349 1.00 30.23  ? 110  PHE D CD1 1 
ATOM   5093  C CD2 . PHE D  1 110 ? 14.281  85.097  158.225 1.00 28.75  ? 110  PHE D CD2 1 
ATOM   5094  C CE1 . PHE D  1 110 ? 14.628  87.378  159.798 1.00 30.00  ? 110  PHE D CE1 1 
ATOM   5095  C CE2 . PHE D  1 110 ? 14.844  86.248  157.670 1.00 29.37  ? 110  PHE D CE2 1 
ATOM   5096  C CZ  . PHE D  1 110 ? 15.014  87.395  158.460 1.00 30.24  ? 110  PHE D CZ  1 
ATOM   5097  N N   . VAL D  1 111 ? 10.144  82.170  159.619 1.00 23.77  ? 111  VAL D N   1 
ATOM   5098  C CA  . VAL D  1 111 ? 9.420   80.967  160.005 1.00 24.28  ? 111  VAL D CA  1 
ATOM   5099  C C   . VAL D  1 111 ? 9.906   79.701  159.278 1.00 23.90  ? 111  VAL D C   1 
ATOM   5100  O O   . VAL D  1 111 ? 10.047  79.706  158.074 1.00 24.46  ? 111  VAL D O   1 
ATOM   5101  C CB  . VAL D  1 111 ? 7.945   81.178  159.708 1.00 25.19  ? 111  VAL D CB  1 
ATOM   5102  C CG1 . VAL D  1 111 ? 7.160   79.943  160.075 1.00 24.14  ? 111  VAL D CG1 1 
ATOM   5103  C CG2 . VAL D  1 111 ? 7.446   82.430  160.455 1.00 24.39  ? 111  VAL D CG2 1 
ATOM   5104  N N   . ARG D  1 112 ? 10.190  78.637  160.006 1.00 23.67  ? 112  ARG D N   1 
ATOM   5105  C CA  . ARG D  1 112 ? 10.643  77.394  159.395 1.00 25.11  ? 112  ARG D CA  1 
ATOM   5106  C C   . ARG D  1 112 ? 9.538   76.364  159.556 1.00 27.57  ? 112  ARG D C   1 
ATOM   5107  O O   . ARG D  1 112 ? 9.147   75.994  160.701 1.00 30.47  ? 112  ARG D O   1 
ATOM   5108  C CB  . ARG D  1 112 ? 11.892  76.856  160.096 1.00 25.43  ? 112  ARG D CB  1 
ATOM   5109  C CG  . ARG D  1 112 ? 12.682  75.886  159.255 1.00 26.73  ? 112  ARG D CG  1 
ATOM   5110  C CD  . ARG D  1 112 ? 13.899  75.260  159.940 1.00 26.51  ? 112  ARG D CD  1 
ATOM   5111  N NE  . ARG D  1 112 ? 13.547  73.893  160.281 1.00 30.69  ? 112  ARG D NE  1 
ATOM   5112  C CZ  . ARG D  1 112 ? 14.274  72.810  160.000 1.00 32.82  ? 112  ARG D CZ  1 
ATOM   5113  N NH1 . ARG D  1 112 ? 15.446  72.908  159.369 1.00 33.50  ? 112  ARG D NH1 1 
ATOM   5114  N NH2 . ARG D  1 112 ? 13.787  71.613  160.310 1.00 32.39  ? 112  ARG D NH2 1 
ATOM   5115  N N   . VAL D  1 113 ? 9.016   75.888  158.443 1.00 26.85  ? 113  VAL D N   1 
ATOM   5116  C CA  . VAL D  1 113 ? 8.004   74.866  158.526 1.00 27.18  ? 113  VAL D CA  1 
ATOM   5117  C C   . VAL D  1 113 ? 8.658   73.500  158.195 1.00 26.00  ? 113  VAL D C   1 
ATOM   5118  O O   . VAL D  1 113 ? 9.555   73.425  157.372 1.00 24.94  ? 113  VAL D O   1 
ATOM   5119  C CB  . VAL D  1 113 ? 6.853   75.205  157.585 1.00 26.44  ? 113  VAL D CB  1 
ATOM   5120  C CG1 . VAL D  1 113 ? 7.393   75.592  156.296 1.00 30.50  ? 113  VAL D CG1 1 
ATOM   5121  C CG2 . VAL D  1 113 ? 5.990   73.996  157.345 1.00 30.81  ? 113  VAL D CG2 1 
ATOM   5122  N N   . GLN D  1 114 ? 8.230   72.440  158.868 1.00 26.01  ? 114  GLN D N   1 
ATOM   5123  C CA  . GLN D  1 114 ? 8.775   71.108  158.632 1.00 27.67  ? 114  GLN D CA  1 
ATOM   5124  C C   . GLN D  1 114 ? 7.696   70.006  158.541 1.00 28.68  ? 114  GLN D C   1 
ATOM   5125  O O   . GLN D  1 114 ? 6.628   70.086  159.177 1.00 30.06  ? 114  GLN D O   1 
ATOM   5126  C CB  . GLN D  1 114 ? 9.705   70.766  159.773 1.00 28.81  ? 114  GLN D CB  1 
ATOM   5127  C CG  . GLN D  1 114 ? 10.383  69.467  159.599 1.00 33.39  ? 114  GLN D CG  1 
ATOM   5128  C CD  . GLN D  1 114 ? 11.132  69.067  160.822 1.00 35.32  ? 114  GLN D CD  1 
ATOM   5129  O OE1 . GLN D  1 114 ? 11.691  69.901  161.513 1.00 40.11  ? 114  GLN D OE1 1 
ATOM   5130  N NE2 . GLN D  1 114 ? 11.156  67.786  161.102 1.00 37.88  ? 114  GLN D NE2 1 
ATOM   5131  N N   . LEU D  1 115 ? 7.965   68.973  157.759 1.00 28.35  ? 115  LEU D N   1 
ATOM   5132  C CA  . LEU D  1 115 ? 7.027   67.848  157.618 1.00 29.47  ? 115  LEU D CA  1 
ATOM   5133  C C   . LEU D  1 115 ? 7.477   66.703  158.538 1.00 31.09  ? 115  LEU D C   1 
ATOM   5134  O O   . LEU D  1 115 ? 8.603   66.705  159.023 1.00 31.76  ? 115  LEU D O   1 
ATOM   5135  C CB  . LEU D  1 115 ? 6.981   67.379  156.169 1.00 26.52  ? 115  LEU D CB  1 
ATOM   5136  C CG  . LEU D  1 115 ? 5.978   67.990  155.209 1.00 23.11  ? 115  LEU D CG  1 
ATOM   5137  C CD1 . LEU D  1 115 ? 5.554   69.343  155.582 1.00 20.90  ? 115  LEU D CD1 1 
ATOM   5138  C CD2 . LEU D  1 115 ? 6.580   67.965  153.897 1.00 21.75  ? 115  LEU D CD2 1 
ATOM   5139  N N   . LYS D  1 116 ? 6.615   65.720  158.772 1.00 33.60  ? 116  LYS D N   1 
ATOM   5140  C CA  . LYS D  1 116 ? 6.956   64.648  159.714 1.00 34.31  ? 116  LYS D CA  1 
ATOM   5141  C C   . LYS D  1 116 ? 8.155   63.930  159.186 1.00 34.61  ? 116  LYS D C   1 
ATOM   5142  O O   . LYS D  1 116 ? 8.804   63.176  159.870 1.00 35.42  ? 116  LYS D O   1 
ATOM   5143  C CB  . LYS D  1 116 ? 5.767   63.697  159.878 1.00 34.72  ? 116  LYS D CB  1 
ATOM   5144  C CG  . LYS D  1 116 ? 5.209   63.119  158.583 1.00 35.87  ? 116  LYS D CG  1 
ATOM   5145  C CD  . LYS D  1 116 ? 4.181   62.052  158.874 1.00 37.21  ? 116  LYS D CD  1 
ATOM   5146  C CE  . LYS D  1 116 ? 3.431   61.585  157.614 1.00 39.31  ? 116  LYS D CE  1 
ATOM   5147  N NZ  . LYS D  1 116 ? 2.240   60.720  157.931 1.00 40.35  ? 116  LYS D NZ  1 
ATOM   5148  N N   . ASP D  1 117 ? 8.401   64.222  157.928 1.00 36.00  ? 117  ASP D N   1 
ATOM   5149  C CA  . ASP D  1 117 ? 9.464   63.726  157.068 1.00 35.73  ? 117  ASP D CA  1 
ATOM   5150  C C   . ASP D  1 117 ? 10.847  64.186  157.504 1.00 35.59  ? 117  ASP D C   1 
ATOM   5151  O O   . ASP D  1 117 ? 11.846  63.481  157.392 1.00 34.97  ? 117  ASP D O   1 
ATOM   5152  C CB  . ASP D  1 117 ? 9.223   64.371  155.697 1.00 36.25  ? 117  ASP D CB  1 
ATOM   5153  C CG  . ASP D  1 117 ? 9.851   63.623  154.619 1.00 38.29  ? 117  ASP D CG  1 
ATOM   5154  O OD1 . ASP D  1 117 ? 10.001  64.146  153.504 1.00 39.19  ? 117  ASP D OD1 1 
ATOM   5155  O OD2 . ASP D  1 117 ? 10.190  62.467  154.910 1.00 42.76  ? 117  ASP D OD2 1 
ATOM   5156  N N   . GLY D  1 118 ? 10.890  65.440  157.923 1.00 34.92  ? 118  GLY D N   1 
ATOM   5157  C CA  . GLY D  1 118 ? 12.148  66.056  158.259 1.00 32.93  ? 118  GLY D CA  1 
ATOM   5158  C C   . GLY D  1 118 ? 12.403  67.084  157.145 1.00 32.06  ? 118  GLY D C   1 
ATOM   5159  O O   . GLY D  1 118 ? 13.258  67.950  157.296 1.00 31.43  ? 118  GLY D O   1 
ATOM   5160  N N   . SER D  1 119 ? 11.670  66.998  156.029 1.00 30.04  ? 119  SER D N   1 
ATOM   5161  C CA  . SER D  1 119 ? 11.853  67.981  154.976 1.00 28.09  ? 119  SER D CA  1 
ATOM   5162  C C   . SER D  1 119 ? 11.365  69.314  155.510 1.00 26.56  ? 119  SER D C   1 
ATOM   5163  O O   . SER D  1 119 ? 10.533  69.346  156.415 1.00 25.55  ? 119  SER D O   1 
ATOM   5164  C CB  . SER D  1 119 ? 11.102  67.571  153.709 1.00 28.11  ? 119  SER D CB  1 
ATOM   5165  O OG  . SER D  1 119 ? 9.791   67.261  153.985 1.00 32.48  ? 119  SER D OG  1 
ATOM   5166  N N   . TYR D  1 120 ? 11.866  70.411  154.940 1.00 25.78  ? 120  TYR D N   1 
ATOM   5167  C CA  . TYR D  1 120 ? 11.539  71.747  155.439 1.00 24.60  ? 120  TYR D CA  1 
ATOM   5168  C C   . TYR D  1 120 ? 11.787  72.921  154.509 1.00 25.27  ? 120  TYR D C   1 
ATOM   5169  O O   . TYR D  1 120 ? 12.556  72.828  153.571 1.00 25.94  ? 120  TYR D O   1 
ATOM   5170  C CB  . TYR D  1 120 ? 12.371  71.983  156.700 1.00 23.53  ? 120  TYR D CB  1 
ATOM   5171  C CG  . TYR D  1 120 ? 13.858  71.926  156.414 1.00 21.01  ? 120  TYR D CG  1 
ATOM   5172  C CD1 . TYR D  1 120 ? 14.540  73.057  156.015 1.00 23.33  ? 120  TYR D CD1 1 
ATOM   5173  C CD2 . TYR D  1 120 ? 14.552  70.717  156.432 1.00 19.22  ? 120  TYR D CD2 1 
ATOM   5174  C CE1 . TYR D  1 120 ? 15.859  73.002  155.636 1.00 22.41  ? 120  TYR D CE1 1 
ATOM   5175  C CE2 . TYR D  1 120 ? 15.876  70.641  156.052 1.00 16.98  ? 120  TYR D CE2 1 
ATOM   5176  C CZ  . TYR D  1 120 ? 16.519  71.795  155.656 1.00 19.47  ? 120  TYR D CZ  1 
ATOM   5177  O OH  . TYR D  1 120 ? 17.815  71.796  155.258 1.00 19.58  ? 120  TYR D OH  1 
ATOM   5178  N N   . HIS D  1 121 ? 11.159  74.051  154.817 1.00 27.12  ? 121  HIS D N   1 
ATOM   5179  C CA  . HIS D  1 121 ? 11.322  75.284  154.049 1.00 28.08  ? 121  HIS D CA  1 
ATOM   5180  C C   . HIS D  1 121 ? 11.185  76.463  155.018 1.00 28.26  ? 121  HIS D C   1 
ATOM   5181  O O   . HIS D  1 121 ? 10.350  76.443  155.931 1.00 26.75  ? 121  HIS D O   1 
ATOM   5182  C CB  . HIS D  1 121 ? 10.270  75.401  152.959 1.00 28.71  ? 121  HIS D CB  1 
ATOM   5183  C CG  . HIS D  1 121 ? 10.441  74.429  151.848 1.00 31.50  ? 121  HIS D CG  1 
ATOM   5184  N ND1 . HIS D  1 121 ? 9.499   73.468  151.544 1.00 32.42  ? 121  HIS D ND1 1 
ATOM   5185  C CD2 . HIS D  1 121 ? 11.442  74.271  150.957 1.00 33.32  ? 121  HIS D CD2 1 
ATOM   5186  C CE1 . HIS D  1 121 ? 9.913   72.758  150.513 1.00 33.25  ? 121  HIS D CE1 1 
ATOM   5187  N NE2 . HIS D  1 121 ? 11.090  73.225  150.137 1.00 35.77  ? 121  HIS D NE2 1 
ATOM   5188  N N   . GLU D  1 122 ? 11.995  77.491  154.806 1.00 27.81  ? 122  GLU D N   1 
ATOM   5189  C CA  . GLU D  1 122 ? 11.965  78.648  155.691 1.00 27.58  ? 122  GLU D CA  1 
ATOM   5190  C C   . GLU D  1 122 ? 11.850  79.924  154.879 1.00 25.53  ? 122  GLU D C   1 
ATOM   5191  O O   . GLU D  1 122 ? 12.380  80.017  153.789 1.00 25.74  ? 122  GLU D O   1 
ATOM   5192  C CB  . GLU D  1 122 ? 13.228  78.646  156.550 1.00 27.85  ? 122  GLU D CB  1 
ATOM   5193  C CG  . GLU D  1 122 ? 13.322  79.800  157.495 1.00 32.99  ? 122  GLU D CG  1 
ATOM   5194  C CD  . GLU D  1 122 ? 14.610  79.755  158.354 1.00 36.43  ? 122  GLU D CD  1 
ATOM   5195  O OE1 . GLU D  1 122 ? 15.520  78.934  158.062 1.00 35.40  ? 122  GLU D OE1 1 
ATOM   5196  O OE2 . GLU D  1 122 ? 14.718  80.559  159.307 1.00 37.10  ? 122  GLU D OE2 1 
ATOM   5197  N N   . ASP D  1 123 ? 11.119  80.897  155.376 1.00 24.28  ? 123  ASP D N   1 
ATOM   5198  C CA  . ASP D  1 123 ? 10.989  82.142  154.652 1.00 25.43  ? 123  ASP D CA  1 
ATOM   5199  C C   . ASP D  1 123 ? 10.813  83.324  155.637 1.00 26.74  ? 123  ASP D C   1 
ATOM   5200  O O   . ASP D  1 123 ? 10.769  83.123  156.852 1.00 24.97  ? 123  ASP D O   1 
ATOM   5201  C CB  . ASP D  1 123 ? 9.809   82.065  153.702 1.00 25.10  ? 123  ASP D CB  1 
ATOM   5202  C CG  . ASP D  1 123 ? 10.023  82.870  152.450 1.00 27.19  ? 123  ASP D CG  1 
ATOM   5203  O OD1 . ASP D  1 123 ? 10.599  83.973  152.581 1.00 28.71  ? 123  ASP D OD1 1 
ATOM   5204  O OD2 . ASP D  1 123 ? 9.628   82.408  151.342 1.00 28.52  ? 123  ASP D OD2 1 
ATOM   5205  N N   . VAL D  1 124 ? 10.793  84.552  155.115 1.00 28.20  ? 124  VAL D N   1 
ATOM   5206  C CA  . VAL D  1 124 ? 10.584  85.730  155.953 1.00 30.41  ? 124  VAL D CA  1 
ATOM   5207  C C   . VAL D  1 124 ? 9.187   86.191  155.721 1.00 30.90  ? 124  VAL D C   1 
ATOM   5208  O O   . VAL D  1 124 ? 8.664   86.106  154.609 1.00 31.94  ? 124  VAL D O   1 
ATOM   5209  C CB  . VAL D  1 124 ? 11.340  87.033  155.545 1.00 30.66  ? 124  VAL D CB  1 
ATOM   5210  C CG1 . VAL D  1 124 ? 12.258  87.462  156.622 1.00 29.67  ? 124  VAL D CG1 1 
ATOM   5211  C CG2 . VAL D  1 124 ? 11.974  86.900  154.211 1.00 33.95  ? 124  VAL D CG2 1 
ATOM   5212  N N   . GLY D  1 125 ? 8.617   86.749  156.765 1.00 31.97  ? 125  GLY D N   1 
ATOM   5213  C CA  . GLY D  1 125 ? 7.306   87.344  156.659 1.00 33.10  ? 125  GLY D CA  1 
ATOM   5214  C C   . GLY D  1 125 ? 7.530   88.749  157.184 1.00 34.80  ? 125  GLY D C   1 
ATOM   5215  O O   . GLY D  1 125 ? 8.502   89.015  157.929 1.00 35.31  ? 125  GLY D O   1 
ATOM   5216  N N   . TYR D  1 126 ? 6.666   89.670  156.808 1.00 35.67  ? 126  TYR D N   1 
ATOM   5217  C CA  . TYR D  1 126 ? 6.812   91.021  157.321 1.00 37.17  ? 126  TYR D CA  1 
ATOM   5218  C C   . TYR D  1 126 ? 5.491   91.469  157.918 1.00 38.20  ? 126  TYR D C   1 
ATOM   5219  O O   . TYR D  1 126 ? 4.446   91.029  157.492 1.00 39.08  ? 126  TYR D O   1 
ATOM   5220  C CB  . TYR D  1 126 ? 7.224   91.995  156.220 1.00 36.69  ? 126  TYR D CB  1 
ATOM   5221  C CG  . TYR D  1 126 ? 8.069   93.118  156.765 1.00 36.51  ? 126  TYR D CG  1 
ATOM   5222  C CD1 . TYR D  1 126 ? 9.360   92.888  157.178 1.00 34.50  ? 126  TYR D CD1 1 
ATOM   5223  C CD2 . TYR D  1 126 ? 7.546   94.396  156.939 1.00 37.58  ? 126  TYR D CD2 1 
ATOM   5224  C CE1 . TYR D  1 126 ? 10.109  93.878  157.743 1.00 34.64  ? 126  TYR D CE1 1 
ATOM   5225  C CE2 . TYR D  1 126 ? 8.292   95.415  157.515 1.00 33.01  ? 126  TYR D CE2 1 
ATOM   5226  C CZ  . TYR D  1 126 ? 9.579   95.144  157.914 1.00 34.15  ? 126  TYR D CZ  1 
ATOM   5227  O OH  . TYR D  1 126 ? 10.382  96.119  158.473 1.00 31.11  ? 126  TYR D OH  1 
ATOM   5228  N N   . GLY D  1 127 ? 5.535   92.337  158.915 1.00 40.41  ? 127  GLY D N   1 
ATOM   5229  C CA  . GLY D  1 127 ? 4.316   92.819  159.548 1.00 41.15  ? 127  GLY D CA  1 
ATOM   5230  C C   . GLY D  1 127 ? 4.402   94.328  159.586 1.00 43.37  ? 127  GLY D C   1 
ATOM   5231  O O   . GLY D  1 127 ? 5.442   94.913  159.928 1.00 43.59  ? 127  GLY D O   1 
ATOM   5232  N N   . VAL D  1 128 ? 3.316   94.990  159.231 1.00 45.04  ? 128  VAL D N   1 
ATOM   5233  C CA  . VAL D  1 128 ? 3.345   96.447  159.222 1.00 46.06  ? 128  VAL D CA  1 
ATOM   5234  C C   . VAL D  1 128 ? 2.193   97.098  159.966 1.00 47.66  ? 128  VAL D C   1 
ATOM   5235  O O   . VAL D  1 128 ? 1.088   96.577  160.009 1.00 47.82  ? 128  VAL D O   1 
ATOM   5236  C CB  . VAL D  1 128 ? 3.311   96.965  157.792 1.00 44.49  ? 128  VAL D CB  1 
ATOM   5237  C CG1 . VAL D  1 128 ? 3.411   98.461  157.792 1.00 45.49  ? 128  VAL D CG1 1 
ATOM   5238  C CG2 . VAL D  1 128 ? 4.431   96.353  156.996 1.00 43.78  ? 128  VAL D CG2 1 
ATOM   5239  N N   . SER D  1 129 ? 2.461   98.237  160.578 1.00 51.11  ? 129  SER D N   1 
ATOM   5240  C CA  . SER D  1 129 ? 1.406   98.994  161.256 1.00 54.36  ? 129  SER D CA  1 
ATOM   5241  C C   . SER D  1 129 ? 1.764   100.454 161.064 1.00 56.50  ? 129  SER D C   1 
ATOM   5242  O O   . SER D  1 129 ? 2.808   100.928 161.525 1.00 56.59  ? 129  SER D O   1 
ATOM   5243  C CB  . SER D  1 129 ? 1.317   98.678  162.749 1.00 54.54  ? 129  SER D CB  1 
ATOM   5244  O OG  . SER D  1 129 ? 0.209   99.362  163.313 1.00 55.40  ? 129  SER D OG  1 
ATOM   5245  N N   . GLU D  1 130 ? 0.916   101.164 160.344 1.00 59.13  ? 130  GLU D N   1 
ATOM   5246  C CA  . GLU D  1 130 ? 1.191   102.563 160.095 1.00 62.22  ? 130  GLU D CA  1 
ATOM   5247  C C   . GLU D  1 130 ? -0.035  103.392 160.415 1.00 63.03  ? 130  GLU D C   1 
ATOM   5248  O O   . GLU D  1 130 ? -1.122  103.101 159.928 1.00 63.24  ? 130  GLU D O   1 
ATOM   5249  C CB  . GLU D  1 130 ? 1.607   102.774 158.625 1.00 64.11  ? 130  GLU D CB  1 
ATOM   5250  C CG  . GLU D  1 130 ? 2.959   102.138 158.273 1.00 66.72  ? 130  GLU D CG  1 
ATOM   5251  C CD  . GLU D  1 130 ? 3.351   102.291 156.793 1.00 68.36  ? 130  GLU D CD  1 
ATOM   5252  O OE1 . GLU D  1 130 ? 2.533   101.914 155.913 1.00 69.56  ? 130  GLU D OE1 1 
ATOM   5253  O OE2 . GLU D  1 130 ? 4.483   102.771 156.513 1.00 67.13  ? 130  GLU D OE2 1 
ATOM   5254  N N   . GLY D  1 131 ? 0.135   104.402 161.267 1.00 64.30  ? 131  GLY D N   1 
ATOM   5255  C CA  . GLY D  1 131 ? -0.977  105.280 161.575 1.00 64.92  ? 131  GLY D CA  1 
ATOM   5256  C C   . GLY D  1 131 ? -1.690  105.201 162.908 1.00 65.28  ? 131  GLY D C   1 
ATOM   5257  O O   . GLY D  1 131 ? -2.352  106.163 163.281 1.00 67.29  ? 131  GLY D O   1 
ATOM   5258  N N   . LEU D  1 132 ? -1.595  104.094 163.632 1.00 64.81  ? 132  LEU D N   1 
ATOM   5259  C CA  . LEU D  1 132 ? -2.281  104.009 164.926 1.00 63.73  ? 132  LEU D CA  1 
ATOM   5260  C C   . LEU D  1 132 ? -1.636  104.944 165.939 1.00 64.06  ? 132  LEU D C   1 
ATOM   5261  O O   . LEU D  1 132 ? -0.483  105.371 165.776 1.00 63.57  ? 132  LEU D O   1 
ATOM   5262  C CB  . LEU D  1 132 ? -2.242  102.582 165.474 1.00 63.00  ? 132  LEU D CB  1 
ATOM   5263  C CG  . LEU D  1 132 ? -2.830  101.515 164.572 1.00 62.62  ? 132  LEU D CG  1 
ATOM   5264  C CD1 . LEU D  1 132 ? -2.786  100.208 165.322 1.00 62.62  ? 132  LEU D CD1 1 
ATOM   5265  C CD2 . LEU D  1 132 ? -4.251  101.874 164.171 1.00 61.21  ? 132  LEU D CD2 1 
ATOM   5266  N N   . LYS D  1 133 ? -2.373  105.275 166.994 1.00 64.46  ? 133  LYS D N   1 
ATOM   5267  C CA  . LYS D  1 133 ? -1.805  106.164 167.991 1.00 64.02  ? 133  LYS D CA  1 
ATOM   5268  C C   . LYS D  1 133 ? -1.298  105.347 169.148 1.00 62.68  ? 133  LYS D C   1 
ATOM   5269  O O   . LYS D  1 133 ? -0.571  105.850 169.992 1.00 61.89  ? 133  LYS D O   1 
ATOM   5270  C CB  . LYS D  1 133 ? -2.836  107.191 168.452 1.00 65.16  ? 133  LYS D CB  1 
ATOM   5271  C CG  . LYS D  1 133 ? -3.260  108.146 167.345 1.00 67.45  ? 133  LYS D CG  1 
ATOM   5272  C CD  . LYS D  1 133 ? -3.861  109.457 167.884 1.00 69.18  ? 133  LYS D CD  1 
ATOM   5273  C CE  . LYS D  1 133 ? -4.948  109.205 168.933 1.00 71.34  ? 133  LYS D CE  1 
ATOM   5274  N NZ  . LYS D  1 133 ? -6.009  108.237 168.482 1.00 72.76  ? 133  LYS D NZ  1 
ATOM   5275  N N   . SER D  1 134 ? -1.683  104.074 169.176 1.00 61.79  ? 134  SER D N   1 
ATOM   5276  C CA  . SER D  1 134 ? -1.245  103.165 170.234 1.00 60.76  ? 134  SER D CA  1 
ATOM   5277  C C   . SER D  1 134 ? 0.043   102.438 169.836 1.00 60.27  ? 134  SER D C   1 
ATOM   5278  O O   . SER D  1 134 ? 0.098   101.745 168.810 1.00 60.57  ? 134  SER D O   1 
ATOM   5279  C CB  . SER D  1 134 ? -2.324  102.121 170.538 1.00 60.36  ? 134  SER D CB  1 
ATOM   5280  O OG  . SER D  1 134 ? -1.881  101.267 171.582 1.00 59.20  ? 134  SER D OG  1 
ATOM   5281  N N   . LYS D  1 135 ? 1.083   102.611 170.636 1.00 58.69  ? 135  LYS D N   1 
ATOM   5282  C CA  . LYS D  1 135 ? 2.348   101.947 170.381 1.00 57.58  ? 135  LYS D CA  1 
ATOM   5283  C C   . LYS D  1 135 ? 2.095   100.434 170.542 1.00 57.85  ? 135  LYS D C   1 
ATOM   5284  O O   . LYS D  1 135 ? 2.441   99.631  169.674 1.00 58.03  ? 135  LYS D O   1 
ATOM   5285  C CB  . LYS D  1 135 ? 3.347   102.406 171.412 1.00 56.97  ? 135  LYS D CB  1 
ATOM   5286  C CG  . LYS D  1 135 ? 4.787   102.192 171.093 1.00 56.51  ? 135  LYS D CG  1 
ATOM   5287  C CD  . LYS D  1 135 ? 5.566   102.616 172.320 1.00 56.84  ? 135  LYS D CD  1 
ATOM   5288  C CE  . LYS D  1 135 ? 6.961   103.069 172.015 1.00 56.94  ? 135  LYS D CE  1 
ATOM   5289  N NZ  . LYS D  1 135 ? 7.632   103.661 173.211 1.00 58.28  ? 135  LYS D NZ  1 
ATOM   5290  N N   . ALA D  1 136 ? 1.473   100.055 171.652 1.00 56.61  ? 136  ALA D N   1 
ATOM   5291  C CA  . ALA D  1 136 ? 1.177   98.658  171.918 1.00 55.45  ? 136  ALA D CA  1 
ATOM   5292  C C   . ALA D  1 136 ? 0.374   98.013  170.801 1.00 55.55  ? 136  ALA D C   1 
ATOM   5293  O O   . ALA D  1 136 ? 0.706   96.948  170.326 1.00 56.82  ? 136  ALA D O   1 
ATOM   5294  C CB  . ALA D  1 136 ? 0.427   98.539  173.204 1.00 55.43  ? 136  ALA D CB  1 
ATOM   5295  N N   . LEU D  1 137 ? -0.707  98.640  170.387 1.00 55.62  ? 137  LEU D N   1 
ATOM   5296  C CA  . LEU D  1 137 ? -1.516  98.063  169.323 1.00 55.81  ? 137  LEU D CA  1 
ATOM   5297  C C   . LEU D  1 137 ? -0.733  97.942  168.002 1.00 54.83  ? 137  LEU D C   1 
ATOM   5298  O O   . LEU D  1 137 ? -0.959  97.017  167.230 1.00 55.71  ? 137  LEU D O   1 
ATOM   5299  C CB  . LEU D  1 137 ? -2.790  98.906  169.116 1.00 56.84  ? 137  LEU D CB  1 
ATOM   5300  C CG  . LEU D  1 137 ? -3.987  98.586  170.011 1.00 58.07  ? 137  LEU D CG  1 
ATOM   5301  C CD1 . LEU D  1 137 ? -4.500  97.177  169.707 1.00 60.88  ? 137  LEU D CD1 1 
ATOM   5302  C CD2 . LEU D  1 137 ? -3.572  98.656  171.454 1.00 59.51  ? 137  LEU D CD2 1 
ATOM   5303  N N   . SER D  1 138 ? 0.170   98.883  167.744 1.00 52.85  ? 138  SER D N   1 
ATOM   5304  C CA  . SER D  1 138 ? 0.972   98.879  166.524 1.00 50.62  ? 138  SER D CA  1 
ATOM   5305  C C   . SER D  1 138 ? 1.965   97.712  166.540 1.00 49.54  ? 138  SER D C   1 
ATOM   5306  O O   . SER D  1 138 ? 2.079   96.965  165.572 1.00 48.51  ? 138  SER D O   1 
ATOM   5307  C CB  . SER D  1 138 ? 1.723   100.204 166.390 1.00 50.08  ? 138  SER D CB  1 
ATOM   5308  O OG  . SER D  1 138 ? 0.869   101.254 165.958 1.00 50.98  ? 138  SER D OG  1 
ATOM   5309  N N   . LEU D  1 139 ? 2.687   97.567  167.642 1.00 47.93  ? 139  LEU D N   1 
ATOM   5310  C CA  . LEU D  1 139 ? 3.628   96.488  167.791 1.00 47.18  ? 139  LEU D CA  1 
ATOM   5311  C C   . LEU D  1 139 ? 2.873   95.159  167.692 1.00 47.81  ? 139  LEU D C   1 
ATOM   5312  O O   . LEU D  1 139 ? 3.267   94.264  166.955 1.00 47.94  ? 139  LEU D O   1 
ATOM   5313  C CB  . LEU D  1 139 ? 4.311   96.590  169.144 1.00 46.31  ? 139  LEU D CB  1 
ATOM   5314  C CG  . LEU D  1 139 ? 5.811   96.843  169.233 1.00 45.26  ? 139  LEU D CG  1 
ATOM   5315  C CD1 . LEU D  1 139 ? 6.425   96.832  167.883 1.00 44.97  ? 139  LEU D CD1 1 
ATOM   5316  C CD2 . LEU D  1 139 ? 6.034   98.155  169.906 1.00 46.11  ? 139  LEU D CD2 1 
ATOM   5317  N N   . GLU D  1 140 ? 1.766   95.031  168.409 1.00 48.17  ? 140  GLU D N   1 
ATOM   5318  C CA  . GLU D  1 140 ? 1.024   93.774  168.376 1.00 48.63  ? 140  GLU D CA  1 
ATOM   5319  C C   . GLU D  1 140 ? 0.612   93.368  166.965 1.00 48.03  ? 140  GLU D C   1 
ATOM   5320  O O   . GLU D  1 140 ? 0.755   92.206  166.577 1.00 49.00  ? 140  GLU D O   1 
ATOM   5321  C CB  . GLU D  1 140 ? -0.217  93.834  169.259 1.00 49.71  ? 140  GLU D CB  1 
ATOM   5322  C CG  . GLU D  1 140 ? -1.226  92.767  168.905 1.00 51.98  ? 140  GLU D CG  1 
ATOM   5323  C CD  . GLU D  1 140 ? -2.463  92.808  169.770 1.00 53.72  ? 140  GLU D CD  1 
ATOM   5324  O OE1 . GLU D  1 140 ? -3.083  93.884  169.890 1.00 55.47  ? 140  GLU D OE1 1 
ATOM   5325  O OE2 . GLU D  1 140 ? -2.827  91.758  170.332 1.00 54.74  ? 140  GLU D OE2 1 
ATOM   5326  N N   . LYS D  1 141 ? 0.097   94.315  166.191 1.00 46.34  ? 141  LYS D N   1 
ATOM   5327  C CA  . LYS D  1 141 ? -0.327  94.005  164.838 1.00 43.72  ? 141  LYS D CA  1 
ATOM   5328  C C   . LYS D  1 141 ? 0.865   93.591  163.992 1.00 42.86  ? 141  LYS D C   1 
ATOM   5329  O O   . LYS D  1 141 ? 0.826   92.574  163.300 1.00 43.45  ? 141  LYS D O   1 
ATOM   5330  C CB  . LYS D  1 141 ? -1.003  95.212  164.203 1.00 43.55  ? 141  LYS D CB  1 
ATOM   5331  C CG  . LYS D  1 141 ? -1.358  95.007  162.734 1.00 41.40  ? 141  LYS D CG  1 
ATOM   5332  C CD  . LYS D  1 141 ? -1.927  96.272  162.152 1.00 39.78  ? 141  LYS D CD  1 
ATOM   5333  C CE  . LYS D  1 141 ? -2.483  96.015  160.756 1.00 39.85  ? 141  LYS D CE  1 
ATOM   5334  N NZ  . LYS D  1 141 ? -1.413  95.807  159.743 1.00 37.60  ? 141  LYS D NZ  1 
ATOM   5335  N N   . ALA D  1 142 ? 1.934   94.371  164.053 1.00 40.75  ? 142  ALA D N   1 
ATOM   5336  C CA  . ALA D  1 142 ? 3.101   94.056  163.267 1.00 40.13  ? 142  ALA D CA  1 
ATOM   5337  C C   . ALA D  1 142 ? 3.777   92.719  163.623 1.00 39.75  ? 142  ALA D C   1 
ATOM   5338  O O   . ALA D  1 142 ? 4.178   91.967  162.730 1.00 39.94  ? 142  ALA D O   1 
ATOM   5339  C CB  . ALA D  1 142 ? 4.103   95.189  163.357 1.00 39.63  ? 142  ALA D CB  1 
ATOM   5340  N N   . ARG D  1 143 ? 3.918   92.417  164.904 1.00 38.17  ? 143  ARG D N   1 
ATOM   5341  C CA  . ARG D  1 143 ? 4.543   91.169  165.265 1.00 38.39  ? 143  ARG D CA  1 
ATOM   5342  C C   . ARG D  1 143 ? 3.687   89.978  164.855 1.00 39.27  ? 143  ARG D C   1 
ATOM   5343  O O   . ARG D  1 143 ? 4.206   88.994  164.350 1.00 39.66  ? 143  ARG D O   1 
ATOM   5344  C CB  . ARG D  1 143 ? 4.830   91.097  166.764 1.00 38.25  ? 143  ARG D CB  1 
ATOM   5345  C CG  . ARG D  1 143 ? 5.652   92.251  167.281 1.00 40.47  ? 143  ARG D CG  1 
ATOM   5346  C CD  . ARG D  1 143 ? 6.173   92.041  168.684 1.00 40.33  ? 143  ARG D CD  1 
ATOM   5347  N NE  . ARG D  1 143 ? 7.507   91.510  168.571 1.00 41.82  ? 143  ARG D NE  1 
ATOM   5348  C CZ  . ARG D  1 143 ? 8.530   91.915  169.304 1.00 43.74  ? 143  ARG D CZ  1 
ATOM   5349  N NH1 . ARG D  1 143 ? 8.351   92.843  170.202 1.00 45.18  ? 143  ARG D NH1 1 
ATOM   5350  N NH2 . ARG D  1 143 ? 9.735   91.419  169.117 1.00 44.97  ? 143  ARG D NH2 1 
ATOM   5351  N N   . LYS D  1 144 ? 2.377   90.050  165.050 1.00 40.14  ? 144  LYS D N   1 
ATOM   5352  C CA  . LYS D  1 144 ? 1.554   88.906  164.681 1.00 41.04  ? 144  LYS D CA  1 
ATOM   5353  C C   . LYS D  1 144 ? 1.471   88.701  163.178 1.00 41.45  ? 144  LYS D C   1 
ATOM   5354  O O   . LYS D  1 144 ? 1.520   87.567  162.699 1.00 42.41  ? 144  LYS D O   1 
ATOM   5355  C CB  . LYS D  1 144 ? 0.140   89.007  165.273 1.00 40.28  ? 144  LYS D CB  1 
ATOM   5356  C CG  . LYS D  1 144 ? 0.141   88.988  166.786 1.00 38.79  ? 144  LYS D CG  1 
ATOM   5357  C CD  . LYS D  1 144 ? -1.260  88.955  167.341 1.00 37.18  ? 144  LYS D CD  1 
ATOM   5358  C CE  . LYS D  1 144 ? -1.223  89.018  168.855 1.00 35.05  ? 144  LYS D CE  1 
ATOM   5359  N NZ  . LYS D  1 144 ? -2.566  88.902  169.417 1.00 31.95  ? 144  LYS D NZ  1 
ATOM   5360  N N   . GLU D  1 145 ? 1.356   89.773  162.415 1.00 40.65  ? 145  GLU D N   1 
ATOM   5361  C CA  . GLU D  1 145 ? 1.267   89.567  160.987 1.00 41.28  ? 145  GLU D CA  1 
ATOM   5362  C C   . GLU D  1 145 ? 2.570   89.064  160.397 1.00 40.11  ? 145  GLU D C   1 
ATOM   5363  O O   . GLU D  1 145 ? 2.547   88.287  159.449 1.00 41.92  ? 145  GLU D O   1 
ATOM   5364  C CB  . GLU D  1 145 ? 0.830   90.836  160.289 1.00 43.43  ? 145  GLU D CB  1 
ATOM   5365  C CG  . GLU D  1 145 ? -0.614  91.150  160.576 1.00 47.96  ? 145  GLU D CG  1 
ATOM   5366  C CD  . GLU D  1 145 ? -1.071  92.459  159.965 1.00 51.03  ? 145  GLU D CD  1 
ATOM   5367  O OE1 . GLU D  1 145 ? -0.235  93.175  159.337 1.00 52.14  ? 145  GLU D OE1 1 
ATOM   5368  O OE2 . GLU D  1 145 ? -2.281  92.752  160.126 1.00 53.72  ? 145  GLU D OE2 1 
ATOM   5369  N N   . ALA D  1 146 ? 3.699   89.496  160.950 1.00 37.43  ? 146  ALA D N   1 
ATOM   5370  C CA  . ALA D  1 146 ? 4.985   89.051  160.460 1.00 34.90  ? 146  ALA D CA  1 
ATOM   5371  C C   . ALA D  1 146 ? 5.045   87.514  160.554 1.00 33.89  ? 146  ALA D C   1 
ATOM   5372  O O   . ALA D  1 146 ? 5.412   86.830  159.587 1.00 31.96  ? 146  ALA D O   1 
ATOM   5373  C CB  . ALA D  1 146 ? 6.101   89.686  161.276 1.00 35.09  ? 146  ALA D CB  1 
ATOM   5374  N N   . VAL D  1 147 ? 4.670   86.971  161.708 1.00 32.16  ? 147  VAL D N   1 
ATOM   5375  C CA  . VAL D  1 147 ? 4.676   85.543  161.860 1.00 31.13  ? 147  VAL D CA  1 
ATOM   5376  C C   . VAL D  1 147 ? 3.755   84.823  160.859 1.00 31.89  ? 147  VAL D C   1 
ATOM   5377  O O   . VAL D  1 147 ? 4.185   83.931  160.144 1.00 31.23  ? 147  VAL D O   1 
ATOM   5378  C CB  . VAL D  1 147 ? 4.293   85.159  163.272 1.00 30.02  ? 147  VAL D CB  1 
ATOM   5379  C CG1 . VAL D  1 147 ? 4.123   83.619  163.399 1.00 28.27  ? 147  VAL D CG1 1 
ATOM   5380  C CG2 . VAL D  1 147 ? 5.386   85.646  164.213 1.00 30.34  ? 147  VAL D CG2 1 
ATOM   5381  N N   . THR D  1 148 ? 2.504   85.245  160.774 1.00 32.96  ? 148  THR D N   1 
ATOM   5382  C CA  . THR D  1 148 ? 1.532   84.593  159.888 1.00 32.67  ? 148  THR D CA  1 
ATOM   5383  C C   . THR D  1 148 ? 1.999   84.724  158.450 1.00 33.49  ? 148  THR D C   1 
ATOM   5384  O O   . THR D  1 148 ? 1.954   83.757  157.663 1.00 34.27  ? 148  THR D O   1 
ATOM   5385  C CB  . THR D  1 148 ? 0.093   85.228  160.077 1.00 32.11  ? 148  THR D CB  1 
ATOM   5386  O OG1 . THR D  1 148 ? -0.383  84.943  161.406 1.00 30.45  ? 148  THR D OG1 1 
ATOM   5387  C CG2 . THR D  1 148 ? -0.890  84.687  159.065 1.00 29.49  ? 148  THR D CG2 1 
ATOM   5388  N N   . ASP D  1 149 ? 2.442   85.927  158.096 1.00 32.95  ? 149  ASP D N   1 
ATOM   5389  C CA  . ASP D  1 149 ? 2.931   86.172  156.739 1.00 33.01  ? 149  ASP D CA  1 
ATOM   5390  C C   . ASP D  1 149 ? 4.074   85.188  156.432 1.00 33.41  ? 149  ASP D C   1 
ATOM   5391  O O   . ASP D  1 149 ? 4.097   84.581  155.372 1.00 33.19  ? 149  ASP D O   1 
ATOM   5392  C CB  . ASP D  1 149 ? 3.459   87.600  156.617 1.00 30.54  ? 149  ASP D CB  1 
ATOM   5393  C CG  . ASP D  1 149 ? 3.666   88.010  155.174 1.00 30.42  ? 149  ASP D CG  1 
ATOM   5394  O OD1 . ASP D  1 149 ? 4.721   88.628  154.868 1.00 30.82  ? 149  ASP D OD1 1 
ATOM   5395  O OD2 . ASP D  1 149 ? 2.759   87.715  154.355 1.00 28.83  ? 149  ASP D OD2 1 
ATOM   5396  N N   . GLY D  1 150 ? 5.002   85.041  157.384 1.00 33.14  ? 150  GLY D N   1 
ATOM   5397  C CA  . GLY D  1 150 ? 6.113   84.129  157.205 1.00 33.38  ? 150  GLY D CA  1 
ATOM   5398  C C   . GLY D  1 150 ? 5.662   82.690  157.074 1.00 32.63  ? 150  GLY D C   1 
ATOM   5399  O O   . GLY D  1 150 ? 6.136   81.971  156.214 1.00 33.36  ? 150  GLY D O   1 
ATOM   5400  N N   . LEU D  1 151 ? 4.752   82.268  157.934 1.00 32.30  ? 151  LEU D N   1 
ATOM   5401  C CA  . LEU D  1 151 ? 4.238   80.908  157.880 1.00 31.92  ? 151  LEU D CA  1 
ATOM   5402  C C   . LEU D  1 151 ? 3.627   80.663  156.498 1.00 32.03  ? 151  LEU D C   1 
ATOM   5403  O O   . LEU D  1 151 ? 3.830   79.617  155.892 1.00 33.15  ? 151  LEU D O   1 
ATOM   5404  C CB  . LEU D  1 151 ? 3.179   80.681  158.978 1.00 29.29  ? 151  LEU D CB  1 
ATOM   5405  C CG  . LEU D  1 151 ? 2.451   79.341  158.882 1.00 28.75  ? 151  LEU D CG  1 
ATOM   5406  C CD1 . LEU D  1 151 ? 3.436   78.176  158.883 1.00 27.55  ? 151  LEU D CD1 1 
ATOM   5407  C CD2 . LEU D  1 151 ? 1.504   79.227  160.025 1.00 27.96  ? 151  LEU D CD2 1 
ATOM   5408  N N   . LYS D  1 152 ? 2.891   81.634  155.989 1.00 31.93  ? 152  LYS D N   1 
ATOM   5409  C CA  . LYS D  1 152 ? 2.290   81.436  154.700 1.00 32.06  ? 152  LYS D CA  1 
ATOM   5410  C C   . LYS D  1 152 ? 3.351   81.341  153.598 1.00 31.47  ? 152  LYS D C   1 
ATOM   5411  O O   . LYS D  1 152 ? 3.270   80.461  152.735 1.00 31.43  ? 152  LYS D O   1 
ATOM   5412  C CB  . LYS D  1 152 ? 1.315   82.570  154.386 1.00 34.05  ? 152  LYS D CB  1 
ATOM   5413  C CG  . LYS D  1 152 ? 0.031   82.557  155.194 1.00 36.44  ? 152  LYS D CG  1 
ATOM   5414  C CD  . LYS D  1 152 ? -1.025  83.531  154.609 1.00 38.98  ? 152  LYS D CD  1 
ATOM   5415  C CE  . LYS D  1 152 ? -0.629  84.993  154.810 1.00 39.48  ? 152  LYS D CE  1 
ATOM   5416  N NZ  . LYS D  1 152 ? -1.431  85.882  153.926 1.00 40.63  ? 152  LYS D NZ  1 
ATOM   5417  N N   . ARG D  1 153 ? 4.338   82.233  153.608 1.00 29.09  ? 153  ARG D N   1 
ATOM   5418  C CA  . ARG D  1 153 ? 5.342   82.183  152.562 1.00 28.24  ? 153  ARG D CA  1 
ATOM   5419  C C   . ARG D  1 153 ? 6.140   80.853  152.608 1.00 27.98  ? 153  ARG D C   1 
ATOM   5420  O O   . ARG D  1 153 ? 6.426   80.240  151.576 1.00 26.58  ? 153  ARG D O   1 
ATOM   5421  C CB  . ARG D  1 153 ? 6.298   83.376  152.666 1.00 27.75  ? 153  ARG D CB  1 
ATOM   5422  C CG  . ARG D  1 153 ? 5.652   84.703  152.432 1.00 27.03  ? 153  ARG D CG  1 
ATOM   5423  C CD  . ARG D  1 153 ? 6.705   85.777  152.535 1.00 28.65  ? 153  ARG D CD  1 
ATOM   5424  N NE  . ARG D  1 153 ? 7.089   86.190  151.196 1.00 32.36  ? 153  ARG D NE  1 
ATOM   5425  C CZ  . ARG D  1 153 ? 8.311   86.063  150.684 1.00 32.40  ? 153  ARG D CZ  1 
ATOM   5426  N NH1 . ARG D  1 153 ? 9.280   85.537  151.414 1.00 30.93  ? 153  ARG D NH1 1 
ATOM   5427  N NH2 . ARG D  1 153 ? 8.551   86.443  149.424 1.00 33.46  ? 153  ARG D NH2 1 
ATOM   5428  N N   . ALA D  1 154 ? 6.514   80.410  153.797 1.00 26.38  ? 154  ALA D N   1 
ATOM   5429  C CA  . ALA D  1 154 ? 7.245   79.162  153.916 1.00 26.38  ? 154  ALA D CA  1 
ATOM   5430  C C   . ALA D  1 154 ? 6.423   78.013  153.272 1.00 26.09  ? 154  ALA D C   1 
ATOM   5431  O O   . ALA D  1 154 ? 6.919   77.302  152.389 1.00 23.94  ? 154  ALA D O   1 
ATOM   5432  C CB  . ALA D  1 154 ? 7.542   78.885  155.409 1.00 25.41  ? 154  ALA D CB  1 
ATOM   5433  N N   . LEU D  1 155 ? 5.160   77.878  153.693 1.00 25.65  ? 155  LEU D N   1 
ATOM   5434  C CA  . LEU D  1 155 ? 4.246   76.854  153.179 1.00 25.29  ? 155  LEU D CA  1 
ATOM   5435  C C   . LEU D  1 155 ? 4.105   76.855  151.646 1.00 26.90  ? 155  LEU D C   1 
ATOM   5436  O O   . LEU D  1 155 ? 3.994   75.760  151.046 1.00 25.68  ? 155  LEU D O   1 
ATOM   5437  C CB  . LEU D  1 155 ? 2.875   77.021  153.838 1.00 22.08  ? 155  LEU D CB  1 
ATOM   5438  C CG  . LEU D  1 155 ? 2.378   76.083  154.944 1.00 23.06  ? 155  LEU D CG  1 
ATOM   5439  C CD1 . LEU D  1 155 ? 3.372   74.989  155.339 1.00 24.39  ? 155  LEU D CD1 1 
ATOM   5440  C CD2 . LEU D  1 155 ? 2.055   76.880  156.131 1.00 19.78  ? 155  LEU D CD2 1 
ATOM   5441  N N   . ARG D  1 156 ? 4.120   78.042  151.015 1.00 28.37  ? 156  ARG D N   1 
ATOM   5442  C CA  . ARG D  1 156 ? 3.988   78.131  149.542 1.00 31.80  ? 156  ARG D CA  1 
ATOM   5443  C C   . ARG D  1 156 ? 5.005   77.207  148.850 1.00 32.64  ? 156  ARG D C   1 
ATOM   5444  O O   . ARG D  1 156 ? 4.709   76.650  147.785 1.00 33.63  ? 156  ARG D O   1 
ATOM   5445  C CB  . ARG D  1 156 ? 4.270   79.538  148.970 1.00 34.21  ? 156  ARG D CB  1 
ATOM   5446  C CG  . ARG D  1 156 ? 3.381   80.695  149.382 1.00 38.24  ? 156  ARG D CG  1 
ATOM   5447  C CD  . ARG D  1 156 ? 3.619   81.888  148.432 1.00 41.85  ? 156  ARG D CD  1 
ATOM   5448  N NE  . ARG D  1 156 ? 3.378   83.241  148.983 1.00 45.39  ? 156  ARG D NE  1 
ATOM   5449  C CZ  . ARG D  1 156 ? 2.286   83.646  149.638 1.00 46.12  ? 156  ARG D CZ  1 
ATOM   5450  N NH1 . ARG D  1 156 ? 1.253   82.822  149.882 1.00 48.04  ? 156  ARG D NH1 1 
ATOM   5451  N NH2 . ARG D  1 156 ? 2.219   84.907  150.035 1.00 46.44  ? 156  ARG D NH2 1 
ATOM   5452  N N   . SER D  1 157 ? 6.199   77.069  149.432 1.00 31.53  ? 157  SER D N   1 
ATOM   5453  C CA  . SER D  1 157 ? 7.263   76.252  148.835 1.00 30.26  ? 157  SER D CA  1 
ATOM   5454  C C   . SER D  1 157 ? 6.841   74.822  148.516 1.00 29.62  ? 157  SER D C   1 
ATOM   5455  O O   . SER D  1 157 ? 7.479   74.154  147.701 1.00 29.03  ? 157  SER D O   1 
ATOM   5456  C CB  . SER D  1 157 ? 8.466   76.184  149.781 1.00 31.12  ? 157  SER D CB  1 
ATOM   5457  O OG  . SER D  1 157 ? 8.963   77.466  150.074 1.00 35.01  ? 157  SER D OG  1 
ATOM   5458  N N   . PHE D  1 158 ? 5.791   74.333  149.181 1.00 28.81  ? 158  PHE D N   1 
ATOM   5459  C CA  . PHE D  1 158 ? 5.348   72.951  148.968 1.00 27.54  ? 158  PHE D CA  1 
ATOM   5460  C C   . PHE D  1 158 ? 4.516   72.781  147.715 1.00 27.17  ? 158  PHE D C   1 
ATOM   5461  O O   . PHE D  1 158 ? 4.357   71.668  147.248 1.00 27.61  ? 158  PHE D O   1 
ATOM   5462  C CB  . PHE D  1 158 ? 4.566   72.412  150.177 1.00 24.79  ? 158  PHE D CB  1 
ATOM   5463  C CG  . PHE D  1 158 ? 5.423   72.092  151.363 1.00 24.31  ? 158  PHE D CG  1 
ATOM   5464  C CD1 . PHE D  1 158 ? 5.399   72.900  152.497 1.00 27.05  ? 158  PHE D CD1 1 
ATOM   5465  C CD2 . PHE D  1 158 ? 6.277   71.005  151.344 1.00 23.51  ? 158  PHE D CD2 1 
ATOM   5466  C CE1 . PHE D  1 158 ? 6.220   72.632  153.605 1.00 27.22  ? 158  PHE D CE1 1 
ATOM   5467  C CE2 . PHE D  1 158 ? 7.092   70.725  152.425 1.00 25.13  ? 158  PHE D CE2 1 
ATOM   5468  C CZ  . PHE D  1 158 ? 7.071   71.542  153.570 1.00 26.67  ? 158  PHE D CZ  1 
ATOM   5469  N N   . GLY D  1 159 ? 4.011   73.873  147.151 1.00 26.97  ? 159  GLY D N   1 
ATOM   5470  C CA  . GLY D  1 159 ? 3.223   73.730  145.957 1.00 29.00  ? 159  GLY D CA  1 
ATOM   5471  C C   . GLY D  1 159 ? 2.081   74.704  145.745 1.00 30.86  ? 159  GLY D C   1 
ATOM   5472  O O   . GLY D  1 159 ? 1.809   75.566  146.577 1.00 31.45  ? 159  GLY D O   1 
ATOM   5473  N N   . ASN D  1 160 ? 1.405   74.575  144.606 1.00 32.18  ? 160  ASN D N   1 
ATOM   5474  C CA  . ASN D  1 160 ? 0.305   75.473  144.311 1.00 33.60  ? 160  ASN D CA  1 
ATOM   5475  C C   . ASN D  1 160 ? -0.785  75.356  145.359 1.00 33.34  ? 160  ASN D C   1 
ATOM   5476  O O   . ASN D  1 160 ? -1.282  76.366  145.856 1.00 31.93  ? 160  ASN D O   1 
ATOM   5477  C CB  . ASN D  1 160 ? -0.289  75.178  142.935 1.00 35.24  ? 160  ASN D CB  1 
ATOM   5478  C CG  . ASN D  1 160 ? 0.718   75.343  141.826 1.00 38.60  ? 160  ASN D CG  1 
ATOM   5479  O OD1 . ASN D  1 160 ? 1.471   76.310  141.801 1.00 42.36  ? 160  ASN D OD1 1 
ATOM   5480  N ND2 . ASN D  1 160 ? 0.736   74.409  140.895 1.00 39.66  ? 160  ASN D ND2 1 
ATOM   5481  N N   . ALA D  1 161 ? -1.135  74.122  145.716 1.00 33.18  ? 161  ALA D N   1 
ATOM   5482  C CA  . ALA D  1 161 ? -2.225  73.902  146.667 1.00 32.72  ? 161  ALA D CA  1 
ATOM   5483  C C   . ALA D  1 161 ? -2.031  74.607  148.003 1.00 32.57  ? 161  ALA D C   1 
ATOM   5484  O O   . ALA D  1 161 ? -2.983  74.842  148.723 1.00 31.27  ? 161  ALA D O   1 
ATOM   5485  C CB  . ALA D  1 161 ? -2.427  72.441  146.882 1.00 31.96  ? 161  ALA D CB  1 
ATOM   5486  N N   . LEU D  1 162 ? -0.793  74.931  148.340 1.00 32.23  ? 162  LEU D N   1 
ATOM   5487  C CA  . LEU D  1 162 ? -0.523  75.608  149.591 1.00 32.15  ? 162  LEU D CA  1 
ATOM   5488  C C   . LEU D  1 162 ? -0.251  77.103  149.376 1.00 31.54  ? 162  LEU D C   1 
ATOM   5489  O O   . LEU D  1 162 ? 0.218   77.771  150.281 1.00 32.25  ? 162  LEU D O   1 
ATOM   5490  C CB  . LEU D  1 162 ? 0.650   74.937  150.323 1.00 31.64  ? 162  LEU D CB  1 
ATOM   5491  C CG  . LEU D  1 162 ? 0.265   73.890  151.363 1.00 33.61  ? 162  LEU D CG  1 
ATOM   5492  C CD1 . LEU D  1 162 ? -0.430  74.506  152.540 1.00 35.89  ? 162  LEU D CD1 1 
ATOM   5493  C CD2 . LEU D  1 162 ? -0.720  72.951  150.741 1.00 37.60  ? 162  LEU D CD2 1 
ATOM   5494  N N   . GLY D  1 163 ? -0.527  77.604  148.176 1.00 30.76  ? 163  GLY D N   1 
ATOM   5495  C CA  . GLY D  1 163 ? -0.352  79.010  147.905 1.00 30.62  ? 163  GLY D CA  1 
ATOM   5496  C C   . GLY D  1 163 ? 0.638   79.407  146.835 1.00 32.36  ? 163  GLY D C   1 
ATOM   5497  O O   . GLY D  1 163 ? 0.715   80.584  146.505 1.00 33.58  ? 163  GLY D O   1 
ATOM   5498  N N   . ASN D  1 164 ? 1.379   78.473  146.251 1.00 33.03  ? 164  ASN D N   1 
ATOM   5499  C CA  . ASN D  1 164 ? 2.383   78.913  145.295 1.00 34.45  ? 164  ASN D CA  1 
ATOM   5500  C C   . ASN D  1 164 ? 1.800   79.518  144.030 1.00 35.91  ? 164  ASN D C   1 
ATOM   5501  O O   . ASN D  1 164 ? 2.468   80.234  143.301 1.00 36.56  ? 164  ASN D O   1 
ATOM   5502  C CB  . ASN D  1 164 ? 3.359   77.778  144.989 1.00 33.48  ? 164  ASN D CB  1 
ATOM   5503  C CG  . ASN D  1 164 ? 4.561   78.241  144.159 1.00 33.93  ? 164  ASN D CG  1 
ATOM   5504  O OD1 . ASN D  1 164 ? 4.881   77.650  143.101 1.00 33.63  ? 164  ASN D OD1 1 
ATOM   5505  N ND2 . ASN D  1 164 ? 5.234   79.293  144.620 1.00 31.89  ? 164  ASN D ND2 1 
ATOM   5506  N N   . CYS D  1 165 ? 0.537   79.259  143.759 1.00 37.66  ? 165  CYS D N   1 
ATOM   5507  C CA  . CYS D  1 165 ? -0.038  79.879  142.571 1.00 40.62  ? 165  CYS D CA  1 
ATOM   5508  C C   . CYS D  1 165 ? -0.255  81.409  142.763 1.00 41.70  ? 165  CYS D C   1 
ATOM   5509  O O   . CYS D  1 165 ? 0.029   82.218  141.878 1.00 41.43  ? 165  CYS D O   1 
ATOM   5510  C CB  . CYS D  1 165 ? -1.356  79.189  142.199 1.00 39.33  ? 165  CYS D CB  1 
ATOM   5511  S SG  . CYS D  1 165 ? -2.579  79.045  143.530 1.00 42.94  ? 165  CYS D SG  1 
ATOM   5512  N N   . ILE D  1 166 ? -0.707  81.772  143.954 1.00 43.09  ? 166  ILE D N   1 
ATOM   5513  C CA  . ILE D  1 166 ? -1.044  83.137  144.342 1.00 45.24  ? 166  ILE D CA  1 
ATOM   5514  C C   . ILE D  1 166 ? -0.333  84.352  143.747 1.00 46.54  ? 166  ILE D C   1 
ATOM   5515  O O   . ILE D  1 166 ? -0.922  85.436  143.654 1.00 47.59  ? 166  ILE D O   1 
ATOM   5516  C CB  . ILE D  1 166 ? -1.002  83.250  145.865 1.00 45.50  ? 166  ILE D CB  1 
ATOM   5517  C CG1 . ILE D  1 166 ? -2.342  83.800  146.376 1.00 46.32  ? 166  ILE D CG1 1 
ATOM   5518  C CG2 . ILE D  1 166 ? 0.213   84.068  146.298 1.00 44.43  ? 166  ILE D CG2 1 
ATOM   5519  C CD1 . ILE D  1 166 ? -2.549  85.262  146.140 1.00 48.13  ? 166  ILE D CD1 1 
ATOM   5520  N N   . LEU D  1 167 ? 0.914   84.210  143.342 1.00 47.44  ? 167  LEU D N   1 
ATOM   5521  C CA  . LEU D  1 167 ? 1.599   85.374  142.791 1.00 48.61  ? 167  LEU D CA  1 
ATOM   5522  C C   . LEU D  1 167 ? 1.865   85.250  141.273 1.00 49.18  ? 167  LEU D C   1 
ATOM   5523  O O   . LEU D  1 167 ? 2.508   86.100  140.670 1.00 49.35  ? 167  LEU D O   1 
ATOM   5524  C CB  . LEU D  1 167 ? 2.880   85.649  143.615 1.00 48.64  ? 167  LEU D CB  1 
ATOM   5525  C CG  . LEU D  1 167 ? 3.840   84.497  143.997 1.00 49.24  ? 167  LEU D CG  1 
ATOM   5526  C CD1 . LEU D  1 167 ? 3.101   83.192  144.361 1.00 47.91  ? 167  LEU D CD1 1 
ATOM   5527  C CD2 . LEU D  1 167 ? 4.735   84.209  142.811 1.00 51.02  ? 167  LEU D CD2 1 
ATOM   5528  N N   . ASP D  1 168 ? 1.319   84.196  140.675 1.00 50.12  ? 168  ASP D N   1 
ATOM   5529  C CA  . ASP D  1 168 ? 1.423   83.895  139.250 1.00 51.39  ? 168  ASP D CA  1 
ATOM   5530  C C   . ASP D  1 168 ? 0.404   84.754  138.492 1.00 52.35  ? 168  ASP D C   1 
ATOM   5531  O O   . ASP D  1 168 ? -0.791  84.453  138.479 1.00 54.14  ? 168  ASP D O   1 
ATOM   5532  C CB  . ASP D  1 168 ? 1.115   82.385  139.031 1.00 52.25  ? 168  ASP D CB  1 
ATOM   5533  C CG  . ASP D  1 168 ? 1.119   81.961  137.537 1.00 52.31  ? 168  ASP D CG  1 
ATOM   5534  O OD1 . ASP D  1 168 ? 0.840   80.761  137.237 1.00 50.00  ? 168  ASP D OD1 1 
ATOM   5535  O OD2 . ASP D  1 168 ? 1.406   82.826  136.669 1.00 52.67  ? 168  ASP D OD2 1 
ATOM   5536  N N   . LYS D  1 169 ? 0.864   85.810  137.846 1.00 52.28  ? 169  LYS D N   1 
ATOM   5537  C CA  . LYS D  1 169 ? -0.045  86.681  137.123 1.00 53.29  ? 169  LYS D CA  1 
ATOM   5538  C C   . LYS D  1 169 ? -1.024  86.022  136.160 1.00 52.40  ? 169  LYS D C   1 
ATOM   5539  O O   . LYS D  1 169 ? -2.136  86.506  136.002 1.00 52.70  ? 169  LYS D O   1 
ATOM   5540  C CB  . LYS D  1 169 ? 0.748   87.757  136.397 1.00 55.85  ? 169  LYS D CB  1 
ATOM   5541  C CG  . LYS D  1 169 ? 1.548   88.619  137.371 1.00 60.90  ? 169  LYS D CG  1 
ATOM   5542  C CD  . LYS D  1 169 ? 2.595   89.463  136.665 1.00 64.30  ? 169  LYS D CD  1 
ATOM   5543  C CE  . LYS D  1 169 ? 3.563   90.094  137.661 1.00 66.13  ? 169  LYS D CE  1 
ATOM   5544  N NZ  . LYS D  1 169 ? 4.657   90.884  136.975 1.00 68.42  ? 169  LYS D NZ  1 
ATOM   5545  N N   . ASP D  1 170 ? -0.647  84.928  135.522 1.00 51.22  ? 170  ASP D N   1 
ATOM   5546  C CA  . ASP D  1 170 ? -1.573  84.296  134.602 1.00 51.71  ? 170  ASP D CA  1 
ATOM   5547  C C   . ASP D  1 170 ? -2.706  83.597  135.341 1.00 51.88  ? 170  ASP D C   1 
ATOM   5548  O O   . ASP D  1 170 ? -3.800  83.415  134.799 1.00 52.27  ? 170  ASP D O   1 
ATOM   5549  C CB  . ASP D  1 170 ? -0.850  83.279  133.732 1.00 53.62  ? 170  ASP D CB  1 
ATOM   5550  C CG  . ASP D  1 170 ? 0.212   83.905  132.868 1.00 53.82  ? 170  ASP D CG  1 
ATOM   5551  O OD1 . ASP D  1 170 ? -0.111  84.884  132.161 1.00 53.92  ? 170  ASP D OD1 1 
ATOM   5552  O OD2 . ASP D  1 170 ? 1.357   83.408  132.893 1.00 55.31  ? 170  ASP D OD2 1 
ATOM   5553  N N   . TYR D  1 171 ? -2.432  83.188  136.574 1.00 51.13  ? 171  TYR D N   1 
ATOM   5554  C CA  . TYR D  1 171 ? -3.418  82.513  137.401 1.00 50.01  ? 171  TYR D CA  1 
ATOM   5555  C C   . TYR D  1 171 ? -4.369  83.579  137.903 1.00 51.02  ? 171  TYR D C   1 
ATOM   5556  O O   . TYR D  1 171 ? -5.576  83.414  137.880 1.00 51.02  ? 171  TYR D O   1 
ATOM   5557  C CB  . TYR D  1 171 ? -2.716  81.826  138.576 1.00 47.38  ? 171  TYR D CB  1 
ATOM   5558  C CG  . TYR D  1 171 ? -3.600  81.530  139.761 1.00 44.76  ? 171  TYR D CG  1 
ATOM   5559  C CD1 . TYR D  1 171 ? -4.455  80.442  139.765 1.00 43.57  ? 171  TYR D CD1 1 
ATOM   5560  C CD2 . TYR D  1 171 ? -3.593  82.364  140.872 1.00 44.38  ? 171  TYR D CD2 1 
ATOM   5561  C CE1 . TYR D  1 171 ? -5.288  80.188  140.841 1.00 43.37  ? 171  TYR D CE1 1 
ATOM   5562  C CE2 . TYR D  1 171 ? -4.418  82.124  141.953 1.00 44.11  ? 171  TYR D CE2 1 
ATOM   5563  C CZ  . TYR D  1 171 ? -5.273  81.031  141.937 1.00 43.46  ? 171  TYR D CZ  1 
ATOM   5564  O OH  . TYR D  1 171 ? -6.129  80.782  143.004 1.00 43.07  ? 171  TYR D OH  1 
ATOM   5565  N N   . LEU D  1 172 ? -3.814  84.685  138.362 1.00 52.59  ? 172  LEU D N   1 
ATOM   5566  C CA  . LEU D  1 172 ? -4.639  85.770  138.871 1.00 54.49  ? 172  LEU D CA  1 
ATOM   5567  C C   . LEU D  1 172 ? -5.570  86.237  137.762 1.00 56.17  ? 172  LEU D C   1 
ATOM   5568  O O   . LEU D  1 172 ? -6.772  86.423  137.972 1.00 57.45  ? 172  LEU D O   1 
ATOM   5569  C CB  . LEU D  1 172 ? -3.768  86.938  139.328 1.00 52.80  ? 172  LEU D CB  1 
ATOM   5570  C CG  . LEU D  1 172 ? -2.940  86.632  140.567 1.00 52.62  ? 172  LEU D CG  1 
ATOM   5571  C CD1 . LEU D  1 172 ? -2.032  87.784  140.918 1.00 52.55  ? 172  LEU D CD1 1 
ATOM   5572  C CD2 . LEU D  1 172 ? -3.868  86.341  141.685 1.00 52.37  ? 172  LEU D CD2 1 
ATOM   5573  N N   . ARG D  1 173 ? -5.006  86.406  136.579 1.00 57.24  ? 173  ARG D N   1 
ATOM   5574  C CA  . ARG D  1 173 ? -5.743  86.863  135.420 1.00 58.69  ? 173  ARG D CA  1 
ATOM   5575  C C   . ARG D  1 173 ? -6.932  85.970  135.135 1.00 59.61  ? 173  ARG D C   1 
ATOM   5576  O O   . ARG D  1 173 ? -8.054  86.442  134.983 1.00 60.20  ? 173  ARG D O   1 
ATOM   5577  C CB  . ARG D  1 173 ? -4.796  86.889  134.229 1.00 59.63  ? 173  ARG D CB  1 
ATOM   5578  C CG  . ARG D  1 173 ? -5.202  87.761  133.065 1.00 61.61  ? 173  ARG D CG  1 
ATOM   5579  C CD  . ARG D  1 173 ? -3.936  88.191  132.278 1.00 62.90  ? 173  ARG D CD  1 
ATOM   5580  N NE  . ARG D  1 173 ? -3.056  87.070  131.935 1.00 63.86  ? 173  ARG D NE  1 
ATOM   5581  C CZ  . ARG D  1 173 ? -3.436  85.990  131.245 1.00 65.01  ? 173  ARG D CZ  1 
ATOM   5582  N NH1 . ARG D  1 173 ? -4.691  85.859  130.798 1.00 65.30  ? 173  ARG D NH1 1 
ATOM   5583  N NH2 . ARG D  1 173 ? -2.562  85.022  131.021 1.00 64.87  ? 173  ARG D NH2 1 
ATOM   5584  N N   . SER D  1 174 ? -6.701  84.670  135.072 1.00 60.35  ? 174  SER D N   1 
ATOM   5585  C CA  . SER D  1 174 ? -7.798  83.783  134.772 1.00 62.12  ? 174  SER D CA  1 
ATOM   5586  C C   . SER D  1 174 ? -8.753  83.604  135.953 1.00 64.06  ? 174  SER D C   1 
ATOM   5587  O O   . SER D  1 174 ? -9.821  83.005  135.808 1.00 65.20  ? 174  SER D O   1 
ATOM   5588  C CB  . SER D  1 174 ? -7.260  82.446  134.277 1.00 61.35  ? 174  SER D CB  1 
ATOM   5589  O OG  . SER D  1 174 ? -7.563  81.423  135.188 1.00 61.69  ? 174  SER D OG  1 
ATOM   5590  N N   . LEU D  1 175 ? -8.386  84.134  137.118 1.00 65.33  ? 175  LEU D N   1 
ATOM   5591  C CA  . LEU D  1 175 ? -9.243  84.049  138.305 1.00 66.18  ? 175  LEU D CA  1 
ATOM   5592  C C   . LEU D  1 175 ? -10.271 85.154  138.174 1.00 68.76  ? 175  LEU D C   1 
ATOM   5593  O O   . LEU D  1 175 ? -11.422 84.992  138.553 1.00 68.86  ? 175  LEU D O   1 
ATOM   5594  C CB  . LEU D  1 175 ? -8.447  84.296  139.582 1.00 64.11  ? 175  LEU D CB  1 
ATOM   5595  C CG  . LEU D  1 175 ? -8.257  83.223  140.653 1.00 61.81  ? 175  LEU D CG  1 
ATOM   5596  C CD1 . LEU D  1 175 ? -7.729  83.905  141.890 1.00 61.16  ? 175  LEU D CD1 1 
ATOM   5597  C CD2 . LEU D  1 175 ? -9.530  82.519  140.980 1.00 61.23  ? 175  LEU D CD2 1 
ATOM   5598  N N   . ASN D  1 176 ? -9.828  86.293  137.654 1.00 71.93  ? 176  ASN D N   1 
ATOM   5599  C CA  . ASN D  1 176 ? -10.692 87.445  137.433 1.00 75.21  ? 176  ASN D CA  1 
ATOM   5600  C C   . ASN D  1 176 ? -11.799 87.154  136.446 1.00 76.34  ? 176  ASN D C   1 
ATOM   5601  O O   . ASN D  1 176 ? -12.889 87.680  136.559 1.00 77.55  ? 176  ASN D O   1 
ATOM   5602  C CB  . ASN D  1 176 ? -9.876  88.621  136.921 1.00 77.65  ? 176  ASN D CB  1 
ATOM   5603  C CG  . ASN D  1 176 ? -9.562  89.611  138.015 1.00 81.42  ? 176  ASN D CG  1 
ATOM   5604  O OD1 . ASN D  1 176 ? -10.433 90.395  138.406 1.00 82.96  ? 176  ASN D OD1 1 
ATOM   5605  N ND2 . ASN D  1 176 ? -8.320  89.577  138.539 1.00 83.93  ? 176  ASN D ND2 1 
ATOM   5606  N N   . LYS D  1 177 ? -11.510 86.315  135.469 1.00 77.91  ? 177  LYS D N   1 
ATOM   5607  C CA  . LYS D  1 177 ? -12.489 85.954  134.460 1.00 80.05  ? 177  LYS D CA  1 
ATOM   5608  C C   . LYS D  1 177 ? -13.507 84.954  134.998 1.00 81.41  ? 177  LYS D C   1 
ATOM   5609  O O   . LYS D  1 177 ? -14.073 84.149  134.245 1.00 81.76  ? 177  LYS D O   1 
ATOM   5610  C CB  . LYS D  1 177 ? -11.783 85.361  133.232 1.00 81.00  ? 177  LYS D CB  1 
ATOM   5611  C CG  . LYS D  1 177 ? -10.860 86.341  132.513 1.00 81.73  ? 177  LYS D CG  1 
ATOM   5612  C CD  . LYS D  1 177 ? -10.070 85.688  131.371 1.00 82.78  ? 177  LYS D CD  1 
ATOM   5613  C CE  . LYS D  1 177 ? -9.077  86.686  130.748 1.00 83.55  ? 177  LYS D CE  1 
ATOM   5614  N NZ  . LYS D  1 177 ? -8.183  86.080  129.721 1.00 83.96  ? 177  LYS D NZ  1 
ATOM   5615  N N   . LEU D  1 178 ? -13.722 84.968  136.305 1.00 82.78  ? 178  LEU D N   1 
ATOM   5616  C CA  . LEU D  1 178 ? -14.702 84.060  136.868 1.00 84.65  ? 178  LEU D CA  1 
ATOM   5617  C C   . LEU D  1 178 ? -15.842 84.852  137.463 1.00 87.06  ? 178  LEU D C   1 
ATOM   5618  O O   . LEU D  1 178 ? -15.692 86.050  137.767 1.00 87.15  ? 178  LEU D O   1 
ATOM   5619  C CB  . LEU D  1 178 ? -14.077 83.151  137.918 1.00 83.42  ? 178  LEU D CB  1 
ATOM   5620  C CG  . LEU D  1 178 ? -13.127 82.117  137.314 1.00 83.16  ? 178  LEU D CG  1 
ATOM   5621  C CD1 . LEU D  1 178 ? -12.977 80.934  138.272 1.00 82.05  ? 178  LEU D CD1 1 
ATOM   5622  C CD2 . LEU D  1 178 ? -13.669 81.649  135.958 1.00 81.97  ? 178  LEU D CD2 1 
ATOM   5623  N N   . PRO D  1 179 ? -17.005 84.203  137.633 1.00 89.06  ? 179  PRO D N   1 
ATOM   5624  C CA  . PRO D  1 179 ? -18.179 84.879  138.195 1.00 91.07  ? 179  PRO D CA  1 
ATOM   5625  C C   . PRO D  1 179 ? -17.899 85.242  139.648 1.00 93.12  ? 179  PRO D C   1 
ATOM   5626  O O   . PRO D  1 179 ? -17.863 84.330  140.484 1.00 94.27  ? 179  PRO D O   1 
ATOM   5627  C CB  . PRO D  1 179 ? -19.280 83.821  138.072 1.00 90.68  ? 179  PRO D CB  1 
ATOM   5628  C CG  . PRO D  1 179 ? -18.746 82.837  137.046 1.00 89.66  ? 179  PRO D CG  1 
ATOM   5629  C CD  . PRO D  1 179 ? -17.293 82.780  137.393 1.00 89.07  ? 179  PRO D CD  1 
ATOM   5630  N N   . ARG D  1 180 ? -17.683 86.537  139.946 1.00 94.53  ? 180  ARG D N   1 
ATOM   5631  C CA  . ARG D  1 180 ? -17.395 86.988  141.322 1.00 96.10  ? 180  ARG D CA  1 
ATOM   5632  C C   . ARG D  1 180 ? -18.087 85.986  142.238 1.00 96.66  ? 180  ARG D C   1 
ATOM   5633  O O   . ARG D  1 180 ? -19.224 85.591  141.957 1.00 97.08  ? 180  ARG D O   1 
ATOM   5634  C CB  . ARG D  1 180 ? -17.973 88.376  141.566 1.00 97.45  ? 180  ARG D CB  1 
ATOM   5635  C CG  . ARG D  1 180 ? -19.455 88.419  141.295 1.00 99.55  ? 180  ARG D CG  1 
ATOM   5636  C CD  . ARG D  1 180 ? -20.134 89.643  141.865 1.00 101.62 ? 180  ARG D CD  1 
ATOM   5637  N NE  . ARG D  1 180 ? -21.241 90.031  140.993 1.00 104.13 ? 180  ARG D NE  1 
ATOM   5638  C CZ  . ARG D  1 180 ? -22.152 90.954  141.286 1.00 105.57 ? 180  ARG D CZ  1 
ATOM   5639  N NH1 . ARG D  1 180 ? -22.100 91.594  142.450 1.00 106.46 ? 180  ARG D NH1 1 
ATOM   5640  N NH2 . ARG D  1 180 ? -23.109 91.247  140.409 1.00 105.83 ? 180  ARG D NH2 1 
ATOM   5641  N N   . GLN D  1 181 ? -17.439 85.554  143.318 1.00 96.70  ? 181  GLN D N   1 
ATOM   5642  C CA  . GLN D  1 181 ? -18.089 84.545  144.167 1.00 96.71  ? 181  GLN D CA  1 
ATOM   5643  C C   . GLN D  1 181 ? -18.822 85.036  145.441 1.00 96.59  ? 181  GLN D C   1 
ATOM   5644  O O   . GLN D  1 181 ? -18.306 85.871  146.211 1.00 96.49  ? 181  GLN D O   1 
ATOM   5645  C CB  . GLN D  1 181 ? -17.076 83.424  144.501 1.00 96.08  ? 181  GLN D CB  1 
ATOM   5646  C CG  . GLN D  1 181 ? -16.050 83.751  145.569 1.00 94.45  ? 181  GLN D CG  1 
ATOM   5647  C CD  . GLN D  1 181 ? -16.178 82.824  146.761 1.00 93.66  ? 181  GLN D CD  1 
ATOM   5648  O OE1 . GLN D  1 181 ? -16.151 81.601  146.609 1.00 92.94  ? 181  GLN D OE1 1 
ATOM   5649  N NE2 . GLN D  1 181 ? -16.324 83.400  147.955 1.00 93.29  ? 181  GLN D NE2 1 
ATOM   5650  N N   . LEU D  1 182 ? -20.030 84.503  145.639 1.00 96.06  ? 182  LEU D N   1 
ATOM   5651  C CA  . LEU D  1 182 ? -20.877 84.861  146.782 1.00 96.30  ? 182  LEU D CA  1 
ATOM   5652  C C   . LEU D  1 182 ? -20.438 84.263  148.134 1.00 96.61  ? 182  LEU D C   1 
ATOM   5653  O O   . LEU D  1 182 ? -20.512 83.043  148.333 1.00 96.76  ? 182  LEU D O   1 
ATOM   5654  C CB  . LEU D  1 182 ? -22.334 84.463  146.487 1.00 95.56  ? 182  LEU D CB  1 
ATOM   5655  C CG  . LEU D  1 182 ? -22.662 83.006  146.133 1.00 94.86  ? 182  LEU D CG  1 
ATOM   5656  C CD1 . LEU D  1 182 ? -24.188 82.825  146.117 1.00 93.55  ? 182  LEU D CD1 1 
ATOM   5657  C CD2 . LEU D  1 182 ? -22.015 82.634  144.787 1.00 94.31  ? 182  LEU D CD2 1 
ATOM   5658  N N   . PRO D  1 183 ? -19.995 85.123  149.085 1.00 96.61  ? 183  PRO D N   1 
ATOM   5659  C CA  . PRO D  1 183 ? -19.524 84.778  150.441 1.00 96.49  ? 183  PRO D CA  1 
ATOM   5660  C C   . PRO D  1 183 ? -20.366 83.722  151.144 1.00 96.38  ? 183  PRO D C   1 
ATOM   5661  O O   . PRO D  1 183 ? -21.180 84.055  152.001 1.00 96.35  ? 183  PRO D O   1 
ATOM   5662  C CB  . PRO D  1 183 ? -19.572 86.113  151.167 1.00 96.36  ? 183  PRO D CB  1 
ATOM   5663  C CG  . PRO D  1 183 ? -19.178 87.067  150.083 1.00 96.39  ? 183  PRO D CG  1 
ATOM   5664  C CD  . PRO D  1 183 ? -19.982 86.587  148.895 1.00 96.34  ? 183  PRO D CD  1 
ATOM   5665  N N   . LEU D  1 184 ? -20.132 82.455  150.798 1.00 96.38  ? 184  LEU D N   1 
ATOM   5666  C CA  . LEU D  1 184 ? -20.895 81.335  151.341 1.00 96.70  ? 184  LEU D CA  1 
ATOM   5667  C C   . LEU D  1 184 ? -20.961 81.180  152.869 1.00 96.77  ? 184  LEU D C   1 
ATOM   5668  O O   . LEU D  1 184 ? -20.021 81.529  153.598 1.00 96.72  ? 184  LEU D O   1 
ATOM   5669  C CB  . LEU D  1 184 ? -20.447 80.024  150.668 1.00 97.17  ? 184  LEU D CB  1 
ATOM   5670  C CG  . LEU D  1 184 ? -20.882 79.830  149.191 1.00 97.41  ? 184  LEU D CG  1 
ATOM   5671  C CD1 . LEU D  1 184 ? -20.313 78.506  148.618 1.00 97.13  ? 184  LEU D CD1 1 
ATOM   5672  C CD2 . LEU D  1 184 ? -22.412 79.836  149.100 1.00 96.41  ? 184  LEU D CD2 1 
ATOM   5673  N N   . GLU D  1 185 ? -22.116 80.663  153.314 1.00 96.69  ? 185  GLU D N   1 
ATOM   5674  C CA  . GLU D  1 185 ? -22.486 80.445  154.722 1.00 95.95  ? 185  GLU D CA  1 
ATOM   5675  C C   . GLU D  1 185 ? -21.801 79.285  155.425 1.00 94.55  ? 185  GLU D C   1 
ATOM   5676  O O   . GLU D  1 185 ? -21.464 78.275  154.802 1.00 94.20  ? 185  GLU D O   1 
ATOM   5677  C CB  . GLU D  1 185 ? -24.009 80.221  154.849 1.00 96.76  ? 185  GLU D CB  1 
ATOM   5678  C CG  . GLU D  1 185 ? -24.906 81.399  154.447 1.00 98.64  ? 185  GLU D CG  1 
ATOM   5679  C CD  . GLU D  1 185 ? -24.594 82.697  155.213 1.00 100.05 ? 185  GLU D CD  1 
ATOM   5680  O OE1 . GLU D  1 185 ? -24.472 82.650  156.473 1.00 100.57 ? 185  GLU D OE1 1 
ATOM   5681  O OE2 . GLU D  1 185 ? -24.479 83.763  154.544 1.00 99.36  ? 185  GLU D OE2 1 
ATOM   5682  N N   . VAL D  1 186 ? -21.639 79.435  156.737 1.00 92.56  ? 186  VAL D N   1 
ATOM   5683  C CA  . VAL D  1 186 ? -21.030 78.411  157.578 1.00 90.57  ? 186  VAL D CA  1 
ATOM   5684  C C   . VAL D  1 186 ? -22.173 77.716  158.371 1.00 89.42  ? 186  VAL D C   1 
ATOM   5685  O O   . VAL D  1 186 ? -22.961 78.396  159.049 1.00 89.07  ? 186  VAL D O   1 
ATOM   5686  C CB  . VAL D  1 186 ? -20.021 79.068  158.556 1.00 90.25  ? 186  VAL D CB  1 
ATOM   5687  C CG1 . VAL D  1 186 ? -19.188 78.015  159.237 1.00 90.26  ? 186  VAL D CG1 1 
ATOM   5688  C CG2 . VAL D  1 186 ? -19.142 80.038  157.812 1.00 89.27  ? 186  VAL D CG2 1 
ATOM   5689  N N   . ASP D  1 187 ? -22.275 76.383  158.280 1.00 87.52  ? 187  ASP D N   1 
ATOM   5690  C CA  . ASP D  1 187 ? -23.340 75.647  158.982 1.00 85.58  ? 187  ASP D CA  1 
ATOM   5691  C C   . ASP D  1 187 ? -22.923 75.226  160.382 1.00 83.95  ? 187  ASP D C   1 
ATOM   5692  O O   . ASP D  1 187 ? -22.302 74.175  160.557 1.00 83.06  ? 187  ASP D O   1 
ATOM   5693  C CB  . ASP D  1 187 ? -23.757 74.390  158.206 1.00 86.62  ? 187  ASP D CB  1 
ATOM   5694  C CG  . ASP D  1 187 ? -24.956 73.665  158.856 1.00 88.02  ? 187  ASP D CG  1 
ATOM   5695  O OD1 . ASP D  1 187 ? -25.167 72.452  158.581 1.00 88.24  ? 187  ASP D OD1 1 
ATOM   5696  O OD2 . ASP D  1 187 ? -25.694 74.315  159.638 1.00 87.79  ? 187  ASP D OD2 1 
ATOM   5697  N N   . LEU D  1 188 ? -23.306 76.031  161.373 1.00 81.94  ? 188  LEU D N   1 
ATOM   5698  C CA  . LEU D  1 188 ? -22.969 75.784  162.773 1.00 80.47  ? 188  LEU D CA  1 
ATOM   5699  C C   . LEU D  1 188 ? -23.798 74.714  163.477 1.00 79.69  ? 188  LEU D C   1 
ATOM   5700  O O   . LEU D  1 188 ? -23.655 74.505  164.682 1.00 80.18  ? 188  LEU D O   1 
ATOM   5701  C CB  . LEU D  1 188 ? -23.080 77.086  163.549 1.00 79.60  ? 188  LEU D CB  1 
ATOM   5702  C CG  . LEU D  1 188 ? -22.219 78.125  162.848 1.00 79.73  ? 188  LEU D CG  1 
ATOM   5703  C CD1 . LEU D  1 188 ? -22.451 79.511  163.449 1.00 79.87  ? 188  LEU D CD1 1 
ATOM   5704  C CD2 . LEU D  1 188 ? -20.757 77.679  162.949 1.00 79.33  ? 188  LEU D CD2 1 
ATOM   5705  N N   . THR D  1 189 ? -24.648 74.025  162.729 1.00 77.98  ? 189  THR D N   1 
ATOM   5706  C CA  . THR D  1 189 ? -25.495 73.002  163.312 1.00 75.99  ? 189  THR D CA  1 
ATOM   5707  C C   . THR D  1 189 ? -24.716 71.979  164.120 1.00 74.25  ? 189  THR D C   1 
ATOM   5708  O O   . THR D  1 189 ? -24.923 71.823  165.333 1.00 73.53  ? 189  THR D O   1 
ATOM   5709  C CB  . THR D  1 189 ? -26.276 72.274  162.219 1.00 76.75  ? 189  THR D CB  1 
ATOM   5710  O OG1 . THR D  1 189 ? -27.180 73.199  161.586 1.00 76.01  ? 189  THR D OG1 1 
ATOM   5711  C CG2 . THR D  1 189 ? -27.038 71.095  162.818 1.00 76.17  ? 189  THR D CG2 1 
ATOM   5712  N N   . LYS D  1 190 ? -23.804 71.299  163.439 1.00 71.93  ? 190  LYS D N   1 
ATOM   5713  C CA  . LYS D  1 190 ? -23.007 70.268  164.071 1.00 69.27  ? 190  LYS D CA  1 
ATOM   5714  C C   . LYS D  1 190 ? -21.758 70.781  164.777 1.00 66.82  ? 190  LYS D C   1 
ATOM   5715  O O   . LYS D  1 190 ? -20.787 70.051  164.954 1.00 65.40  ? 190  LYS D O   1 
ATOM   5716  C CB  . LYS D  1 190 ? -22.630 69.236  163.022 1.00 70.41  ? 190  LYS D CB  1 
ATOM   5717  C CG  . LYS D  1 190 ? -23.828 68.588  162.345 1.00 71.95  ? 190  LYS D CG  1 
ATOM   5718  C CD  . LYS D  1 190 ? -23.393 67.320  161.592 1.00 73.45  ? 190  LYS D CD  1 
ATOM   5719  C CE  . LYS D  1 190 ? -24.243 66.092  161.962 1.00 74.07  ? 190  LYS D CE  1 
ATOM   5720  N NZ  . LYS D  1 190 ? -23.663 64.830  161.381 1.00 75.11  ? 190  LYS D NZ  1 
ATOM   5721  N N   . ALA D  1 191 ? -21.796 72.036  165.193 1.00 65.15  ? 191  ALA D N   1 
ATOM   5722  C CA  . ALA D  1 191 ? -20.669 72.668  165.874 1.00 64.45  ? 191  ALA D CA  1 
ATOM   5723  C C   . ALA D  1 191 ? -20.316 72.110  167.243 1.00 64.22  ? 191  ALA D C   1 
ATOM   5724  O O   . ALA D  1 191 ? -21.183 71.948  168.085 1.00 65.42  ? 191  ALA D O   1 
ATOM   5725  C CB  . ALA D  1 191 ? -20.932 74.148  166.008 1.00 64.46  ? 191  ALA D CB  1 
ATOM   5726  N N   . LYS D  1 192 ? -19.033 71.848  167.478 1.00 63.89  ? 192  LYS D N   1 
ATOM   5727  C CA  . LYS D  1 192 ? -18.576 71.340  168.774 1.00 62.90  ? 192  LYS D CA  1 
ATOM   5728  C C   . LYS D  1 192 ? -19.173 72.220  169.886 1.00 63.14  ? 192  LYS D C   1 
ATOM   5729  O O   . LYS D  1 192 ? -18.941 73.443  169.925 1.00 61.86  ? 192  LYS D O   1 
ATOM   5730  C CB  . LYS D  1 192 ? -17.048 71.385  168.838 1.00 61.28  ? 192  LYS D CB  1 
ATOM   5731  C CG  . LYS D  1 192 ? -16.438 70.517  169.916 1.00 59.58  ? 192  LYS D CG  1 
ATOM   5732  C CD  . LYS D  1 192 ? -15.005 70.927  170.162 1.00 58.60  ? 192  LYS D CD  1 
ATOM   5733  C CE  . LYS D  1 192 ? -14.131 69.744  170.514 1.00 58.63  ? 192  LYS D CE  1 
ATOM   5734  N NZ  . LYS D  1 192 ? -14.635 68.924  171.638 1.00 57.09  ? 192  LYS D NZ  1 
ATOM   5735  N N   . ARG D  1 193 ? -19.947 71.601  170.779 1.00 64.25  ? 193  ARG D N   1 
ATOM   5736  C CA  . ARG D  1 193 ? -20.579 72.353  171.862 1.00 65.65  ? 193  ARG D CA  1 
ATOM   5737  C C   . ARG D  1 193 ? -20.006 72.073  173.238 1.00 65.93  ? 193  ARG D C   1 
ATOM   5738  O O   . ARG D  1 193 ? -20.388 72.713  174.215 1.00 64.38  ? 193  ARG D O   1 
ATOM   5739  C CB  . ARG D  1 193 ? -22.089 72.128  171.851 1.00 65.99  ? 193  ARG D CB  1 
ATOM   5740  C CG  . ARG D  1 193 ? -22.742 72.759  170.630 1.00 67.58  ? 193  ARG D CG  1 
ATOM   5741  C CD  . ARG D  1 193 ? -24.239 72.523  170.586 1.00 69.42  ? 193  ARG D CD  1 
ATOM   5742  N NE  . ARG D  1 193 ? -24.772 72.647  169.227 1.00 71.72  ? 193  ARG D NE  1 
ATOM   5743  C CZ  . ARG D  1 193 ? -24.900 73.792  168.552 1.00 73.31  ? 193  ARG D CZ  1 
ATOM   5744  N NH1 . ARG D  1 193 ? -24.539 74.952  169.111 1.00 73.30  ? 193  ARG D NH1 1 
ATOM   5745  N NH2 . ARG D  1 193 ? -25.372 73.766  167.300 1.00 72.34  ? 193  ARG D NH2 1 
ATOM   5746  N N   . GLN D  1 194 ? -19.077 71.121  173.294 1.00 67.56  ? 194  GLN D N   1 
ATOM   5747  C CA  . GLN D  1 194 ? -18.390 70.749  174.538 1.00 69.36  ? 194  GLN D CA  1 
ATOM   5748  C C   . GLN D  1 194 ? -16.920 70.338  174.302 1.00 68.50  ? 194  GLN D C   1 
ATOM   5749  O O   . GLN D  1 194 ? -16.440 70.279  173.160 1.00 69.92  ? 194  GLN D O   1 
ATOM   5750  C CB  . GLN D  1 194 ? -19.108 69.600  175.243 1.00 71.48  ? 194  GLN D CB  1 
ATOM   5751  C CG  . GLN D  1 194 ? -20.360 69.187  174.586 1.00 75.16  ? 194  GLN D CG  1 
ATOM   5752  C CD  . GLN D  1 194 ? -20.413 67.704  174.380 1.00 78.34  ? 194  GLN D CD  1 
ATOM   5753  O OE1 . GLN D  1 194 ? -21.462 67.174  174.006 1.00 81.07  ? 194  GLN D OE1 1 
ATOM   5754  N NE2 . GLN D  1 194 ? -19.287 67.013  174.611 1.00 78.27  ? 194  GLN D NE2 1 
ATOM   5755  N N   . ASP D  1 195 ? -16.222 70.055  175.396 1.00 65.74  ? 195  ASP D N   1 
ATOM   5756  C CA  . ASP D  1 195 ? -14.828 69.671  175.354 1.00 63.27  ? 195  ASP D CA  1 
ATOM   5757  C C   . ASP D  1 195 ? -14.665 68.168  175.157 1.00 63.53  ? 195  ASP D C   1 
ATOM   5758  O O   . ASP D  1 195 ? -13.774 67.710  174.438 1.00 63.18  ? 195  ASP D O   1 
ATOM   5759  C CB  . ASP D  1 195 ? -14.136 70.116  176.661 1.00 59.78  ? 195  ASP D CB  1 
ATOM   5760  C CG  . ASP D  1 195 ? -14.103 71.642  176.825 1.00 56.65  ? 195  ASP D CG  1 
ATOM   5761  O OD1 . ASP D  1 195 ? -13.696 72.117  177.915 1.00 53.28  ? 195  ASP D OD1 1 
ATOM   5762  O OD2 . ASP D  1 195 ? -14.481 72.353  175.861 1.00 53.05  ? 195  ASP D OD2 1 
ATOM   5763  N N   . LEU D  1 196 ? -15.536 67.394  175.783 1.00 64.09  ? 196  LEU D N   1 
ATOM   5764  C CA  . LEU D  1 196 ? -15.412 65.952  175.685 1.00 64.76  ? 196  LEU D CA  1 
ATOM   5765  C C   . LEU D  1 196 ? -15.419 65.421  174.244 1.00 64.88  ? 196  LEU D C   1 
ATOM   5766  O O   . LEU D  1 196 ? -16.253 65.816  173.414 1.00 64.04  ? 196  LEU D O   1 
ATOM   5767  C CB  . LEU D  1 196 ? -16.503 65.294  176.532 1.00 65.44  ? 196  LEU D CB  1 
ATOM   5768  C CG  . LEU D  1 196 ? -16.305 63.826  176.936 1.00 66.21  ? 196  LEU D CG  1 
ATOM   5769  C CD1 . LEU D  1 196 ? -16.766 62.899  175.808 1.00 66.20  ? 196  LEU D CD1 1 
ATOM   5770  C CD2 . LEU D  1 196 ? -14.836 63.591  177.312 1.00 65.69  ? 196  LEU D CD2 1 
ATOM   5771  N N   . GLU D  1 197 ? -14.451 64.540  173.966 1.00 65.68  ? 197  GLU D N   1 
ATOM   5772  C CA  . GLU D  1 197 ? -14.282 63.900  172.651 1.00 66.52  ? 197  GLU D CA  1 
ATOM   5773  C C   . GLU D  1 197 ? -14.222 62.380  172.745 1.00 66.91  ? 197  GLU D C   1 
ATOM   5774  O O   . GLU D  1 197 ? -13.141 61.795  172.849 1.00 66.83  ? 197  GLU D O   1 
ATOM   5775  C CB  . GLU D  1 197 ? -13.014 64.386  171.940 1.00 66.19  ? 197  GLU D CB  1 
ATOM   5776  C CG  . GLU D  1 197 ? -13.162 65.711  171.204 1.00 65.06  ? 197  GLU D CG  1 
ATOM   5777  C CD  . GLU D  1 197 ? -14.121 65.620  170.042 1.00 65.58  ? 197  GLU D CD  1 
ATOM   5778  O OE1 . GLU D  1 197 ? -14.417 64.478  169.605 1.00 65.19  ? 197  GLU D OE1 1 
ATOM   5779  O OE2 . GLU D  1 197 ? -14.564 66.694  169.562 1.00 66.29  ? 197  GLU D OE2 1 
ATOM   5780  N N   . PRO D  1 198 ? -15.403 61.733  172.667 1.00 67.54  ? 198  PRO D N   1 
ATOM   5781  C CA  . PRO D  1 198 ? -15.819 60.316  172.712 1.00 67.28  ? 198  PRO D CA  1 
ATOM   5782  C C   . PRO D  1 198 ? -15.002 59.269  171.945 1.00 66.74  ? 198  PRO D C   1 
ATOM   5783  O O   . PRO D  1 198 ? -14.348 58.397  172.531 1.00 65.75  ? 198  PRO D O   1 
ATOM   5784  C CB  . PRO D  1 198 ? -17.254 60.375  172.186 1.00 68.04  ? 198  PRO D CB  1 
ATOM   5785  C CG  . PRO D  1 198 ? -17.738 61.723  172.676 1.00 67.56  ? 198  PRO D CG  1 
ATOM   5786  C CD  . PRO D  1 198 ? -16.562 62.596  172.342 1.00 67.42  ? 198  PRO D CD  1 
ATOM   5787  N N   . SER D  1 199 ? -15.090 59.350  170.621 1.00 66.71  ? 199  SER D N   1 
ATOM   5788  C CA  . SER D  1 199 ? -14.393 58.422  169.718 1.00 66.92  ? 199  SER D CA  1 
ATOM   5789  C C   . SER D  1 199 ? -12.894 58.541  169.922 1.00 66.69  ? 199  SER D C   1 
ATOM   5790  O O   . SER D  1 199 ? -12.154 57.543  169.900 1.00 66.20  ? 199  SER D O   1 
ATOM   5791  C CB  . SER D  1 199 ? -14.769 58.765  168.284 1.00 66.48  ? 199  SER D CB  1 
ATOM   5792  O OG  . SER D  1 199 ? -15.578 59.939  168.290 1.00 68.00  ? 199  SER D OG  1 
ATOM   5793  N N   . VAL D  1 200 ? -12.474 59.787  170.132 1.00 66.68  ? 200  VAL D N   1 
ATOM   5794  C CA  . VAL D  1 200 ? -11.089 60.128  170.374 1.00 66.39  ? 200  VAL D CA  1 
ATOM   5795  C C   . VAL D  1 200 ? -10.669 59.491  171.682 1.00 66.86  ? 200  VAL D C   1 
ATOM   5796  O O   . VAL D  1 200 ? -9.774  58.650  171.695 1.00 66.19  ? 200  VAL D O   1 
ATOM   5797  C CB  . VAL D  1 200 ? -10.896 61.675  170.424 1.00 66.23  ? 200  VAL D CB  1 
ATOM   5798  C CG1 . VAL D  1 200 ? -9.630  62.036  171.177 1.00 65.28  ? 200  VAL D CG1 1 
ATOM   5799  C CG2 . VAL D  1 200 ? -10.809 62.224  169.000 1.00 65.34  ? 200  VAL D CG2 1 
ATOM   5800  N N   . GLU D  1 201 ? -11.339 59.855  172.772 1.00 68.03  ? 201  GLU D N   1 
ATOM   5801  C CA  . GLU D  1 201 ? -10.991 59.301  174.073 1.00 69.86  ? 201  GLU D CA  1 
ATOM   5802  C C   . GLU D  1 201 ? -10.884 57.769  174.054 1.00 69.97  ? 201  GLU D C   1 
ATOM   5803  O O   . GLU D  1 201 ? -10.059 57.189  174.786 1.00 68.81  ? 201  GLU D O   1 
ATOM   5804  C CB  . GLU D  1 201 ? -11.988 59.772  175.145 1.00 71.55  ? 201  GLU D CB  1 
ATOM   5805  C CG  . GLU D  1 201 ? -11.678 59.276  176.584 1.00 74.29  ? 201  GLU D CG  1 
ATOM   5806  C CD  . GLU D  1 201 ? -10.276 59.689  177.116 1.00 75.92  ? 201  GLU D CD  1 
ATOM   5807  O OE1 . GLU D  1 201 ? -9.588  58.810  177.726 1.00 76.30  ? 201  GLU D OE1 1 
ATOM   5808  O OE2 . GLU D  1 201 ? -9.884  60.880  176.937 1.00 74.97  ? 201  GLU D OE2 1 
ATOM   5809  N N   . GLU D  1 202 ? -11.692 57.121  173.207 1.00 70.86  ? 202  GLU D N   1 
ATOM   5810  C CA  . GLU D  1 202 ? -11.662 55.662  173.093 1.00 71.90  ? 202  GLU D CA  1 
ATOM   5811  C C   . GLU D  1 202 ? -10.414 55.185  172.372 1.00 71.92  ? 202  GLU D C   1 
ATOM   5812  O O   . GLU D  1 202 ? -9.660  54.335  172.875 1.00 71.25  ? 202  GLU D O   1 
ATOM   5813  C CB  . GLU D  1 202 ? -12.878 55.128  172.332 1.00 73.34  ? 202  GLU D CB  1 
ATOM   5814  C CG  . GLU D  1 202 ? -12.817 53.589  172.136 1.00 76.34  ? 202  GLU D CG  1 
ATOM   5815  C CD  . GLU D  1 202 ? -14.004 52.993  171.352 1.00 78.27  ? 202  GLU D CD  1 
ATOM   5816  O OE1 . GLU D  1 202 ? -14.151 51.748  171.379 1.00 78.69  ? 202  GLU D OE1 1 
ATOM   5817  O OE2 . GLU D  1 202 ? -14.777 53.750  170.704 1.00 79.38  ? 202  GLU D OE2 1 
ATOM   5818  N N   . ALA D  1 203 ? -10.220 55.731  171.175 1.00 72.18  ? 203  ALA D N   1 
ATOM   5819  C CA  . ALA D  1 203 ? -9.082  55.380  170.348 1.00 72.00  ? 203  ALA D CA  1 
ATOM   5820  C C   . ALA D  1 203 ? -7.795  55.595  171.118 1.00 72.95  ? 203  ALA D C   1 
ATOM   5821  O O   . ALA D  1 203 ? -6.880  54.773  171.047 1.00 72.52  ? 203  ALA D O   1 
ATOM   5822  C CB  . ALA D  1 203 ? -9.090  56.216  169.108 1.00 70.59  ? 203  ALA D CB  1 
ATOM   5823  N N   . ARG D  1 204 ? -7.739  56.699  171.862 1.00 74.74  ? 204  ARG D N   1 
ATOM   5824  C CA  . ARG D  1 204 ? -6.560  57.061  172.650 1.00 77.30  ? 204  ARG D CA  1 
ATOM   5825  C C   . ARG D  1 204 ? -6.337  56.134  173.809 1.00 80.13  ? 204  ARG D C   1 
ATOM   5826  O O   . ARG D  1 204 ? -5.203  55.795  174.128 1.00 80.86  ? 204  ARG D O   1 
ATOM   5827  C CB  . ARG D  1 204 ? -6.683  58.465  173.235 1.00 76.43  ? 204  ARG D CB  1 
ATOM   5828  C CG  . ARG D  1 204 ? -5.361  59.008  173.732 1.00 74.87  ? 204  ARG D CG  1 
ATOM   5829  C CD  . ARG D  1 204 ? -5.479  60.083  174.804 1.00 73.73  ? 204  ARG D CD  1 
ATOM   5830  N NE  . ARG D  1 204 ? -6.595  61.024  174.687 1.00 72.59  ? 204  ARG D NE  1 
ATOM   5831  C CZ  . ARG D  1 204 ? -6.941  61.686  173.594 1.00 72.55  ? 204  ARG D CZ  1 
ATOM   5832  N NH1 . ARG D  1 204 ? -7.966  62.517  173.638 1.00 73.52  ? 204  ARG D NH1 1 
ATOM   5833  N NH2 . ARG D  1 204 ? -6.289  61.515  172.456 1.00 73.23  ? 204  ARG D NH2 1 
ATOM   5834  N N   . TYR D  1 205 ? -7.427  55.761  174.471 1.00 83.63  ? 205  TYR D N   1 
ATOM   5835  C CA  . TYR D  1 205 ? -7.344  54.875  175.617 1.00 86.51  ? 205  TYR D CA  1 
ATOM   5836  C C   . TYR D  1 205 ? -6.701  53.541  175.210 1.00 87.83  ? 205  TYR D C   1 
ATOM   5837  O O   . TYR D  1 205 ? -5.836  53.003  175.921 1.00 87.86  ? 205  TYR D O   1 
ATOM   5838  C CB  . TYR D  1 205 ? -8.743  54.651  176.209 1.00 88.09  ? 205  TYR D CB  1 
ATOM   5839  C CG  . TYR D  1 205 ? -8.719  53.763  177.436 1.00 90.07  ? 205  TYR D CG  1 
ATOM   5840  C CD1 . TYR D  1 205 ? -8.038  54.162  178.602 1.00 90.30  ? 205  TYR D CD1 1 
ATOM   5841  C CD2 . TYR D  1 205 ? -9.312  52.488  177.415 1.00 90.52  ? 205  TYR D CD2 1 
ATOM   5842  C CE1 . TYR D  1 205 ? -7.940  53.309  179.719 1.00 90.69  ? 205  TYR D CE1 1 
ATOM   5843  C CE2 . TYR D  1 205 ? -9.223  51.627  178.529 1.00 91.09  ? 205  TYR D CE2 1 
ATOM   5844  C CZ  . TYR D  1 205 ? -8.536  52.044  179.676 1.00 90.99  ? 205  TYR D CZ  1 
ATOM   5845  O OH  . TYR D  1 205 ? -8.464  51.208  180.772 1.00 90.55  ? 205  TYR D OH  1 
ATOM   5846  N N   . ASN D  1 206 ? -7.109  53.022  174.055 1.00 89.23  ? 206  ASN D N   1 
ATOM   5847  C CA  . ASN D  1 206 ? -6.571  51.757  173.556 1.00 91.01  ? 206  ASN D CA  1 
ATOM   5848  C C   . ASN D  1 206 ? -5.114  51.812  173.055 1.00 91.97  ? 206  ASN D C   1 
ATOM   5849  O O   . ASN D  1 206 ? -4.406  50.809  173.107 1.00 92.11  ? 206  ASN D O   1 
ATOM   5850  C CB  . ASN D  1 206 ? -7.471  51.218  172.441 1.00 91.39  ? 206  ASN D CB  1 
ATOM   5851  C CG  . ASN D  1 206 ? -8.912  51.105  172.872 1.00 91.77  ? 206  ASN D CG  1 
ATOM   5852  O OD1 . ASN D  1 206 ? -9.208  50.504  173.905 1.00 91.62  ? 206  ASN D OD1 1 
ATOM   5853  N ND2 . ASN D  1 206 ? -9.823  51.683  172.084 1.00 91.89  ? 206  ASN D ND2 1 
ATOM   5854  N N   . SER D  1 207 ? -4.662  52.968  172.570 1.00 93.01  ? 207  SER D N   1 
ATOM   5855  C CA  . SER D  1 207 ? -3.288  53.080  172.070 1.00 93.94  ? 207  SER D CA  1 
ATOM   5856  C C   . SER D  1 207 ? -2.259  52.635  173.106 1.00 95.13  ? 207  SER D C   1 
ATOM   5857  O O   . SER D  1 207 ? -1.099  52.411  172.768 1.00 95.35  ? 207  SER D O   1 
ATOM   5858  C CB  . SER D  1 207 ? -2.971  54.517  171.630 1.00 93.37  ? 207  SER D CB  1 
ATOM   5859  O OG  . SER D  1 207 ? -2.627  55.348  172.724 1.00 91.83  ? 207  SER D OG  1 
ATOM   5860  N N   . CYS D  1 208 ? -2.685  52.507  174.363 1.00 96.65  ? 208  CYS D N   1 
ATOM   5861  C CA  . CYS D  1 208 ? -1.795  52.085  175.446 1.00 97.95  ? 208  CYS D CA  1 
ATOM   5862  C C   . CYS D  1 208 ? -1.858  50.563  175.560 1.00 99.22  ? 208  CYS D C   1 
ATOM   5863  O O   . CYS D  1 208 ? -1.670  49.995  176.645 1.00 99.21  ? 208  CYS D O   1 
ATOM   5864  C CB  . CYS D  1 208 ? -2.228  52.709  176.780 1.00 97.93  ? 208  CYS D CB  1 
ATOM   5865  S SG  . CYS D  1 208 ? -2.339  54.539  176.870 1.00 97.19  ? 208  CYS D SG  1 
ATOM   5866  N N   . ARG D  1 209 ? -2.124  49.912  174.428 1.00 100.63 ? 209  ARG D N   1 
ATOM   5867  C CA  . ARG D  1 209 ? -2.240  48.454  174.362 1.00 101.86 ? 209  ARG D CA  1 
ATOM   5868  C C   . ARG D  1 209 ? -1.837  47.938  172.976 1.00 101.96 ? 209  ARG D C   1 
ATOM   5869  O O   . ARG D  1 209 ? -2.661  47.388  172.237 1.00 101.70 ? 209  ARG D O   1 
ATOM   5870  C CB  . ARG D  1 209 ? -3.686  48.037  174.661 1.00 103.08 ? 209  ARG D CB  1 
ATOM   5871  C CG  . ARG D  1 209 ? -4.238  48.562  175.985 1.00 104.74 ? 209  ARG D CG  1 
ATOM   5872  C CD  . ARG D  1 209 ? -5.760  48.655  175.956 1.00 106.07 ? 209  ARG D CD  1 
ATOM   5873  N NE  . ARG D  1 209 ? -6.312  48.884  177.290 1.00 107.65 ? 209  ARG D NE  1 
ATOM   5874  C CZ  . ARG D  1 209 ? -7.609  48.836  177.580 1.00 108.25 ? 209  ARG D CZ  1 
ATOM   5875  N NH1 . ARG D  1 209 ? -8.494  48.575  176.625 1.00 109.01 ? 209  ARG D NH1 1 
ATOM   5876  N NH2 . ARG D  1 209 ? -8.021  49.013  178.830 1.00 108.10 ? 209  ARG D NH2 1 
ATOM   5877  N N   . LEU E  1 24  ? 9.761   55.564  175.201 1.00 66.12  ? 24   LEU E N   1 
ATOM   5878  C CA  . LEU E  1 24  ? 8.393   55.826  174.640 1.00 67.14  ? 24   LEU E CA  1 
ATOM   5879  C C   . LEU E  1 24  ? 7.662   56.969  175.371 1.00 67.61  ? 24   LEU E C   1 
ATOM   5880  O O   . LEU E  1 24  ? 6.404   57.002  175.502 1.00 67.82  ? 24   LEU E O   1 
ATOM   5881  C CB  . LEU E  1 24  ? 7.552   54.552  174.709 1.00 67.55  ? 24   LEU E CB  1 
ATOM   5882  C CG  . LEU E  1 24  ? 6.721   54.358  173.432 1.00 68.35  ? 24   LEU E CG  1 
ATOM   5883  C CD1 . LEU E  1 24  ? 5.680   55.472  173.255 1.00 67.01  ? 24   LEU E CD1 1 
ATOM   5884  C CD2 . LEU E  1 24  ? 7.687   54.328  172.243 1.00 67.96  ? 24   LEU E CD2 1 
ATOM   5885  N N   . CYS E  1 25  ? 8.485   57.907  175.835 1.00 66.90  ? 25   CYS E N   1 
ATOM   5886  C CA  . CYS E  1 25  ? 8.048   59.092  176.573 1.00 65.76  ? 25   CYS E CA  1 
ATOM   5887  C C   . CYS E  1 25  ? 7.505   60.214  175.659 1.00 64.08  ? 25   CYS E C   1 
ATOM   5888  O O   . CYS E  1 25  ? 7.390   60.037  174.449 1.00 63.21  ? 25   CYS E O   1 
ATOM   5889  C CB  . CYS E  1 25  ? 9.240   59.623  177.345 1.00 66.51  ? 25   CYS E CB  1 
ATOM   5890  S SG  . CYS E  1 25  ? 10.620  59.947  176.211 1.00 65.43  ? 25   CYS E SG  1 
ATOM   5891  N N   . PHE E  1 26  ? 7.197   61.370  176.252 1.00 61.43  ? 26   PHE E N   1 
ATOM   5892  C CA  . PHE E  1 26  ? 6.665   62.499  175.504 1.00 57.40  ? 26   PHE E CA  1 
ATOM   5893  C C   . PHE E  1 26  ? 7.630   62.902  174.412 1.00 57.21  ? 26   PHE E C   1 
ATOM   5894  O O   . PHE E  1 26  ? 8.832   62.952  174.626 1.00 56.99  ? 26   PHE E O   1 
ATOM   5895  C CB  . PHE E  1 26  ? 6.429   63.684  176.416 1.00 53.89  ? 26   PHE E CB  1 
ATOM   5896  C CG  . PHE E  1 26  ? 5.628   64.759  175.778 1.00 50.80  ? 26   PHE E CG  1 
ATOM   5897  C CD1 . PHE E  1 26  ? 4.245   64.711  175.792 1.00 49.01  ? 26   PHE E CD1 1 
ATOM   5898  C CD2 . PHE E  1 26  ? 6.255   65.807  175.126 1.00 49.45  ? 26   PHE E CD2 1 
ATOM   5899  C CE1 . PHE E  1 26  ? 3.487   65.691  175.163 1.00 47.55  ? 26   PHE E CE1 1 
ATOM   5900  C CE2 . PHE E  1 26  ? 5.515   66.791  174.493 1.00 48.73  ? 26   PHE E CE2 1 
ATOM   5901  C CZ  . PHE E  1 26  ? 4.115   66.732  174.512 1.00 48.46  ? 26   PHE E CZ  1 
ATOM   5902  N N   . GLY E  1 27  ? 7.089   63.182  173.233 1.00 57.31  ? 27   GLY E N   1 
ATOM   5903  C CA  . GLY E  1 27  ? 7.908   63.581  172.107 1.00 56.39  ? 27   GLY E CA  1 
ATOM   5904  C C   . GLY E  1 27  ? 8.366   62.414  171.251 1.00 56.42  ? 27   GLY E C   1 
ATOM   5905  O O   . GLY E  1 27  ? 8.924   62.612  170.185 1.00 56.10  ? 27   GLY E O   1 
ATOM   5906  N N   . GLN E  1 28  ? 8.136   61.195  171.715 1.00 56.47  ? 28   GLN E N   1 
ATOM   5907  C CA  . GLN E  1 28  ? 8.552   60.015  170.975 1.00 56.47  ? 28   GLN E CA  1 
ATOM   5908  C C   . GLN E  1 28  ? 7.453   59.033  170.666 1.00 56.56  ? 28   GLN E C   1 
ATOM   5909  O O   . GLN E  1 28  ? 7.732   57.918  170.232 1.00 55.88  ? 28   GLN E O   1 
ATOM   5910  C CB  . GLN E  1 28  ? 9.617   59.279  171.734 1.00 58.33  ? 28   GLN E CB  1 
ATOM   5911  C CG  . GLN E  1 28  ? 10.897  60.004  171.804 1.00 61.59  ? 28   GLN E CG  1 
ATOM   5912  C CD  . GLN E  1 28  ? 11.825  59.371  172.819 1.00 63.93  ? 28   GLN E CD  1 
ATOM   5913  O OE1 . GLN E  1 28  ? 12.989  59.767  172.923 1.00 65.95  ? 28   GLN E OE1 1 
ATOM   5914  N NE2 . GLN E  1 28  ? 11.318  58.383  173.584 1.00 64.08  ? 28   GLN E NE2 1 
ATOM   5915  N N   . CYS E  1 29  ? 6.211   59.422  170.931 1.00 57.48  ? 29   CYS E N   1 
ATOM   5916  C CA  . CYS E  1 29  ? 5.081   58.564  170.626 1.00 57.94  ? 29   CYS E CA  1 
ATOM   5917  C C   . CYS E  1 29  ? 4.767   58.736  169.175 1.00 57.76  ? 29   CYS E C   1 
ATOM   5918  O O   . CYS E  1 29  ? 5.167   59.705  168.534 1.00 59.86  ? 29   CYS E O   1 
ATOM   5919  C CB  . CYS E  1 29  ? 3.851   58.960  171.415 1.00 58.09  ? 29   CYS E CB  1 
ATOM   5920  S SG  . CYS E  1 29  ? 4.004   58.489  173.125 1.00 63.22  ? 29   CYS E SG  1 
ATOM   5921  N N   . GLN E  1 30  ? 4.072   57.766  168.631 1.00 57.04  ? 30   GLN E N   1 
ATOM   5922  C CA  . GLN E  1 30  ? 3.660   57.875  167.260 1.00 55.71  ? 30   GLN E CA  1 
ATOM   5923  C C   . GLN E  1 30  ? 2.175   57.622  167.408 1.00 54.40  ? 30   GLN E C   1 
ATOM   5924  O O   . GLN E  1 30  ? 1.769   56.728  168.135 1.00 54.32  ? 30   GLN E O   1 
ATOM   5925  C CB  . GLN E  1 30  ? 4.340   56.810  166.401 1.00 56.35  ? 30   GLN E CB  1 
ATOM   5926  C CG  . GLN E  1 30  ? 4.142   57.049  164.904 1.00 57.17  ? 30   GLN E CG  1 
ATOM   5927  C CD  . GLN E  1 30  ? 4.624   55.902  164.020 1.00 57.93  ? 30   GLN E CD  1 
ATOM   5928  O OE1 . GLN E  1 30  ? 4.330   55.874  162.819 1.00 57.18  ? 30   GLN E OE1 1 
ATOM   5929  N NE2 . GLN E  1 30  ? 5.371   54.952  164.605 1.00 59.71  ? 30   GLN E NE2 1 
ATOM   5930  N N   . TYR E  1 31  ? 1.348   58.443  166.788 1.00 53.43  ? 31   TYR E N   1 
ATOM   5931  C CA  . TYR E  1 31  ? -0.068  58.210  166.903 1.00 51.90  ? 31   TYR E CA  1 
ATOM   5932  C C   . TYR E  1 31  ? -0.468  56.923  166.204 1.00 52.37  ? 31   TYR E C   1 
ATOM   5933  O O   . TYR E  1 31  ? 0.037   56.623  165.112 1.00 52.57  ? 31   TYR E O   1 
ATOM   5934  C CB  . TYR E  1 31  ? -0.839  59.353  166.291 1.00 49.83  ? 31   TYR E CB  1 
ATOM   5935  C CG  . TYR E  1 31  ? -0.931  60.527  167.208 1.00 49.25  ? 31   TYR E CG  1 
ATOM   5936  C CD1 . TYR E  1 31  ? -0.102  61.628  167.046 1.00 47.89  ? 31   TYR E CD1 1 
ATOM   5937  C CD2 . TYR E  1 31  ? -1.869  60.547  168.232 1.00 49.16  ? 31   TYR E CD2 1 
ATOM   5938  C CE1 . TYR E  1 31  ? -0.207  62.721  167.863 1.00 48.36  ? 31   TYR E CE1 1 
ATOM   5939  C CE2 . TYR E  1 31  ? -1.985  61.641  169.073 1.00 50.16  ? 31   TYR E CE2 1 
ATOM   5940  C CZ  . TYR E  1 31  ? -1.150  62.733  168.883 1.00 49.98  ? 31   TYR E CZ  1 
ATOM   5941  O OH  . TYR E  1 31  ? -1.271  63.825  169.715 1.00 49.24  ? 31   TYR E OH  1 
ATOM   5942  N N   . THR E  1 32  ? -1.360  56.162  166.845 1.00 51.75  ? 32   THR E N   1 
ATOM   5943  C CA  . THR E  1 32  ? -1.881  54.935  166.259 1.00 51.83  ? 32   THR E CA  1 
ATOM   5944  C C   . THR E  1 32  ? -2.853  55.409  165.193 1.00 51.53  ? 32   THR E C   1 
ATOM   5945  O O   . THR E  1 32  ? -3.377  56.528  165.284 1.00 52.12  ? 32   THR E O   1 
ATOM   5946  C CB  . THR E  1 32  ? -2.653  54.100  167.283 1.00 52.45  ? 32   THR E CB  1 
ATOM   5947  O OG1 . THR E  1 32  ? -3.775  54.851  167.773 1.00 55.45  ? 32   THR E OG1 1 
ATOM   5948  C CG2 . THR E  1 32  ? -1.763  53.738  168.440 1.00 52.30  ? 32   THR E CG2 1 
ATOM   5949  N N   . ALA E  1 33  ? -3.093  54.585  164.182 1.00 51.12  ? 33   ALA E N   1 
ATOM   5950  C CA  . ALA E  1 33  ? -4.009  54.976  163.119 1.00 51.18  ? 33   ALA E CA  1 
ATOM   5951  C C   . ALA E  1 33  ? -5.349  55.415  163.685 1.00 52.21  ? 33   ALA E C   1 
ATOM   5952  O O   . ALA E  1 33  ? -5.948  56.412  163.259 1.00 50.72  ? 33   ALA E O   1 
ATOM   5953  C CB  . ALA E  1 33  ? -4.203  53.833  162.188 1.00 49.28  ? 33   ALA E CB  1 
ATOM   5954  N N   . GLU E  1 34  ? -5.807  54.677  164.689 1.00 54.90  ? 34   GLU E N   1 
ATOM   5955  C CA  . GLU E  1 34  ? -7.099  54.979  165.277 1.00 56.23  ? 34   GLU E CA  1 
ATOM   5956  C C   . GLU E  1 34  ? -7.144  56.357  165.970 1.00 53.66  ? 34   GLU E C   1 
ATOM   5957  O O   . GLU E  1 34  ? -8.064  57.154  165.714 1.00 52.57  ? 34   GLU E O   1 
ATOM   5958  C CB  . GLU E  1 34  ? -7.521  53.840  166.224 1.00 60.41  ? 34   GLU E CB  1 
ATOM   5959  C CG  . GLU E  1 34  ? -9.060  53.719  166.354 1.00 67.00  ? 34   GLU E CG  1 
ATOM   5960  C CD  . GLU E  1 34  ? -9.532  52.908  167.585 1.00 70.15  ? 34   GLU E CD  1 
ATOM   5961  O OE1 . GLU E  1 34  ? -10.702 53.137  168.015 1.00 70.61  ? 34   GLU E OE1 1 
ATOM   5962  O OE2 . GLU E  1 34  ? -8.742  52.057  168.105 1.00 71.07  ? 34   GLU E OE2 1 
ATOM   5963  N N   . GLU E  1 35  ? -6.159  56.663  166.815 1.00 50.62  ? 35   GLU E N   1 
ATOM   5964  C CA  . GLU E  1 35  ? -6.178  57.962  167.478 1.00 47.96  ? 35   GLU E CA  1 
ATOM   5965  C C   . GLU E  1 35  ? -5.976  59.075  166.461 1.00 46.90  ? 35   GLU E C   1 
ATOM   5966  O O   . GLU E  1 35  ? -6.660  60.122  166.513 1.00 46.02  ? 35   GLU E O   1 
ATOM   5967  C CB  . GLU E  1 35  ? -5.112  58.040  168.565 1.00 48.02  ? 35   GLU E CB  1 
ATOM   5968  C CG  . GLU E  1 35  ? -5.292  59.252  169.478 1.00 48.06  ? 35   GLU E CG  1 
ATOM   5969  C CD  . GLU E  1 35  ? -4.304  59.287  170.662 1.00 49.97  ? 35   GLU E CD  1 
ATOM   5970  O OE1 . GLU E  1 35  ? -4.311  60.285  171.430 1.00 49.42  ? 35   GLU E OE1 1 
ATOM   5971  O OE2 . GLU E  1 35  ? -3.517  58.324  170.828 1.00 50.61  ? 35   GLU E OE2 1 
ATOM   5972  N N   . TYR E  1 36  ? -5.047  58.848  165.528 1.00 45.20  ? 36   TYR E N   1 
ATOM   5973  C CA  . TYR E  1 36  ? -4.775  59.840  164.484 1.00 43.24  ? 36   TYR E CA  1 
ATOM   5974  C C   . TYR E  1 36  ? -6.058  60.197  163.765 1.00 43.57  ? 36   TYR E C   1 
ATOM   5975  O O   . TYR E  1 36  ? -6.435  61.381  163.641 1.00 43.08  ? 36   TYR E O   1 
ATOM   5976  C CB  . TYR E  1 36  ? -3.755  59.318  163.445 1.00 41.08  ? 36   TYR E CB  1 
ATOM   5977  C CG  . TYR E  1 36  ? -3.840  60.089  162.146 1.00 38.57  ? 36   TYR E CG  1 
ATOM   5978  C CD1 . TYR E  1 36  ? -3.440  61.439  162.073 1.00 38.19  ? 36   TYR E CD1 1 
ATOM   5979  C CD2 . TYR E  1 36  ? -4.524  59.557  161.055 1.00 37.80  ? 36   TYR E CD2 1 
ATOM   5980  C CE1 . TYR E  1 36  ? -3.745  62.237  160.945 1.00 35.64  ? 36   TYR E CE1 1 
ATOM   5981  C CE2 . TYR E  1 36  ? -4.837  60.335  159.930 1.00 37.06  ? 36   TYR E CE2 1 
ATOM   5982  C CZ  . TYR E  1 36  ? -4.449  61.673  159.877 1.00 37.31  ? 36   TYR E CZ  1 
ATOM   5983  O OH  . TYR E  1 36  ? -4.785  62.425  158.764 1.00 34.29  ? 36   TYR E OH  1 
ATOM   5984  N N   . GLN E  1 37  ? -6.736  59.161  163.285 1.00 44.70  ? 37   GLN E N   1 
ATOM   5985  C CA  . GLN E  1 37  ? -7.967  59.376  162.548 1.00 46.60  ? 37   GLN E CA  1 
ATOM   5986  C C   . GLN E  1 37  ? -9.057  60.116  163.346 1.00 46.40  ? 37   GLN E C   1 
ATOM   5987  O O   . GLN E  1 37  ? -9.706  61.060  162.836 1.00 46.44  ? 37   GLN E O   1 
ATOM   5988  C CB  . GLN E  1 37  ? -8.493  58.057  162.051 1.00 48.41  ? 37   GLN E CB  1 
ATOM   5989  C CG  . GLN E  1 37  ? -9.646  58.260  161.107 1.00 56.02  ? 37   GLN E CG  1 
ATOM   5990  C CD  . GLN E  1 37  ? -10.518 57.014  160.939 1.00 59.09  ? 37   GLN E CD  1 
ATOM   5991  O OE1 . GLN E  1 37  ? -10.200 56.099  160.147 1.00 59.48  ? 37   GLN E OE1 1 
ATOM   5992  N NE2 . GLN E  1 37  ? -11.635 56.973  161.696 1.00 60.95  ? 37   GLN E NE2 1 
ATOM   5993  N N   . ALA E  1 38  ? -9.239  59.717  164.601 1.00 44.92  ? 38   ALA E N   1 
ATOM   5994  C CA  . ALA E  1 38  ? -10.237 60.358  165.418 1.00 44.96  ? 38   ALA E CA  1 
ATOM   5995  C C   . ALA E  1 38  ? -9.929  61.837  165.598 1.00 45.43  ? 38   ALA E C   1 
ATOM   5996  O O   . ALA E  1 38  ? -10.821 62.696  165.485 1.00 44.99  ? 38   ALA E O   1 
ATOM   5997  C CB  . ALA E  1 38  ? -10.318 59.663  166.758 1.00 45.30  ? 38   ALA E CB  1 
ATOM   5998  N N   . ILE E  1 39  ? -8.664  62.139  165.872 1.00 46.20  ? 39   ILE E N   1 
ATOM   5999  C CA  . ILE E  1 39  ? -8.276  63.530  166.077 1.00 47.00  ? 39   ILE E CA  1 
ATOM   6000  C C   . ILE E  1 39  ? -8.356  64.370  164.806 1.00 47.81  ? 39   ILE E C   1 
ATOM   6001  O O   . ILE E  1 39  ? -8.854  65.499  164.849 1.00 47.85  ? 39   ILE E O   1 
ATOM   6002  C CB  . ILE E  1 39  ? -6.877  63.616  166.704 1.00 46.98  ? 39   ILE E CB  1 
ATOM   6003  C CG1 . ILE E  1 39  ? -6.937  63.051  168.130 1.00 46.55  ? 39   ILE E CG1 1 
ATOM   6004  C CG2 . ILE E  1 39  ? -6.377  65.062  166.689 1.00 46.20  ? 39   ILE E CG2 1 
ATOM   6005  C CD1 . ILE E  1 39  ? -5.597  62.901  168.829 1.00 48.00  ? 39   ILE E CD1 1 
ATOM   6006  N N   . GLN E  1 40  ? -7.895  63.826  163.680 1.00 48.61  ? 40   GLN E N   1 
ATOM   6007  C CA  . GLN E  1 40  ? -7.973  64.566  162.428 1.00 50.42  ? 40   GLN E CA  1 
ATOM   6008  C C   . GLN E  1 40  ? -9.400  65.044  162.240 1.00 51.25  ? 40   GLN E C   1 
ATOM   6009  O O   . GLN E  1 40  ? -9.644  66.218  161.885 1.00 52.30  ? 40   GLN E O   1 
ATOM   6010  C CB  . GLN E  1 40  ? -7.629  63.689  161.223 1.00 51.93  ? 40   GLN E CB  1 
ATOM   6011  C CG  . GLN E  1 40  ? -6.380  64.098  160.425 1.00 54.47  ? 40   GLN E CG  1 
ATOM   6012  C CD  . GLN E  1 40  ? -6.390  65.498  159.871 1.00 53.94  ? 40   GLN E CD  1 
ATOM   6013  O OE1 . GLN E  1 40  ? -5.921  65.726  158.768 1.00 54.28  ? 40   GLN E OE1 1 
ATOM   6014  N NE2 . GLN E  1 40  ? -6.907  66.444  160.629 1.00 57.52  ? 40   GLN E NE2 1 
ATOM   6015  N N   . LYS E  1 41  ? -10.344 64.126  162.464 1.00 51.27  ? 41   LYS E N   1 
ATOM   6016  C CA  . LYS E  1 41  ? -11.756 64.444  162.305 1.00 51.44  ? 41   LYS E CA  1 
ATOM   6017  C C   . LYS E  1 41  ? -12.259 65.433  163.337 1.00 50.86  ? 41   LYS E C   1 
ATOM   6018  O O   . LYS E  1 41  ? -12.899 66.435  162.993 1.00 50.70  ? 41   LYS E O   1 
ATOM   6019  C CB  . LYS E  1 41  ? -12.589 63.176  162.358 1.00 52.63  ? 41   LYS E CB  1 
ATOM   6020  C CG  . LYS E  1 41  ? -12.528 62.367  161.074 1.00 54.53  ? 41   LYS E CG  1 
ATOM   6021  C CD  . LYS E  1 41  ? -13.207 61.025  161.219 1.00 53.90  ? 41   LYS E CD  1 
ATOM   6022  C CE  . LYS E  1 41  ? -13.002 60.197  159.971 1.00 54.18  ? 41   LYS E CE  1 
ATOM   6023  N NZ  . LYS E  1 41  ? -13.483 58.819  160.210 1.00 57.80  ? 41   LYS E NZ  1 
ATOM   6024  N N   . ALA E  1 42  ? -11.957 65.173  164.603 1.00 49.80  ? 42   ALA E N   1 
ATOM   6025  C CA  . ALA E  1 42  ? -12.407 66.085  165.650 1.00 49.94  ? 42   ALA E CA  1 
ATOM   6026  C C   . ALA E  1 42  ? -11.892 67.524  165.460 1.00 49.82  ? 42   ALA E C   1 
ATOM   6027  O O   . ALA E  1 42  ? -12.631 68.495  165.740 1.00 50.80  ? 42   ALA E O   1 
ATOM   6028  C CB  . ALA E  1 42  ? -12.006 65.553  167.023 1.00 48.27  ? 42   ALA E CB  1 
ATOM   6029  N N   . LEU E  1 43  ? -10.654 67.668  164.970 1.00 48.34  ? 43   LEU E N   1 
ATOM   6030  C CA  . LEU E  1 43  ? -10.089 68.997  164.792 1.00 48.63  ? 43   LEU E CA  1 
ATOM   6031  C C   . LEU E  1 43  ? -10.803 69.866  163.752 1.00 49.19  ? 43   LEU E C   1 
ATOM   6032  O O   . LEU E  1 43  ? -10.749 71.101  163.809 1.00 48.99  ? 43   LEU E O   1 
ATOM   6033  C CB  . LEU E  1 43  ? -8.601  68.887  164.477 1.00 48.40  ? 43   LEU E CB  1 
ATOM   6034  C CG  . LEU E  1 43  ? -7.735  68.444  165.669 1.00 47.54  ? 43   LEU E CG  1 
ATOM   6035  C CD1 . LEU E  1 43  ? -6.334  68.110  165.181 1.00 47.41  ? 43   LEU E CD1 1 
ATOM   6036  C CD2 . LEU E  1 43  ? -7.703  69.526  166.726 1.00 44.33  ? 43   LEU E CD2 1 
ATOM   6037  N N   . ARG E  1 44  ? -11.496 69.229  162.815 1.00 49.65  ? 44   ARG E N   1 
ATOM   6038  C CA  . ARG E  1 44  ? -12.219 69.974  161.796 1.00 50.26  ? 44   ARG E CA  1 
ATOM   6039  C C   . ARG E  1 44  ? -13.426 70.758  162.300 1.00 50.96  ? 44   ARG E C   1 
ATOM   6040  O O   . ARG E  1 44  ? -13.776 71.760  161.712 1.00 51.94  ? 44   ARG E O   1 
ATOM   6041  C CB  . ARG E  1 44  ? -12.678 69.038  160.684 1.00 49.66  ? 44   ARG E CB  1 
ATOM   6042  C CG  . ARG E  1 44  ? -11.551 68.425  159.902 1.00 50.12  ? 44   ARG E CG  1 
ATOM   6043  C CD  . ARG E  1 44  ? -12.038 67.825  158.622 1.00 47.42  ? 44   ARG E CD  1 
ATOM   6044  N NE  . ARG E  1 44  ? -12.110 66.374  158.713 1.00 48.26  ? 44   ARG E NE  1 
ATOM   6045  C CZ  . ARG E  1 44  ? -11.192 65.558  158.217 1.00 47.31  ? 44   ARG E CZ  1 
ATOM   6046  N NH1 . ARG E  1 44  ? -10.140 66.067  157.610 1.00 46.49  ? 44   ARG E NH1 1 
ATOM   6047  N NH2 . ARG E  1 44  ? -11.352 64.241  158.290 1.00 47.91  ? 44   ARG E NH2 1 
ATOM   6048  N N   . GLN E  1 45  ? -14.059 70.318  163.381 1.00 52.18  ? 45   GLN E N   1 
ATOM   6049  C CA  . GLN E  1 45  ? -15.248 70.996  163.917 1.00 53.55  ? 45   GLN E CA  1 
ATOM   6050  C C   . GLN E  1 45  ? -15.056 72.463  164.264 1.00 54.12  ? 45   GLN E C   1 
ATOM   6051  O O   . GLN E  1 45  ? -14.045 72.825  164.838 1.00 54.94  ? 45   GLN E O   1 
ATOM   6052  C CB  . GLN E  1 45  ? -15.718 70.296  165.189 1.00 55.02  ? 45   GLN E CB  1 
ATOM   6053  C CG  . GLN E  1 45  ? -15.816 68.792  165.109 1.00 58.04  ? 45   GLN E CG  1 
ATOM   6054  C CD  . GLN E  1 45  ? -16.067 68.145  166.460 1.00 60.47  ? 45   GLN E CD  1 
ATOM   6055  O OE1 . GLN E  1 45  ? -16.314 66.937  166.554 1.00 62.72  ? 45   GLN E OE1 1 
ATOM   6056  N NE2 . GLN E  1 45  ? -16.000 68.942  167.517 1.00 62.44  ? 45   GLN E NE2 1 
ATOM   6057  N N   . ARG E  1 46  ? -16.027 73.305  163.941 1.00 55.19  ? 46   ARG E N   1 
ATOM   6058  C CA  . ARG E  1 46  ? -15.945 74.718  164.306 1.00 57.44  ? 46   ARG E CA  1 
ATOM   6059  C C   . ARG E  1 46  ? -16.506 74.721  165.709 1.00 58.94  ? 46   ARG E C   1 
ATOM   6060  O O   . ARG E  1 46  ? -17.182 73.767  166.080 1.00 59.81  ? 46   ARG E O   1 
ATOM   6061  C CB  . ARG E  1 46  ? -16.869 75.554  163.445 1.00 58.93  ? 46   ARG E CB  1 
ATOM   6062  C CG  . ARG E  1 46  ? -16.809 75.255  161.984 1.00 60.21  ? 46   ARG E CG  1 
ATOM   6063  C CD  . ARG E  1 46  ? -16.281 76.463  161.258 1.00 62.39  ? 46   ARG E CD  1 
ATOM   6064  N NE  . ARG E  1 46  ? -16.415 76.309  159.819 1.00 64.81  ? 46   ARG E NE  1 
ATOM   6065  C CZ  . ARG E  1 46  ? -15.655 76.937  158.924 1.00 66.12  ? 46   ARG E CZ  1 
ATOM   6066  N NH1 . ARG E  1 46  ? -14.687 77.773  159.319 1.00 65.05  ? 46   ARG E NH1 1 
ATOM   6067  N NH2 . ARG E  1 46  ? -15.876 76.724  157.625 1.00 67.27  ? 46   ARG E NH2 1 
ATOM   6068  N N   . LEU E  1 47  ? -16.270 75.751  166.510 1.00 59.89  ? 47   LEU E N   1 
ATOM   6069  C CA  . LEU E  1 47  ? -16.852 75.652  167.829 1.00 61.24  ? 47   LEU E CA  1 
ATOM   6070  C C   . LEU E  1 47  ? -18.117 76.451  168.005 1.00 61.67  ? 47   LEU E C   1 
ATOM   6071  O O   . LEU E  1 47  ? -18.271 77.505  167.393 1.00 61.68  ? 47   LEU E O   1 
ATOM   6072  C CB  . LEU E  1 47  ? -15.849 75.975  168.948 1.00 62.21  ? 47   LEU E CB  1 
ATOM   6073  C CG  . LEU E  1 47  ? -14.460 76.591  168.837 1.00 63.24  ? 47   LEU E CG  1 
ATOM   6074  C CD1 . LEU E  1 47  ? -13.654 76.224  170.076 1.00 63.06  ? 47   LEU E CD1 1 
ATOM   6075  C CD2 . LEU E  1 47  ? -13.748 76.036  167.636 1.00 65.00  ? 47   LEU E CD2 1 
ATOM   6076  N N   . GLY E  1 48  ? -19.021 75.919  168.836 1.00 61.57  ? 48   GLY E N   1 
ATOM   6077  C CA  . GLY E  1 48  ? -20.289 76.572  169.099 1.00 61.65  ? 48   GLY E CA  1 
ATOM   6078  C C   . GLY E  1 48  ? -20.182 77.881  169.860 1.00 61.90  ? 48   GLY E C   1 
ATOM   6079  O O   . GLY E  1 48  ? -19.101 78.268  170.328 1.00 61.92  ? 48   GLY E O   1 
ATOM   6080  N N   . PRO E  1 49  ? -21.316 78.577  170.021 1.00 62.14  ? 49   PRO E N   1 
ATOM   6081  C CA  . PRO E  1 49  ? -21.399 79.863  170.723 1.00 61.82  ? 49   PRO E CA  1 
ATOM   6082  C C   . PRO E  1 49  ? -20.931 79.793  172.176 1.00 61.49  ? 49   PRO E C   1 
ATOM   6083  O O   . PRO E  1 49  ? -20.527 80.815  172.758 1.00 60.88  ? 49   PRO E O   1 
ATOM   6084  C CB  . PRO E  1 49  ? -22.885 80.217  170.633 1.00 61.35  ? 49   PRO E CB  1 
ATOM   6085  C CG  . PRO E  1 49  ? -23.381 79.418  169.490 1.00 61.47  ? 49   PRO E CG  1 
ATOM   6086  C CD  . PRO E  1 49  ? -22.658 78.118  169.630 1.00 61.67  ? 49   PRO E CD  1 
ATOM   6087  N N   . GLU E  1 50  ? -21.001 78.601  172.763 1.00 60.78  ? 50   GLU E N   1 
ATOM   6088  C CA  . GLU E  1 50  ? -20.596 78.456  174.144 1.00 61.84  ? 50   GLU E CA  1 
ATOM   6089  C C   . GLU E  1 50  ? -19.120 78.649  174.381 1.00 61.55  ? 50   GLU E C   1 
ATOM   6090  O O   . GLU E  1 50  ? -18.679 78.676  175.527 1.00 62.30  ? 50   GLU E O   1 
ATOM   6091  C CB  . GLU E  1 50  ? -21.032 77.104  174.734 1.00 63.52  ? 50   GLU E CB  1 
ATOM   6092  C CG  . GLU E  1 50  ? -21.019 75.889  173.817 1.00 66.02  ? 50   GLU E CG  1 
ATOM   6093  C CD  . GLU E  1 50  ? -22.214 75.842  172.858 1.00 67.78  ? 50   GLU E CD  1 
ATOM   6094  O OE1 . GLU E  1 50  ? -22.147 76.476  171.781 1.00 68.23  ? 50   GLU E OE1 1 
ATOM   6095  O OE2 . GLU E  1 50  ? -23.225 75.174  173.191 1.00 68.42  ? 50   GLU E OE2 1 
ATOM   6096  N N   . TYR E  1 51  ? -18.346 78.796  173.309 1.00 61.10  ? 51   TYR E N   1 
ATOM   6097  C CA  . TYR E  1 51  ? -16.899 79.000  173.446 1.00 59.73  ? 51   TYR E CA  1 
ATOM   6098  C C   . TYR E  1 51  ? -16.487 80.453  173.222 1.00 60.32  ? 51   TYR E C   1 
ATOM   6099  O O   . TYR E  1 51  ? -15.600 80.994  173.889 1.00 60.24  ? 51   TYR E O   1 
ATOM   6100  C CB  . TYR E  1 51  ? -16.159 78.122  172.451 1.00 55.57  ? 51   TYR E CB  1 
ATOM   6101  C CG  . TYR E  1 51  ? -16.145 76.680  172.828 1.00 51.53  ? 51   TYR E CG  1 
ATOM   6102  C CD1 . TYR E  1 51  ? -17.037 75.765  172.245 1.00 50.74  ? 51   TYR E CD1 1 
ATOM   6103  C CD2 . TYR E  1 51  ? -15.231 76.218  173.759 1.00 49.73  ? 51   TYR E CD2 1 
ATOM   6104  C CE1 . TYR E  1 51  ? -17.005 74.405  172.595 1.00 49.43  ? 51   TYR E CE1 1 
ATOM   6105  C CE2 . TYR E  1 51  ? -15.185 74.888  174.118 1.00 49.07  ? 51   TYR E CE2 1 
ATOM   6106  C CZ  . TYR E  1 51  ? -16.071 73.986  173.540 1.00 50.03  ? 51   TYR E CZ  1 
ATOM   6107  O OH  . TYR E  1 51  ? -16.022 72.678  173.951 1.00 50.09  ? 51   TYR E OH  1 
ATOM   6108  N N   . ILE E  1 52  ? -17.175 81.082  172.292 1.00 61.92  ? 52   ILE E N   1 
ATOM   6109  C CA  . ILE E  1 52  ? -16.876 82.440  171.905 1.00 64.78  ? 52   ILE E CA  1 
ATOM   6110  C C   . ILE E  1 52  ? -17.355 83.539  172.827 1.00 67.11  ? 52   ILE E C   1 
ATOM   6111  O O   . ILE E  1 52  ? -18.511 83.538  173.239 1.00 68.57  ? 52   ILE E O   1 
ATOM   6112  C CB  . ILE E  1 52  ? -17.462 82.725  170.517 1.00 63.77  ? 52   ILE E CB  1 
ATOM   6113  C CG1 . ILE E  1 52  ? -17.273 81.500  169.611 1.00 63.02  ? 52   ILE E CG1 1 
ATOM   6114  C CG2 . ILE E  1 52  ? -16.824 83.964  169.937 1.00 64.16  ? 52   ILE E CG2 1 
ATOM   6115  C CD1 . ILE E  1 52  ? -15.868 80.964  169.556 1.00 61.62  ? 52   ILE E CD1 1 
ATOM   6116  N N   . SER E  1 53  ? -16.463 84.471  173.144 1.00 69.30  ? 53   SER E N   1 
ATOM   6117  C CA  . SER E  1 53  ? -16.817 85.617  173.962 1.00 72.45  ? 53   SER E CA  1 
ATOM   6118  C C   . SER E  1 53  ? -16.340 86.857  173.206 1.00 74.41  ? 53   SER E C   1 
ATOM   6119  O O   . SER E  1 53  ? -15.696 86.724  172.167 1.00 75.02  ? 53   SER E O   1 
ATOM   6120  C CB  . SER E  1 53  ? -16.208 85.517  175.378 1.00 72.79  ? 53   SER E CB  1 
ATOM   6121  O OG  . SER E  1 53  ? -14.894 85.009  175.387 1.00 74.28  ? 53   SER E OG  1 
ATOM   6122  N N   . SER E  1 54  ? -16.670 88.054  173.681 1.00 76.31  ? 54   SER E N   1 
ATOM   6123  C CA  . SER E  1 54  ? -16.253 89.246  172.962 1.00 78.49  ? 54   SER E CA  1 
ATOM   6124  C C   . SER E  1 54  ? -16.019 90.445  173.848 1.00 80.31  ? 54   SER E C   1 
ATOM   6125  O O   . SER E  1 54  ? -16.454 90.470  174.992 1.00 80.26  ? 54   SER E O   1 
ATOM   6126  C CB  . SER E  1 54  ? -17.283 89.606  171.882 1.00 78.26  ? 54   SER E CB  1 
ATOM   6127  O OG  . SER E  1 54  ? -18.573 89.766  172.427 1.00 79.18  ? 54   SER E OG  1 
ATOM   6128  N N   . ARG E  1 55  ? -15.316 91.434  173.301 1.00 82.57  ? 55   ARG E N   1 
ATOM   6129  C CA  . ARG E  1 55  ? -15.013 92.660  174.016 1.00 85.01  ? 55   ARG E CA  1 
ATOM   6130  C C   . ARG E  1 55  ? -15.101 93.799  173.019 1.00 86.92  ? 55   ARG E C   1 
ATOM   6131  O O   . ARG E  1 55  ? -15.232 93.571  171.815 1.00 86.74  ? 55   ARG E O   1 
ATOM   6132  C CB  . ARG E  1 55  ? -13.604 92.613  174.623 1.00 84.85  ? 55   ARG E CB  1 
ATOM   6133  C CG  . ARG E  1 55  ? -12.499 92.386  173.597 1.00 85.40  ? 55   ARG E CG  1 
ATOM   6134  C CD  . ARG E  1 55  ? -11.122 92.777  174.138 1.00 85.99  ? 55   ARG E CD  1 
ATOM   6135  N NE  . ARG E  1 55  ? -10.033 92.366  173.246 1.00 86.62  ? 55   ARG E NE  1 
ATOM   6136  C CZ  . ARG E  1 55  ? -9.566  91.120  173.144 1.00 86.93  ? 55   ARG E CZ  1 
ATOM   6137  N NH1 . ARG E  1 55  ? -10.084 90.145  173.884 1.00 86.83  ? 55   ARG E NH1 1 
ATOM   6138  N NH2 . ARG E  1 55  ? -8.582  90.846  172.294 1.00 86.18  ? 55   ARG E NH2 1 
ATOM   6139  N N   . MET E  1 56  ? -15.036 95.025  173.531 1.00 89.65  ? 56   MET E N   1 
ATOM   6140  C CA  . MET E  1 56  ? -15.098 96.215  172.690 1.00 91.85  ? 56   MET E CA  1 
ATOM   6141  C C   . MET E  1 56  ? -13.725 96.743  172.353 1.00 92.75  ? 56   MET E C   1 
ATOM   6142  O O   . MET E  1 56  ? -12.945 97.100  173.244 1.00 92.39  ? 56   MET E O   1 
ATOM   6143  C CB  . MET E  1 56  ? -15.894 97.337  173.363 1.00 93.28  ? 56   MET E CB  1 
ATOM   6144  C CG  . MET E  1 56  ? -17.369 97.335  173.011 1.00 95.14  ? 56   MET E CG  1 
ATOM   6145  S SD  . MET E  1 56  ? -17.635 97.231  171.217 1.00 97.23  ? 56   MET E SD  1 
ATOM   6146  C CE  . MET E  1 56  ? -18.365 95.536  171.066 1.00 95.56  ? 56   MET E CE  1 
ATOM   6147  N N   . ALA E  1 57  ? -13.435 96.783  171.056 1.00 93.94  ? 57   ALA E N   1 
ATOM   6148  C CA  . ALA E  1 57  ? -12.163 97.292  170.572 1.00 95.14  ? 57   ALA E CA  1 
ATOM   6149  C C   . ALA E  1 57  ? -12.228 98.809  170.691 1.00 96.25  ? 57   ALA E C   1 
ATOM   6150  O O   . ALA E  1 57  ? -13.312 99.387  170.813 1.00 96.10  ? 57   ALA E O   1 
ATOM   6151  C CB  . ALA E  1 57  ? -11.952 96.888  169.122 1.00 94.74  ? 57   ALA E CB  1 
ATOM   6152  N N   . GLY E  1 58  ? -11.067 99.454  170.666 1.00 97.67  ? 58   GLY E N   1 
ATOM   6153  C CA  . GLY E  1 58  ? -11.037 100.902 170.759 1.00 98.70  ? 58   GLY E CA  1 
ATOM   6154  C C   . GLY E  1 58  ? -11.878 101.548 169.666 1.00 99.10  ? 58   GLY E C   1 
ATOM   6155  O O   . GLY E  1 58  ? -12.503 102.585 169.903 1.00 99.58  ? 58   GLY E O   1 
ATOM   6156  N N   . GLY E  1 59  ? -11.896 100.939 168.477 1.00 98.99  ? 59   GLY E N   1 
ATOM   6157  C CA  . GLY E  1 59  ? -12.675 101.472 167.369 1.00 98.52  ? 59   GLY E CA  1 
ATOM   6158  C C   . GLY E  1 59  ? -14.168 101.269 167.563 1.00 98.25  ? 59   GLY E C   1 
ATOM   6159  O O   . GLY E  1 59  ? -14.946 101.323 166.608 1.00 98.05  ? 59   GLY E O   1 
ATOM   6160  N N   . GLY E  1 60  ? -14.569 101.044 168.809 1.00 97.69  ? 60   GLY E N   1 
ATOM   6161  C CA  . GLY E  1 60  ? -15.969 100.832 169.102 1.00 97.47  ? 60   GLY E CA  1 
ATOM   6162  C C   . GLY E  1 60  ? -16.477 99.647  168.304 1.00 97.40  ? 60   GLY E C   1 
ATOM   6163  O O   . GLY E  1 60  ? -17.626 99.637  167.845 1.00 97.47  ? 60   GLY E O   1 
ATOM   6164  N N   . GLN E  1 61  ? -15.619 98.641  168.141 1.00 96.70  ? 61   GLN E N   1 
ATOM   6165  C CA  . GLN E  1 61  ? -15.983 97.450  167.383 1.00 95.97  ? 61   GLN E CA  1 
ATOM   6166  C C   . GLN E  1 61  ? -15.748 96.112  168.111 1.00 94.44  ? 61   GLN E C   1 
ATOM   6167  O O   . GLN E  1 61  ? -14.725 95.899  168.778 1.00 94.41  ? 61   GLN E O   1 
ATOM   6168  C CB  . GLN E  1 61  ? -15.236 97.460  166.066 1.00 97.13  ? 61   GLN E CB  1 
ATOM   6169  C CG  . GLN E  1 61  ? -13.762 97.643  166.260 1.00 99.00  ? 61   GLN E CG  1 
ATOM   6170  C CD  . GLN E  1 61  ? -13.020 97.540  164.961 1.00 100.50 ? 61   GLN E CD  1 
ATOM   6171  O OE1 . GLN E  1 61  ? -11.789 97.569  164.936 1.00 101.26 ? 61   GLN E OE1 1 
ATOM   6172  N NE2 . GLN E  1 61  ? -13.764 97.417  163.858 1.00 101.70 ? 61   GLN E NE2 1 
ATOM   6173  N N   . LYS E  1 62  ? -16.717 95.216  167.957 1.00 92.09  ? 62   LYS E N   1 
ATOM   6174  C CA  . LYS E  1 62  ? -16.695 93.906  168.584 1.00 89.53  ? 62   LYS E CA  1 
ATOM   6175  C C   . LYS E  1 62  ? -15.485 93.080  168.156 1.00 87.46  ? 62   LYS E C   1 
ATOM   6176  O O   . LYS E  1 62  ? -15.077 93.083  166.992 1.00 86.98  ? 62   LYS E O   1 
ATOM   6177  C CB  . LYS E  1 62  ? -17.991 93.168  168.228 1.00 90.26  ? 62   LYS E CB  1 
ATOM   6178  C CG  . LYS E  1 62  ? -18.373 92.000  169.125 1.00 90.53  ? 62   LYS E CG  1 
ATOM   6179  C CD  . LYS E  1 62  ? -19.590 91.287  168.535 1.00 91.29  ? 62   LYS E CD  1 
ATOM   6180  C CE  . LYS E  1 62  ? -20.050 90.118  169.392 1.00 92.11  ? 62   LYS E CE  1 
ATOM   6181  N NZ  . LYS E  1 62  ? -21.049 89.282  168.656 1.00 92.19  ? 62   LYS E NZ  1 
ATOM   6182  N N   . VAL E  1 63  ? -14.913 92.374  169.117 1.00 84.63  ? 63   VAL E N   1 
ATOM   6183  C CA  . VAL E  1 63  ? -13.776 91.521  168.856 1.00 82.13  ? 63   VAL E CA  1 
ATOM   6184  C C   . VAL E  1 63  ? -14.049 90.204  169.534 1.00 80.78  ? 63   VAL E C   1 
ATOM   6185  O O   . VAL E  1 63  ? -14.207 90.158  170.749 1.00 81.21  ? 63   VAL E O   1 
ATOM   6186  C CB  . VAL E  1 63  ? -12.503 92.106  169.438 1.00 82.09  ? 63   VAL E CB  1 
ATOM   6187  C CG1 . VAL E  1 63  ? -11.357 91.109  169.311 1.00 80.44  ? 63   VAL E CG1 1 
ATOM   6188  C CG2 . VAL E  1 63  ? -12.190 93.401  168.726 1.00 82.39  ? 63   VAL E CG2 1 
ATOM   6189  N N   . CYS E  1 64  ? -14.106 89.134  168.751 1.00 78.42  ? 64   CYS E N   1 
ATOM   6190  C CA  . CYS E  1 64  ? -14.368 87.821  169.308 1.00 76.62  ? 64   CYS E CA  1 
ATOM   6191  C C   . CYS E  1 64  ? -13.078 87.120  169.670 1.00 75.29  ? 64   CYS E C   1 
ATOM   6192  O O   . CYS E  1 64  ? -12.032 87.364  169.061 1.00 75.29  ? 64   CYS E O   1 
ATOM   6193  C CB  . CYS E  1 64  ? -15.155 86.973  168.315 1.00 77.00  ? 64   CYS E CB  1 
ATOM   6194  S SG  . CYS E  1 64  ? -16.806 87.618  167.939 1.00 78.81  ? 64   CYS E SG  1 
ATOM   6195  N N   . TYR E  1 65  ? -13.158 86.243  170.663 1.00 73.60  ? 65   TYR E N   1 
ATOM   6196  C CA  . TYR E  1 65  ? -11.995 85.509  171.108 1.00 72.06  ? 65   TYR E CA  1 
ATOM   6197  C C   . TYR E  1 65  ? -12.428 84.373  172.011 1.00 71.32  ? 65   TYR E C   1 
ATOM   6198  O O   . TYR E  1 65  ? -13.586 84.297  172.423 1.00 70.73  ? 65   TYR E O   1 
ATOM   6199  C CB  . TYR E  1 65  ? -11.070 86.446  171.865 1.00 73.04  ? 65   TYR E CB  1 
ATOM   6200  C CG  . TYR E  1 65  ? -11.603 86.913  173.212 1.00 73.75  ? 65   TYR E CG  1 
ATOM   6201  C CD1 . TYR E  1 65  ? -11.261 86.234  174.384 1.00 73.54  ? 65   TYR E CD1 1 
ATOM   6202  C CD2 . TYR E  1 65  ? -12.431 88.041  173.314 1.00 73.68  ? 65   TYR E CD2 1 
ATOM   6203  C CE1 . TYR E  1 65  ? -11.721 86.661  175.619 1.00 74.52  ? 65   TYR E CE1 1 
ATOM   6204  C CE2 . TYR E  1 65  ? -12.901 88.477  174.553 1.00 74.48  ? 65   TYR E CE2 1 
ATOM   6205  C CZ  . TYR E  1 65  ? -12.539 87.780  175.708 1.00 74.86  ? 65   TYR E CZ  1 
ATOM   6206  O OH  . TYR E  1 65  ? -12.963 88.192  176.962 1.00 75.10  ? 65   TYR E OH  1 
ATOM   6207  N N   . ILE E  1 66  ? -11.493 83.486  172.316 1.00 69.94  ? 66   ILE E N   1 
ATOM   6208  C CA  . ILE E  1 66  ? -11.785 82.366  173.190 1.00 69.41  ? 66   ILE E CA  1 
ATOM   6209  C C   . ILE E  1 66  ? -10.970 82.571  174.451 1.00 69.61  ? 66   ILE E C   1 
ATOM   6210  O O   . ILE E  1 66  ? -9.823  82.998  174.383 1.00 70.34  ? 66   ILE E O   1 
ATOM   6211  C CB  . ILE E  1 66  ? -11.392 81.039  172.530 1.00 68.71  ? 66   ILE E CB  1 
ATOM   6212  C CG1 . ILE E  1 66  ? -12.050 80.950  171.152 1.00 68.61  ? 66   ILE E CG1 1 
ATOM   6213  C CG2 . ILE E  1 66  ? -11.820 79.874  173.407 1.00 68.60  ? 66   ILE E CG2 1 
ATOM   6214  C CD1 . ILE E  1 66  ? -11.582 79.803  170.313 1.00 67.64  ? 66   ILE E CD1 1 
ATOM   6215  N N   . GLU E  1 67  ? -11.558 82.292  175.607 1.00 69.26  ? 67   GLU E N   1 
ATOM   6216  C CA  . GLU E  1 67  ? -10.823 82.472  176.843 1.00 68.03  ? 67   GLU E CA  1 
ATOM   6217  C C   . GLU E  1 67  ? -9.842  81.342  177.042 1.00 65.74  ? 67   GLU E C   1 
ATOM   6218  O O   . GLU E  1 67  ? -10.138 80.177  176.772 1.00 64.67  ? 67   GLU E O   1 
ATOM   6219  C CB  . GLU E  1 67  ? -11.782 82.583  178.022 1.00 70.10  ? 67   GLU E CB  1 
ATOM   6220  C CG  . GLU E  1 67  ? -12.610 83.848  177.958 1.00 72.75  ? 67   GLU E CG  1 
ATOM   6221  C CD  . GLU E  1 67  ? -13.586 83.973  179.108 1.00 74.80  ? 67   GLU E CD  1 
ATOM   6222  O OE1 . GLU E  1 67  ? -14.450 83.079  179.261 1.00 75.68  ? 67   GLU E OE1 1 
ATOM   6223  O OE2 . GLU E  1 67  ? -13.485 84.969  179.859 1.00 76.76  ? 67   GLU E OE2 1 
ATOM   6224  N N   . GLY E  1 68  ? -8.665  81.717  177.515 1.00 64.13  ? 68   GLY E N   1 
ATOM   6225  C CA  . GLY E  1 68  ? -7.601  80.762  177.725 1.00 62.85  ? 68   GLY E CA  1 
ATOM   6226  C C   . GLY E  1 68  ? -7.995  79.472  178.395 1.00 62.64  ? 68   GLY E C   1 
ATOM   6227  O O   . GLY E  1 68  ? -7.584  78.397  177.957 1.00 62.75  ? 68   GLY E O   1 
ATOM   6228  N N   . HIS E  1 69  ? -8.802  79.549  179.448 1.00 62.06  ? 69   HIS E N   1 
ATOM   6229  C CA  . HIS E  1 69  ? -9.159  78.327  180.144 1.00 60.32  ? 69   HIS E CA  1 
ATOM   6230  C C   . HIS E  1 69  ? -9.973  77.393  179.266 1.00 59.38  ? 69   HIS E C   1 
ATOM   6231  O O   . HIS E  1 69  ? -9.899  76.178  179.426 1.00 58.39  ? 69   HIS E O   1 
ATOM   6232  C CB  . HIS E  1 69  ? -9.877  78.621  181.486 1.00 60.72  ? 69   HIS E CB  1 
ATOM   6233  C CG  . HIS E  1 69  ? -11.274 79.157  181.346 1.00 61.01  ? 69   HIS E CG  1 
ATOM   6234  N ND1 . HIS E  1 69  ? -11.551 80.505  181.219 1.00 60.57  ? 69   HIS E ND1 1 
ATOM   6235  C CD2 . HIS E  1 69  ? -12.470 78.519  181.290 1.00 59.61  ? 69   HIS E CD2 1 
ATOM   6236  C CE1 . HIS E  1 69  ? -12.856 80.672  181.088 1.00 59.59  ? 69   HIS E CE1 1 
ATOM   6237  N NE2 . HIS E  1 69  ? -13.434 79.483  181.126 1.00 59.45  ? 69   HIS E NE2 1 
ATOM   6238  N N   . ARG E  1 70  ? -10.729 77.935  178.318 1.00 59.10  ? 70   ARG E N   1 
ATOM   6239  C CA  . ARG E  1 70  ? -11.513 77.058  177.446 1.00 60.10  ? 70   ARG E CA  1 
ATOM   6240  C C   . ARG E  1 70  ? -10.571 76.353  176.500 1.00 59.19  ? 70   ARG E C   1 
ATOM   6241  O O   . ARG E  1 70  ? -10.718 75.155  176.221 1.00 58.84  ? 70   ARG E O   1 
ATOM   6242  C CB  . ARG E  1 70  ? -12.542 77.839  176.631 1.00 62.55  ? 70   ARG E CB  1 
ATOM   6243  C CG  . ARG E  1 70  ? -13.593 78.539  177.467 1.00 66.65  ? 70   ARG E CG  1 
ATOM   6244  C CD  . ARG E  1 70  ? -15.002 78.008  177.229 1.00 70.07  ? 70   ARG E CD  1 
ATOM   6245  N NE  . ARG E  1 70  ? -15.924 78.619  178.190 1.00 73.95  ? 70   ARG E NE  1 
ATOM   6246  C CZ  . ARG E  1 70  ? -16.102 79.936  178.321 1.00 75.16  ? 70   ARG E CZ  1 
ATOM   6247  N NH1 . ARG E  1 70  ? -15.431 80.785  177.541 1.00 77.25  ? 70   ARG E NH1 1 
ATOM   6248  N NH2 . ARG E  1 70  ? -16.911 80.411  179.261 1.00 75.81  ? 70   ARG E NH2 1 
ATOM   6249  N N   . VAL E  1 71  ? -9.590  77.106  176.009 1.00 57.61  ? 71   VAL E N   1 
ATOM   6250  C CA  . VAL E  1 71  ? -8.624  76.554  175.087 1.00 55.22  ? 71   VAL E CA  1 
ATOM   6251  C C   . VAL E  1 71  ? -7.848  75.448  175.765 1.00 55.58  ? 71   VAL E C   1 
ATOM   6252  O O   . VAL E  1 71  ? -7.618  74.377  175.173 1.00 54.98  ? 71   VAL E O   1 
ATOM   6253  C CB  . VAL E  1 71  ? -7.671  77.634  174.590 1.00 53.58  ? 71   VAL E CB  1 
ATOM   6254  C CG1 . VAL E  1 71  ? -6.615  77.021  173.729 1.00 52.84  ? 71   VAL E CG1 1 
ATOM   6255  C CG2 . VAL E  1 71  ? -8.435  78.665  173.805 1.00 51.07  ? 71   VAL E CG2 1 
ATOM   6256  N N   . ILE E  1 72  ? -7.462  75.688  177.017 1.00 55.90  ? 72   ILE E N   1 
ATOM   6257  C CA  . ILE E  1 72  ? -6.686  74.691  177.754 1.00 56.30  ? 72   ILE E CA  1 
ATOM   6258  C C   . ILE E  1 72  ? -7.463  73.395  177.852 1.00 56.69  ? 72   ILE E C   1 
ATOM   6259  O O   . ILE E  1 72  ? -6.924  72.315  177.626 1.00 56.93  ? 72   ILE E O   1 
ATOM   6260  C CB  . ILE E  1 72  ? -6.293  75.216  179.160 1.00 55.75  ? 72   ILE E CB  1 
ATOM   6261  C CG1 . ILE E  1 72  ? -5.140  76.193  179.025 1.00 57.05  ? 72   ILE E CG1 1 
ATOM   6262  C CG2 . ILE E  1 72  ? -5.807  74.095  180.039 1.00 55.91  ? 72   ILE E CG2 1 
ATOM   6263  C CD1 . ILE E  1 72  ? -4.790  76.919  180.301 1.00 58.42  ? 72   ILE E CD1 1 
ATOM   6264  N N   . ASN E  1 73  ? -8.755  73.498  178.147 1.00 58.06  ? 73   ASN E N   1 
ATOM   6265  C CA  . ASN E  1 73  ? -9.574  72.290  178.272 1.00 57.42  ? 73   ASN E CA  1 
ATOM   6266  C C   . ASN E  1 73  ? -9.809  71.651  176.943 1.00 55.61  ? 73   ASN E C   1 
ATOM   6267  O O   . ASN E  1 73  ? -9.828  70.427  176.837 1.00 55.07  ? 73   ASN E O   1 
ATOM   6268  C CB  . ASN E  1 73  ? -10.909 72.584  178.968 1.00 60.51  ? 73   ASN E CB  1 
ATOM   6269  C CG  . ASN E  1 73  ? -10.753 72.718  180.484 1.00 62.57  ? 73   ASN E CG  1 
ATOM   6270  O OD1 . ASN E  1 73  ? -9.840  72.117  181.094 1.00 63.77  ? 73   ASN E OD1 1 
ATOM   6271  N ND2 . ASN E  1 73  ? -11.646 73.490  181.100 1.00 62.85  ? 73   ASN E ND2 1 
ATOM   6272  N N   . LEU E  1 74  ? -9.990  72.472  175.919 1.00 54.47  ? 74   LEU E N   1 
ATOM   6273  C CA  . LEU E  1 74  ? -10.165 71.922  174.593 1.00 53.52  ? 74   LEU E CA  1 
ATOM   6274  C C   . LEU E  1 74  ? -8.943  71.071  174.296 1.00 53.07  ? 74   LEU E C   1 
ATOM   6275  O O   . LEU E  1 74  ? -9.078  69.937  173.853 1.00 53.66  ? 74   LEU E O   1 
ATOM   6276  C CB  . LEU E  1 74  ? -10.276 73.033  173.569 1.00 53.81  ? 74   LEU E CB  1 
ATOM   6277  C CG  . LEU E  1 74  ? -11.654 73.650  173.333 1.00 53.95  ? 74   LEU E CG  1 
ATOM   6278  C CD1 . LEU E  1 74  ? -11.518 74.910  172.514 1.00 53.16  ? 74   LEU E CD1 1 
ATOM   6279  C CD2 . LEU E  1 74  ? -12.544 72.651  172.596 1.00 53.97  ? 74   LEU E CD2 1 
ATOM   6280  N N   . ALA E  1 75  ? -7.755  71.605  174.584 1.00 52.28  ? 75   ALA E N   1 
ATOM   6281  C CA  . ALA E  1 75  ? -6.512  70.881  174.327 1.00 51.42  ? 75   ALA E CA  1 
ATOM   6282  C C   . ALA E  1 75  ? -6.403  69.603  175.118 1.00 51.26  ? 75   ALA E C   1 
ATOM   6283  O O   . ALA E  1 75  ? -6.083  68.545  174.558 1.00 49.56  ? 75   ALA E O   1 
ATOM   6284  C CB  . ALA E  1 75  ? -5.308  71.763  174.622 1.00 51.00  ? 75   ALA E CB  1 
ATOM   6285  N N   . ASN E  1 76  ? -6.674  69.694  176.418 1.00 51.77  ? 76   ASN E N   1 
ATOM   6286  C CA  . ASN E  1 76  ? -6.542  68.517  177.259 1.00 53.24  ? 76   ASN E CA  1 
ATOM   6287  C C   . ASN E  1 76  ? -7.476  67.393  176.822 1.00 53.84  ? 76   ASN E C   1 
ATOM   6288  O O   . ASN E  1 76  ? -7.096  66.214  176.865 1.00 53.42  ? 76   ASN E O   1 
ATOM   6289  C CB  . ASN E  1 76  ? -6.791  68.859  178.734 1.00 54.59  ? 76   ASN E CB  1 
ATOM   6290  C CG  . ASN E  1 76  ? -5.610  69.574  179.395 1.00 54.53  ? 76   ASN E CG  1 
ATOM   6291  O OD1 . ASN E  1 76  ? -4.454  69.194  179.230 1.00 54.56  ? 76   ASN E OD1 1 
ATOM   6292  N ND2 . ASN E  1 76  ? -5.910  70.604  180.167 1.00 55.42  ? 76   ASN E ND2 1 
ATOM   6293  N N   . GLU E  1 77  ? -8.688  67.758  176.400 1.00 53.80  ? 77   GLU E N   1 
ATOM   6294  C CA  . GLU E  1 77  ? -9.655  66.764  175.959 1.00 54.35  ? 77   GLU E CA  1 
ATOM   6295  C C   . GLU E  1 77  ? -9.317  66.238  174.561 1.00 53.72  ? 77   GLU E C   1 
ATOM   6296  O O   . GLU E  1 77  ? -9.558  65.074  174.250 1.00 53.76  ? 77   GLU E O   1 
ATOM   6297  C CB  . GLU E  1 77  ? -11.084 67.352  175.991 1.00 56.05  ? 77   GLU E CB  1 
ATOM   6298  C CG  . GLU E  1 77  ? -11.579 67.725  177.395 1.00 56.66  ? 77   GLU E CG  1 
ATOM   6299  C CD  . GLU E  1 77  ? -11.596 66.538  178.330 1.00 56.78  ? 77   GLU E CD  1 
ATOM   6300  O OE1 . GLU E  1 77  ? -11.527 66.733  179.567 1.00 57.13  ? 77   GLU E OE1 1 
ATOM   6301  O OE2 . GLU E  1 77  ? -11.675 65.411  177.809 1.00 58.13  ? 77   GLU E OE2 1 
ATOM   6302  N N   . MET E  1 78  ? -8.742  67.089  173.718 1.00 53.00  ? 78   MET E N   1 
ATOM   6303  C CA  . MET E  1 78  ? -8.393  66.658  172.366 1.00 51.70  ? 78   MET E CA  1 
ATOM   6304  C C   . MET E  1 78  ? -7.198  65.714  172.333 1.00 50.78  ? 78   MET E C   1 
ATOM   6305  O O   . MET E  1 78  ? -7.239  64.685  171.658 1.00 50.68  ? 78   MET E O   1 
ATOM   6306  C CB  . MET E  1 78  ? -8.112  67.871  171.486 1.00 51.32  ? 78   MET E CB  1 
ATOM   6307  C CG  . MET E  1 78  ? -7.961  67.547  170.027 1.00 51.10  ? 78   MET E CG  1 
ATOM   6308  S SD  . MET E  1 78  ? -9.433  66.807  169.272 1.00 51.20  ? 78   MET E SD  1 
ATOM   6309  C CE  . MET E  1 78  ? -10.509 68.286  169.122 1.00 49.66  ? 78   MET E CE  1 
ATOM   6310  N N   . PHE E  1 79  ? -6.153  66.044  173.094 1.00 49.78  ? 79   PHE E N   1 
ATOM   6311  C CA  . PHE E  1 79  ? -4.921  65.250  173.110 1.00 48.34  ? 79   PHE E CA  1 
ATOM   6312  C C   . PHE E  1 79  ? -4.601  64.494  174.381 1.00 47.91  ? 79   PHE E C   1 
ATOM   6313  O O   . PHE E  1 79  ? -3.660  63.711  174.394 1.00 48.27  ? 79   PHE E O   1 
ATOM   6314  C CB  . PHE E  1 79  ? -3.703  66.149  172.831 1.00 48.97  ? 79   PHE E CB  1 
ATOM   6315  C CG  . PHE E  1 79  ? -3.864  67.069  171.651 1.00 47.88  ? 79   PHE E CG  1 
ATOM   6316  C CD1 . PHE E  1 79  ? -3.869  66.566  170.366 1.00 47.23  ? 79   PHE E CD1 1 
ATOM   6317  C CD2 . PHE E  1 79  ? -4.006  68.448  171.838 1.00 48.37  ? 79   PHE E CD2 1 
ATOM   6318  C CE1 . PHE E  1 79  ? -4.011  67.419  169.261 1.00 48.24  ? 79   PHE E CE1 1 
ATOM   6319  C CE2 . PHE E  1 79  ? -4.153  69.314  170.746 1.00 48.99  ? 79   PHE E CE2 1 
ATOM   6320  C CZ  . PHE E  1 79  ? -4.154  68.792  169.448 1.00 48.66  ? 79   PHE E CZ  1 
ATOM   6321  N N   . GLY E  1 80  ? -5.346  64.730  175.453 1.00 47.77  ? 80   GLY E N   1 
ATOM   6322  C CA  . GLY E  1 80  ? -5.044  64.068  176.709 1.00 46.71  ? 80   GLY E CA  1 
ATOM   6323  C C   . GLY E  1 80  ? -4.180  65.014  177.531 1.00 46.50  ? 80   GLY E C   1 
ATOM   6324  O O   . GLY E  1 80  ? -3.422  65.789  176.974 1.00 48.62  ? 80   GLY E O   1 
ATOM   6325  N N   . TYR E  1 81  ? -4.285  64.980  178.849 1.00 44.86  ? 81   TYR E N   1 
ATOM   6326  C CA  . TYR E  1 81  ? -3.478  65.871  179.667 1.00 42.77  ? 81   TYR E CA  1 
ATOM   6327  C C   . TYR E  1 81  ? -2.004  65.668  179.369 1.00 42.34  ? 81   TYR E C   1 
ATOM   6328  O O   . TYR E  1 81  ? -1.215  66.593  179.553 1.00 43.67  ? 81   TYR E O   1 
ATOM   6329  C CB  . TYR E  1 81  ? -3.707  65.627  181.172 1.00 40.74  ? 81   TYR E CB  1 
ATOM   6330  C CG  . TYR E  1 81  ? -3.188  64.283  181.683 1.00 38.06  ? 81   TYR E CG  1 
ATOM   6331  C CD1 . TYR E  1 81  ? -3.956  63.113  181.554 1.00 37.42  ? 81   TYR E CD1 1 
ATOM   6332  C CD2 . TYR E  1 81  ? -1.926  64.181  182.255 1.00 34.55  ? 81   TYR E CD2 1 
ATOM   6333  C CE1 . TYR E  1 81  ? -3.464  61.878  181.981 1.00 36.43  ? 81   TYR E CE1 1 
ATOM   6334  C CE2 . TYR E  1 81  ? -1.436  62.961  182.680 1.00 34.91  ? 81   TYR E CE2 1 
ATOM   6335  C CZ  . TYR E  1 81  ? -2.208  61.808  182.542 1.00 35.61  ? 81   TYR E CZ  1 
ATOM   6336  O OH  . TYR E  1 81  ? -1.726  60.578  182.968 1.00 36.16  ? 81   TYR E OH  1 
ATOM   6337  N N   . ASN E  1 82  ? -1.634  64.471  178.926 1.00 40.40  ? 82   ASN E N   1 
ATOM   6338  C CA  . ASN E  1 82  ? -0.232  64.178  178.635 1.00 41.25  ? 82   ASN E CA  1 
ATOM   6339  C C   . ASN E  1 82  ? 0.070   64.082  177.121 1.00 42.68  ? 82   ASN E C   1 
ATOM   6340  O O   . ASN E  1 82  ? 1.077   63.470  176.708 1.00 39.90  ? 82   ASN E O   1 
ATOM   6341  C CB  . ASN E  1 82  ? 0.148   62.844  179.259 1.00 42.10  ? 82   ASN E CB  1 
ATOM   6342  C CG  . ASN E  1 82  ? -0.525  61.669  178.564 1.00 41.44  ? 82   ASN E CG  1 
ATOM   6343  O OD1 . ASN E  1 82  ? -0.033  60.541  178.614 1.00 42.55  ? 82   ASN E OD1 1 
ATOM   6344  N ND2 . ASN E  1 82  ? -1.659  61.934  177.915 1.00 39.63  ? 82   ASN E ND2 1 
ATOM   6345  N N   . GLY E  1 83  ? -0.824  64.661  176.314 1.00 44.09  ? 83   GLY E N   1 
ATOM   6346  C CA  . GLY E  1 83  ? -0.698  64.614  174.872 1.00 45.39  ? 83   GLY E CA  1 
ATOM   6347  C C   . GLY E  1 83  ? -0.213  65.876  174.208 1.00 44.87  ? 83   GLY E C   1 
ATOM   6348  O O   . GLY E  1 83  ? 0.075   65.874  173.014 1.00 45.57  ? 83   GLY E O   1 
ATOM   6349  N N   . TRP E  1 84  ? -0.128  66.956  174.965 1.00 44.35  ? 84   TRP E N   1 
ATOM   6350  C CA  . TRP E  1 84  ? 0.361   68.211  174.417 1.00 43.99  ? 84   TRP E CA  1 
ATOM   6351  C C   . TRP E  1 84  ? 1.163   68.926  175.494 1.00 44.38  ? 84   TRP E C   1 
ATOM   6352  O O   . TRP E  1 84  ? 0.999   68.649  176.684 1.00 45.01  ? 84   TRP E O   1 
ATOM   6353  C CB  . TRP E  1 84  ? -0.796  69.090  173.956 1.00 44.44  ? 84   TRP E CB  1 
ATOM   6354  C CG  . TRP E  1 84  ? -1.634  69.637  175.074 1.00 45.16  ? 84   TRP E CG  1 
ATOM   6355  C CD1 . TRP E  1 84  ? -2.557  68.958  175.815 1.00 44.16  ? 84   TRP E CD1 1 
ATOM   6356  C CD2 . TRP E  1 84  ? -1.619  70.985  175.579 1.00 45.40  ? 84   TRP E CD2 1 
ATOM   6357  N NE1 . TRP E  1 84  ? -3.118  69.800  176.742 1.00 45.91  ? 84   TRP E NE1 1 
ATOM   6358  C CE2 . TRP E  1 84  ? -2.560  71.046  176.626 1.00 45.60  ? 84   TRP E CE2 1 
ATOM   6359  C CE3 . TRP E  1 84  ? -0.896  72.149  175.246 1.00 44.60  ? 84   TRP E CE3 1 
ATOM   6360  C CZ2 . TRP E  1 84  ? -2.803  72.218  177.348 1.00 45.08  ? 84   TRP E CZ2 1 
ATOM   6361  C CZ3 . TRP E  1 84  ? -1.136  73.316  175.954 1.00 44.00  ? 84   TRP E CZ3 1 
ATOM   6362  C CH2 . TRP E  1 84  ? -2.083  73.341  176.999 1.00 45.61  ? 84   TRP E CH2 1 
ATOM   6363  N N   . ALA E  1 85  ? 2.028   69.846  175.081 1.00 43.85  ? 85   ALA E N   1 
ATOM   6364  C CA  . ALA E  1 85  ? 2.865   70.588  176.016 1.00 42.48  ? 85   ALA E CA  1 
ATOM   6365  C C   . ALA E  1 85  ? 3.151   71.927  175.426 1.00 41.78  ? 85   ALA E C   1 
ATOM   6366  O O   . ALA E  1 85  ? 2.861   72.156  174.253 1.00 43.34  ? 85   ALA E O   1 
ATOM   6367  C CB  . ALA E  1 85  ? 4.174   69.856  176.234 1.00 41.85  ? 85   ALA E CB  1 
ATOM   6368  N N   . HIS E  1 86  ? 3.692   72.827  176.224 1.00 40.55  ? 86   HIS E N   1 
ATOM   6369  C CA  . HIS E  1 86  ? 4.052   74.125  175.681 1.00 41.11  ? 86   HIS E CA  1 
ATOM   6370  C C   . HIS E  1 86  ? 5.129   74.748  176.528 1.00 40.15  ? 86   HIS E C   1 
ATOM   6371  O O   . HIS E  1 86  ? 5.229   74.470  177.712 1.00 38.54  ? 86   HIS E O   1 
ATOM   6372  C CB  . HIS E  1 86  ? 2.847   75.064  175.537 1.00 41.73  ? 86   HIS E CB  1 
ATOM   6373  C CG  . HIS E  1 86  ? 2.383   75.678  176.823 1.00 45.92  ? 86   HIS E CG  1 
ATOM   6374  N ND1 . HIS E  1 86  ? 1.686   74.972  177.787 1.00 46.04  ? 86   HIS E ND1 1 
ATOM   6375  C CD2 . HIS E  1 86  ? 2.478   76.951  177.286 1.00 46.47  ? 86   HIS E CD2 1 
ATOM   6376  C CE1 . HIS E  1 86  ? 1.373   75.785  178.780 1.00 46.83  ? 86   HIS E CE1 1 
ATOM   6377  N NE2 . HIS E  1 86  ? 1.840   76.992  178.502 1.00 46.34  ? 86   HIS E NE2 1 
ATOM   6378  N N   . SER E  1 87  ? 5.978   75.542  175.891 1.00 40.04  ? 87   SER E N   1 
ATOM   6379  C CA  . SER E  1 87  ? 7.058   76.215  176.593 1.00 39.80  ? 87   SER E CA  1 
ATOM   6380  C C   . SER E  1 87  ? 7.128   77.626  176.022 1.00 39.75  ? 87   SER E C   1 
ATOM   6381  O O   . SER E  1 87  ? 6.547   77.908  174.962 1.00 39.10  ? 87   SER E O   1 
ATOM   6382  C CB  . SER E  1 87  ? 8.388   75.473  176.412 1.00 38.34  ? 87   SER E CB  1 
ATOM   6383  O OG  . SER E  1 87  ? 8.744   75.370  175.046 1.00 40.20  ? 87   SER E OG  1 
ATOM   6384  N N   . ILE E  1 88  ? 7.787   78.520  176.755 1.00 39.99  ? 88   ILE E N   1 
ATOM   6385  C CA  . ILE E  1 88  ? 7.941   79.912  176.333 1.00 40.12  ? 88   ILE E CA  1 
ATOM   6386  C C   . ILE E  1 88  ? 9.358   80.011  175.785 1.00 41.49  ? 88   ILE E C   1 
ATOM   6387  O O   . ILE E  1 88  ? 10.326  79.987  176.543 1.00 42.26  ? 88   ILE E O   1 
ATOM   6388  C CB  . ILE E  1 88  ? 7.747   80.864  177.536 1.00 38.67  ? 88   ILE E CB  1 
ATOM   6389  C CG1 . ILE E  1 88  ? 6.303   80.757  178.039 1.00 36.79  ? 88   ILE E CG1 1 
ATOM   6390  C CG2 . ILE E  1 88  ? 8.071   82.275  177.146 1.00 36.89  ? 88   ILE E CG2 1 
ATOM   6391  C CD1 . ILE E  1 88  ? 6.104   81.183  179.460 1.00 35.52  ? 88   ILE E CD1 1 
ATOM   6392  N N   . THR E  1 89  ? 9.498   80.080  174.469 1.00 42.74  ? 89   THR E N   1 
ATOM   6393  C CA  . THR E  1 89  ? 10.840  80.142  173.953 1.00 45.48  ? 89   THR E CA  1 
ATOM   6394  C C   . THR E  1 89  ? 11.419  81.489  174.340 1.00 45.18  ? 89   THR E C   1 
ATOM   6395  O O   . THR E  1 89  ? 12.608  81.604  174.607 1.00 45.81  ? 89   THR E O   1 
ATOM   6396  C CB  . THR E  1 89  ? 10.885  79.891  172.436 1.00 45.39  ? 89   THR E CB  1 
ATOM   6397  O OG1 . THR E  1 89  ? 9.918   80.715  171.815 1.00 51.06  ? 89   THR E OG1 1 
ATOM   6398  C CG2 . THR E  1 89  ? 10.516  78.457  172.122 1.00 46.75  ? 89   THR E CG2 1 
ATOM   6399  N N   . GLN E  1 90  ? 10.581  82.505  174.432 1.00 45.16  ? 90   GLN E N   1 
ATOM   6400  C CA  . GLN E  1 90  ? 11.100  83.803  174.835 1.00 46.00  ? 90   GLN E CA  1 
ATOM   6401  C C   . GLN E  1 90  ? 10.018  84.824  175.126 1.00 44.85  ? 90   GLN E C   1 
ATOM   6402  O O   . GLN E  1 90  ? 8.959   84.815  174.495 1.00 43.60  ? 90   GLN E O   1 
ATOM   6403  C CB  . GLN E  1 90  ? 12.017  84.373  173.744 1.00 47.58  ? 90   GLN E CB  1 
ATOM   6404  C CG  . GLN E  1 90  ? 12.792  85.569  174.216 1.00 51.73  ? 90   GLN E CG  1 
ATOM   6405  C CD  . GLN E  1 90  ? 13.406  86.364  173.095 1.00 54.83  ? 90   GLN E CD  1 
ATOM   6406  O OE1 . GLN E  1 90  ? 14.140  85.825  172.282 1.00 56.81  ? 90   GLN E OE1 1 
ATOM   6407  N NE2 . GLN E  1 90  ? 13.117  87.675  173.051 1.00 58.27  ? 90   GLN E NE2 1 
ATOM   6408  N N   . GLN E  1 91  ? 10.275  85.700  176.093 1.00 45.56  ? 91   GLN E N   1 
ATOM   6409  C CA  . GLN E  1 91  ? 9.311   86.776  176.362 1.00 46.58  ? 91   GLN E CA  1 
ATOM   6410  C C   . GLN E  1 91  ? 10.084  88.047  176.397 1.00 45.09  ? 91   GLN E C   1 
ATOM   6411  O O   . GLN E  1 91  ? 11.085  88.138  177.088 1.00 44.95  ? 91   GLN E O   1 
ATOM   6412  C CB  . GLN E  1 91  ? 8.563   86.631  177.696 1.00 47.79  ? 91   GLN E CB  1 
ATOM   6413  C CG  . GLN E  1 91  ? 7.536   87.752  177.836 1.00 49.41  ? 91   GLN E CG  1 
ATOM   6414  C CD  . GLN E  1 91  ? 6.606   87.596  179.006 1.00 50.20  ? 91   GLN E CD  1 
ATOM   6415  O OE1 . GLN E  1 91  ? 7.026   87.639  180.161 1.00 52.75  ? 91   GLN E OE1 1 
ATOM   6416  N NE2 . GLN E  1 91  ? 5.332   87.412  178.718 1.00 48.91  ? 91   GLN E NE2 1 
ATOM   6417  N N   . ASN E  1 92  ? 9.608   89.037  175.675 1.00 45.29  ? 92   ASN E N   1 
ATOM   6418  C CA  . ASN E  1 92  ? 10.326  90.282  175.637 1.00 46.80  ? 92   ASN E CA  1 
ATOM   6419  C C   . ASN E  1 92  ? 9.413   91.443  175.909 1.00 46.57  ? 92   ASN E C   1 
ATOM   6420  O O   . ASN E  1 92  ? 8.317   91.497  175.360 1.00 47.42  ? 92   ASN E O   1 
ATOM   6421  C CB  . ASN E  1 92  ? 10.981  90.430  174.271 1.00 49.94  ? 92   ASN E CB  1 
ATOM   6422  C CG  . ASN E  1 92  ? 11.918  91.617  174.201 1.00 52.61  ? 92   ASN E CG  1 
ATOM   6423  O OD1 . ASN E  1 92  ? 11.501  92.754  173.920 1.00 52.37  ? 92   ASN E OD1 1 
ATOM   6424  N ND2 . ASN E  1 92  ? 13.202  91.362  174.469 1.00 54.95  ? 92   ASN E ND2 1 
ATOM   6425  N N   . VAL E  1 93  ? 9.850   92.354  176.783 1.00 46.31  ? 93   VAL E N   1 
ATOM   6426  C CA  . VAL E  1 93  ? 9.069   93.543  177.108 1.00 45.17  ? 93   VAL E CA  1 
ATOM   6427  C C   . VAL E  1 93  ? 9.451   94.608  176.114 1.00 45.58  ? 93   VAL E C   1 
ATOM   6428  O O   . VAL E  1 93  ? 10.574  95.085  176.118 1.00 46.11  ? 93   VAL E O   1 
ATOM   6429  C CB  . VAL E  1 93  ? 9.384   94.063  178.511 1.00 45.18  ? 93   VAL E CB  1 
ATOM   6430  C CG1 . VAL E  1 93  ? 8.724   95.431  178.710 1.00 42.69  ? 93   VAL E CG1 1 
ATOM   6431  C CG2 . VAL E  1 93  ? 8.903   93.070  179.549 1.00 43.88  ? 93   VAL E CG2 1 
ATOM   6432  N N   . ASP E  1 94  ? 8.516   95.011  175.278 1.00 46.76  ? 94   ASP E N   1 
ATOM   6433  C CA  . ASP E  1 94  ? 8.825   95.994  174.261 1.00 49.33  ? 94   ASP E CA  1 
ATOM   6434  C C   . ASP E  1 94  ? 9.043   97.376  174.774 1.00 50.42  ? 94   ASP E C   1 
ATOM   6435  O O   . ASP E  1 94  ? 9.892   98.099  174.278 1.00 49.86  ? 94   ASP E O   1 
ATOM   6436  C CB  . ASP E  1 94  ? 7.729   96.015  173.201 1.00 50.94  ? 94   ASP E CB  1 
ATOM   6437  C CG  . ASP E  1 94  ? 7.773   94.795  172.328 1.00 52.12  ? 94   ASP E CG  1 
ATOM   6438  O OD1 . ASP E  1 94  ? 6.804   94.535  171.578 1.00 53.73  ? 94   ASP E OD1 1 
ATOM   6439  O OD2 . ASP E  1 94  ? 8.806   94.096  172.411 1.00 52.97  ? 94   ASP E OD2 1 
ATOM   6440  N N   . PHE E  1 95  ? 8.262   97.758  175.769 1.00 52.83  ? 95   PHE E N   1 
ATOM   6441  C CA  . PHE E  1 95  ? 8.395   99.094  176.312 1.00 54.64  ? 95   PHE E CA  1 
ATOM   6442  C C   . PHE E  1 95  ? 7.541   99.257  177.543 1.00 56.21  ? 95   PHE E C   1 
ATOM   6443  O O   . PHE E  1 95  ? 6.558   98.525  177.743 1.00 56.61  ? 95   PHE E O   1 
ATOM   6444  C CB  . PHE E  1 95  ? 7.974   100.142 175.267 1.00 54.41  ? 95   PHE E CB  1 
ATOM   6445  C CG  . PHE E  1 95  ? 6.521   100.066 174.877 1.00 55.89  ? 95   PHE E CG  1 
ATOM   6446  C CD1 . PHE E  1 95  ? 5.550   100.739 175.606 1.00 56.16  ? 95   PHE E CD1 1 
ATOM   6447  C CD2 . PHE E  1 95  ? 6.117   99.287  173.802 1.00 56.75  ? 95   PHE E CD2 1 
ATOM   6448  C CE1 . PHE E  1 95  ? 4.200   100.629 175.266 1.00 57.51  ? 95   PHE E CE1 1 
ATOM   6449  C CE2 . PHE E  1 95  ? 4.762   99.174  173.459 1.00 57.78  ? 95   PHE E CE2 1 
ATOM   6450  C CZ  . PHE E  1 95  ? 3.807   99.844  174.192 1.00 57.51  ? 95   PHE E CZ  1 
ATOM   6451  N N   . VAL E  1 96  ? 7.953   100.209 178.377 1.00 57.19  ? 96   VAL E N   1 
ATOM   6452  C CA  . VAL E  1 96  ? 7.226   100.580 179.574 1.00 57.06  ? 96   VAL E CA  1 
ATOM   6453  C C   . VAL E  1 96  ? 7.248   102.096 179.534 1.00 59.39  ? 96   VAL E C   1 
ATOM   6454  O O   . VAL E  1 96  ? 8.262   102.716 179.843 1.00 59.86  ? 96   VAL E O   1 
ATOM   6455  C CB  . VAL E  1 96  ? 7.903   100.069 180.823 1.00 53.79  ? 96   VAL E CB  1 
ATOM   6456  C CG1 . VAL E  1 96  ? 7.177   100.569 182.031 1.00 52.56  ? 96   VAL E CG1 1 
ATOM   6457  C CG2 . VAL E  1 96  ? 7.885   98.593  180.814 1.00 52.09  ? 96   VAL E CG2 1 
ATOM   6458  N N   . ASP E  1 97  ? 6.149   102.691 179.084 1.00 61.80  ? 97   ASP E N   1 
ATOM   6459  C CA  . ASP E  1 97  ? 6.074   104.143 179.021 1.00 65.07  ? 97   ASP E CA  1 
ATOM   6460  C C   . ASP E  1 97  ? 5.171   104.743 180.100 1.00 67.14  ? 97   ASP E C   1 
ATOM   6461  O O   . ASP E  1 97  ? 4.122   104.175 180.434 1.00 66.55  ? 97   ASP E O   1 
ATOM   6462  C CB  . ASP E  1 97  ? 5.566   104.598 177.651 1.00 64.60  ? 97   ASP E CB  1 
ATOM   6463  C CG  . ASP E  1 97  ? 6.563   104.340 176.535 1.00 64.82  ? 97   ASP E CG  1 
ATOM   6464  O OD1 . ASP E  1 97  ? 7.774   104.191 176.811 1.00 66.62  ? 97   ASP E OD1 1 
ATOM   6465  O OD2 . ASP E  1 97  ? 6.142   104.305 175.370 1.00 63.02  ? 97   ASP E OD2 1 
ATOM   6466  N N   . LEU E  1 98  ? 5.610   105.882 180.642 1.00 69.77  ? 98   LEU E N   1 
ATOM   6467  C CA  . LEU E  1 98  ? 4.880   106.652 181.665 1.00 72.82  ? 98   LEU E CA  1 
ATOM   6468  C C   . LEU E  1 98  ? 4.561   107.956 180.957 1.00 74.02  ? 98   LEU E C   1 
ATOM   6469  O O   . LEU E  1 98  ? 5.456   108.757 180.742 1.00 73.82  ? 98   LEU E O   1 
ATOM   6470  C CB  . LEU E  1 98  ? 5.784   106.942 182.856 1.00 73.46  ? 98   LEU E CB  1 
ATOM   6471  C CG  . LEU E  1 98  ? 5.265   107.959 183.868 1.00 74.51  ? 98   LEU E CG  1 
ATOM   6472  C CD1 . LEU E  1 98  ? 4.267   107.300 184.845 1.00 74.61  ? 98   LEU E CD1 1 
ATOM   6473  C CD2 . LEU E  1 98  ? 6.463   108.537 184.603 1.00 73.88  ? 98   LEU E CD2 1 
ATOM   6474  N N   . ASN E  1 99  ? 3.302   108.181 180.600 1.00 76.80  ? 99   ASN E N   1 
ATOM   6475  C CA  . ASN E  1 99  ? 2.960   109.388 179.842 1.00 79.60  ? 99   ASN E CA  1 
ATOM   6476  C C   . ASN E  1 99  ? 2.115   110.449 180.524 1.00 80.96  ? 99   ASN E C   1 
ATOM   6477  O O   . ASN E  1 99  ? 1.775   111.470 179.920 1.00 81.70  ? 99   ASN E O   1 
ATOM   6478  C CB  . ASN E  1 99  ? 2.285   108.988 178.524 1.00 80.47  ? 99   ASN E CB  1 
ATOM   6479  C CG  . ASN E  1 99  ? 3.276   108.408 177.508 1.00 81.12  ? 99   ASN E CG  1 
ATOM   6480  O OD1 . ASN E  1 99  ? 2.869   107.788 176.516 1.00 81.62  ? 99   ASN E OD1 1 
ATOM   6481  N ND2 . ASN E  1 99  ? 4.580   108.620 177.746 1.00 79.97  ? 99   ASN E ND2 1 
ATOM   6482  N N   . ASN E  1 100 ? 1.782   110.211 181.780 1.00 82.18  ? 100  ASN E N   1 
ATOM   6483  C CA  . ASN E  1 100 ? 0.967   111.128 182.565 1.00 83.38  ? 100  ASN E CA  1 
ATOM   6484  C C   . ASN E  1 100 ? 1.323   110.573 183.923 1.00 82.73  ? 100  ASN E C   1 
ATOM   6485  O O   . ASN E  1 100 ? 2.459   110.705 184.370 1.00 83.13  ? 100  ASN E O   1 
ATOM   6486  C CB  . ASN E  1 100 ? -0.507  110.882 182.239 1.00 86.14  ? 100  ASN E CB  1 
ATOM   6487  C CG  . ASN E  1 100 ? -0.683  109.771 181.185 1.00 89.06  ? 100  ASN E CG  1 
ATOM   6488  O OD1 . ASN E  1 100 ? -0.500  109.999 179.976 1.00 90.49  ? 100  ASN E OD1 1 
ATOM   6489  N ND2 . ASN E  1 100 ? -1.002  108.558 181.645 1.00 89.68  ? 100  ASN E ND2 1 
ATOM   6490  N N   . GLY E  1 101 ? 0.369   109.920 184.560 1.00 81.76  ? 101  GLY E N   1 
ATOM   6491  C CA  . GLY E  1 101 ? 0.640   109.312 185.841 1.00 81.02  ? 101  GLY E CA  1 
ATOM   6492  C C   . GLY E  1 101 ? 0.312   107.864 185.587 1.00 80.83  ? 101  GLY E C   1 
ATOM   6493  O O   . GLY E  1 101 ? 0.250   107.028 186.510 1.00 81.34  ? 101  GLY E O   1 
ATOM   6494  N N   . LYS E  1 102 ? 0.106   107.577 184.300 1.00 79.87  ? 102  LYS E N   1 
ATOM   6495  C CA  . LYS E  1 102 ? -0.250  106.236 183.846 1.00 78.39  ? 102  LYS E CA  1 
ATOM   6496  C C   . LYS E  1 102 ? 0.814   105.533 182.987 1.00 76.30  ? 102  LYS E C   1 
ATOM   6497  O O   . LYS E  1 102 ? 1.615   106.174 182.299 1.00 75.28  ? 102  LYS E O   1 
ATOM   6498  C CB  . LYS E  1 102 ? -1.564  106.299 183.082 1.00 79.03  ? 102  LYS E CB  1 
ATOM   6499  C CG  . LYS E  1 102 ? -2.654  107.006 183.834 1.00 80.18  ? 102  LYS E CG  1 
ATOM   6500  C CD  . LYS E  1 102 ? -3.780  107.336 182.879 1.00 81.97  ? 102  LYS E CD  1 
ATOM   6501  C CE  . LYS E  1 102 ? -5.024  107.815 183.618 1.00 83.06  ? 102  LYS E CE  1 
ATOM   6502  N NZ  . LYS E  1 102 ? -6.168  108.016 182.689 1.00 83.37  ? 102  LYS E NZ  1 
ATOM   6503  N N   . PHE E  1 103 ? 0.791   104.202 183.046 1.00 73.79  ? 103  PHE E N   1 
ATOM   6504  C CA  . PHE E  1 103 ? 1.723   103.359 182.321 1.00 70.65  ? 103  PHE E CA  1 
ATOM   6505  C C   . PHE E  1 103 ? 1.159   102.671 181.082 1.00 68.19  ? 103  PHE E C   1 
ATOM   6506  O O   . PHE E  1 103 ? 0.017   102.187 181.065 1.00 67.44  ? 103  PHE E O   1 
ATOM   6507  C CB  . PHE E  1 103 ? 2.293   102.299 183.260 1.00 70.12  ? 103  PHE E CB  1 
ATOM   6508  C CG  . PHE E  1 103 ? 3.195   102.853 184.318 1.00 70.24  ? 103  PHE E CG  1 
ATOM   6509  C CD1 . PHE E  1 103 ? 2.755   102.974 185.633 1.00 70.34  ? 103  PHE E CD1 1 
ATOM   6510  C CD2 . PHE E  1 103 ? 4.496   103.236 184.007 1.00 69.64  ? 103  PHE E CD2 1 
ATOM   6511  C CE1 . PHE E  1 103 ? 3.596   103.461 186.616 1.00 69.50  ? 103  PHE E CE1 1 
ATOM   6512  C CE2 . PHE E  1 103 ? 5.343   103.727 184.989 1.00 69.25  ? 103  PHE E CE2 1 
ATOM   6513  C CZ  . PHE E  1 103 ? 4.890   103.837 186.294 1.00 69.48  ? 103  PHE E CZ  1 
ATOM   6514  N N   . TYR E  1 104 ? 2.003   102.630 180.056 1.00 65.72  ? 104  TYR E N   1 
ATOM   6515  C CA  . TYR E  1 104 ? 1.691   101.998 178.789 1.00 63.85  ? 104  TYR E CA  1 
ATOM   6516  C C   . TYR E  1 104 ? 2.736   100.931 178.570 1.00 62.20  ? 104  TYR E C   1 
ATOM   6517  O O   . TYR E  1 104 ? 3.932   101.226 178.434 1.00 62.84  ? 104  TYR E O   1 
ATOM   6518  C CB  . TYR E  1 104 ? 1.684   103.046 177.679 1.00 63.79  ? 104  TYR E CB  1 
ATOM   6519  C CG  . TYR E  1 104 ? 0.636   104.089 177.981 1.00 64.71  ? 104  TYR E CG  1 
ATOM   6520  C CD1 . TYR E  1 104 ? 0.889   105.118 178.895 1.00 65.46  ? 104  TYR E CD1 1 
ATOM   6521  C CD2 . TYR E  1 104 ? -0.659  103.949 177.504 1.00 64.87  ? 104  TYR E CD2 1 
ATOM   6522  C CE1 . TYR E  1 104 ? -0.128  105.969 179.343 1.00 65.71  ? 104  TYR E CE1 1 
ATOM   6523  C CE2 . TYR E  1 104 ? -1.691  104.795 177.942 1.00 66.13  ? 104  TYR E CE2 1 
ATOM   6524  C CZ  . TYR E  1 104 ? -1.421  105.799 178.866 1.00 65.60  ? 104  TYR E CZ  1 
ATOM   6525  O OH  . TYR E  1 104 ? -2.446  106.600 179.322 1.00 64.10  ? 104  TYR E OH  1 
ATOM   6526  N N   . VAL E  1 105 ? 2.278   99.687  178.553 1.00 59.65  ? 105  VAL E N   1 
ATOM   6527  C CA  . VAL E  1 105 ? 3.166   98.545  178.409 1.00 58.18  ? 105  VAL E CA  1 
ATOM   6528  C C   . VAL E  1 105 ? 2.818   97.525  177.325 1.00 57.26  ? 105  VAL E C   1 
ATOM   6529  O O   . VAL E  1 105 ? 1.672   97.036  177.234 1.00 57.62  ? 105  VAL E O   1 
ATOM   6530  C CB  . VAL E  1 105 ? 3.250   97.800  179.745 1.00 58.25  ? 105  VAL E CB  1 
ATOM   6531  C CG1 . VAL E  1 105 ? 4.247   96.669  179.668 1.00 56.88  ? 105  VAL E CG1 1 
ATOM   6532  C CG2 . VAL E  1 105 ? 3.615   98.785  180.833 1.00 58.37  ? 105  VAL E CG2 1 
ATOM   6533  N N   . GLY E  1 106 ? 3.829   97.188  176.522 1.00 55.58  ? 106  GLY E N   1 
ATOM   6534  C CA  . GLY E  1 106 ? 3.668   96.205  175.464 1.00 52.44  ? 106  GLY E CA  1 
ATOM   6535  C C   . GLY E  1 106 ? 4.634   95.055  175.662 1.00 50.18  ? 106  GLY E C   1 
ATOM   6536  O O   . GLY E  1 106 ? 5.839   95.278  175.788 1.00 50.96  ? 106  GLY E O   1 
ATOM   6537  N N   . VAL E  1 107 ? 4.121   93.830  175.701 1.00 47.56  ? 107  VAL E N   1 
ATOM   6538  C CA  . VAL E  1 107 ? 4.972   92.652  175.878 1.00 44.90  ? 107  VAL E CA  1 
ATOM   6539  C C   . VAL E  1 107 ? 4.630   91.543  174.882 1.00 44.80  ? 107  VAL E C   1 
ATOM   6540  O O   . VAL E  1 107 ? 3.448   91.290  174.570 1.00 46.25  ? 107  VAL E O   1 
ATOM   6541  C CB  . VAL E  1 107 ? 4.847   92.085  177.305 1.00 43.29  ? 107  VAL E CB  1 
ATOM   6542  C CG1 . VAL E  1 107 ? 5.550   90.753  177.421 1.00 41.21  ? 107  VAL E CG1 1 
ATOM   6543  C CG2 . VAL E  1 107 ? 5.450   93.063  178.280 1.00 42.50  ? 107  VAL E CG2 1 
ATOM   6544  N N   . CYS E  1 108 ? 5.660   90.881  174.360 1.00 42.36  ? 108  CYS E N   1 
ATOM   6545  C CA  . CYS E  1 108 ? 5.418   89.785  173.426 1.00 39.01  ? 108  CYS E CA  1 
ATOM   6546  C C   . CYS E  1 108 ? 5.995   88.496  173.979 1.00 37.05  ? 108  CYS E C   1 
ATOM   6547  O O   . CYS E  1 108 ? 6.932   88.510  174.780 1.00 36.66  ? 108  CYS E O   1 
ATOM   6548  C CB  . CYS E  1 108 ? 6.007   90.100  172.039 1.00 39.42  ? 108  CYS E CB  1 
ATOM   6549  S SG  . CYS E  1 108 ? 7.794   90.194  171.907 1.00 37.32  ? 108  CYS E SG  1 
ATOM   6550  N N   . ALA E  1 109 ? 5.398   87.380  173.596 1.00 35.37  ? 109  ALA E N   1 
ATOM   6551  C CA  . ALA E  1 109 ? 5.893   86.088  174.049 1.00 34.54  ? 109  ALA E CA  1 
ATOM   6552  C C   . ALA E  1 109 ? 5.845   85.137  172.881 1.00 34.18  ? 109  ALA E C   1 
ATOM   6553  O O   . ALA E  1 109 ? 4.961   85.218  172.024 1.00 34.76  ? 109  ALA E O   1 
ATOM   6554  C CB  . ALA E  1 109 ? 5.063   85.549  175.172 1.00 33.53  ? 109  ALA E CB  1 
ATOM   6555  N N   . PHE E  1 110 ? 6.811   84.240  172.836 1.00 33.70  ? 110  PHE E N   1 
ATOM   6556  C CA  . PHE E  1 110 ? 6.878   83.262  171.771 1.00 33.04  ? 110  PHE E CA  1 
ATOM   6557  C C   . PHE E  1 110 ? 6.634   81.950  172.453 1.00 33.44  ? 110  PHE E C   1 
ATOM   6558  O O   . PHE E  1 110 ? 7.430   81.517  173.306 1.00 34.63  ? 110  PHE E O   1 
ATOM   6559  C CB  . PHE E  1 110 ? 8.260   83.308  171.109 1.00 32.35  ? 110  PHE E CB  1 
ATOM   6560  C CG  . PHE E  1 110 ? 8.511   84.577  170.379 1.00 31.95  ? 110  PHE E CG  1 
ATOM   6561  C CD1 . PHE E  1 110 ? 9.014   85.681  171.046 1.00 32.62  ? 110  PHE E CD1 1 
ATOM   6562  C CD2 . PHE E  1 110 ? 8.121   84.716  169.047 1.00 31.85  ? 110  PHE E CD2 1 
ATOM   6563  C CE1 . PHE E  1 110 ? 9.113   86.926  170.390 1.00 32.95  ? 110  PHE E CE1 1 
ATOM   6564  C CE2 . PHE E  1 110 ? 8.216   85.947  168.392 1.00 32.49  ? 110  PHE E CE2 1 
ATOM   6565  C CZ  . PHE E  1 110 ? 8.709   87.058  169.068 1.00 32.05  ? 110  PHE E CZ  1 
ATOM   6566  N N   . VAL E  1 111 ? 5.522   81.322  172.094 1.00 33.57  ? 111  VAL E N   1 
ATOM   6567  C CA  . VAL E  1 111 ? 5.106   80.041  172.712 1.00 33.17  ? 111  VAL E CA  1 
ATOM   6568  C C   . VAL E  1 111 ? 5.128   78.875  171.727 1.00 32.99  ? 111  VAL E C   1 
ATOM   6569  O O   . VAL E  1 111 ? 4.560   78.961  170.628 1.00 32.78  ? 111  VAL E O   1 
ATOM   6570  C CB  . VAL E  1 111 ? 3.667   80.184  173.308 1.00 32.07  ? 111  VAL E CB  1 
ATOM   6571  C CG1 . VAL E  1 111 ? 3.225   78.888  173.927 1.00 27.99  ? 111  VAL E CG1 1 
ATOM   6572  C CG2 . VAL E  1 111 ? 3.653   81.324  174.312 1.00 28.67  ? 111  VAL E CG2 1 
ATOM   6573  N N   . ARG E  1 112 ? 5.792   77.803  172.126 1.00 33.52  ? 112  ARG E N   1 
ATOM   6574  C CA  . ARG E  1 112 ? 5.926   76.628  171.282 1.00 35.59  ? 112  ARG E CA  1 
ATOM   6575  C C   . ARG E  1 112 ? 5.163   75.527  171.935 1.00 36.20  ? 112  ARG E C   1 
ATOM   6576  O O   . ARG E  1 112 ? 5.495   75.108  173.050 1.00 36.77  ? 112  ARG E O   1 
ATOM   6577  C CB  . ARG E  1 112 ? 7.397   76.177  171.169 1.00 36.66  ? 112  ARG E CB  1 
ATOM   6578  C CG  . ARG E  1 112 ? 7.655   75.332  169.967 1.00 38.27  ? 112  ARG E CG  1 
ATOM   6579  C CD  . ARG E  1 112 ? 9.060   74.755  169.873 1.00 40.66  ? 112  ARG E CD  1 
ATOM   6580  N NE  . ARG E  1 112 ? 9.020   73.334  170.194 1.00 44.23  ? 112  ARG E NE  1 
ATOM   6581  C CZ  . ARG E  1 112 ? 9.514   72.352  169.434 1.00 46.54  ? 112  ARG E CZ  1 
ATOM   6582  N NH1 . ARG E  1 112 ? 10.115  72.627  168.266 1.00 46.88  ? 112  ARG E NH1 1 
ATOM   6583  N NH2 . ARG E  1 112 ? 9.393   71.082  169.845 1.00 45.78  ? 112  ARG E NH2 1 
ATOM   6584  N N   . VAL E  1 113 ? 4.142   75.054  171.253 1.00 36.48  ? 113  VAL E N   1 
ATOM   6585  C CA  . VAL E  1 113 ? 3.369   73.952  171.769 1.00 37.29  ? 113  VAL E CA  1 
ATOM   6586  C C   . VAL E  1 113 ? 3.767   72.668  170.990 1.00 37.41  ? 113  VAL E C   1 
ATOM   6587  O O   . VAL E  1 113 ? 4.013   72.701  169.774 1.00 36.75  ? 113  VAL E O   1 
ATOM   6588  C CB  . VAL E  1 113 ? 1.875   74.256  171.640 1.00 37.52  ? 113  VAL E CB  1 
ATOM   6589  C CG1 . VAL E  1 113 ? 1.602   74.792  170.287 1.00 41.76  ? 113  VAL E CG1 1 
ATOM   6590  C CG2 . VAL E  1 113 ? 1.055   72.999  171.798 1.00 39.13  ? 113  VAL E CG2 1 
ATOM   6591  N N   . GLN E  1 114 ? 3.826   71.545  171.697 1.00 37.03  ? 114  GLN E N   1 
ATOM   6592  C CA  . GLN E  1 114 ? 4.190   70.275  171.082 1.00 38.72  ? 114  GLN E CA  1 
ATOM   6593  C C   . GLN E  1 114 ? 3.267   69.119  171.479 1.00 38.95  ? 114  GLN E C   1 
ATOM   6594  O O   . GLN E  1 114 ? 2.710   69.108  172.569 1.00 40.25  ? 114  GLN E O   1 
ATOM   6595  C CB  . GLN E  1 114 ? 5.598   69.920  171.505 1.00 38.25  ? 114  GLN E CB  1 
ATOM   6596  C CG  . GLN E  1 114 ? 6.134   68.691  170.884 1.00 39.63  ? 114  GLN E CG  1 
ATOM   6597  C CD  . GLN E  1 114 ? 7.477   68.340  171.463 1.00 40.44  ? 114  GLN E CD  1 
ATOM   6598  O OE1 . GLN E  1 114 ? 8.263   69.205  171.776 1.00 43.72  ? 114  GLN E OE1 1 
ATOM   6599  N NE2 . GLN E  1 114 ? 7.743   67.068  171.614 1.00 43.92  ? 114  GLN E NE2 1 
ATOM   6600  N N   . LEU E  1 115 ? 3.120   68.145  170.595 1.00 38.70  ? 115  LEU E N   1 
ATOM   6601  C CA  . LEU E  1 115 ? 2.299   66.968  170.856 1.00 38.80  ? 115  LEU E CA  1 
ATOM   6602  C C   . LEU E  1 115 ? 3.232   65.827  171.285 1.00 39.53  ? 115  LEU E C   1 
ATOM   6603  O O   . LEU E  1 115 ? 4.443   65.918  171.117 1.00 38.61  ? 115  LEU E O   1 
ATOM   6604  C CB  . LEU E  1 115 ? 1.539   66.591  169.590 1.00 38.49  ? 115  LEU E CB  1 
ATOM   6605  C CG  . LEU E  1 115 ? 0.139   67.177  169.388 1.00 37.42  ? 115  LEU E CG  1 
ATOM   6606  C CD1 . LEU E  1 115 ? -0.066  68.456  170.144 1.00 35.00  ? 115  LEU E CD1 1 
ATOM   6607  C CD2 . LEU E  1 115 ? -0.084  67.367  167.935 1.00 36.41  ? 115  LEU E CD2 1 
ATOM   6608  N N   . LYS E  1 116 ? 2.675   64.754  171.845 1.00 41.32  ? 116  LYS E N   1 
ATOM   6609  C CA  . LYS E  1 116 ? 3.494   63.620  172.342 1.00 41.21  ? 116  LYS E CA  1 
ATOM   6610  C C   . LYS E  1 116 ? 4.221   62.993  171.176 1.00 39.78  ? 116  LYS E C   1 
ATOM   6611  O O   . LYS E  1 116 ? 5.158   62.218  171.295 1.00 38.23  ? 116  LYS E O   1 
ATOM   6612  C CB  . LYS E  1 116 ? 2.592   62.592  173.044 1.00 42.90  ? 116  LYS E CB  1 
ATOM   6613  C CG  . LYS E  1 116 ? 1.437   62.057  172.202 1.00 44.68  ? 116  LYS E CG  1 
ATOM   6614  C CD  . LYS E  1 116 ? 0.695   60.964  172.958 1.00 45.04  ? 116  LYS E CD  1 
ATOM   6615  C CE  . LYS E  1 116 ? -0.572  60.512  172.220 1.00 45.60  ? 116  LYS E CE  1 
ATOM   6616  N NZ  . LYS E  1 116 ? -1.384  59.511  172.976 1.00 46.48  ? 116  LYS E NZ  1 
ATOM   6617  N N   . ASP E  1 117 ? 3.745   63.412  170.030 1.00 40.41  ? 117  ASP E N   1 
ATOM   6618  C CA  . ASP E  1 117 ? 4.194   63.051  168.709 1.00 40.01  ? 117  ASP E CA  1 
ATOM   6619  C C   . ASP E  1 117 ? 5.595   63.573  168.377 1.00 40.70  ? 117  ASP E C   1 
ATOM   6620  O O   . ASP E  1 117 ? 6.406   62.899  167.778 1.00 39.14  ? 117  ASP E O   1 
ATOM   6621  C CB  . ASP E  1 117 ? 3.237   63.732  167.751 1.00 38.50  ? 117  ASP E CB  1 
ATOM   6622  C CG  . ASP E  1 117 ? 3.257   63.125  166.459 1.00 39.23  ? 117  ASP E CG  1 
ATOM   6623  O OD1 . ASP E  1 117 ? 2.767   63.741  165.514 1.00 39.94  ? 117  ASP E OD1 1 
ATOM   6624  O OD2 . ASP E  1 117 ? 3.765   61.991  166.413 1.00 42.92  ? 117  ASP E OD2 1 
ATOM   6625  N N   . GLY E  1 118 ? 5.821   64.828  168.759 1.00 41.68  ? 118  GLY E N   1 
ATOM   6626  C CA  . GLY E  1 118 ? 7.036   65.530  168.434 1.00 40.00  ? 118  GLY E CA  1 
ATOM   6627  C C   . GLY E  1 118 ? 6.616   66.672  167.493 1.00 39.83  ? 118  GLY E C   1 
ATOM   6628  O O   . GLY E  1 118 ? 7.373   67.611  167.284 1.00 40.03  ? 118  GLY E O   1 
ATOM   6629  N N   . SER E  1 119 ? 5.411   66.607  166.924 1.00 38.66  ? 119  SER E N   1 
ATOM   6630  C CA  . SER E  1 119 ? 4.947   67.661  166.034 1.00 37.65  ? 119  SER E CA  1 
ATOM   6631  C C   . SER E  1 119 ? 4.763   68.903  166.859 1.00 37.68  ? 119  SER E C   1 
ATOM   6632  O O   . SER E  1 119 ? 4.559   68.797  168.066 1.00 38.99  ? 119  SER E O   1 
ATOM   6633  C CB  . SER E  1 119 ? 3.658   67.266  165.326 1.00 38.00  ? 119  SER E CB  1 
ATOM   6634  O OG  . SER E  1 119 ? 2.735   66.740  166.215 1.00 40.07  ? 119  SER E OG  1 
ATOM   6635  N N   . TYR E  1 120 ? 4.821   70.075  166.228 1.00 36.64  ? 120  TYR E N   1 
ATOM   6636  C CA  . TYR E  1 120 ? 4.759   71.323  166.976 1.00 37.59  ? 120  TYR E CA  1 
ATOM   6637  C C   . TYR E  1 120 ? 4.398   72.563  166.172 1.00 38.44  ? 120  TYR E C   1 
ATOM   6638  O O   . TYR E  1 120 ? 4.497   72.584  164.951 1.00 38.97  ? 120  TYR E O   1 
ATOM   6639  C CB  . TYR E  1 120 ? 6.131   71.580  167.624 1.00 36.85  ? 120  TYR E CB  1 
ATOM   6640  C CG  . TYR E  1 120 ? 7.248   71.675  166.585 1.00 36.97  ? 120  TYR E CG  1 
ATOM   6641  C CD1 . TYR E  1 120 ? 7.525   72.866  165.934 1.00 36.21  ? 120  TYR E CD1 1 
ATOM   6642  C CD2 . TYR E  1 120 ? 7.940   70.524  166.152 1.00 38.48  ? 120  TYR E CD2 1 
ATOM   6643  C CE1 . TYR E  1 120 ? 8.441   72.924  164.868 1.00 35.75  ? 120  TYR E CE1 1 
ATOM   6644  C CE2 . TYR E  1 120 ? 8.864   70.571  165.079 1.00 35.97  ? 120  TYR E CE2 1 
ATOM   6645  C CZ  . TYR E  1 120 ? 9.097   71.776  164.444 1.00 35.24  ? 120  TYR E CZ  1 
ATOM   6646  O OH  . TYR E  1 120 ? 9.937   71.838  163.362 1.00 33.00  ? 120  TYR E OH  1 
ATOM   6647  N N   . HIS E  1 121 ? 4.010   73.612  166.887 1.00 38.69  ? 121  HIS E N   1 
ATOM   6648  C CA  . HIS E  1 121 ? 3.684   74.890  166.278 1.00 39.66  ? 121  HIS E CA  1 
ATOM   6649  C C   . HIS E  1 121 ? 4.050   76.027  167.241 1.00 39.42  ? 121  HIS E C   1 
ATOM   6650  O O   . HIS E  1 121 ? 3.840   75.921  168.446 1.00 38.74  ? 121  HIS E O   1 
ATOM   6651  C CB  . HIS E  1 121 ? 2.215   74.964  165.916 1.00 39.85  ? 121  HIS E CB  1 
ATOM   6652  C CG  . HIS E  1 121 ? 1.825   74.078  164.777 1.00 41.35  ? 121  HIS E CG  1 
ATOM   6653  N ND1 . HIS E  1 121 ? 0.934   73.038  164.916 1.00 42.63  ? 121  HIS E ND1 1 
ATOM   6654  C CD2 . HIS E  1 121 ? 2.162   74.106  163.468 1.00 42.25  ? 121  HIS E CD2 1 
ATOM   6655  C CE1 . HIS E  1 121 ? 0.732   72.467  163.746 1.00 43.79  ? 121  HIS E CE1 1 
ATOM   6656  N NE2 . HIS E  1 121 ? 1.466   73.100  162.848 1.00 43.54  ? 121  HIS E NE2 1 
ATOM   6657  N N   . GLU E  1 122 ? 4.598   77.118  166.713 1.00 38.39  ? 122  GLU E N   1 
ATOM   6658  C CA  . GLU E  1 122 ? 5.020   78.214  167.581 1.00 37.24  ? 122  GLU E CA  1 
ATOM   6659  C C   . GLU E  1 122 ? 4.457   79.498  167.069 1.00 36.48  ? 122  GLU E C   1 
ATOM   6660  O O   . GLU E  1 122 ? 4.356   79.687  165.883 1.00 37.58  ? 122  GLU E O   1 
ATOM   6661  C CB  . GLU E  1 122 ? 6.543   78.289  167.608 1.00 37.50  ? 122  GLU E CB  1 
ATOM   6662  C CG  . GLU E  1 122 ? 7.104   79.332  168.503 1.00 37.97  ? 122  GLU E CG  1 
ATOM   6663  C CD  . GLU E  1 122 ? 8.625   79.389  168.496 1.00 39.51  ? 122  GLU E CD  1 
ATOM   6664  O OE1 . GLU E  1 122 ? 9.275   78.691  167.690 1.00 41.33  ? 122  GLU E OE1 1 
ATOM   6665  O OE2 . GLU E  1 122 ? 9.189   80.147  169.299 1.00 39.36  ? 122  GLU E OE2 1 
ATOM   6666  N N   . ASP E  1 123 ? 4.053   80.383  167.958 1.00 35.81  ? 123  ASP E N   1 
ATOM   6667  C CA  . ASP E  1 123 ? 3.499   81.656  167.513 1.00 34.98  ? 123  ASP E CA  1 
ATOM   6668  C C   . ASP E  1 123 ? 3.818   82.771  168.517 1.00 35.08  ? 123  ASP E C   1 
ATOM   6669  O O   . ASP E  1 123 ? 4.391   82.500  169.574 1.00 35.31  ? 123  ASP E O   1 
ATOM   6670  C CB  . ASP E  1 123 ? 1.997   81.525  167.319 1.00 32.71  ? 123  ASP E CB  1 
ATOM   6671  C CG  . ASP E  1 123 ? 1.485   82.423  166.217 1.00 33.78  ? 123  ASP E CG  1 
ATOM   6672  O OD1 . ASP E  1 123 ? 1.951   83.576  166.148 1.00 34.15  ? 123  ASP E OD1 1 
ATOM   6673  O OD2 . ASP E  1 123 ? 0.613   81.997  165.421 1.00 34.50  ? 123  ASP E OD2 1 
ATOM   6674  N N   . VAL E  1 124 ? 3.502   84.019  168.178 1.00 36.01  ? 124  VAL E N   1 
ATOM   6675  C CA  . VAL E  1 124 ? 3.753   85.127  169.106 1.00 37.91  ? 124  VAL E CA  1 
ATOM   6676  C C   . VAL E  1 124 ? 2.438   85.484  169.736 1.00 40.25  ? 124  VAL E C   1 
ATOM   6677  O O   . VAL E  1 124 ? 1.377   85.394  169.098 1.00 41.25  ? 124  VAL E O   1 
ATOM   6678  C CB  . VAL E  1 124 ? 4.105   86.471  168.484 1.00 36.04  ? 124  VAL E CB  1 
ATOM   6679  C CG1 . VAL E  1 124 ? 5.374   86.956  169.050 1.00 36.13  ? 124  VAL E CG1 1 
ATOM   6680  C CG2 . VAL E  1 124 ? 4.044   86.407  167.003 1.00 36.08  ? 124  VAL E CG2 1 
ATOM   6681  N N   . GLY E  1 125 ? 2.533   85.931  170.974 1.00 40.84  ? 125  GLY E N   1 
ATOM   6682  C CA  . GLY E  1 125 ? 1.367   86.407  171.667 1.00 43.58  ? 125  GLY E CA  1 
ATOM   6683  C C   . GLY E  1 125 ? 1.754   87.820  172.078 1.00 44.96  ? 125  GLY E C   1 
ATOM   6684  O O   . GLY E  1 125 ? 2.944   88.121  172.180 1.00 44.71  ? 125  GLY E O   1 
ATOM   6685  N N   . TYR E  1 126 ? 0.787   88.700  172.278 1.00 46.44  ? 126  TYR E N   1 
ATOM   6686  C CA  . TYR E  1 126 ? 1.119   90.031  172.730 1.00 48.00  ? 126  TYR E CA  1 
ATOM   6687  C C   . TYR E  1 126 ? 0.290   90.336  173.968 1.00 49.69  ? 126  TYR E C   1 
ATOM   6688  O O   . TYR E  1 126 ? -0.856  89.884  174.086 1.00 50.92  ? 126  TYR E O   1 
ATOM   6689  C CB  . TYR E  1 126 ? 0.828   91.069  171.656 1.00 49.06  ? 126  TYR E CB  1 
ATOM   6690  C CG  . TYR E  1 126 ? 1.768   92.241  171.748 1.00 49.69  ? 126  TYR E CG  1 
ATOM   6691  C CD1 . TYR E  1 126 ? 3.101   92.099  171.398 1.00 48.61  ? 126  TYR E CD1 1 
ATOM   6692  C CD2 . TYR E  1 126 ? 1.352   93.458  172.270 1.00 50.30  ? 126  TYR E CD2 1 
ATOM   6693  C CE1 . TYR E  1 126 ? 4.002   93.121  171.565 1.00 48.69  ? 126  TYR E CE1 1 
ATOM   6694  C CE2 . TYR E  1 126 ? 2.253   94.504  172.452 1.00 49.92  ? 126  TYR E CE2 1 
ATOM   6695  C CZ  . TYR E  1 126 ? 3.584   94.327  172.096 1.00 49.03  ? 126  TYR E CZ  1 
ATOM   6696  O OH  . TYR E  1 126 ? 4.502   95.341  172.278 1.00 46.38  ? 126  TYR E OH  1 
ATOM   6697  N N   . GLY E  1 127 ? 0.880   91.078  174.901 1.00 51.02  ? 127  GLY E N   1 
ATOM   6698  C CA  . GLY E  1 127 ? 0.185   91.463  176.128 1.00 52.33  ? 127  GLY E CA  1 
ATOM   6699  C C   . GLY E  1 127 ? 0.189   92.980  176.247 1.00 53.26  ? 127  GLY E C   1 
ATOM   6700  O O   . GLY E  1 127 ? 1.240   93.605  176.062 1.00 52.81  ? 127  GLY E O   1 
ATOM   6701  N N   . VAL E  1 128 ? -0.959  93.590  176.539 1.00 54.44  ? 128  VAL E N   1 
ATOM   6702  C CA  . VAL E  1 128 ? -1.002  95.055  176.642 1.00 55.75  ? 128  VAL E CA  1 
ATOM   6703  C C   . VAL E  1 128 ? -1.615  95.568  177.924 1.00 56.32  ? 128  VAL E C   1 
ATOM   6704  O O   . VAL E  1 128 ? -2.542  94.963  178.459 1.00 56.30  ? 128  VAL E O   1 
ATOM   6705  C CB  . VAL E  1 128 ? -1.815  95.675  175.493 1.00 55.59  ? 128  VAL E CB  1 
ATOM   6706  C CG1 . VAL E  1 128 ? -1.783  97.175  175.590 1.00 55.47  ? 128  VAL E CG1 1 
ATOM   6707  C CG2 . VAL E  1 128 ? -1.261  95.230  174.179 1.00 56.27  ? 128  VAL E CG2 1 
ATOM   6708  N N   . SER E  1 129 ? -1.086  96.686  178.417 1.00 57.19  ? 129  SER E N   1 
ATOM   6709  C CA  . SER E  1 129 ? -1.637  97.327  179.609 1.00 57.87  ? 129  SER E CA  1 
ATOM   6710  C C   . SER E  1 129 ? -1.483  98.799  179.412 1.00 58.16  ? 129  SER E C   1 
ATOM   6711  O O   . SER E  1 129 ? -0.372  99.306  179.375 1.00 56.32  ? 129  SER E O   1 
ATOM   6712  C CB  . SER E  1 129 ? -0.920  96.916  180.885 1.00 58.07  ? 129  SER E CB  1 
ATOM   6713  O OG  . SER E  1 129 ? -1.609  97.445  182.005 1.00 58.64  ? 129  SER E OG  1 
ATOM   6714  N N   . GLU E  1 130 ? -2.611  99.478  179.258 1.00 60.21  ? 130  GLU E N   1 
ATOM   6715  C CA  . GLU E  1 130 ? -2.601  100.917 179.054 1.00 62.95  ? 130  GLU E CA  1 
ATOM   6716  C C   . GLU E  1 130 ? -3.480  101.661 180.066 1.00 64.27  ? 130  GLU E C   1 
ATOM   6717  O O   . GLU E  1 130 ? -4.662  101.337 180.236 1.00 64.64  ? 130  GLU E O   1 
ATOM   6718  C CB  . GLU E  1 130 ? -3.048  101.237 177.619 1.00 62.32  ? 130  GLU E CB  1 
ATOM   6719  C CG  . GLU E  1 130 ? -2.054  100.757 176.584 1.00 63.50  ? 130  GLU E CG  1 
ATOM   6720  C CD  . GLU E  1 130 ? -2.499  101.010 175.169 1.00 64.02  ? 130  GLU E CD  1 
ATOM   6721  O OE1 . GLU E  1 130 ? -3.623  100.588 174.828 1.00 65.22  ? 130  GLU E OE1 1 
ATOM   6722  O OE2 . GLU E  1 130 ? -1.719  101.615 174.395 1.00 63.72  ? 130  GLU E OE2 1 
ATOM   6723  N N   . GLY E  1 131 ? -2.890  102.635 180.761 1.00 65.40  ? 131  GLY E N   1 
ATOM   6724  C CA  . GLY E  1 131 ? -3.666  103.431 181.699 1.00 66.49  ? 131  GLY E CA  1 
ATOM   6725  C C   . GLY E  1 131 ? -3.558  103.225 183.198 1.00 67.44  ? 131  GLY E C   1 
ATOM   6726  O O   . GLY E  1 131 ? -3.877  104.141 183.939 1.00 67.56  ? 131  GLY E O   1 
ATOM   6727  N N   . LEU E  1 132 ? -3.137  102.053 183.666 1.00 68.40  ? 132  LEU E N   1 
ATOM   6728  C CA  . LEU E  1 132 ? -3.031  101.841 185.110 1.00 68.94  ? 132  LEU E CA  1 
ATOM   6729  C C   . LEU E  1 132 ? -1.980  102.782 185.699 1.00 69.79  ? 132  LEU E C   1 
ATOM   6730  O O   . LEU E  1 132 ? -1.143  103.331 184.980 1.00 69.15  ? 132  LEU E O   1 
ATOM   6731  C CB  . LEU E  1 132 ? -2.646  100.393 185.417 1.00 68.27  ? 132  LEU E CB  1 
ATOM   6732  C CG  . LEU E  1 132 ? -3.571  99.335  184.813 1.00 68.96  ? 132  LEU E CG  1 
ATOM   6733  C CD1 . LEU E  1 132 ? -3.164  97.938  185.280 1.00 68.06  ? 132  LEU E CD1 1 
ATOM   6734  C CD2 . LEU E  1 132 ? -4.997  99.636  185.208 1.00 69.36  ? 132  LEU E CD2 1 
ATOM   6735  N N   . LYS E  1 133 ? -2.021  102.990 187.005 1.00 70.99  ? 133  LYS E N   1 
ATOM   6736  C CA  . LYS E  1 133 ? -1.023  103.859 187.591 1.00 72.88  ? 133  LYS E CA  1 
ATOM   6737  C C   . LYS E  1 133 ? 0.052   103.011 188.237 1.00 73.19  ? 133  LYS E C   1 
ATOM   6738  O O   . LYS E  1 133 ? 1.113   103.522 188.598 1.00 73.47  ? 133  LYS E O   1 
ATOM   6739  C CB  . LYS E  1 133 ? -1.646  104.802 188.610 1.00 74.77  ? 133  LYS E CB  1 
ATOM   6740  C CG  . LYS E  1 133 ? -2.649  105.762 188.000 1.00 77.64  ? 133  LYS E CG  1 
ATOM   6741  C CD  . LYS E  1 133 ? -2.931  106.941 188.920 1.00 79.98  ? 133  LYS E CD  1 
ATOM   6742  C CE  . LYS E  1 133 ? -3.284  106.546 190.375 1.00 82.08  ? 133  LYS E CE  1 
ATOM   6743  N NZ  . LYS E  1 133 ? -4.456  105.601 190.508 1.00 82.90  ? 133  LYS E NZ  1 
ATOM   6744  N N   . SER E  1 134 ? -0.225  101.713 188.376 1.00 73.00  ? 134  SER E N   1 
ATOM   6745  C CA  . SER E  1 134 ? 0.733   100.785 188.960 1.00 71.93  ? 134  SER E CA  1 
ATOM   6746  C C   . SER E  1 134 ? 1.623   100.186 187.874 1.00 72.06  ? 134  SER E C   1 
ATOM   6747  O O   . SER E  1 134 ? 1.150   99.558  186.928 1.00 72.86  ? 134  SER E O   1 
ATOM   6748  C CB  . SER E  1 134 ? 0.015   99.660  189.691 1.00 71.49  ? 134  SER E CB  1 
ATOM   6749  O OG  . SER E  1 134 ? 0.963   98.789  190.282 1.00 71.78  ? 134  SER E OG  1 
ATOM   6750  N N   . LYS E  1 135 ? 2.918   100.399 188.007 1.00 71.22  ? 135  LYS E N   1 
ATOM   6751  C CA  . LYS E  1 135 ? 3.873   99.861  187.068 1.00 70.11  ? 135  LYS E CA  1 
ATOM   6752  C C   . LYS E  1 135 ? 3.788   98.341  187.223 1.00 69.64  ? 135  LYS E C   1 
ATOM   6753  O O   . LYS E  1 135 ? 3.622   97.602  186.259 1.00 69.72  ? 135  LYS E O   1 
ATOM   6754  C CB  . LYS E  1 135 ? 5.254   100.357 187.467 1.00 70.33  ? 135  LYS E CB  1 
ATOM   6755  C CG  . LYS E  1 135 ? 6.353   100.208 186.454 1.00 70.32  ? 135  LYS E CG  1 
ATOM   6756  C CD  . LYS E  1 135 ? 7.647   100.652 187.102 1.00 70.25  ? 135  LYS E CD  1 
ATOM   6757  C CE  . LYS E  1 135 ? 8.582   101.325 186.121 1.00 70.90  ? 135  LYS E CE  1 
ATOM   6758  N NZ  . LYS E  1 135 ? 9.745   101.906 186.833 1.00 70.78  ? 135  LYS E NZ  1 
ATOM   6759  N N   . ALA E  1 136 ? 3.881   97.882  188.460 1.00 69.15  ? 136  ALA E N   1 
ATOM   6760  C CA  . ALA E  1 136 ? 3.845   96.458  188.730 1.00 69.10  ? 136  ALA E CA  1 
ATOM   6761  C C   . ALA E  1 136 ? 2.615   95.791  188.141 1.00 68.25  ? 136  ALA E C   1 
ATOM   6762  O O   . ALA E  1 136 ? 2.729   94.777  187.455 1.00 69.09  ? 136  ALA E O   1 
ATOM   6763  C CB  . ALA E  1 136 ? 3.910   96.209  190.226 1.00 69.51  ? 136  ALA E CB  1 
ATOM   6764  N N   . LEU E  1 137 ? 1.441   96.350  188.400 1.00 66.86  ? 137  LEU E N   1 
ATOM   6765  C CA  . LEU E  1 137 ? 0.222   95.744  187.879 1.00 66.10  ? 137  LEU E CA  1 
ATOM   6766  C C   . LEU E  1 137 ? 0.169   95.760  186.345 1.00 65.29  ? 137  LEU E C   1 
ATOM   6767  O O   . LEU E  1 137 ? -0.393  94.847  185.721 1.00 65.68  ? 137  LEU E O   1 
ATOM   6768  C CB  . LEU E  1 137 ? -1.007  96.439  188.472 1.00 66.98  ? 137  LEU E CB  1 
ATOM   6769  C CG  . LEU E  1 137 ? -1.504  95.945  189.849 1.00 67.95  ? 137  LEU E CG  1 
ATOM   6770  C CD1 . LEU E  1 137 ? -2.072  94.530  189.732 1.00 67.39  ? 137  LEU E CD1 1 
ATOM   6771  C CD2 . LEU E  1 137 ? -0.375  95.966  190.868 1.00 68.10  ? 137  LEU E CD2 1 
ATOM   6772  N N   . SER E  1 138 ? 0.754   96.790  185.735 1.00 62.99  ? 138  SER E N   1 
ATOM   6773  C CA  . SER E  1 138 ? 0.780   96.888  184.284 1.00 60.69  ? 138  SER E CA  1 
ATOM   6774  C C   . SER E  1 138 ? 1.680   95.788  183.689 1.00 59.98  ? 138  SER E C   1 
ATOM   6775  O O   . SER E  1 138 ? 1.267   95.059  182.788 1.00 58.61  ? 138  SER E O   1 
ATOM   6776  C CB  . SER E  1 138 ? 1.283   98.265  183.867 1.00 60.35  ? 138  SER E CB  1 
ATOM   6777  O OG  . SER E  1 138 ? 0.280   99.248  184.042 1.00 60.85  ? 138  SER E OG  1 
ATOM   6778  N N   . LEU E  1 139 ? 2.904   95.671  184.203 1.00 58.49  ? 139  LEU E N   1 
ATOM   6779  C CA  . LEU E  1 139 ? 3.835   94.655  183.750 1.00 57.43  ? 139  LEU E CA  1 
ATOM   6780  C C   . LEU E  1 139 ? 3.224   93.279  183.939 1.00 57.51  ? 139  LEU E C   1 
ATOM   6781  O O   . LEU E  1 139 ? 3.249   92.459  183.026 1.00 57.61  ? 139  LEU E O   1 
ATOM   6782  C CB  . LEU E  1 139 ? 5.136   94.730  184.542 1.00 57.46  ? 139  LEU E CB  1 
ATOM   6783  C CG  . LEU E  1 139 ? 6.432   95.155  183.846 1.00 57.22  ? 139  LEU E CG  1 
ATOM   6784  C CD1 . LEU E  1 139 ? 6.209   95.275  182.336 1.00 57.53  ? 139  LEU E CD1 1 
ATOM   6785  C CD2 . LEU E  1 139 ? 6.907   96.462  184.408 1.00 55.66  ? 139  LEU E CD2 1 
ATOM   6786  N N   . GLU E  1 140 ? 2.666   93.023  185.120 1.00 57.46  ? 140  GLU E N   1 
ATOM   6787  C CA  . GLU E  1 140 ? 2.055   91.727  185.383 1.00 57.34  ? 140  GLU E CA  1 
ATOM   6788  C C   . GLU E  1 140 ? 0.961   91.369  184.368 1.00 56.23  ? 140  GLU E C   1 
ATOM   6789  O O   . GLU E  1 140 ? 0.915   90.235  183.875 1.00 57.05  ? 140  GLU E O   1 
ATOM   6790  C CB  . GLU E  1 140 ? 1.460   91.663  186.792 1.00 58.67  ? 140  GLU E CB  1 
ATOM   6791  C CG  . GLU E  1 140 ? 0.533   90.460  186.973 1.00 60.02  ? 140  GLU E CG  1 
ATOM   6792  C CD  . GLU E  1 140 ? -0.088  90.359  188.344 1.00 60.79  ? 140  GLU E CD  1 
ATOM   6793  O OE1 . GLU E  1 140 ? -0.627  91.383  188.834 1.00 61.23  ? 140  GLU E OE1 1 
ATOM   6794  O OE2 . GLU E  1 140 ? -0.050  89.235  188.911 1.00 61.16  ? 140  GLU E OE2 1 
ATOM   6795  N N   . LYS E  1 141 ? 0.080   92.317  184.065 1.00 53.79  ? 141  LYS E N   1 
ATOM   6796  C CA  . LYS E  1 141 ? -0.998  92.050  183.119 1.00 52.25  ? 141  LYS E CA  1 
ATOM   6797  C C   . LYS E  1 141 ? -0.467  91.741  181.713 1.00 51.46  ? 141  LYS E C   1 
ATOM   6798  O O   . LYS E  1 141 ? -0.902  90.791  181.056 1.00 50.40  ? 141  LYS E O   1 
ATOM   6799  C CB  . LYS E  1 141 ? -1.949  93.254  183.036 1.00 52.20  ? 141  LYS E CB  1 
ATOM   6800  C CG  . LYS E  1 141 ? -3.065  93.084  182.013 1.00 51.41  ? 141  LYS E CG  1 
ATOM   6801  C CD  . LYS E  1 141 ? -3.925  94.330  181.929 1.00 50.88  ? 141  LYS E CD  1 
ATOM   6802  C CE  . LYS E  1 141 ? -5.143  94.112  181.022 1.00 51.10  ? 141  LYS E CE  1 
ATOM   6803  N NZ  . LYS E  1 141 ? -4.885  94.025  179.563 1.00 51.05  ? 141  LYS E NZ  1 
ATOM   6804  N N   . ALA E  1 142 ? 0.472   92.559  181.252 1.00 50.42  ? 142  ALA E N   1 
ATOM   6805  C CA  . ALA E  1 142 ? 1.032   92.383  179.919 1.00 49.72  ? 142  ALA E CA  1 
ATOM   6806  C C   . ALA E  1 142 ? 1.852   91.096  179.764 1.00 49.13  ? 142  ALA E C   1 
ATOM   6807  O O   . ALA E  1 142 ? 1.751   90.398  178.767 1.00 47.65  ? 142  ALA E O   1 
ATOM   6808  C CB  . ALA E  1 142 ? 1.874   93.592  179.546 1.00 49.35  ? 142  ALA E CB  1 
ATOM   6809  N N   . ARG E  1 143 ? 2.659   90.767  180.752 1.00 49.26  ? 143  ARG E N   1 
ATOM   6810  C CA  . ARG E  1 143 ? 3.433   89.559  180.634 1.00 50.06  ? 143  ARG E CA  1 
ATOM   6811  C C   . ARG E  1 143 ? 2.554   88.321  180.653 1.00 50.43  ? 143  ARG E C   1 
ATOM   6812  O O   . ARG E  1 143 ? 2.783   87.397  179.895 1.00 51.78  ? 143  ARG E O   1 
ATOM   6813  C CB  . ARG E  1 143 ? 4.481   89.468  181.753 1.00 50.00  ? 143  ARG E CB  1 
ATOM   6814  C CG  . ARG E  1 143 ? 5.352   90.698  181.884 1.00 49.09  ? 143  ARG E CG  1 
ATOM   6815  C CD  . ARG E  1 143 ? 6.569   90.463  182.742 1.00 49.78  ? 143  ARG E CD  1 
ATOM   6816  N NE  . ARG E  1 143 ? 7.650   90.021  181.887 1.00 52.99  ? 143  ARG E NE  1 
ATOM   6817  C CZ  . ARG E  1 143 ? 8.916   90.391  182.015 1.00 54.38  ? 143  ARG E CZ  1 
ATOM   6818  N NH1 . ARG E  1 143 ? 9.270   91.219  182.987 1.00 54.43  ? 143  ARG E NH1 1 
ATOM   6819  N NH2 . ARG E  1 143 ? 9.819   89.946  181.143 1.00 55.75  ? 143  ARG E NH2 1 
ATOM   6820  N N   . LYS E  1 144 ? 1.551   88.282  181.513 1.00 50.80  ? 144  LYS E N   1 
ATOM   6821  C CA  . LYS E  1 144 ? 0.715   87.093  181.560 1.00 51.76  ? 144  LYS E CA  1 
ATOM   6822  C C   . LYS E  1 144 ? -0.176  86.936  180.338 1.00 51.82  ? 144  LYS E C   1 
ATOM   6823  O O   . LYS E  1 144 ? -0.389  85.823  179.863 1.00 51.19  ? 144  LYS E O   1 
ATOM   6824  C CB  . LYS E  1 144 ? -0.141  87.084  182.819 1.00 53.45  ? 144  LYS E CB  1 
ATOM   6825  C CG  . LYS E  1 144 ? 0.660   87.037  184.099 1.00 54.55  ? 144  LYS E CG  1 
ATOM   6826  C CD  . LYS E  1 144 ? -0.230  86.852  185.313 1.00 56.85  ? 144  LYS E CD  1 
ATOM   6827  C CE  . LYS E  1 144 ? 0.591   86.844  186.606 1.00 56.77  ? 144  LYS E CE  1 
ATOM   6828  N NZ  . LYS E  1 144 ? -0.207  86.576  187.822 1.00 54.60  ? 144  LYS E NZ  1 
ATOM   6829  N N   . GLU E  1 145 ? -0.704  88.038  179.820 1.00 51.87  ? 145  GLU E N   1 
ATOM   6830  C CA  . GLU E  1 145 ? -1.561  87.925  178.653 1.00 52.54  ? 145  GLU E CA  1 
ATOM   6831  C C   . GLU E  1 145 ? -0.778  87.556  177.410 1.00 51.76  ? 145  GLU E C   1 
ATOM   6832  O O   . GLU E  1 145 ? -1.282  86.820  176.566 1.00 53.03  ? 145  GLU E O   1 
ATOM   6833  C CB  . GLU E  1 145 ? -2.344  89.220  178.423 1.00 54.63  ? 145  GLU E CB  1 
ATOM   6834  C CG  . GLU E  1 145 ? -3.478  89.401  179.410 1.00 56.43  ? 145  GLU E CG  1 
ATOM   6835  C CD  . GLU E  1 145 ? -4.156  90.754  179.306 1.00 58.33  ? 145  GLU E CD  1 
ATOM   6836  O OE1 . GLU E  1 145 ? -3.898  91.520  178.335 1.00 57.63  ? 145  GLU E OE1 1 
ATOM   6837  O OE2 . GLU E  1 145 ? -4.969  91.033  180.213 1.00 60.11  ? 145  GLU E OE2 1 
ATOM   6838  N N   . ALA E  1 146 ? 0.443   88.067  177.291 1.00 49.50  ? 146  ALA E N   1 
ATOM   6839  C CA  . ALA E  1 146 ? 1.267   87.746  176.145 1.00 46.38  ? 146  ALA E CA  1 
ATOM   6840  C C   . ALA E  1 146 ? 1.431   86.231  176.094 1.00 44.86  ? 146  ALA E C   1 
ATOM   6841  O O   . ALA E  1 146 ? 1.295   85.628  175.032 1.00 43.83  ? 146  ALA E O   1 
ATOM   6842  C CB  . ALA E  1 146 ? 2.623   88.429  176.259 1.00 45.36  ? 146  ALA E CB  1 
ATOM   6843  N N   . VAL E  1 147 ? 1.692   85.611  177.241 1.00 43.07  ? 147  VAL E N   1 
ATOM   6844  C CA  . VAL E  1 147 ? 1.885   84.165  177.264 1.00 43.37  ? 147  VAL E CA  1 
ATOM   6845  C C   . VAL E  1 147 ? 0.644   83.410  176.863 1.00 44.60  ? 147  VAL E C   1 
ATOM   6846  O O   . VAL E  1 147 ? 0.684   82.534  176.004 1.00 46.22  ? 147  VAL E O   1 
ATOM   6847  C CB  . VAL E  1 147 ? 2.350   83.666  178.640 1.00 41.74  ? 147  VAL E CB  1 
ATOM   6848  C CG1 . VAL E  1 147 ? 2.296   82.156  178.713 1.00 40.39  ? 147  VAL E CG1 1 
ATOM   6849  C CG2 . VAL E  1 147 ? 3.775   84.140  178.881 1.00 41.36  ? 147  VAL E CG2 1 
ATOM   6850  N N   . THR E  1 148 ? -0.473  83.771  177.462 1.00 45.42  ? 148  THR E N   1 
ATOM   6851  C CA  . THR E  1 148 ? -1.718  83.096  177.156 1.00 45.53  ? 148  THR E CA  1 
ATOM   6852  C C   . THR E  1 148 ? -2.103  83.335  175.703 1.00 44.24  ? 148  THR E C   1 
ATOM   6853  O O   . THR E  1 148 ? -2.488  82.403  174.995 1.00 44.42  ? 148  THR E O   1 
ATOM   6854  C CB  . THR E  1 148 ? -2.858  83.561  178.133 1.00 47.18  ? 148  THR E CB  1 
ATOM   6855  O OG1 . THR E  1 148 ? -2.499  83.195  179.483 1.00 45.99  ? 148  THR E OG1 1 
ATOM   6856  C CG2 . THR E  1 148 ? -4.209  82.902  177.747 1.00 45.71  ? 148  THR E CG2 1 
ATOM   6857  N N   . ASP E  1 149 ? -1.990  84.574  175.262 1.00 43.26  ? 149  ASP E N   1 
ATOM   6858  C CA  . ASP E  1 149 ? -2.318  84.908  173.888 1.00 44.51  ? 149  ASP E CA  1 
ATOM   6859  C C   . ASP E  1 149 ? -1.448  84.043  172.951 1.00 45.84  ? 149  ASP E C   1 
ATOM   6860  O O   . ASP E  1 149 ? -1.939  83.485  171.977 1.00 47.24  ? 149  ASP E O   1 
ATOM   6861  C CB  . ASP E  1 149 ? -2.048  86.385  173.649 1.00 44.47  ? 149  ASP E CB  1 
ATOM   6862  C CG  . ASP E  1 149 ? -2.574  86.855  172.342 1.00 46.01  ? 149  ASP E CG  1 
ATOM   6863  O OD1 . ASP E  1 149 ? -1.849  87.598  171.634 1.00 47.81  ? 149  ASP E OD1 1 
ATOM   6864  O OD2 . ASP E  1 149 ? -3.724  86.493  172.020 1.00 47.54  ? 149  ASP E OD2 1 
ATOM   6865  N N   . GLY E  1 150 ? -0.166  83.896  173.268 1.00 45.44  ? 150  GLY E N   1 
ATOM   6866  C CA  . GLY E  1 150 ? 0.695   83.105  172.415 1.00 46.52  ? 150  GLY E CA  1 
ATOM   6867  C C   . GLY E  1 150 ? 0.298   81.646  172.426 1.00 46.56  ? 150  GLY E C   1 
ATOM   6868  O O   . GLY E  1 150 ? 0.287   80.982  171.389 1.00 48.16  ? 150  GLY E O   1 
ATOM   6869  N N   . LEU E  1 151 ? -0.022  81.133  173.600 1.00 45.57  ? 151  LEU E N   1 
ATOM   6870  C CA  . LEU E  1 151 ? -0.421  79.754  173.687 1.00 45.09  ? 151  LEU E CA  1 
ATOM   6871  C C   . LEU E  1 151 ? -1.652  79.544  172.812 1.00 44.98  ? 151  LEU E C   1 
ATOM   6872  O O   . LEU E  1 151 ? -1.739  78.558  172.087 1.00 45.33  ? 151  LEU E O   1 
ATOM   6873  C CB  . LEU E  1 151 ? -0.733  79.376  175.133 1.00 45.46  ? 151  LEU E CB  1 
ATOM   6874  C CG  . LEU E  1 151 ? -1.361  77.990  175.332 1.00 47.39  ? 151  LEU E CG  1 
ATOM   6875  C CD1 . LEU E  1 151 ? -0.512  76.896  174.642 1.00 47.55  ? 151  LEU E CD1 1 
ATOM   6876  C CD2 . LEU E  1 151 ? -1.499  77.702  176.830 1.00 47.10  ? 151  LEU E CD2 1 
ATOM   6877  N N   . LYS E  1 152 ? -2.605  80.467  172.864 1.00 44.65  ? 152  LYS E N   1 
ATOM   6878  C CA  . LYS E  1 152 ? -3.801  80.295  172.051 1.00 44.86  ? 152  LYS E CA  1 
ATOM   6879  C C   . LYS E  1 152 ? -3.482  80.325  170.557 1.00 43.71  ? 152  LYS E C   1 
ATOM   6880  O O   . LYS E  1 152 ? -3.911  79.438  169.811 1.00 43.30  ? 152  LYS E O   1 
ATOM   6881  C CB  . LYS E  1 152 ? -4.863  81.349  172.382 1.00 46.93  ? 152  LYS E CB  1 
ATOM   6882  C CG  . LYS E  1 152 ? -5.559  81.140  173.735 1.00 49.75  ? 152  LYS E CG  1 
ATOM   6883  C CD  . LYS E  1 152 ? -6.731  82.109  173.921 1.00 50.53  ? 152  LYS E CD  1 
ATOM   6884  C CE  . LYS E  1 152 ? -6.298  83.571  173.973 1.00 52.27  ? 152  LYS E CE  1 
ATOM   6885  N NZ  . LYS E  1 152 ? -7.467  84.498  173.833 1.00 53.80  ? 152  LYS E NZ  1 
ATOM   6886  N N   . ARG E  1 153 ? -2.729  81.330  170.110 1.00 41.82  ? 153  ARG E N   1 
ATOM   6887  C CA  . ARG E  1 153 ? -2.368  81.386  168.699 1.00 39.10  ? 153  ARG E CA  1 
ATOM   6888  C C   . ARG E  1 153 ? -1.613  80.122  168.261 1.00 37.73  ? 153  ARG E C   1 
ATOM   6889  O O   . ARG E  1 153 ? -1.888  79.582  167.201 1.00 37.49  ? 153  ARG E O   1 
ATOM   6890  C CB  . ARG E  1 153 ? -1.524  82.611  168.402 1.00 38.50  ? 153  ARG E CB  1 
ATOM   6891  C CG  . ARG E  1 153 ? -2.192  83.922  168.755 1.00 38.76  ? 153  ARG E CG  1 
ATOM   6892  C CD  . ARG E  1 153 ? -1.363  85.091  168.292 1.00 37.51  ? 153  ARG E CD  1 
ATOM   6893  N NE  . ARG E  1 153 ? -1.829  85.551  167.001 1.00 40.96  ? 153  ARG E NE  1 
ATOM   6894  C CZ  . ARG E  1 153 ? -1.083  85.586  165.912 1.00 44.12  ? 153  ARG E CZ  1 
ATOM   6895  N NH1 . ARG E  1 153 ? 0.183   85.178  165.963 1.00 45.74  ? 153  ARG E NH1 1 
ATOM   6896  N NH2 . ARG E  1 153 ? -1.599  86.040  164.769 1.00 46.33  ? 153  ARG E NH2 1 
ATOM   6897  N N   . ALA E  1 154 ? -0.668  79.642  169.057 1.00 35.61  ? 154  ALA E N   1 
ATOM   6898  C CA  . ALA E  1 154 ? 0.042   78.430  168.671 1.00 35.58  ? 154  ALA E CA  1 
ATOM   6899  C C   . ALA E  1 154 ? -0.931  77.286  168.481 1.00 36.43  ? 154  ALA E C   1 
ATOM   6900  O O   . ALA E  1 154 ? -0.887  76.584  167.477 1.00 37.38  ? 154  ALA E O   1 
ATOM   6901  C CB  . ALA E  1 154 ? 1.085   78.042  169.732 1.00 33.90  ? 154  ALA E CB  1 
ATOM   6902  N N   . LEU E  1 155 ? -1.826  77.102  169.448 1.00 37.30  ? 155  LEU E N   1 
ATOM   6903  C CA  . LEU E  1 155 ? -2.790  76.017  169.386 1.00 36.66  ? 155  LEU E CA  1 
ATOM   6904  C C   . LEU E  1 155 ? -3.702  76.084  168.171 1.00 36.45  ? 155  LEU E C   1 
ATOM   6905  O O   . LEU E  1 155 ? -4.004  75.061  167.594 1.00 36.72  ? 155  LEU E O   1 
ATOM   6906  C CB  . LEU E  1 155 ? -3.588  75.970  170.684 1.00 36.18  ? 155  LEU E CB  1 
ATOM   6907  C CG  . LEU E  1 155 ? -3.443  74.871  171.753 1.00 35.49  ? 155  LEU E CG  1 
ATOM   6908  C CD1 . LEU E  1 155 ? -2.429  73.817  171.443 1.00 35.01  ? 155  LEU E CD1 1 
ATOM   6909  C CD2 . LEU E  1 155 ? -3.110  75.577  173.042 1.00 36.66  ? 155  LEU E CD2 1 
ATOM   6910  N N   . ARG E  1 156 ? -4.127  77.275  167.767 1.00 38.13  ? 156  ARG E N   1 
ATOM   6911  C CA  . ARG E  1 156 ? -4.985  77.414  166.574 1.00 40.34  ? 156  ARG E CA  1 
ATOM   6912  C C   . ARG E  1 156 ? -4.455  76.605  165.376 1.00 40.84  ? 156  ARG E C   1 
ATOM   6913  O O   . ARG E  1 156 ? -5.228  76.101  164.571 1.00 40.70  ? 156  ARG E O   1 
ATOM   6914  C CB  . ARG E  1 156 ? -5.058  78.862  166.075 1.00 42.78  ? 156  ARG E CB  1 
ATOM   6915  C CG  . ARG E  1 156 ? -5.603  79.917  167.027 1.00 48.57  ? 156  ARG E CG  1 
ATOM   6916  C CD  . ARG E  1 156 ? -6.060  81.140  166.186 1.00 54.37  ? 156  ARG E CD  1 
ATOM   6917  N NE  . ARG E  1 156 ? -6.024  82.457  166.840 1.00 57.91  ? 156  ARG E NE  1 
ATOM   6918  C CZ  . ARG E  1 156 ? -6.645  82.777  167.969 1.00 59.69  ? 156  ARG E CZ  1 
ATOM   6919  N NH1 . ARG E  1 156 ? -7.378  81.868  168.629 1.00 60.47  ? 156  ARG E NH1 1 
ATOM   6920  N NH2 . ARG E  1 156 ? -6.541  84.031  168.414 1.00 60.74  ? 156  ARG E NH2 1 
ATOM   6921  N N   . SER E  1 157 ? -3.136  76.512  165.241 1.00 40.44  ? 157  SER E N   1 
ATOM   6922  C CA  . SER E  1 157 ? -2.531  75.815  164.120 1.00 40.49  ? 157  SER E CA  1 
ATOM   6923  C C   . SER E  1 157 ? -2.988  74.376  163.959 1.00 40.83  ? 157  SER E C   1 
ATOM   6924  O O   . SER E  1 157 ? -2.890  73.802  162.866 1.00 41.24  ? 157  SER E O   1 
ATOM   6925  C CB  . SER E  1 157 ? -1.013  75.840  164.256 1.00 41.41  ? 157  SER E CB  1 
ATOM   6926  O OG  . SER E  1 157 ? -0.514  77.170  164.311 1.00 42.39  ? 157  SER E OG  1 
ATOM   6927  N N   . PHE E  1 158 ? -3.471  73.777  165.034 1.00 39.95  ? 158  PHE E N   1 
ATOM   6928  C CA  . PHE E  1 158 ? -3.903  72.406  164.915 1.00 41.26  ? 158  PHE E CA  1 
ATOM   6929  C C   . PHE E  1 158 ? -5.265  72.214  164.268 1.00 42.26  ? 158  PHE E C   1 
ATOM   6930  O O   . PHE E  1 158 ? -5.602  71.107  163.866 1.00 42.29  ? 158  PHE E O   1 
ATOM   6931  C CB  . PHE E  1 158 ? -3.880  71.730  166.264 1.00 39.79  ? 158  PHE E CB  1 
ATOM   6932  C CG  . PHE E  1 158 ? -2.511  71.474  166.763 1.00 39.85  ? 158  PHE E CG  1 
ATOM   6933  C CD1 . PHE E  1 158 ? -1.995  72.186  167.824 1.00 40.31  ? 158  PHE E CD1 1 
ATOM   6934  C CD2 . PHE E  1 158 ? -1.736  70.497  166.181 1.00 40.36  ? 158  PHE E CD2 1 
ATOM   6935  C CE1 . PHE E  1 158 ? -0.704  71.913  168.302 1.00 41.37  ? 158  PHE E CE1 1 
ATOM   6936  C CE2 . PHE E  1 158 ? -0.461  70.218  166.646 1.00 41.48  ? 158  PHE E CE2 1 
ATOM   6937  C CZ  . PHE E  1 158 ? 0.061   70.926  167.713 1.00 40.45  ? 158  PHE E CZ  1 
ATOM   6938  N N   . GLY E  1 159 ? -6.049  73.280  164.144 1.00 43.71  ? 159  GLY E N   1 
ATOM   6939  C CA  . GLY E  1 159 ? -7.367  73.123  163.545 1.00 45.10  ? 159  GLY E CA  1 
ATOM   6940  C C   . GLY E  1 159 ? -8.479  74.030  164.058 1.00 45.59  ? 159  GLY E C   1 
ATOM   6941  O O   . GLY E  1 159 ? -8.290  74.831  164.980 1.00 45.72  ? 159  GLY E O   1 
ATOM   6942  N N   . ASN E  1 160 ? -9.651  73.908  163.446 1.00 45.81  ? 160  ASN E N   1 
ATOM   6943  C CA  . ASN E  1 160 ? -10.779 74.730  163.860 1.00 47.07  ? 160  ASN E CA  1 
ATOM   6944  C C   . ASN E  1 160 ? -11.155 74.480  165.325 1.00 46.05  ? 160  ASN E C   1 
ATOM   6945  O O   . ASN E  1 160 ? -11.370 75.424  166.085 1.00 47.33  ? 160  ASN E O   1 
ATOM   6946  C CB  . ASN E  1 160 ? -12.007 74.461  162.973 1.00 47.90  ? 160  ASN E CB  1 
ATOM   6947  C CG  . ASN E  1 160 ? -11.774 74.808  161.524 1.00 48.15  ? 160  ASN E CG  1 
ATOM   6948  O OD1 . ASN E  1 160 ? -11.242 75.868  161.194 1.00 49.27  ? 160  ASN E OD1 1 
ATOM   6949  N ND2 . ASN E  1 160 ? -12.183 73.924  160.651 1.00 47.72  ? 160  ASN E ND2 1 
ATOM   6950  N N   . ALA E  1 161 ? -11.233 73.214  165.710 1.00 44.07  ? 161  ALA E N   1 
ATOM   6951  C CA  . ALA E  1 161 ? -11.605 72.853  167.064 1.00 43.62  ? 161  ALA E CA  1 
ATOM   6952  C C   . ALA E  1 161 ? -10.726 73.490  168.136 1.00 43.29  ? 161  ALA E C   1 
ATOM   6953  O O   . ALA E  1 161 ? -11.121 73.579  169.287 1.00 44.60  ? 161  ALA E O   1 
ATOM   6954  C CB  . ALA E  1 161 ? -11.606 71.331  167.214 1.00 42.90  ? 161  ALA E CB  1 
ATOM   6955  N N   . LEU E  1 162 ? -9.528  73.932  167.785 1.00 42.74  ? 162  LEU E N   1 
ATOM   6956  C CA  . LEU E  1 162 ? -8.670  74.557  168.778 1.00 41.67  ? 162  LEU E CA  1 
ATOM   6957  C C   . LEU E  1 162 ? -8.621  76.054  168.600 1.00 41.77  ? 162  LEU E C   1 
ATOM   6958  O O   . LEU E  1 162 ? -7.790  76.717  169.211 1.00 41.50  ? 162  LEU E O   1 
ATOM   6959  C CB  . LEU E  1 162 ? -7.263  73.963  168.745 1.00 41.03  ? 162  LEU E CB  1 
ATOM   6960  C CG  . LEU E  1 162 ? -6.979  72.802  169.717 1.00 40.88  ? 162  LEU E CG  1 
ATOM   6961  C CD1 . LEU E  1 162 ? -6.998  73.322  171.144 1.00 40.45  ? 162  LEU E CD1 1 
ATOM   6962  C CD2 . LEU E  1 162 ? -8.022  71.700  169.553 1.00 40.92  ? 162  LEU E CD2 1 
ATOM   6963  N N   . GLY E  1 163 ? -9.512  76.583  167.757 1.00 42.94  ? 163  GLY E N   1 
ATOM   6964  C CA  . GLY E  1 163 ? -9.585  78.018  167.548 1.00 45.04  ? 163  GLY E CA  1 
ATOM   6965  C C   . GLY E  1 163 ? -9.313  78.576  166.175 1.00 47.77  ? 163  GLY E C   1 
ATOM   6966  O O   . GLY E  1 163 ? -9.451  79.771  165.963 1.00 48.72  ? 163  GLY E O   1 
ATOM   6967  N N   . ASN E  1 164 ? -8.962  77.747  165.211 1.00 50.08  ? 164  ASN E N   1 
ATOM   6968  C CA  . ASN E  1 164 ? -8.644  78.317  163.905 1.00 53.28  ? 164  ASN E CA  1 
ATOM   6969  C C   . ASN E  1 164 ? -9.825  78.990  163.189 1.00 54.95  ? 164  ASN E C   1 
ATOM   6970  O O   . ASN E  1 164 ? -9.655  79.833  162.310 1.00 54.88  ? 164  ASN E O   1 
ATOM   6971  C CB  . ASN E  1 164 ? -7.986  77.247  163.005 1.00 52.76  ? 164  ASN E CB  1 
ATOM   6972  C CG  . ASN E  1 164 ? -7.408  77.839  161.730 1.00 50.34  ? 164  ASN E CG  1 
ATOM   6973  O OD1 . ASN E  1 164 ? -7.621  77.313  160.658 1.00 50.82  ? 164  ASN E OD1 1 
ATOM   6974  N ND2 . ASN E  1 164 ? -6.686  78.934  161.851 1.00 48.79  ? 164  ASN E ND2 1 
ATOM   6975  N N   . CYS E  1 165 ? -11.034 78.622  163.569 1.00 59.01  ? 165  CYS E N   1 
ATOM   6976  C CA  . CYS E  1 165 ? -12.213 79.236  162.947 1.00 62.09  ? 165  CYS E CA  1 
ATOM   6977  C C   . CYS E  1 165 ? -12.370 80.716  163.396 1.00 63.70  ? 165  CYS E C   1 
ATOM   6978  O O   . CYS E  1 165 ? -12.669 81.618  162.595 1.00 63.91  ? 165  CYS E O   1 
ATOM   6979  C CB  . CYS E  1 165 ? -13.491 78.413  163.276 1.00 61.15  ? 165  CYS E CB  1 
ATOM   6980  S SG  . CYS E  1 165 ? -13.783 77.973  165.035 1.00 62.17  ? 165  CYS E SG  1 
ATOM   6981  N N   . ILE E  1 166 ? -12.107 80.951  164.674 1.00 65.09  ? 166  ILE E N   1 
ATOM   6982  C CA  . ILE E  1 166 ? -12.231 82.254  165.311 1.00 67.00  ? 166  ILE E CA  1 
ATOM   6983  C C   . ILE E  1 166 ? -11.997 83.542  164.524 1.00 67.57  ? 166  ILE E C   1 
ATOM   6984  O O   . ILE E  1 166 ? -12.565 84.569  164.844 1.00 68.28  ? 166  ILE E O   1 
ATOM   6985  C CB  . ILE E  1 166 ? -11.344 82.278  166.566 1.00 68.00  ? 166  ILE E CB  1 
ATOM   6986  C CG1 . ILE E  1 166 ? -12.172 82.703  167.779 1.00 68.52  ? 166  ILE E CG1 1 
ATOM   6987  C CG2 . ILE E  1 166 ? -10.158 83.197  166.351 1.00 68.63  ? 166  ILE E CG2 1 
ATOM   6988  C CD1 . ILE E  1 166 ? -12.558 84.150  167.765 1.00 70.63  ? 166  ILE E CD1 1 
ATOM   6989  N N   . LEU E  1 167 ? -11.166 83.519  163.505 1.00 68.70  ? 167  LEU E N   1 
ATOM   6990  C CA  . LEU E  1 167 ? -10.918 84.757  162.789 1.00 69.97  ? 167  LEU E CA  1 
ATOM   6991  C C   . LEU E  1 167 ? -11.493 84.760  161.356 1.00 70.07  ? 167  LEU E C   1 
ATOM   6992  O O   . LEU E  1 167 ? -11.317 85.712  160.588 1.00 69.81  ? 167  LEU E O   1 
ATOM   6993  C CB  . LEU E  1 167 ? -9.403  85.052  162.848 1.00 71.02  ? 167  LEU E CB  1 
ATOM   6994  C CG  . LEU E  1 167 ? -8.337  83.971  162.543 1.00 72.44  ? 167  LEU E CG  1 
ATOM   6995  C CD1 . LEU E  1 167 ? -8.667  82.610  163.186 1.00 70.06  ? 167  LEU E CD1 1 
ATOM   6996  C CD2 . LEU E  1 167 ? -8.234  83.810  161.009 1.00 73.85  ? 167  LEU E CD2 1 
ATOM   6997  N N   . ASP E  1 168 ? -12.220 83.686  161.045 1.00 70.25  ? 168  ASP E N   1 
ATOM   6998  C CA  . ASP E  1 168 ? -12.877 83.466  159.755 1.00 70.26  ? 168  ASP E CA  1 
ATOM   6999  C C   . ASP E  1 168 ? -14.171 84.265  159.739 1.00 72.55  ? 168  ASP E C   1 
ATOM   7000  O O   . ASP E  1 168 ? -15.162 83.857  160.351 1.00 73.01  ? 168  ASP E O   1 
ATOM   7001  C CB  . ASP E  1 168 ? -13.182 81.969  159.601 1.00 67.56  ? 168  ASP E CB  1 
ATOM   7002  C CG  . ASP E  1 168 ? -13.939 81.637  158.327 1.00 66.65  ? 168  ASP E CG  1 
ATOM   7003  O OD1 . ASP E  1 168 ? -14.245 80.443  158.135 1.00 65.73  ? 168  ASP E OD1 1 
ATOM   7004  O OD2 . ASP E  1 168 ? -14.229 82.541  157.519 1.00 65.36  ? 168  ASP E OD2 1 
ATOM   7005  N N   . LYS E  1 169 ? -14.169 85.400  159.047 1.00 74.71  ? 169  LYS E N   1 
ATOM   7006  C CA  . LYS E  1 169 ? -15.354 86.263  158.971 1.00 76.98  ? 169  LYS E CA  1 
ATOM   7007  C C   . LYS E  1 169 ? -16.701 85.602  158.618 1.00 77.84  ? 169  LYS E C   1 
ATOM   7008  O O   . LYS E  1 169 ? -17.748 86.053  159.097 1.00 77.52  ? 169  LYS E O   1 
ATOM   7009  C CB  . LYS E  1 169 ? -15.082 87.416  158.012 1.00 77.89  ? 169  LYS E CB  1 
ATOM   7010  C CG  . LYS E  1 169 ? -13.918 88.276  158.480 1.00 79.69  ? 169  LYS E CG  1 
ATOM   7011  C CD  . LYS E  1 169 ? -13.446 89.234  157.396 1.00 81.44  ? 169  LYS E CD  1 
ATOM   7012  C CE  . LYS E  1 169 ? -12.122 89.901  157.798 1.00 82.15  ? 169  LYS E CE  1 
ATOM   7013  N NZ  . LYS E  1 169 ? -11.563 90.798  156.739 1.00 82.23  ? 169  LYS E NZ  1 
ATOM   7014  N N   . ASP E  1 170 ? -16.685 84.550  157.793 1.00 78.88  ? 170  ASP E N   1 
ATOM   7015  C CA  . ASP E  1 170 ? -17.926 83.850  157.430 1.00 79.52  ? 170  ASP E CA  1 
ATOM   7016  C C   . ASP E  1 170 ? -18.449 83.020  158.607 1.00 79.14  ? 170  ASP E C   1 
ATOM   7017  O O   . ASP E  1 170 ? -19.653 82.783  158.730 1.00 79.83  ? 170  ASP E O   1 
ATOM   7018  C CB  . ASP E  1 170 ? -17.716 82.918  156.229 1.00 81.26  ? 170  ASP E CB  1 
ATOM   7019  C CG  . ASP E  1 170 ? -17.317 83.659  154.978 1.00 83.50  ? 170  ASP E CG  1 
ATOM   7020  O OD1 . ASP E  1 170 ? -18.043 84.605  154.578 1.00 85.24  ? 170  ASP E OD1 1 
ATOM   7021  O OD2 . ASP E  1 170 ? -16.272 83.284  154.396 1.00 84.93  ? 170  ASP E OD2 1 
ATOM   7022  N N   . TYR E  1 171 ? -17.538 82.557  159.454 1.00 77.86  ? 171  TYR E N   1 
ATOM   7023  C CA  . TYR E  1 171 ? -17.904 81.783  160.630 1.00 76.41  ? 171  TYR E CA  1 
ATOM   7024  C C   . TYR E  1 171 ? -18.487 82.757  161.647 1.00 76.92  ? 171  TYR E C   1 
ATOM   7025  O O   . TYR E  1 171 ? -19.530 82.489  162.241 1.00 76.93  ? 171  TYR E O   1 
ATOM   7026  C CB  . TYR E  1 171 ? -16.660 81.115  161.212 1.00 74.41  ? 171  TYR E CB  1 
ATOM   7027  C CG  . TYR E  1 171 ? -16.780 80.709  162.659 1.00 71.00  ? 171  TYR E CG  1 
ATOM   7028  C CD1 . TYR E  1 171 ? -17.414 79.526  163.021 1.00 69.84  ? 171  TYR E CD1 1 
ATOM   7029  C CD2 . TYR E  1 171 ? -16.251 81.509  163.664 1.00 70.02  ? 171  TYR E CD2 1 
ATOM   7030  C CE1 . TYR E  1 171 ? -17.516 79.141  164.346 1.00 68.90  ? 171  TYR E CE1 1 
ATOM   7031  C CE2 . TYR E  1 171 ? -16.346 81.138  164.994 1.00 69.20  ? 171  TYR E CE2 1 
ATOM   7032  C CZ  . TYR E  1 171 ? -16.981 79.948  165.325 1.00 68.69  ? 171  TYR E CZ  1 
ATOM   7033  O OH  . TYR E  1 171 ? -17.077 79.547  166.628 1.00 68.34  ? 171  TYR E OH  1 
ATOM   7034  N N   . LEU E  1 172 ? -17.802 83.887  161.840 1.00 77.05  ? 172  LEU E N   1 
ATOM   7035  C CA  . LEU E  1 172 ? -18.251 84.909  162.780 1.00 77.33  ? 172  LEU E CA  1 
ATOM   7036  C C   . LEU E  1 172 ? -19.654 85.364  162.414 1.00 78.58  ? 172  LEU E C   1 
ATOM   7037  O O   . LEU E  1 172 ? -20.551 85.419  163.257 1.00 78.67  ? 172  LEU E O   1 
ATOM   7038  C CB  . LEU E  1 172 ? -17.297 86.106  162.763 1.00 75.23  ? 172  LEU E CB  1 
ATOM   7039  C CG  . LEU E  1 172 ? -15.931 85.813  163.370 1.00 73.69  ? 172  LEU E CG  1 
ATOM   7040  C CD1 . LEU E  1 172 ? -15.065 87.026  163.265 1.00 72.94  ? 172  LEU E CD1 1 
ATOM   7041  C CD2 . LEU E  1 172 ? -16.095 85.394  164.822 1.00 73.45  ? 172  LEU E CD2 1 
ATOM   7042  N N   . ARG E  1 173 ? -19.825 85.675  161.136 1.00 80.15  ? 173  ARG E N   1 
ATOM   7043  C CA  . ARG E  1 173 ? -21.091 86.132  160.582 1.00 81.02  ? 173  ARG E CA  1 
ATOM   7044  C C   . ARG E  1 173 ? -22.210 85.149  160.903 1.00 81.57  ? 173  ARG E C   1 
ATOM   7045  O O   . ARG E  1 173 ? -23.226 85.538  161.469 1.00 82.32  ? 173  ARG E O   1 
ATOM   7046  C CB  . ARG E  1 173 ? -20.928 86.290  159.074 1.00 81.53  ? 173  ARG E CB  1 
ATOM   7047  C CG  . ARG E  1 173 ? -21.942 87.163  158.382 1.00 83.02  ? 173  ARG E CG  1 
ATOM   7048  C CD  . ARG E  1 173 ? -21.357 87.722  157.079 1.00 84.29  ? 173  ARG E CD  1 
ATOM   7049  N NE  . ARG E  1 173 ? -20.712 86.691  156.260 1.00 86.55  ? 173  ARG E NE  1 
ATOM   7050  C CZ  . ARG E  1 173 ? -21.336 85.622  155.768 1.00 87.63  ? 173  ARG E CZ  1 
ATOM   7051  N NH1 . ARG E  1 173 ? -22.632 85.438  156.010 1.00 88.69  ? 173  ARG E NH1 1 
ATOM   7052  N NH2 . ARG E  1 173 ? -20.666 84.736  155.034 1.00 88.13  ? 173  ARG E NH2 1 
ATOM   7053  N N   . SER E  1 174 ? -22.025 83.879  160.563 1.00 82.13  ? 174  SER E N   1 
ATOM   7054  C CA  . SER E  1 174 ? -23.051 82.889  160.836 1.00 83.68  ? 174  SER E CA  1 
ATOM   7055  C C   . SER E  1 174 ? -23.190 82.551  162.338 1.00 84.95  ? 174  SER E C   1 
ATOM   7056  O O   . SER E  1 174 ? -24.111 81.828  162.741 1.00 85.41  ? 174  SER E O   1 
ATOM   7057  C CB  . SER E  1 174 ? -22.784 81.631  160.017 1.00 83.23  ? 174  SER E CB  1 
ATOM   7058  O OG  . SER E  1 174 ? -22.513 80.534  160.859 1.00 83.54  ? 174  SER E OG  1 
ATOM   7059  N N   . LEU E  1 175 ? -22.291 83.075  163.169 1.00 85.86  ? 175  LEU E N   1 
ATOM   7060  C CA  . LEU E  1 175 ? -22.375 82.839  164.613 1.00 87.03  ? 175  LEU E CA  1 
ATOM   7061  C C   . LEU E  1 175 ? -23.376 83.856  165.157 1.00 88.59  ? 175  LEU E C   1 
ATOM   7062  O O   . LEU E  1 175 ? -24.155 83.556  166.061 1.00 88.30  ? 175  LEU E O   1 
ATOM   7063  C CB  . LEU E  1 175 ? -21.026 83.083  165.289 1.00 85.74  ? 175  LEU E CB  1 
ATOM   7064  C CG  . LEU E  1 175 ? -20.275 81.976  166.026 1.00 84.66  ? 175  LEU E CG  1 
ATOM   7065  C CD1 . LEU E  1 175 ? -19.194 82.640  166.847 1.00 84.29  ? 175  LEU E CD1 1 
ATOM   7066  C CD2 . LEU E  1 175 ? -21.177 81.179  166.931 1.00 83.96  ? 175  LEU E CD2 1 
ATOM   7067  N N   . ASN E  1 176 ? -23.323 85.064  164.593 1.00 90.19  ? 176  ASN E N   1 
ATOM   7068  C CA  . ASN E  1 176 ? -24.195 86.168  164.975 1.00 92.00  ? 176  ASN E CA  1 
ATOM   7069  C C   . ASN E  1 176 ? -25.650 85.871  164.691 1.00 93.24  ? 176  ASN E C   1 
ATOM   7070  O O   . ASN E  1 176 ? -26.538 86.343  165.403 1.00 94.03  ? 176  ASN E O   1 
ATOM   7071  C CB  . ASN E  1 176 ? -23.801 87.432  164.226 1.00 92.52  ? 176  ASN E CB  1 
ATOM   7072  C CG  . ASN E  1 176 ? -22.986 88.372  165.079 1.00 93.39  ? 176  ASN E CG  1 
ATOM   7073  O OD1 . ASN E  1 176 ? -23.520 89.035  165.968 1.00 93.49  ? 176  ASN E OD1 1 
ATOM   7074  N ND2 . ASN E  1 176 ? -21.683 88.427  164.829 1.00 94.05  ? 176  ASN E ND2 1 
ATOM   7075  N N   . LYS E  1 177 ? -25.893 85.098  163.637 1.00 94.26  ? 177  LYS E N   1 
ATOM   7076  C CA  . LYS E  1 177 ? -27.249 84.721  163.253 1.00 94.91  ? 177  LYS E CA  1 
ATOM   7077  C C   . LYS E  1 177 ? -27.797 83.631  164.170 1.00 95.74  ? 177  LYS E C   1 
ATOM   7078  O O   . LYS E  1 177 ? -28.493 82.710  163.740 1.00 95.33  ? 177  LYS E O   1 
ATOM   7079  C CB  . LYS E  1 177 ? -27.268 84.245  161.802 1.00 94.46  ? 177  LYS E CB  1 
ATOM   7080  C CG  . LYS E  1 177 ? -26.906 85.324  160.810 1.00 93.53  ? 177  LYS E CG  1 
ATOM   7081  C CD  . LYS E  1 177 ? -26.851 84.783  159.392 1.00 93.86  ? 177  LYS E CD  1 
ATOM   7082  C CE  . LYS E  1 177 ? -26.417 85.873  158.417 1.00 94.39  ? 177  LYS E CE  1 
ATOM   7083  N NZ  . LYS E  1 177 ? -26.238 85.387  157.016 1.00 94.47  ? 177  LYS E NZ  1 
ATOM   7084  N N   . LEU E  1 178 ? -27.485 83.745  165.449 1.00 97.09  ? 178  LEU E N   1 
ATOM   7085  C CA  . LEU E  1 178 ? -27.978 82.774  166.406 1.00 98.51  ? 178  LEU E CA  1 
ATOM   7086  C C   . LEU E  1 178 ? -28.685 83.483  167.572 1.00 99.69  ? 178  LEU E C   1 
ATOM   7087  O O   . LEU E  1 178 ? -28.714 84.732  167.649 1.00 99.17  ? 178  LEU E O   1 
ATOM   7088  C CB  . LEU E  1 178 ? -26.825 81.887  166.908 1.00 98.42  ? 178  LEU E CB  1 
ATOM   7089  C CG  . LEU E  1 178 ? -26.174 80.937  165.893 1.00 98.22  ? 178  LEU E CG  1 
ATOM   7090  C CD1 . LEU E  1 178 ? -25.051 80.180  166.575 1.00 97.67  ? 178  LEU E CD1 1 
ATOM   7091  C CD2 . LEU E  1 178 ? -27.207 79.972  165.326 1.00 96.96  ? 178  LEU E CD2 1 
ATOM   7092  N N   . PRO E  1 179 ? -29.301 82.691  168.474 1.00 101.08 ? 179  PRO E N   1 
ATOM   7093  C CA  . PRO E  1 179 ? -30.012 83.237  169.638 1.00 102.00 ? 179  PRO E CA  1 
ATOM   7094  C C   . PRO E  1 179 ? -29.049 83.515  170.795 1.00 102.78 ? 179  PRO E C   1 
ATOM   7095  O O   . PRO E  1 179 ? -27.978 82.897  170.870 1.00 102.98 ? 179  PRO E O   1 
ATOM   7096  C CB  . PRO E  1 179 ? -31.006 82.119  169.994 1.00 101.65 ? 179  PRO E CB  1 
ATOM   7097  C CG  . PRO E  1 179 ? -31.084 81.262  168.724 1.00 101.06 ? 179  PRO E CG  1 
ATOM   7098  C CD  . PRO E  1 179 ? -29.662 81.274  168.272 1.00 100.80 ? 179  PRO E CD  1 
ATOM   7099  N N   . ARG E  1 180 ? -29.415 84.443  171.683 1.00 103.58 ? 180  ARG E N   1 
ATOM   7100  C CA  . ARG E  1 180 ? -28.581 84.719  172.856 1.00 104.09 ? 180  ARG E CA  1 
ATOM   7101  C C   . ARG E  1 180 ? -28.351 83.343  173.487 1.00 103.76 ? 180  ARG E C   1 
ATOM   7102  O O   . ARG E  1 180 ? -28.893 82.322  173.049 1.00 103.44 ? 180  ARG E O   1 
ATOM   7103  C CB  . ARG E  1 180 ? -29.312 85.540  173.943 1.00 105.31 ? 180  ARG E CB  1 
ATOM   7104  C CG  . ARG E  1 180 ? -29.714 87.002  173.700 1.00 106.87 ? 180  ARG E CG  1 
ATOM   7105  C CD  . ARG E  1 180 ? -30.333 87.564  175.025 1.00 107.70 ? 180  ARG E CD  1 
ATOM   7106  N NE  . ARG E  1 180 ? -31.031 88.849  174.884 1.00 108.62 ? 180  ARG E NE  1 
ATOM   7107  C CZ  . ARG E  1 180 ? -31.497 89.576  175.903 1.00 108.85 ? 180  ARG E CZ  1 
ATOM   7108  N NH1 . ARG E  1 180 ? -31.345 89.156  177.157 1.00 108.69 ? 180  ARG E NH1 1 
ATOM   7109  N NH2 . ARG E  1 180 ? -32.114 90.734  175.670 1.00 108.65 ? 180  ARG E NH2 1 
ATOM   7110  N N   . GLN E  1 181 ? -27.575 83.319  174.551 1.00 103.63 ? 181  GLN E N   1 
ATOM   7111  C CA  . GLN E  1 181 ? -27.352 82.069  175.228 1.00 103.81 ? 181  GLN E CA  1 
ATOM   7112  C C   . GLN E  1 181 ? -26.907 82.386  176.658 1.00 103.67 ? 181  GLN E C   1 
ATOM   7113  O O   . GLN E  1 181 ? -25.784 82.842  176.904 1.00 104.27 ? 181  GLN E O   1 
ATOM   7114  C CB  . GLN E  1 181 ? -26.337 81.228  174.435 1.00 104.52 ? 181  GLN E CB  1 
ATOM   7115  C CG  . GLN E  1 181 ? -24.900 81.715  174.429 1.00 104.72 ? 181  GLN E CG  1 
ATOM   7116  C CD  . GLN E  1 181 ? -23.987 80.676  175.045 1.00 105.26 ? 181  GLN E CD  1 
ATOM   7117  O OE1 . GLN E  1 181 ? -24.053 79.493  174.689 1.00 105.26 ? 181  GLN E OE1 1 
ATOM   7118  N NE2 . GLN E  1 181 ? -23.136 81.102  175.977 1.00 105.68 ? 181  GLN E NE2 1 
ATOM   7119  N N   . LEU E  1 182 ? -27.824 82.172  177.598 1.00 102.52 ? 182  LEU E N   1 
ATOM   7120  C CA  . LEU E  1 182 ? -27.563 82.457  179.002 1.00 101.62 ? 182  LEU E CA  1 
ATOM   7121  C C   . LEU E  1 182 ? -26.405 81.645  179.564 1.00 100.70 ? 182  LEU E C   1 
ATOM   7122  O O   . LEU E  1 182 ? -26.466 80.421  179.627 1.00 99.95  ? 182  LEU E O   1 
ATOM   7123  C CB  . LEU E  1 182 ? -28.831 82.223  179.840 1.00 102.02 ? 182  LEU E CB  1 
ATOM   7124  C CG  . LEU E  1 182 ? -29.405 80.827  180.130 1.00 102.04 ? 182  LEU E CG  1 
ATOM   7125  C CD1 . LEU E  1 182 ? -30.602 81.032  181.052 1.00 101.38 ? 182  LEU E CD1 1 
ATOM   7126  C CD2 . LEU E  1 182 ? -29.812 80.071  178.843 1.00 101.58 ? 182  LEU E CD2 1 
ATOM   7127  N N   . PRO E  1 183 ? -25.330 82.331  179.980 1.00 100.34 ? 183  PRO E N   1 
ATOM   7128  C CA  . PRO E  1 183 ? -24.143 81.678  180.544 1.00 100.30 ? 183  PRO E CA  1 
ATOM   7129  C C   . PRO E  1 183 ? -24.541 80.563  181.512 1.00 99.97  ? 183  PRO E C   1 
ATOM   7130  O O   . PRO E  1 183 ? -24.588 80.774  182.734 1.00 99.81  ? 183  PRO E O   1 
ATOM   7131  C CB  . PRO E  1 183 ? -23.419 82.834  181.238 1.00 100.42 ? 183  PRO E CB  1 
ATOM   7132  C CG  . PRO E  1 183 ? -23.728 83.993  180.327 1.00 100.59 ? 183  PRO E CG  1 
ATOM   7133  C CD  . PRO E  1 183 ? -25.210 83.800  180.050 1.00 100.32 ? 183  PRO E CD  1 
ATOM   7134  N N   . LEU E  1 184 ? -24.813 79.383  180.951 1.00 99.53  ? 184  LEU E N   1 
ATOM   7135  C CA  . LEU E  1 184 ? -25.244 78.216  181.720 1.00 99.05  ? 184  LEU E CA  1 
ATOM   7136  C C   . LEU E  1 184 ? -24.688 78.222  183.146 1.00 99.19  ? 184  LEU E C   1 
ATOM   7137  O O   . LEU E  1 184 ? -23.637 78.823  183.424 1.00 99.88  ? 184  LEU E O   1 
ATOM   7138  C CB  . LEU E  1 184 ? -24.817 76.919  181.017 1.00 98.25  ? 184  LEU E CB  1 
ATOM   7139  C CG  . LEU E  1 184 ? -25.701 75.657  181.089 1.00 97.39  ? 184  LEU E CG  1 
ATOM   7140  C CD1 . LEU E  1 184 ? -24.813 74.440  180.851 1.00 96.52  ? 184  LEU E CD1 1 
ATOM   7141  C CD2 . LEU E  1 184 ? -26.400 75.519  182.433 1.00 96.69  ? 184  LEU E CD2 1 
ATOM   7142  N N   . GLU E  1 185 ? -25.406 77.556  184.050 1.00 98.48  ? 185  GLU E N   1 
ATOM   7143  C CA  . GLU E  1 185 ? -24.985 77.469  185.439 1.00 97.26  ? 185  GLU E CA  1 
ATOM   7144  C C   . GLU E  1 185 ? -24.083 76.259  185.611 1.00 95.76  ? 185  GLU E C   1 
ATOM   7145  O O   . GLU E  1 185 ? -24.327 75.179  185.054 1.00 95.33  ? 185  GLU E O   1 
ATOM   7146  C CB  . GLU E  1 185 ? -26.201 77.369  186.377 1.00 97.99  ? 185  GLU E CB  1 
ATOM   7147  C CG  . GLU E  1 185 ? -27.204 78.535  186.234 1.00 100.11 ? 185  GLU E CG  1 
ATOM   7148  C CD  . GLU E  1 185 ? -26.603 79.927  186.551 1.00 101.24 ? 185  GLU E CD  1 
ATOM   7149  O OE1 . GLU E  1 185 ? -26.521 80.303  187.744 1.00 100.69 ? 185  GLU E OE1 1 
ATOM   7150  O OE2 . GLU E  1 185 ? -26.211 80.646  185.598 1.00 101.82 ? 185  GLU E OE2 1 
ATOM   7151  N N   . VAL E  1 186 ? -23.023 76.461  186.377 1.00 94.18  ? 186  VAL E N   1 
ATOM   7152  C CA  . VAL E  1 186 ? -22.069 75.406  186.648 1.00 92.57  ? 186  VAL E CA  1 
ATOM   7153  C C   . VAL E  1 186 ? -22.598 74.553  187.809 1.00 91.48  ? 186  VAL E C   1 
ATOM   7154  O O   . VAL E  1 186 ? -22.967 75.083  188.864 1.00 91.44  ? 186  VAL E O   1 
ATOM   7155  C CB  . VAL E  1 186 ? -20.719 76.026  187.016 1.00 92.63  ? 186  VAL E CB  1 
ATOM   7156  C CG1 . VAL E  1 186 ? -19.648 74.949  187.081 1.00 92.46  ? 186  VAL E CG1 1 
ATOM   7157  C CG2 . VAL E  1 186 ? -20.373 77.131  186.013 1.00 91.98  ? 186  VAL E CG2 1 
ATOM   7158  N N   . ASP E  1 187 ? -22.639 73.239  187.614 1.00 89.68  ? 187  ASP E N   1 
ATOM   7159  C CA  . ASP E  1 187 ? -23.135 72.333  188.645 1.00 87.99  ? 187  ASP E CA  1 
ATOM   7160  C C   . ASP E  1 187 ? -21.998 71.778  189.509 1.00 86.72  ? 187  ASP E C   1 
ATOM   7161  O O   . ASP E  1 187 ? -21.376 70.782  189.165 1.00 86.40  ? 187  ASP E O   1 
ATOM   7162  C CB  . ASP E  1 187 ? -23.910 71.172  187.989 1.00 88.26  ? 187  ASP E CB  1 
ATOM   7163  C CG  . ASP E  1 187 ? -24.533 70.213  189.011 1.00 88.26  ? 187  ASP E CG  1 
ATOM   7164  O OD1 . ASP E  1 187 ? -24.916 69.076  188.630 1.00 87.94  ? 187  ASP E OD1 1 
ATOM   7165  O OD2 . ASP E  1 187 ? -24.646 70.607  190.192 1.00 88.22  ? 187  ASP E OD2 1 
ATOM   7166  N N   . LEU E  1 188 ? -21.742 72.410  190.644 1.00 85.16  ? 188  LEU E N   1 
ATOM   7167  C CA  . LEU E  1 188 ? -20.686 71.959  191.546 1.00 84.26  ? 188  LEU E CA  1 
ATOM   7168  C C   . LEU E  1 188 ? -21.051 70.757  192.450 1.00 83.17  ? 188  LEU E C   1 
ATOM   7169  O O   . LEU E  1 188 ? -20.540 70.641  193.553 1.00 82.76  ? 188  LEU E O   1 
ATOM   7170  C CB  . LEU E  1 188 ? -20.267 73.145  192.416 1.00 84.54  ? 188  LEU E CB  1 
ATOM   7171  C CG  . LEU E  1 188 ? -19.759 74.371  191.641 1.00 85.12  ? 188  LEU E CG  1 
ATOM   7172  C CD1 . LEU E  1 188 ? -19.831 75.647  192.489 1.00 84.67  ? 188  LEU E CD1 1 
ATOM   7173  C CD2 . LEU E  1 188 ? -18.327 74.098  191.206 1.00 85.35  ? 188  LEU E CD2 1 
ATOM   7174  N N   . THR E  1 189 ? -21.908 69.853  191.987 1.00 82.26  ? 189  THR E N   1 
ATOM   7175  C CA  . THR E  1 189 ? -22.327 68.709  192.817 1.00 81.45  ? 189  THR E CA  1 
ATOM   7176  C C   . THR E  1 189 ? -21.173 67.809  193.232 1.00 80.28  ? 189  THR E C   1 
ATOM   7177  O O   . THR E  1 189 ? -20.912 67.596  194.422 1.00 79.43  ? 189  THR E O   1 
ATOM   7178  C CB  . THR E  1 189 ? -23.389 67.796  192.087 1.00 81.99  ? 189  THR E CB  1 
ATOM   7179  O OG1 . THR E  1 189 ? -24.546 68.569  191.750 1.00 82.09  ? 189  THR E OG1 1 
ATOM   7180  C CG2 . THR E  1 189 ? -23.832 66.618  192.992 1.00 81.32  ? 189  THR E CG2 1 
ATOM   7181  N N   . LYS E  1 190 ? -20.497 67.269  192.226 1.00 79.57  ? 190  LYS E N   1 
ATOM   7182  C CA  . LYS E  1 190 ? -19.380 66.362  192.448 1.00 78.72  ? 190  LYS E CA  1 
ATOM   7183  C C   . LYS E  1 190 ? -18.020 67.071  192.319 1.00 77.85  ? 190  LYS E C   1 
ATOM   7184  O O   . LYS E  1 190 ? -17.046 66.507  191.793 1.00 77.94  ? 190  LYS E O   1 
ATOM   7185  C CB  . LYS E  1 190 ? -19.489 65.183  191.468 1.00 78.77  ? 190  LYS E CB  1 
ATOM   7186  C CG  . LYS E  1 190 ? -20.850 64.503  191.498 1.00 77.68  ? 190  LYS E CG  1 
ATOM   7187  C CD  . LYS E  1 190 ? -21.061 63.603  190.308 1.00 77.63  ? 190  LYS E CD  1 
ATOM   7188  C CE  . LYS E  1 190 ? -22.537 63.285  190.148 1.00 77.72  ? 190  LYS E CE  1 
ATOM   7189  N NZ  . LYS E  1 190 ? -22.805 62.433  188.955 1.00 78.11  ? 190  LYS E NZ  1 
ATOM   7190  N N   . ALA E  1 191 ? -17.977 68.313  192.803 1.00 76.40  ? 191  ALA E N   1 
ATOM   7191  C CA  . ALA E  1 191 ? -16.771 69.115  192.792 1.00 75.05  ? 191  ALA E CA  1 
ATOM   7192  C C   . ALA E  1 191 ? -15.802 68.480  193.775 1.00 75.05  ? 191  ALA E C   1 
ATOM   7193  O O   . ALA E  1 191 ? -16.198 67.945  194.802 1.00 74.60  ? 191  ALA E O   1 
ATOM   7194  C CB  . ALA E  1 191 ? -17.091 70.552  193.200 1.00 74.21  ? 191  ALA E CB  1 
ATOM   7195  N N   . LYS E  1 192 ? -14.523 68.525  193.442 1.00 75.93  ? 192  LYS E N   1 
ATOM   7196  C CA  . LYS E  1 192 ? -13.491 67.943  194.290 1.00 76.83  ? 192  LYS E CA  1 
ATOM   7197  C C   . LYS E  1 192 ? -13.374 68.751  195.599 1.00 77.30  ? 192  LYS E C   1 
ATOM   7198  O O   . LYS E  1 192 ? -13.375 69.988  195.557 1.00 76.28  ? 192  LYS E O   1 
ATOM   7199  C CB  . LYS E  1 192 ? -12.159 67.957  193.520 1.00 76.59  ? 192  LYS E CB  1 
ATOM   7200  C CG  . LYS E  1 192 ? -11.024 67.136  194.133 1.00 76.51  ? 192  LYS E CG  1 
ATOM   7201  C CD  . LYS E  1 192 ? -9.667  67.525  193.512 1.00 76.22  ? 192  LYS E CD  1 
ATOM   7202  C CE  . LYS E  1 192 ? -8.831  66.317  193.102 1.00 75.33  ? 192  LYS E CE  1 
ATOM   7203  N NZ  . LYS E  1 192 ? -8.390  65.463  194.219 1.00 74.82  ? 192  LYS E NZ  1 
ATOM   7204  N N   . ARG E  1 193 ? -13.296 68.055  196.745 1.00 78.30  ? 193  ARG E N   1 
ATOM   7205  C CA  . ARG E  1 193 ? -13.152 68.704  198.076 1.00 79.07  ? 193  ARG E CA  1 
ATOM   7206  C C   . ARG E  1 193 ? -11.972 68.125  198.865 1.00 79.43  ? 193  ARG E C   1 
ATOM   7207  O O   . ARG E  1 193 ? -11.491 68.720  199.843 1.00 79.23  ? 193  ARG E O   1 
ATOM   7208  C CB  . ARG E  1 193 ? -14.401 68.532  198.937 1.00 78.91  ? 193  ARG E CB  1 
ATOM   7209  C CG  . ARG E  1 193 ? -15.627 69.212  198.437 1.00 79.10  ? 193  ARG E CG  1 
ATOM   7210  C CD  . ARG E  1 193 ? -16.802 68.574  199.096 1.00 80.07  ? 193  ARG E CD  1 
ATOM   7211  N NE  . ARG E  1 193 ? -18.012 68.847  198.348 1.00 81.24  ? 193  ARG E NE  1 
ATOM   7212  C CZ  . ARG E  1 193 ? -18.509 70.063  198.196 1.00 82.49  ? 193  ARG E CZ  1 
ATOM   7213  N NH1 . ARG E  1 193 ? -17.885 71.096  198.751 1.00 82.73  ? 193  ARG E NH1 1 
ATOM   7214  N NH2 . ARG E  1 193 ? -19.613 70.244  197.480 1.00 83.09  ? 193  ARG E NH2 1 
ATOM   7215  N N   . GLN E  1 194 ? -11.527 66.947  198.450 1.00 79.58  ? 194  GLN E N   1 
ATOM   7216  C CA  . GLN E  1 194 ? -10.398 66.307  199.089 1.00 79.69  ? 194  GLN E CA  1 
ATOM   7217  C C   . GLN E  1 194 ? -9.227  66.369  198.114 1.00 78.92  ? 194  GLN E C   1 
ATOM   7218  O O   . GLN E  1 194 ? -9.367  66.831  196.973 1.00 79.48  ? 194  GLN E O   1 
ATOM   7219  C CB  . GLN E  1 194 ? -10.725 64.853  199.369 1.00 81.07  ? 194  GLN E CB  1 
ATOM   7220  C CG  . GLN E  1 194 ? -12.131 64.646  199.838 1.00 83.75  ? 194  GLN E CG  1 
ATOM   7221  C CD  . GLN E  1 194 ? -12.310 63.290  200.500 1.00 85.85  ? 194  GLN E CD  1 
ATOM   7222  O OE1 . GLN E  1 194 ? -13.361 62.996  201.093 1.00 86.22  ? 194  GLN E OE1 1 
ATOM   7223  N NE2 . GLN E  1 194 ? -11.279 62.448  200.402 1.00 87.18  ? 194  GLN E NE2 1 
ATOM   7224  N N   . ASP E  1 195 ? -8.071  65.913  198.568 1.00 76.90  ? 195  ASP E N   1 
ATOM   7225  C CA  . ASP E  1 195 ? -6.910  65.879  197.711 1.00 74.11  ? 195  ASP E CA  1 
ATOM   7226  C C   . ASP E  1 195 ? -6.935  64.479  197.130 1.00 73.26  ? 195  ASP E C   1 
ATOM   7227  O O   . ASP E  1 195 ? -7.315  64.279  195.977 1.00 73.59  ? 195  ASP E O   1 
ATOM   7228  C CB  . ASP E  1 195 ? -5.630  66.102  198.523 1.00 72.44  ? 195  ASP E CB  1 
ATOM   7229  C CG  . ASP E  1 195 ? -5.406  67.561  198.861 1.00 70.97  ? 195  ASP E CG  1 
ATOM   7230  O OD1 . ASP E  1 195 ? -4.497  67.858  199.671 1.00 70.48  ? 195  ASP E OD1 1 
ATOM   7231  O OD2 . ASP E  1 195 ? -6.134  68.408  198.301 1.00 69.18  ? 195  ASP E OD2 1 
ATOM   7232  N N   . LEU E  1 196 ? -6.569  63.510  197.960 1.00 71.97  ? 196  LEU E N   1 
ATOM   7233  C CA  . LEU E  1 196 ? -6.502  62.100  197.571 1.00 70.38  ? 196  LEU E CA  1 
ATOM   7234  C C   . LEU E  1 196 ? -7.447  61.697  196.429 1.00 69.09  ? 196  LEU E C   1 
ATOM   7235  O O   . LEU E  1 196 ? -8.636  62.024  196.427 1.00 68.72  ? 196  LEU E O   1 
ATOM   7236  C CB  . LEU E  1 196 ? -6.757  61.217  198.802 1.00 70.47  ? 196  LEU E CB  1 
ATOM   7237  C CG  . LEU E  1 196 ? -6.173  59.801  198.958 1.00 70.37  ? 196  LEU E CG  1 
ATOM   7238  C CD1 . LEU E  1 196 ? -6.672  58.889  197.868 1.00 70.56  ? 196  LEU E CD1 1 
ATOM   7239  C CD2 . LEU E  1 196 ? -4.672  59.866  198.943 1.00 69.96  ? 196  LEU E CD2 1 
ATOM   7240  N N   . GLU E  1 197 ? -6.878  61.015  195.441 1.00 67.64  ? 197  GLU E N   1 
ATOM   7241  C CA  . GLU E  1 197 ? -7.620  60.515  194.307 1.00 66.42  ? 197  GLU E CA  1 
ATOM   7242  C C   . GLU E  1 197 ? -7.316  59.019  194.323 1.00 67.02  ? 197  GLU E C   1 
ATOM   7243  O O   . GLU E  1 197 ? -6.295  58.561  193.831 1.00 66.39  ? 197  GLU E O   1 
ATOM   7244  C CB  . GLU E  1 197 ? -7.171  61.200  193.012 1.00 64.29  ? 197  GLU E CB  1 
ATOM   7245  C CG  . GLU E  1 197 ? -7.756  62.633  192.826 1.00 62.07  ? 197  GLU E CG  1 
ATOM   7246  C CD  . GLU E  1 197 ? -9.198  62.648  192.273 1.00 61.66  ? 197  GLU E CD  1 
ATOM   7247  O OE1 . GLU E  1 197 ? -9.714  61.555  191.905 1.00 60.06  ? 197  GLU E OE1 1 
ATOM   7248  O OE2 . GLU E  1 197 ? -9.804  63.751  192.197 1.00 59.42  ? 197  GLU E OE2 1 
ATOM   7249  N N   . PRO E  1 198 ? -8.209  58.244  194.958 1.00 68.20  ? 198  PRO E N   1 
ATOM   7250  C CA  . PRO E  1 198 ? -8.160  56.782  195.135 1.00 68.56  ? 198  PRO E CA  1 
ATOM   7251  C C   . PRO E  1 198 ? -7.879  55.913  193.916 1.00 68.89  ? 198  PRO E C   1 
ATOM   7252  O O   . PRO E  1 198 ? -7.038  55.018  193.994 1.00 69.18  ? 198  PRO E O   1 
ATOM   7253  C CB  . PRO E  1 198 ? -9.515  56.461  195.778 1.00 68.59  ? 198  PRO E CB  1 
ATOM   7254  C CG  . PRO E  1 198 ? -9.797  57.716  196.588 1.00 67.87  ? 198  PRO E CG  1 
ATOM   7255  C CD  . PRO E  1 198 ? -9.372  58.828  195.666 1.00 67.56  ? 198  PRO E CD  1 
ATOM   7256  N N   . SER E  1 199 ? -8.573  56.143  192.803 1.00 68.82  ? 199  SER E N   1 
ATOM   7257  C CA  . SER E  1 199 ? -8.343  55.326  191.599 1.00 69.36  ? 199  SER E CA  1 
ATOM   7258  C C   . SER E  1 199 ? -7.013  55.711  190.967 1.00 69.28  ? 199  SER E C   1 
ATOM   7259  O O   . SER E  1 199 ? -6.233  54.847  190.541 1.00 69.01  ? 199  SER E O   1 
ATOM   7260  C CB  . SER E  1 199 ? -9.454  55.571  190.618 1.00 69.48  ? 199  SER E CB  1 
ATOM   7261  O OG  . SER E  1 199 ? -9.886  56.894  190.843 1.00 73.28  ? 199  SER E OG  1 
ATOM   7262  N N   . VAL E  1 200 ? -6.771  57.021  190.918 1.00 68.65  ? 200  VAL E N   1 
ATOM   7263  C CA  . VAL E  1 200 ? -5.533  57.559  190.374 1.00 68.30  ? 200  VAL E CA  1 
ATOM   7264  C C   . VAL E  1 200 ? -4.408  56.862  191.124 1.00 68.36  ? 200  VAL E C   1 
ATOM   7265  O O   . VAL E  1 200 ? -3.459  56.339  190.532 1.00 67.83  ? 200  VAL E O   1 
ATOM   7266  C CB  . VAL E  1 200 ? -5.439  59.106  190.611 1.00 67.95  ? 200  VAL E CB  1 
ATOM   7267  C CG1 . VAL E  1 200 ? -3.993  59.568  190.540 1.00 67.37  ? 200  VAL E CG1 1 
ATOM   7268  C CG2 . VAL E  1 200 ? -6.272  59.846  189.585 1.00 67.44  ? 200  VAL E CG2 1 
ATOM   7269  N N   . GLU E  1 201 ? -4.565  56.842  192.444 1.00 68.35  ? 201  GLU E N   1 
ATOM   7270  C CA  . GLU E  1 201 ? -3.597  56.259  193.343 1.00 68.10  ? 201  GLU E CA  1 
ATOM   7271  C C   . GLU E  1 201 ? -3.532  54.759  193.264 1.00 68.04  ? 201  GLU E C   1 
ATOM   7272  O O   . GLU E  1 201 ? -2.492  54.174  193.496 1.00 67.78  ? 201  GLU E O   1 
ATOM   7273  C CB  . GLU E  1 201 ? -3.896  56.695  194.767 1.00 67.94  ? 201  GLU E CB  1 
ATOM   7274  C CG  . GLU E  1 201 ? -2.986  56.069  195.794 1.00 67.15  ? 201  GLU E CG  1 
ATOM   7275  C CD  . GLU E  1 201 ? -1.529  56.477  195.663 1.00 67.16  ? 201  GLU E CD  1 
ATOM   7276  O OE1 . GLU E  1 201 ? -0.702  55.553  195.815 1.00 67.68  ? 201  GLU E OE1 1 
ATOM   7277  O OE2 . GLU E  1 201 ? -1.212  57.685  195.439 1.00 65.86  ? 201  GLU E OE2 1 
ATOM   7278  N N   . GLU E  1 202 ? -4.634  54.117  192.937 1.00 69.12  ? 202  GLU E N   1 
ATOM   7279  C CA  . GLU E  1 202 ? -4.577  52.668  192.841 1.00 70.84  ? 202  GLU E CA  1 
ATOM   7280  C C   . GLU E  1 202 ? -3.794  52.298  191.592 1.00 71.59  ? 202  GLU E C   1 
ATOM   7281  O O   . GLU E  1 202 ? -2.922  51.424  191.630 1.00 71.88  ? 202  GLU E O   1 
ATOM   7282  C CB  . GLU E  1 202 ? -5.980  52.067  192.749 1.00 71.14  ? 202  GLU E CB  1 
ATOM   7283  C CG  . GLU E  1 202 ? -5.994  50.545  192.630 1.00 71.58  ? 202  GLU E CG  1 
ATOM   7284  C CD  . GLU E  1 202 ? -7.384  49.966  192.322 1.00 72.43  ? 202  GLU E CD  1 
ATOM   7285  O OE1 . GLU E  1 202 ? -7.431  48.802  191.857 1.00 72.24  ? 202  GLU E OE1 1 
ATOM   7286  O OE2 . GLU E  1 202 ? -8.417  50.657  192.547 1.00 72.40  ? 202  GLU E OE2 1 
ATOM   7287  N N   . ALA E  1 203 ? -4.116  52.968  190.485 1.00 71.99  ? 203  ALA E N   1 
ATOM   7288  C CA  . ALA E  1 203 ? -3.463  52.705  189.217 1.00 72.29  ? 203  ALA E CA  1 
ATOM   7289  C C   . ALA E  1 203 ? -1.991  53.030  189.354 1.00 73.10  ? 203  ALA E C   1 
ATOM   7290  O O   . ALA E  1 203 ? -1.135  52.323  188.820 1.00 73.47  ? 203  ALA E O   1 
ATOM   7291  C CB  . ALA E  1 203 ? -4.098  53.538  188.125 1.00 71.58  ? 203  ALA E CB  1 
ATOM   7292  N N   . ARG E  1 204 ? -1.692  54.093  190.090 1.00 74.30  ? 204  ARG E N   1 
ATOM   7293  C CA  . ARG E  1 204 ? -0.303  54.494  190.298 1.00 76.11  ? 204  ARG E CA  1 
ATOM   7294  C C   . ARG E  1 204 ? 0.502   53.423  191.058 1.00 78.86  ? 204  ARG E C   1 
ATOM   7295  O O   . ARG E  1 204 ? 1.717   53.317  190.876 1.00 79.83  ? 204  ARG E O   1 
ATOM   7296  C CB  . ARG E  1 204 ? -0.225  55.832  191.062 1.00 74.28  ? 204  ARG E CB  1 
ATOM   7297  C CG  . ARG E  1 204 ? 0.892   56.749  190.573 1.00 72.01  ? 204  ARG E CG  1 
ATOM   7298  C CD  . ARG E  1 204 ? 1.398   57.802  191.562 1.00 68.91  ? 204  ARG E CD  1 
ATOM   7299  N NE  . ARG E  1 204 ? 0.399   58.703  192.129 1.00 66.87  ? 204  ARG E NE  1 
ATOM   7300  C CZ  . ARG E  1 204 ? -0.530  59.370  191.455 1.00 67.42  ? 204  ARG E CZ  1 
ATOM   7301  N NH1 . ARG E  1 204 ? -1.362  60.159  192.117 1.00 68.40  ? 204  ARG E NH1 1 
ATOM   7302  N NH2 . ARG E  1 204 ? -0.658  59.248  190.141 1.00 67.52  ? 204  ARG E NH2 1 
ATOM   7303  N N   . TYR E  1 205 ? -0.163  52.636  191.910 1.00 81.39  ? 205  TYR E N   1 
ATOM   7304  C CA  . TYR E  1 205 ? 0.524   51.598  192.680 1.00 83.29  ? 205  TYR E CA  1 
ATOM   7305  C C   . TYR E  1 205 ? 0.698   50.363  191.810 1.00 84.58  ? 205  TYR E C   1 
ATOM   7306  O O   . TYR E  1 205 ? 1.684   49.649  191.943 1.00 84.36  ? 205  TYR E O   1 
ATOM   7307  C CB  . TYR E  1 205 ? -0.261  51.251  193.971 1.00 84.24  ? 205  TYR E CB  1 
ATOM   7308  C CG  . TYR E  1 205 ? 0.449   50.281  194.938 1.00 85.46  ? 205  TYR E CG  1 
ATOM   7309  C CD1 . TYR E  1 205 ? 1.727   50.567  195.455 1.00 85.98  ? 205  TYR E CD1 1 
ATOM   7310  C CD2 . TYR E  1 205 ? -0.144  49.058  195.304 1.00 85.54  ? 205  TYR E CD2 1 
ATOM   7311  C CE1 . TYR E  1 205 ? 2.407   49.645  196.312 1.00 86.18  ? 205  TYR E CE1 1 
ATOM   7312  C CE2 . TYR E  1 205 ? 0.527   48.128  196.159 1.00 85.86  ? 205  TYR E CE2 1 
ATOM   7313  C CZ  . TYR E  1 205 ? 1.803   48.423  196.657 1.00 86.25  ? 205  TYR E CZ  1 
ATOM   7314  O OH  . TYR E  1 205 ? 2.477   47.498  197.459 1.00 85.44  ? 205  TYR E OH  1 
ATOM   7315  N N   . ASN E  1 206 ? -0.245  50.123  190.904 1.00 86.64  ? 206  ASN E N   1 
ATOM   7316  C CA  . ASN E  1 206 ? -0.167  48.956  190.019 1.00 88.75  ? 206  ASN E CA  1 
ATOM   7317  C C   . ASN E  1 206 ? 0.770   49.133  188.831 1.00 89.81  ? 206  ASN E C   1 
ATOM   7318  O O   . ASN E  1 206 ? 1.201   48.148  188.240 1.00 89.53  ? 206  ASN E O   1 
ATOM   7319  C CB  . ASN E  1 206 ? -1.544  48.605  189.475 1.00 89.16  ? 206  ASN E CB  1 
ATOM   7320  C CG  . ASN E  1 206 ? -2.557  48.395  190.562 1.00 89.55  ? 206  ASN E CG  1 
ATOM   7321  O OD1 . ASN E  1 206 ? -2.374  47.544  191.436 1.00 89.76  ? 206  ASN E OD1 1 
ATOM   7322  N ND2 . ASN E  1 206 ? -3.641  49.170  190.520 1.00 89.29  ? 206  ASN E ND2 1 
ATOM   7323  N N   . SER E  1 207 ? 1.077   50.380  188.479 1.00 91.53  ? 207  SER E N   1 
ATOM   7324  C CA  . SER E  1 207 ? 1.946   50.642  187.342 1.00 93.45  ? 207  SER E CA  1 
ATOM   7325  C C   . SER E  1 207 ? 3.386   50.263  187.622 1.00 94.97  ? 207  SER E C   1 
ATOM   7326  O O   . SER E  1 207 ? 4.032   49.669  186.769 1.00 95.35  ? 207  SER E O   1 
ATOM   7327  C CB  . SER E  1 207 ? 1.883   52.111  186.936 1.00 93.15  ? 207  SER E CB  1 
ATOM   7328  O OG  . SER E  1 207 ? 2.681   52.894  187.792 1.00 92.88  ? 207  SER E OG  1 
ATOM   7329  N N   . CYS E  1 208 ? 3.892   50.599  188.806 1.00 96.90  ? 208  CYS E N   1 
ATOM   7330  C CA  . CYS E  1 208 ? 5.274   50.272  189.170 1.00 99.41  ? 208  CYS E CA  1 
ATOM   7331  C C   . CYS E  1 208 ? 5.524   48.762  189.091 1.00 101.08 ? 208  CYS E C   1 
ATOM   7332  O O   . CYS E  1 208 ? 6.562   48.267  189.550 1.00 101.72 ? 208  CYS E O   1 
ATOM   7333  C CB  . CYS E  1 208 ? 5.586   50.735  190.596 1.00 99.74  ? 208  CYS E CB  1 
ATOM   7334  S SG  . CYS E  1 208 ? 5.075   52.428  191.021 1.00 101.76 ? 208  CYS E SG  1 
ATOM   7335  N N   . ARG E  1 209 ? 4.563   48.033  188.526 1.00 102.71 ? 209  ARG E N   1 
ATOM   7336  C CA  . ARG E  1 209 ? 4.661   46.579  188.374 1.00 104.14 ? 209  ARG E CA  1 
ATOM   7337  C C   . ARG E  1 209 ? 4.453   46.170  186.912 1.00 104.04 ? 209  ARG E C   1 
ATOM   7338  O O   . ARG E  1 209 ? 3.349   46.276  186.372 1.00 103.90 ? 209  ARG E O   1 
ATOM   7339  C CB  . ARG E  1 209 ? 3.615   45.881  189.254 1.00 105.67 ? 209  ARG E CB  1 
ATOM   7340  C CG  . ARG E  1 209 ? 3.847   46.023  190.750 1.00 107.53 ? 209  ARG E CG  1 
ATOM   7341  C CD  . ARG E  1 209 ? 2.528   45.903  191.488 1.00 109.28 ? 209  ARG E CD  1 
ATOM   7342  N NE  . ARG E  1 209 ? 2.690   45.873  192.939 1.00 110.72 ? 209  ARG E NE  1 
ATOM   7343  C CZ  . ARG E  1 209 ? 1.674   45.913  193.800 1.00 112.11 ? 209  ARG E CZ  1 
ATOM   7344  N NH1 . ARG E  1 209 ? 0.422   45.993  193.342 1.00 112.83 ? 209  ARG E NH1 1 
ATOM   7345  N NH2 . ARG E  1 209 ? 1.896   45.835  195.115 1.00 112.21 ? 209  ARG E NH2 1 
ATOM   7346  N N   . LEU F  1 24  ? 14.513  54.053  183.129 1.00 74.36  ? 24   LEU F N   1 
ATOM   7347  C CA  . LEU F  1 24  ? 13.053  54.210  183.411 1.00 74.97  ? 24   LEU F CA  1 
ATOM   7348  C C   . LEU F  1 24  ? 12.782  55.237  184.525 1.00 74.14  ? 24   LEU F C   1 
ATOM   7349  O O   . LEU F  1 24  ? 11.802  55.150  185.295 1.00 73.25  ? 24   LEU F O   1 
ATOM   7350  C CB  . LEU F  1 24  ? 12.444  52.862  183.778 1.00 76.22  ? 24   LEU F CB  1 
ATOM   7351  C CG  . LEU F  1 24  ? 11.081  52.673  183.084 1.00 78.45  ? 24   LEU F CG  1 
ATOM   7352  C CD1 . LEU F  1 24  ? 10.058  53.730  183.568 1.00 79.27  ? 24   LEU F CD1 1 
ATOM   7353  C CD2 . LEU F  1 24  ? 11.272  52.777  181.561 1.00 77.81  ? 24   LEU F CD2 1 
ATOM   7354  N N   . CYS F  1 25  ? 13.674  56.222  184.563 1.00 72.90  ? 25   CYS F N   1 
ATOM   7355  C CA  . CYS F  1 25  ? 13.651  57.316  185.517 1.00 71.15  ? 25   CYS F CA  1 
ATOM   7356  C C   . CYS F  1 25  ? 12.671  58.425  185.126 1.00 69.45  ? 25   CYS F C   1 
ATOM   7357  O O   . CYS F  1 25  ? 11.928  58.296  184.157 1.00 68.83  ? 25   CYS F O   1 
ATOM   7358  C CB  . CYS F  1 25  ? 15.050  57.893  185.595 1.00 72.66  ? 25   CYS F CB  1 
ATOM   7359  S SG  . CYS F  1 25  ? 15.625  58.473  183.982 1.00 73.29  ? 25   CYS F SG  1 
ATOM   7360  N N   . PHE F  1 26  ? 12.697  59.521  185.885 1.00 67.71  ? 26   PHE F N   1 
ATOM   7361  C CA  . PHE F  1 26  ? 11.812  60.654  185.638 1.00 65.53  ? 26   PHE F CA  1 
ATOM   7362  C C   . PHE F  1 26  ? 12.030  61.229  184.255 1.00 64.84  ? 26   PHE F C   1 
ATOM   7363  O O   . PHE F  1 26  ? 13.153  61.418  183.839 1.00 64.16  ? 26   PHE F O   1 
ATOM   7364  C CB  . PHE F  1 26  ? 12.041  61.748  186.664 1.00 62.99  ? 26   PHE F CB  1 
ATOM   7365  C CG  . PHE F  1 26  ? 10.992  62.794  186.643 1.00 60.98  ? 26   PHE F CG  1 
ATOM   7366  C CD1 . PHE F  1 26  ? 9.828   62.632  187.373 1.00 58.94  ? 26   PHE F CD1 1 
ATOM   7367  C CD2 . PHE F  1 26  ? 11.141  63.930  185.854 1.00 60.75  ? 26   PHE F CD2 1 
ATOM   7368  C CE1 . PHE F  1 26  ? 8.815   63.584  187.325 1.00 58.74  ? 26   PHE F CE1 1 
ATOM   7369  C CE2 . PHE F  1 26  ? 10.131  64.896  185.797 1.00 60.56  ? 26   PHE F CE2 1 
ATOM   7370  C CZ  . PHE F  1 26  ? 8.961   64.718  186.538 1.00 59.69  ? 26   PHE F CZ  1 
ATOM   7371  N N   . GLY F  1 27  ? 10.939  61.510  183.555 1.00 65.43  ? 27   GLY F N   1 
ATOM   7372  C CA  . GLY F  1 27  ? 11.028  62.055  182.218 1.00 65.82  ? 27   GLY F CA  1 
ATOM   7373  C C   . GLY F  1 27  ? 10.972  60.981  181.154 1.00 66.78  ? 27   GLY F C   1 
ATOM   7374  O O   . GLY F  1 27  ? 10.796  61.277  179.983 1.00 67.15  ? 27   GLY F O   1 
ATOM   7375  N N   . GLN F  1 28  ? 11.107  59.727  181.560 1.00 68.37  ? 28   GLN F N   1 
ATOM   7376  C CA  . GLN F  1 28  ? 11.082  58.615  180.623 1.00 69.41  ? 28   GLN F CA  1 
ATOM   7377  C C   . GLN F  1 28  ? 10.011  57.581  180.863 1.00 70.35  ? 28   GLN F C   1 
ATOM   7378  O O   . GLN F  1 28  ? 10.055  56.507  180.265 1.00 70.89  ? 28   GLN F O   1 
ATOM   7379  C CB  . GLN F  1 28  ? 12.403  57.908  180.644 1.00 70.20  ? 28   GLN F CB  1 
ATOM   7380  C CG  . GLN F  1 28  ? 13.501  58.725  180.084 1.00 72.31  ? 28   GLN F CG  1 
ATOM   7381  C CD  . GLN F  1 28  ? 14.841  58.069  180.338 1.00 73.98  ? 28   GLN F CD  1 
ATOM   7382  O OE1 . GLN F  1 28  ? 15.866  58.510  179.816 1.00 75.57  ? 28   GLN F OE1 1 
ATOM   7383  N NE2 . GLN F  1 28  ? 14.844  57.006  181.155 1.00 74.00  ? 28   GLN F NE2 1 
ATOM   7384  N N   . CYS F  1 29  ? 9.067   57.870  181.752 1.00 71.06  ? 29   CYS F N   1 
ATOM   7385  C CA  . CYS F  1 29  ? 7.996   56.927  182.003 1.00 71.65  ? 29   CYS F CA  1 
ATOM   7386  C C   . CYS F  1 29  ? 6.958   57.157  180.965 1.00 70.78  ? 29   CYS F C   1 
ATOM   7387  O O   . CYS F  1 29  ? 6.932   58.190  180.311 1.00 71.65  ? 29   CYS F O   1 
ATOM   7388  C CB  . CYS F  1 29  ? 7.352   57.166  183.352 1.00 73.24  ? 29   CYS F CB  1 
ATOM   7389  S SG  . CYS F  1 29  ? 8.349   56.570  184.674 1.00 78.95  ? 29   CYS F SG  1 
ATOM   7390  N N   . GLN F  1 30  ? 6.094   56.185  180.804 1.00 69.70  ? 30   GLN F N   1 
ATOM   7391  C CA  . GLN F  1 30  ? 5.029   56.348  179.869 1.00 68.93  ? 30   GLN F CA  1 
ATOM   7392  C C   . GLN F  1 30  ? 3.877   55.953  180.754 1.00 67.07  ? 30   GLN F C   1 
ATOM   7393  O O   . GLN F  1 30  ? 3.974   54.991  181.514 1.00 67.61  ? 30   GLN F O   1 
ATOM   7394  C CB  . GLN F  1 30  ? 5.198   55.394  178.697 1.00 70.97  ? 30   GLN F CB  1 
ATOM   7395  C CG  . GLN F  1 30  ? 4.252   55.704  177.547 1.00 74.51  ? 30   GLN F CG  1 
ATOM   7396  C CD  . GLN F  1 30  ? 4.184   54.586  176.486 1.00 76.16  ? 30   GLN F CD  1 
ATOM   7397  O OE1 . GLN F  1 30  ? 3.274   54.583  175.643 1.00 76.72  ? 30   GLN F OE1 1 
ATOM   7398  N NE2 . GLN F  1 30  ? 5.144   53.641  176.523 1.00 76.34  ? 30   GLN F NE2 1 
ATOM   7399  N N   . TYR F  1 31  ? 2.802   56.712  180.716 1.00 64.42  ? 31   TYR F N   1 
ATOM   7400  C CA  . TYR F  1 31  ? 1.690   56.358  181.552 1.00 62.36  ? 31   TYR F CA  1 
ATOM   7401  C C   . TYR F  1 31  ? 1.065   55.063  181.076 1.00 62.10  ? 31   TYR F C   1 
ATOM   7402  O O   . TYR F  1 31  ? 1.011   54.802  179.872 1.00 62.20  ? 31   TYR F O   1 
ATOM   7403  C CB  . TYR F  1 31  ? 0.645   57.467  181.549 1.00 61.29  ? 31   TYR F CB  1 
ATOM   7404  C CG  . TYR F  1 31  ? 0.979   58.594  182.486 1.00 60.96  ? 31   TYR F CG  1 
ATOM   7405  C CD1 . TYR F  1 31  ? 1.517   59.778  182.008 1.00 60.19  ? 31   TYR F CD1 1 
ATOM   7406  C CD2 . TYR F  1 31  ? 0.776   58.467  183.860 1.00 60.11  ? 31   TYR F CD2 1 
ATOM   7407  C CE1 . TYR F  1 31  ? 1.845   60.804  182.865 1.00 60.20  ? 31   TYR F CE1 1 
ATOM   7408  C CE2 . TYR F  1 31  ? 1.104   59.487  184.722 1.00 60.48  ? 31   TYR F CE2 1 
ATOM   7409  C CZ  . TYR F  1 31  ? 1.642   60.658  184.218 1.00 60.60  ? 31   TYR F CZ  1 
ATOM   7410  O OH  . TYR F  1 31  ? 2.000   61.685  185.058 1.00 59.55  ? 31   TYR F OH  1 
ATOM   7411  N N   . THR F  1 32  ? 0.620   54.243  182.029 1.00 61.32  ? 32   THR F N   1 
ATOM   7412  C CA  . THR F  1 32  ? -0.070  52.996  181.714 1.00 59.68  ? 32   THR F CA  1 
ATOM   7413  C C   . THR F  1 32  ? -1.484  53.448  181.381 1.00 58.62  ? 32   THR F C   1 
ATOM   7414  O O   . THR F  1 32  ? -1.921  54.512  181.839 1.00 57.48  ? 32   THR F O   1 
ATOM   7415  C CB  . THR F  1 32  ? -0.138  52.061  182.931 1.00 60.13  ? 32   THR F CB  1 
ATOM   7416  O OG1 . THR F  1 32  ? -0.884  52.703  183.982 1.00 61.92  ? 32   THR F OG1 1 
ATOM   7417  C CG2 . THR F  1 32  ? 1.259   51.716  183.423 1.00 57.97  ? 32   THR F CG2 1 
ATOM   7418  N N   . ALA F  1 33  ? -2.199  52.656  180.588 1.00 58.63  ? 33   ALA F N   1 
ATOM   7419  C CA  . ALA F  1 33  ? -3.562  53.031  180.214 1.00 58.68  ? 33   ALA F CA  1 
ATOM   7420  C C   . ALA F  1 33  ? -4.408  53.319  181.440 1.00 58.44  ? 33   ALA F C   1 
ATOM   7421  O O   . ALA F  1 33  ? -5.187  54.278  181.471 1.00 58.20  ? 33   ALA F O   1 
ATOM   7422  C CB  . ALA F  1 33  ? -4.207  51.927  179.387 1.00 57.92  ? 33   ALA F CB  1 
ATOM   7423  N N   . GLU F  1 34  ? -4.230  52.498  182.463 1.00 58.73  ? 34   GLU F N   1 
ATOM   7424  C CA  . GLU F  1 34  ? -5.021  52.666  183.653 1.00 60.17  ? 34   GLU F CA  1 
ATOM   7425  C C   . GLU F  1 34  ? -4.720  53.980  184.365 1.00 58.64  ? 34   GLU F C   1 
ATOM   7426  O O   . GLU F  1 34  ? -5.641  54.733  184.688 1.00 58.95  ? 34   GLU F O   1 
ATOM   7427  C CB  . GLU F  1 34  ? -4.833  51.468  184.588 1.00 63.65  ? 34   GLU F CB  1 
ATOM   7428  C CG  . GLU F  1 34  ? -6.021  51.276  185.536 1.00 69.03  ? 34   GLU F CG  1 
ATOM   7429  C CD  . GLU F  1 34  ? -5.730  50.320  186.719 1.00 73.48  ? 34   GLU F CD  1 
ATOM   7430  O OE1 . GLU F  1 34  ? -6.489  50.373  187.744 1.00 74.88  ? 34   GLU F OE1 1 
ATOM   7431  O OE2 . GLU F  1 34  ? -4.749  49.523  186.617 1.00 75.14  ? 34   GLU F OE2 1 
ATOM   7432  N N   . GLU F  1 35  ? -3.451  54.284  184.604 1.00 56.54  ? 35   GLU F N   1 
ATOM   7433  C CA  . GLU F  1 35  ? -3.161  55.539  185.271 1.00 55.57  ? 35   GLU F CA  1 
ATOM   7434  C C   . GLU F  1 35  ? -3.571  56.728  184.400 1.00 56.09  ? 35   GLU F C   1 
ATOM   7435  O O   . GLU F  1 35  ? -4.135  57.721  184.890 1.00 56.34  ? 35   GLU F O   1 
ATOM   7436  C CB  . GLU F  1 35  ? -1.683  55.635  185.631 1.00 53.98  ? 35   GLU F CB  1 
ATOM   7437  C CG  . GLU F  1 35  ? -1.388  56.842  186.520 1.00 52.00  ? 35   GLU F CG  1 
ATOM   7438  C CD  . GLU F  1 35  ? 0.043   56.871  187.068 1.00 52.44  ? 35   GLU F CD  1 
ATOM   7439  O OE1 . GLU F  1 35  ? 0.350   57.830  187.812 1.00 52.14  ? 35   GLU F OE1 1 
ATOM   7440  O OE2 . GLU F  1 35  ? 0.859   55.956  186.769 1.00 50.77  ? 35   GLU F OE2 1 
ATOM   7441  N N   . TYR F  1 36  ? -3.299  56.625  183.103 1.00 55.84  ? 36   TYR F N   1 
ATOM   7442  C CA  . TYR F  1 36  ? -3.642  57.709  182.199 1.00 56.43  ? 36   TYR F CA  1 
ATOM   7443  C C   . TYR F  1 36  ? -5.109  58.041  182.328 1.00 57.25  ? 36   TYR F C   1 
ATOM   7444  O O   . TYR F  1 36  ? -5.487  59.211  182.562 1.00 56.65  ? 36   TYR F O   1 
ATOM   7445  C CB  . TYR F  1 36  ? -3.345  57.338  180.736 1.00 55.14  ? 36   TYR F CB  1 
ATOM   7446  C CG  . TYR F  1 36  ? -4.148  58.169  179.765 1.00 53.24  ? 36   TYR F CG  1 
ATOM   7447  C CD1 . TYR F  1 36  ? -3.879  59.529  179.590 1.00 52.89  ? 36   TYR F CD1 1 
ATOM   7448  C CD2 . TYR F  1 36  ? -5.300  57.644  179.168 1.00 52.34  ? 36   TYR F CD2 1 
ATOM   7449  C CE1 . TYR F  1 36  ? -4.759  60.355  178.856 1.00 52.12  ? 36   TYR F CE1 1 
ATOM   7450  C CE2 . TYR F  1 36  ? -6.181  58.453  178.438 1.00 51.64  ? 36   TYR F CE2 1 
ATOM   7451  C CZ  . TYR F  1 36  ? -5.908  59.812  178.291 1.00 51.68  ? 36   TYR F CZ  1 
ATOM   7452  O OH  . TYR F  1 36  ? -6.809  60.634  177.636 1.00 51.79  ? 36   TYR F OH  1 
ATOM   7453  N N   . GLN F  1 37  ? -5.926  56.997  182.178 1.00 58.82  ? 37   GLN F N   1 
ATOM   7454  C CA  . GLN F  1 37  ? -7.372  57.154  182.217 1.00 59.98  ? 37   GLN F CA  1 
ATOM   7455  C C   . GLN F  1 37  ? -7.885  57.744  183.527 1.00 59.78  ? 37   GLN F C   1 
ATOM   7456  O O   . GLN F  1 37  ? -8.744  58.643  183.526 1.00 59.13  ? 37   GLN F O   1 
ATOM   7457  C CB  . GLN F  1 37  ? -8.044  55.830  181.927 1.00 60.76  ? 37   GLN F CB  1 
ATOM   7458  C CG  . GLN F  1 37  ? -9.527  56.004  181.697 1.00 66.77  ? 37   GLN F CG  1 
ATOM   7459  C CD  . GLN F  1 37  ? -10.341 54.719  181.959 1.00 69.87  ? 37   GLN F CD  1 
ATOM   7460  O OE1 . GLN F  1 37  ? -10.453 53.834  181.083 1.00 70.73  ? 37   GLN F OE1 1 
ATOM   7461  N NE2 . GLN F  1 37  ? -10.908 54.613  183.179 1.00 70.09  ? 37   GLN F NE2 1 
ATOM   7462  N N   . ALA F  1 38  ? -7.336  57.273  184.641 1.00 59.57  ? 38   ALA F N   1 
ATOM   7463  C CA  . ALA F  1 38  ? -7.768  57.770  185.933 1.00 60.14  ? 38   ALA F CA  1 
ATOM   7464  C C   . ALA F  1 38  ? -7.503  59.256  186.063 1.00 61.03  ? 38   ALA F C   1 
ATOM   7465  O O   . ALA F  1 38  ? -8.371  60.029  186.531 1.00 61.47  ? 38   ALA F O   1 
ATOM   7466  C CB  . ALA F  1 38  ? -7.061  57.023  187.022 1.00 60.34  ? 38   ALA F CB  1 
ATOM   7467  N N   . ILE F  1 39  ? -6.305  59.658  185.638 1.00 61.02  ? 39   ILE F N   1 
ATOM   7468  C CA  . ILE F  1 39  ? -5.902  61.055  185.724 1.00 60.06  ? 39   ILE F CA  1 
ATOM   7469  C C   . ILE F  1 39  ? -6.666  61.946  184.777 1.00 59.61  ? 39   ILE F C   1 
ATOM   7470  O O   . ILE F  1 39  ? -7.072  63.044  185.155 1.00 58.43  ? 39   ILE F O   1 
ATOM   7471  C CB  . ILE F  1 39  ? -4.373  61.206  185.508 1.00 60.31  ? 39   ILE F CB  1 
ATOM   7472  C CG1 . ILE F  1 39  ? -3.633  60.556  186.689 1.00 60.06  ? 39   ILE F CG1 1 
ATOM   7473  C CG2 . ILE F  1 39  ? -4.001  62.683  185.389 1.00 60.12  ? 39   ILE F CG2 1 
ATOM   7474  C CD1 . ILE F  1 39  ? -2.140  60.487  186.584 1.00 59.88  ? 39   ILE F CD1 1 
ATOM   7475  N N   . GLN F  1 40  ? -6.876  61.481  183.551 1.00 60.24  ? 40   GLN F N   1 
ATOM   7476  C CA  . GLN F  1 40  ? -7.626  62.292  182.597 1.00 61.73  ? 40   GLN F CA  1 
ATOM   7477  C C   . GLN F  1 40  ? -8.944  62.707  183.239 1.00 61.88  ? 40   GLN F C   1 
ATOM   7478  O O   . GLN F  1 40  ? -9.313  63.885  183.236 1.00 62.23  ? 40   GLN F O   1 
ATOM   7479  C CB  . GLN F  1 40  ? -7.934  61.515  181.311 1.00 62.42  ? 40   GLN F CB  1 
ATOM   7480  C CG  . GLN F  1 40  ? -7.324  62.082  180.013 1.00 64.97  ? 40   GLN F CG  1 
ATOM   7481  C CD  . GLN F  1 40  ? -7.723  63.519  179.671 1.00 65.84  ? 40   GLN F CD  1 
ATOM   7482  O OE1 . GLN F  1 40  ? -7.956  63.843  178.510 1.00 66.58  ? 40   GLN F OE1 1 
ATOM   7483  N NE2 . GLN F  1 40  ? -7.777  64.384  180.672 1.00 67.87  ? 40   GLN F NE2 1 
ATOM   7484  N N   . LYS F  1 41  ? -9.646  61.721  183.799 1.00 62.46  ? 41   LYS F N   1 
ATOM   7485  C CA  . LYS F  1 41  ? -10.934 61.957  184.446 1.00 61.56  ? 41   LYS F CA  1 
ATOM   7486  C C   . LYS F  1 41  ? -10.803 62.852  185.674 1.00 60.80  ? 41   LYS F C   1 
ATOM   7487  O O   . LYS F  1 41  ? -11.487 63.877  185.784 1.00 59.96  ? 41   LYS F O   1 
ATOM   7488  C CB  . LYS F  1 41  ? -11.562 60.622  184.830 1.00 63.03  ? 41   LYS F CB  1 
ATOM   7489  C CG  . LYS F  1 41  ? -12.118 59.851  183.634 1.00 64.83  ? 41   LYS F CG  1 
ATOM   7490  C CD  . LYS F  1 41  ? -12.507 58.432  184.012 1.00 66.06  ? 41   LYS F CD  1 
ATOM   7491  C CE  . LYS F  1 41  ? -12.960 57.633  182.800 1.00 67.28  ? 41   LYS F CE  1 
ATOM   7492  N NZ  . LYS F  1 41  ? -13.223 56.200  183.172 1.00 68.27  ? 41   LYS F NZ  1 
ATOM   7493  N N   . ALA F  1 42  ? -9.907  62.480  186.585 1.00 59.48  ? 42   ALA F N   1 
ATOM   7494  C CA  . ALA F  1 42  ? -9.711  63.277  187.780 1.00 58.99  ? 42   ALA F CA  1 
ATOM   7495  C C   . ALA F  1 42  ? -9.442  64.757  187.464 1.00 59.41  ? 42   ALA F C   1 
ATOM   7496  O O   . ALA F  1 42  ? -9.955  65.651  188.123 1.00 60.01  ? 42   ALA F O   1 
ATOM   7497  C CB  . ALA F  1 42  ? -8.574  62.689  188.602 1.00 57.13  ? 42   ALA F CB  1 
ATOM   7498  N N   . LEU F  1 43  ? -8.657  65.023  186.435 1.00 60.09  ? 43   LEU F N   1 
ATOM   7499  C CA  . LEU F  1 43  ? -8.322  66.398  186.109 1.00 60.34  ? 43   LEU F CA  1 
ATOM   7500  C C   . LEU F  1 43  ? -9.501  67.269  185.713 1.00 61.04  ? 43   LEU F C   1 
ATOM   7501  O O   . LEU F  1 43  ? -9.450  68.508  185.853 1.00 60.41  ? 43   LEU F O   1 
ATOM   7502  C CB  . LEU F  1 43  ? -7.240  66.416  185.019 1.00 60.02  ? 43   LEU F CB  1 
ATOM   7503  C CG  . LEU F  1 43  ? -5.843  66.002  185.517 1.00 58.50  ? 43   LEU F CG  1 
ATOM   7504  C CD1 . LEU F  1 43  ? -4.884  65.845  184.364 1.00 57.81  ? 43   LEU F CD1 1 
ATOM   7505  C CD2 . LEU F  1 43  ? -5.335  67.039  186.510 1.00 56.20  ? 43   LEU F CD2 1 
ATOM   7506  N N   . ARG F  1 44  ? -10.568 66.627  185.244 1.00 62.05  ? 44   ARG F N   1 
ATOM   7507  C CA  . ARG F  1 44  ? -11.749 67.369  184.818 1.00 63.70  ? 44   ARG F CA  1 
ATOM   7508  C C   . ARG F  1 44  ? -12.519 68.050  185.950 1.00 65.33  ? 44   ARG F C   1 
ATOM   7509  O O   . ARG F  1 44  ? -13.141 69.091  185.733 1.00 65.93  ? 44   ARG F O   1 
ATOM   7510  C CB  . ARG F  1 44  ? -12.692 66.459  184.043 1.00 62.93  ? 44   ARG F CB  1 
ATOM   7511  C CG  . ARG F  1 44  ? -12.158 66.024  182.701 1.00 64.56  ? 44   ARG F CG  1 
ATOM   7512  C CD  . ARG F  1 44  ? -13.253 65.429  181.828 1.00 63.62  ? 44   ARG F CD  1 
ATOM   7513  N NE  . ARG F  1 44  ? -13.221 63.965  181.819 1.00 64.74  ? 44   ARG F NE  1 
ATOM   7514  C CZ  . ARG F  1 44  ? -12.708 63.228  180.833 1.00 66.46  ? 44   ARG F CZ  1 
ATOM   7515  N NH1 . ARG F  1 44  ? -12.175 63.822  179.765 1.00 68.20  ? 44   ARG F NH1 1 
ATOM   7516  N NH2 . ARG F  1 44  ? -12.741 61.897  180.894 1.00 65.57  ? 44   ARG F NH2 1 
ATOM   7517  N N   . GLN F  1 45  ? -12.476 67.474  187.157 1.00 66.47  ? 45   GLN F N   1 
ATOM   7518  C CA  . GLN F  1 45  ? -13.198 68.022  188.317 1.00 66.77  ? 45   GLN F CA  1 
ATOM   7519  C C   . GLN F  1 45  ? -12.899 69.475  188.613 1.00 67.17  ? 45   GLN F C   1 
ATOM   7520  O O   . GLN F  1 45  ? -11.765 69.899  188.509 1.00 67.43  ? 45   GLN F O   1 
ATOM   7521  C CB  . GLN F  1 45  ? -12.861 67.226  189.574 1.00 66.22  ? 45   GLN F CB  1 
ATOM   7522  C CG  . GLN F  1 45  ? -13.047 65.734  189.448 1.00 66.92  ? 45   GLN F CG  1 
ATOM   7523  C CD  . GLN F  1 45  ? -12.442 64.990  190.623 1.00 67.73  ? 45   GLN F CD  1 
ATOM   7524  O OE1 . GLN F  1 45  ? -12.542 63.769  190.728 1.00 66.99  ? 45   GLN F OE1 1 
ATOM   7525  N NE2 . GLN F  1 45  ? -11.799 65.729  191.514 1.00 69.22  ? 45   GLN F NE2 1 
ATOM   7526  N N   . ARG F  1 46  ? -13.916 70.242  188.977 1.00 68.71  ? 46   ARG F N   1 
ATOM   7527  C CA  . ARG F  1 46  ? -13.696 71.633  189.366 1.00 70.71  ? 46   ARG F CA  1 
ATOM   7528  C C   . ARG F  1 46  ? -13.446 71.500  190.858 1.00 71.01  ? 46   ARG F C   1 
ATOM   7529  O O   . ARG F  1 46  ? -13.815 70.495  191.457 1.00 70.35  ? 46   ARG F O   1 
ATOM   7530  C CB  . ARG F  1 46  ? -14.946 72.475  189.158 1.00 72.05  ? 46   ARG F CB  1 
ATOM   7531  C CG  . ARG F  1 46  ? -15.626 72.239  187.852 1.00 74.66  ? 46   ARG F CG  1 
ATOM   7532  C CD  . ARG F  1 46  ? -15.725 73.516  187.102 1.00 76.99  ? 46   ARG F CD  1 
ATOM   7533  N NE  . ARG F  1 46  ? -16.589 73.381  185.942 1.00 79.23  ? 46   ARG F NE  1 
ATOM   7534  C CZ  . ARG F  1 46  ? -16.477 74.141  184.860 1.00 81.72  ? 46   ARG F CZ  1 
ATOM   7535  N NH1 . ARG F  1 46  ? -15.531 75.088  184.787 1.00 82.86  ? 46   ARG F NH1 1 
ATOM   7536  N NH2 . ARG F  1 46  ? -17.317 73.957  183.853 1.00 83.38  ? 46   ARG F NH2 1 
ATOM   7537  N N   . LEU F  1 47  ? -12.825 72.478  191.488 1.00 72.32  ? 47   LEU F N   1 
ATOM   7538  C CA  . LEU F  1 47  ? -12.624 72.272  192.905 1.00 74.47  ? 47   LEU F CA  1 
ATOM   7539  C C   . LEU F  1 47  ? -13.637 72.973  193.786 1.00 75.01  ? 47   LEU F C   1 
ATOM   7540  O O   . LEU F  1 47  ? -14.170 74.033  193.426 1.00 75.30  ? 47   LEU F O   1 
ATOM   7541  C CB  . LEU F  1 47  ? -11.187 72.598  193.353 1.00 74.60  ? 47   LEU F CB  1 
ATOM   7542  C CG  . LEU F  1 47  ? -10.115 73.342  192.570 1.00 75.54  ? 47   LEU F CG  1 
ATOM   7543  C CD1 . LEU F  1 47  ? -8.766  72.942  193.117 1.00 76.01  ? 47   LEU F CD1 1 
ATOM   7544  C CD2 . LEU F  1 47  ? -10.154 72.969  191.131 1.00 76.80  ? 47   LEU F CD2 1 
ATOM   7545  N N   . GLY F  1 48  ? -13.911 72.337  194.928 1.00 75.08  ? 48   GLY F N   1 
ATOM   7546  C CA  . GLY F  1 48  ? -14.862 72.857  195.894 1.00 75.74  ? 48   GLY F CA  1 
ATOM   7547  C C   . GLY F  1 48  ? -14.420 74.130  196.600 1.00 76.00  ? 48   GLY F C   1 
ATOM   7548  O O   . GLY F  1 48  ? -13.266 74.563  196.469 1.00 76.80  ? 48   GLY F O   1 
ATOM   7549  N N   . PRO F  1 49  ? -15.320 74.746  197.379 1.00 75.52  ? 49   PRO F N   1 
ATOM   7550  C CA  . PRO F  1 49  ? -15.063 75.980  198.123 1.00 74.71  ? 49   PRO F CA  1 
ATOM   7551  C C   . PRO F  1 49  ? -13.892 75.851  199.088 1.00 73.71  ? 49   PRO F C   1 
ATOM   7552  O O   . PRO F  1 49  ? -13.268 76.855  199.467 1.00 72.61  ? 49   PRO F O   1 
ATOM   7553  C CB  . PRO F  1 49  ? -16.377 76.218  198.865 1.00 75.35  ? 49   PRO F CB  1 
ATOM   7554  C CG  . PRO F  1 49  ? -17.380 75.469  198.064 1.00 75.58  ? 49   PRO F CG  1 
ATOM   7555  C CD  . PRO F  1 49  ? -16.650 74.219  197.708 1.00 75.81  ? 49   PRO F CD  1 
ATOM   7556  N N   . GLU F  1 50  ? -13.594 74.620  199.490 1.00 72.82  ? 50   GLU F N   1 
ATOM   7557  C CA  . GLU F  1 50  ? -12.499 74.424  200.426 1.00 72.89  ? 50   GLU F CA  1 
ATOM   7558  C C   . GLU F  1 50  ? -11.121 74.752  199.864 1.00 72.45  ? 50   GLU F C   1 
ATOM   7559  O O   . GLU F  1 50  ? -10.139 74.801  200.606 1.00 72.62  ? 50   GLU F O   1 
ATOM   7560  C CB  . GLU F  1 50  ? -12.498 72.994  201.016 1.00 73.21  ? 50   GLU F CB  1 
ATOM   7561  C CG  . GLU F  1 50  ? -12.950 71.847  200.123 1.00 72.28  ? 50   GLU F CG  1 
ATOM   7562  C CD  . GLU F  1 50  ? -14.471 71.771  199.975 1.00 73.54  ? 50   GLU F CD  1 
ATOM   7563  O OE1 . GLU F  1 50  ? -14.995 72.458  199.072 1.00 74.04  ? 50   GLU F OE1 1 
ATOM   7564  O OE2 . GLU F  1 50  ? -15.144 71.042  200.756 1.00 72.36  ? 50   GLU F OE2 1 
ATOM   7565  N N   . TYR F  1 51  ? -11.053 75.001  198.558 1.00 71.35  ? 51   TYR F N   1 
ATOM   7566  C CA  . TYR F  1 51  ? -9.784  75.309  197.909 1.00 69.88  ? 51   TYR F CA  1 
ATOM   7567  C C   . TYR F  1 51  ? -9.613  76.788  197.625 1.00 71.18  ? 51   TYR F C   1 
ATOM   7568  O O   . TYR F  1 51  ? -8.503  77.344  197.707 1.00 71.49  ? 51   TYR F O   1 
ATOM   7569  C CB  . TYR F  1 51  ? -9.670  74.549  196.587 1.00 65.96  ? 51   TYR F CB  1 
ATOM   7570  C CG  . TYR F  1 51  ? -9.386  73.079  196.750 1.00 61.88  ? 51   TYR F CG  1 
ATOM   7571  C CD1 . TYR F  1 51  ? -10.388 72.138  196.631 1.00 59.37  ? 51   TYR F CD1 1 
ATOM   7572  C CD2 . TYR F  1 51  ? -8.106  72.638  197.059 1.00 60.47  ? 51   TYR F CD2 1 
ATOM   7573  C CE1 . TYR F  1 51  ? -10.120 70.794  196.812 1.00 58.37  ? 51   TYR F CE1 1 
ATOM   7574  C CE2 . TYR F  1 51  ? -7.833  71.302  197.253 1.00 58.57  ? 51   TYR F CE2 1 
ATOM   7575  C CZ  . TYR F  1 51  ? -8.842  70.386  197.126 1.00 58.13  ? 51   TYR F CZ  1 
ATOM   7576  O OH  . TYR F  1 51  ? -8.572  69.051  197.306 1.00 57.72  ? 51   TYR F OH  1 
ATOM   7577  N N   . ILE F  1 52  ? -10.725 77.426  197.298 1.00 71.84  ? 52   ILE F N   1 
ATOM   7578  C CA  . ILE F  1 52  ? -10.727 78.830  196.939 1.00 72.70  ? 52   ILE F CA  1 
ATOM   7579  C C   . ILE F  1 52  ? -10.702 79.828  198.074 1.00 74.35  ? 52   ILE F C   1 
ATOM   7580  O O   . ILE F  1 52  ? -11.460 79.715  199.029 1.00 75.15  ? 52   ILE F O   1 
ATOM   7581  C CB  . ILE F  1 52  ? -11.959 79.142  196.117 1.00 72.16  ? 52   ILE F CB  1 
ATOM   7582  C CG1 . ILE F  1 52  ? -12.247 77.984  195.153 1.00 72.18  ? 52   ILE F CG1 1 
ATOM   7583  C CG2 . ILE F  1 52  ? -11.783 80.460  195.424 1.00 71.43  ? 52   ILE F CG2 1 
ATOM   7584  C CD1 . ILE F  1 52  ? -11.095 77.608  194.242 1.00 71.47  ? 52   ILE F CD1 1 
ATOM   7585  N N   . SER F  1 53  ? -9.826  80.812  197.960 1.00 76.41  ? 53   SER F N   1 
ATOM   7586  C CA  . SER F  1 53  ? -9.736  81.868  198.955 1.00 79.21  ? 53   SER F CA  1 
ATOM   7587  C C   . SER F  1 53  ? -9.806  83.177  198.181 1.00 81.66  ? 53   SER F C   1 
ATOM   7588  O O   . SER F  1 53  ? -9.856  83.158  196.953 1.00 81.89  ? 53   SER F O   1 
ATOM   7589  C CB  . SER F  1 53  ? -8.448  81.749  199.813 1.00 78.83  ? 53   SER F CB  1 
ATOM   7590  O OG  . SER F  1 53  ? -7.293  81.348  199.091 1.00 78.56  ? 53   SER F OG  1 
ATOM   7591  N N   . SER F  1 54  ? -9.845  84.310  198.871 1.00 84.89  ? 54   SER F N   1 
ATOM   7592  C CA  . SER F  1 54  ? -9.930  85.580  198.160 1.00 88.36  ? 54   SER F CA  1 
ATOM   7593  C C   . SER F  1 54  ? -9.295  86.754  198.881 1.00 90.82  ? 54   SER F C   1 
ATOM   7594  O O   . SER F  1 54  ? -9.064  86.711  200.083 1.00 91.05  ? 54   SER F O   1 
ATOM   7595  C CB  . SER F  1 54  ? -11.384 85.907  197.868 1.00 88.29  ? 54   SER F CB  1 
ATOM   7596  O OG  . SER F  1 54  ? -12.134 85.876  199.068 1.00 88.91  ? 54   SER F OG  1 
ATOM   7597  N N   . ARG F  1 55  ? -9.007  87.804  198.124 1.00 94.16  ? 55   ARG F N   1 
ATOM   7598  C CA  . ARG F  1 55  ? -8.405  89.005  198.671 1.00 97.73  ? 55   ARG F CA  1 
ATOM   7599  C C   . ARG F  1 55  ? -9.039  90.195  197.974 1.00 99.95  ? 55   ARG F C   1 
ATOM   7600  O O   . ARG F  1 55  ? -9.757  90.045  196.982 1.00 99.76  ? 55   ARG F O   1 
ATOM   7601  C CB  . ARG F  1 55  ? -6.888  89.026  198.437 1.00 98.28  ? 55   ARG F CB  1 
ATOM   7602  C CG  . ARG F  1 55  ? -6.493  89.024  196.965 1.00 99.89  ? 55   ARG F CG  1 
ATOM   7603  C CD  . ARG F  1 55  ? -5.048  89.454  196.749 1.00 100.61 ? 55   ARG F CD  1 
ATOM   7604  N NE  . ARG F  1 55  ? -4.608  89.170  195.383 1.00 102.56 ? 55   ARG F NE  1 
ATOM   7605  C CZ  . ARG F  1 55  ? -4.231  87.966  194.942 1.00 103.77 ? 55   ARG F CZ  1 
ATOM   7606  N NH1 . ARG F  1 55  ? -4.227  86.913  195.755 1.00 103.64 ? 55   ARG F NH1 1 
ATOM   7607  N NH2 . ARG F  1 55  ? -3.851  87.806  193.678 1.00 104.61 ? 55   ARG F NH2 1 
ATOM   7608  N N   . MET F  1 56  ? -8.766  91.380  198.506 1.00 103.07 ? 56   MET F N   1 
ATOM   7609  C CA  . MET F  1 56  ? -9.302  92.608  197.945 1.00 105.87 ? 56   MET F CA  1 
ATOM   7610  C C   . MET F  1 56  ? -8.357  93.277  196.966 1.00 106.11 ? 56   MET F C   1 
ATOM   7611  O O   . MET F  1 56  ? -7.242  93.670  197.321 1.00 106.13 ? 56   MET F O   1 
ATOM   7612  C CB  . MET F  1 56  ? -9.664  93.599  199.059 1.00 108.58 ? 56   MET F CB  1 
ATOM   7613  C CG  . MET F  1 56  ? -11.115 93.474  199.548 1.00 111.92 ? 56   MET F CG  1 
ATOM   7614  S SD  . MET F  1 56  ? -12.358 93.456  198.179 1.00 115.58 ? 56   MET F SD  1 
ATOM   7615  C CE  . MET F  1 56  ? -12.941 91.714  198.243 1.00 114.02 ? 56   MET F CE  1 
ATOM   7616  N N   . ALA F  1 57  ? -8.815  93.400  195.727 1.00 106.50 ? 57   ALA F N   1 
ATOM   7617  C CA  . ALA F  1 57  ? -8.021  94.042  194.698 1.00 107.22 ? 57   ALA F CA  1 
ATOM   7618  C C   . ALA F  1 57  ? -8.064  95.537  194.982 1.00 107.63 ? 57   ALA F C   1 
ATOM   7619  O O   . ALA F  1 57  ? -8.918  96.002  195.737 1.00 107.58 ? 57   ALA F O   1 
ATOM   7620  C CB  . ALA F  1 57  ? -8.609  93.748  193.323 1.00 106.88 ? 57   ALA F CB  1 
ATOM   7621  N N   . GLY F  1 58  ? -7.139  96.283  194.386 1.00 108.16 ? 58   GLY F N   1 
ATOM   7622  C CA  . GLY F  1 58  ? -7.115  97.722  194.582 1.00 108.54 ? 58   GLY F CA  1 
ATOM   7623  C C   . GLY F  1 58  ? -8.433  98.370  194.170 1.00 108.71 ? 58   GLY F C   1 
ATOM   7624  O O   . GLY F  1 58  ? -8.884  99.340  194.801 1.00 108.79 ? 58   GLY F O   1 
ATOM   7625  N N   . GLY F  1 59  ? -9.056  97.834  193.118 1.00 108.44 ? 59   GLY F N   1 
ATOM   7626  C CA  . GLY F  1 59  ? -10.319 98.376  192.650 1.00 108.13 ? 59   GLY F CA  1 
ATOM   7627  C C   . GLY F  1 59  ? -11.458 98.045  193.595 1.00 107.90 ? 59   GLY F C   1 
ATOM   7628  O O   . GLY F  1 59  ? -12.627 98.118  193.211 1.00 107.74 ? 59   GLY F O   1 
ATOM   7629  N N   . GLY F  1 60  ? -11.113 97.691  194.833 1.00 107.73 ? 60   GLY F N   1 
ATOM   7630  C CA  . GLY F  1 60  ? -12.116 97.334  195.825 1.00 107.17 ? 60   GLY F CA  1 
ATOM   7631  C C   . GLY F  1 60  ? -12.940 96.166  195.312 1.00 106.52 ? 60   GLY F C   1 
ATOM   7632  O O   . GLY F  1 60  ? -14.157 96.112  195.520 1.00 106.69 ? 60   GLY F O   1 
ATOM   7633  N N   . GLN F  1 61  ? -12.275 95.228  194.637 1.00 105.46 ? 61   GLN F N   1 
ATOM   7634  C CA  . GLN F  1 61  ? -12.960 94.066  194.076 1.00 104.00 ? 61   GLN F CA  1 
ATOM   7635  C C   . GLN F  1 61  ? -12.319 92.726  194.433 1.00 102.07 ? 61   GLN F C   1 
ATOM   7636  O O   . GLN F  1 61  ? -11.092 92.566  194.429 1.00 101.30 ? 61   GLN F O   1 
ATOM   7637  C CB  . GLN F  1 61  ? -13.043 94.204  192.565 1.00 104.99 ? 61   GLN F CB  1 
ATOM   7638  C CG  . GLN F  1 61  ? -11.694 94.485  191.941 1.00 106.83 ? 61   GLN F CG  1 
ATOM   7639  C CD  . GLN F  1 61  ? -11.758 94.519  190.430 1.00 107.80 ? 61   GLN F CD  1 
ATOM   7640  O OE1 . GLN F  1 61  ? -10.731 94.653  189.754 1.00 107.84 ? 61   GLN F OE1 1 
ATOM   7641  N NE2 . GLN F  1 61  ? -12.970 94.397  189.885 1.00 108.00 ? 61   GLN F NE2 1 
ATOM   7642  N N   . LYS F  1 62  ? -13.191 91.768  194.727 1.00 99.87  ? 62   LYS F N   1 
ATOM   7643  C CA  . LYS F  1 62  ? -12.808 90.427  195.119 1.00 97.62  ? 62   LYS F CA  1 
ATOM   7644  C C   . LYS F  1 62  ? -11.989 89.726  194.042 1.00 95.69  ? 62   LYS F C   1 
ATOM   7645  O O   . LYS F  1 62  ? -12.271 89.832  192.850 1.00 95.76  ? 62   LYS F O   1 
ATOM   7646  C CB  . LYS F  1 62  ? -14.070 89.623  195.423 1.00 98.18  ? 62   LYS F CB  1 
ATOM   7647  C CG  . LYS F  1 62  ? -13.864 88.390  196.277 1.00 98.91  ? 62   LYS F CG  1 
ATOM   7648  C CD  . LYS F  1 62  ? -15.171 87.599  196.354 1.00 99.73  ? 62   LYS F CD  1 
ATOM   7649  C CE  . LYS F  1 62  ? -15.046 86.335  197.220 1.00 100.21 ? 62   LYS F CE  1 
ATOM   7650  N NZ  . LYS F  1 62  ? -16.257 85.447  197.122 1.00 99.95  ? 62   LYS F NZ  1 
ATOM   7651  N N   . VAL F  1 63  ? -10.963 89.012  194.481 1.00 93.00  ? 63   VAL F N   1 
ATOM   7652  C CA  . VAL F  1 63  ? -10.099 88.275  193.585 1.00 89.70  ? 63   VAL F CA  1 
ATOM   7653  C C   . VAL F  1 63  ? -9.930  86.890  194.165 1.00 87.69  ? 63   VAL F C   1 
ATOM   7654  O O   . VAL F  1 63  ? -9.440  86.736  195.281 1.00 87.97  ? 63   VAL F O   1 
ATOM   7655  C CB  . VAL F  1 63  ? -8.720  88.941  193.474 1.00 89.65  ? 63   VAL F CB  1 
ATOM   7656  C CG1 . VAL F  1 63  ? -7.776  88.060  192.671 1.00 88.98  ? 63   VAL F CG1 1 
ATOM   7657  C CG2 . VAL F  1 63  ? -8.870  90.304  192.824 1.00 89.32  ? 63   VAL F CG2 1 
ATOM   7658  N N   . CYS F  1 64  ? -10.339 85.880  193.416 1.00 84.54  ? 64   CYS F N   1 
ATOM   7659  C CA  . CYS F  1 64  ? -10.212 84.517  193.891 1.00 81.94  ? 64   CYS F CA  1 
ATOM   7660  C C   . CYS F  1 64  ? -8.903  83.893  193.474 1.00 79.55  ? 64   CYS F C   1 
ATOM   7661  O O   . CYS F  1 64  ? -8.349  84.246  192.445 1.00 79.60  ? 64   CYS F O   1 
ATOM   7662  C CB  . CYS F  1 64  ? -11.366 83.693  193.367 1.00 82.89  ? 64   CYS F CB  1 
ATOM   7663  S SG  . CYS F  1 64  ? -12.921 84.323  193.990 1.00 84.66  ? 64   CYS F SG  1 
ATOM   7664  N N   . TYR F  1 65  ? -8.407  82.964  194.280 1.00 76.62  ? 65   TYR F N   1 
ATOM   7665  C CA  . TYR F  1 65  ? -7.146  82.305  193.982 1.00 73.94  ? 65   TYR F CA  1 
ATOM   7666  C C   . TYR F  1 65  ? -6.977  81.102  194.877 1.00 71.70  ? 65   TYR F C   1 
ATOM   7667  O O   . TYR F  1 65  ? -7.707  80.933  195.834 1.00 71.44  ? 65   TYR F O   1 
ATOM   7668  C CB  . TYR F  1 65  ? -5.975  83.273  194.195 1.00 74.70  ? 65   TYR F CB  1 
ATOM   7669  C CG  . TYR F  1 65  ? -5.693  83.609  195.648 1.00 75.34  ? 65   TYR F CG  1 
ATOM   7670  C CD1 . TYR F  1 65  ? -4.748  82.885  196.387 1.00 74.62  ? 65   TYR F CD1 1 
ATOM   7671  C CD2 . TYR F  1 65  ? -6.394  84.642  196.293 1.00 75.68  ? 65   TYR F CD2 1 
ATOM   7672  C CE1 . TYR F  1 65  ? -4.508  83.180  197.729 1.00 75.11  ? 65   TYR F CE1 1 
ATOM   7673  C CE2 . TYR F  1 65  ? -6.164  84.944  197.637 1.00 75.71  ? 65   TYR F CE2 1 
ATOM   7674  C CZ  . TYR F  1 65  ? -5.219  84.212  198.348 1.00 75.94  ? 65   TYR F CZ  1 
ATOM   7675  O OH  . TYR F  1 65  ? -4.972  84.518  199.668 1.00 76.29  ? 65   TYR F OH  1 
ATOM   7676  N N   . ILE F  1 66  ? -6.014  80.260  194.551 1.00 70.04  ? 66   ILE F N   1 
ATOM   7677  C CA  . ILE F  1 66  ? -5.748  79.076  195.345 1.00 69.05  ? 66   ILE F CA  1 
ATOM   7678  C C   . ILE F  1 66  ? -4.380  79.287  195.978 1.00 70.13  ? 66   ILE F C   1 
ATOM   7679  O O   . ILE F  1 66  ? -3.464  79.824  195.355 1.00 71.03  ? 66   ILE F O   1 
ATOM   7680  C CB  . ILE F  1 66  ? -5.729  77.812  194.470 1.00 67.34  ? 66   ILE F CB  1 
ATOM   7681  C CG1 . ILE F  1 66  ? -7.008  77.766  193.641 1.00 66.48  ? 66   ILE F CG1 1 
ATOM   7682  C CG2 . ILE F  1 66  ? -5.569  76.573  195.330 1.00 64.60  ? 66   ILE F CG2 1 
ATOM   7683  C CD1 . ILE F  1 66  ? -7.029  76.709  192.565 1.00 67.11  ? 66   ILE F CD1 1 
ATOM   7684  N N   . GLU F  1 67  ? -4.241  78.892  197.231 1.00 70.82  ? 67   GLU F N   1 
ATOM   7685  C CA  . GLU F  1 67  ? -2.968  79.057  197.896 1.00 70.65  ? 67   GLU F CA  1 
ATOM   7686  C C   . GLU F  1 67  ? -1.991  77.986  197.438 1.00 69.18  ? 67   GLU F C   1 
ATOM   7687  O O   . GLU F  1 67  ? -2.350  76.821  197.261 1.00 68.35  ? 67   GLU F O   1 
ATOM   7688  C CB  . GLU F  1 67  ? -3.157  79.032  199.414 1.00 72.54  ? 67   GLU F CB  1 
ATOM   7689  C CG  . GLU F  1 67  ? -3.933  80.231  199.912 1.00 75.06  ? 67   GLU F CG  1 
ATOM   7690  C CD  . GLU F  1 67  ? -4.138  80.207  201.402 1.00 77.22  ? 67   GLU F CD  1 
ATOM   7691  O OE1 . GLU F  1 67  ? -4.730  79.230  201.913 1.00 78.84  ? 67   GLU F OE1 1 
ATOM   7692  O OE2 . GLU F  1 67  ? -3.708  81.172  202.064 1.00 78.95  ? 67   GLU F OE2 1 
ATOM   7693  N N   . GLY F  1 68  ? -0.755  78.423  197.231 1.00 68.45  ? 68   GLY F N   1 
ATOM   7694  C CA  . GLY F  1 68  ? 0.303   77.552  196.775 1.00 66.87  ? 68   GLY F CA  1 
ATOM   7695  C C   . GLY F  1 68  ? 0.386   76.202  197.444 1.00 66.22  ? 68   GLY F C   1 
ATOM   7696  O O   . GLY F  1 68  ? 0.555   75.185  196.771 1.00 65.30  ? 68   GLY F O   1 
ATOM   7697  N N   . HIS F  1 69  ? 0.265   76.164  198.764 1.00 66.53  ? 69   HIS F N   1 
ATOM   7698  C CA  . HIS F  1 69  ? 0.369   74.880  199.435 1.00 66.98  ? 69   HIS F CA  1 
ATOM   7699  C C   . HIS F  1 69  ? -0.760  73.926  199.048 1.00 67.45  ? 69   HIS F C   1 
ATOM   7700  O O   . HIS F  1 69  ? -0.575  72.712  199.063 1.00 67.00  ? 69   HIS F O   1 
ATOM   7701  C CB  . HIS F  1 69  ? 0.456   75.046  200.965 1.00 67.21  ? 69   HIS F CB  1 
ATOM   7702  C CG  . HIS F  1 69  ? -0.823  75.474  201.620 1.00 67.18  ? 69   HIS F CG  1 
ATOM   7703  N ND1 . HIS F  1 69  ? -1.185  76.798  201.762 1.00 67.10  ? 69   HIS F ND1 1 
ATOM   7704  C CD2 . HIS F  1 69  ? -1.844  74.749  202.136 1.00 66.27  ? 69   HIS F CD2 1 
ATOM   7705  C CE1 . HIS F  1 69  ? -2.375  76.868  202.330 1.00 66.05  ? 69   HIS F CE1 1 
ATOM   7706  N NE2 . HIS F  1 69  ? -2.797  75.639  202.564 1.00 65.46  ? 69   HIS F NE2 1 
ATOM   7707  N N   . ARG F  1 70  ? -1.925  74.454  198.685 1.00 68.65  ? 70   ARG F N   1 
ATOM   7708  C CA  . ARG F  1 70  ? -3.023  73.569  198.283 1.00 70.05  ? 70   ARG F CA  1 
ATOM   7709  C C   . ARG F  1 70  ? -2.710  72.997  196.898 1.00 69.20  ? 70   ARG F C   1 
ATOM   7710  O O   . ARG F  1 70  ? -2.937  71.803  196.615 1.00 68.80  ? 70   ARG F O   1 
ATOM   7711  C CB  . ARG F  1 70  ? -4.353  74.331  198.232 1.00 73.20  ? 70   ARG F CB  1 
ATOM   7712  C CG  . ARG F  1 70  ? -4.826  74.882  199.574 1.00 76.71  ? 70   ARG F CG  1 
ATOM   7713  C CD  . ARG F  1 70  ? -6.162  74.267  200.050 1.00 79.53  ? 70   ARG F CD  1 
ATOM   7714  N NE  . ARG F  1 70  ? -6.443  74.726  201.410 1.00 82.89  ? 70   ARG F NE  1 
ATOM   7715  C CZ  . ARG F  1 70  ? -6.537  76.012  201.754 1.00 84.33  ? 70   ARG F CZ  1 
ATOM   7716  N NH1 . ARG F  1 70  ? -6.392  76.964  200.828 1.00 85.75  ? 70   ARG F NH1 1 
ATOM   7717  N NH2 . ARG F  1 70  ? -6.719  76.353  203.027 1.00 84.29  ? 70   ARG F NH2 1 
ATOM   7718  N N   . VAL F  1 71  ? -2.181  73.866  196.039 1.00 67.79  ? 71   VAL F N   1 
ATOM   7719  C CA  . VAL F  1 71  ? -1.818  73.462  194.690 1.00 65.84  ? 71   VAL F CA  1 
ATOM   7720  C C   . VAL F  1 71  ? -0.751  72.378  194.750 1.00 64.82  ? 71   VAL F C   1 
ATOM   7721  O O   . VAL F  1 71  ? -0.852  71.362  194.049 1.00 64.41  ? 71   VAL F O   1 
ATOM   7722  C CB  . VAL F  1 71  ? -1.313  74.660  193.869 1.00 65.04  ? 71   VAL F CB  1 
ATOM   7723  C CG1 . VAL F  1 71  ? -0.879  74.206  192.508 1.00 64.49  ? 71   VAL F CG1 1 
ATOM   7724  C CG2 . VAL F  1 71  ? -2.427  75.672  193.712 1.00 64.68  ? 71   VAL F CG2 1 
ATOM   7725  N N   . ILE F  1 72  ? 0.252   72.576  195.608 1.00 63.45  ? 72   ILE F N   1 
ATOM   7726  C CA  . ILE F  1 72  ? 1.312   71.593  195.743 1.00 62.34  ? 72   ILE F CA  1 
ATOM   7727  C C   . ILE F  1 72  ? 0.748   70.240  196.146 1.00 63.54  ? 72   ILE F C   1 
ATOM   7728  O O   . ILE F  1 72  ? 1.155   69.205  195.608 1.00 63.15  ? 72   ILE F O   1 
ATOM   7729  C CB  . ILE F  1 72  ? 2.377   72.053  196.750 1.00 60.64  ? 72   ILE F CB  1 
ATOM   7730  C CG1 . ILE F  1 72  ? 3.187   73.188  196.131 1.00 60.02  ? 72   ILE F CG1 1 
ATOM   7731  C CG2 . ILE F  1 72  ? 3.314   70.895  197.112 1.00 60.03  ? 72   ILE F CG2 1 
ATOM   7732  C CD1 . ILE F  1 72  ? 4.156   73.833  197.062 1.00 58.90  ? 72   ILE F CD1 1 
ATOM   7733  N N   . ASN F  1 73  ? -0.215  70.233  197.065 1.00 64.88  ? 73   ASN F N   1 
ATOM   7734  C CA  . ASN F  1 73  ? -0.773  68.963  197.501 1.00 65.62  ? 73   ASN F CA  1 
ATOM   7735  C C   . ASN F  1 73  ? -1.672  68.383  196.443 1.00 64.86  ? 73   ASN F C   1 
ATOM   7736  O O   . ASN F  1 73  ? -1.700  67.162  196.240 1.00 65.07  ? 73   ASN F O   1 
ATOM   7737  C CB  . ASN F  1 73  ? -1.509  69.106  198.837 1.00 67.99  ? 73   ASN F CB  1 
ATOM   7738  C CG  . ASN F  1 73  ? -0.551  69.169  200.033 1.00 69.62  ? 73   ASN F CG  1 
ATOM   7739  O OD1 . ASN F  1 73  ? 0.556   68.605  200.008 1.00 70.69  ? 73   ASN F OD1 1 
ATOM   7740  N ND2 . ASN F  1 73  ? -0.981  69.844  201.089 1.00 71.07  ? 73   ASN F ND2 1 
ATOM   7741  N N   . LEU F  1 74  ? -2.405  69.243  195.756 1.00 63.50  ? 74   LEU F N   1 
ATOM   7742  C CA  . LEU F  1 74  ? -3.246  68.735  194.689 1.00 63.09  ? 74   LEU F CA  1 
ATOM   7743  C C   . LEU F  1 74  ? -2.336  67.971  193.727 1.00 63.00  ? 74   LEU F C   1 
ATOM   7744  O O   . LEU F  1 74  ? -2.621  66.812  193.371 1.00 63.28  ? 74   LEU F O   1 
ATOM   7745  C CB  . LEU F  1 74  ? -3.915  69.881  193.956 1.00 62.71  ? 74   LEU F CB  1 
ATOM   7746  C CG  . LEU F  1 74  ? -5.190  70.399  194.588 1.00 62.05  ? 74   LEU F CG  1 
ATOM   7747  C CD1 . LEU F  1 74  ? -5.538  71.759  193.999 1.00 62.95  ? 74   LEU F CD1 1 
ATOM   7748  C CD2 . LEU F  1 74  ? -6.314  69.373  194.353 1.00 62.87  ? 74   LEU F CD2 1 
ATOM   7749  N N   . ALA F  1 75  ? -1.229  68.613  193.340 1.00 61.89  ? 75   ALA F N   1 
ATOM   7750  C CA  . ALA F  1 75  ? -0.266  68.006  192.420 1.00 61.45  ? 75   ALA F CA  1 
ATOM   7751  C C   . ALA F  1 75  ? 0.311   66.688  192.919 1.00 60.85  ? 75   ALA F C   1 
ATOM   7752  O O   . ALA F  1 75  ? 0.347   65.695  192.188 1.00 59.19  ? 75   ALA F O   1 
ATOM   7753  C CB  . ALA F  1 75  ? 0.873   68.990  192.125 1.00 62.14  ? 75   ALA F CB  1 
ATOM   7754  N N   . ASN F  1 76  ? 0.764   66.683  194.168 1.00 61.56  ? 76   ASN F N   1 
ATOM   7755  C CA  . ASN F  1 76  ? 1.344   65.480  194.733 1.00 62.45  ? 76   ASN F CA  1 
ATOM   7756  C C   . ASN F  1 76  ? 0.359   64.336  194.747 1.00 63.13  ? 76   ASN F C   1 
ATOM   7757  O O   . ASN F  1 76  ? 0.728   63.194  194.468 1.00 63.63  ? 76   ASN F O   1 
ATOM   7758  C CB  . ASN F  1 76  ? 1.864   65.741  196.139 1.00 62.20  ? 76   ASN F CB  1 
ATOM   7759  C CG  . ASN F  1 76  ? 3.176   66.489  196.133 1.00 62.23  ? 76   ASN F CG  1 
ATOM   7760  O OD1 . ASN F  1 76  ? 4.060   66.182  195.341 1.00 63.69  ? 76   ASN F OD1 1 
ATOM   7761  N ND2 . ASN F  1 76  ? 3.320   67.464  197.026 1.00 62.91  ? 76   ASN F ND2 1 
ATOM   7762  N N   . GLU F  1 77  ? -0.901  64.640  195.048 1.00 63.51  ? 77   GLU F N   1 
ATOM   7763  C CA  . GLU F  1 77  ? -1.921  63.593  195.086 1.00 63.77  ? 77   GLU F CA  1 
ATOM   7764  C C   . GLU F  1 77  ? -2.359  63.168  193.693 1.00 61.87  ? 77   GLU F C   1 
ATOM   7765  O O   . GLU F  1 77  ? -2.646  62.003  193.449 1.00 60.86  ? 77   GLU F O   1 
ATOM   7766  C CB  . GLU F  1 77  ? -3.119  64.053  195.922 1.00 65.54  ? 77   GLU F CB  1 
ATOM   7767  C CG  . GLU F  1 77  ? -2.745  64.270  197.390 1.00 67.72  ? 77   GLU F CG  1 
ATOM   7768  C CD  . GLU F  1 77  ? -2.114  63.024  198.025 1.00 69.61  ? 77   GLU F CD  1 
ATOM   7769  O OE1 . GLU F  1 77  ? -1.430  63.146  199.077 1.00 69.52  ? 77   GLU F OE1 1 
ATOM   7770  O OE2 . GLU F  1 77  ? -2.311  61.916  197.469 1.00 71.56  ? 77   GLU F OE2 1 
ATOM   7771  N N   . MET F  1 78  ? -2.385  64.118  192.771 1.00 60.72  ? 78   MET F N   1 
ATOM   7772  C CA  . MET F  1 78  ? -2.753  63.804  191.397 1.00 59.16  ? 78   MET F CA  1 
ATOM   7773  C C   . MET F  1 78  ? -1.714  62.938  190.675 1.00 57.33  ? 78   MET F C   1 
ATOM   7774  O O   . MET F  1 78  ? -2.066  61.931  190.079 1.00 56.82  ? 78   MET F O   1 
ATOM   7775  C CB  . MET F  1 78  ? -2.969  65.097  190.610 1.00 58.61  ? 78   MET F CB  1 
ATOM   7776  C CG  . MET F  1 78  ? -3.612  64.906  189.246 1.00 59.21  ? 78   MET F CG  1 
ATOM   7777  S SD  . MET F  1 78  ? -5.262  64.151  189.245 1.00 61.50  ? 78   MET F SD  1 
ATOM   7778  C CE  . MET F  1 78  ? -6.272  65.517  189.882 1.00 58.65  ? 78   MET F CE  1 
ATOM   7779  N N   . PHE F  1 79  ? -0.436  63.308  190.775 1.00 56.47  ? 79   PHE F N   1 
ATOM   7780  C CA  . PHE F  1 79  ? 0.644   62.612  190.048 1.00 55.54  ? 79   PHE F CA  1 
ATOM   7781  C C   . PHE F  1 79  ? 1.604   61.793  190.880 1.00 55.63  ? 79   PHE F C   1 
ATOM   7782  O O   . PHE F  1 79  ? 2.373   61.003  190.336 1.00 55.76  ? 79   PHE F O   1 
ATOM   7783  C CB  . PHE F  1 79  ? 1.502   63.626  189.246 1.00 52.73  ? 79   PHE F CB  1 
ATOM   7784  C CG  . PHE F  1 79  ? 0.697   64.608  188.413 1.00 50.58  ? 79   PHE F CG  1 
ATOM   7785  C CD1 . PHE F  1 79  ? 0.013   64.181  187.283 1.00 50.67  ? 79   PHE F CD1 1 
ATOM   7786  C CD2 . PHE F  1 79  ? 0.616   65.961  188.767 1.00 48.76  ? 79   PHE F CD2 1 
ATOM   7787  C CE1 . PHE F  1 79  ? -0.744  65.095  186.516 1.00 51.21  ? 79   PHE F CE1 1 
ATOM   7788  C CE2 . PHE F  1 79  ? -0.141  66.887  188.006 1.00 47.98  ? 79   PHE F CE2 1 
ATOM   7789  C CZ  . PHE F  1 79  ? -0.816  66.457  186.890 1.00 49.35  ? 79   PHE F CZ  1 
ATOM   7790  N N   . GLY F  1 80  ? 1.574   61.974  192.189 1.00 55.68  ? 80   GLY F N   1 
ATOM   7791  C CA  . GLY F  1 80  ? 2.520   61.258  193.024 1.00 55.67  ? 80   GLY F CA  1 
ATOM   7792  C C   . GLY F  1 80  ? 3.665   62.227  193.341 1.00 56.22  ? 80   GLY F C   1 
ATOM   7793  O O   . GLY F  1 80  ? 3.972   63.117  192.544 1.00 56.25  ? 80   GLY F O   1 
ATOM   7794  N N   . TYR F  1 81  ? 4.290   62.086  194.505 1.00 55.45  ? 81   TYR F N   1 
ATOM   7795  C CA  . TYR F  1 81  ? 5.376   62.978  194.869 1.00 54.67  ? 81   TYR F CA  1 
ATOM   7796  C C   . TYR F  1 81  ? 6.485   62.895  193.818 1.00 55.28  ? 81   TYR F C   1 
ATOM   7797  O O   . TYR F  1 81  ? 7.267   63.853  193.654 1.00 55.63  ? 81   TYR F O   1 
ATOM   7798  C CB  . TYR F  1 81  ? 5.970   62.609  196.227 1.00 53.16  ? 81   TYR F CB  1 
ATOM   7799  C CG  . TYR F  1 81  ? 6.732   61.289  196.250 1.00 51.56  ? 81   TYR F CG  1 
ATOM   7800  C CD1 . TYR F  1 81  ? 6.076   60.084  196.445 1.00 50.98  ? 81   TYR F CD1 1 
ATOM   7801  C CD2 . TYR F  1 81  ? 8.109   61.258  196.079 1.00 51.78  ? 81   TYR F CD2 1 
ATOM   7802  C CE1 . TYR F  1 81  ? 6.765   58.873  196.475 1.00 51.17  ? 81   TYR F CE1 1 
ATOM   7803  C CE2 . TYR F  1 81  ? 8.821   60.050  196.101 1.00 51.94  ? 81   TYR F CE2 1 
ATOM   7804  C CZ  . TYR F  1 81  ? 8.134   58.854  196.301 1.00 52.14  ? 81   TYR F CZ  1 
ATOM   7805  O OH  . TYR F  1 81  ? 8.800   57.634  196.321 1.00 52.34  ? 81   TYR F OH  1 
ATOM   7806  N N   . ASN F  1 82  ? 6.548   61.765  193.109 1.00 54.12  ? 82   ASN F N   1 
ATOM   7807  C CA  . ASN F  1 82  ? 7.574   61.571  192.096 1.00 53.98  ? 82   ASN F CA  1 
ATOM   7808  C C   . ASN F  1 82  ? 7.014   61.600  190.665 1.00 53.52  ? 82   ASN F C   1 
ATOM   7809  O O   . ASN F  1 82  ? 7.650   61.094  189.736 1.00 52.81  ? 82   ASN F O   1 
ATOM   7810  C CB  . ASN F  1 82  ? 8.263   60.228  192.327 1.00 54.48  ? 82   ASN F CB  1 
ATOM   7811  C CG  . ASN F  1 82  ? 7.359   59.046  191.976 1.00 54.94  ? 82   ASN F CG  1 
ATOM   7812  O OD1 . ASN F  1 82  ? 7.825   57.916  191.702 1.00 56.13  ? 82   ASN F OD1 1 
ATOM   7813  N ND2 . ASN F  1 82  ? 6.056   59.301  191.981 1.00 53.15  ? 82   ASN F ND2 1 
ATOM   7814  N N   . GLY F  1 83  ? 5.836   62.183  190.484 1.00 53.22  ? 83   GLY F N   1 
ATOM   7815  C CA  . GLY F  1 83  ? 5.236   62.197  189.164 1.00 52.14  ? 83   GLY F CA  1 
ATOM   7816  C C   . GLY F  1 83  ? 5.241   63.538  188.486 1.00 52.25  ? 83   GLY F C   1 
ATOM   7817  O O   . GLY F  1 83  ? 4.895   63.649  187.314 1.00 52.25  ? 83   GLY F O   1 
ATOM   7818  N N   . TRP F  1 84  ? 5.616   64.576  189.214 1.00 52.18  ? 84   TRP F N   1 
ATOM   7819  C CA  . TRP F  1 84  ? 5.670   65.901  188.617 1.00 52.26  ? 84   TRP F CA  1 
ATOM   7820  C C   . TRP F  1 84  ? 6.897   66.620  189.174 1.00 51.95  ? 84   TRP F C   1 
ATOM   7821  O O   . TRP F  1 84  ? 7.395   66.260  190.248 1.00 52.15  ? 84   TRP F O   1 
ATOM   7822  C CB  . TRP F  1 84  ? 4.399   66.708  188.915 1.00 52.44  ? 84   TRP F CB  1 
ATOM   7823  C CG  . TRP F  1 84  ? 4.288   67.124  190.338 1.00 52.81  ? 84   TRP F CG  1 
ATOM   7824  C CD1 . TRP F  1 84  ? 4.001   66.327  191.394 1.00 52.71  ? 84   TRP F CD1 1 
ATOM   7825  C CD2 . TRP F  1 84  ? 4.536   68.430  190.877 1.00 53.45  ? 84   TRP F CD2 1 
ATOM   7826  N NE1 . TRP F  1 84  ? 4.054   67.044  192.552 1.00 52.82  ? 84   TRP F NE1 1 
ATOM   7827  C CE2 . TRP F  1 84  ? 4.376   68.341  192.267 1.00 53.22  ? 84   TRP F CE2 1 
ATOM   7828  C CE3 . TRP F  1 84  ? 4.873   69.667  190.317 1.00 53.94  ? 84   TRP F CE3 1 
ATOM   7829  C CZ2 . TRP F  1 84  ? 4.548   69.435  193.116 1.00 53.80  ? 84   TRP F CZ2 1 
ATOM   7830  C CZ3 . TRP F  1 84  ? 5.046   70.763  191.166 1.00 54.72  ? 84   TRP F CZ3 1 
ATOM   7831  C CH2 . TRP F  1 84  ? 4.878   70.632  192.551 1.00 54.76  ? 84   TRP F CH2 1 
ATOM   7832  N N   . ALA F  1 85  ? 7.383   67.617  188.432 1.00 50.85  ? 85   ALA F N   1 
ATOM   7833  C CA  . ALA F  1 85  ? 8.556   68.387  188.808 1.00 49.67  ? 85   ALA F CA  1 
ATOM   7834  C C   . ALA F  1 85  ? 8.416   69.784  188.262 1.00 49.81  ? 85   ALA F C   1 
ATOM   7835  O O   . ALA F  1 85  ? 7.523   70.071  187.461 1.00 50.45  ? 85   ALA F O   1 
ATOM   7836  C CB  . ALA F  1 85  ? 9.805   67.742  188.252 1.00 48.42  ? 85   ALA F CB  1 
ATOM   7837  N N   . HIS F  1 86  ? 9.266   70.679  188.728 1.00 50.16  ? 86   HIS F N   1 
ATOM   7838  C CA  . HIS F  1 86  ? 9.224   72.032  188.221 1.00 51.37  ? 86   HIS F CA  1 
ATOM   7839  C C   . HIS F  1 86  ? 10.579  72.670  188.443 1.00 51.79  ? 86   HIS F C   1 
ATOM   7840  O O   . HIS F  1 86  ? 11.308  72.309  189.374 1.00 52.00  ? 86   HIS F O   1 
ATOM   7841  C CB  . HIS F  1 86  ? 8.085   72.864  188.854 1.00 50.04  ? 86   HIS F CB  1 
ATOM   7842  C CG  . HIS F  1 86  ? 8.382   73.376  190.232 1.00 51.23  ? 86   HIS F CG  1 
ATOM   7843  N ND1 . HIS F  1 86  ? 8.423   72.559  191.344 1.00 50.38  ? 86   HIS F ND1 1 
ATOM   7844  C CD2 . HIS F  1 86  ? 8.639   74.629  190.684 1.00 50.82  ? 86   HIS F CD2 1 
ATOM   7845  C CE1 . HIS F  1 86  ? 8.691   73.282  192.413 1.00 48.64  ? 86   HIS F CE1 1 
ATOM   7846  N NE2 . HIS F  1 86  ? 8.826   74.542  192.042 1.00 49.52  ? 86   HIS F NE2 1 
ATOM   7847  N N   . SER F  1 87  ? 10.923  73.582  187.541 1.00 52.29  ? 87   SER F N   1 
ATOM   7848  C CA  . SER F  1 87  ? 12.179  74.296  187.605 1.00 52.97  ? 87   SER F CA  1 
ATOM   7849  C C   . SER F  1 87  ? 11.928  75.754  187.230 1.00 53.35  ? 87   SER F C   1 
ATOM   7850  O O   . SER F  1 87  ? 10.900  76.092  186.625 1.00 53.16  ? 87   SER F O   1 
ATOM   7851  C CB  . SER F  1 87  ? 13.196  73.638  186.659 1.00 53.56  ? 87   SER F CB  1 
ATOM   7852  O OG  . SER F  1 87  ? 12.731  73.604  185.318 1.00 55.11  ? 87   SER F OG  1 
ATOM   7853  N N   . ILE F  1 88  ? 12.844  76.626  187.626 1.00 53.84  ? 88   ILE F N   1 
ATOM   7854  C CA  . ILE F  1 88  ? 12.708  78.032  187.294 1.00 54.89  ? 88   ILE F CA  1 
ATOM   7855  C C   . ILE F  1 88  ? 13.613  78.295  186.091 1.00 55.19  ? 88   ILE F C   1 
ATOM   7856  O O   . ILE F  1 88  ? 14.840  78.362  186.235 1.00 54.07  ? 88   ILE F O   1 
ATOM   7857  C CB  . ILE F  1 88  ? 13.138  78.896  188.460 1.00 55.46  ? 88   ILE F CB  1 
ATOM   7858  C CG1 . ILE F  1 88  ? 12.170  78.691  189.627 1.00 55.66  ? 88   ILE F CG1 1 
ATOM   7859  C CG2 . ILE F  1 88  ? 13.165  80.367  188.028 1.00 55.67  ? 88   ILE F CG2 1 
ATOM   7860  C CD1 . ILE F  1 88  ? 12.757  79.028  190.980 1.00 56.28  ? 88   ILE F CD1 1 
ATOM   7861  N N   . THR F  1 89  ? 13.018  78.421  184.905 1.00 55.37  ? 89   THR F N   1 
ATOM   7862  C CA  . THR F  1 89  ? 13.829  78.644  183.723 1.00 55.86  ? 89   THR F CA  1 
ATOM   7863  C C   . THR F  1 89  ? 14.470  80.009  183.845 1.00 56.21  ? 89   THR F C   1 
ATOM   7864  O O   . THR F  1 89  ? 15.602  80.198  183.414 1.00 56.89  ? 89   THR F O   1 
ATOM   7865  C CB  . THR F  1 89  ? 13.018  78.515  182.428 1.00 55.20  ? 89   THR F CB  1 
ATOM   7866  O OG1 . THR F  1 89  ? 11.865  79.342  182.513 1.00 55.93  ? 89   THR F OG1 1 
ATOM   7867  C CG2 . THR F  1 89  ? 12.576  77.086  182.224 1.00 52.86  ? 89   THR F CG2 1 
ATOM   7868  N N   . GLN F  1 90  ? 13.771  80.961  184.448 1.00 56.38  ? 90   GLN F N   1 
ATOM   7869  C CA  . GLN F  1 90  ? 14.394  82.266  184.661 1.00 55.86  ? 90   GLN F CA  1 
ATOM   7870  C C   . GLN F  1 90  ? 13.591  83.180  185.602 1.00 55.63  ? 90   GLN F C   1 
ATOM   7871  O O   . GLN F  1 90  ? 12.367  83.078  185.673 1.00 55.05  ? 90   GLN F O   1 
ATOM   7872  C CB  . GLN F  1 90  ? 14.592  82.967  183.323 1.00 54.38  ? 90   GLN F CB  1 
ATOM   7873  C CG  . GLN F  1 90  ? 15.417  84.228  183.435 1.00 55.71  ? 90   GLN F CG  1 
ATOM   7874  C CD  . GLN F  1 90  ? 15.291  85.138  182.224 1.00 55.93  ? 90   GLN F CD  1 
ATOM   7875  O OE1 . GLN F  1 90  ? 15.521  84.721  181.097 1.00 57.17  ? 90   GLN F OE1 1 
ATOM   7876  N NE2 . GLN F  1 90  ? 14.933  86.395  182.458 1.00 56.51  ? 90   GLN F NE2 1 
ATOM   7877  N N   . GLN F  1 91  ? 14.284  84.042  186.346 1.00 55.52  ? 91   GLN F N   1 
ATOM   7878  C CA  . GLN F  1 91  ? 13.603  85.006  187.198 1.00 55.43  ? 91   GLN F CA  1 
ATOM   7879  C C   . GLN F  1 91  ? 14.218  86.344  186.959 1.00 55.32  ? 91   GLN F C   1 
ATOM   7880  O O   . GLN F  1 91  ? 15.417  86.518  187.090 1.00 55.11  ? 91   GLN F O   1 
ATOM   7881  C CB  . GLN F  1 91  ? 13.705  84.704  188.687 1.00 56.07  ? 91   GLN F CB  1 
ATOM   7882  C CG  . GLN F  1 91  ? 12.915  85.758  189.477 1.00 57.62  ? 91   GLN F CG  1 
ATOM   7883  C CD  . GLN F  1 91  ? 12.728  85.413  190.934 1.00 58.08  ? 91   GLN F CD  1 
ATOM   7884  O OE1 . GLN F  1 91  ? 13.674  85.470  191.731 1.00 57.82  ? 91   GLN F OE1 1 
ATOM   7885  N NE2 . GLN F  1 91  ? 11.501  85.046  191.296 1.00 58.20  ? 91   GLN F NE2 1 
ATOM   7886  N N   . ASN F  1 92  ? 13.387  87.310  186.636 1.00 56.60  ? 92   ASN F N   1 
ATOM   7887  C CA  . ASN F  1 92  ? 13.905  88.620  186.357 1.00 58.60  ? 92   ASN F CA  1 
ATOM   7888  C C   . ASN F  1 92  ? 13.239  89.722  187.181 1.00 59.81  ? 92   ASN F C   1 
ATOM   7889  O O   . ASN F  1 92  ? 12.005  89.803  187.267 1.00 60.80  ? 92   ASN F O   1 
ATOM   7890  C CB  . ASN F  1 92  ? 13.742  88.900  184.873 1.00 59.31  ? 92   ASN F CB  1 
ATOM   7891  C CG  . ASN F  1 92  ? 14.434  90.166  184.449 1.00 60.84  ? 92   ASN F CG  1 
ATOM   7892  O OD1 . ASN F  1 92  ? 13.891  91.268  184.587 1.00 60.09  ? 92   ASN F OD1 1 
ATOM   7893  N ND2 . ASN F  1 92  ? 15.660  90.025  183.942 1.00 61.54  ? 92   ASN F ND2 1 
ATOM   7894  N N   . VAL F  1 93  ? 14.064  90.557  187.802 1.00 59.89  ? 93   VAL F N   1 
ATOM   7895  C CA  . VAL F  1 93  ? 13.562  91.662  188.587 1.00 60.39  ? 93   VAL F CA  1 
ATOM   7896  C C   . VAL F  1 93  ? 13.295  92.814  187.623 1.00 61.48  ? 93   VAL F C   1 
ATOM   7897  O O   . VAL F  1 93  ? 14.231  93.387  187.066 1.00 61.36  ? 93   VAL F O   1 
ATOM   7898  C CB  . VAL F  1 93  ? 14.592  92.120  189.612 1.00 59.86  ? 93   VAL F CB  1 
ATOM   7899  C CG1 . VAL F  1 93  ? 14.107  93.399  190.252 1.00 59.94  ? 93   VAL F CG1 1 
ATOM   7900  C CG2 . VAL F  1 93  ? 14.822  91.034  190.663 1.00 59.52  ? 93   VAL F CG2 1 
ATOM   7901  N N   . ASP F  1 94  ? 12.027  93.172  187.443 1.00 62.54  ? 94   ASP F N   1 
ATOM   7902  C CA  . ASP F  1 94  ? 11.676  94.236  186.512 1.00 63.57  ? 94   ASP F CA  1 
ATOM   7903  C C   . ASP F  1 94  ? 12.063  95.610  186.935 1.00 64.59  ? 94   ASP F C   1 
ATOM   7904  O O   . ASP F  1 94  ? 12.448  96.427  186.094 1.00 64.93  ? 94   ASP F O   1 
ATOM   7905  C CB  . ASP F  1 94  ? 10.185  94.220  186.216 1.00 64.35  ? 94   ASP F CB  1 
ATOM   7906  C CG  . ASP F  1 94  ? 9.795   93.075  185.321 1.00 65.14  ? 94   ASP F CG  1 
ATOM   7907  O OD1 . ASP F  1 94  ? 8.589   92.826  185.140 1.00 66.12  ? 94   ASP F OD1 1 
ATOM   7908  O OD2 . ASP F  1 94  ? 10.711  92.421  184.791 1.00 66.30  ? 94   ASP F OD2 1 
ATOM   7909  N N   . PHE F  1 95  ? 11.947  95.874  188.233 1.00 65.98  ? 95   PHE F N   1 
ATOM   7910  C CA  . PHE F  1 95  ? 12.287  97.181  188.780 1.00 66.91  ? 95   PHE F CA  1 
ATOM   7911  C C   . PHE F  1 95  ? 12.252  97.223  190.302 1.00 67.76  ? 95   PHE F C   1 
ATOM   7912  O O   . PHE F  1 95  ? 11.595  96.410  190.957 1.00 67.91  ? 95   PHE F O   1 
ATOM   7913  C CB  . PHE F  1 95  ? 11.328  98.238  188.223 1.00 66.84  ? 95   PHE F CB  1 
ATOM   7914  C CG  . PHE F  1 95  ? 9.899   98.058  188.664 1.00 67.25  ? 95   PHE F CG  1 
ATOM   7915  C CD1 . PHE F  1 95  ? 9.463   98.550  189.893 1.00 67.68  ? 95   PHE F CD1 1 
ATOM   7916  C CD2 . PHE F  1 95  ? 8.990   97.375  187.868 1.00 67.08  ? 95   PHE F CD2 1 
ATOM   7917  C CE1 . PHE F  1 95  ? 8.139   98.357  190.317 1.00 67.23  ? 95   PHE F CE1 1 
ATOM   7918  C CE2 . PHE F  1 95  ? 7.665   97.178  188.287 1.00 66.74  ? 95   PHE F CE2 1 
ATOM   7919  C CZ  . PHE F  1 95  ? 7.243   97.668  189.507 1.00 66.95  ? 95   PHE F CZ  1 
ATOM   7920  N N   . VAL F  1 96  ? 13.006  98.161  190.851 1.00 68.96  ? 96   VAL F N   1 
ATOM   7921  C CA  . VAL F  1 96  ? 13.040  98.389  192.279 1.00 70.95  ? 96   VAL F CA  1 
ATOM   7922  C C   . VAL F  1 96  ? 13.011  99.910  192.404 1.00 73.36  ? 96   VAL F C   1 
ATOM   7923  O O   . VAL F  1 96  ? 14.023  100.581 192.235 1.00 73.51  ? 96   VAL F O   1 
ATOM   7924  C CB  . VAL F  1 96  ? 14.317  97.817  192.945 1.00 69.79  ? 96   VAL F CB  1 
ATOM   7925  C CG1 . VAL F  1 96  ? 14.367  98.233  194.406 1.00 68.60  ? 96   VAL F CG1 1 
ATOM   7926  C CG2 . VAL F  1 96  ? 14.319  96.311  192.864 1.00 68.35  ? 96   VAL F CG2 1 
ATOM   7927  N N   . ASP F  1 97  ? 11.830  100.452 192.665 1.00 76.02  ? 97   ASP F N   1 
ATOM   7928  C CA  . ASP F  1 97  ? 11.688  101.886 192.801 1.00 78.66  ? 97   ASP F CA  1 
ATOM   7929  C C   . ASP F  1 97  ? 11.464  102.329 194.240 1.00 80.56  ? 97   ASP F C   1 
ATOM   7930  O O   . ASP F  1 97  ? 10.761  101.669 195.016 1.00 80.95  ? 97   ASP F O   1 
ATOM   7931  C CB  . ASP F  1 97  ? 10.529  102.379 191.944 1.00 78.82  ? 97   ASP F CB  1 
ATOM   7932  C CG  . ASP F  1 97  ? 10.761  102.154 190.483 1.00 79.13  ? 97   ASP F CG  1 
ATOM   7933  O OD1 . ASP F  1 97  ? 11.936  102.080 190.077 1.00 79.79  ? 97   ASP F OD1 1 
ATOM   7934  O OD2 . ASP F  1 97  ? 9.768   102.072 189.738 1.00 80.58  ? 97   ASP F OD2 1 
ATOM   7935  N N   . LEU F  1 98  ? 12.080  103.456 194.582 1.00 82.72  ? 98   LEU F N   1 
ATOM   7936  C CA  . LEU F  1 98  ? 11.958  104.087 195.900 1.00 85.11  ? 98   LEU F CA  1 
ATOM   7937  C C   . LEU F  1 98  ? 11.256  105.406 195.605 1.00 87.10  ? 98   LEU F C   1 
ATOM   7938  O O   . LEU F  1 98  ? 11.888  106.322 195.076 1.00 86.80  ? 98   LEU F O   1 
ATOM   7939  C CB  . LEU F  1 98  ? 13.339  104.380 196.458 1.00 84.80  ? 98   LEU F CB  1 
ATOM   7940  C CG  . LEU F  1 98  ? 13.411  105.305 197.671 1.00 84.66  ? 98   LEU F CG  1 
ATOM   7941  C CD1 . LEU F  1 98  ? 13.104  104.535 198.954 1.00 83.48  ? 98   LEU F CD1 1 
ATOM   7942  C CD2 . LEU F  1 98  ? 14.793  105.914 197.715 1.00 83.53  ? 98   LEU F CD2 1 
ATOM   7943  N N   . ASN F  1 99  ? 9.973   105.524 195.950 1.00 89.86  ? 99   ASN F N   1 
ATOM   7944  C CA  . ASN F  1 99  ? 9.227   106.743 195.606 1.00 92.54  ? 99   ASN F CA  1 
ATOM   7945  C C   . ASN F  1 99  ? 8.852   107.688 196.722 1.00 93.06  ? 99   ASN F C   1 
ATOM   7946  O O   . ASN F  1 99  ? 8.187   108.704 196.493 1.00 93.29  ? 99   ASN F O   1 
ATOM   7947  C CB  . ASN F  1 99  ? 7.955   106.374 194.825 1.00 94.21  ? 99   ASN F CB  1 
ATOM   7948  C CG  . ASN F  1 99  ? 8.250   105.942 193.382 1.00 96.81  ? 99   ASN F CG  1 
ATOM   7949  O OD1 . ASN F  1 99  ? 7.395   105.345 192.709 1.00 97.52  ? 99   ASN F OD1 1 
ATOM   7950  N ND2 . ASN F  1 99  ? 9.464   106.255 192.897 1.00 97.72  ? 99   ASN F ND2 1 
ATOM   7951  N N   . ASN F  1 100 ? 9.282   107.352 197.924 1.00 93.73  ? 100  ASN F N   1 
ATOM   7952  C CA  . ASN F  1 100 ? 8.991   108.149 199.102 1.00 94.74  ? 100  ASN F CA  1 
ATOM   7953  C C   . ASN F  1 100 ? 10.034  107.550 200.009 1.00 93.98  ? 100  ASN F C   1 
ATOM   7954  O O   . ASN F  1 100 ? 11.229  107.723 199.780 1.00 93.99  ? 100  ASN F O   1 
ATOM   7955  C CB  . ASN F  1 100 ? 7.584   107.812 199.589 1.00 97.36  ? 100  ASN F CB  1 
ATOM   7956  C CG  . ASN F  1 100 ? 6.898   106.775 198.688 1.00 99.70  ? 100  ASN F CG  1 
ATOM   7957  O OD1 . ASN F  1 100 ? 6.356   107.111 197.620 1.00 100.98 ? 100  ASN F OD1 1 
ATOM   7958  N ND2 . ASN F  1 100 ? 6.948   105.507 199.100 1.00 100.29 ? 100  ASN F ND2 1 
ATOM   7959  N N   . GLY F  1 101 ? 9.587   106.820 201.018 1.00 93.10  ? 101  GLY F N   1 
ATOM   7960  C CA  . GLY F  1 101 ? 10.521  106.156 201.900 1.00 91.86  ? 101  GLY F CA  1 
ATOM   7961  C C   . GLY F  1 101 ? 10.180  104.700 201.708 1.00 91.25  ? 101  GLY F C   1 
ATOM   7962  O O   . GLY F  1 101 ? 10.661  103.816 202.424 1.00 90.99  ? 101  GLY F O   1 
ATOM   7963  N N   . LYS F  1 102 ? 9.338   104.461 200.705 1.00 90.68  ? 102  LYS F N   1 
ATOM   7964  C CA  . LYS F  1 102 ? 8.858   103.119 200.397 1.00 89.66  ? 102  LYS F CA  1 
ATOM   7965  C C   . LYS F  1 102 ? 9.331   102.558 199.047 1.00 87.68  ? 102  LYS F C   1 
ATOM   7966  O O   . LYS F  1 102 ? 9.630   103.308 198.101 1.00 87.71  ? 102  LYS F O   1 
ATOM   7967  C CB  . LYS F  1 102 ? 7.323   103.113 200.445 1.00 91.26  ? 102  LYS F CB  1 
ATOM   7968  C CG  . LYS F  1 102 ? 6.731   103.704 201.719 1.00 92.43  ? 102  LYS F CG  1 
ATOM   7969  C CD  . LYS F  1 102 ? 5.239   103.962 201.540 1.00 93.65  ? 102  LYS F CD  1 
ATOM   7970  C CE  . LYS F  1 102 ? 4.587   104.349 202.854 1.00 94.56  ? 102  LYS F CE  1 
ATOM   7971  N NZ  . LYS F  1 102 ? 3.119   104.511 202.676 1.00 95.70  ? 102  LYS F NZ  1 
ATOM   7972  N N   . PHE F  1 103 ? 9.368   101.229 198.975 1.00 84.48  ? 103  PHE F N   1 
ATOM   7973  C CA  . PHE F  1 103 ? 9.790   100.526 197.785 1.00 81.14  ? 103  PHE F CA  1 
ATOM   7974  C C   . PHE F  1 103 ? 8.682   99.873  196.991 1.00 80.39  ? 103  PHE F C   1 
ATOM   7975  O O   . PHE F  1 103 ? 7.738   99.305  197.543 1.00 80.30  ? 103  PHE F O   1 
ATOM   7976  C CB  . PHE F  1 103 ? 10.796  99.472  198.162 1.00 79.24  ? 103  PHE F CB  1 
ATOM   7977  C CG  . PHE F  1 103 ? 12.072  100.032 198.640 1.00 78.00  ? 103  PHE F CG  1 
ATOM   7978  C CD1 . PHE F  1 103 ? 12.386  100.036 199.986 1.00 77.11  ? 103  PHE F CD1 1 
ATOM   7979  C CD2 . PHE F  1 103 ? 12.978  100.551 197.736 1.00 77.58  ? 103  PHE F CD2 1 
ATOM   7980  C CE1 . PHE F  1 103 ? 13.597  100.551 200.427 1.00 77.11  ? 103  PHE F CE1 1 
ATOM   7981  C CE2 . PHE F  1 103 ? 14.189  101.066 198.163 1.00 78.06  ? 103  PHE F CE2 1 
ATOM   7982  C CZ  . PHE F  1 103 ? 14.503  101.066 199.514 1.00 77.66  ? 103  PHE F CZ  1 
ATOM   7983  N N   . TYR F  1 104 ? 8.829   99.956  195.675 1.00 79.67  ? 104  TYR F N   1 
ATOM   7984  C CA  . TYR F  1 104 ? 7.889   99.372  194.730 1.00 78.37  ? 104  TYR F CA  1 
ATOM   7985  C C   . TYR F  1 104 ? 8.693   98.395  193.897 1.00 76.19  ? 104  TYR F C   1 
ATOM   7986  O O   . TYR F  1 104 ? 9.625   98.785  193.191 1.00 75.83  ? 104  TYR F O   1 
ATOM   7987  C CB  . TYR F  1 104 ? 7.254   100.480 193.888 1.00 80.67  ? 104  TYR F CB  1 
ATOM   7988  C CG  . TYR F  1 104 ? 6.500   101.420 194.792 1.00 83.26  ? 104  TYR F CG  1 
ATOM   7989  C CD1 . TYR F  1 104 ? 7.179   102.402 195.530 1.00 83.61  ? 104  TYR F CD1 1 
ATOM   7990  C CD2 . TYR F  1 104 ? 5.140   101.217 195.048 1.00 84.33  ? 104  TYR F CD2 1 
ATOM   7991  C CE1 . TYR F  1 104 ? 6.531   103.143 196.507 1.00 84.95  ? 104  TYR F CE1 1 
ATOM   7992  C CE2 . TYR F  1 104 ? 4.477   101.953 196.026 1.00 85.74  ? 104  TYR F CE2 1 
ATOM   7993  C CZ  . TYR F  1 104 ? 5.179   102.913 196.758 1.00 85.88  ? 104  TYR F CZ  1 
ATOM   7994  O OH  . TYR F  1 104 ? 4.535   103.614 197.758 1.00 86.44  ? 104  TYR F OH  1 
ATOM   7995  N N   . VAL F  1 105 ? 8.331   97.120  194.010 1.00 73.22  ? 105  VAL F N   1 
ATOM   7996  C CA  . VAL F  1 105 ? 9.040   96.059  193.325 1.00 70.47  ? 105  VAL F CA  1 
ATOM   7997  C C   . VAL F  1 105 ? 8.202   95.107  192.476 1.00 69.52  ? 105  VAL F C   1 
ATOM   7998  O O   . VAL F  1 105 ? 7.172   94.596  192.920 1.00 69.31  ? 105  VAL F O   1 
ATOM   7999  C CB  . VAL F  1 105 ? 9.817   95.230  194.345 1.00 69.19  ? 105  VAL F CB  1 
ATOM   8000  C CG1 . VAL F  1 105 ? 10.651  94.199  193.649 1.00 68.78  ? 105  VAL F CG1 1 
ATOM   8001  C CG2 . VAL F  1 105 ? 10.678  96.148  195.176 1.00 68.29  ? 105  VAL F CG2 1 
ATOM   8002  N N   . GLY F  1 106 ? 8.670   94.871  191.249 1.00 67.82  ? 106  GLY F N   1 
ATOM   8003  C CA  . GLY F  1 106 ? 7.999   93.956  190.350 1.00 65.65  ? 106  GLY F CA  1 
ATOM   8004  C C   . GLY F  1 106 ? 8.958   92.866  189.896 1.00 64.11  ? 106  GLY F C   1 
ATOM   8005  O O   . GLY F  1 106 ? 10.057  93.139  189.407 1.00 64.08  ? 106  GLY F O   1 
ATOM   8006  N N   . VAL F  1 107 ? 8.557   91.617  190.059 1.00 62.27  ? 107  VAL F N   1 
ATOM   8007  C CA  . VAL F  1 107 ? 9.419   90.528  189.642 1.00 60.77  ? 107  VAL F CA  1 
ATOM   8008  C C   . VAL F  1 107 ? 8.635   89.467  188.891 1.00 60.14  ? 107  VAL F C   1 
ATOM   8009  O O   . VAL F  1 107 ? 7.494   89.165  189.255 1.00 60.14  ? 107  VAL F O   1 
ATOM   8010  C CB  . VAL F  1 107 ? 10.097  89.866  190.851 1.00 60.89  ? 107  VAL F CB  1 
ATOM   8011  C CG1 . VAL F  1 107 ? 10.831  88.590  190.413 1.00 59.28  ? 107  VAL F CG1 1 
ATOM   8012  C CG2 . VAL F  1 107 ? 11.056  90.846  191.488 1.00 60.05  ? 107  VAL F CG2 1 
ATOM   8013  N N   . CYS F  1 108 ? 9.247   88.902  187.846 1.00 58.59  ? 108  CYS F N   1 
ATOM   8014  C CA  . CYS F  1 108 ? 8.603   87.841  187.062 1.00 55.88  ? 108  CYS F CA  1 
ATOM   8015  C C   . CYS F  1 108 ? 9.445   86.574  187.088 1.00 53.78  ? 108  CYS F C   1 
ATOM   8016  O O   . CYS F  1 108 ? 10.661  86.629  187.186 1.00 53.32  ? 108  CYS F O   1 
ATOM   8017  C CB  . CYS F  1 108 ? 8.382   88.279  185.604 1.00 56.46  ? 108  CYS F CB  1 
ATOM   8018  S SG  . CYS F  1 108 ? 9.904   88.448  184.605 1.00 54.18  ? 108  CYS F SG  1 
ATOM   8019  N N   . ALA F  1 109 ? 8.782   85.433  187.009 1.00 52.16  ? 109  ALA F N   1 
ATOM   8020  C CA  . ALA F  1 109 ? 9.473   84.161  187.021 1.00 50.21  ? 109  ALA F CA  1 
ATOM   8021  C C   . ALA F  1 109 ? 8.830   83.283  185.979 1.00 48.91  ? 109  ALA F C   1 
ATOM   8022  O O   . ALA F  1 109 ? 7.612   83.351  185.759 1.00 48.92  ? 109  ALA F O   1 
ATOM   8023  C CB  . ALA F  1 109 ? 9.349   83.515  188.371 1.00 51.00  ? 109  ALA F CB  1 
ATOM   8024  N N   . PHE F  1 110 ? 9.651   82.465  185.331 1.00 46.62  ? 110  PHE F N   1 
ATOM   8025  C CA  . PHE F  1 110 ? 9.173   81.549  184.305 1.00 44.31  ? 110  PHE F CA  1 
ATOM   8026  C C   . PHE F  1 110 ? 9.366   80.171  184.881 1.00 44.28  ? 110  PHE F C   1 
ATOM   8027  O O   . PHE F  1 110 ? 10.493  79.745  185.169 1.00 45.75  ? 110  PHE F O   1 
ATOM   8028  C CB  . PHE F  1 110 ? 9.972   81.737  183.005 1.00 42.48  ? 110  PHE F CB  1 
ATOM   8029  C CG  . PHE F  1 110 ? 9.749   83.072  182.367 1.00 38.49  ? 110  PHE F CG  1 
ATOM   8030  C CD1 . PHE F  1 110 ? 10.497  84.168  182.759 1.00 36.82  ? 110  PHE F CD1 1 
ATOM   8031  C CD2 . PHE F  1 110 ? 8.719   83.248  181.455 1.00 35.67  ? 110  PHE F CD2 1 
ATOM   8032  C CE1 . PHE F  1 110 ? 10.221  85.421  182.259 1.00 37.29  ? 110  PHE F CE1 1 
ATOM   8033  C CE2 . PHE F  1 110 ? 8.440   84.487  180.957 1.00 36.16  ? 110  PHE F CE2 1 
ATOM   8034  C CZ  . PHE F  1 110 ? 9.188   85.586  181.358 1.00 37.03  ? 110  PHE F CZ  1 
ATOM   8035  N N   . VAL F  1 111 ? 8.260   79.468  185.052 1.00 43.84  ? 111  VAL F N   1 
ATOM   8036  C CA  . VAL F  1 111 ? 8.326   78.162  185.673 1.00 44.58  ? 111  VAL F CA  1 
ATOM   8037  C C   . VAL F  1 111 ? 7.877   77.080  184.718 1.00 44.42  ? 111  VAL F C   1 
ATOM   8038  O O   . VAL F  1 111 ? 6.847   77.201  184.062 1.00 42.94  ? 111  VAL F O   1 
ATOM   8039  C CB  . VAL F  1 111 ? 7.450   78.124  186.987 1.00 45.26  ? 111  VAL F CB  1 
ATOM   8040  C CG1 . VAL F  1 111 ? 7.575   76.772  187.668 1.00 45.19  ? 111  VAL F CG1 1 
ATOM   8041  C CG2 . VAL F  1 111 ? 7.895   79.212  187.949 1.00 45.26  ? 111  VAL F CG2 1 
ATOM   8042  N N   . ARG F  1 112 ? 8.667   76.019  184.646 1.00 45.07  ? 112  ARG F N   1 
ATOM   8043  C CA  . ARG F  1 112 ? 8.364   74.920  183.761 1.00 46.84  ? 112  ARG F CA  1 
ATOM   8044  C C   . ARG F  1 112 ? 8.081   73.696  184.615 1.00 47.10  ? 112  ARG F C   1 
ATOM   8045  O O   . ARG F  1 112 ? 8.945   73.224  185.371 1.00 46.92  ? 112  ARG F O   1 
ATOM   8046  C CB  . ARG F  1 112 ? 9.557   74.616  182.829 1.00 48.76  ? 112  ARG F CB  1 
ATOM   8047  C CG  . ARG F  1 112 ? 9.160   73.946  181.502 1.00 50.89  ? 112  ARG F CG  1 
ATOM   8048  C CD  . ARG F  1 112 ? 10.342  73.398  180.648 1.00 52.75  ? 112  ARG F CD  1 
ATOM   8049  N NE  . ARG F  1 112 ? 10.504  71.960  180.863 1.00 55.74  ? 112  ARG F NE  1 
ATOM   8050  C CZ  . ARG F  1 112 ? 10.549  71.031  179.904 1.00 56.63  ? 112  ARG F CZ  1 
ATOM   8051  N NH1 . ARG F  1 112 ? 10.449  71.387  178.615 1.00 56.39  ? 112  ARG F NH1 1 
ATOM   8052  N NH2 . ARG F  1 112 ? 10.668  69.739  180.247 1.00 54.18  ? 112  ARG F NH2 1 
ATOM   8053  N N   . VAL F  1 113 ? 6.879   73.171  184.487 1.00 45.64  ? 113  VAL F N   1 
ATOM   8054  C CA  . VAL F  1 113 ? 6.548   71.994  185.253 1.00 46.60  ? 113  VAL F CA  1 
ATOM   8055  C C   . VAL F  1 113 ? 6.485   70.803  184.296 1.00 45.24  ? 113  VAL F C   1 
ATOM   8056  O O   . VAL F  1 113 ? 5.994   70.920  183.178 1.00 45.42  ? 113  VAL F O   1 
ATOM   8057  C CB  . VAL F  1 113 ? 5.205   72.184  186.011 1.00 47.60  ? 113  VAL F CB  1 
ATOM   8058  C CG1 . VAL F  1 113 ? 4.189   72.852  185.105 1.00 47.71  ? 113  VAL F CG1 1 
ATOM   8059  C CG2 . VAL F  1 113 ? 4.677   70.831  186.450 1.00 47.31  ? 113  VAL F CG2 1 
ATOM   8060  N N   . GLN F  1 114 ? 6.974   69.661  184.749 1.00 44.00  ? 114  GLN F N   1 
ATOM   8061  C CA  . GLN F  1 114 ? 7.007   68.484  183.919 1.00 44.63  ? 114  GLN F CA  1 
ATOM   8062  C C   . GLN F  1 114 ? 6.489   67.220  184.622 1.00 44.89  ? 114  GLN F C   1 
ATOM   8063  O O   . GLN F  1 114 ? 6.617   67.090  185.830 1.00 45.96  ? 114  GLN F O   1 
ATOM   8064  C CB  . GLN F  1 114 ? 8.444   68.266  183.484 1.00 45.01  ? 114  GLN F CB  1 
ATOM   8065  C CG  . GLN F  1 114 ? 8.643   67.040  182.615 1.00 47.49  ? 114  GLN F CG  1 
ATOM   8066  C CD  . GLN F  1 114 ? 10.131  66.735  182.357 1.00 48.32  ? 114  GLN F CD  1 
ATOM   8067  O OE1 . GLN F  1 114 ? 10.966  67.641  182.285 1.00 50.90  ? 114  GLN F OE1 1 
ATOM   8068  N NE2 . GLN F  1 114 ? 10.455  65.468  182.201 1.00 47.31  ? 114  GLN F NE2 1 
ATOM   8069  N N   . LEU F  1 115 ? 5.925   66.287  183.868 1.00 43.88  ? 115  LEU F N   1 
ATOM   8070  C CA  . LEU F  1 115 ? 5.432   65.040  184.439 1.00 44.31  ? 115  LEU F CA  1 
ATOM   8071  C C   . LEU F  1 115 ? 6.490   63.981  184.226 1.00 45.16  ? 115  LEU F C   1 
ATOM   8072  O O   . LEU F  1 115 ? 7.391   64.206  183.451 1.00 45.50  ? 115  LEU F O   1 
ATOM   8073  C CB  . LEU F  1 115 ? 4.133   64.650  183.752 1.00 43.51  ? 115  LEU F CB  1 
ATOM   8074  C CG  . LEU F  1 115 ? 2.826   65.159  184.386 1.00 44.57  ? 115  LEU F CG  1 
ATOM   8075  C CD1 . LEU F  1 115 ? 3.024   66.438  185.180 1.00 43.48  ? 115  LEU F CD1 1 
ATOM   8076  C CD2 . LEU F  1 115 ? 1.806   65.376  183.314 1.00 43.79  ? 115  LEU F CD2 1 
ATOM   8077  N N   . LYS F  1 116 ? 6.395   62.841  184.908 1.00 46.98  ? 116  LYS F N   1 
ATOM   8078  C CA  . LYS F  1 116 ? 7.384   61.756  184.772 1.00 49.63  ? 116  LYS F CA  1 
ATOM   8079  C C   . LYS F  1 116 ? 7.414   61.256  183.326 1.00 50.91  ? 116  LYS F C   1 
ATOM   8080  O O   . LYS F  1 116 ? 8.309   60.534  182.864 1.00 51.15  ? 116  LYS F O   1 
ATOM   8081  C CB  . LYS F  1 116 ? 7.033   60.596  185.717 1.00 50.99  ? 116  LYS F CB  1 
ATOM   8082  C CG  . LYS F  1 116 ? 5.652   59.991  185.526 1.00 52.42  ? 116  LYS F CG  1 
ATOM   8083  C CD  . LYS F  1 116 ? 5.470   58.770  186.444 1.00 55.06  ? 116  LYS F CD  1 
ATOM   8084  C CE  . LYS F  1 116 ? 3.996   58.265  186.486 1.00 55.53  ? 116  LYS F CE  1 
ATOM   8085  N NZ  . LYS F  1 116 ? 3.733   57.183  187.507 1.00 55.75  ? 116  LYS F NZ  1 
ATOM   8086  N N   . ASP F  1 117 ? 6.371   61.676  182.648 1.00 51.57  ? 117  ASP F N   1 
ATOM   8087  C CA  . ASP F  1 117 ? 6.057   61.417  181.270 1.00 51.21  ? 117  ASP F CA  1 
ATOM   8088  C C   . ASP F  1 117 ? 7.035   62.097  180.321 1.00 51.79  ? 117  ASP F C   1 
ATOM   8089  O O   . ASP F  1 117 ? 7.433   61.556  179.294 1.00 53.05  ? 117  ASP F O   1 
ATOM   8090  C CB  . ASP F  1 117 ? 4.715   62.063  181.022 1.00 50.57  ? 117  ASP F CB  1 
ATOM   8091  C CG  . ASP F  1 117 ? 4.037   61.482  179.903 1.00 50.49  ? 117  ASP F CG  1 
ATOM   8092  O OD1 . ASP F  1 117 ? 3.131   62.132  179.357 1.00 51.63  ? 117  ASP F OD1 1 
ATOM   8093  O OD2 . ASP F  1 117 ? 4.427   60.346  179.597 1.00 50.90  ? 117  ASP F OD2 1 
ATOM   8094  N N   . GLY F  1 118 ? 7.365   63.331  180.663 1.00 50.62  ? 118  GLY F N   1 
ATOM   8095  C CA  . GLY F  1 118 ? 8.201   64.140  179.813 1.00 49.30  ? 118  GLY F CA  1 
ATOM   8096  C C   . GLY F  1 118 ? 7.296   65.278  179.329 1.00 48.27  ? 118  GLY F C   1 
ATOM   8097  O O   . GLY F  1 118 ? 7.778   66.277  178.805 1.00 48.64  ? 118  GLY F O   1 
ATOM   8098  N N   . SER F  1 119 ? 5.982   65.148  179.513 1.00 46.62  ? 119  SER F N   1 
ATOM   8099  C CA  . SER F  1 119 ? 5.066   66.219  179.089 1.00 44.58  ? 119  SER F CA  1 
ATOM   8100  C C   . SER F  1 119 ? 5.304   67.407  179.992 1.00 42.86  ? 119  SER F C   1 
ATOM   8101  O O   . SER F  1 119 ? 5.782   67.241  181.102 1.00 42.01  ? 119  SER F O   1 
ATOM   8102  C CB  . SER F  1 119 ? 3.603   65.758  179.125 1.00 44.20  ? 119  SER F CB  1 
ATOM   8103  O OG  . SER F  1 119 ? 3.360   64.982  180.271 1.00 46.51  ? 119  SER F OG  1 
ATOM   8104  N N   . TYR F  1 120 ? 4.952   68.606  179.537 1.00 41.88  ? 120  TYR F N   1 
ATOM   8105  C CA  . TYR F  1 120 ? 5.276   69.790  180.329 1.00 40.80  ? 120  TYR F CA  1 
ATOM   8106  C C   . TYR F  1 120 ? 4.500   71.034  179.943 1.00 41.41  ? 120  TYR F C   1 
ATOM   8107  O O   . TYR F  1 120 ? 3.940   71.111  178.856 1.00 41.68  ? 120  TYR F O   1 
ATOM   8108  C CB  . TYR F  1 120 ? 6.771   70.089  180.131 1.00 39.85  ? 120  TYR F CB  1 
ATOM   8109  C CG  . TYR F  1 120 ? 7.121   70.312  178.640 1.00 38.51  ? 120  TYR F CG  1 
ATOM   8110  C CD1 . TYR F  1 120 ? 6.947   71.560  178.045 1.00 37.82  ? 120  TYR F CD1 1 
ATOM   8111  C CD2 . TYR F  1 120 ? 7.508   69.244  177.815 1.00 36.83  ? 120  TYR F CD2 1 
ATOM   8112  C CE1 . TYR F  1 120 ? 7.136   71.749  176.671 1.00 38.06  ? 120  TYR F CE1 1 
ATOM   8113  C CE2 . TYR F  1 120 ? 7.695   69.412  176.436 1.00 36.59  ? 120  TYR F CE2 1 
ATOM   8114  C CZ  . TYR F  1 120 ? 7.509   70.674  175.862 1.00 37.24  ? 120  TYR F CZ  1 
ATOM   8115  O OH  . TYR F  1 120 ? 7.700   70.885  174.499 1.00 33.46  ? 120  TYR F OH  1 
ATOM   8116  N N   . HIS F  1 121 ? 4.496   72.018  180.837 1.00 41.33  ? 121  HIS F N   1 
ATOM   8117  C CA  . HIS F  1 121 ? 3.861   73.295  180.558 1.00 42.38  ? 121  HIS F CA  1 
ATOM   8118  C C   . HIS F  1 121 ? 4.665   74.363  181.264 1.00 43.32  ? 121  HIS F C   1 
ATOM   8119  O O   . HIS F  1 121 ? 5.213   74.120  182.328 1.00 44.67  ? 121  HIS F O   1 
ATOM   8120  C CB  . HIS F  1 121 ? 2.429   73.322  181.029 1.00 42.74  ? 121  HIS F CB  1 
ATOM   8121  C CG  . HIS F  1 121 ? 1.508   72.455  180.223 1.00 43.78  ? 121  HIS F CG  1 
ATOM   8122  N ND1 . HIS F  1 121 ? 0.947   71.290  180.711 1.00 42.78  ? 121  HIS F ND1 1 
ATOM   8123  C CD2 . HIS F  1 121 ? 1.024   72.603  178.971 1.00 44.10  ? 121  HIS F CD2 1 
ATOM   8124  C CE1 . HIS F  1 121 ? 0.153   70.764  179.799 1.00 43.13  ? 121  HIS F CE1 1 
ATOM   8125  N NE2 . HIS F  1 121 ? 0.180   71.542  178.733 1.00 44.54  ? 121  HIS F NE2 1 
ATOM   8126  N N   . GLU F  1 122 ? 4.763   75.543  180.674 1.00 44.18  ? 122  GLU F N   1 
ATOM   8127  C CA  . GLU F  1 122 ? 5.547   76.598  181.283 1.00 44.77  ? 122  GLU F CA  1 
ATOM   8128  C C   . GLU F  1 122 ? 4.739   77.870  181.244 1.00 44.30  ? 122  GLU F C   1 
ATOM   8129  O O   . GLU F  1 122 ? 3.983   78.079  180.314 1.00 43.11  ? 122  GLU F O   1 
ATOM   8130  C CB  . GLU F  1 122 ? 6.870   76.767  180.525 1.00 47.77  ? 122  GLU F CB  1 
ATOM   8131  C CG  . GLU F  1 122 ? 7.689   77.980  180.932 1.00 51.37  ? 122  GLU F CG  1 
ATOM   8132  C CD  . GLU F  1 122 ? 9.013   78.062  180.211 1.00 55.27  ? 122  GLU F CD  1 
ATOM   8133  O OE1 . GLU F  1 122 ? 9.135   77.494  179.097 1.00 56.33  ? 122  GLU F OE1 1 
ATOM   8134  O OE2 . GLU F  1 122 ? 9.931   78.713  180.754 1.00 58.10  ? 122  GLU F OE2 1 
ATOM   8135  N N   . ASP F  1 123 ? 4.866   78.698  182.284 1.00 44.99  ? 123  ASP F N   1 
ATOM   8136  C CA  . ASP F  1 123 ? 4.156   79.958  182.344 1.00 44.61  ? 123  ASP F CA  1 
ATOM   8137  C C   . ASP F  1 123 ? 4.937   80.999  183.141 1.00 45.03  ? 123  ASP F C   1 
ATOM   8138  O O   . ASP F  1 123 ? 5.978   80.687  183.729 1.00 43.39  ? 123  ASP F O   1 
ATOM   8139  C CB  . ASP F  1 123 ? 2.790   79.747  182.967 1.00 45.62  ? 123  ASP F CB  1 
ATOM   8140  C CG  . ASP F  1 123 ? 1.718   80.667  182.353 1.00 48.40  ? 123  ASP F CG  1 
ATOM   8141  O OD1 . ASP F  1 123 ? 2.012   81.873  182.128 1.00 47.70  ? 123  ASP F OD1 1 
ATOM   8142  O OD2 . ASP F  1 123 ? 0.586   80.187  182.084 1.00 48.71  ? 123  ASP F OD2 1 
ATOM   8143  N N   . VAL F  1 124 ? 4.456   82.244  183.117 1.00 47.04  ? 124  VAL F N   1 
ATOM   8144  C CA  . VAL F  1 124 ? 5.072   83.335  183.880 1.00 49.38  ? 124  VAL F CA  1 
ATOM   8145  C C   . VAL F  1 124 ? 4.284   83.553  185.146 1.00 51.91  ? 124  VAL F C   1 
ATOM   8146  O O   . VAL F  1 124 ? 3.055   83.453  185.150 1.00 52.50  ? 124  VAL F O   1 
ATOM   8147  C CB  . VAL F  1 124 ? 4.958   84.733  183.263 1.00 48.35  ? 124  VAL F CB  1 
ATOM   8148  C CG1 . VAL F  1 124 ? 6.308   85.287  183.050 1.00 49.25  ? 124  VAL F CG1 1 
ATOM   8149  C CG2 . VAL F  1 124 ? 4.077   84.735  182.046 1.00 48.48  ? 124  VAL F CG2 1 
ATOM   8150  N N   . GLY F  1 125 ? 4.992   83.922  186.203 1.00 54.20  ? 125  GLY F N   1 
ATOM   8151  C CA  . GLY F  1 125 ? 4.341   84.231  187.460 1.00 55.77  ? 125  GLY F CA  1 
ATOM   8152  C C   . GLY F  1 125 ? 4.836   85.628  187.724 1.00 57.34  ? 125  GLY F C   1 
ATOM   8153  O O   . GLY F  1 125 ? 5.880   86.001  187.195 1.00 57.07  ? 125  GLY F O   1 
ATOM   8154  N N   . TYR F  1 126 ? 4.096   86.422  188.483 1.00 59.92  ? 126  TYR F N   1 
ATOM   8155  C CA  . TYR F  1 126 ? 4.571   87.753  188.798 1.00 62.55  ? 126  TYR F CA  1 
ATOM   8156  C C   . TYR F  1 126 ? 4.550   87.917  190.311 1.00 64.25  ? 126  TYR F C   1 
ATOM   8157  O O   . TYR F  1 126 ? 3.746   87.295  190.989 1.00 64.60  ? 126  TYR F O   1 
ATOM   8158  C CB  . TYR F  1 126 ? 3.718   88.829  188.137 1.00 62.56  ? 126  TYR F CB  1 
ATOM   8159  C CG  . TYR F  1 126 ? 4.528   90.063  187.836 1.00 63.88  ? 126  TYR F CG  1 
ATOM   8160  C CD1 . TYR F  1 126 ? 5.442   90.070  186.791 1.00 64.81  ? 126  TYR F CD1 1 
ATOM   8161  C CD2 . TYR F  1 126 ? 4.441   91.203  188.635 1.00 65.02  ? 126  TYR F CD2 1 
ATOM   8162  C CE1 . TYR F  1 126 ? 6.258   91.177  186.544 1.00 65.42  ? 126  TYR F CE1 1 
ATOM   8163  C CE2 . TYR F  1 126 ? 5.258   92.327  188.393 1.00 65.40  ? 126  TYR F CE2 1 
ATOM   8164  C CZ  . TYR F  1 126 ? 6.162   92.299  187.344 1.00 65.17  ? 126  TYR F CZ  1 
ATOM   8165  O OH  . TYR F  1 126 ? 6.955   93.388  187.075 1.00 65.06  ? 126  TYR F OH  1 
ATOM   8166  N N   . GLY F  1 127 ? 5.463   88.731  190.830 1.00 66.25  ? 127  GLY F N   1 
ATOM   8167  C CA  . GLY F  1 127 ? 5.538   88.978  192.260 1.00 68.02  ? 127  GLY F CA  1 
ATOM   8168  C C   . GLY F  1 127 ? 5.576   90.475  192.496 1.00 68.89  ? 127  GLY F C   1 
ATOM   8169  O O   . GLY F  1 127 ? 6.323   91.202  191.846 1.00 68.84  ? 127  GLY F O   1 
ATOM   8170  N N   . VAL F  1 128 ? 4.772   90.951  193.431 1.00 70.63  ? 128  VAL F N   1 
ATOM   8171  C CA  . VAL F  1 128 ? 4.731   92.382  193.701 1.00 71.77  ? 128  VAL F CA  1 
ATOM   8172  C C   . VAL F  1 128 ? 4.880   92.752  195.174 1.00 72.90  ? 128  VAL F C   1 
ATOM   8173  O O   . VAL F  1 128 ? 4.438   92.040  196.069 1.00 73.34  ? 128  VAL F O   1 
ATOM   8174  C CB  . VAL F  1 128 ? 3.407   92.985  193.209 1.00 70.84  ? 128  VAL F CB  1 
ATOM   8175  C CG1 . VAL F  1 128 ? 3.408   94.470  193.423 1.00 71.11  ? 128  VAL F CG1 1 
ATOM   8176  C CG2 . VAL F  1 128 ? 3.190   92.653  191.758 1.00 70.86  ? 128  VAL F CG2 1 
ATOM   8177  N N   . SER F  1 129 ? 5.523   93.876  195.419 1.00 74.74  ? 129  SER F N   1 
ATOM   8178  C CA  . SER F  1 129 ? 5.667   94.379  196.773 1.00 76.70  ? 129  SER F CA  1 
ATOM   8179  C C   . SER F  1 129 ? 5.644   95.898  196.664 1.00 77.86  ? 129  SER F C   1 
ATOM   8180  O O   . SER F  1 129 ? 6.560   96.514  196.098 1.00 77.70  ? 129  SER F O   1 
ATOM   8181  C CB  . SER F  1 129 ? 6.968   93.918  197.401 1.00 76.36  ? 129  SER F CB  1 
ATOM   8182  O OG  . SER F  1 129 ? 6.993   94.329  198.751 1.00 77.36  ? 129  SER F OG  1 
ATOM   8183  N N   . GLU F  1 130 ? 4.581   96.504  197.174 1.00 79.14  ? 130  GLU F N   1 
ATOM   8184  C CA  . GLU F  1 130 ? 4.465   97.958  197.103 1.00 80.91  ? 130  GLU F CA  1 
ATOM   8185  C C   . GLU F  1 130 ? 4.227   98.554  198.478 1.00 81.12  ? 130  GLU F C   1 
ATOM   8186  O O   . GLU F  1 130 ? 3.344   98.104  199.197 1.00 82.04  ? 130  GLU F O   1 
ATOM   8187  C CB  . GLU F  1 130 ? 3.322   98.355  196.154 1.00 81.55  ? 130  GLU F CB  1 
ATOM   8188  C CG  . GLU F  1 130 ? 3.582   97.967  194.697 1.00 82.63  ? 130  GLU F CG  1 
ATOM   8189  C CD  . GLU F  1 130 ? 2.409   98.255  193.766 1.00 83.26  ? 130  GLU F CD  1 
ATOM   8190  O OE1 . GLU F  1 130 ? 1.277   97.786  194.047 1.00 84.06  ? 130  GLU F OE1 1 
ATOM   8191  O OE2 . GLU F  1 130 ? 2.627   98.940  192.741 1.00 83.11  ? 130  GLU F OE2 1 
ATOM   8192  N N   . GLY F  1 131 ? 5.035   99.542  198.855 1.00 81.47  ? 131  GLY F N   1 
ATOM   8193  C CA  . GLY F  1 131 ? 4.850   100.186 200.146 1.00 81.89  ? 131  GLY F CA  1 
ATOM   8194  C C   . GLY F  1 131 ? 5.766   99.887  201.334 1.00 82.11  ? 131  GLY F C   1 
ATOM   8195  O O   . GLY F  1 131 ? 5.830   100.688 202.262 1.00 82.64  ? 131  GLY F O   1 
ATOM   8196  N N   . LEU F  1 132 ? 6.462   98.758  201.353 1.00 81.83  ? 132  LEU F N   1 
ATOM   8197  C CA  . LEU F  1 132 ? 7.333   98.471  202.488 1.00 81.28  ? 132  LEU F CA  1 
ATOM   8198  C C   . LEU F  1 132 ? 8.490   99.460  202.534 1.00 81.00  ? 132  LEU F C   1 
ATOM   8199  O O   . LEU F  1 132 ? 8.788   100.137 201.553 1.00 80.79  ? 132  LEU F O   1 
ATOM   8200  C CB  . LEU F  1 132 ? 7.870   97.042  202.398 1.00 81.33  ? 132  LEU F CB  1 
ATOM   8201  C CG  . LEU F  1 132 ? 6.795   95.952  202.312 1.00 81.68  ? 132  LEU F CG  1 
ATOM   8202  C CD1 . LEU F  1 132 ? 7.456   94.578  202.327 1.00 81.82  ? 132  LEU F CD1 1 
ATOM   8203  C CD2 . LEU F  1 132 ? 5.828   96.079  203.476 1.00 82.05  ? 132  LEU F CD2 1 
ATOM   8204  N N   . LYS F  1 133 ? 9.145   99.568  203.677 1.00 80.89  ? 133  LYS F N   1 
ATOM   8205  C CA  . LYS F  1 133 ? 10.258  100.493 203.744 1.00 80.67  ? 133  LYS F CA  1 
ATOM   8206  C C   . LYS F  1 133 ? 11.531  99.686  203.678 1.00 79.95  ? 133  LYS F C   1 
ATOM   8207  O O   . LYS F  1 133 ? 12.625  100.233 203.556 1.00 80.02  ? 133  LYS F O   1 
ATOM   8208  C CB  . LYS F  1 133 ? 10.221  101.320 205.027 1.00 82.09  ? 133  LYS F CB  1 
ATOM   8209  C CG  . LYS F  1 133 ? 8.999   102.238 205.145 1.00 83.18  ? 133  LYS F CG  1 
ATOM   8210  C CD  . LYS F  1 133 ? 9.181   103.369 206.183 1.00 83.44  ? 133  LYS F CD  1 
ATOM   8211  C CE  . LYS F  1 133 ? 9.689   102.866 207.546 1.00 84.15  ? 133  LYS F CE  1 
ATOM   8212  N NZ  . LYS F  1 133 ? 8.882   101.741 208.127 1.00 83.51  ? 133  LYS F NZ  1 
ATOM   8213  N N   . SER F  1 134 ? 11.385  98.371  203.765 1.00 78.67  ? 134  SER F N   1 
ATOM   8214  C CA  . SER F  1 134 ? 12.538  97.497  203.671 1.00 77.67  ? 134  SER F CA  1 
ATOM   8215  C C   . SER F  1 134 ? 12.748  97.035  202.218 1.00 77.26  ? 134  SER F C   1 
ATOM   8216  O O   . SER F  1 134 ? 11.857  96.445  201.598 1.00 76.82  ? 134  SER F O   1 
ATOM   8217  C CB  . SER F  1 134 ? 12.347  96.284  204.574 1.00 76.78  ? 134  SER F CB  1 
ATOM   8218  O OG  . SER F  1 134 ? 13.501  95.477  204.567 1.00 77.03  ? 134  SER F OG  1 
ATOM   8219  N N   . LYS F  1 135 ? 13.926  97.325  201.678 1.00 76.90  ? 135  LYS F N   1 
ATOM   8220  C CA  . LYS F  1 135 ? 14.273  96.915  200.324 1.00 76.56  ? 135  LYS F CA  1 
ATOM   8221  C C   . LYS F  1 135 ? 14.337  95.386  200.321 1.00 75.84  ? 135  LYS F C   1 
ATOM   8222  O O   . LYS F  1 135 ? 13.698  94.722  199.494 1.00 76.11  ? 135  LYS F O   1 
ATOM   8223  C CB  . LYS F  1 135 ? 15.636  97.489  199.964 1.00 77.10  ? 135  LYS F CB  1 
ATOM   8224  C CG  . LYS F  1 135 ? 15.997  97.528  198.488 1.00 77.25  ? 135  LYS F CG  1 
ATOM   8225  C CD  . LYS F  1 135 ? 17.426  98.036  198.374 1.00 77.28  ? 135  LYS F CD  1 
ATOM   8226  C CE  . LYS F  1 135 ? 17.681  98.821  197.112 1.00 77.71  ? 135  LYS F CE  1 
ATOM   8227  N NZ  . LYS F  1 135 ? 19.037  99.443  197.156 1.00 77.92  ? 135  LYS F NZ  1 
ATOM   8228  N N   . ALA F  1 136 ? 15.107  94.841  201.264 1.00 74.49  ? 136  ALA F N   1 
ATOM   8229  C CA  . ALA F  1 136 ? 15.270  93.398  201.407 1.00 73.33  ? 136  ALA F CA  1 
ATOM   8230  C C   . ALA F  1 136 ? 13.929  92.667  201.513 1.00 72.83  ? 136  ALA F C   1 
ATOM   8231  O O   . ALA F  1 136 ? 13.678  91.700  200.795 1.00 73.39  ? 136  ALA F O   1 
ATOM   8232  C CB  . ALA F  1 136 ? 16.104  93.099  202.613 1.00 73.16  ? 136  ALA F CB  1 
ATOM   8233  N N   . LEU F  1 137 ? 13.063  93.122  202.404 1.00 71.80  ? 137  LEU F N   1 
ATOM   8234  C CA  . LEU F  1 137 ? 11.763  92.490  202.557 1.00 70.57  ? 137  LEU F CA  1 
ATOM   8235  C C   . LEU F  1 137 ? 10.912  92.608  201.295 1.00 68.84  ? 137  LEU F C   1 
ATOM   8236  O O   . LEU F  1 137 ? 10.146  91.702  200.978 1.00 68.37  ? 137  LEU F O   1 
ATOM   8237  C CB  . LEU F  1 137 ? 11.022  93.089  203.756 1.00 71.92  ? 137  LEU F CB  1 
ATOM   8238  C CG  . LEU F  1 137 ? 11.339  92.469  205.128 1.00 73.11  ? 137  LEU F CG  1 
ATOM   8239  C CD1 . LEU F  1 137 ? 10.840  91.021  205.166 1.00 73.14  ? 137  LEU F CD1 1 
ATOM   8240  C CD2 . LEU F  1 137 ? 12.839  92.509  205.409 1.00 73.47  ? 137  LEU F CD2 1 
ATOM   8241  N N   . SER F  1 138 ? 11.042  93.717  200.575 1.00 66.94  ? 138  SER F N   1 
ATOM   8242  C CA  . SER F  1 138 ? 10.277  93.901  199.356 1.00 66.01  ? 138  SER F CA  1 
ATOM   8243  C C   . SER F  1 138 ? 10.757  92.933  198.283 1.00 65.88  ? 138  SER F C   1 
ATOM   8244  O O   . SER F  1 138 ? 9.947   92.226  197.669 1.00 65.86  ? 138  SER F O   1 
ATOM   8245  C CB  . SER F  1 138 ? 10.398  95.333  198.871 1.00 65.89  ? 138  SER F CB  1 
ATOM   8246  O OG  . SER F  1 138 ? 9.617   96.185  199.686 1.00 66.63  ? 138  SER F OG  1 
ATOM   8247  N N   . LEU F  1 139 ? 12.067  92.896  198.058 1.00 65.24  ? 139  LEU F N   1 
ATOM   8248  C CA  . LEU F  1 139 ? 12.639  91.979  197.080 1.00 65.56  ? 139  LEU F CA  1 
ATOM   8249  C C   . LEU F  1 139 ? 12.255  90.545  197.427 1.00 65.94  ? 139  LEU F C   1 
ATOM   8250  O O   . LEU F  1 139 ? 11.776  89.811  196.568 1.00 66.64  ? 139  LEU F O   1 
ATOM   8251  C CB  . LEU F  1 139 ? 14.164  92.090  197.061 1.00 65.94  ? 139  LEU F CB  1 
ATOM   8252  C CG  . LEU F  1 139 ? 14.874  92.652  195.828 1.00 65.82  ? 139  LEU F CG  1 
ATOM   8253  C CD1 . LEU F  1 139 ? 13.883  92.875  194.694 1.00 67.29  ? 139  LEU F CD1 1 
ATOM   8254  C CD2 . LEU F  1 139 ? 15.539  93.935  196.182 1.00 65.13  ? 139  LEU F CD2 1 
ATOM   8255  N N   . GLU F  1 140 ? 12.457  90.145  198.683 1.00 65.96  ? 140  GLU F N   1 
ATOM   8256  C CA  . GLU F  1 140 ? 12.109  88.789  199.101 1.00 65.70  ? 140  GLU F CA  1 
ATOM   8257  C C   . GLU F  1 140 ? 10.654  88.411  198.799 1.00 65.41  ? 140  GLU F C   1 
ATOM   8258  O O   . GLU F  1 140 ? 10.378  87.327  198.301 1.00 65.51  ? 140  GLU F O   1 
ATOM   8259  C CB  . GLU F  1 140 ? 12.367  88.596  200.588 1.00 65.87  ? 140  GLU F CB  1 
ATOM   8260  C CG  . GLU F  1 140 ? 11.677  87.344  201.130 1.00 66.95  ? 140  GLU F CG  1 
ATOM   8261  C CD  . GLU F  1 140 ? 11.936  87.118  202.608 1.00 67.46  ? 140  GLU F CD  1 
ATOM   8262  O OE1 . GLU F  1 140 ? 11.733  88.069  203.403 1.00 68.10  ? 140  GLU F OE1 1 
ATOM   8263  O OE2 . GLU F  1 140 ? 12.336  85.986  202.972 1.00 67.34  ? 140  GLU F OE2 1 
ATOM   8264  N N   . LYS F  1 141 ? 9.719   89.300  199.101 1.00 65.32  ? 141  LYS F N   1 
ATOM   8265  C CA  . LYS F  1 141 ? 8.319   89.001  198.848 1.00 65.32  ? 141  LYS F CA  1 
ATOM   8266  C C   . LYS F  1 141 ? 8.038   88.816  197.352 1.00 64.71  ? 141  LYS F C   1 
ATOM   8267  O O   . LYS F  1 141 ? 7.404   87.836  196.927 1.00 63.43  ? 141  LYS F O   1 
ATOM   8268  C CB  . LYS F  1 141 ? 7.433   90.124  199.413 1.00 66.09  ? 141  LYS F CB  1 
ATOM   8269  C CG  . LYS F  1 141 ? 5.936   89.944  199.142 1.00 66.98  ? 141  LYS F CG  1 
ATOM   8270  C CD  . LYS F  1 141 ? 5.120   91.151  199.607 1.00 67.85  ? 141  LYS F CD  1 
ATOM   8271  C CE  . LYS F  1 141 ? 3.615   90.909  199.465 1.00 68.05  ? 141  LYS F CE  1 
ATOM   8272  N NZ  . LYS F  1 141 ? 3.145   90.881  198.050 1.00 68.94  ? 141  LYS F NZ  1 
ATOM   8273  N N   . ALA F  1 142 ? 8.517   89.766  196.556 1.00 64.57  ? 142  ALA F N   1 
ATOM   8274  C CA  . ALA F  1 142 ? 8.297   89.724  195.113 1.00 64.40  ? 142  ALA F CA  1 
ATOM   8275  C C   . ALA F  1 142 ? 8.926   88.522  194.426 1.00 64.02  ? 142  ALA F C   1 
ATOM   8276  O O   . ALA F  1 142 ? 8.300   87.914  193.555 1.00 62.76  ? 142  ALA F O   1 
ATOM   8277  C CB  . ALA F  1 142 ? 8.795   91.000  194.461 1.00 64.58  ? 142  ALA F CB  1 
ATOM   8278  N N   . ARG F  1 143 ? 10.156  88.177  194.805 1.00 63.54  ? 143  ARG F N   1 
ATOM   8279  C CA  . ARG F  1 143 ? 10.815  87.035  194.184 1.00 63.11  ? 143  ARG F CA  1 
ATOM   8280  C C   . ARG F  1 143 ? 10.099  85.739  194.534 1.00 63.08  ? 143  ARG F C   1 
ATOM   8281  O O   . ARG F  1 143 ? 9.823   84.924  193.658 1.00 64.26  ? 143  ARG F O   1 
ATOM   8282  C CB  . ARG F  1 143 ? 12.290  86.946  194.598 1.00 63.16  ? 143  ARG F CB  1 
ATOM   8283  C CG  . ARG F  1 143 ? 13.083  88.227  194.354 1.00 64.53  ? 143  ARG F CG  1 
ATOM   8284  C CD  . ARG F  1 143 ? 14.595  88.022  194.420 1.00 64.93  ? 143  ARG F CD  1 
ATOM   8285  N NE  . ARG F  1 143 ? 15.066  87.733  193.081 1.00 68.07  ? 143  ARG F NE  1 
ATOM   8286  C CZ  . ARG F  1 143 ? 16.160  88.240  192.541 1.00 68.60  ? 143  ARG F CZ  1 
ATOM   8287  N NH1 . ARG F  1 143 ? 16.920  89.058  193.231 1.00 69.75  ? 143  ARG F NH1 1 
ATOM   8288  N NH2 . ARG F  1 143 ? 16.457  87.971  191.285 1.00 70.51  ? 143  ARG F NH2 1 
ATOM   8289  N N   . LYS F  1 144 ? 9.778   85.542  195.803 1.00 62.12  ? 144  LYS F N   1 
ATOM   8290  C CA  . LYS F  1 144 ? 9.105   84.321  196.181 1.00 61.02  ? 144  LYS F CA  1 
ATOM   8291  C C   . LYS F  1 144 ? 7.713   84.198  195.596 1.00 60.89  ? 144  LYS F C   1 
ATOM   8292  O O   . LYS F  1 144 ? 7.312   83.108  195.191 1.00 60.87  ? 144  LYS F O   1 
ATOM   8293  C CB  . LYS F  1 144 ? 9.035   84.200  197.695 1.00 60.67  ? 144  LYS F CB  1 
ATOM   8294  C CG  . LYS F  1 144 ? 10.395  84.061  198.326 1.00 60.06  ? 144  LYS F CG  1 
ATOM   8295  C CD  . LYS F  1 144 ? 10.301  83.712  199.792 1.00 59.88  ? 144  LYS F CD  1 
ATOM   8296  C CE  . LYS F  1 144 ? 11.674  83.711  200.433 1.00 59.41  ? 144  LYS F CE  1 
ATOM   8297  N NZ  . LYS F  1 144 ? 11.637  83.270  201.842 1.00 58.60  ? 144  LYS F NZ  1 
ATOM   8298  N N   . GLU F  1 145 ? 6.959   85.293  195.546 1.00 60.77  ? 145  GLU F N   1 
ATOM   8299  C CA  . GLU F  1 145 ? 5.615   85.184  194.989 1.00 60.56  ? 145  GLU F CA  1 
ATOM   8300  C C   . GLU F  1 145 ? 5.627   84.934  193.486 1.00 59.18  ? 145  GLU F C   1 
ATOM   8301  O O   . GLU F  1 145 ? 4.812   84.158  192.980 1.00 59.69  ? 145  GLU F O   1 
ATOM   8302  C CB  . GLU F  1 145 ? 4.782   86.411  195.336 1.00 61.57  ? 145  GLU F CB  1 
ATOM   8303  C CG  . GLU F  1 145 ? 4.369   86.434  196.796 1.00 63.57  ? 145  GLU F CG  1 
ATOM   8304  C CD  . GLU F  1 145 ? 3.612   87.706  197.203 1.00 65.11  ? 145  GLU F CD  1 
ATOM   8305  O OE1 . GLU F  1 145 ? 3.251   88.536  196.324 1.00 66.37  ? 145  GLU F OE1 1 
ATOM   8306  O OE2 . GLU F  1 145 ? 3.372   87.869  198.421 1.00 64.99  ? 145  GLU F OE2 1 
ATOM   8307  N N   . ALA F  1 146 ? 6.553   85.568  192.773 1.00 56.98  ? 146  ALA F N   1 
ATOM   8308  C CA  . ALA F  1 146 ? 6.655   85.341  191.342 1.00 54.32  ? 146  ALA F CA  1 
ATOM   8309  C C   . ALA F  1 146 ? 6.807   83.829  191.089 1.00 53.16  ? 146  ALA F C   1 
ATOM   8310  O O   . ALA F  1 146 ? 6.096   83.260  190.251 1.00 53.25  ? 146  ALA F O   1 
ATOM   8311  C CB  . ALA F  1 146 ? 7.832   86.069  190.788 1.00 54.49  ? 146  ALA F CB  1 
ATOM   8312  N N   . VAL F  1 147 ? 7.706   83.172  191.817 1.00 50.30  ? 147  VAL F N   1 
ATOM   8313  C CA  . VAL F  1 147 ? 7.904   81.747  191.630 1.00 48.01  ? 147  VAL F CA  1 
ATOM   8314  C C   . VAL F  1 147 ? 6.647   80.941  191.885 1.00 48.36  ? 147  VAL F C   1 
ATOM   8315  O O   . VAL F  1 147 ? 6.215   80.155  191.043 1.00 49.27  ? 147  VAL F O   1 
ATOM   8316  C CB  . VAL F  1 147 ? 9.023   81.218  192.535 1.00 47.06  ? 147  VAL F CB  1 
ATOM   8317  C CG1 . VAL F  1 147 ? 9.109   79.695  192.440 1.00 46.14  ? 147  VAL F CG1 1 
ATOM   8318  C CG2 . VAL F  1 147 ? 10.320  81.852  192.144 1.00 46.85  ? 147  VAL F CG2 1 
ATOM   8319  N N   . THR F  1 148 ? 6.042   81.137  193.042 1.00 48.02  ? 148  THR F N   1 
ATOM   8320  C CA  . THR F  1 148 ? 4.838   80.388  193.379 1.00 47.56  ? 148  THR F CA  1 
ATOM   8321  C C   . THR F  1 148 ? 3.713   80.687  192.377 1.00 46.46  ? 148  THR F C   1 
ATOM   8322  O O   . THR F  1 148 ? 3.018   79.781  191.910 1.00 44.65  ? 148  THR F O   1 
ATOM   8323  C CB  . THR F  1 148 ? 4.385   80.715  194.842 1.00 48.42  ? 148  THR F CB  1 
ATOM   8324  O OG1 . THR F  1 148 ? 5.396   80.274  195.771 1.00 48.68  ? 148  THR F OG1 1 
ATOM   8325  C CG2 . THR F  1 148 ? 3.067   80.031  195.167 1.00 47.64  ? 148  THR F CG2 1 
ATOM   8326  N N   . ASP F  1 149 ? 3.552   81.960  192.034 1.00 46.22  ? 149  ASP F N   1 
ATOM   8327  C CA  . ASP F  1 149 ? 2.517   82.359  191.094 1.00 46.78  ? 149  ASP F CA  1 
ATOM   8328  C C   . ASP F  1 149 ? 2.747   81.653  189.749 1.00 48.58  ? 149  ASP F C   1 
ATOM   8329  O O   . ASP F  1 149 ? 1.795   81.214  189.080 1.00 48.43  ? 149  ASP F O   1 
ATOM   8330  C CB  . ASP F  1 149 ? 2.562   83.860  190.896 1.00 46.34  ? 149  ASP F CB  1 
ATOM   8331  C CG  . ASP F  1 149 ? 1.381   84.372  190.097 1.00 49.54  ? 149  ASP F CG  1 
ATOM   8332  O OD1 . ASP F  1 149 ? 1.590   85.214  189.179 1.00 49.87  ? 149  ASP F OD1 1 
ATOM   8333  O OD2 . ASP F  1 149 ? 0.230   83.940  190.392 1.00 50.68  ? 149  ASP F OD2 1 
ATOM   8334  N N   . GLY F  1 150 ? 4.018   81.545  189.364 1.00 48.47  ? 150  GLY F N   1 
ATOM   8335  C CA  . GLY F  1 150 ? 4.352   80.898  188.123 1.00 49.61  ? 150  GLY F CA  1 
ATOM   8336  C C   . GLY F  1 150 ? 4.070   79.427  188.208 1.00 49.73  ? 150  GLY F C   1 
ATOM   8337  O O   . GLY F  1 150 ? 3.502   78.871  187.276 1.00 51.06  ? 150  GLY F O   1 
ATOM   8338  N N   . LEU F  1 151 ? 4.460   78.792  189.307 1.00 49.63  ? 151  LEU F N   1 
ATOM   8339  C CA  . LEU F  1 151 ? 4.202   77.367  189.454 1.00 50.71  ? 151  LEU F CA  1 
ATOM   8340  C C   . LEU F  1 151 ? 2.700   77.103  189.331 1.00 52.32  ? 151  LEU F C   1 
ATOM   8341  O O   . LEU F  1 151 ? 2.265   76.165  188.652 1.00 52.60  ? 151  LEU F O   1 
ATOM   8342  C CB  . LEU F  1 151 ? 4.695   76.876  190.807 1.00 50.00  ? 151  LEU F CB  1 
ATOM   8343  C CG  . LEU F  1 151 ? 4.363   75.433  191.171 1.00 50.27  ? 151  LEU F CG  1 
ATOM   8344  C CD1 . LEU F  1 151 ? 4.776   74.507  190.064 1.00 50.03  ? 151  LEU F CD1 1 
ATOM   8345  C CD2 . LEU F  1 151 ? 5.088   75.056  192.450 1.00 50.31  ? 151  LEU F CD2 1 
ATOM   8346  N N   . LYS F  1 152 ? 1.896   77.941  189.978 1.00 53.42  ? 152  LYS F N   1 
ATOM   8347  C CA  . LYS F  1 152 ? 0.452   77.743  189.921 1.00 54.58  ? 152  LYS F CA  1 
ATOM   8348  C C   . LYS F  1 152 ? -0.084  77.892  188.502 1.00 54.37  ? 152  LYS F C   1 
ATOM   8349  O O   . LYS F  1 152 ? -0.855  77.045  188.042 1.00 53.66  ? 152  LYS F O   1 
ATOM   8350  C CB  . LYS F  1 152 ? -0.281  78.702  190.881 1.00 55.29  ? 152  LYS F CB  1 
ATOM   8351  C CG  . LYS F  1 152 ? -0.091  78.371  192.380 1.00 56.22  ? 152  LYS F CG  1 
ATOM   8352  C CD  . LYS F  1 152 ? -1.012  79.204  193.273 1.00 57.45  ? 152  LYS F CD  1 
ATOM   8353  C CE  . LYS F  1 152 ? -0.731  80.708  193.178 1.00 57.50  ? 152  LYS F CE  1 
ATOM   8354  N NZ  . LYS F  1 152 ? -1.822  81.548  193.786 1.00 57.39  ? 152  LYS F NZ  1 
ATOM   8355  N N   . ARG F  1 153 ? 0.318   78.951  187.801 1.00 54.13  ? 153  ARG F N   1 
ATOM   8356  C CA  . ARG F  1 153 ? -0.169  79.127  186.436 1.00 54.00  ? 153  ARG F CA  1 
ATOM   8357  C C   . ARG F  1 153 ? 0.256   77.980  185.539 1.00 53.62  ? 153  ARG F C   1 
ATOM   8358  O O   . ARG F  1 153 ? -0.524  77.522  184.712 1.00 53.11  ? 153  ARG F O   1 
ATOM   8359  C CB  . ARG F  1 153 ? 0.309   80.437  185.835 1.00 54.44  ? 153  ARG F CB  1 
ATOM   8360  C CG  . ARG F  1 153 ? -0.113  81.644  186.613 1.00 56.23  ? 153  ARG F CG  1 
ATOM   8361  C CD  . ARG F  1 153 ? 0.314   82.914  185.901 1.00 58.09  ? 153  ARG F CD  1 
ATOM   8362  N NE  . ARG F  1 153 ? -0.765  83.458  185.092 1.00 60.28  ? 153  ARG F NE  1 
ATOM   8363  C CZ  . ARG F  1 153 ? -0.723  83.612  183.780 1.00 61.27  ? 153  ARG F CZ  1 
ATOM   8364  N NH1 . ARG F  1 153 ? 0.360   83.265  183.113 1.00 63.51  ? 153  ARG F NH1 1 
ATOM   8365  N NH2 . ARG F  1 153 ? -1.777  84.102  183.137 1.00 62.20  ? 153  ARG F NH2 1 
ATOM   8366  N N   . ALA F  1 154 ? 1.480   77.493  185.702 1.00 53.56  ? 154  ALA F N   1 
ATOM   8367  C CA  . ALA F  1 154 ? 1.929   76.388  184.868 1.00 54.74  ? 154  ALA F CA  1 
ATOM   8368  C C   . ALA F  1 154 ? 1.042   75.166  185.110 1.00 55.67  ? 154  ALA F C   1 
ATOM   8369  O O   . ALA F  1 154 ? 0.525   74.562  184.167 1.00 56.39  ? 154  ALA F O   1 
ATOM   8370  C CB  . ALA F  1 154 ? 3.387   76.051  185.165 1.00 53.30  ? 154  ALA F CB  1 
ATOM   8371  N N   . LEU F  1 155 ? 0.852   74.819  186.380 1.00 56.26  ? 155  LEU F N   1 
ATOM   8372  C CA  . LEU F  1 155 ? 0.045   73.665  186.743 1.00 55.70  ? 155  LEU F CA  1 
ATOM   8373  C C   . LEU F  1 155 ? -1.397  73.750  186.241 1.00 56.51  ? 155  LEU F C   1 
ATOM   8374  O O   . LEU F  1 155 ? -1.991  72.717  185.932 1.00 57.02  ? 155  LEU F O   1 
ATOM   8375  C CB  . LEU F  1 155 ? 0.074   73.497  188.247 1.00 55.51  ? 155  LEU F CB  1 
ATOM   8376  C CG  . LEU F  1 155 ? 0.857   72.383  188.959 1.00 55.19  ? 155  LEU F CG  1 
ATOM   8377  C CD1 . LEU F  1 155 ? 1.544   71.471  188.004 1.00 54.64  ? 155  LEU F CD1 1 
ATOM   8378  C CD2 . LEU F  1 155 ? 1.843   73.014  189.931 1.00 54.78  ? 155  LEU F CD2 1 
ATOM   8379  N N   . ARG F  1 156 ? -1.961  74.961  186.146 1.00 57.06  ? 156  ARG F N   1 
ATOM   8380  C CA  . ARG F  1 156 ? -3.338  75.123  185.649 1.00 57.82  ? 156  ARG F CA  1 
ATOM   8381  C C   . ARG F  1 156 ? -3.547  74.411  184.308 1.00 57.84  ? 156  ARG F C   1 
ATOM   8382  O O   . ARG F  1 156 ? -4.626  73.897  184.029 1.00 57.93  ? 156  ARG F O   1 
ATOM   8383  C CB  . ARG F  1 156 ? -3.713  76.596  185.410 1.00 58.49  ? 156  ARG F CB  1 
ATOM   8384  C CG  . ARG F  1 156 ? -3.691  77.535  186.584 1.00 60.52  ? 156  ARG F CG  1 
ATOM   8385  C CD  . ARG F  1 156 ? -4.566  78.758  186.217 1.00 64.72  ? 156  ARG F CD  1 
ATOM   8386  N NE  . ARG F  1 156 ? -4.256  80.033  186.903 1.00 67.10  ? 156  ARG F NE  1 
ATOM   8387  C CZ  . ARG F  1 156 ? -4.166  80.224  188.223 1.00 67.63  ? 156  ARG F CZ  1 
ATOM   8388  N NH1 . ARG F  1 156 ? -4.354  79.213  189.093 1.00 67.91  ? 156  ARG F NH1 1 
ATOM   8389  N NH2 . ARG F  1 156 ? -3.886  81.450  188.666 1.00 66.96  ? 156  ARG F NH2 1 
ATOM   8390  N N   . SER F  1 157 ? -2.516  74.419  183.467 1.00 58.11  ? 157  SER F N   1 
ATOM   8391  C CA  . SER F  1 157 ? -2.583  73.820  182.137 1.00 56.82  ? 157  SER F CA  1 
ATOM   8392  C C   . SER F  1 157 ? -2.998  72.357  182.118 1.00 55.57  ? 157  SER F C   1 
ATOM   8393  O O   . SER F  1 157 ? -3.520  71.858  181.127 1.00 54.50  ? 157  SER F O   1 
ATOM   8394  C CB  . SER F  1 157 ? -1.236  73.998  181.450 1.00 57.31  ? 157  SER F CB  1 
ATOM   8395  O OG  . SER F  1 157 ? -0.912  75.379  181.388 1.00 59.07  ? 157  SER F OG  1 
ATOM   8396  N N   . PHE F  1 158 ? -2.777  71.661  183.215 1.00 54.95  ? 158  PHE F N   1 
ATOM   8397  C CA  . PHE F  1 158 ? -3.161  70.272  183.242 1.00 56.05  ? 158  PHE F CA  1 
ATOM   8398  C C   . PHE F  1 158 ? -4.672  70.028  183.385 1.00 56.73  ? 158  PHE F C   1 
ATOM   8399  O O   . PHE F  1 158 ? -5.165  68.953  183.040 1.00 56.53  ? 158  PHE F O   1 
ATOM   8400  C CB  . PHE F  1 158 ? -2.388  69.552  184.331 1.00 56.76  ? 158  PHE F CB  1 
ATOM   8401  C CG  . PHE F  1 158 ? -0.951  69.342  183.990 1.00 57.90  ? 158  PHE F CG  1 
ATOM   8402  C CD1 . PHE F  1 158 ? 0.042   70.035  184.665 1.00 57.75  ? 158  PHE F CD1 1 
ATOM   8403  C CD2 . PHE F  1 158 ? -0.585  68.449  182.978 1.00 58.42  ? 158  PHE F CD2 1 
ATOM   8404  C CE1 . PHE F  1 158 ? 1.374   69.837  184.343 1.00 58.34  ? 158  PHE F CE1 1 
ATOM   8405  C CE2 . PHE F  1 158 ? 0.745   68.247  182.648 1.00 58.23  ? 158  PHE F CE2 1 
ATOM   8406  C CZ  . PHE F  1 158 ? 1.726   68.936  183.327 1.00 58.83  ? 158  PHE F CZ  1 
ATOM   8407  N N   . GLY F  1 159 ? -5.413  71.017  183.876 1.00 57.05  ? 159  GLY F N   1 
ATOM   8408  C CA  . GLY F  1 159 ? -6.849  70.849  183.998 1.00 58.79  ? 159  GLY F CA  1 
ATOM   8409  C C   . GLY F  1 159 ? -7.535  71.631  185.117 1.00 59.37  ? 159  GLY F C   1 
ATOM   8410  O O   . GLY F  1 159 ? -6.896  72.370  185.878 1.00 60.20  ? 159  GLY F O   1 
ATOM   8411  N N   . ASN F  1 160 ? -8.854  71.463  185.222 1.00 58.12  ? 160  ASN F N   1 
ATOM   8412  C CA  . ASN F  1 160 ? -9.626  72.138  186.249 1.00 56.12  ? 160  ASN F CA  1 
ATOM   8413  C C   . ASN F  1 160 ? -9.121  71.726  187.640 1.00 55.50  ? 160  ASN F C   1 
ATOM   8414  O O   . ASN F  1 160 ? -8.867  72.566  188.496 1.00 54.19  ? 160  ASN F O   1 
ATOM   8415  C CB  . ASN F  1 160 ? -11.105 71.770  186.120 1.00 55.62  ? 160  ASN F CB  1 
ATOM   8416  C CG  . ASN F  1 160 ? -11.717 72.236  184.808 1.00 55.94  ? 160  ASN F CG  1 
ATOM   8417  O OD1 . ASN F  1 160 ? -11.562 73.398  184.409 1.00 57.10  ? 160  ASN F OD1 1 
ATOM   8418  N ND2 . ASN F  1 160 ? -12.427 71.340  184.137 1.00 53.01  ? 160  ASN F ND2 1 
ATOM   8419  N N   . ALA F  1 161 ? -8.957  70.427  187.854 1.00 54.27  ? 161  ALA F N   1 
ATOM   8420  C CA  . ALA F  1 161 ? -8.518  69.945  189.144 1.00 53.87  ? 161  ALA F CA  1 
ATOM   8421  C C   . ALA F  1 161 ? -7.246  70.605  189.660 1.00 54.73  ? 161  ALA F C   1 
ATOM   8422  O O   . ALA F  1 161 ? -6.988  70.583  190.863 1.00 55.46  ? 161  ALA F O   1 
ATOM   8423  C CB  . ALA F  1 161 ? -8.339  68.461  189.089 1.00 53.22  ? 161  ALA F CB  1 
ATOM   8424  N N   . LEU F  1 162 ? -6.440  71.186  188.773 1.00 54.74  ? 162  LEU F N   1 
ATOM   8425  C CA  . LEU F  1 162 ? -5.214  71.828  189.215 1.00 53.61  ? 162  LEU F CA  1 
ATOM   8426  C C   . LEU F  1 162 ? -5.317  73.345  189.176 1.00 53.79  ? 162  LEU F C   1 
ATOM   8427  O O   . LEU F  1 162 ? -4.323  74.065  189.316 1.00 54.48  ? 162  LEU F O   1 
ATOM   8428  C CB  . LEU F  1 162 ? -4.040  71.330  188.397 1.00 53.20  ? 162  LEU F CB  1 
ATOM   8429  C CG  . LEU F  1 162 ? -3.268  70.144  188.976 1.00 54.19  ? 162  LEU F CG  1 
ATOM   8430  C CD1 . LEU F  1 162 ? -2.548  70.608  190.219 1.00 55.35  ? 162  LEU F CD1 1 
ATOM   8431  C CD2 . LEU F  1 162 ? -4.172  69.001  189.313 1.00 53.44  ? 162  LEU F CD2 1 
ATOM   8432  N N   . GLY F  1 163 ? -6.528  73.840  188.994 1.00 53.76  ? 163  GLY F N   1 
ATOM   8433  C CA  . GLY F  1 163 ? -6.715  75.270  189.003 1.00 55.78  ? 163  GLY F CA  1 
ATOM   8434  C C   . GLY F  1 163 ? -7.255  75.929  187.761 1.00 58.27  ? 163  GLY F C   1 
ATOM   8435  O O   . GLY F  1 163 ? -7.539  77.128  187.796 1.00 58.96  ? 163  GLY F O   1 
ATOM   8436  N N   . ASN F  1 164 ? -7.418  75.189  186.668 1.00 60.44  ? 164  ASN F N   1 
ATOM   8437  C CA  . ASN F  1 164 ? -7.891  75.821  185.446 1.00 62.82  ? 164  ASN F CA  1 
ATOM   8438  C C   . ASN F  1 164 ? -9.296  76.435  185.529 1.00 65.57  ? 164  ASN F C   1 
ATOM   8439  O O   . ASN F  1 164 ? -9.641  77.340  184.758 1.00 66.96  ? 164  ASN F O   1 
ATOM   8440  C CB  . ASN F  1 164 ? -7.823  74.854  184.281 1.00 60.58  ? 164  ASN F CB  1 
ATOM   8441  C CG  . ASN F  1 164 ? -8.014  75.551  182.972 1.00 58.99  ? 164  ASN F CG  1 
ATOM   8442  O OD1 . ASN F  1 164 ? -8.732  75.062  182.104 1.00 58.35  ? 164  ASN F OD1 1 
ATOM   8443  N ND2 . ASN F  1 164 ? -7.367  76.706  182.812 1.00 58.77  ? 164  ASN F ND2 1 
ATOM   8444  N N   . CYS F  1 165 ? -10.116 75.963  186.459 1.00 68.37  ? 165  CYS F N   1 
ATOM   8445  C CA  . CYS F  1 165 ? -11.466 76.534  186.601 1.00 70.71  ? 165  CYS F CA  1 
ATOM   8446  C C   . CYS F  1 165 ? -11.426 77.977  187.173 1.00 71.35  ? 165  CYS F C   1 
ATOM   8447  O O   . CYS F  1 165 ? -12.116 78.886  186.695 1.00 70.68  ? 165  CYS F O   1 
ATOM   8448  C CB  . CYS F  1 165 ? -12.329 75.616  187.493 1.00 70.80  ? 165  CYS F CB  1 
ATOM   8449  S SG  . CYS F  1 165 ? -11.601 75.128  189.113 1.00 72.28  ? 165  CYS F SG  1 
ATOM   8450  N N   . ILE F  1 166 ? -10.565 78.160  188.167 1.00 72.68  ? 166  ILE F N   1 
ATOM   8451  C CA  . ILE F  1 166 ? -10.363 79.401  188.902 1.00 74.32  ? 166  ILE F CA  1 
ATOM   8452  C C   . ILE F  1 166 ? -10.642 80.750  188.246 1.00 75.08  ? 166  ILE F C   1 
ATOM   8453  O O   . ILE F  1 166 ? -10.999 81.709  188.926 1.00 75.34  ? 166  ILE F O   1 
ATOM   8454  C CB  . ILE F  1 166 ? -8.918  79.413  189.491 1.00 74.87  ? 166  ILE F CB  1 
ATOM   8455  C CG1 . ILE F  1 166 ? -8.956  79.737  190.991 1.00 74.55  ? 166  ILE F CG1 1 
ATOM   8456  C CG2 . ILE F  1 166 ? -8.039  80.392  188.720 1.00 75.47  ? 166  ILE F CG2 1 
ATOM   8457  C CD1 . ILE F  1 166 ? -9.360  81.157  191.318 1.00 74.93  ? 166  ILE F CD1 1 
ATOM   8458  N N   . LEU F  1 167 ? -10.494 80.848  186.940 1.00 76.38  ? 167  LEU F N   1 
ATOM   8459  C CA  . LEU F  1 167 ? -10.701 82.142  186.315 1.00 78.04  ? 167  LEU F CA  1 
ATOM   8460  C C   . LEU F  1 167 ? -11.917 82.146  185.412 1.00 78.36  ? 167  LEU F C   1 
ATOM   8461  O O   . LEU F  1 167 ? -12.183 83.120  184.697 1.00 78.32  ? 167  LEU F O   1 
ATOM   8462  C CB  . LEU F  1 167 ? -9.415  82.568  185.573 1.00 79.04  ? 167  LEU F CB  1 
ATOM   8463  C CG  . LEU F  1 167 ? -8.647  81.598  184.650 1.00 80.24  ? 167  LEU F CG  1 
ATOM   8464  C CD1 . LEU F  1 167 ? -8.520  80.177  185.253 1.00 80.38  ? 167  LEU F CD1 1 
ATOM   8465  C CD2 . LEU F  1 167 ? -9.378  81.533  183.320 1.00 80.69  ? 167  LEU F CD2 1 
ATOM   8466  N N   . ASP F  1 168 ? -12.662 81.045  185.486 1.00 78.97  ? 168  ASP F N   1 
ATOM   8467  C CA  . ASP F  1 168 ? -13.888 80.842  184.709 1.00 79.98  ? 168  ASP F CA  1 
ATOM   8468  C C   . ASP F  1 168 ? -15.028 81.563  185.442 1.00 81.01  ? 168  ASP F C   1 
ATOM   8469  O O   . ASP F  1 168 ? -15.500 81.089  186.473 1.00 81.28  ? 168  ASP F O   1 
ATOM   8470  C CB  . ASP F  1 168 ? -14.168 79.331  184.603 1.00 78.65  ? 168  ASP F CB  1 
ATOM   8471  C CG  . ASP F  1 168 ? -15.498 79.015  183.931 1.00 78.55  ? 168  ASP F CG  1 
ATOM   8472  O OD1 . ASP F  1 168 ? -15.824 77.808  183.828 1.00 77.45  ? 168  ASP F OD1 1 
ATOM   8473  O OD2 . ASP F  1 168 ? -16.211 79.964  183.513 1.00 78.31  ? 168  ASP F OD2 1 
ATOM   8474  N N   . LYS F  1 169 ? -15.471 82.702  184.919 1.00 81.86  ? 169  LYS F N   1 
ATOM   8475  C CA  . LYS F  1 169 ? -16.523 83.469  185.579 1.00 82.96  ? 169  LYS F CA  1 
ATOM   8476  C C   . LYS F  1 169 ? -17.799 82.717  185.943 1.00 83.24  ? 169  LYS F C   1 
ATOM   8477  O O   . LYS F  1 169 ? -18.422 83.036  186.951 1.00 83.69  ? 169  LYS F O   1 
ATOM   8478  C CB  . LYS F  1 169 ? -16.863 84.700  184.746 1.00 83.56  ? 169  LYS F CB  1 
ATOM   8479  C CG  . LYS F  1 169 ? -15.682 85.633  184.613 1.00 85.00  ? 169  LYS F CG  1 
ATOM   8480  C CD  . LYS F  1 169 ? -15.912 86.689  183.552 1.00 86.18  ? 169  LYS F CD  1 
ATOM   8481  C CE  . LYS F  1 169 ? -14.608 87.438  183.253 1.00 86.40  ? 169  LYS F CE  1 
ATOM   8482  N NZ  . LYS F  1 169 ? -14.779 88.457  182.174 1.00 86.21  ? 169  LYS F NZ  1 
ATOM   8483  N N   . ASP F  1 170 ? -18.189 81.722  185.148 1.00 83.52  ? 170  ASP F N   1 
ATOM   8484  C CA  . ASP F  1 170 ? -19.414 80.965  185.446 1.00 83.58  ? 170  ASP F CA  1 
ATOM   8485  C C   . ASP F  1 170 ? -19.212 80.044  186.634 1.00 83.35  ? 170  ASP F C   1 
ATOM   8486  O O   . ASP F  1 170 ? -20.161 79.731  187.357 1.00 83.87  ? 170  ASP F O   1 
ATOM   8487  C CB  . ASP F  1 170 ? -19.872 80.129  184.245 1.00 83.79  ? 170  ASP F CB  1 
ATOM   8488  C CG  . ASP F  1 170 ? -20.261 80.985  183.051 1.00 84.42  ? 170  ASP F CG  1 
ATOM   8489  O OD1 . ASP F  1 170 ? -21.103 81.910  183.210 1.00 83.44  ? 170  ASP F OD1 1 
ATOM   8490  O OD2 . ASP F  1 170 ? -19.714 80.722  181.952 1.00 85.11  ? 170  ASP F OD2 1 
ATOM   8491  N N   . TYR F  1 171 ? -17.975 79.594  186.813 1.00 82.99  ? 171  TYR F N   1 
ATOM   8492  C CA  . TYR F  1 171 ? -17.611 78.730  187.933 1.00 82.52  ? 171  TYR F CA  1 
ATOM   8493  C C   . TYR F  1 171 ? -17.574 79.590  189.205 1.00 83.33  ? 171  TYR F C   1 
ATOM   8494  O O   . TYR F  1 171 ? -18.103 79.193  190.243 1.00 83.02  ? 171  TYR F O   1 
ATOM   8495  C CB  . TYR F  1 171 ? -16.238 78.088  187.677 1.00 80.21  ? 171  TYR F CB  1 
ATOM   8496  C CG  . TYR F  1 171 ? -15.529 77.593  188.922 1.00 77.56  ? 171  TYR F CG  1 
ATOM   8497  C CD1 . TYR F  1 171 ? -15.809 76.338  189.456 1.00 76.01  ? 171  TYR F CD1 1 
ATOM   8498  C CD2 . TYR F  1 171 ? -14.581 78.393  189.574 1.00 76.36  ? 171  TYR F CD2 1 
ATOM   8499  C CE1 . TYR F  1 171 ? -15.160 75.889  190.608 1.00 74.56  ? 171  TYR F CE1 1 
ATOM   8500  C CE2 . TYR F  1 171 ? -13.930 77.951  190.723 1.00 74.98  ? 171  TYR F CE2 1 
ATOM   8501  C CZ  . TYR F  1 171 ? -14.225 76.701  191.232 1.00 74.00  ? 171  TYR F CZ  1 
ATOM   8502  O OH  . TYR F  1 171 ? -13.574 76.254  192.350 1.00 73.37  ? 171  TYR F OH  1 
ATOM   8503  N N   . LEU F  1 172 ? -16.954 80.767  189.110 1.00 84.38  ? 172  LEU F N   1 
ATOM   8504  C CA  . LEU F  1 172 ? -16.864 81.685  190.237 1.00 85.76  ? 172  LEU F CA  1 
ATOM   8505  C C   . LEU F  1 172 ? -18.267 82.052  190.704 1.00 87.08  ? 172  LEU F C   1 
ATOM   8506  O O   . LEU F  1 172 ? -18.578 82.005  191.898 1.00 87.57  ? 172  LEU F O   1 
ATOM   8507  C CB  . LEU F  1 172 ? -16.110 82.948  189.833 1.00 85.31  ? 172  LEU F CB  1 
ATOM   8508  C CG  . LEU F  1 172 ? -14.623 82.716  189.557 1.00 86.03  ? 172  LEU F CG  1 
ATOM   8509  C CD1 . LEU F  1 172 ? -13.978 84.017  189.110 1.00 85.82  ? 172  LEU F CD1 1 
ATOM   8510  C CD2 . LEU F  1 172 ? -13.946 82.175  190.808 1.00 86.31  ? 172  LEU F CD2 1 
ATOM   8511  N N   . ARG F  1 173 ? -19.110 82.403  189.742 1.00 88.21  ? 173  ARG F N   1 
ATOM   8512  C CA  . ARG F  1 173 ? -20.499 82.783  189.993 1.00 89.39  ? 173  ARG F CA  1 
ATOM   8513  C C   . ARG F  1 173 ? -21.248 81.704  190.775 1.00 89.68  ? 173  ARG F C   1 
ATOM   8514  O O   . ARG F  1 173 ? -21.842 81.984  191.816 1.00 89.93  ? 173  ARG F O   1 
ATOM   8515  C CB  . ARG F  1 173 ? -21.189 83.032  188.654 1.00 90.45  ? 173  ARG F CB  1 
ATOM   8516  C CG  . ARG F  1 173 ? -22.434 83.871  188.697 1.00 91.84  ? 173  ARG F CG  1 
ATOM   8517  C CD  . ARG F  1 173 ? -22.661 84.541  187.331 1.00 93.63  ? 173  ARG F CD  1 
ATOM   8518  N NE  . ARG F  1 173 ? -22.532 83.617  186.195 1.00 95.78  ? 173  ARG F NE  1 
ATOM   8519  C CZ  . ARG F  1 173 ? -23.283 82.531  186.013 1.00 96.41  ? 173  ARG F CZ  1 
ATOM   8520  N NH1 . ARG F  1 173 ? -24.227 82.230  186.898 1.00 97.25  ? 173  ARG F NH1 1 
ATOM   8521  N NH2 . ARG F  1 173 ? -23.090 81.744  184.954 1.00 95.68  ? 173  ARG F NH2 1 
ATOM   8522  N N   . SER F  1 174 ? -21.216 80.474  190.278 1.00 89.95  ? 174  SER F N   1 
ATOM   8523  C CA  . SER F  1 174 ? -21.895 79.388  190.949 1.00 90.50  ? 174  SER F CA  1 
ATOM   8524  C C   . SER F  1 174 ? -21.182 78.958  192.243 1.00 91.20  ? 174  SER F C   1 
ATOM   8525  O O   . SER F  1 174 ? -21.692 78.120  192.987 1.00 92.03  ? 174  SER F O   1 
ATOM   8526  C CB  . SER F  1 174 ? -22.036 78.209  189.996 1.00 90.30  ? 174  SER F CB  1 
ATOM   8527  O OG  . SER F  1 174 ? -21.295 77.106  190.471 1.00 90.99  ? 174  SER F OG  1 
ATOM   8528  N N   . LEU F  1 175 ? -20.010 79.525  192.519 1.00 91.37  ? 175  LEU F N   1 
ATOM   8529  C CA  . LEU F  1 175 ? -19.294 79.205  193.758 1.00 92.22  ? 175  LEU F CA  1 
ATOM   8530  C C   . LEU F  1 175 ? -19.871 80.106  194.840 1.00 92.92  ? 175  LEU F C   1 
ATOM   8531  O O   . LEU F  1 175 ? -20.017 79.707  195.994 1.00 92.70  ? 175  LEU F O   1 
ATOM   8532  C CB  . LEU F  1 175 ? -17.803 79.510  193.633 1.00 91.75  ? 175  LEU F CB  1 
ATOM   8533  C CG  . LEU F  1 175 ? -16.742 78.410  193.740 1.00 91.52  ? 175  LEU F CG  1 
ATOM   8534  C CD1 . LEU F  1 175 ? -15.400 79.107  193.909 1.00 91.91  ? 175  LEU F CD1 1 
ATOM   8535  C CD2 . LEU F  1 175 ? -16.983 77.477  194.911 1.00 91.11  ? 175  LEU F CD2 1 
ATOM   8536  N N   . ASN F  1 176 ? -20.181 81.336  194.444 1.00 94.01  ? 176  ASN F N   1 
ATOM   8537  C CA  . ASN F  1 176 ? -20.750 82.334  195.338 1.00 95.54  ? 176  ASN F CA  1 
ATOM   8538  C C   . ASN F  1 176 ? -22.112 81.915  195.863 1.00 96.63  ? 176  ASN F C   1 
ATOM   8539  O O   . ASN F  1 176 ? -22.485 82.253  196.990 1.00 97.14  ? 176  ASN F O   1 
ATOM   8540  C CB  . ASN F  1 176 ? -20.874 83.669  194.612 1.00 95.82  ? 176  ASN F CB  1 
ATOM   8541  C CG  . ASN F  1 176 ? -19.767 84.628  194.985 1.00 96.36  ? 176  ASN F CG  1 
ATOM   8542  O OD1 . ASN F  1 176 ? -19.753 85.173  196.093 1.00 96.27  ? 176  ASN F OD1 1 
ATOM   8543  N ND2 . ASN F  1 176 ? -18.818 84.830  194.070 1.00 96.37  ? 176  ASN F ND2 1 
ATOM   8544  N N   . LYS F  1 177 ? -22.854 81.182  195.038 1.00 97.53  ? 177  LYS F N   1 
ATOM   8545  C CA  . LYS F  1 177 ? -24.179 80.693  195.411 1.00 98.03  ? 177  LYS F CA  1 
ATOM   8546  C C   . LYS F  1 177 ? -24.098 79.476  196.351 1.00 98.38  ? 177  LYS F C   1 
ATOM   8547  O O   . LYS F  1 177 ? -25.021 78.666  196.419 1.00 98.34  ? 177  LYS F O   1 
ATOM   8548  C CB  . LYS F  1 177 ? -24.983 80.328  194.155 1.00 98.45  ? 177  LYS F CB  1 
ATOM   8549  C CG  . LYS F  1 177 ? -25.253 81.502  193.220 1.00 98.98  ? 177  LYS F CG  1 
ATOM   8550  C CD  . LYS F  1 177 ? -25.961 81.069  191.939 1.00 99.57  ? 177  LYS F CD  1 
ATOM   8551  C CE  . LYS F  1 177 ? -26.109 82.251  190.981 1.00 99.89  ? 177  LYS F CE  1 
ATOM   8552  N NZ  . LYS F  1 177 ? -26.662 81.855  189.655 1.00 99.85  ? 177  LYS F NZ  1 
ATOM   8553  N N   . LEU F  1 178 ? -22.972 79.320  197.039 1.00 98.58  ? 178  LEU F N   1 
ATOM   8554  C CA  . LEU F  1 178 ? -22.798 78.233  198.006 1.00 98.73  ? 178  LEU F CA  1 
ATOM   8555  C C   . LEU F  1 178 ? -22.495 79.000  199.289 1.00 99.17  ? 178  LEU F C   1 
ATOM   8556  O O   . LEU F  1 178 ? -21.874 80.060  199.238 1.00 99.18  ? 178  LEU F O   1 
ATOM   8557  C CB  . LEU F  1 178 ? -21.630 77.302  197.613 1.00 98.12  ? 178  LEU F CB  1 
ATOM   8558  C CG  . LEU F  1 178 ? -21.965 76.085  196.730 1.00 97.48  ? 178  LEU F CG  1 
ATOM   8559  C CD1 . LEU F  1 178 ? -20.729 75.568  196.070 1.00 96.68  ? 178  LEU F CD1 1 
ATOM   8560  C CD2 . LEU F  1 178 ? -22.592 74.986  197.558 1.00 97.15  ? 178  LEU F CD2 1 
ATOM   8561  N N   . PRO F  1 179 ? -22.956 78.493  200.447 1.00 99.83  ? 179  PRO F N   1 
ATOM   8562  C CA  . PRO F  1 179 ? -22.802 79.054  201.805 1.00 100.33 ? 179  PRO F CA  1 
ATOM   8563  C C   . PRO F  1 179 ? -21.413 79.441  202.366 1.00 101.14 ? 179  PRO F C   1 
ATOM   8564  O O   . PRO F  1 179 ? -20.401 79.476  201.652 1.00 101.16 ? 179  PRO F O   1 
ATOM   8565  C CB  . PRO F  1 179 ? -23.484 78.004  202.679 1.00 99.56  ? 179  PRO F CB  1 
ATOM   8566  C CG  . PRO F  1 179 ? -24.556 77.490  201.785 1.00 99.55  ? 179  PRO F CG  1 
ATOM   8567  C CD  . PRO F  1 179 ? -23.826 77.303  200.482 1.00 99.55  ? 179  PRO F CD  1 
ATOM   8568  N N   . ARG F  1 180 ? -21.396 79.755  203.661 1.00 101.72 ? 180  ARG F N   1 
ATOM   8569  C CA  . ARG F  1 180 ? -20.172 80.118  204.362 1.00 102.31 ? 180  ARG F CA  1 
ATOM   8570  C C   . ARG F  1 180 ? -19.209 78.933  204.417 1.00 102.21 ? 180  ARG F C   1 
ATOM   8571  O O   . ARG F  1 180 ? -19.585 77.793  204.740 1.00 101.92 ? 180  ARG F O   1 
ATOM   8572  C CB  . ARG F  1 180 ? -20.484 80.560  205.796 1.00 103.96 ? 180  ARG F CB  1 
ATOM   8573  C CG  . ARG F  1 180 ? -20.467 82.063  206.063 1.00 105.59 ? 180  ARG F CG  1 
ATOM   8574  C CD  . ARG F  1 180 ? -20.724 82.317  207.560 1.00 107.12 ? 180  ARG F CD  1 
ATOM   8575  N NE  . ARG F  1 180 ? -20.987 83.725  207.886 1.00 108.74 ? 180  ARG F NE  1 
ATOM   8576  C CZ  . ARG F  1 180 ? -21.468 84.151  209.056 1.00 108.82 ? 180  ARG F CZ  1 
ATOM   8577  N NH1 . ARG F  1 180 ? -21.740 83.277  210.024 1.00 108.74 ? 180  ARG F NH1 1 
ATOM   8578  N NH2 . ARG F  1 180 ? -21.693 85.448  209.256 1.00 108.73 ? 180  ARG F NH2 1 
ATOM   8579  N N   . GLN F  1 181 ? -17.954 79.224  204.105 1.00 102.27 ? 181  GLN F N   1 
ATOM   8580  C CA  . GLN F  1 181 ? -16.899 78.222  204.119 1.00 102.24 ? 181  GLN F CA  1 
ATOM   8581  C C   . GLN F  1 181 ? -16.054 78.363  205.411 1.00 102.34 ? 181  GLN F C   1 
ATOM   8582  O O   . GLN F  1 181 ? -14.899 78.815  205.373 1.00 102.42 ? 181  GLN F O   1 
ATOM   8583  C CB  . GLN F  1 181 ? -16.031 78.391  202.854 1.00 101.66 ? 181  GLN F CB  1 
ATOM   8584  C CG  . GLN F  1 181 ? -14.766 77.553  202.843 1.00 101.26 ? 181  GLN F CG  1 
ATOM   8585  C CD  . GLN F  1 181 ? -15.036 76.083  203.102 1.00 100.93 ? 181  GLN F CD  1 
ATOM   8586  O OE1 . GLN F  1 181 ? -14.176 75.367  203.618 1.00 100.97 ? 181  GLN F OE1 1 
ATOM   8587  N NE2 . GLN F  1 181 ? -16.233 75.622  202.739 1.00 100.60 ? 181  GLN F NE2 1 
ATOM   8588  N N   . LEU F  1 182 ? -16.624 77.980  206.555 1.00 102.02 ? 182  LEU F N   1 
ATOM   8589  C CA  . LEU F  1 182 ? -15.883 78.098  207.811 1.00 101.56 ? 182  LEU F CA  1 
ATOM   8590  C C   . LEU F  1 182 ? -14.609 77.264  207.714 1.00 101.33 ? 182  LEU F C   1 
ATOM   8591  O O   . LEU F  1 182 ? -14.657 76.063  207.401 1.00 101.15 ? 182  LEU F O   1 
ATOM   8592  C CB  . LEU F  1 182 ? -16.717 77.621  209.018 1.00 101.43 ? 182  LEU F CB  1 
ATOM   8593  C CG  . LEU F  1 182 ? -16.537 76.173  209.513 1.00 101.20 ? 182  LEU F CG  1 
ATOM   8594  C CD1 . LEU F  1 182 ? -16.120 76.171  210.994 1.00 100.54 ? 182  LEU F CD1 1 
ATOM   8595  C CD2 . LEU F  1 182 ? -17.828 75.385  209.279 1.00 100.80 ? 182  LEU F CD2 1 
ATOM   8596  N N   . PRO F  1 183 ? -13.449 77.899  207.971 1.00 101.11 ? 183  PRO F N   1 
ATOM   8597  C CA  . PRO F  1 183 ? -12.143 77.228  207.921 1.00 100.35 ? 183  PRO F CA  1 
ATOM   8598  C C   . PRO F  1 183 ? -12.234 75.833  208.520 1.00 99.26  ? 183  PRO F C   1 
ATOM   8599  O O   . PRO F  1 183 ? -12.812 75.653  209.600 1.00 99.58  ? 183  PRO F O   1 
ATOM   8600  C CB  . PRO F  1 183 ? -11.251 78.155  208.746 1.00 100.88 ? 183  PRO F CB  1 
ATOM   8601  C CG  . PRO F  1 183 ? -11.799 79.527  208.396 1.00 101.30 ? 183  PRO F CG  1 
ATOM   8602  C CD  . PRO F  1 183 ? -13.311 79.303  208.417 1.00 101.15 ? 183  PRO F CD  1 
ATOM   8603  N N   . LEU F  1 184 ? -11.687 74.843  207.826 1.00 97.67  ? 184  LEU F N   1 
ATOM   8604  C CA  . LEU F  1 184 ? -11.748 73.502  208.364 1.00 96.37  ? 184  LEU F CA  1 
ATOM   8605  C C   . LEU F  1 184 ? -10.709 73.349  209.481 1.00 95.43  ? 184  LEU F C   1 
ATOM   8606  O O   . LEU F  1 184 ? -9.814  74.196  209.646 1.00 94.46  ? 184  LEU F O   1 
ATOM   8607  C CB  . LEU F  1 184 ? -11.552 72.459  207.251 1.00 96.46  ? 184  LEU F CB  1 
ATOM   8608  C CG  . LEU F  1 184 ? -12.428 71.187  207.319 1.00 96.15  ? 184  LEU F CG  1 
ATOM   8609  C CD1 . LEU F  1 184 ? -11.599 69.977  207.766 1.00 95.65  ? 184  LEU F CD1 1 
ATOM   8610  C CD2 . LEU F  1 184 ? -13.625 71.425  208.250 1.00 95.70  ? 184  LEU F CD2 1 
ATOM   8611  N N   . GLU F  1 185 ? -10.851 72.273  210.255 1.00 94.34  ? 185  GLU F N   1 
ATOM   8612  C CA  . GLU F  1 185 ? -9.968  72.016  211.383 1.00 93.13  ? 185  GLU F CA  1 
ATOM   8613  C C   . GLU F  1 185 ? -8.908  70.978  211.055 1.00 91.76  ? 185  GLU F C   1 
ATOM   8614  O O   . GLU F  1 185 ? -9.197  69.899  210.534 1.00 90.83  ? 185  GLU F O   1 
ATOM   8615  C CB  . GLU F  1 185 ? -10.777 71.542  212.618 1.00 93.91  ? 185  GLU F CB  1 
ATOM   8616  C CG  . GLU F  1 185 ? -12.166 72.202  212.856 1.00 93.68  ? 185  GLU F CG  1 
ATOM   8617  C CD  . GLU F  1 185 ? -12.105 73.719  213.008 1.00 94.13  ? 185  GLU F CD  1 
ATOM   8618  O OE1 . GLU F  1 185 ? -11.259 74.206  213.798 1.00 94.31  ? 185  GLU F OE1 1 
ATOM   8619  O OE2 . GLU F  1 185 ? -12.908 74.419  212.339 1.00 93.54  ? 185  GLU F OE2 1 
ATOM   8620  N N   . VAL F  1 186 ? -7.676  71.318  211.399 1.00 90.69  ? 186  VAL F N   1 
ATOM   8621  C CA  . VAL F  1 186 ? -6.535  70.450  211.169 1.00 89.98  ? 186  VAL F CA  1 
ATOM   8622  C C   . VAL F  1 186 ? -6.285  69.601  212.421 1.00 89.68  ? 186  VAL F C   1 
ATOM   8623  O O   . VAL F  1 186 ? -5.705  70.085  213.396 1.00 89.09  ? 186  VAL F O   1 
ATOM   8624  C CB  . VAL F  1 186 ? -5.288  71.309  210.894 1.00 89.81  ? 186  VAL F CB  1 
ATOM   8625  C CG1 . VAL F  1 186 ? -4.269  70.523  210.100 1.00 89.90  ? 186  VAL F CG1 1 
ATOM   8626  C CG2 . VAL F  1 186 ? -5.695  72.583  210.181 1.00 89.10  ? 186  VAL F CG2 1 
ATOM   8627  N N   . ASP F  1 187 ? -6.712  68.341  212.414 1.00 89.74  ? 187  ASP F N   1 
ATOM   8628  C CA  . ASP F  1 187 ? -6.486  67.503  213.597 1.00 89.73  ? 187  ASP F CA  1 
ATOM   8629  C C   . ASP F  1 187 ? -5.052  66.951  213.714 1.00 88.79  ? 187  ASP F C   1 
ATOM   8630  O O   . ASP F  1 187 ? -4.729  65.847  213.249 1.00 88.12  ? 187  ASP F O   1 
ATOM   8631  C CB  . ASP F  1 187 ? -7.482  66.339  213.652 1.00 91.02  ? 187  ASP F CB  1 
ATOM   8632  C CG  . ASP F  1 187 ? -7.195  65.385  214.815 1.00 92.19  ? 187  ASP F CG  1 
ATOM   8633  O OD1 . ASP F  1 187 ? -7.690  64.233  214.782 1.00 92.93  ? 187  ASP F OD1 1 
ATOM   8634  O OD2 . ASP F  1 187 ? -6.474  65.793  215.761 1.00 92.86  ? 187  ASP F OD2 1 
ATOM   8635  N N   . LEU F  1 188 ? -4.206  67.721  214.379 1.00 87.98  ? 188  LEU F N   1 
ATOM   8636  C CA  . LEU F  1 188 ? -2.815  67.347  214.565 1.00 87.63  ? 188  LEU F CA  1 
ATOM   8637  C C   . LEU F  1 188 ? -2.583  66.059  215.359 1.00 87.64  ? 188  LEU F C   1 
ATOM   8638  O O   . LEU F  1 188 ? -1.454  65.784  215.758 1.00 87.82  ? 188  LEU F O   1 
ATOM   8639  C CB  . LEU F  1 188 ? -2.083  68.498  215.246 1.00 86.77  ? 188  LEU F CB  1 
ATOM   8640  C CG  . LEU F  1 188 ? -2.441  69.884  214.709 1.00 86.41  ? 188  LEU F CG  1 
ATOM   8641  C CD1 . LEU F  1 188 ? -1.680  70.971  215.477 1.00 85.49  ? 188  LEU F CD1 1 
ATOM   8642  C CD2 . LEU F  1 188 ? -2.111  69.927  213.217 1.00 87.00  ? 188  LEU F CD2 1 
ATOM   8643  N N   . THR F  1 189 ? -3.623  65.260  215.579 1.00 87.88  ? 189  THR F N   1 
ATOM   8644  C CA  . THR F  1 189 ? -3.445  64.033  216.358 1.00 88.60  ? 189  THR F CA  1 
ATOM   8645  C C   . THR F  1 189 ? -2.259  63.198  215.896 1.00 88.64  ? 189  THR F C   1 
ATOM   8646  O O   . THR F  1 189 ? -1.201  63.202  216.527 1.00 88.26  ? 189  THR F O   1 
ATOM   8647  C CB  . THR F  1 189 ? -4.708  63.108  216.338 1.00 89.00  ? 189  THR F CB  1 
ATOM   8648  O OG1 . THR F  1 189 ? -5.829  63.793  216.919 1.00 88.29  ? 189  THR F OG1 1 
ATOM   8649  C CG2 . THR F  1 189 ? -4.435  61.798  217.145 1.00 88.61  ? 189  THR F CG2 1 
ATOM   8650  N N   . LYS F  1 190 ? -2.443  62.488  214.788 1.00 89.33  ? 190  LYS F N   1 
ATOM   8651  C CA  . LYS F  1 190 ? -1.401  61.615  214.248 1.00 90.08  ? 190  LYS F CA  1 
ATOM   8652  C C   . LYS F  1 190 ? -0.327  62.337  213.397 1.00 89.83  ? 190  LYS F C   1 
ATOM   8653  O O   . LYS F  1 190 ? 0.219   61.785  212.427 1.00 89.29  ? 190  LYS F O   1 
ATOM   8654  C CB  . LYS F  1 190 ? -2.065  60.475  213.455 1.00 90.63  ? 190  LYS F CB  1 
ATOM   8655  C CG  . LYS F  1 190 ? -2.960  59.557  214.310 1.00 91.00  ? 190  LYS F CG  1 
ATOM   8656  C CD  . LYS F  1 190 ? -3.433  58.334  213.508 1.00 91.72  ? 190  LYS F CD  1 
ATOM   8657  C CE  . LYS F  1 190 ? -3.948  57.190  214.410 1.00 91.75  ? 190  LYS F CE  1 
ATOM   8658  N NZ  . LYS F  1 190 ? -4.059  55.868  213.697 1.00 90.96  ? 190  LYS F NZ  1 
ATOM   8659  N N   . ALA F  1 191 ? -0.024  63.572  213.795 1.00 89.51  ? 191  ALA F N   1 
ATOM   8660  C CA  . ALA F  1 191 ? 0.971   64.393  213.126 1.00 89.49  ? 191  ALA F CA  1 
ATOM   8661  C C   . ALA F  1 191 ? 2.354   63.755  213.200 1.00 89.72  ? 191  ALA F C   1 
ATOM   8662  O O   . ALA F  1 191 ? 2.519   62.663  213.747 1.00 89.75  ? 191  ALA F O   1 
ATOM   8663  C CB  . ALA F  1 191 ? 1.004   65.763  213.758 1.00 88.85  ? 191  ALA F CB  1 
ATOM   8664  N N   . LYS F  1 192 ? 3.343   64.442  212.636 1.00 89.94  ? 192  LYS F N   1 
ATOM   8665  C CA  . LYS F  1 192 ? 4.712   63.951  212.641 1.00 90.15  ? 192  LYS F CA  1 
ATOM   8666  C C   . LYS F  1 192 ? 5.398   64.429  213.911 1.00 90.04  ? 192  LYS F C   1 
ATOM   8667  O O   . LYS F  1 192 ? 5.407   65.624  214.192 1.00 90.13  ? 192  LYS F O   1 
ATOM   8668  C CB  . LYS F  1 192 ? 5.469   64.462  211.408 1.00 90.38  ? 192  LYS F CB  1 
ATOM   8669  C CG  . LYS F  1 192 ? 6.982   64.291  211.517 1.00 90.98  ? 192  LYS F CG  1 
ATOM   8670  C CD  . LYS F  1 192 ? 7.646   64.100  210.171 1.00 91.06  ? 192  LYS F CD  1 
ATOM   8671  C CE  . LYS F  1 192 ? 7.355   62.717  209.595 1.00 91.37  ? 192  LYS F CE  1 
ATOM   8672  N NZ  . LYS F  1 192 ? 8.514   61.779  209.722 1.00 90.92  ? 192  LYS F NZ  1 
ATOM   8673  N N   . ARG F  1 193 ? 5.972   63.501  214.675 1.00 90.05  ? 193  ARG F N   1 
ATOM   8674  C CA  . ARG F  1 193 ? 6.652   63.864  215.925 1.00 90.00  ? 193  ARG F CA  1 
ATOM   8675  C C   . ARG F  1 193 ? 8.128   63.493  215.904 1.00 88.88  ? 193  ARG F C   1 
ATOM   8676  O O   . ARG F  1 193 ? 8.945   64.064  216.631 1.00 88.00  ? 193  ARG F O   1 
ATOM   8677  C CB  . ARG F  1 193 ? 5.967   63.183  217.123 1.00 91.25  ? 193  ARG F CB  1 
ATOM   8678  C CG  . ARG F  1 193 ? 4.501   63.565  217.270 1.00 93.04  ? 193  ARG F CG  1 
ATOM   8679  C CD  . ARG F  1 193 ? 3.893   63.170  218.622 1.00 94.02  ? 193  ARG F CD  1 
ATOM   8680  N NE  . ARG F  1 193 ? 2.490   63.589  218.685 1.00 94.25  ? 193  ARG F NE  1 
ATOM   8681  C CZ  . ARG F  1 193 ? 2.083   64.859  218.706 1.00 94.28  ? 193  ARG F CZ  1 
ATOM   8682  N NH1 . ARG F  1 193 ? 2.974   65.850  218.684 1.00 93.86  ? 193  ARG F NH1 1 
ATOM   8683  N NH2 . ARG F  1 193 ? 0.781   65.138  218.710 1.00 93.76  ? 193  ARG F NH2 1 
ATOM   8684  N N   . GLN F  1 194 ? 8.459   62.531  215.055 1.00 88.07  ? 194  GLN F N   1 
ATOM   8685  C CA  . GLN F  1 194 ? 9.824   62.068  214.938 1.00 87.36  ? 194  GLN F CA  1 
ATOM   8686  C C   . GLN F  1 194 ? 10.297  62.140  213.497 1.00 85.93  ? 194  GLN F C   1 
ATOM   8687  O O   . GLN F  1 194 ? 9.518   62.350  212.573 1.00 85.23  ? 194  GLN F O   1 
ATOM   8688  C CB  . GLN F  1 194 ? 9.907   60.624  215.412 1.00 88.49  ? 194  GLN F CB  1 
ATOM   8689  C CG  . GLN F  1 194 ? 9.176   60.363  216.715 1.00 91.04  ? 194  GLN F CG  1 
ATOM   8690  C CD  . GLN F  1 194 ? 9.058   58.873  217.022 1.00 92.67  ? 194  GLN F CD  1 
ATOM   8691  O OE1 . GLN F  1 194 ? 8.661   58.471  218.131 1.00 92.82  ? 194  GLN F OE1 1 
ATOM   8692  N NE2 . GLN F  1 194 ? 9.398   58.043  216.033 1.00 93.35  ? 194  GLN F NE2 1 
ATOM   8693  N N   . ASP F  1 195 ? 11.593  61.969  213.312 1.00 84.63  ? 195  ASP F N   1 
ATOM   8694  C CA  . ASP F  1 195 ? 12.146  61.972  211.976 1.00 83.13  ? 195  ASP F CA  1 
ATOM   8695  C C   . ASP F  1 195 ? 11.942  60.561  211.383 1.00 82.06  ? 195  ASP F C   1 
ATOM   8696  O O   . ASP F  1 195 ? 11.151  60.372  210.464 1.00 82.10  ? 195  ASP F O   1 
ATOM   8697  C CB  . ASP F  1 195 ? 13.635  62.346  212.033 1.00 82.63  ? 195  ASP F CB  1 
ATOM   8698  C CG  . ASP F  1 195 ? 13.861  63.842  212.290 1.00 82.54  ? 195  ASP F CG  1 
ATOM   8699  O OD1 . ASP F  1 195 ? 15.020  64.237  212.574 1.00 82.15  ? 195  ASP F OD1 1 
ATOM   8700  O OD2 . ASP F  1 195 ? 12.885  64.624  212.196 1.00 81.75  ? 195  ASP F OD2 1 
ATOM   8701  N N   . LEU F  1 196 ? 12.634  59.574  211.935 1.00 80.87  ? 196  LEU F N   1 
ATOM   8702  C CA  . LEU F  1 196 ? 12.560  58.192  211.463 1.00 79.81  ? 196  LEU F CA  1 
ATOM   8703  C C   . LEU F  1 196 ? 11.195  57.716  210.922 1.00 79.80  ? 196  LEU F C   1 
ATOM   8704  O O   . LEU F  1 196 ? 10.162  57.985  211.529 1.00 80.26  ? 196  LEU F O   1 
ATOM   8705  C CB  . LEU F  1 196 ? 13.047  57.284  212.594 1.00 78.18  ? 196  LEU F CB  1 
ATOM   8706  C CG  . LEU F  1 196 ? 13.003  55.773  212.439 1.00 76.97  ? 196  LEU F CG  1 
ATOM   8707  C CD1 . LEU F  1 196 ? 11.593  55.321  212.534 1.00 77.20  ? 196  LEU F CD1 1 
ATOM   8708  C CD2 . LEU F  1 196 ? 13.603  55.343  211.137 1.00 77.41  ? 196  LEU F CD2 1 
ATOM   8709  N N   . GLU F  1 197 ? 11.207  57.017  209.777 1.00 79.85  ? 197  GLU F N   1 
ATOM   8710  C CA  . GLU F  1 197 ? 9.999   56.459  209.105 1.00 79.24  ? 197  GLU F CA  1 
ATOM   8711  C C   . GLU F  1 197 ? 10.247  54.976  208.769 1.00 80.43  ? 197  GLU F C   1 
ATOM   8712  O O   . GLU F  1 197 ? 10.783  54.657  207.707 1.00 79.80  ? 197  GLU F O   1 
ATOM   8713  C CB  . GLU F  1 197 ? 9.722   57.214  207.811 1.00 77.14  ? 197  GLU F CB  1 
ATOM   8714  C CG  . GLU F  1 197 ? 9.222   58.634  208.010 1.00 74.80  ? 197  GLU F CG  1 
ATOM   8715  C CD  . GLU F  1 197 ? 7.719   58.701  208.044 1.00 73.09  ? 197  GLU F CD  1 
ATOM   8716  O OE1 . GLU F  1 197 ? 7.092   57.635  207.863 1.00 72.58  ? 197  GLU F OE1 1 
ATOM   8717  O OE2 . GLU F  1 197 ? 7.167   59.803  208.240 1.00 70.88  ? 197  GLU F OE2 1 
ATOM   8718  N N   . PRO F  1 198 ? 9.831   54.054  209.669 1.00 81.70  ? 198  PRO F N   1 
ATOM   8719  C CA  . PRO F  1 198 ? 9.975   52.587  209.583 1.00 82.27  ? 198  PRO F CA  1 
ATOM   8720  C C   . PRO F  1 198 ? 9.480   51.847  208.343 1.00 83.04  ? 198  PRO F C   1 
ATOM   8721  O O   . PRO F  1 198 ? 10.244  51.063  207.755 1.00 83.09  ? 198  PRO F O   1 
ATOM   8722  C CB  . PRO F  1 198 ? 9.275   52.087  210.849 1.00 82.00  ? 198  PRO F CB  1 
ATOM   8723  C CG  . PRO F  1 198 ? 9.340   53.268  211.784 1.00 81.73  ? 198  PRO F CG  1 
ATOM   8724  C CD  . PRO F  1 198 ? 9.033   54.413  210.855 1.00 81.43  ? 198  PRO F CD  1 
ATOM   8725  N N   . SER F  1 199 ? 8.209   52.062  207.972 1.00 83.50  ? 199  SER F N   1 
ATOM   8726  C CA  . SER F  1 199 ? 7.604   51.400  206.793 1.00 83.33  ? 199  SER F CA  1 
ATOM   8727  C C   . SER F  1 199 ? 8.379   51.818  205.555 1.00 83.09  ? 199  SER F C   1 
ATOM   8728  O O   . SER F  1 199 ? 8.682   51.001  204.679 1.00 82.60  ? 199  SER F O   1 
ATOM   8729  C CB  . SER F  1 199 ? 6.136   51.814  206.615 1.00 83.25  ? 199  SER F CB  1 
ATOM   8730  O OG  . SER F  1 199 ? 6.026   53.190  206.255 1.00 83.22  ? 199  SER F OG  1 
ATOM   8731  N N   . VAL F  1 200 ? 8.681   53.112  205.508 1.00 82.72  ? 200  VAL F N   1 
ATOM   8732  C CA  . VAL F  1 200 ? 9.432   53.699  204.421 1.00 82.39  ? 200  VAL F CA  1 
ATOM   8733  C C   . VAL F  1 200 ? 10.795  53.019  204.404 1.00 82.32  ? 200  VAL F C   1 
ATOM   8734  O O   . VAL F  1 200 ? 11.195  52.435  203.397 1.00 82.33  ? 200  VAL F O   1 
ATOM   8735  C CB  . VAL F  1 200 ? 9.623   55.210  204.657 1.00 82.30  ? 200  VAL F CB  1 
ATOM   8736  C CG1 . VAL F  1 200 ? 10.281  55.835  203.460 1.00 82.59  ? 200  VAL F CG1 1 
ATOM   8737  C CG2 . VAL F  1 200 ? 8.284   55.875  204.942 1.00 82.59  ? 200  VAL F CG2 1 
ATOM   8738  N N   . GLU F  1 201 ? 11.484  53.085  205.543 1.00 82.25  ? 201  GLU F N   1 
ATOM   8739  C CA  . GLU F  1 201 ? 12.809  52.498  205.705 1.00 82.43  ? 201  GLU F CA  1 
ATOM   8740  C C   . GLU F  1 201 ? 12.843  51.011  205.357 1.00 82.39  ? 201  GLU F C   1 
ATOM   8741  O O   . GLU F  1 201 ? 13.881  50.475  204.958 1.00 81.94  ? 201  GLU F O   1 
ATOM   8742  C CB  . GLU F  1 201 ? 13.300  52.700  207.146 1.00 82.42  ? 201  GLU F CB  1 
ATOM   8743  C CG  . GLU F  1 201 ? 14.737  52.205  207.406 1.00 82.59  ? 201  GLU F CG  1 
ATOM   8744  C CD  . GLU F  1 201 ? 15.817  53.144  206.871 1.00 82.55  ? 201  GLU F CD  1 
ATOM   8745  O OE1 . GLU F  1 201 ? 16.998  52.743  206.840 1.00 82.80  ? 201  GLU F OE1 1 
ATOM   8746  O OE2 . GLU F  1 201 ? 15.495  54.289  206.497 1.00 82.79  ? 201  GLU F OE2 1 
ATOM   8747  N N   . GLU F  1 202 ? 11.706  50.343  205.500 1.00 82.90  ? 202  GLU F N   1 
ATOM   8748  C CA  . GLU F  1 202 ? 11.654  48.924  205.204 1.00 83.53  ? 202  GLU F CA  1 
ATOM   8749  C C   . GLU F  1 202 ? 11.557  48.678  203.707 1.00 83.68  ? 202  GLU F C   1 
ATOM   8750  O O   . GLU F  1 202 ? 12.255  47.807  203.168 1.00 84.17  ? 202  GLU F O   1 
ATOM   8751  C CB  . GLU F  1 202 ? 10.481  48.254  205.917 1.00 83.95  ? 202  GLU F CB  1 
ATOM   8752  C CG  . GLU F  1 202 ? 10.800  46.811  206.303 1.00 84.58  ? 202  GLU F CG  1 
ATOM   8753  C CD  . GLU F  1 202 ? 9.570   45.978  206.619 1.00 84.50  ? 202  GLU F CD  1 
ATOM   8754  O OE1 . GLU F  1 202 ? 8.864   45.563  205.669 1.00 83.22  ? 202  GLU F OE1 1 
ATOM   8755  O OE2 . GLU F  1 202 ? 9.316   45.742  207.823 1.00 85.10  ? 202  GLU F OE2 1 
ATOM   8756  N N   . ALA F  1 203 ? 10.698  49.433  203.028 1.00 83.55  ? 203  ALA F N   1 
ATOM   8757  C CA  . ALA F  1 203 ? 10.569  49.268  201.587 1.00 83.87  ? 203  ALA F CA  1 
ATOM   8758  C C   . ALA F  1 203 ? 11.951  49.511  200.983 1.00 84.59  ? 203  ALA F C   1 
ATOM   8759  O O   . ALA F  1 203 ? 12.434  48.737  200.144 1.00 84.04  ? 203  ALA F O   1 
ATOM   8760  C CB  . ALA F  1 203 ? 9.573   50.265  201.030 1.00 82.92  ? 203  ALA F CB  1 
ATOM   8761  N N   . ARG F  1 204 ? 12.590  50.581  201.457 1.00 85.48  ? 204  ARG F N   1 
ATOM   8762  C CA  . ARG F  1 204 ? 13.909  50.991  200.991 1.00 86.63  ? 204  ARG F CA  1 
ATOM   8763  C C   . ARG F  1 204 ? 14.986  49.929  201.108 1.00 89.25  ? 204  ARG F C   1 
ATOM   8764  O O   . ARG F  1 204 ? 15.803  49.792  200.207 1.00 89.68  ? 204  ARG F O   1 
ATOM   8765  C CB  . ARG F  1 204 ? 14.369  52.248  201.728 1.00 84.14  ? 204  ARG F CB  1 
ATOM   8766  C CG  . ARG F  1 204 ? 14.839  53.320  200.793 1.00 81.06  ? 204  ARG F CG  1 
ATOM   8767  C CD  . ARG F  1 204 ? 16.041  54.057  201.304 1.00 79.08  ? 204  ARG F CD  1 
ATOM   8768  N NE  . ARG F  1 204 ? 15.789  54.987  202.401 1.00 77.78  ? 204  ARG F NE  1 
ATOM   8769  C CZ  . ARG F  1 204 ? 14.708  55.749  202.532 1.00 77.74  ? 204  ARG F CZ  1 
ATOM   8770  N NH1 . ARG F  1 204 ? 14.614  56.574  203.565 1.00 77.76  ? 204  ARG F NH1 1 
ATOM   8771  N NH2 . ARG F  1 204 ? 13.699  55.668  201.669 1.00 78.32  ? 204  ARG F NH2 1 
ATOM   8772  N N   . TYR F  1 205 ? 15.009  49.191  202.213 1.00 92.71  ? 205  TYR F N   1 
ATOM   8773  C CA  . TYR F  1 205 ? 16.019  48.152  202.384 1.00 96.07  ? 205  TYR F CA  1 
ATOM   8774  C C   . TYR F  1 205 ? 15.650  46.968  201.495 1.00 97.81  ? 205  TYR F C   1 
ATOM   8775  O O   . TYR F  1 205 ? 16.489  46.103  201.198 1.00 97.65  ? 205  TYR F O   1 
ATOM   8776  C CB  . TYR F  1 205 ? 16.111  47.705  203.855 1.00 97.08  ? 205  TYR F CB  1 
ATOM   8777  C CG  . TYR F  1 205 ? 17.168  46.635  204.088 1.00 97.87  ? 205  TYR F CG  1 
ATOM   8778  C CD1 . TYR F  1 205 ? 18.520  46.910  203.876 1.00 97.62  ? 205  TYR F CD1 1 
ATOM   8779  C CD2 . TYR F  1 205 ? 16.808  45.321  204.443 1.00 98.29  ? 205  TYR F CD2 1 
ATOM   8780  C CE1 . TYR F  1 205 ? 19.496  45.905  203.999 1.00 97.74  ? 205  TYR F CE1 1 
ATOM   8781  C CE2 . TYR F  1 205 ? 17.780  44.303  204.571 1.00 98.05  ? 205  TYR F CE2 1 
ATOM   8782  C CZ  . TYR F  1 205 ? 19.126  44.603  204.341 1.00 97.81  ? 205  TYR F CZ  1 
ATOM   8783  O OH  . TYR F  1 205 ? 20.097  43.618  204.409 1.00 96.49  ? 205  TYR F OH  1 
ATOM   8784  N N   . ASN F  1 206 ? 14.388  46.948  201.065 1.00 99.94  ? 206  ASN F N   1 
ATOM   8785  C CA  . ASN F  1 206 ? 13.887  45.884  200.201 1.00 102.31 ? 206  ASN F CA  1 
ATOM   8786  C C   . ASN F  1 206 ? 13.938  46.241  198.723 1.00 103.61 ? 206  ASN F C   1 
ATOM   8787  O O   . ASN F  1 206 ? 13.844  45.357  197.862 1.00 103.58 ? 206  ASN F O   1 
ATOM   8788  C CB  . ASN F  1 206 ? 12.458  45.503  200.589 1.00 102.34 ? 206  ASN F CB  1 
ATOM   8789  C CG  . ASN F  1 206 ? 12.395  44.790  201.921 1.00 102.51 ? 206  ASN F CG  1 
ATOM   8790  O OD1 . ASN F  1 206 ? 13.214  43.908  202.207 1.00 102.22 ? 206  ASN F OD1 1 
ATOM   8791  N ND2 . ASN F  1 206 ? 11.419  45.159  202.744 1.00 102.34 ? 206  ASN F ND2 1 
ATOM   8792  N N   . SER F  1 207 ? 14.071  47.534  198.429 1.00 105.45 ? 207  SER F N   1 
ATOM   8793  C CA  . SER F  1 207 ? 14.167  47.985  197.043 1.00 107.33 ? 207  SER F CA  1 
ATOM   8794  C C   . SER F  1 207 ? 15.640  47.881  196.605 1.00 108.52 ? 207  SER F C   1 
ATOM   8795  O O   . SER F  1 207 ? 15.951  47.919  195.406 1.00 108.61 ? 207  SER F O   1 
ATOM   8796  C CB  . SER F  1 207 ? 13.616  49.422  196.884 1.00 107.22 ? 207  SER F CB  1 
ATOM   8797  O OG  . SER F  1 207 ? 14.305  50.379  197.674 1.00 107.68 ? 207  SER F OG  1 
ATOM   8798  N N   . CYS F  1 208 ? 16.531  47.728  197.592 1.00 109.82 ? 208  CYS F N   1 
ATOM   8799  C CA  . CYS F  1 208 ? 17.972  47.562  197.355 1.00 111.43 ? 208  CYS F CA  1 
ATOM   8800  C C   . CYS F  1 208 ? 18.217  46.140  196.847 1.00 112.70 ? 208  CYS F C   1 
ATOM   8801  O O   . CYS F  1 208 ? 19.371  45.717  196.657 1.00 112.93 ? 208  CYS F O   1 
ATOM   8802  C CB  . CYS F  1 208 ? 18.768  47.764  198.652 1.00 111.12 ? 208  CYS F CB  1 
ATOM   8803  S SG  . CYS F  1 208 ? 19.182  49.477  199.064 1.00 110.83 ? 208  CYS F SG  1 
ATOM   8804  N N   . ARG F  1 209 ? 17.104  45.426  196.643 1.00 113.99 ? 209  ARG F N   1 
ATOM   8805  C CA  . ARG F  1 209 ? 17.070  44.038  196.167 1.00 114.95 ? 209  ARG F CA  1 
ATOM   8806  C C   . ARG F  1 209 ? 16.252  43.932  194.866 1.00 115.17 ? 209  ARG F C   1 
ATOM   8807  O O   . ARG F  1 209 ? 15.017  44.061  194.866 1.00 115.18 ? 209  ARG F O   1 
ATOM   8808  C CB  . ARG F  1 209 ? 16.431  43.131  197.236 1.00 115.74 ? 209  ARG F CB  1 
ATOM   8809  C CG  . ARG F  1 209 ? 17.112  43.156  198.619 1.00 116.46 ? 209  ARG F CG  1 
ATOM   8810  C CD  . ARG F  1 209 ? 16.211  42.512  199.671 1.00 116.72 ? 209  ARG F CD  1 
ATOM   8811  N NE  . ARG F  1 209 ? 16.813  42.481  201.000 1.00 116.82 ? 209  ARG F NE  1 
ATOM   8812  C CZ  . ARG F  1 209 ? 16.181  42.036  202.080 1.00 117.03 ? 209  ARG F CZ  1 
ATOM   8813  N NH1 . ARG F  1 209 ? 14.935  41.595  201.979 1.00 116.58 ? 209  ARG F NH1 1 
ATOM   8814  N NH2 . ARG F  1 209 ? 16.792  42.020  203.256 1.00 117.21 ? 209  ARG F NH2 1 
ATOM   8815  N N   . LEU G  1 24  ? 22.816  52.345  187.185 1.00 77.20  ? 24   LEU G N   1 
ATOM   8816  C CA  . LEU G  1 24  ? 21.723  52.410  188.221 1.00 77.28  ? 24   LEU G CA  1 
ATOM   8817  C C   . LEU G  1 24  ? 22.041  53.383  189.395 1.00 76.65  ? 24   LEU G C   1 
ATOM   8818  O O   . LEU G  1 24  ? 21.607  53.204  190.545 1.00 76.79  ? 24   LEU G O   1 
ATOM   8819  C CB  . LEU G  1 24  ? 21.449  51.004  188.754 1.00 76.84  ? 24   LEU G CB  1 
ATOM   8820  C CG  . LEU G  1 24  ? 19.941  50.749  188.870 1.00 78.14  ? 24   LEU G CG  1 
ATOM   8821  C CD1 . LEU G  1 24  ? 19.301  51.697  189.881 1.00 77.94  ? 24   LEU G CD1 1 
ATOM   8822  C CD2 . LEU G  1 24  ? 19.298  50.958  187.502 1.00 78.07  ? 24   LEU G CD2 1 
ATOM   8823  N N   . CYS G  1 25  ? 22.796  54.426  189.059 1.00 75.38  ? 25   CYS G N   1 
ATOM   8824  C CA  . CYS G  1 25  ? 23.237  55.457  189.986 1.00 73.10  ? 25   CYS G CA  1 
ATOM   8825  C C   . CYS G  1 25  ? 22.161  56.514  190.271 1.00 70.50  ? 25   CYS G C   1 
ATOM   8826  O O   . CYS G  1 25  ? 21.023  56.405  189.830 1.00 69.18  ? 25   CYS G O   1 
ATOM   8827  C CB  . CYS G  1 25  ? 24.477  56.123  189.392 1.00 74.67  ? 25   CYS G CB  1 
ATOM   8828  S SG  . CYS G  1 25  ? 24.170  56.711  187.717 1.00 78.48  ? 25   CYS G SG  1 
ATOM   8829  N N   . PHE G  1 26  ? 22.544  57.543  191.012 1.00 68.41  ? 26   PHE G N   1 
ATOM   8830  C CA  . PHE G  1 26  ? 21.628  58.606  191.354 1.00 66.91  ? 26   PHE G CA  1 
ATOM   8831  C C   . PHE G  1 26  ? 21.059  59.252  190.108 1.00 67.24  ? 26   PHE G C   1 
ATOM   8832  O O   . PHE G  1 26  ? 21.790  59.542  189.168 1.00 66.89  ? 26   PHE G O   1 
ATOM   8833  C CB  . PHE G  1 26  ? 22.335  59.673  192.170 1.00 65.46  ? 26   PHE G CB  1 
ATOM   8834  C CG  . PHE G  1 26  ? 21.406  60.640  192.782 1.00 63.65  ? 26   PHE G CG  1 
ATOM   8835  C CD1 . PHE G  1 26  ? 20.831  60.361  194.005 1.00 63.34  ? 26   PHE G CD1 1 
ATOM   8836  C CD2 . PHE G  1 26  ? 21.047  61.803  192.109 1.00 64.12  ? 26   PHE G CD2 1 
ATOM   8837  C CE1 . PHE G  1 26  ? 19.903  61.218  194.568 1.00 64.21  ? 26   PHE G CE1 1 
ATOM   8838  C CE2 . PHE G  1 26  ? 20.112  62.685  192.651 1.00 64.05  ? 26   PHE G CE2 1 
ATOM   8839  C CZ  . PHE G  1 26  ? 19.535  62.392  193.889 1.00 64.92  ? 26   PHE G CZ  1 
ATOM   8840  N N   . GLY G  1 27  ? 19.753  59.492  190.117 1.00 67.42  ? 27   GLY G N   1 
ATOM   8841  C CA  . GLY G  1 27  ? 19.095  60.118  188.986 1.00 67.46  ? 27   GLY G CA  1 
ATOM   8842  C C   . GLY G  1 27  ? 18.527  59.106  188.015 1.00 68.42  ? 27   GLY G C   1 
ATOM   8843  O O   . GLY G  1 27  ? 17.750  59.443  187.126 1.00 68.21  ? 27   GLY G O   1 
ATOM   8844  N N   . GLN G  1 28  ? 18.907  57.851  188.193 1.00 69.71  ? 28   GLN G N   1 
ATOM   8845  C CA  . GLN G  1 28  ? 18.443  56.792  187.314 1.00 71.22  ? 28   GLN G CA  1 
ATOM   8846  C C   . GLN G  1 28  ? 17.722  55.661  187.993 1.00 72.09  ? 28   GLN G C   1 
ATOM   8847  O O   . GLN G  1 28  ? 17.509  54.616  187.388 1.00 72.39  ? 28   GLN G O   1 
ATOM   8848  C CB  . GLN G  1 28  ? 19.608  56.200  186.561 1.00 71.44  ? 28   GLN G CB  1 
ATOM   8849  C CG  . GLN G  1 28  ? 20.191  57.117  185.539 1.00 71.69  ? 28   GLN G CG  1 
ATOM   8850  C CD  . GLN G  1 28  ? 21.487  56.564  184.992 1.00 71.89  ? 28   GLN G CD  1 
ATOM   8851  O OE1 . GLN G  1 28  ? 22.049  57.121  184.051 1.00 73.43  ? 28   GLN G OE1 1 
ATOM   8852  N NE2 . GLN G  1 28  ? 21.979  55.465  185.587 1.00 69.82  ? 28   GLN G NE2 1 
ATOM   8853  N N   . CYS G  1 29  ? 17.386  55.830  189.258 1.00 73.19  ? 29   CYS G N   1 
ATOM   8854  C CA  . CYS G  1 29  ? 16.648  54.791  189.931 1.00 74.42  ? 29   CYS G CA  1 
ATOM   8855  C C   . CYS G  1 29  ? 15.202  55.019  189.592 1.00 74.97  ? 29   CYS G C   1 
ATOM   8856  O O   . CYS G  1 29  ? 14.806  56.092  189.112 1.00 75.34  ? 29   CYS G O   1 
ATOM   8857  C CB  . CYS G  1 29  ? 16.809  54.895  191.433 1.00 74.59  ? 29   CYS G CB  1 
ATOM   8858  S SG  . CYS G  1 29  ? 18.415  54.383  191.958 1.00 78.28  ? 29   CYS G SG  1 
ATOM   8859  N N   . GLN G  1 30  ? 14.409  53.991  189.820 1.00 75.06  ? 30   GLN G N   1 
ATOM   8860  C CA  . GLN G  1 30  ? 12.988  54.104  189.615 1.00 74.98  ? 30   GLN G CA  1 
ATOM   8861  C C   . GLN G  1 30  ? 12.488  53.565  190.949 1.00 74.63  ? 30   GLN G C   1 
ATOM   8862  O O   . GLN G  1 30  ? 13.018  52.566  191.454 1.00 74.63  ? 30   GLN G O   1 
ATOM   8863  C CB  . GLN G  1 30  ? 12.542  53.236  188.454 1.00 74.92  ? 30   GLN G CB  1 
ATOM   8864  C CG  . GLN G  1 30  ? 11.129  53.541  188.021 1.00 76.21  ? 30   GLN G CG  1 
ATOM   8865  C CD  . GLN G  1 30  ? 10.563  52.495  187.059 1.00 76.30  ? 30   GLN G CD  1 
ATOM   8866  O OE1 . GLN G  1 30  ? 9.352   52.448  186.828 1.00 76.41  ? 30   GLN G OE1 1 
ATOM   8867  N NE2 . GLN G  1 30  ? 11.437  51.658  186.492 1.00 75.64  ? 30   GLN G NE2 1 
ATOM   8868  N N   . TYR G  1 31  ? 11.522  54.244  191.555 1.00 74.16  ? 31   TYR G N   1 
ATOM   8869  C CA  . TYR G  1 31  ? 11.028  53.776  192.836 1.00 73.78  ? 31   TYR G CA  1 
ATOM   8870  C C   . TYR G  1 31  ? 10.253  52.493  192.678 1.00 73.86  ? 31   TYR G C   1 
ATOM   8871  O O   . TYR G  1 31  ? 9.476   52.345  191.730 1.00 74.18  ? 31   TYR G O   1 
ATOM   8872  C CB  . TYR G  1 31  ? 10.129  54.815  193.494 1.00 73.20  ? 31   TYR G CB  1 
ATOM   8873  C CG  . TYR G  1 31  ? 10.891  55.905  194.200 1.00 72.99  ? 31   TYR G CG  1 
ATOM   8874  C CD1 . TYR G  1 31  ? 11.055  57.155  193.609 1.00 72.85  ? 31   TYR G CD1 1 
ATOM   8875  C CD2 . TYR G  1 31  ? 11.470  55.682  195.452 1.00 72.67  ? 31   TYR G CD2 1 
ATOM   8876  C CE1 . TYR G  1 31  ? 11.780  58.159  194.243 1.00 72.54  ? 31   TYR G CE1 1 
ATOM   8877  C CE2 . TYR G  1 31  ? 12.196  56.682  196.095 1.00 72.18  ? 31   TYR G CE2 1 
ATOM   8878  C CZ  . TYR G  1 31  ? 12.346  57.918  195.480 1.00 72.00  ? 31   TYR G CZ  1 
ATOM   8879  O OH  . TYR G  1 31  ? 13.053  58.921  196.087 1.00 70.86  ? 31   TYR G OH  1 
ATOM   8880  N N   . THR G  1 32  ? 10.489  51.558  193.596 1.00 73.94  ? 32   THR G N   1 
ATOM   8881  C CA  . THR G  1 32  ? 9.769   50.294  193.594 1.00 73.21  ? 32   THR G CA  1 
ATOM   8882  C C   . THR G  1 32  ? 8.375   50.650  194.081 1.00 73.49  ? 32   THR G C   1 
ATOM   8883  O O   . THR G  1 32  ? 8.191   51.656  194.765 1.00 72.87  ? 32   THR G O   1 
ATOM   8884  C CB  . THR G  1 32  ? 10.392  49.309  194.565 1.00 72.68  ? 32   THR G CB  1 
ATOM   8885  O OG1 . THR G  1 32  ? 10.308  49.831  195.899 1.00 72.18  ? 32   THR G OG1 1 
ATOM   8886  C CG2 . THR G  1 32  ? 11.849  49.088  194.208 1.00 72.46  ? 32   THR G CG2 1 
ATOM   8887  N N   . ALA G  1 33  ? 7.384   49.848  193.727 1.00 74.43  ? 33   ALA G N   1 
ATOM   8888  C CA  . ALA G  1 33  ? 6.018   50.143  194.162 1.00 75.39  ? 33   ALA G CA  1 
ATOM   8889  C C   . ALA G  1 33  ? 5.930   50.304  195.687 1.00 75.64  ? 33   ALA G C   1 
ATOM   8890  O O   . ALA G  1 33  ? 5.245   51.199  196.209 1.00 75.41  ? 33   ALA G O   1 
ATOM   8891  C CB  . ALA G  1 33  ? 5.087   49.038  193.697 1.00 75.09  ? 33   ALA G CB  1 
ATOM   8892  N N   . GLU G  1 34  ? 6.652   49.442  196.397 1.00 75.89  ? 34   GLU G N   1 
ATOM   8893  C CA  . GLU G  1 34  ? 6.627   49.481  197.846 1.00 75.66  ? 34   GLU G CA  1 
ATOM   8894  C C   . GLU G  1 34  ? 7.190   50.785  198.425 1.00 72.79  ? 34   GLU G C   1 
ATOM   8895  O O   . GLU G  1 34  ? 6.544   51.412  199.264 1.00 72.48  ? 34   GLU G O   1 
ATOM   8896  C CB  . GLU G  1 34  ? 7.356   48.258  198.424 1.00 78.93  ? 34   GLU G CB  1 
ATOM   8897  C CG  . GLU G  1 34  ? 6.806   47.850  199.808 1.00 84.61  ? 34   GLU G CG  1 
ATOM   8898  C CD  . GLU G  1 34  ? 7.741   46.911  200.613 1.00 88.31  ? 34   GLU G CD  1 
ATOM   8899  O OE1 . GLU G  1 34  ? 7.649   46.899  201.878 1.00 88.84  ? 34   GLU G OE1 1 
ATOM   8900  O OE2 . GLU G  1 34  ? 8.556   46.181  199.983 1.00 90.91  ? 34   GLU G OE2 1 
ATOM   8901  N N   . GLU G  1 35  ? 8.373   51.204  197.984 1.00 69.79  ? 35   GLU G N   1 
ATOM   8902  C CA  . GLU G  1 35  ? 8.950   52.442  198.500 1.00 66.75  ? 35   GLU G CA  1 
ATOM   8903  C C   . GLU G  1 35  ? 8.119   53.654  198.073 1.00 64.86  ? 35   GLU G C   1 
ATOM   8904  O O   . GLU G  1 35  ? 7.888   54.574  198.849 1.00 63.44  ? 35   GLU G O   1 
ATOM   8905  C CB  . GLU G  1 35  ? 10.402  52.604  198.038 1.00 66.69  ? 35   GLU G CB  1 
ATOM   8906  C CG  . GLU G  1 35  ? 11.096  53.778  198.702 1.00 66.88  ? 35   GLU G CG  1 
ATOM   8907  C CD  . GLU G  1 35  ? 12.581  53.881  198.372 1.00 67.86  ? 35   GLU G CD  1 
ATOM   8908  O OE1 . GLU G  1 35  ? 13.209  54.846  198.876 1.00 68.98  ? 35   GLU G OE1 1 
ATOM   8909  O OE2 . GLU G  1 35  ? 13.115  53.012  197.630 1.00 66.64  ? 35   GLU G OE2 1 
ATOM   8910  N N   . TYR G  1 36  ? 7.665   53.650  196.830 1.00 64.01  ? 36   TYR G N   1 
ATOM   8911  C CA  . TYR G  1 36  ? 6.854   54.750  196.326 1.00 63.53  ? 36   TYR G CA  1 
ATOM   8912  C C   . TYR G  1 36  ? 5.641   54.927  197.232 1.00 64.73  ? 36   TYR G C   1 
ATOM   8913  O O   . TYR G  1 36  ? 5.344   56.031  197.714 1.00 64.46  ? 36   TYR G O   1 
ATOM   8914  C CB  . TYR G  1 36  ? 6.350   54.461  194.900 1.00 61.06  ? 36   TYR G CB  1 
ATOM   8915  C CG  . TYR G  1 36  ? 5.103   55.262  194.590 1.00 58.43  ? 36   TYR G CG  1 
ATOM   8916  C CD1 . TYR G  1 36  ? 5.167   56.646  194.458 1.00 57.74  ? 36   TYR G CD1 1 
ATOM   8917  C CD2 . TYR G  1 36  ? 3.845   54.669  194.620 1.00 56.25  ? 36   TYR G CD2 1 
ATOM   8918  C CE1 . TYR G  1 36  ? 4.018   57.415  194.388 1.00 56.39  ? 36   TYR G CE1 1 
ATOM   8919  C CE2 . TYR G  1 36  ? 2.696   55.433  194.554 1.00 55.70  ? 36   TYR G CE2 1 
ATOM   8920  C CZ  . TYR G  1 36  ? 2.784   56.805  194.450 1.00 55.87  ? 36   TYR G CZ  1 
ATOM   8921  O OH  . TYR G  1 36  ? 1.634   57.577  194.505 1.00 56.43  ? 36   TYR G OH  1 
ATOM   8922  N N   . GLN G  1 37  ? 4.927   53.823  197.447 1.00 66.16  ? 37   GLN G N   1 
ATOM   8923  C CA  . GLN G  1 37  ? 3.723   53.858  198.267 1.00 67.13  ? 37   GLN G CA  1 
ATOM   8924  C C   . GLN G  1 37  ? 3.972   54.353  199.691 1.00 66.73  ? 37   GLN G C   1 
ATOM   8925  O O   . GLN G  1 37  ? 3.233   55.212  200.200 1.00 65.75  ? 37   GLN G O   1 
ATOM   8926  C CB  . GLN G  1 37  ? 3.067   52.482  198.305 1.00 67.87  ? 37   GLN G CB  1 
ATOM   8927  C CG  . GLN G  1 37  ? 1.675   52.531  198.923 1.00 70.55  ? 37   GLN G CG  1 
ATOM   8928  C CD  . GLN G  1 37  ? 1.200   51.166  199.404 1.00 72.34  ? 37   GLN G CD  1 
ATOM   8929  O OE1 . GLN G  1 37  ? 0.644   50.371  198.637 1.00 73.95  ? 37   GLN G OE1 1 
ATOM   8930  N NE2 . GLN G  1 37  ? 1.433   50.879  200.684 1.00 73.14  ? 37   GLN G NE2 1 
ATOM   8931  N N   . ALA G  1 38  ? 5.012   53.811  200.324 1.00 66.39  ? 38   ALA G N   1 
ATOM   8932  C CA  . ALA G  1 38  ? 5.359   54.201  201.681 1.00 66.56  ? 38   ALA G CA  1 
ATOM   8933  C C   . ALA G  1 38  ? 5.613   55.700  201.776 1.00 66.98  ? 38   ALA G C   1 
ATOM   8934  O O   . ALA G  1 38  ? 5.104   56.373  202.685 1.00 67.46  ? 38   ALA G O   1 
ATOM   8935  C CB  . ALA G  1 38  ? 6.584   53.438  202.144 1.00 65.56  ? 38   ALA G CB  1 
ATOM   8936  N N   . ILE G  1 39  ? 6.396   56.220  200.832 1.00 67.21  ? 39   ILE G N   1 
ATOM   8937  C CA  . ILE G  1 39  ? 6.729   57.640  200.819 1.00 67.23  ? 39   ILE G CA  1 
ATOM   8938  C C   . ILE G  1 39  ? 5.527   58.525  200.502 1.00 66.86  ? 39   ILE G C   1 
ATOM   8939  O O   . ILE G  1 39  ? 5.342   59.565  201.146 1.00 64.87  ? 39   ILE G O   1 
ATOM   8940  C CB  . ILE G  1 39  ? 7.902   57.925  199.826 1.00 67.83  ? 39   ILE G CB  1 
ATOM   8941  C CG1 . ILE G  1 39  ? 9.189   57.282  200.361 1.00 67.41  ? 39   ILE G CG1 1 
ATOM   8942  C CG2 . ILE G  1 39  ? 8.111   59.436  199.661 1.00 68.07  ? 39   ILE G CG2 1 
ATOM   8943  C CD1 . ILE G  1 39  ? 10.384  57.356  199.435 1.00 66.43  ? 39   ILE G CD1 1 
ATOM   8944  N N   . GLN G  1 40  ? 4.717   58.120  199.523 1.00 67.89  ? 40   GLN G N   1 
ATOM   8945  C CA  . GLN G  1 40  ? 3.538   58.908  199.161 1.00 70.23  ? 40   GLN G CA  1 
ATOM   8946  C C   . GLN G  1 40  ? 2.721   59.183  200.424 1.00 71.26  ? 40   GLN G C   1 
ATOM   8947  O O   . GLN G  1 40  ? 2.309   60.329  200.689 1.00 71.74  ? 40   GLN G O   1 
ATOM   8948  C CB  . GLN G  1 40  ? 2.651   58.159  198.159 1.00 71.16  ? 40   GLN G CB  1 
ATOM   8949  C CG  . GLN G  1 40  ? 2.430   58.841  196.803 1.00 72.56  ? 40   GLN G CG  1 
ATOM   8950  C CD  . GLN G  1 40  ? 1.848   60.246  196.867 1.00 73.76  ? 40   GLN G CD  1 
ATOM   8951  O OE1 . GLN G  1 40  ? 0.994   60.607  196.050 1.00 74.52  ? 40   GLN G OE1 1 
ATOM   8952  N NE2 . GLN G  1 40  ? 2.322   61.056  197.816 1.00 75.92  ? 40   GLN G NE2 1 
ATOM   8953  N N   . LYS G  1 41  ? 2.485   58.118  201.193 1.00 71.81  ? 41   LYS G N   1 
ATOM   8954  C CA  . LYS G  1 41  ? 1.732   58.218  202.432 1.00 71.39  ? 41   LYS G CA  1 
ATOM   8955  C C   . LYS G  1 41  ? 2.462   59.070  203.465 1.00 71.17  ? 41   LYS G C   1 
ATOM   8956  O O   . LYS G  1 41  ? 1.899   60.055  203.959 1.00 70.79  ? 41   LYS G O   1 
ATOM   8957  C CB  . LYS G  1 41  ? 1.463   56.823  202.982 1.00 71.71  ? 41   LYS G CB  1 
ATOM   8958  C CG  . LYS G  1 41  ? 0.427   56.076  202.179 1.00 72.36  ? 41   LYS G CG  1 
ATOM   8959  C CD  . LYS G  1 41  ? 0.292   54.639  202.636 1.00 73.69  ? 41   LYS G CD  1 
ATOM   8960  C CE  . LYS G  1 41  ? -0.742  53.890  201.791 1.00 75.43  ? 41   LYS G CE  1 
ATOM   8961  N NZ  . LYS G  1 41  ? -0.771  52.427  202.122 1.00 76.98  ? 41   LYS G NZ  1 
ATOM   8962  N N   . ALA G  1 42  ? 3.714   58.714  203.765 1.00 70.82  ? 42   ALA G N   1 
ATOM   8963  C CA  . ALA G  1 42  ? 4.500   59.455  204.754 1.00 70.81  ? 42   ALA G CA  1 
ATOM   8964  C C   . ALA G  1 42  ? 4.542   60.966  204.501 1.00 70.92  ? 42   ALA G C   1 
ATOM   8965  O O   . ALA G  1 42  ? 4.505   61.761  205.438 1.00 70.75  ? 42   ALA G O   1 
ATOM   8966  C CB  . ALA G  1 42  ? 5.922   58.892  204.822 1.00 70.25  ? 42   ALA G CB  1 
ATOM   8967  N N   . LEU G  1 43  ? 4.610   61.358  203.234 1.00 71.20  ? 43   LEU G N   1 
ATOM   8968  C CA  . LEU G  1 43  ? 4.687   62.766  202.886 1.00 71.83  ? 43   LEU G CA  1 
ATOM   8969  C C   . LEU G  1 43  ? 3.443   63.566  203.244 1.00 71.91  ? 43   LEU G C   1 
ATOM   8970  O O   . LEU G  1 43  ? 3.503   64.788  203.448 1.00 71.59  ? 43   LEU G O   1 
ATOM   8971  C CB  . LEU G  1 43  ? 5.013   62.909  201.389 1.00 73.27  ? 43   LEU G CB  1 
ATOM   8972  C CG  . LEU G  1 43  ? 6.462   62.547  201.018 1.00 73.22  ? 43   LEU G CG  1 
ATOM   8973  C CD1 . LEU G  1 43  ? 6.633   62.564  199.522 1.00 73.38  ? 43   LEU G CD1 1 
ATOM   8974  C CD2 . LEU G  1 43  ? 7.427   63.531  201.680 1.00 73.03  ? 43   LEU G CD2 1 
ATOM   8975  N N   . ARG G  1 44  ? 2.317   62.872  203.334 1.00 72.05  ? 44   ARG G N   1 
ATOM   8976  C CA  . ARG G  1 44  ? 1.068   63.527  203.672 1.00 72.36  ? 44   ARG G CA  1 
ATOM   8977  C C   . ARG G  1 44  ? 1.014   64.099  205.114 1.00 72.75  ? 44   ARG G C   1 
ATOM   8978  O O   . ARG G  1 44  ? 0.391   65.142  205.359 1.00 72.57  ? 44   ARG G O   1 
ATOM   8979  C CB  . ARG G  1 44  ? -0.087  62.553  203.440 1.00 72.02  ? 44   ARG G CB  1 
ATOM   8980  C CG  . ARG G  1 44  ? -0.337  62.263  201.974 1.00 72.45  ? 44   ARG G CG  1 
ATOM   8981  C CD  . ARG G  1 44  ? -1.702  61.641  201.742 1.00 71.41  ? 44   ARG G CD  1 
ATOM   8982  N NE  . ARG G  1 44  ? -1.632  60.191  201.576 1.00 70.68  ? 44   ARG G NE  1 
ATOM   8983  C CZ  . ARG G  1 44  ? -1.684  59.568  200.401 1.00 70.57  ? 44   ARG G CZ  1 
ATOM   8984  N NH1 . ARG G  1 44  ? -1.803  60.258  199.278 1.00 70.56  ? 44   ARG G NH1 1 
ATOM   8985  N NH2 . ARG G  1 44  ? -1.630  58.248  200.343 1.00 70.04  ? 44   ARG G NH2 1 
ATOM   8986  N N   . GLN G  1 45  ? 1.683   63.436  206.058 1.00 72.39  ? 45   GLN G N   1 
ATOM   8987  C CA  . GLN G  1 45  ? 1.679   63.873  207.453 1.00 72.18  ? 45   GLN G CA  1 
ATOM   8988  C C   . GLN G  1 45  ? 2.030   65.339  207.669 1.00 73.36  ? 45   GLN G C   1 
ATOM   8989  O O   . GLN G  1 45  ? 2.902   65.868  207.002 1.00 73.84  ? 45   GLN G O   1 
ATOM   8990  C CB  . GLN G  1 45  ? 2.663   63.045  208.263 1.00 70.28  ? 45   GLN G CB  1 
ATOM   8991  C CG  . GLN G  1 45  ? 2.493   61.563  208.132 1.00 69.93  ? 45   GLN G CG  1 
ATOM   8992  C CD  . GLN G  1 45  ? 3.624   60.811  208.793 1.00 69.83  ? 45   GLN G CD  1 
ATOM   8993  O OE1 . GLN G  1 45  ? 3.607   59.585  208.868 1.00 70.95  ? 45   GLN G OE1 1 
ATOM   8994  N NE2 . GLN G  1 45  ? 4.621   61.543  209.273 1.00 69.43  ? 45   GLN G NE2 1 
ATOM   8995  N N   . ARG G  1 46  ? 1.342   65.999  208.602 1.00 74.92  ? 46   ARG G N   1 
ATOM   8996  C CA  . ARG G  1 46  ? 1.670   67.388  208.950 1.00 75.90  ? 46   ARG G CA  1 
ATOM   8997  C C   . ARG G  1 46  ? 2.681   67.193  210.077 1.00 76.48  ? 46   ARG G C   1 
ATOM   8998  O O   . ARG G  1 46  ? 2.709   66.133  210.705 1.00 77.09  ? 46   ARG G O   1 
ATOM   8999  C CB  . ARG G  1 46  ? 0.467   68.126  209.510 1.00 75.66  ? 46   ARG G CB  1 
ATOM   9000  C CG  . ARG G  1 46  ? -0.787  67.913  208.718 1.00 76.49  ? 46   ARG G CG  1 
ATOM   9001  C CD  . ARG G  1 46  ? -1.265  69.211  208.201 1.00 76.52  ? 46   ARG G CD  1 
ATOM   9002  N NE  . ARG G  1 46  ? -2.611  69.092  207.686 1.00 77.48  ? 46   ARG G NE  1 
ATOM   9003  C CZ  . ARG G  1 46  ? -3.126  69.923  206.791 1.00 78.58  ? 46   ARG G CZ  1 
ATOM   9004  N NH1 . ARG G  1 46  ? -2.388  70.926  206.312 1.00 78.52  ? 46   ARG G NH1 1 
ATOM   9005  N NH2 . ARG G  1 46  ? -4.381  69.758  206.384 1.00 79.04  ? 46   ARG G NH2 1 
ATOM   9006  N N   . LEU G  1 47  ? 3.524   68.171  210.360 1.00 76.78  ? 47   LEU G N   1 
ATOM   9007  C CA  . LEU G  1 47  ? 4.465   67.900  211.425 1.00 77.16  ? 47   LEU G CA  1 
ATOM   9008  C C   . LEU G  1 47  ? 4.066   68.469  212.764 1.00 77.44  ? 47   LEU G C   1 
ATOM   9009  O O   . LEU G  1 47  ? 3.414   69.512  212.857 1.00 77.28  ? 47   LEU G O   1 
ATOM   9010  C CB  . LEU G  1 47  ? 5.906   68.311  211.058 1.00 76.68  ? 47   LEU G CB  1 
ATOM   9011  C CG  . LEU G  1 47  ? 6.365   69.205  209.912 1.00 75.57  ? 47   LEU G CG  1 
ATOM   9012  C CD1 . LEU G  1 47  ? 7.809   68.885  209.653 1.00 75.30  ? 47   LEU G CD1 1 
ATOM   9013  C CD2 . LEU G  1 47  ? 5.608   68.929  208.662 1.00 76.05  ? 47   LEU G CD2 1 
ATOM   9014  N N   . GLY G  1 48  ? 4.458   67.741  213.803 1.00 77.91  ? 48   GLY G N   1 
ATOM   9015  C CA  . GLY G  1 48  ? 4.151   68.132  215.163 1.00 78.61  ? 48   GLY G CA  1 
ATOM   9016  C C   . GLY G  1 48  ? 4.842   69.403  215.623 1.00 78.70  ? 48   GLY G C   1 
ATOM   9017  O O   . GLY G  1 48  ? 5.692   69.962  214.917 1.00 79.70  ? 48   GLY G O   1 
ATOM   9018  N N   . PRO G  1 49  ? 4.495   69.882  216.825 1.00 77.75  ? 49   PRO G N   1 
ATOM   9019  C CA  . PRO G  1 49  ? 5.060   71.093  217.417 1.00 76.12  ? 49   PRO G CA  1 
ATOM   9020  C C   . PRO G  1 49  ? 6.565   70.985  217.590 1.00 74.80  ? 49   PRO G C   1 
ATOM   9021  O O   . PRO G  1 49  ? 7.265   71.999  217.626 1.00 74.00  ? 49   PRO G O   1 
ATOM   9022  C CB  . PRO G  1 49  ? 4.355   71.179  218.766 1.00 77.02  ? 49   PRO G CB  1 
ATOM   9023  C CG  . PRO G  1 49  ? 3.080   70.396  218.552 1.00 77.77  ? 49   PRO G CG  1 
ATOM   9024  C CD  . PRO G  1 49  ? 3.547   69.237  217.748 1.00 77.65  ? 49   PRO G CD  1 
ATOM   9025  N N   . GLU G  1 50  ? 7.071   69.762  217.707 1.00 73.58  ? 50   GLU G N   1 
ATOM   9026  C CA  . GLU G  1 50  ? 8.499   69.604  217.905 1.00 73.72  ? 50   GLU G CA  1 
ATOM   9027  C C   . GLU G  1 50  ? 9.346   70.046  216.718 1.00 74.39  ? 50   GLU G C   1 
ATOM   9028  O O   . GLU G  1 50  ? 10.582  70.099  216.804 1.00 75.28  ? 50   GLU G O   1 
ATOM   9029  C CB  . GLU G  1 50  ? 8.866   68.168  218.311 1.00 73.36  ? 50   GLU G CB  1 
ATOM   9030  C CG  . GLU G  1 50  ? 8.068   67.037  217.687 1.00 74.81  ? 50   GLU G CG  1 
ATOM   9031  C CD  . GLU G  1 50  ? 6.691   66.847  218.327 1.00 75.13  ? 50   GLU G CD  1 
ATOM   9032  O OE1 . GLU G  1 50  ? 5.724   67.504  217.875 1.00 74.63  ? 50   GLU G OE1 1 
ATOM   9033  O OE2 . GLU G  1 50  ? 6.583   66.046  219.290 1.00 74.64  ? 50   GLU G OE2 1 
ATOM   9034  N N   . TYR G  1 51  ? 8.691   70.394  215.613 1.00 73.79  ? 51   TYR G N   1 
ATOM   9035  C CA  . TYR G  1 51  ? 9.410   70.830  214.426 1.00 72.51  ? 51   TYR G CA  1 
ATOM   9036  C C   . TYR G  1 51  ? 9.359   72.331  214.223 1.00 72.51  ? 51   TYR G C   1 
ATOM   9037  O O   . TYR G  1 51  ? 10.325  72.951  213.760 1.00 73.11  ? 51   TYR G O   1 
ATOM   9038  C CB  . TYR G  1 51  ? 8.827   70.157  213.191 1.00 71.21  ? 51   TYR G CB  1 
ATOM   9039  C CG  . TYR G  1 51  ? 9.224   68.718  213.049 1.00 69.79  ? 51   TYR G CG  1 
ATOM   9040  C CD1 . TYR G  1 51  ? 8.346   67.696  213.382 1.00 69.08  ? 51   TYR G CD1 1 
ATOM   9041  C CD2 . TYR G  1 51  ? 10.500  68.374  212.609 1.00 69.63  ? 51   TYR G CD2 1 
ATOM   9042  C CE1 . TYR G  1 51  ? 8.731   66.370  213.281 1.00 68.54  ? 51   TYR G CE1 1 
ATOM   9043  C CE2 . TYR G  1 51  ? 10.894  67.047  212.514 1.00 68.82  ? 51   TYR G CE2 1 
ATOM   9044  C CZ  . TYR G  1 51  ? 10.006  66.057  212.849 1.00 68.27  ? 51   TYR G CZ  1 
ATOM   9045  O OH  . TYR G  1 51  ? 10.404  64.747  212.749 1.00 69.70  ? 51   TYR G OH  1 
ATOM   9046  N N   . ILE G  1 52  ? 8.225   72.908  214.582 1.00 72.25  ? 52   ILE G N   1 
ATOM   9047  C CA  . ILE G  1 52  ? 7.990   74.328  214.390 1.00 72.43  ? 52   ILE G CA  1 
ATOM   9048  C C   . ILE G  1 52  ? 8.626   75.261  215.409 1.00 74.07  ? 52   ILE G C   1 
ATOM   9049  O O   . ILE G  1 52  ? 8.572   75.012  216.610 1.00 76.01  ? 52   ILE G O   1 
ATOM   9050  C CB  . ILE G  1 52  ? 6.473   74.608  214.374 1.00 70.91  ? 52   ILE G CB  1 
ATOM   9051  C CG1 . ILE G  1 52  ? 5.749   73.494  213.611 1.00 69.93  ? 52   ILE G CG1 1 
ATOM   9052  C CG2 . ILE G  1 52  ? 6.197   75.972  213.769 1.00 70.09  ? 52   ILE G CG2 1 
ATOM   9053  C CD1 . ILE G  1 52  ? 6.266   73.241  212.216 1.00 69.31  ? 52   ILE G CD1 1 
ATOM   9054  N N   . SER G  1 53  ? 9.241   76.332  214.924 1.00 74.97  ? 53   SER G N   1 
ATOM   9055  C CA  . SER G  1 53  ? 9.828   77.338  215.792 1.00 75.66  ? 53   SER G CA  1 
ATOM   9056  C C   . SER G  1 53  ? 9.330   78.686  215.292 1.00 76.79  ? 53   SER G C   1 
ATOM   9057  O O   . SER G  1 53  ? 8.645   78.741  214.283 1.00 76.55  ? 53   SER G O   1 
ATOM   9058  C CB  . SER G  1 53  ? 11.364  77.244  215.816 1.00 75.58  ? 53   SER G CB  1 
ATOM   9059  O OG  . SER G  1 53  ? 11.943  77.037  214.548 1.00 74.56  ? 53   SER G OG  1 
ATOM   9060  N N   . SER G  1 54  ? 9.622   79.770  215.995 1.00 79.44  ? 54   SER G N   1 
ATOM   9061  C CA  . SER G  1 54  ? 9.113   81.063  215.553 1.00 83.03  ? 54   SER G CA  1 
ATOM   9062  C C   . SER G  1 54  ? 9.981   82.219  215.951 1.00 85.37  ? 54   SER G C   1 
ATOM   9063  O O   . SER G  1 54  ? 10.831  82.102  216.824 1.00 85.17  ? 54   SER G O   1 
ATOM   9064  C CB  . SER G  1 54  ? 7.706   81.311  216.103 1.00 83.51  ? 54   SER G CB  1 
ATOM   9065  O OG  . SER G  1 54  ? 7.690   81.221  217.523 1.00 84.50  ? 54   SER G OG  1 
ATOM   9066  N N   . ARG G  1 55  ? 9.749   83.342  215.292 1.00 89.02  ? 55   ARG G N   1 
ATOM   9067  C CA  . ARG G  1 55  ? 10.501  84.554  215.549 1.00 93.29  ? 55   ARG G CA  1 
ATOM   9068  C C   . ARG G  1 55  ? 9.558   85.725  215.406 1.00 95.56  ? 55   ARG G C   1 
ATOM   9069  O O   . ARG G  1 55  ? 8.425   85.574  214.942 1.00 95.50  ? 55   ARG G O   1 
ATOM   9070  C CB  . ARG G  1 55  ? 11.653  84.715  214.546 1.00 94.82  ? 55   ARG G CB  1 
ATOM   9071  C CG  . ARG G  1 55  ? 11.207  84.818  213.082 1.00 97.33  ? 55   ARG G CG  1 
ATOM   9072  C CD  . ARG G  1 55  ? 12.309  85.366  212.150 1.00 99.18  ? 55   ARG G CD  1 
ATOM   9073  N NE  . ARG G  1 55  ? 11.963  85.202  210.729 1.00 101.27 ? 55   ARG G NE  1 
ATOM   9074  C CZ  . ARG G  1 55  ? 12.075  84.057  210.043 1.00 102.39 ? 55   ARG G CZ  1 
ATOM   9075  N NH1 . ARG G  1 55  ? 12.537  82.955  210.631 1.00 102.83 ? 55   ARG G NH1 1 
ATOM   9076  N NH2 . ARG G  1 55  ? 11.709  84.002  208.763 1.00 102.61 ? 55   ARG G NH2 1 
ATOM   9077  N N   . MET G  1 56  ? 10.039  86.896  215.802 1.00 98.87  ? 56   MET G N   1 
ATOM   9078  C CA  . MET G  1 56  ? 9.245   88.113  215.718 1.00 102.40 ? 56   MET G CA  1 
ATOM   9079  C C   . MET G  1 56  ? 9.496   88.902  214.444 1.00 103.72 ? 56   MET G C   1 
ATOM   9080  O O   . MET G  1 56  ? 10.618  89.345  214.172 1.00 103.82 ? 56   MET G O   1 
ATOM   9081  C CB  . MET G  1 56  ? 9.503   89.020  216.932 1.00 103.78 ? 56   MET G CB  1 
ATOM   9082  C CG  . MET G  1 56  ? 8.532   88.788  218.086 1.00 105.87 ? 56   MET G CG  1 
ATOM   9083  S SD  . MET G  1 56  ? 6.770   88.804  217.559 1.00 108.09 ? 56   MET G SD  1 
ATOM   9084  C CE  . MET G  1 56  ? 6.338   86.980  217.809 1.00 108.07 ? 56   MET G CE  1 
ATOM   9085  N N   . ALA G  1 57  ? 8.437   89.081  213.666 1.00 105.45 ? 57   ALA G N   1 
ATOM   9086  C CA  . ALA G  1 57  ? 8.544   89.835  212.428 1.00 107.42 ? 57   ALA G CA  1 
ATOM   9087  C C   . ALA G  1 57  ? 8.603   91.301  212.818 1.00 108.43 ? 57   ALA G C   1 
ATOM   9088  O O   . ALA G  1 57  ? 8.249   91.665  213.949 1.00 108.54 ? 57   ALA G O   1 
ATOM   9089  C CB  . ALA G  1 57  ? 7.328   89.576  211.537 1.00 107.59 ? 57   ALA G CB  1 
ATOM   9090  N N   . GLY G  1 58  ? 9.054   92.135  211.885 1.00 109.34 ? 58   GLY G N   1 
ATOM   9091  C CA  . GLY G  1 58  ? 9.133   93.557  212.157 1.00 110.47 ? 58   GLY G CA  1 
ATOM   9092  C C   . GLY G  1 58  ? 7.781   94.108  212.585 1.00 111.37 ? 58   GLY G C   1 
ATOM   9093  O O   . GLY G  1 58  ? 7.713   94.980  213.464 1.00 111.52 ? 58   GLY G O   1 
ATOM   9094  N N   . GLY G  1 59  ? 6.708   93.596  211.970 1.00 111.78 ? 59   GLY G N   1 
ATOM   9095  C CA  . GLY G  1 59  ? 5.364   94.048  212.295 1.00 111.76 ? 59   GLY G CA  1 
ATOM   9096  C C   . GLY G  1 59  ? 4.910   93.568  213.661 1.00 111.72 ? 59   GLY G C   1 
ATOM   9097  O O   . GLY G  1 59  ? 3.709   93.571  213.955 1.00 111.83 ? 59   GLY G O   1 
ATOM   9098  N N   . GLY G  1 60  ? 5.877   93.163  214.491 1.00 111.48 ? 60   GLY G N   1 
ATOM   9099  C CA  . GLY G  1 60  ? 5.576   92.667  215.824 1.00 111.17 ? 60   GLY G CA  1 
ATOM   9100  C C   . GLY G  1 60  ? 4.633   91.479  215.729 1.00 110.74 ? 60   GLY G C   1 
ATOM   9101  O O   . GLY G  1 60  ? 3.712   91.310  216.540 1.00 110.83 ? 60   GLY G O   1 
ATOM   9102  N N   . GLN G  1 61  ? 4.867   90.643  214.725 1.00 109.81 ? 61   GLN G N   1 
ATOM   9103  C CA  . GLN G  1 61  ? 4.017   89.483  214.514 1.00 108.77 ? 61   GLN G CA  1 
ATOM   9104  C C   . GLN G  1 61  ? 4.787   88.182  214.340 1.00 106.85 ? 61   GLN G C   1 
ATOM   9105  O O   . GLN G  1 61  ? 5.799   88.113  213.639 1.00 106.84 ? 61   GLN G O   1 
ATOM   9106  C CB  . GLN G  1 61  ? 3.135   89.717  213.300 1.00 110.79 ? 61   GLN G CB  1 
ATOM   9107  C CG  . GLN G  1 61  ? 3.931   90.122  212.078 1.00 113.52 ? 61   GLN G CG  1 
ATOM   9108  C CD  . GLN G  1 61  ? 3.062   90.267  210.850 1.00 114.99 ? 61   GLN G CD  1 
ATOM   9109  O OE1 . GLN G  1 61  ? 3.569   90.517  209.751 1.00 116.16 ? 61   GLN G OE1 1 
ATOM   9110  N NE2 . GLN G  1 61  ? 1.740   90.108  211.023 1.00 115.05 ? 61   GLN G NE2 1 
ATOM   9111  N N   . LYS G  1 62  ? 4.268   87.148  214.986 1.00 104.27 ? 62   LYS G N   1 
ATOM   9112  C CA  . LYS G  1 62  ? 4.854   85.823  214.974 1.00 101.44 ? 62   LYS G CA  1 
ATOM   9113  C C   . LYS G  1 62  ? 4.993   85.266  213.565 1.00 100.19 ? 62   LYS G C   1 
ATOM   9114  O O   . LYS G  1 62  ? 4.130   85.452  212.703 1.00 99.58  ? 62   LYS G O   1 
ATOM   9115  C CB  . LYS G  1 62  ? 3.985   84.893  215.826 1.00 100.75 ? 62   LYS G CB  1 
ATOM   9116  C CG  . LYS G  1 62  ? 4.648   83.624  216.332 1.00 98.93  ? 62   LYS G CG  1 
ATOM   9117  C CD  . LYS G  1 62  ? 3.612   82.749  217.032 1.00 97.63  ? 62   LYS G CD  1 
ATOM   9118  C CE  . LYS G  1 62  ? 4.226   81.482  217.596 1.00 97.14  ? 62   LYS G CE  1 
ATOM   9119  N NZ  . LYS G  1 62  ? 3.182   80.518  218.028 1.00 96.30  ? 62   LYS G NZ  1 
ATOM   9120  N N   . VAL G  1 63  ? 6.109   84.588  213.345 1.00 99.00  ? 63   VAL G N   1 
ATOM   9121  C CA  . VAL G  1 63  ? 6.389   83.964  212.073 1.00 97.40  ? 63   VAL G CA  1 
ATOM   9122  C C   . VAL G  1 63  ? 6.912   82.578  212.366 1.00 96.00  ? 63   VAL G C   1 
ATOM   9123  O O   . VAL G  1 63  ? 7.921   82.414  213.047 1.00 96.10  ? 63   VAL G O   1 
ATOM   9124  C CB  . VAL G  1 63  ? 7.453   84.739  211.288 1.00 98.11  ? 63   VAL G CB  1 
ATOM   9125  C CG1 . VAL G  1 63  ? 7.850   83.955  210.024 1.00 98.17  ? 63   VAL G CG1 1 
ATOM   9126  C CG2 . VAL G  1 63  ? 6.910   86.122  210.924 1.00 98.56  ? 63   VAL G CG2 1 
ATOM   9127  N N   . CYS G  1 64  ? 6.211   81.576  211.864 1.00 94.21  ? 64   CYS G N   1 
ATOM   9128  C CA  . CYS G  1 64  ? 6.627   80.205  212.076 1.00 92.72  ? 64   CYS G CA  1 
ATOM   9129  C C   . CYS G  1 64  ? 7.527   79.728  210.967 1.00 90.49  ? 64   CYS G C   1 
ATOM   9130  O O   . CYS G  1 64  ? 7.429   80.179  209.834 1.00 90.44  ? 64   CYS G O   1 
ATOM   9131  C CB  . CYS G  1 64  ? 5.415   79.294  212.160 1.00 94.24  ? 64   CYS G CB  1 
ATOM   9132  S SG  . CYS G  1 64  ? 4.463   79.566  213.641 1.00 98.31  ? 64   CYS G SG  1 
ATOM   9133  N N   . TYR G  1 65  ? 8.407   78.799  211.300 1.00 88.16  ? 65   TYR G N   1 
ATOM   9134  C CA  . TYR G  1 65  ? 9.327   78.263  210.319 1.00 85.95  ? 65   TYR G CA  1 
ATOM   9135  C C   . TYR G  1 65  ? 9.983   77.020  210.871 1.00 84.19  ? 65   TYR G C   1 
ATOM   9136  O O   . TYR G  1 65  ? 9.884   76.746  212.053 1.00 84.29  ? 65   TYR G O   1 
ATOM   9137  C CB  . TYR G  1 65  ? 10.386  79.309  209.979 1.00 86.02  ? 65   TYR G CB  1 
ATOM   9138  C CG  . TYR G  1 65  ? 11.360  79.569  211.099 1.00 86.41  ? 65   TYR G CG  1 
ATOM   9139  C CD1 . TYR G  1 65  ? 12.563  78.859  211.183 1.00 86.37  ? 65   TYR G CD1 1 
ATOM   9140  C CD2 . TYR G  1 65  ? 11.086  80.524  212.084 1.00 86.20  ? 65   TYR G CD2 1 
ATOM   9141  C CE1 . TYR G  1 65  ? 13.472  79.096  212.219 1.00 86.15  ? 65   TYR G CE1 1 
ATOM   9142  C CE2 . TYR G  1 65  ? 11.991  80.766  213.126 1.00 85.76  ? 65   TYR G CE2 1 
ATOM   9143  C CZ  . TYR G  1 65  ? 13.182  80.048  213.182 1.00 85.85  ? 65   TYR G CZ  1 
ATOM   9144  O OH  . TYR G  1 65  ? 14.093  80.276  214.183 1.00 85.46  ? 65   TYR G OH  1 
ATOM   9145  N N   . ILE G  1 66  ? 10.644  76.265  210.005 1.00 82.39  ? 66   ILE G N   1 
ATOM   9146  C CA  . ILE G  1 66  ? 11.330  75.057  210.422 1.00 80.24  ? 66   ILE G CA  1 
ATOM   9147  C C   . ILE G  1 66  ? 12.813  75.321  210.236 1.00 79.75  ? 66   ILE G C   1 
ATOM   9148  O O   . ILE G  1 66  ? 13.227  75.920  209.244 1.00 79.42  ? 66   ILE G O   1 
ATOM   9149  C CB  . ILE G  1 66  ? 10.911  73.860  209.574 1.00 79.36  ? 66   ILE G CB  1 
ATOM   9150  C CG1 . ILE G  1 66  ? 9.383   73.771  209.546 1.00 78.87  ? 66   ILE G CG1 1 
ATOM   9151  C CG2 . ILE G  1 66  ? 11.530  72.589  210.133 1.00 78.47  ? 66   ILE G CG2 1 
ATOM   9152  C CD1 . ILE G  1 66  ? 8.840   72.789  208.537 1.00 78.70  ? 66   ILE G CD1 1 
ATOM   9153  N N   . GLU G  1 67  ? 13.613  74.888  211.200 1.00 79.29  ? 67   GLU G N   1 
ATOM   9154  C CA  . GLU G  1 67  ? 15.037  75.111  211.112 1.00 77.99  ? 67   GLU G CA  1 
ATOM   9155  C C   . GLU G  1 67  ? 15.674  74.160  210.124 1.00 76.27  ? 67   GLU G C   1 
ATOM   9156  O O   . GLU G  1 67  ? 15.356  72.970  210.075 1.00 74.67  ? 67   GLU G O   1 
ATOM   9157  C CB  . GLU G  1 67  ? 15.678  74.983  212.491 1.00 79.93  ? 67   GLU G CB  1 
ATOM   9158  C CG  . GLU G  1 67  ? 15.275  76.114  213.442 1.00 82.29  ? 67   GLU G CG  1 
ATOM   9159  C CD  . GLU G  1 67  ? 15.886  75.960  214.833 1.00 83.84  ? 67   GLU G CD  1 
ATOM   9160  O OE1 . GLU G  1 67  ? 15.638  74.920  215.490 1.00 84.28  ? 67   GLU G OE1 1 
ATOM   9161  O OE2 . GLU G  1 67  ? 16.616  76.884  215.264 1.00 85.01  ? 67   GLU G OE2 1 
ATOM   9162  N N   . GLY G  1 68  ? 16.579  74.723  209.334 1.00 74.89  ? 68   GLY G N   1 
ATOM   9163  C CA  . GLY G  1 68  ? 17.264  73.959  208.325 1.00 73.98  ? 68   GLY G CA  1 
ATOM   9164  C C   . GLY G  1 68  ? 17.707  72.581  208.741 1.00 73.71  ? 68   GLY G C   1 
ATOM   9165  O O   . GLY G  1 68  ? 17.443  71.612  208.033 1.00 73.78  ? 68   GLY G O   1 
ATOM   9166  N N   . HIS G  1 69  ? 18.367  72.464  209.884 1.00 73.19  ? 69   HIS G N   1 
ATOM   9167  C CA  . HIS G  1 69  ? 18.840  71.147  210.265 1.00 72.98  ? 69   HIS G CA  1 
ATOM   9168  C C   . HIS G  1 69  ? 17.718  70.120  210.438 1.00 71.78  ? 69   HIS G C   1 
ATOM   9169  O O   . HIS G  1 69  ? 17.942  68.924  210.231 1.00 70.94  ? 69   HIS G O   1 
ATOM   9170  C CB  . HIS G  1 69  ? 19.749  71.218  211.516 1.00 74.88  ? 69   HIS G CB  1 
ATOM   9171  C CG  . HIS G  1 69  ? 19.028  71.521  212.797 1.00 76.68  ? 69   HIS G CG  1 
ATOM   9172  N ND1 . HIS G  1 69  ? 18.756  72.805  213.220 1.00 77.06  ? 69   HIS G ND1 1 
ATOM   9173  C CD2 . HIS G  1 69  ? 18.500  70.698  213.735 1.00 77.51  ? 69   HIS G CD2 1 
ATOM   9174  C CE1 . HIS G  1 69  ? 18.088  72.762  214.361 1.00 77.32  ? 69   HIS G CE1 1 
ATOM   9175  N NE2 . HIS G  1 69  ? 17.918  71.495  214.694 1.00 77.90  ? 69   HIS G NE2 1 
ATOM   9176  N N   . ARG G  1 70  ? 16.515  70.574  210.790 1.00 71.19  ? 70   ARG G N   1 
ATOM   9177  C CA  . ARG G  1 70  ? 15.392  69.642  210.969 1.00 71.48  ? 70   ARG G CA  1 
ATOM   9178  C C   . ARG G  1 70  ? 14.941  69.161  209.587 1.00 70.60  ? 70   ARG G C   1 
ATOM   9179  O O   . ARG G  1 70  ? 14.655  67.975  209.362 1.00 69.83  ? 70   ARG G O   1 
ATOM   9180  C CB  . ARG G  1 70  ? 14.203  70.316  211.688 1.00 72.23  ? 70   ARG G CB  1 
ATOM   9181  C CG  . ARG G  1 70  ? 14.478  70.729  213.114 1.00 74.19  ? 70   ARG G CG  1 
ATOM   9182  C CD  . ARG G  1 70  ? 13.667  69.957  214.172 1.00 75.76  ? 70   ARG G CD  1 
ATOM   9183  N NE  . ARG G  1 70  ? 14.133  70.344  215.506 1.00 77.13  ? 70   ARG G NE  1 
ATOM   9184  C CZ  . ARG G  1 70  ? 14.159  71.606  215.954 1.00 77.52  ? 70   ARG G CZ  1 
ATOM   9185  N NH1 . ARG G  1 70  ? 13.727  72.616  215.187 1.00 77.14  ? 70   ARG G NH1 1 
ATOM   9186  N NH2 . ARG G  1 70  ? 14.683  71.874  217.146 1.00 76.71  ? 70   ARG G NH2 1 
ATOM   9187  N N   . VAL G  1 71  ? 14.883  70.102  208.658 1.00 69.57  ? 71   VAL G N   1 
ATOM   9188  C CA  . VAL G  1 71  ? 14.474  69.782  207.309 1.00 68.12  ? 71   VAL G CA  1 
ATOM   9189  C C   . VAL G  1 71  ? 15.470  68.787  206.710 1.00 67.35  ? 71   VAL G C   1 
ATOM   9190  O O   . VAL G  1 71  ? 15.075  67.808  206.073 1.00 66.40  ? 71   VAL G O   1 
ATOM   9191  C CB  . VAL G  1 71  ? 14.416  71.054  206.448 1.00 68.22  ? 71   VAL G CB  1 
ATOM   9192  C CG1 . VAL G  1 71  ? 14.048  70.704  205.052 1.00 67.54  ? 71   VAL G CG1 1 
ATOM   9193  C CG2 . VAL G  1 71  ? 13.394  72.008  207.003 1.00 67.96  ? 71   VAL G CG2 1 
ATOM   9194  N N   . ILE G  1 72  ? 16.762  69.024  206.929 1.00 66.30  ? 72   ILE G N   1 
ATOM   9195  C CA  . ILE G  1 72  ? 17.758  68.126  206.379 1.00 66.46  ? 72   ILE G CA  1 
ATOM   9196  C C   . ILE G  1 72  ? 17.522  66.707  206.874 1.00 67.53  ? 72   ILE G C   1 
ATOM   9197  O O   . ILE G  1 72  ? 17.528  65.752  206.075 1.00 66.69  ? 72   ILE G O   1 
ATOM   9198  C CB  . ILE G  1 72  ? 19.196  68.605  206.709 1.00 65.59  ? 72   ILE G CB  1 
ATOM   9199  C CG1 . ILE G  1 72  ? 19.533  69.806  205.822 1.00 66.10  ? 72   ILE G CG1 1 
ATOM   9200  C CG2 . ILE G  1 72  ? 20.221  67.492  206.450 1.00 64.37  ? 72   ILE G CG2 1 
ATOM   9201  C CD1 . ILE G  1 72  ? 20.819  70.526  206.188 1.00 66.14  ? 72   ILE G CD1 1 
ATOM   9202  N N   . ASN G  1 73  ? 17.286  66.564  208.183 1.00 68.35  ? 73   ASN G N   1 
ATOM   9203  C CA  . ASN G  1 73  ? 17.056  65.235  208.738 1.00 67.42  ? 73   ASN G CA  1 
ATOM   9204  C C   . ASN G  1 73  ? 15.740  64.654  208.265 1.00 66.37  ? 73   ASN G C   1 
ATOM   9205  O O   . ASN G  1 73  ? 15.638  63.452  208.032 1.00 65.86  ? 73   ASN G O   1 
ATOM   9206  C CB  . ASN G  1 73  ? 17.132  65.256  210.257 1.00 68.13  ? 73   ASN G CB  1 
ATOM   9207  C CG  . ASN G  1 73  ? 18.558  65.300  210.753 1.00 69.16  ? 73   ASN G CG  1 
ATOM   9208  O OD1 . ASN G  1 73  ? 19.463  64.801  210.091 1.00 69.10  ? 73   ASN G OD1 1 
ATOM   9209  N ND2 . ASN G  1 73  ? 18.767  65.881  211.931 1.00 70.33  ? 73   ASN G ND2 1 
ATOM   9210  N N   . LEU G  1 74  ? 14.730  65.497  208.103 1.00 65.40  ? 74   LEU G N   1 
ATOM   9211  C CA  . LEU G  1 74  ? 13.466  64.992  207.608 1.00 65.46  ? 74   LEU G CA  1 
ATOM   9212  C C   . LEU G  1 74  ? 13.743  64.364  206.250 1.00 66.80  ? 74   LEU G C   1 
ATOM   9213  O O   . LEU G  1 74  ? 13.337  63.230  205.976 1.00 67.96  ? 74   LEU G O   1 
ATOM   9214  C CB  . LEU G  1 74  ? 12.468  66.128  207.463 1.00 64.01  ? 74   LEU G CB  1 
ATOM   9215  C CG  . LEU G  1 74  ? 11.696  66.524  208.719 1.00 62.93  ? 74   LEU G CG  1 
ATOM   9216  C CD1 . LEU G  1 74  ? 11.026  67.872  208.506 1.00 61.89  ? 74   LEU G CD1 1 
ATOM   9217  C CD2 . LEU G  1 74  ? 10.658  65.432  209.048 1.00 62.39  ? 74   LEU G CD2 1 
ATOM   9218  N N   . ALA G  1 75  ? 14.465  65.099  205.410 1.00 67.70  ? 75   ALA G N   1 
ATOM   9219  C CA  . ALA G  1 75  ? 14.803  64.631  204.076 1.00 67.89  ? 75   ALA G CA  1 
ATOM   9220  C C   . ALA G  1 75  ? 15.605  63.328  204.097 1.00 68.29  ? 75   ALA G C   1 
ATOM   9221  O O   . ALA G  1 75  ? 15.259  62.358  203.414 1.00 68.27  ? 75   ALA G O   1 
ATOM   9222  C CB  . ALA G  1 75  ? 15.579  65.716  203.335 1.00 68.11  ? 75   ALA G CB  1 
ATOM   9223  N N   . ASN G  1 76  ? 16.672  63.291  204.884 1.00 68.46  ? 76   ASN G N   1 
ATOM   9224  C CA  . ASN G  1 76  ? 17.485  62.086  204.925 1.00 69.45  ? 76   ASN G CA  1 
ATOM   9225  C C   . ASN G  1 76  ? 16.701  60.870  205.359 1.00 69.58  ? 76   ASN G C   1 
ATOM   9226  O O   . ASN G  1 76  ? 16.899  59.784  204.830 1.00 69.72  ? 76   ASN G O   1 
ATOM   9227  C CB  . ASN G  1 76  ? 18.701  62.273  205.833 1.00 70.44  ? 76   ASN G CB  1 
ATOM   9228  C CG  . ASN G  1 76  ? 19.773  63.146  205.198 1.00 70.90  ? 76   ASN G CG  1 
ATOM   9229  O OD1 . ASN G  1 76  ? 20.092  62.986  204.021 1.00 70.79  ? 76   ASN G OD1 1 
ATOM   9230  N ND2 . ASN G  1 76  ? 20.345  64.060  205.980 1.00 71.68  ? 76   ASN G ND2 1 
ATOM   9231  N N   . GLU G  1 77  ? 15.798  61.049  206.315 1.00 70.26  ? 77   GLU G N   1 
ATOM   9232  C CA  . GLU G  1 77  ? 14.996  59.921  206.798 1.00 70.31  ? 77   GLU G CA  1 
ATOM   9233  C C   . GLU G  1 77  ? 13.898  59.542  205.819 1.00 69.07  ? 77   GLU G C   1 
ATOM   9234  O O   . GLU G  1 77  ? 13.555  58.367  205.686 1.00 68.85  ? 77   GLU G O   1 
ATOM   9235  C CB  . GLU G  1 77  ? 14.396  60.230  208.177 1.00 71.30  ? 77   GLU G CB  1 
ATOM   9236  C CG  . GLU G  1 77  ? 15.464  60.407  209.255 1.00 73.07  ? 77   GLU G CG  1 
ATOM   9237  C CD  . GLU G  1 77  ? 16.332  59.169  209.404 1.00 74.46  ? 77   GLU G CD  1 
ATOM   9238  O OE1 . GLU G  1 77  ? 17.478  59.278  209.922 1.00 76.36  ? 77   GLU G OE1 1 
ATOM   9239  O OE2 . GLU G  1 77  ? 15.851  58.084  209.003 1.00 74.35  ? 77   GLU G OE2 1 
ATOM   9240  N N   . MET G  1 78  ? 13.362  60.538  205.121 1.00 67.24  ? 78   MET G N   1 
ATOM   9241  C CA  . MET G  1 78  ? 12.313  60.282  204.151 1.00 64.98  ? 78   MET G CA  1 
ATOM   9242  C C   . MET G  1 78  ? 12.832  59.567  202.887 1.00 62.85  ? 78   MET G C   1 
ATOM   9243  O O   . MET G  1 78  ? 12.253  58.580  202.440 1.00 62.46  ? 78   MET G O   1 
ATOM   9244  C CB  . MET G  1 78  ? 11.634  61.606  203.774 1.00 65.63  ? 78   MET G CB  1 
ATOM   9245  C CG  . MET G  1 78  ? 10.351  61.447  202.940 1.00 66.67  ? 78   MET G CG  1 
ATOM   9246  S SD  . MET G  1 78  ? 9.046   60.439  203.734 1.00 67.78  ? 78   MET G SD  1 
ATOM   9247  C CE  . MET G  1 78  ? 8.388   61.662  205.003 1.00 67.43  ? 78   MET G CE  1 
ATOM   9248  N N   . PHE G  1 79  ? 13.943  60.049  202.333 1.00 60.50  ? 79   PHE G N   1 
ATOM   9249  C CA  . PHE G  1 79  ? 14.487  59.488  201.091 1.00 57.67  ? 79   PHE G CA  1 
ATOM   9250  C C   . PHE G  1 79  ? 15.785  58.711  201.206 1.00 58.04  ? 79   PHE G C   1 
ATOM   9251  O O   . PHE G  1 79  ? 16.196  58.045  200.244 1.00 57.11  ? 79   PHE G O   1 
ATOM   9252  C CB  . PHE G  1 79  ? 14.725  60.601  200.083 1.00 53.78  ? 79   PHE G CB  1 
ATOM   9253  C CG  . PHE G  1 79  ? 13.557  61.527  199.907 1.00 51.06  ? 79   PHE G CG  1 
ATOM   9254  C CD1 . PHE G  1 79  ? 12.405  61.110  199.258 1.00 49.87  ? 79   PHE G CD1 1 
ATOM   9255  C CD2 . PHE G  1 79  ? 13.621  62.843  200.356 1.00 49.17  ? 79   PHE G CD2 1 
ATOM   9256  C CE1 . PHE G  1 79  ? 11.340  62.003  199.052 1.00 48.29  ? 79   PHE G CE1 1 
ATOM   9257  C CE2 . PHE G  1 79  ? 12.549  63.741  200.151 1.00 47.35  ? 79   PHE G CE2 1 
ATOM   9258  C CZ  . PHE G  1 79  ? 11.423  63.319  199.503 1.00 46.26  ? 79   PHE G CZ  1 
ATOM   9259  N N   . GLY G  1 80  ? 16.437  58.794  202.364 1.00 57.81  ? 80   GLY G N   1 
ATOM   9260  C CA  . GLY G  1 80  ? 17.705  58.112  202.528 1.00 57.85  ? 80   GLY G CA  1 
ATOM   9261  C C   . GLY G  1 80  ? 18.798  59.131  202.286 1.00 58.13  ? 80   GLY G C   1 
ATOM   9262  O O   . GLY G  1 80  ? 18.599  60.095  201.546 1.00 58.64  ? 80   GLY G O   1 
ATOM   9263  N N   . TYR G  1 81  ? 19.951  58.951  202.910 1.00 58.07  ? 81   TYR G N   1 
ATOM   9264  C CA  . TYR G  1 81  ? 21.024  59.904  202.707 1.00 57.97  ? 81   TYR G CA  1 
ATOM   9265  C C   . TYR G  1 81  ? 21.387  59.999  201.220 1.00 58.79  ? 81   TYR G C   1 
ATOM   9266  O O   . TYR G  1 81  ? 21.824  61.049  200.745 1.00 59.21  ? 81   TYR G O   1 
ATOM   9267  C CB  . TYR G  1 81  ? 22.264  59.489  203.497 1.00 56.97  ? 81   TYR G CB  1 
ATOM   9268  C CG  . TYR G  1 81  ? 22.966  58.246  202.989 1.00 55.52  ? 81   TYR G CG  1 
ATOM   9269  C CD1 . TYR G  1 81  ? 22.577  56.975  203.406 1.00 54.90  ? 81   TYR G CD1 1 
ATOM   9270  C CD2 . TYR G  1 81  ? 24.042  58.343  202.098 1.00 55.65  ? 81   TYR G CD2 1 
ATOM   9271  C CE1 . TYR G  1 81  ? 23.250  55.822  202.951 1.00 53.20  ? 81   TYR G CE1 1 
ATOM   9272  C CE2 . TYR G  1 81  ? 24.724  57.193  201.637 1.00 54.10  ? 81   TYR G CE2 1 
ATOM   9273  C CZ  . TYR G  1 81  ? 24.319  55.948  202.066 1.00 53.33  ? 81   TYR G CZ  1 
ATOM   9274  O OH  . TYR G  1 81  ? 24.969  54.847  201.583 1.00 51.56  ? 81   TYR G OH  1 
ATOM   9275  N N   . ASN G  1 82  ? 21.193  58.904  200.490 1.00 58.71  ? 82   ASN G N   1 
ATOM   9276  C CA  . ASN G  1 82  ? 21.521  58.868  199.076 1.00 58.89  ? 82   ASN G CA  1 
ATOM   9277  C C   . ASN G  1 82  ? 20.270  58.923  198.190 1.00 58.09  ? 82   ASN G C   1 
ATOM   9278  O O   . ASN G  1 82  ? 20.321  58.520  197.025 1.00 58.15  ? 82   ASN G O   1 
ATOM   9279  C CB  . ASN G  1 82  ? 22.278  57.581  198.772 1.00 60.41  ? 82   ASN G CB  1 
ATOM   9280  C CG  . ASN G  1 82  ? 21.374  56.350  198.850 1.00 62.47  ? 82   ASN G CG  1 
ATOM   9281  O OD1 . ASN G  1 82  ? 21.663  55.294  198.260 1.00 63.54  ? 82   ASN G OD1 1 
ATOM   9282  N ND2 . ASN G  1 82  ? 20.263  56.487  199.579 1.00 62.50  ? 82   ASN G ND2 1 
ATOM   9283  N N   . GLY G  1 83  ? 19.158  59.409  198.733 1.00 56.98  ? 83   GLY G N   1 
ATOM   9284  C CA  . GLY G  1 83  ? 17.923  59.454  197.961 1.00 55.48  ? 83   GLY G CA  1 
ATOM   9285  C C   . GLY G  1 83  ? 17.485  60.820  197.466 1.00 54.69  ? 83   GLY G C   1 
ATOM   9286  O O   . GLY G  1 83  ? 16.539  60.943  196.677 1.00 53.71  ? 83   GLY G O   1 
ATOM   9287  N N   . TRP G  1 84  ? 18.156  61.862  197.946 1.00 53.80  ? 84   TRP G N   1 
ATOM   9288  C CA  . TRP G  1 84  ? 17.840  63.214  197.510 1.00 52.26  ? 84   TRP G CA  1 
ATOM   9289  C C   . TRP G  1 84  ? 19.143  63.970  197.385 1.00 51.12  ? 84   TRP G C   1 
ATOM   9290  O O   . TRP G  1 84  ? 20.151  63.576  197.992 1.00 51.98  ? 84   TRP G O   1 
ATOM   9291  C CB  . TRP G  1 84  ? 16.923  63.923  198.503 1.00 52.46  ? 84   TRP G CB  1 
ATOM   9292  C CG  . TRP G  1 84  ? 17.571  64.228  199.816 1.00 54.02  ? 84   TRP G CG  1 
ATOM   9293  C CD1 . TRP G  1 84  ? 17.873  63.336  200.826 1.00 53.38  ? 84   TRP G CD1 1 
ATOM   9294  C CD2 . TRP G  1 84  ? 18.028  65.509  200.263 1.00 54.05  ? 84   TRP G CD2 1 
ATOM   9295  N NE1 . TRP G  1 84  ? 18.489  63.997  201.862 1.00 53.82  ? 84   TRP G NE1 1 
ATOM   9296  C CE2 . TRP G  1 84  ? 18.596  65.329  201.545 1.00 54.84  ? 84   TRP G CE2 1 
ATOM   9297  C CE3 . TRP G  1 84  ? 18.011  66.791  199.708 1.00 54.07  ? 84   TRP G CE3 1 
ATOM   9298  C CZ2 . TRP G  1 84  ? 19.146  66.392  202.277 1.00 55.82  ? 84   TRP G CZ2 1 
ATOM   9299  C CZ3 . TRP G  1 84  ? 18.556  67.852  200.436 1.00 54.55  ? 84   TRP G CZ3 1 
ATOM   9300  C CH2 . TRP G  1 84  ? 19.113  67.646  201.703 1.00 55.65  ? 84   TRP G CH2 1 
ATOM   9301  N N   . ALA G  1 85  ? 19.126  65.042  196.591 1.00 49.28  ? 85   ALA G N   1 
ATOM   9302  C CA  . ALA G  1 85  ? 20.311  65.858  196.391 1.00 47.03  ? 85   ALA G CA  1 
ATOM   9303  C C   . ALA G  1 85  ? 19.849  67.258  196.123 1.00 46.12  ? 85   ALA G C   1 
ATOM   9304  O O   . ALA G  1 85  ? 18.657  67.483  195.924 1.00 45.24  ? 85   ALA G O   1 
ATOM   9305  C CB  . ALA G  1 85  ? 21.131  65.333  195.214 1.00 45.35  ? 85   ALA G CB  1 
ATOM   9306  N N   . HIS G  1 86  ? 20.778  68.207  196.154 1.00 46.32  ? 86   HIS G N   1 
ATOM   9307  C CA  . HIS G  1 86  ? 20.429  69.587  195.854 1.00 46.97  ? 86   HIS G CA  1 
ATOM   9308  C C   . HIS G  1 86  ? 21.664  70.331  195.377 1.00 48.05  ? 86   HIS G C   1 
ATOM   9309  O O   . HIS G  1 86  ? 22.803  70.002  195.749 1.00 48.87  ? 86   HIS G O   1 
ATOM   9310  C CB  . HIS G  1 86  ? 19.764  70.300  197.071 1.00 44.97  ? 86   HIS G CB  1 
ATOM   9311  C CG  . HIS G  1 86  ? 20.721  70.762  198.129 1.00 43.38  ? 86   HIS G CG  1 
ATOM   9312  N ND1 . HIS G  1 86  ? 21.344  69.894  199.004 1.00 42.78  ? 86   HIS G ND1 1 
ATOM   9313  C CD2 . HIS G  1 86  ? 21.178  72.000  198.440 1.00 41.72  ? 86   HIS G CD2 1 
ATOM   9314  C CE1 . HIS G  1 86  ? 22.141  70.575  199.803 1.00 42.13  ? 86   HIS G CE1 1 
ATOM   9315  N NE2 . HIS G  1 86  ? 22.059  71.855  199.481 1.00 41.66  ? 86   HIS G NE2 1 
ATOM   9316  N N   . SER G  1 87  ? 21.428  71.320  194.536 1.00 48.75  ? 87   SER G N   1 
ATOM   9317  C CA  . SER G  1 87  ? 22.500  72.117  194.003 1.00 51.03  ? 87   SER G CA  1 
ATOM   9318  C C   . SER G  1 87  ? 21.998  73.566  193.926 1.00 52.48  ? 87   SER G C   1 
ATOM   9319  O O   . SER G  1 87  ? 20.783  73.833  193.987 1.00 50.76  ? 87   SER G O   1 
ATOM   9320  C CB  . SER G  1 87  ? 22.917  71.576  192.621 1.00 52.04  ? 87   SER G CB  1 
ATOM   9321  O OG  . SER G  1 87  ? 21.829  71.590  191.706 1.00 54.43  ? 87   SER G OG  1 
ATOM   9322  N N   . ILE G  1 88  ? 22.944  74.499  193.835 1.00 53.54  ? 88   ILE G N   1 
ATOM   9323  C CA  . ILE G  1 88  ? 22.620  75.913  193.779 1.00 54.41  ? 88   ILE G CA  1 
ATOM   9324  C C   . ILE G  1 88  ? 22.725  76.285  192.323 1.00 54.49  ? 88   ILE G C   1 
ATOM   9325  O O   . ILE G  1 88  ? 23.817  76.413  191.780 1.00 55.00  ? 88   ILE G O   1 
ATOM   9326  C CB  . ILE G  1 88  ? 23.641  76.749  194.647 1.00 55.25  ? 88   ILE G CB  1 
ATOM   9327  C CG1 . ILE G  1 88  ? 23.451  76.423  196.134 1.00 54.54  ? 88   ILE G CG1 1 
ATOM   9328  C CG2 . ILE G  1 88  ? 23.445  78.253  194.437 1.00 53.92  ? 88   ILE G CG2 1 
ATOM   9329  C CD1 . ILE G  1 88  ? 24.672  76.731  196.988 1.00 54.63  ? 88   ILE G CD1 1 
ATOM   9330  N N   . THR G  1 89  ? 21.598  76.435  191.660 1.00 55.05  ? 89   THR G N   1 
ATOM   9331  C CA  . THR G  1 89  ? 21.698  76.791  190.268 1.00 56.85  ? 89   THR G CA  1 
ATOM   9332  C C   . THR G  1 89  ? 22.295  78.198  190.128 1.00 57.73  ? 89   THR G C   1 
ATOM   9333  O O   . THR G  1 89  ? 23.031  78.480  189.167 1.00 57.90  ? 89   THR G O   1 
ATOM   9334  C CB  . THR G  1 89  ? 20.347  76.651  189.575 1.00 56.80  ? 89   THR G CB  1 
ATOM   9335  O OG1 . THR G  1 89  ? 19.339  77.335  190.320 1.00 58.43  ? 89   THR G OG1 1 
ATOM   9336  C CG2 . THR G  1 89  ? 19.975  75.193  189.519 1.00 56.93  ? 89   THR G CG2 1 
ATOM   9337  N N   . GLN G  1 90  ? 22.023  79.067  191.106 1.00 58.33  ? 90   GLN G N   1 
ATOM   9338  C CA  . GLN G  1 90  ? 22.575  80.412  191.073 1.00 58.77  ? 90   GLN G CA  1 
ATOM   9339  C C   . GLN G  1 90  ? 22.332  81.208  192.335 1.00 58.38  ? 90   GLN G C   1 
ATOM   9340  O O   . GLN G  1 90  ? 21.323  81.046  192.988 1.00 59.59  ? 90   GLN G O   1 
ATOM   9341  C CB  . GLN G  1 90  ? 21.993  81.189  189.906 1.00 59.33  ? 90   GLN G CB  1 
ATOM   9342  C CG  . GLN G  1 90  ? 22.706  82.493  189.676 1.00 61.72  ? 90   GLN G CG  1 
ATOM   9343  C CD  . GLN G  1 90  ? 21.927  83.457  188.797 1.00 63.10  ? 90   GLN G CD  1 
ATOM   9344  O OE1 . GLN G  1 90  ? 21.469  83.091  187.718 1.00 64.96  ? 90   GLN G OE1 1 
ATOM   9345  N NE2 . GLN G  1 90  ? 21.782  84.706  189.256 1.00 64.21  ? 90   GLN G NE2 1 
ATOM   9346  N N   . GLN G  1 91  ? 23.268  82.070  192.687 1.00 58.82  ? 91   GLN G N   1 
ATOM   9347  C CA  . GLN G  1 91  ? 23.093  82.919  193.855 1.00 59.37  ? 91   GLN G CA  1 
ATOM   9348  C C   . GLN G  1 91  ? 23.450  84.316  193.451 1.00 59.94  ? 91   GLN G C   1 
ATOM   9349  O O   . GLN G  1 91  ? 24.543  84.577  192.956 1.00 60.09  ? 91   GLN G O   1 
ATOM   9350  C CB  . GLN G  1 91  ? 23.973  82.535  195.043 1.00 59.04  ? 91   GLN G CB  1 
ATOM   9351  C CG  . GLN G  1 91  ? 23.731  83.524  196.195 1.00 58.79  ? 91   GLN G CG  1 
ATOM   9352  C CD  . GLN G  1 91  ? 24.380  83.127  197.478 1.00 57.66  ? 91   GLN G CD  1 
ATOM   9353  O OE1 . GLN G  1 91  ? 25.592  83.234  197.633 1.00 56.51  ? 91   GLN G OE1 1 
ATOM   9354  N NE2 . GLN G  1 91  ? 23.571  82.652  198.415 1.00 58.06  ? 91   GLN G NE2 1 
ATOM   9355  N N   . ASN G  1 92  ? 22.538  85.232  193.695 1.00 61.09  ? 92   ASN G N   1 
ATOM   9356  C CA  . ASN G  1 92  ? 22.787  86.586  193.296 1.00 62.24  ? 92   ASN G CA  1 
ATOM   9357  C C   . ASN G  1 92  ? 22.612  87.587  194.416 1.00 62.23  ? 92   ASN G C   1 
ATOM   9358  O O   . ASN G  1 92  ? 21.578  87.613  195.080 1.00 62.36  ? 92   ASN G O   1 
ATOM   9359  C CB  . ASN G  1 92  ? 21.860  86.915  192.142 1.00 64.30  ? 92   ASN G CB  1 
ATOM   9360  C CG  . ASN G  1 92  ? 22.181  88.243  191.514 1.00 66.81  ? 92   ASN G CG  1 
ATOM   9361  O OD1 . ASN G  1 92  ? 21.737  89.292  191.985 1.00 67.65  ? 92   ASN G OD1 1 
ATOM   9362  N ND2 . ASN G  1 92  ? 22.980  88.214  190.448 1.00 68.76  ? 92   ASN G ND2 1 
ATOM   9363  N N   . VAL G  1 93  ? 23.636  88.407  194.633 1.00 62.14  ? 93   VAL G N   1 
ATOM   9364  C CA  . VAL G  1 93  ? 23.580  89.444  195.659 1.00 61.72  ? 93   VAL G CA  1 
ATOM   9365  C C   . VAL G  1 93  ? 22.813  90.629  195.083 1.00 62.85  ? 93   VAL G C   1 
ATOM   9366  O O   . VAL G  1 93  ? 23.304  91.315  194.191 1.00 62.79  ? 93   VAL G O   1 
ATOM   9367  C CB  . VAL G  1 93  ? 24.986  89.937  196.062 1.00 60.76  ? 93   VAL G CB  1 
ATOM   9368  C CG1 . VAL G  1 93  ? 24.851  91.139  196.999 1.00 59.24  ? 93   VAL G CG1 1 
ATOM   9369  C CG2 . VAL G  1 93  ? 25.784  88.803  196.720 1.00 58.99  ? 93   VAL G CG2 1 
ATOM   9370  N N   . ASP G  1 94  ? 21.615  90.881  195.595 1.00 63.96  ? 94   ASP G N   1 
ATOM   9371  C CA  . ASP G  1 94  ? 20.810  91.980  195.089 1.00 65.63  ? 94   ASP G CA  1 
ATOM   9372  C C   . ASP G  1 94  ? 21.356  93.345  195.389 1.00 67.12  ? 94   ASP G C   1 
ATOM   9373  O O   . ASP G  1 94  ? 21.277  94.236  194.540 1.00 68.26  ? 94   ASP G O   1 
ATOM   9374  C CB  . ASP G  1 94  ? 19.390  91.887  195.623 1.00 65.91  ? 94   ASP G CB  1 
ATOM   9375  C CG  . ASP G  1 94  ? 18.615  90.791  194.957 1.00 66.13  ? 94   ASP G CG  1 
ATOM   9376  O OD1 . ASP G  1 94  ? 17.519  90.440  195.439 1.00 65.35  ? 94   ASP G OD1 1 
ATOM   9377  O OD2 . ASP G  1 94  ? 19.124  90.282  193.936 1.00 67.34  ? 94   ASP G OD2 1 
ATOM   9378  N N   . PHE G  1 95  ? 21.907  93.518  196.591 1.00 67.94  ? 95   PHE G N   1 
ATOM   9379  C CA  . PHE G  1 95  ? 22.443  94.815  196.986 1.00 68.45  ? 95   PHE G CA  1 
ATOM   9380  C C   . PHE G  1 95  ? 23.210  94.766  198.296 1.00 68.56  ? 95   PHE G C   1 
ATOM   9381  O O   . PHE G  1 95  ? 23.007  93.889  199.130 1.00 68.02  ? 95   PHE G O   1 
ATOM   9382  C CB  . PHE G  1 95  ? 21.300  95.855  197.109 1.00 69.28  ? 95   PHE G CB  1 
ATOM   9383  C CG  . PHE G  1 95  ? 20.311  95.553  198.212 1.00 69.99  ? 95   PHE G CG  1 
ATOM   9384  C CD1 . PHE G  1 95  ? 20.572  95.935  199.521 1.00 70.31  ? 95   PHE G CD1 1 
ATOM   9385  C CD2 . PHE G  1 95  ? 19.150  94.842  197.952 1.00 70.04  ? 95   PHE G CD2 1 
ATOM   9386  C CE1 . PHE G  1 95  ? 19.692  95.608  200.558 1.00 70.96  ? 95   PHE G CE1 1 
ATOM   9387  C CE2 . PHE G  1 95  ? 18.266  94.511  198.985 1.00 70.99  ? 95   PHE G CE2 1 
ATOM   9388  C CZ  . PHE G  1 95  ? 18.540  94.894  200.291 1.00 70.72  ? 95   PHE G CZ  1 
ATOM   9389  N N   . VAL G  1 96  ? 24.109  95.726  198.446 1.00 69.26  ? 96   VAL G N   1 
ATOM   9390  C CA  . VAL G  1 96  ? 24.891  95.897  199.651 1.00 69.70  ? 96   VAL G CA  1 
ATOM   9391  C C   . VAL G  1 96  ? 24.882  97.413  199.894 1.00 70.78  ? 96   VAL G C   1 
ATOM   9392  O O   . VAL G  1 96  ? 25.635  98.165  199.283 1.00 70.22  ? 96   VAL G O   1 
ATOM   9393  C CB  . VAL G  1 96  ? 26.323  95.373  199.478 1.00 68.78  ? 96   VAL G CB  1 
ATOM   9394  C CG1 . VAL G  1 96  ? 27.162  95.701  200.706 1.00 68.60  ? 96   VAL G CG1 1 
ATOM   9395  C CG2 . VAL G  1 96  ? 26.286  93.888  199.264 1.00 67.60  ? 96   VAL G CG2 1 
ATOM   9396  N N   . ASP G  1 97  ? 23.981  97.853  200.762 1.00 72.90  ? 97   ASP G N   1 
ATOM   9397  C CA  . ASP G  1 97  ? 23.859  99.262  201.085 1.00 75.79  ? 97   ASP G CA  1 
ATOM   9398  C C   . ASP G  1 97  ? 24.432  99.599  202.465 1.00 78.29  ? 97   ASP G C   1 
ATOM   9399  O O   . ASP G  1 97  ? 24.281  98.836  203.429 1.00 78.96  ? 97   ASP G O   1 
ATOM   9400  C CB  . ASP G  1 97  ? 22.394  99.694  201.034 1.00 75.12  ? 97   ASP G CB  1 
ATOM   9401  C CG  . ASP G  1 97  ? 21.810  99.626  199.637 1.00 75.61  ? 97   ASP G CG  1 
ATOM   9402  O OD1 . ASP G  1 97  ? 22.584  99.707  198.657 1.00 76.95  ? 97   ASP G OD1 1 
ATOM   9403  O OD2 . ASP G  1 97  ? 20.571  99.512  199.518 1.00 75.01  ? 97   ASP G OD2 1 
ATOM   9404  N N   . LEU G  1 98  ? 25.103  100.747 202.536 1.00 80.58  ? 98   LEU G N   1 
ATOM   9405  C CA  . LEU G  1 98  ? 25.700  101.279 203.767 1.00 82.94  ? 98   LEU G CA  1 
ATOM   9406  C C   . LEU G  1 98  ? 24.892  102.568 203.994 1.00 84.81  ? 98   LEU G C   1 
ATOM   9407  O O   . LEU G  1 98  ? 25.088  103.553 203.271 1.00 85.22  ? 98   LEU G O   1 
ATOM   9408  C CB  . LEU G  1 98  ? 27.169  101.612 203.518 1.00 81.78  ? 98   LEU G CB  1 
ATOM   9409  C CG  . LEU G  1 98  ? 27.837  102.491 204.557 1.00 81.57  ? 98   LEU G CG  1 
ATOM   9410  C CD1 . LEU G  1 98  ? 28.298  101.627 205.709 1.00 81.30  ? 98   LEU G CD1 1 
ATOM   9411  C CD2 . LEU G  1 98  ? 28.985  103.229 203.925 1.00 80.21  ? 98   LEU G CD2 1 
ATOM   9412  N N   . ASN G  1 99  ? 23.990  102.575 204.975 1.00 86.91  ? 99   ASN G N   1 
ATOM   9413  C CA  . ASN G  1 99  ? 23.136  103.753 205.171 1.00 89.66  ? 99   ASN G CA  1 
ATOM   9414  C C   . ASN G  1 99  ? 23.373  104.621 206.401 1.00 90.60  ? 99   ASN G C   1 
ATOM   9415  O O   . ASN G  1 99  ? 22.665  105.605 206.617 1.00 90.03  ? 99   ASN G O   1 
ATOM   9416  C CB  . ASN G  1 99  ? 21.657  103.326 205.138 1.00 90.81  ? 99   ASN G CB  1 
ATOM   9417  C CG  . ASN G  1 99  ? 21.162  102.977 203.710 1.00 92.35  ? 99   ASN G CG  1 
ATOM   9418  O OD1 . ASN G  1 99  ? 20.102  102.352 203.534 1.00 92.72  ? 99   ASN G OD1 1 
ATOM   9419  N ND2 . ASN G  1 99  ? 21.925  103.395 202.691 1.00 92.36  ? 99   ASN G ND2 1 
ATOM   9420  N N   . ASN G  1 100 ? 24.370  104.248 207.196 1.00 91.88  ? 100  ASN G N   1 
ATOM   9421  C CA  . ASN G  1 100 ? 24.737  104.947 208.431 1.00 92.48  ? 100  ASN G CA  1 
ATOM   9422  C C   . ASN G  1 100 ? 26.144  104.392 208.604 1.00 92.13  ? 100  ASN G C   1 
ATOM   9423  O O   . ASN G  1 100 ? 27.049  104.715 207.826 1.00 92.74  ? 100  ASN G O   1 
ATOM   9424  C CB  . ASN G  1 100 ? 23.822  104.463 209.549 1.00 93.74  ? 100  ASN G CB  1 
ATOM   9425  C CG  . ASN G  1 100 ? 22.800  103.416 209.045 1.00 95.92  ? 100  ASN G CG  1 
ATOM   9426  O OD1 . ASN G  1 100 ? 21.781  103.754 208.418 1.00 96.98  ? 100  ASN G OD1 1 
ATOM   9427  N ND2 . ASN G  1 100 ? 23.091  102.144 209.295 1.00 96.08  ? 100  ASN G ND2 1 
ATOM   9428  N N   . GLY G  1 101 ? 26.324  103.540 209.599 1.00 90.69  ? 101  GLY G N   1 
ATOM   9429  C CA  . GLY G  1 101 ? 27.610  102.910 209.782 1.00 89.17  ? 101  GLY G CA  1 
ATOM   9430  C C   . GLY G  1 101 ? 27.272  101.441 209.668 1.00 88.88  ? 101  GLY G C   1 
ATOM   9431  O O   . GLY G  1 101 ? 28.090  100.562 209.936 1.00 88.00  ? 101  GLY G O   1 
ATOM   9432  N N   . LYS G  1 102 ? 26.034  101.188 209.251 1.00 89.39  ? 102  LYS G N   1 
ATOM   9433  C CA  . LYS G  1 102 ? 25.504  99.832  209.118 1.00 89.64  ? 102  LYS G CA  1 
ATOM   9434  C C   . LYS G  1 102 ? 25.187  99.388  207.687 1.00 89.08  ? 102  LYS G C   1 
ATOM   9435  O O   . LYS G  1 102 ? 24.880  100.197 206.803 1.00 88.97  ? 102  LYS G O   1 
ATOM   9436  C CB  . LYS G  1 102 ? 24.242  99.695  209.970 1.00 90.37  ? 102  LYS G CB  1 
ATOM   9437  C CG  . LYS G  1 102 ? 24.408  100.172 211.402 1.00 91.49  ? 102  LYS G CG  1 
ATOM   9438  C CD  . LYS G  1 102 ? 23.048  100.330 212.073 1.00 92.85  ? 102  LYS G CD  1 
ATOM   9439  C CE  . LYS G  1 102 ? 23.174  100.558 213.572 1.00 93.32  ? 102  LYS G CE  1 
ATOM   9440  N NZ  . LYS G  1 102 ? 21.825  100.631 214.184 1.00 93.84  ? 102  LYS G NZ  1 
ATOM   9441  N N   . PHE G  1 103 ? 25.235  98.075  207.493 1.00 88.33  ? 103  PHE G N   1 
ATOM   9442  C CA  . PHE G  1 103 ? 24.988  97.472  206.197 1.00 87.05  ? 103  PHE G CA  1 
ATOM   9443  C C   . PHE G  1 103 ? 23.646  96.779  206.038 1.00 86.01  ? 103  PHE G C   1 
ATOM   9444  O O   . PHE G  1 103 ? 23.168  96.098  206.952 1.00 86.53  ? 103  PHE G O   1 
ATOM   9445  C CB  . PHE G  1 103 ? 26.092  96.475  205.885 1.00 87.14  ? 103  PHE G CB  1 
ATOM   9446  C CG  . PHE G  1 103 ? 27.420  97.111  205.649 1.00 87.35  ? 103  PHE G CG  1 
ATOM   9447  C CD1 . PHE G  1 103 ? 28.400  97.092  206.626 1.00 87.55  ? 103  PHE G CD1 1 
ATOM   9448  C CD2 . PHE G  1 103 ? 27.695  97.725  204.438 1.00 87.63  ? 103  PHE G CD2 1 
ATOM   9449  C CE1 . PHE G  1 103 ? 29.642  97.676  206.396 1.00 87.80  ? 103  PHE G CE1 1 
ATOM   9450  C CE2 . PHE G  1 103 ? 28.929  98.308  204.202 1.00 87.93  ? 103  PHE G CE2 1 
ATOM   9451  C CZ  . PHE G  1 103 ? 29.905  98.283  205.182 1.00 87.70  ? 103  PHE G CZ  1 
ATOM   9452  N N   . TYR G  1 104 ? 23.061  96.953  204.852 1.00 84.33  ? 104  TYR G N   1 
ATOM   9453  C CA  . TYR G  1 104 ? 21.779  96.350  204.488 1.00 82.05  ? 104  TYR G CA  1 
ATOM   9454  C C   . TYR G  1 104 ? 22.043  95.486  203.272 1.00 79.39  ? 104  TYR G C   1 
ATOM   9455  O O   . TYR G  1 104 ? 22.449  95.981  202.223 1.00 78.81  ? 104  TYR G O   1 
ATOM   9456  C CB  . TYR G  1 104 ? 20.755  97.453  204.222 1.00 83.34  ? 104  TYR G CB  1 
ATOM   9457  C CG  . TYR G  1 104 ? 20.580  98.277  205.473 1.00 84.72  ? 104  TYR G CG  1 
ATOM   9458  C CD1 . TYR G  1 104 ? 21.521  99.253  205.829 1.00 85.18  ? 104  TYR G CD1 1 
ATOM   9459  C CD2 . TYR G  1 104 ? 19.572  97.974  206.387 1.00 85.37  ? 104  TYR G CD2 1 
ATOM   9460  C CE1 . TYR G  1 104 ? 21.468  99.889  207.060 1.00 85.79  ? 104  TYR G CE1 1 
ATOM   9461  C CE2 . TYR G  1 104 ? 19.512  98.608  207.625 1.00 85.93  ? 104  TYR G CE2 1 
ATOM   9462  C CZ  . TYR G  1 104 ? 20.464  99.559  207.954 1.00 86.03  ? 104  TYR G CZ  1 
ATOM   9463  O OH  . TYR G  1 104 ? 20.432  100.159 209.191 1.00 87.61  ? 104  TYR G OH  1 
ATOM   9464  N N   . VAL G  1 105 ? 21.832  94.186  203.438 1.00 76.12  ? 105  VAL G N   1 
ATOM   9465  C CA  . VAL G  1 105 ? 22.125  93.233  202.382 1.00 73.83  ? 105  VAL G CA  1 
ATOM   9466  C C   . VAL G  1 105 ? 20.995  92.271  202.048 1.00 72.20  ? 105  VAL G C   1 
ATOM   9467  O O   . VAL G  1 105 ? 20.400  91.668  202.935 1.00 71.82  ? 105  VAL G O   1 
ATOM   9468  C CB  . VAL G  1 105 ? 23.378  92.396  202.761 1.00 73.52  ? 105  VAL G CB  1 
ATOM   9469  C CG1 . VAL G  1 105 ? 23.748  91.473  201.649 1.00 72.77  ? 105  VAL G CG1 1 
ATOM   9470  C CG2 . VAL G  1 105 ? 24.539  93.311  203.072 1.00 73.60  ? 105  VAL G CG2 1 
ATOM   9471  N N   . GLY G  1 106 ? 20.725  92.130  200.751 1.00 70.77  ? 106  GLY G N   1 
ATOM   9472  C CA  . GLY G  1 106 ? 19.698  91.215  200.266 1.00 67.80  ? 106  GLY G CA  1 
ATOM   9473  C C   . GLY G  1 106 ? 20.286  90.238  199.258 1.00 65.23  ? 106  GLY G C   1 
ATOM   9474  O O   . GLY G  1 106 ? 20.870  90.644  198.250 1.00 64.92  ? 106  GLY G O   1 
ATOM   9475  N N   . VAL G  1 107 ? 20.144  88.948  199.527 1.00 62.95  ? 107  VAL G N   1 
ATOM   9476  C CA  . VAL G  1 107 ? 20.689  87.933  198.632 1.00 61.43  ? 107  VAL G CA  1 
ATOM   9477  C C   . VAL G  1 107 ? 19.653  86.857  198.305 1.00 60.96  ? 107  VAL G C   1 
ATOM   9478  O O   . VAL G  1 107 ? 18.875  86.457  199.162 1.00 61.59  ? 107  VAL G O   1 
ATOM   9479  C CB  . VAL G  1 107 ? 21.931  87.253  199.256 1.00 60.24  ? 107  VAL G CB  1 
ATOM   9480  C CG1 . VAL G  1 107 ? 22.356  86.062  198.433 1.00 59.55  ? 107  VAL G CG1 1 
ATOM   9481  C CG2 . VAL G  1 107 ? 23.065  88.246  199.344 1.00 59.29  ? 107  VAL G CG2 1 
ATOM   9482  N N   . CYS G  1 108 ? 19.624  86.402  197.055 1.00 59.64  ? 108  CYS G N   1 
ATOM   9483  C CA  . CYS G  1 108 ? 18.695  85.350  196.671 1.00 56.95  ? 108  CYS G CA  1 
ATOM   9484  C C   . CYS G  1 108 ? 19.486  84.180  196.151 1.00 56.38  ? 108  CYS G C   1 
ATOM   9485  O O   . CYS G  1 108 ? 20.595  84.351  195.636 1.00 56.09  ? 108  CYS G O   1 
ATOM   9486  C CB  . CYS G  1 108 ? 17.726  85.830  195.590 1.00 56.79  ? 108  CYS G CB  1 
ATOM   9487  S SG  . CYS G  1 108 ? 18.448  86.205  193.989 1.00 54.37  ? 108  CYS G SG  1 
ATOM   9488  N N   . ALA G  1 109 ? 18.928  82.987  196.311 1.00 55.52  ? 109  ALA G N   1 
ATOM   9489  C CA  . ALA G  1 109 ? 19.579  81.783  195.816 1.00 55.71  ? 109  ALA G CA  1 
ATOM   9490  C C   . ALA G  1 109 ? 18.539  80.912  195.139 1.00 55.44  ? 109  ALA G C   1 
ATOM   9491  O O   . ALA G  1 109 ? 17.383  80.873  195.558 1.00 57.73  ? 109  ALA G O   1 
ATOM   9492  C CB  . ALA G  1 109 ? 20.224  81.008  196.955 1.00 54.70  ? 109  ALA G CB  1 
ATOM   9493  N N   . PHE G  1 110 ? 18.929  80.215  194.086 1.00 53.16  ? 110  PHE G N   1 
ATOM   9494  C CA  . PHE G  1 110 ? 17.999  79.315  193.439 1.00 50.73  ? 110  PHE G CA  1 
ATOM   9495  C C   . PHE G  1 110 ? 18.529  77.928  193.728 1.00 51.62  ? 110  PHE G C   1 
ATOM   9496  O O   . PHE G  1 110 ? 19.679  77.596  193.396 1.00 52.61  ? 110  PHE G O   1 
ATOM   9497  C CB  . PHE G  1 110 ? 17.937  79.625  191.962 1.00 46.77  ? 110  PHE G CB  1 
ATOM   9498  C CG  . PHE G  1 110 ? 17.360  80.980  191.682 1.00 43.41  ? 110  PHE G CG  1 
ATOM   9499  C CD1 . PHE G  1 110 ? 18.169  82.114  191.714 1.00 40.32  ? 110  PHE G CD1 1 
ATOM   9500  C CD2 . PHE G  1 110 ? 15.983  81.133  191.449 1.00 40.11  ? 110  PHE G CD2 1 
ATOM   9501  C CE1 . PHE G  1 110 ? 17.613  83.385  191.525 1.00 37.98  ? 110  PHE G CE1 1 
ATOM   9502  C CE2 . PHE G  1 110 ? 15.434  82.400  191.256 1.00 37.71  ? 110  PHE G CE2 1 
ATOM   9503  C CZ  . PHE G  1 110 ? 16.247  83.523  191.297 1.00 36.49  ? 110  PHE G CZ  1 
ATOM   9504  N N   . VAL G  1 111 ? 17.703  77.127  194.395 1.00 51.35  ? 111  VAL G N   1 
ATOM   9505  C CA  . VAL G  1 111 ? 18.114  75.784  194.768 1.00 51.25  ? 111  VAL G CA  1 
ATOM   9506  C C   . VAL G  1 111 ? 17.262  74.750  194.090 1.00 50.99  ? 111  VAL G C   1 
ATOM   9507  O O   . VAL G  1 111 ? 16.043  74.862  194.093 1.00 50.46  ? 111  VAL G O   1 
ATOM   9508  C CB  . VAL G  1 111 ? 18.031  75.611  196.291 1.00 50.65  ? 111  VAL G CB  1 
ATOM   9509  C CG1 . VAL G  1 111 ? 18.502  74.225  196.702 1.00 49.03  ? 111  VAL G CG1 1 
ATOM   9510  C CG2 . VAL G  1 111 ? 18.864  76.689  196.944 1.00 51.67  ? 111  VAL G CG2 1 
ATOM   9511  N N   . ARG G  1 112 ? 17.925  73.758  193.496 1.00 51.88  ? 112  ARG G N   1 
ATOM   9512  C CA  . ARG G  1 112 ? 17.262  72.663  192.785 1.00 52.73  ? 112  ARG G CA  1 
ATOM   9513  C C   . ARG G  1 112 ? 17.514  71.389  193.547 1.00 53.07  ? 112  ARG G C   1 
ATOM   9514  O O   . ARG G  1 112 ? 18.662  70.966  193.706 1.00 53.20  ? 112  ARG G O   1 
ATOM   9515  C CB  . ARG G  1 112 ? 17.829  72.478  191.367 1.00 53.13  ? 112  ARG G CB  1 
ATOM   9516  C CG  . ARG G  1 112 ? 16.799  71.902  190.386 1.00 54.08  ? 112  ARG G CG  1 
ATOM   9517  C CD  . ARG G  1 112 ? 17.352  71.486  189.010 1.00 52.66  ? 112  ARG G CD  1 
ATOM   9518  N NE  . ARG G  1 112 ? 17.661  70.064  189.008 1.00 50.88  ? 112  ARG G NE  1 
ATOM   9519  C CZ  . ARG G  1 112 ? 17.201  69.199  188.117 1.00 50.62  ? 112  ARG G CZ  1 
ATOM   9520  N NH1 . ARG G  1 112 ? 16.402  69.610  187.121 1.00 50.88  ? 112  ARG G NH1 1 
ATOM   9521  N NH2 . ARG G  1 112 ? 17.529  67.918  188.246 1.00 49.03  ? 112  ARG G NH2 1 
ATOM   9522  N N   . VAL G  1 113 ? 16.452  70.764  194.020 1.00 52.83  ? 113  VAL G N   1 
ATOM   9523  C CA  . VAL G  1 113 ? 16.632  69.528  194.760 1.00 53.37  ? 113  VAL G CA  1 
ATOM   9524  C C   . VAL G  1 113 ? 16.132  68.374  193.875 1.00 52.66  ? 113  VAL G C   1 
ATOM   9525  O O   . VAL G  1 113 ? 15.174  68.525  193.109 1.00 54.21  ? 113  VAL G O   1 
ATOM   9526  C CB  . VAL G  1 113 ? 15.882  69.608  196.131 1.00 54.33  ? 113  VAL G CB  1 
ATOM   9527  C CG1 . VAL G  1 113 ? 14.518  70.233  195.923 1.00 55.74  ? 113  VAL G CG1 1 
ATOM   9528  C CG2 . VAL G  1 113 ? 15.719  68.226  196.737 1.00 54.21  ? 113  VAL G CG2 1 
ATOM   9529  N N   . GLN G  1 114 ? 16.781  67.224  193.970 1.00 51.23  ? 114  GLN G N   1 
ATOM   9530  C CA  . GLN G  1 114 ? 16.401  66.103  193.138 1.00 49.81  ? 114  GLN G CA  1 
ATOM   9531  C C   . GLN G  1 114 ? 16.442  64.790  193.885 1.00 49.29  ? 114  GLN G C   1 
ATOM   9532  O O   . GLN G  1 114 ? 17.257  64.606  194.779 1.00 46.91  ? 114  GLN G O   1 
ATOM   9533  C CB  . GLN G  1 114 ? 17.359  66.024  191.963 1.00 50.24  ? 114  GLN G CB  1 
ATOM   9534  C CG  . GLN G  1 114 ? 17.064  64.929  190.942 1.00 49.64  ? 114  GLN G CG  1 
ATOM   9535  C CD  . GLN G  1 114 ? 18.223  64.725  189.964 1.00 47.76  ? 114  GLN G CD  1 
ATOM   9536  O OE1 . GLN G  1 114 ? 18.877  65.668  189.537 1.00 48.06  ? 114  GLN G OE1 1 
ATOM   9537  N NE2 . GLN G  1 114 ? 18.464  63.497  189.609 1.00 47.84  ? 114  GLN G NE2 1 
ATOM   9538  N N   . LEU G  1 115 ? 15.574  63.871  193.482 1.00 50.00  ? 115  LEU G N   1 
ATOM   9539  C CA  . LEU G  1 115 ? 15.496  62.541  194.085 1.00 51.50  ? 115  LEU G CA  1 
ATOM   9540  C C   . LEU G  1 115 ? 16.309  61.564  193.239 1.00 52.49  ? 115  LEU G C   1 
ATOM   9541  O O   . LEU G  1 115 ? 16.655  61.884  192.110 1.00 52.01  ? 115  LEU G O   1 
ATOM   9542  C CB  . LEU G  1 115 ? 14.038  62.089  194.153 1.00 51.87  ? 115  LEU G CB  1 
ATOM   9543  C CG  . LEU G  1 115 ? 13.210  62.435  195.399 1.00 52.84  ? 115  LEU G CG  1 
ATOM   9544  C CD1 . LEU G  1 115 ? 13.793  63.603  196.168 1.00 54.19  ? 115  LEU G CD1 1 
ATOM   9545  C CD2 . LEU G  1 115 ? 11.805  62.744  194.980 1.00 51.54  ? 115  LEU G CD2 1 
ATOM   9546  N N   . LYS G  1 116 ? 16.619  60.382  193.777 1.00 54.06  ? 116  LYS G N   1 
ATOM   9547  C CA  . LYS G  1 116 ? 17.419  59.384  193.033 1.00 56.04  ? 116  LYS G CA  1 
ATOM   9548  C C   . LYS G  1 116 ? 16.666  58.967  191.770 1.00 56.03  ? 116  LYS G C   1 
ATOM   9549  O O   . LYS G  1 116 ? 17.177  58.304  190.869 1.00 56.48  ? 116  LYS G O   1 
ATOM   9550  C CB  . LYS G  1 116 ? 17.686  58.147  193.897 1.00 56.45  ? 116  LYS G CB  1 
ATOM   9551  C CG  . LYS G  1 116 ? 16.426  57.441  194.413 1.00 57.44  ? 116  LYS G CG  1 
ATOM   9552  C CD  . LYS G  1 116 ? 16.806  56.181  195.180 1.00 58.04  ? 116  LYS G CD  1 
ATOM   9553  C CE  . LYS G  1 116 ? 15.629  55.606  195.949 1.00 58.39  ? 116  LYS G CE  1 
ATOM   9554  N NZ  . LYS G  1 116 ? 16.037  54.444  196.813 1.00 60.57  ? 116  LYS G NZ  1 
ATOM   9555  N N   . ASP G  1 117 ? 15.427  59.410  191.761 1.00 55.60  ? 117  ASP G N   1 
ATOM   9556  C CA  . ASP G  1 117 ? 14.423  59.207  190.748 1.00 54.38  ? 117  ASP G CA  1 
ATOM   9557  C C   . ASP G  1 117 ? 14.679  60.000  189.477 1.00 53.25  ? 117  ASP G C   1 
ATOM   9558  O O   . ASP G  1 117 ? 14.409  59.558  188.368 1.00 52.11  ? 117  ASP G O   1 
ATOM   9559  C CB  . ASP G  1 117 ? 13.142  59.738  191.338 1.00 55.06  ? 117  ASP G CB  1 
ATOM   9560  C CG  . ASP G  1 117 ? 11.975  59.213  190.669 1.00 57.39  ? 117  ASP G CG  1 
ATOM   9561  O OD1 . ASP G  1 117 ? 10.929  59.888  190.721 1.00 58.30  ? 117  ASP G OD1 1 
ATOM   9562  O OD2 . ASP G  1 117 ? 12.123  58.107  190.100 1.00 60.99  ? 117  ASP G OD2 1 
ATOM   9563  N N   . GLY G  1 118 ? 15.132  61.225  189.686 1.00 52.31  ? 118  GLY G N   1 
ATOM   9564  C CA  . GLY G  1 118 ? 15.359  62.139  188.603 1.00 49.99  ? 118  GLY G CA  1 
ATOM   9565  C C   . GLY G  1 118 ? 14.317  63.226  188.786 1.00 49.23  ? 118  GLY G C   1 
ATOM   9566  O O   . GLY G  1 118 ? 14.401  64.300  188.184 1.00 50.39  ? 118  GLY G O   1 
ATOM   9567  N N   . SER G  1 119 ? 13.328  62.970  189.628 1.00 47.58  ? 119  SER G N   1 
ATOM   9568  C CA  . SER G  1 119 ? 12.301  63.977  189.853 1.00 46.84  ? 119  SER G CA  1 
ATOM   9569  C C   . SER G  1 119 ? 12.940  65.153  190.585 1.00 45.59  ? 119  SER G C   1 
ATOM   9570  O O   . SER G  1 119 ? 13.952  64.985  191.265 1.00 44.19  ? 119  SER G O   1 
ATOM   9571  C CB  . SER G  1 119 ? 11.107  63.381  190.625 1.00 47.27  ? 119  SER G CB  1 
ATOM   9572  O OG  . SER G  1 119 ? 11.521  62.580  191.706 1.00 48.52  ? 119  SER G OG  1 
ATOM   9573  N N   . TYR G  1 120 ? 12.347  66.339  190.463 1.00 45.34  ? 120  TYR G N   1 
ATOM   9574  C CA  . TYR G  1 120 ? 12.973  67.516  191.052 1.00 46.78  ? 120  TYR G CA  1 
ATOM   9575  C C   . TYR G  1 120 ? 12.060  68.726  191.239 1.00 48.02  ? 120  TYR G C   1 
ATOM   9576  O O   . TYR G  1 120 ? 11.013  68.839  190.605 1.00 48.59  ? 120  TYR G O   1 
ATOM   9577  C CB  . TYR G  1 120 ? 14.136  67.935  190.136 1.00 46.51  ? 120  TYR G CB  1 
ATOM   9578  C CG  . TYR G  1 120 ? 13.662  68.270  188.711 1.00 45.55  ? 120  TYR G CG  1 
ATOM   9579  C CD1 . TYR G  1 120 ? 13.177  69.535  188.402 1.00 46.53  ? 120  TYR G CD1 1 
ATOM   9580  C CD2 . TYR G  1 120 ? 13.583  67.291  187.727 1.00 45.19  ? 120  TYR G CD2 1 
ATOM   9581  C CE1 . TYR G  1 120 ? 12.617  69.823  187.180 1.00 46.37  ? 120  TYR G CE1 1 
ATOM   9582  C CE2 . TYR G  1 120 ? 13.020  67.565  186.493 1.00 45.16  ? 120  TYR G CE2 1 
ATOM   9583  C CZ  . TYR G  1 120 ? 12.532  68.837  186.230 1.00 46.30  ? 120  TYR G CZ  1 
ATOM   9584  O OH  . TYR G  1 120 ? 11.898  69.130  185.039 1.00 46.63  ? 120  TYR G OH  1 
ATOM   9585  N N   . HIS G  1 121 ? 12.491  69.645  192.099 1.00 49.27  ? 121  HIS G N   1 
ATOM   9586  C CA  . HIS G  1 121 ? 11.771  70.891  192.349 1.00 50.45  ? 121  HIS G CA  1 
ATOM   9587  C C   . HIS G  1 121 ? 12.803  71.979  192.624 1.00 50.63  ? 121  HIS G C   1 
ATOM   9588  O O   . HIS G  1 121 ? 13.859  71.726  193.228 1.00 49.91  ? 121  HIS G O   1 
ATOM   9589  C CB  . HIS G  1 121 ? 10.820  70.754  193.531 1.00 51.37  ? 121  HIS G CB  1 
ATOM   9590  C CG  . HIS G  1 121 ? 9.643   69.869  193.262 1.00 53.59  ? 121  HIS G CG  1 
ATOM   9591  N ND1 . HIS G  1 121 ? 9.476   68.638  193.863 1.00 54.17  ? 121  HIS G ND1 1 
ATOM   9592  C CD2 . HIS G  1 121 ? 8.555   70.051  192.474 1.00 54.69  ? 121  HIS G CD2 1 
ATOM   9593  C CE1 . HIS G  1 121 ? 8.335   68.106  193.461 1.00 56.23  ? 121  HIS G CE1 1 
ATOM   9594  N NE2 . HIS G  1 121 ? 7.755   68.944  192.617 1.00 55.63  ? 121  HIS G NE2 1 
ATOM   9595  N N   . GLU G  1 122 ? 12.524  73.189  192.166 1.00 51.17  ? 122  GLU G N   1 
ATOM   9596  C CA  . GLU G  1 122 ? 13.478  74.263  192.362 1.00 52.09  ? 122  GLU G CA  1 
ATOM   9597  C C   . GLU G  1 122 ? 12.749  75.486  192.853 1.00 52.71  ? 122  GLU G C   1 
ATOM   9598  O O   . GLU G  1 122 ? 11.627  75.743  192.436 1.00 52.13  ? 122  GLU G O   1 
ATOM   9599  C CB  . GLU G  1 122 ? 14.192  74.555  191.040 1.00 53.41  ? 122  GLU G CB  1 
ATOM   9600  C CG  . GLU G  1 122 ? 15.170  75.728  191.071 1.00 54.21  ? 122  GLU G CG  1 
ATOM   9601  C CD  . GLU G  1 122 ? 15.824  76.011  189.707 1.00 54.05  ? 122  GLU G CD  1 
ATOM   9602  O OE1 . GLU G  1 122 ? 15.279  75.550  188.687 1.00 53.14  ? 122  GLU G OE1 1 
ATOM   9603  O OE2 . GLU G  1 122 ? 16.865  76.713  189.654 1.00 53.47  ? 122  GLU G OE2 1 
ATOM   9604  N N   . ASP G  1 123 ? 13.379  76.246  193.746 1.00 53.60  ? 123  ASP G N   1 
ATOM   9605  C CA  . ASP G  1 123 ? 12.733  77.443  194.265 1.00 53.51  ? 123  ASP G CA  1 
ATOM   9606  C C   . ASP G  1 123 ? 13.741  78.508  194.622 1.00 52.99  ? 123  ASP G C   1 
ATOM   9607  O O   . ASP G  1 123 ? 14.946  78.258  194.545 1.00 52.14  ? 123  ASP G O   1 
ATOM   9608  C CB  . ASP G  1 123 ? 11.917  77.083  195.503 1.00 54.91  ? 123  ASP G CB  1 
ATOM   9609  C CG  . ASP G  1 123 ? 10.693  77.929  195.635 1.00 56.59  ? 123  ASP G CG  1 
ATOM   9610  O OD1 . ASP G  1 123 ? 10.827  79.152  195.388 1.00 57.32  ? 123  ASP G OD1 1 
ATOM   9611  O OD2 . ASP G  1 123 ? 9.615   77.373  195.964 1.00 57.87  ? 123  ASP G OD2 1 
ATOM   9612  N N   . VAL G  1 124 ? 13.257  79.695  194.996 1.00 53.97  ? 124  VAL G N   1 
ATOM   9613  C CA  . VAL G  1 124 ? 14.156  80.785  195.417 1.00 56.09  ? 124  VAL G CA  1 
ATOM   9614  C C   . VAL G  1 124 ? 14.168  80.832  196.915 1.00 58.03  ? 124  VAL G C   1 
ATOM   9615  O O   . VAL G  1 124 ? 13.156  80.526  197.545 1.00 59.33  ? 124  VAL G O   1 
ATOM   9616  C CB  . VAL G  1 124 ? 13.690  82.204  195.090 1.00 54.84  ? 124  VAL G CB  1 
ATOM   9617  C CG1 . VAL G  1 124 ? 14.676  82.869  194.220 1.00 55.42  ? 124  VAL G CG1 1 
ATOM   9618  C CG2 . VAL G  1 124 ? 12.308  82.204  194.532 1.00 56.19  ? 124  VAL G CG2 1 
ATOM   9619  N N   . GLY G  1 125 ? 15.306  81.243  197.465 1.00 59.58  ? 125  GLY G N   1 
ATOM   9620  C CA  . GLY G  1 125 ? 15.472  81.407  198.895 1.00 60.80  ? 125  GLY G CA  1 
ATOM   9621  C C   . GLY G  1 125 ? 16.028  82.816  199.007 1.00 62.62  ? 125  GLY G C   1 
ATOM   9622  O O   . GLY G  1 125 ? 16.698  83.283  198.084 1.00 63.32  ? 125  GLY G O   1 
ATOM   9623  N N   . TYR G  1 126 ? 15.736  83.528  200.087 1.00 64.32  ? 126  TYR G N   1 
ATOM   9624  C CA  . TYR G  1 126 ? 16.274  84.868  200.231 1.00 65.79  ? 126  TYR G CA  1 
ATOM   9625  C C   . TYR G  1 126 ? 17.034  84.953  201.538 1.00 66.77  ? 126  TYR G C   1 
ATOM   9626  O O   . TYR G  1 126 ? 16.710  84.257  202.491 1.00 67.24  ? 126  TYR G O   1 
ATOM   9627  C CB  . TYR G  1 126 ? 15.178  85.914  200.211 1.00 66.49  ? 126  TYR G CB  1 
ATOM   9628  C CG  . TYR G  1 126 ? 15.675  87.214  199.632 1.00 68.50  ? 126  TYR G CG  1 
ATOM   9629  C CD1 . TYR G  1 126 ? 15.834  87.368  198.258 1.00 68.68  ? 126  TYR G CD1 1 
ATOM   9630  C CD2 . TYR G  1 126 ? 16.029  88.273  200.452 1.00 68.55  ? 126  TYR G CD2 1 
ATOM   9631  C CE1 . TYR G  1 126 ? 16.330  88.542  197.718 1.00 68.77  ? 126  TYR G CE1 1 
ATOM   9632  C CE2 . TYR G  1 126 ? 16.531  89.450  199.918 1.00 69.11  ? 126  TYR G CE2 1 
ATOM   9633  C CZ  . TYR G  1 126 ? 16.678  89.577  198.554 1.00 69.00  ? 126  TYR G CZ  1 
ATOM   9634  O OH  . TYR G  1 126 ? 17.181  90.746  198.034 1.00 69.18  ? 126  TYR G OH  1 
ATOM   9635  N N   . GLY G  1 127 ? 18.067  85.782  201.562 1.00 67.32  ? 127  GLY G N   1 
ATOM   9636  C CA  . GLY G  1 127 ? 18.880  85.955  202.753 1.00 68.52  ? 127  GLY G CA  1 
ATOM   9637  C C   . GLY G  1 127 ? 18.975  87.438  203.080 1.00 69.74  ? 127  GLY G C   1 
ATOM   9638  O O   . GLY G  1 127 ? 19.231  88.270  202.201 1.00 69.40  ? 127  GLY G O   1 
ATOM   9639  N N   . VAL G  1 128 ? 18.768  87.786  204.345 1.00 71.25  ? 128  VAL G N   1 
ATOM   9640  C CA  . VAL G  1 128 ? 18.817  89.188  204.724 1.00 73.43  ? 128  VAL G CA  1 
ATOM   9641  C C   . VAL G  1 128 ? 19.701  89.498  205.913 1.00 74.32  ? 128  VAL G C   1 
ATOM   9642  O O   . VAL G  1 128 ? 19.807  88.712  206.841 1.00 73.95  ? 128  VAL G O   1 
ATOM   9643  C CB  . VAL G  1 128 ? 17.407  89.737  205.048 1.00 73.34  ? 128  VAL G CB  1 
ATOM   9644  C CG1 . VAL G  1 128 ? 17.486  91.228  205.307 1.00 72.87  ? 128  VAL G CG1 1 
ATOM   9645  C CG2 . VAL G  1 128 ? 16.455  89.469  203.895 1.00 74.01  ? 128  VAL G CG2 1 
ATOM   9646  N N   . SER G  1 129 ? 20.348  90.654  205.865 1.00 76.44  ? 129  SER G N   1 
ATOM   9647  C CA  . SER G  1 129 ? 21.182  91.106  206.967 1.00 79.20  ? 129  SER G CA  1 
ATOM   9648  C C   . SER G  1 129 ? 21.054  92.619  207.016 1.00 80.56  ? 129  SER G C   1 
ATOM   9649  O O   . SER G  1 129 ? 21.499  93.343  206.116 1.00 80.97  ? 129  SER G O   1 
ATOM   9650  C CB  . SER G  1 129 ? 22.650  90.700  206.787 1.00 79.53  ? 129  SER G CB  1 
ATOM   9651  O OG  . SER G  1 129 ? 23.401  91.053  207.942 1.00 79.26  ? 129  SER G OG  1 
ATOM   9652  N N   . GLU G  1 130 ? 20.411  93.095  208.067 1.00 81.93  ? 130  GLU G N   1 
ATOM   9653  C CA  . GLU G  1 130 ? 20.219  94.523  208.213 1.00 83.45  ? 130  GLU G CA  1 
ATOM   9654  C C   . GLU G  1 130 ? 20.743  94.999  209.565 1.00 84.05  ? 130  GLU G C   1 
ATOM   9655  O O   . GLU G  1 130 ? 20.441  94.403  210.605 1.00 84.06  ? 130  GLU G O   1 
ATOM   9656  C CB  . GLU G  1 130 ? 18.726  94.866  208.053 1.00 83.61  ? 130  GLU G CB  1 
ATOM   9657  C CG  . GLU G  1 130 ? 18.195  94.563  206.654 1.00 83.29  ? 130  GLU G CG  1 
ATOM   9658  C CD  . GLU G  1 130 ? 16.716  94.846  206.501 1.00 83.36  ? 130  GLU G CD  1 
ATOM   9659  O OE1 . GLU G  1 130 ? 15.918  94.264  207.273 1.00 83.61  ? 130  GLU G OE1 1 
ATOM   9660  O OE2 . GLU G  1 130 ? 16.360  95.642  205.604 1.00 83.09  ? 130  GLU G OE2 1 
ATOM   9661  N N   . GLY G  1 131 ? 21.567  96.047  209.538 1.00 84.38  ? 131  GLY G N   1 
ATOM   9662  C CA  . GLY G  1 131 ? 22.082  96.602  210.775 1.00 84.28  ? 131  GLY G CA  1 
ATOM   9663  C C   . GLY G  1 131 ? 23.494  96.315  211.258 1.00 84.08  ? 131  GLY G C   1 
ATOM   9664  O O   . GLY G  1 131 ? 24.002  97.084  212.070 1.00 85.08  ? 131  GLY G O   1 
ATOM   9665  N N   . LEU G  1 132 ? 24.140  95.244  210.808 1.00 83.20  ? 132  LEU G N   1 
ATOM   9666  C CA  . LEU G  1 132 ? 25.498  94.962  211.277 1.00 81.99  ? 132  LEU G CA  1 
ATOM   9667  C C   . LEU G  1 132 ? 26.473  96.029  210.796 1.00 81.43  ? 132  LEU G C   1 
ATOM   9668  O O   . LEU G  1 132 ? 26.178  96.769  209.863 1.00 81.88  ? 132  LEU G O   1 
ATOM   9669  C CB  . LEU G  1 132 ? 25.951  93.583  210.797 1.00 81.64  ? 132  LEU G CB  1 
ATOM   9670  C CG  . LEU G  1 132 ? 25.036  92.422  211.208 1.00 81.81  ? 132  LEU G CG  1 
ATOM   9671  C CD1 . LEU G  1 132 ? 25.646  91.111  210.754 1.00 82.10  ? 132  LEU G CD1 1 
ATOM   9672  C CD2 . LEU G  1 132 ? 24.851  92.400  212.715 1.00 80.86  ? 132  LEU G CD2 1 
ATOM   9673  N N   . LYS G  1 133 ? 27.629  96.132  211.436 1.00 80.53  ? 133  LYS G N   1 
ATOM   9674  C CA  . LYS G  1 133 ? 28.586  97.126  210.997 1.00 80.32  ? 133  LYS G CA  1 
ATOM   9675  C C   . LYS G  1 133 ? 29.661  96.459  210.165 1.00 79.81  ? 133  LYS G C   1 
ATOM   9676  O O   . LYS G  1 133 ? 30.499  97.126  209.546 1.00 79.00  ? 133  LYS G O   1 
ATOM   9677  C CB  . LYS G  1 133 ? 29.204  97.842  212.187 1.00 81.08  ? 133  LYS G CB  1 
ATOM   9678  C CG  . LYS G  1 133 ? 28.203  98.678  212.973 1.00 82.23  ? 133  LYS G CG  1 
ATOM   9679  C CD  . LYS G  1 133 ? 28.882  99.773  213.824 1.00 82.77  ? 133  LYS G CD  1 
ATOM   9680  C CE  . LYS G  1 133 ? 30.045  99.223  214.660 1.00 83.34  ? 133  LYS G CE  1 
ATOM   9681  N NZ  . LYS G  1 133 ? 29.695  97.982  215.440 1.00 82.89  ? 133  LYS G NZ  1 
ATOM   9682  N N   . SER G  1 134 ? 29.626  95.128  210.160 1.00 79.65  ? 134  SER G N   1 
ATOM   9683  C CA  . SER G  1 134 ? 30.578  94.338  209.383 1.00 78.70  ? 134  SER G CA  1 
ATOM   9684  C C   . SER G  1 134 ? 29.976  93.981  208.025 1.00 77.85  ? 134  SER G C   1 
ATOM   9685  O O   . SER G  1 134 ? 28.906  93.365  207.941 1.00 78.08  ? 134  SER G O   1 
ATOM   9686  C CB  . SER G  1 134 ? 30.950  93.046  210.116 1.00 78.54  ? 134  SER G CB  1 
ATOM   9687  O OG  . SER G  1 134 ? 31.941  92.338  209.396 1.00 78.02  ? 134  SER G OG  1 
ATOM   9688  N N   . LYS G  1 135 ? 30.662  94.397  206.967 1.00 76.51  ? 135  LYS G N   1 
ATOM   9689  C CA  . LYS G  1 135 ? 30.238  94.098  205.612 1.00 74.85  ? 135  LYS G CA  1 
ATOM   9690  C C   . LYS G  1 135 ? 30.348  92.573  205.462 1.00 74.12  ? 135  LYS G C   1 
ATOM   9691  O O   . LYS G  1 135 ? 29.385  91.902  205.088 1.00 73.54  ? 135  LYS G O   1 
ATOM   9692  C CB  . LYS G  1 135 ? 31.188  94.784  204.647 1.00 74.74  ? 135  LYS G CB  1 
ATOM   9693  C CG  . LYS G  1 135 ? 30.726  94.916  203.227 1.00 74.43  ? 135  LYS G CG  1 
ATOM   9694  C CD  . LYS G  1 135 ? 31.856  95.560  202.458 1.00 75.20  ? 135  LYS G CD  1 
ATOM   9695  C CE  . LYS G  1 135 ? 31.373  96.415  201.312 1.00 76.48  ? 135  LYS G CE  1 
ATOM   9696  N NZ  . LYS G  1 135 ? 32.518  97.158  200.691 1.00 77.46  ? 135  LYS G NZ  1 
ATOM   9697  N N   . ALA G  1 136 ? 31.526  92.039  205.790 1.00 72.87  ? 136  ALA G N   1 
ATOM   9698  C CA  . ALA G  1 136 ? 31.796  90.608  205.695 1.00 71.61  ? 136  ALA G CA  1 
ATOM   9699  C C   . ALA G  1 136 ? 30.750  89.784  206.426 1.00 70.88  ? 136  ALA G C   1 
ATOM   9700  O O   . ALA G  1 136 ? 30.182  88.855  205.849 1.00 70.82  ? 136  ALA G O   1 
ATOM   9701  C CB  . ALA G  1 136 ? 33.184  90.297  206.245 1.00 71.78  ? 136  ALA G CB  1 
ATOM   9702  N N   . LEU G  1 137 ? 30.487  90.120  207.687 1.00 69.53  ? 137  LEU G N   1 
ATOM   9703  C CA  . LEU G  1 137 ? 29.491  89.384  208.462 1.00 68.29  ? 137  LEU G CA  1 
ATOM   9704  C C   . LEU G  1 137 ? 28.083  89.489  207.852 1.00 67.05  ? 137  LEU G C   1 
ATOM   9705  O O   . LEU G  1 137 ? 27.294  88.532  207.910 1.00 65.85  ? 137  LEU G O   1 
ATOM   9706  C CB  . LEU G  1 137 ? 29.485  89.869  209.924 1.00 68.29  ? 137  LEU G CB  1 
ATOM   9707  C CG  . LEU G  1 137 ? 30.498  89.208  210.877 1.00 68.11  ? 137  LEU G CG  1 
ATOM   9708  C CD1 . LEU G  1 137 ? 30.124  87.730  211.067 1.00 66.97  ? 137  LEU G CD1 1 
ATOM   9709  C CD2 . LEU G  1 137 ? 31.925  89.349  210.323 1.00 67.70  ? 137  LEU G CD2 1 
ATOM   9710  N N   . SER G  1 138 ? 27.775  90.643  207.264 1.00 65.25  ? 138  SER G N   1 
ATOM   9711  C CA  . SER G  1 138 ? 26.470  90.845  206.644 1.00 64.55  ? 138  SER G CA  1 
ATOM   9712  C C   . SER G  1 138 ? 26.314  89.956  205.396 1.00 63.97  ? 138  SER G C   1 
ATOM   9713  O O   . SER G  1 138 ? 25.307  89.253  205.236 1.00 63.67  ? 138  SER G O   1 
ATOM   9714  C CB  . SER G  1 138 ? 26.284  92.321  206.268 1.00 64.58  ? 138  SER G CB  1 
ATOM   9715  O OG  . SER G  1 138 ? 26.008  93.128  207.405 1.00 64.39  ? 138  SER G OG  1 
ATOM   9716  N N   . LEU G  1 139 ? 27.314  89.994  204.516 1.00 62.58  ? 139  LEU G N   1 
ATOM   9717  C CA  . LEU G  1 139 ? 27.309  89.191  203.298 1.00 60.49  ? 139  LEU G CA  1 
ATOM   9718  C C   . LEU G  1 139 ? 27.252  87.723  203.684 1.00 60.77  ? 139  LEU G C   1 
ATOM   9719  O O   . LEU G  1 139 ? 26.439  86.977  203.160 1.00 61.42  ? 139  LEU G O   1 
ATOM   9720  C CB  . LEU G  1 139 ? 28.573  89.440  202.491 1.00 59.68  ? 139  LEU G CB  1 
ATOM   9721  C CG  . LEU G  1 139 ? 28.487  90.104  201.125 1.00 58.22  ? 139  LEU G CG  1 
ATOM   9722  C CD1 . LEU G  1 139 ? 27.051  90.291  200.742 1.00 58.36  ? 139  LEU G CD1 1 
ATOM   9723  C CD2 . LEU G  1 139 ? 29.211  91.416  201.152 1.00 58.33  ? 139  LEU G CD2 1 
ATOM   9724  N N   . GLU G  1 140 ? 28.105  87.302  204.612 1.00 60.09  ? 140  GLU G N   1 
ATOM   9725  C CA  . GLU G  1 140 ? 28.090  85.909  205.032 1.00 59.48  ? 140  GLU G CA  1 
ATOM   9726  C C   . GLU G  1 140 ? 26.723  85.457  205.505 1.00 59.04  ? 140  GLU G C   1 
ATOM   9727  O O   . GLU G  1 140 ? 26.277  84.391  205.145 1.00 60.02  ? 140  GLU G O   1 
ATOM   9728  C CB  . GLU G  1 140 ? 29.098  85.651  206.155 1.00 59.94  ? 140  GLU G CB  1 
ATOM   9729  C CG  . GLU G  1 140 ? 28.859  84.311  206.871 1.00 60.18  ? 140  GLU G CG  1 
ATOM   9730  C CD  . GLU G  1 140 ? 29.881  84.021  207.955 1.00 59.82  ? 140  GLU G CD  1 
ATOM   9731  O OE1 . GLU G  1 140 ? 30.089  84.898  208.818 1.00 60.21  ? 140  GLU G OE1 1 
ATOM   9732  O OE2 . GLU G  1 140 ? 30.467  82.915  207.945 1.00 57.85  ? 140  GLU G OE2 1 
ATOM   9733  N N   . LYS G  1 141 ? 26.056  86.258  206.318 1.00 58.99  ? 141  LYS G N   1 
ATOM   9734  C CA  . LYS G  1 141 ? 24.754  85.861  206.829 1.00 59.37  ? 141  LYS G CA  1 
ATOM   9735  C C   . LYS G  1 141 ? 23.721  85.771  205.721 1.00 59.87  ? 141  LYS G C   1 
ATOM   9736  O O   . LYS G  1 141 ? 22.949  84.793  205.663 1.00 61.36  ? 141  LYS G O   1 
ATOM   9737  C CB  . LYS G  1 141 ? 24.252  86.846  207.888 1.00 59.73  ? 141  LYS G CB  1 
ATOM   9738  C CG  . LYS G  1 141 ? 22.841  86.550  208.388 1.00 59.16  ? 141  LYS G CG  1 
ATOM   9739  C CD  . LYS G  1 141 ? 22.365  87.596  209.373 1.00 59.32  ? 141  LYS G CD  1 
ATOM   9740  C CE  . LYS G  1 141 ? 21.032  87.206  210.012 1.00 57.78  ? 141  LYS G CE  1 
ATOM   9741  N NZ  . LYS G  1 141 ? 19.889  87.337  209.069 1.00 57.53  ? 141  LYS G NZ  1 
ATOM   9742  N N   . ALA G  1 142 ? 23.695  86.775  204.842 1.00 58.24  ? 142  ALA G N   1 
ATOM   9743  C CA  . ALA G  1 142 ? 22.709  86.786  203.771 1.00 56.23  ? 142  ALA G CA  1 
ATOM   9744  C C   . ALA G  1 142 ? 22.915  85.653  202.780 1.00 56.05  ? 142  ALA G C   1 
ATOM   9745  O O   . ALA G  1 142 ? 21.968  84.981  202.416 1.00 55.82  ? 142  ALA G O   1 
ATOM   9746  C CB  . ALA G  1 142 ? 22.724  88.106  203.076 1.00 55.12  ? 142  ALA G CB  1 
ATOM   9747  N N   . ARG G  1 143 ? 24.149  85.412  202.364 1.00 56.13  ? 143  ARG G N   1 
ATOM   9748  C CA  . ARG G  1 143 ? 24.386  84.344  201.411 1.00 57.50  ? 143  ARG G CA  1 
ATOM   9749  C C   . ARG G  1 143 ? 24.029  82.980  201.982 1.00 58.09  ? 143  ARG G C   1 
ATOM   9750  O O   . ARG G  1 143 ? 23.357  82.205  201.329 1.00 59.19  ? 143  ARG G O   1 
ATOM   9751  C CB  . ARG G  1 143 ? 25.847  84.329  200.918 1.00 58.48  ? 143  ARG G CB  1 
ATOM   9752  C CG  . ARG G  1 143 ? 26.343  85.679  200.400 1.00 60.55  ? 143  ARG G CG  1 
ATOM   9753  C CD  . ARG G  1 143 ? 27.670  85.617  199.639 1.00 61.28  ? 143  ARG G CD  1 
ATOM   9754  N NE  . ARG G  1 143 ? 27.368  85.456  198.232 1.00 63.49  ? 143  ARG G NE  1 
ATOM   9755  C CZ  . ARG G  1 143 ? 28.013  86.057  197.251 1.00 63.15  ? 143  ARG G CZ  1 
ATOM   9756  N NH1 . ARG G  1 143 ? 29.018  86.863  197.518 1.00 62.97  ? 143  ARG G NH1 1 
ATOM   9757  N NH2 . ARG G  1 143 ? 27.620  85.862  196.005 1.00 64.40  ? 143  ARG G NH2 1 
ATOM   9758  N N   . LYS G  1 144 ? 24.451  82.671  203.197 1.00 58.85  ? 144  LYS G N   1 
ATOM   9759  C CA  . LYS G  1 144 ? 24.131  81.359  203.739 1.00 59.59  ? 144  LYS G CA  1 
ATOM   9760  C C   . LYS G  1 144 ? 22.645  81.144  203.965 1.00 60.22  ? 144  LYS G C   1 
ATOM   9761  O O   . LYS G  1 144 ? 22.137  80.050  203.722 1.00 59.96  ? 144  LYS G O   1 
ATOM   9762  C CB  . LYS G  1 144 ? 24.890  81.115  205.036 1.00 59.53  ? 144  LYS G CB  1 
ATOM   9763  C CG  . LYS G  1 144 ? 26.405  81.153  204.876 1.00 58.35  ? 144  LYS G CG  1 
ATOM   9764  C CD  . LYS G  1 144 ? 27.114  80.675  206.123 1.00 56.86  ? 144  LYS G CD  1 
ATOM   9765  C CE  . LYS G  1 144 ? 28.593  80.773  205.928 1.00 56.86  ? 144  LYS G CE  1 
ATOM   9766  N NZ  . LYS G  1 144 ? 29.356  80.267  207.083 1.00 58.46  ? 144  LYS G NZ  1 
ATOM   9767  N N   . GLU G  1 145 ? 21.937  82.174  204.410 1.00 60.90  ? 145  GLU G N   1 
ATOM   9768  C CA  . GLU G  1 145 ? 20.520  81.996  204.657 1.00 62.54  ? 145  GLU G CA  1 
ATOM   9769  C C   . GLU G  1 145 ? 19.725  81.848  203.381 1.00 61.77  ? 145  GLU G C   1 
ATOM   9770  O O   . GLU G  1 145 ? 18.732  81.113  203.343 1.00 61.80  ? 145  GLU G O   1 
ATOM   9771  C CB  . GLU G  1 145 ? 19.969  83.147  205.491 1.00 64.76  ? 145  GLU G CB  1 
ATOM   9772  C CG  . GLU G  1 145 ? 20.400  83.063  206.951 1.00 69.04  ? 145  GLU G CG  1 
ATOM   9773  C CD  . GLU G  1 145 ? 19.904  84.229  207.805 1.00 71.30  ? 145  GLU G CD  1 
ATOM   9774  O OE1 . GLU G  1 145 ? 19.119  85.083  207.304 1.00 73.22  ? 145  GLU G OE1 1 
ATOM   9775  O OE2 . GLU G  1 145 ? 20.307  84.276  208.989 1.00 73.07  ? 145  GLU G OE2 1 
ATOM   9776  N N   . ALA G  1 146 ? 20.153  82.546  202.334 1.00 60.40  ? 146  ALA G N   1 
ATOM   9777  C CA  . ALA G  1 146 ? 19.460  82.445  201.058 1.00 58.05  ? 146  ALA G CA  1 
ATOM   9778  C C   . ALA G  1 146 ? 19.508  80.983  200.609 1.00 56.82  ? 146  ALA G C   1 
ATOM   9779  O O   . ALA G  1 146 ? 18.496  80.408  200.215 1.00 57.17  ? 146  ALA G O   1 
ATOM   9780  C CB  . ALA G  1 146 ? 20.113  83.346  200.024 1.00 57.39  ? 146  ALA G CB  1 
ATOM   9781  N N   . VAL G  1 147 ? 20.673  80.362  200.688 1.00 55.07  ? 147  VAL G N   1 
ATOM   9782  C CA  . VAL G  1 147 ? 20.766  78.972  200.269 1.00 54.69  ? 147  VAL G CA  1 
ATOM   9783  C C   . VAL G  1 147 ? 19.869  78.058  201.088 1.00 55.60  ? 147  VAL G C   1 
ATOM   9784  O O   . VAL G  1 147 ? 19.072  77.313  200.517 1.00 55.80  ? 147  VAL G O   1 
ATOM   9785  C CB  . VAL G  1 147 ? 22.223  78.447  200.331 1.00 54.29  ? 147  VAL G CB  1 
ATOM   9786  C CG1 . VAL G  1 147 ? 22.276  76.958  200.079 1.00 52.22  ? 147  VAL G CG1 1 
ATOM   9787  C CG2 . VAL G  1 147 ? 23.058  79.155  199.290 1.00 53.15  ? 147  VAL G CG2 1 
ATOM   9788  N N   . THR G  1 148 ? 19.990  78.116  202.420 1.00 56.12  ? 148  THR G N   1 
ATOM   9789  C CA  . THR G  1 148 ? 19.189  77.264  203.297 1.00 54.20  ? 148  THR G CA  1 
ATOM   9790  C C   . THR G  1 148 ? 17.705  77.536  203.095 1.00 53.08  ? 148  THR G C   1 
ATOM   9791  O O   . THR G  1 148 ? 16.889  76.605  203.053 1.00 52.61  ? 148  THR G O   1 
ATOM   9792  C CB  . THR G  1 148 ? 19.574  77.472  204.768 1.00 54.44  ? 148  THR G CB  1 
ATOM   9793  O OG1 . THR G  1 148 ? 20.923  77.035  204.966 1.00 55.04  ? 148  THR G OG1 1 
ATOM   9794  C CG2 . THR G  1 148 ? 18.692  76.654  205.668 1.00 54.33  ? 148  THR G CG2 1 
ATOM   9795  N N   . ASP G  1 149 ? 17.354  78.808  202.955 1.00 52.13  ? 149  ASP G N   1 
ATOM   9796  C CA  . ASP G  1 149 ? 15.960  79.171  202.748 1.00 51.98  ? 149  ASP G CA  1 
ATOM   9797  C C   . ASP G  1 149 ? 15.454  78.541  201.432 1.00 52.57  ? 149  ASP G C   1 
ATOM   9798  O O   . ASP G  1 149 ? 14.331  78.015  201.358 1.00 52.40  ? 149  ASP G O   1 
ATOM   9799  C CB  . ASP G  1 149 ? 15.827  80.682  202.681 1.00 51.66  ? 149  ASP G CB  1 
ATOM   9800  C CG  . ASP G  1 149 ? 14.396  81.121  202.688 1.00 53.49  ? 149  ASP G CG  1 
ATOM   9801  O OD1 . ASP G  1 149 ? 14.015  82.020  201.890 1.00 54.59  ? 149  ASP G OD1 1 
ATOM   9802  O OD2 . ASP G  1 149 ? 13.644  80.560  203.515 1.00 55.01  ? 149  ASP G OD2 1 
ATOM   9803  N N   . GLY G  1 150 ? 16.297  78.596  200.398 1.00 52.27  ? 150  GLY G N   1 
ATOM   9804  C CA  . GLY G  1 150 ? 15.935  78.031  199.113 1.00 51.74  ? 150  GLY G CA  1 
ATOM   9805  C C   . GLY G  1 150 ? 15.793  76.527  199.193 1.00 51.54  ? 150  GLY G C   1 
ATOM   9806  O O   . GLY G  1 150 ? 14.851  75.950  198.654 1.00 51.02  ? 150  GLY G O   1 
ATOM   9807  N N   . LEU G  1 151 ? 16.727  75.879  199.872 1.00 51.53  ? 151  LEU G N   1 
ATOM   9808  C CA  . LEU G  1 151 ? 16.658  74.443  200.009 1.00 52.43  ? 151  LEU G CA  1 
ATOM   9809  C C   . LEU G  1 151 ? 15.355  74.056  200.705 1.00 54.47  ? 151  LEU G C   1 
ATOM   9810  O O   . LEU G  1 151 ? 14.697  73.082  200.332 1.00 54.65  ? 151  LEU G O   1 
ATOM   9811  C CB  . LEU G  1 151 ? 17.848  73.944  200.807 1.00 51.01  ? 151  LEU G CB  1 
ATOM   9812  C CG  . LEU G  1 151 ? 17.767  72.487  201.220 1.00 51.22  ? 151  LEU G CG  1 
ATOM   9813  C CD1 . LEU G  1 151 ? 17.564  71.637  199.998 1.00 52.26  ? 151  LEU G CD1 1 
ATOM   9814  C CD2 . LEU G  1 151 ? 19.035  72.083  201.946 1.00 52.50  ? 151  LEU G CD2 1 
ATOM   9815  N N   . LYS G  1 152 ? 14.978  74.815  201.726 1.00 55.97  ? 152  LYS G N   1 
ATOM   9816  C CA  . LYS G  1 152 ? 13.757  74.495  202.437 1.00 57.35  ? 152  LYS G CA  1 
ATOM   9817  C C   . LYS G  1 152 ? 12.553  74.690  201.529 1.00 57.27  ? 152  LYS G C   1 
ATOM   9818  O O   . LYS G  1 152 ? 11.695  73.813  201.444 1.00 56.65  ? 152  LYS G O   1 
ATOM   9819  C CB  . LYS G  1 152 ? 13.615  75.346  203.722 1.00 58.46  ? 152  LYS G CB  1 
ATOM   9820  C CG  . LYS G  1 152 ? 14.563  74.944  204.879 1.00 58.33  ? 152  LYS G CG  1 
ATOM   9821  C CD  . LYS G  1 152 ? 14.214  75.641  206.202 1.00 58.31  ? 152  LYS G CD  1 
ATOM   9822  C CE  . LYS G  1 152 ? 14.324  77.163  206.090 1.00 59.50  ? 152  LYS G CE  1 
ATOM   9823  N NZ  . LYS G  1 152 ? 13.669  77.885  207.222 1.00 59.57  ? 152  LYS G NZ  1 
ATOM   9824  N N   . ARG G  1 153 ? 12.484  75.817  200.835 1.00 57.42  ? 153  ARG G N   1 
ATOM   9825  C CA  . ARG G  1 153 ? 11.328  76.024  199.975 1.00 59.09  ? 153  ARG G CA  1 
ATOM   9826  C C   . ARG G  1 153 ? 11.232  74.959  198.871 1.00 59.97  ? 153  ARG G C   1 
ATOM   9827  O O   . ARG G  1 153 ? 10.129  74.510  198.528 1.00 60.58  ? 153  ARG G O   1 
ATOM   9828  C CB  . ARG G  1 153 ? 11.344  77.408  199.333 1.00 59.80  ? 153  ARG G CB  1 
ATOM   9829  C CG  . ARG G  1 153 ? 11.368  78.547  200.307 1.00 60.96  ? 153  ARG G CG  1 
ATOM   9830  C CD  . ARG G  1 153 ? 11.274  79.868  199.587 1.00 61.76  ? 153  ARG G CD  1 
ATOM   9831  N NE  . ARG G  1 153 ? 9.899   80.345  199.522 1.00 63.54  ? 153  ARG G NE  1 
ATOM   9832  C CZ  . ARG G  1 153 ? 9.236   80.610  198.403 1.00 64.63  ? 153  ARG G CZ  1 
ATOM   9833  N NH1 . ARG G  1 153 ? 9.816   80.448  197.230 1.00 66.97  ? 153  ARG G NH1 1 
ATOM   9834  N NH2 . ARG G  1 153 ? 7.983   81.028  198.456 1.00 65.26  ? 153  ARG G NH2 1 
ATOM   9835  N N   . ALA G  1 154 ? 12.365  74.547  198.306 1.00 59.47  ? 154  ALA G N   1 
ATOM   9836  C CA  . ALA G  1 154 ? 12.333  73.528  197.252 1.00 58.40  ? 154  ALA G CA  1 
ATOM   9837  C C   . ALA G  1 154 ? 11.796  72.227  197.815 1.00 57.78  ? 154  ALA G C   1 
ATOM   9838  O O   . ALA G  1 154 ? 10.961  71.580  197.212 1.00 57.82  ? 154  ALA G O   1 
ATOM   9839  C CB  . ALA G  1 154 ? 13.728  73.309  196.672 1.00 58.03  ? 154  ALA G CB  1 
ATOM   9840  N N   . LEU G  1 155 ? 12.278  71.846  198.983 1.00 57.89  ? 155  LEU G N   1 
ATOM   9841  C CA  . LEU G  1 155 ? 11.826  70.614  199.613 1.00 58.65  ? 155  LEU G CA  1 
ATOM   9842  C C   . LEU G  1 155 ? 10.311  70.615  199.948 1.00 59.79  ? 155  LEU G C   1 
ATOM   9843  O O   . LEU G  1 155 ? 9.648   69.573  199.881 1.00 59.33  ? 155  LEU G O   1 
ATOM   9844  C CB  . LEU G  1 155 ? 12.651  70.360  200.868 1.00 57.02  ? 155  LEU G CB  1 
ATOM   9845  C CG  . LEU G  1 155 ? 13.754  69.294  200.944 1.00 55.85  ? 155  LEU G CG  1 
ATOM   9846  C CD1 . LEU G  1 155 ? 13.874  68.516  199.675 1.00 54.94  ? 155  LEU G CD1 1 
ATOM   9847  C CD2 . LEU G  1 155 ? 15.057  69.971  201.288 1.00 53.92  ? 155  LEU G CD2 1 
ATOM   9848  N N   . ARG G  1 156 ? 9.756   71.779  200.283 1.00 61.27  ? 156  ARG G N   1 
ATOM   9849  C CA  . ARG G  1 156 ? 8.329   71.853  200.608 1.00 62.78  ? 156  ARG G CA  1 
ATOM   9850  C C   . ARG G  1 156 ? 7.493   71.221  199.515 1.00 63.83  ? 156  ARG G C   1 
ATOM   9851  O O   . ARG G  1 156 ? 6.440   70.660  199.777 1.00 64.86  ? 156  ARG G O   1 
ATOM   9852  C CB  . ARG G  1 156 ? 7.835   73.297  200.749 1.00 62.52  ? 156  ARG G CB  1 
ATOM   9853  C CG  . ARG G  1 156 ? 8.435   74.158  201.857 1.00 63.80  ? 156  ARG G CG  1 
ATOM   9854  C CD  . ARG G  1 156 ? 7.472   75.336  202.111 1.00 66.51  ? 156  ARG G CD  1 
ATOM   9855  N NE  . ARG G  1 156 ? 8.064   76.580  202.622 1.00 67.22  ? 156  ARG G NE  1 
ATOM   9856  C CZ  . ARG G  1 156 ? 8.843   76.684  203.694 1.00 67.31  ? 156  ARG G CZ  1 
ATOM   9857  N NH1 . ARG G  1 156 ? 9.169   75.601  204.415 1.00 65.46  ? 156  ARG G NH1 1 
ATOM   9858  N NH2 . ARG G  1 156 ? 9.280   77.892  204.041 1.00 66.48  ? 156  ARG G NH2 1 
ATOM   9859  N N   . SER G  1 157 ? 7.953   71.330  198.280 1.00 65.34  ? 157  SER G N   1 
ATOM   9860  C CA  . SER G  1 157 ? 7.205   70.808  197.141 1.00 66.55  ? 157  SER G CA  1 
ATOM   9861  C C   . SER G  1 157 ? 6.854   69.334  197.203 1.00 66.51  ? 157  SER G C   1 
ATOM   9862  O O   . SER G  1 157 ? 5.878   68.892  196.601 1.00 66.16  ? 157  SER G O   1 
ATOM   9863  C CB  . SER G  1 157 ? 7.968   71.107  195.857 1.00 66.98  ? 157  SER G CB  1 
ATOM   9864  O OG  . SER G  1 157 ? 8.164   72.510  195.741 1.00 67.46  ? 157  SER G OG  1 
ATOM   9865  N N   . PHE G  1 158 ? 7.646   68.570  197.932 1.00 66.58  ? 158  PHE G N   1 
ATOM   9866  C CA  . PHE G  1 158 ? 7.368   67.158  198.047 1.00 67.10  ? 158  PHE G CA  1 
ATOM   9867  C C   . PHE G  1 158 ? 6.200   66.783  198.965 1.00 67.52  ? 158  PHE G C   1 
ATOM   9868  O O   . PHE G  1 158 ? 5.677   65.668  198.893 1.00 67.95  ? 158  PHE G O   1 
ATOM   9869  C CB  . PHE G  1 158 ? 8.627   66.440  198.481 1.00 67.74  ? 158  PHE G CB  1 
ATOM   9870  C CG  . PHE G  1 158 ? 9.667   66.379  197.411 1.00 68.93  ? 158  PHE G CG  1 
ATOM   9871  C CD1 . PHE G  1 158 ? 10.849  67.091  197.527 1.00 69.22  ? 158  PHE G CD1 1 
ATOM   9872  C CD2 . PHE G  1 158 ? 9.472   65.589  196.274 1.00 69.49  ? 158  PHE G CD2 1 
ATOM   9873  C CE1 . PHE G  1 158 ? 11.828  67.011  196.525 1.00 69.42  ? 158  PHE G CE1 1 
ATOM   9874  C CE2 . PHE G  1 158 ? 10.445  65.509  195.276 1.00 68.85  ? 158  PHE G CE2 1 
ATOM   9875  C CZ  . PHE G  1 158 ? 11.619  66.218  195.402 1.00 68.81  ? 158  PHE G CZ  1 
ATOM   9876  N N   . GLY G  1 159 ? 5.781   67.695  199.835 1.00 68.14  ? 159  GLY G N   1 
ATOM   9877  C CA  . GLY G  1 159 ? 4.665   67.378  200.718 1.00 67.72  ? 159  GLY G CA  1 
ATOM   9878  C C   . GLY G  1 159 ? 4.641   68.059  202.073 1.00 67.29  ? 159  GLY G C   1 
ATOM   9879  O O   . GLY G  1 159 ? 5.538   68.828  202.428 1.00 67.17  ? 159  GLY G O   1 
ATOM   9880  N N   . ASN G  1 160 ? 3.596   67.769  202.843 1.00 67.06  ? 160  ASN G N   1 
ATOM   9881  C CA  . ASN G  1 160 ? 3.455   68.343  204.173 1.00 65.33  ? 160  ASN G CA  1 
ATOM   9882  C C   . ASN G  1 160 ? 4.618   67.919  205.058 1.00 63.72  ? 160  ASN G C   1 
ATOM   9883  O O   . ASN G  1 160 ? 5.229   68.744  205.726 1.00 63.48  ? 160  ASN G O   1 
ATOM   9884  C CB  . ASN G  1 160 ? 2.137   67.898  204.800 1.00 65.46  ? 160  ASN G CB  1 
ATOM   9885  C CG  . ASN G  1 160 ? 0.929   68.407  204.038 1.00 65.68  ? 160  ASN G CG  1 
ATOM   9886  O OD1 . ASN G  1 160 ? 0.825   69.594  203.702 1.00 64.34  ? 160  ASN G OD1 1 
ATOM   9887  N ND2 . ASN G  1 160 ? -0.001  67.509  203.772 1.00 66.12  ? 160  ASN G ND2 1 
ATOM   9888  N N   . ALA G  1 161 ? 4.936   66.632  205.032 1.00 62.05  ? 161  ALA G N   1 
ATOM   9889  C CA  . ALA G  1 161 ? 6.013   66.110  205.852 1.00 61.29  ? 161  ALA G CA  1 
ATOM   9890  C C   . ALA G  1 161 ? 7.342   66.829  205.677 1.00 61.09  ? 161  ALA G C   1 
ATOM   9891  O O   . ALA G  1 161 ? 8.215   66.724  206.539 1.00 60.70  ? 161  ALA G O   1 
ATOM   9892  C CB  . ALA G  1 161 ? 6.196   64.637  205.584 1.00 60.82  ? 161  ALA G CB  1 
ATOM   9893  N N   . LEU G  1 162 ? 7.509   67.544  204.565 1.00 60.42  ? 162  LEU G N   1 
ATOM   9894  C CA  . LEU G  1 162 ? 8.764   68.250  204.317 1.00 59.07  ? 162  LEU G CA  1 
ATOM   9895  C C   . LEU G  1 162 ? 8.587   69.749  204.420 1.00 59.07  ? 162  LEU G C   1 
ATOM   9896  O O   . LEU G  1 162 ? 9.436   70.522  203.973 1.00 58.45  ? 162  LEU G O   1 
ATOM   9897  C CB  . LEU G  1 162 ? 9.360   67.853  202.961 1.00 57.57  ? 162  LEU G CB  1 
ATOM   9898  C CG  . LEU G  1 162 ? 10.402  66.723  202.940 1.00 56.30  ? 162  LEU G CG  1 
ATOM   9899  C CD1 . LEU G  1 162 ? 11.622  67.184  203.674 1.00 56.39  ? 162  LEU G CD1 1 
ATOM   9900  C CD2 . LEU G  1 162 ? 9.891   65.462  203.596 1.00 55.80  ? 162  LEU G CD2 1 
ATOM   9901  N N   . GLY G  1 163 ? 7.475   70.156  205.023 1.00 59.41  ? 163  GLY G N   1 
ATOM   9902  C CA  . GLY G  1 163 ? 7.246   71.570  205.238 1.00 60.34  ? 163  GLY G CA  1 
ATOM   9903  C C   . GLY G  1 163 ? 6.117   72.272  204.527 1.00 61.95  ? 163  GLY G C   1 
ATOM   9904  O O   . GLY G  1 163 ? 5.851   73.452  204.792 1.00 60.79  ? 163  GLY G O   1 
ATOM   9905  N N   . ASN G  1 164 ? 5.430   71.576  203.632 1.00 64.18  ? 164  ASN G N   1 
ATOM   9906  C CA  . ASN G  1 164 ? 4.362   72.244  202.911 1.00 66.83  ? 164  ASN G CA  1 
ATOM   9907  C C   . ASN G  1 164 ? 3.204   72.740  203.794 1.00 68.88  ? 164  ASN G C   1 
ATOM   9908  O O   . ASN G  1 164 ? 2.487   73.673  203.427 1.00 68.90  ? 164  ASN G O   1 
ATOM   9909  C CB  . ASN G  1 164 ? 3.825   71.347  201.806 1.00 66.41  ? 164  ASN G CB  1 
ATOM   9910  C CG  . ASN G  1 164 ? 2.915   72.098  200.864 1.00 66.31  ? 164  ASN G CG  1 
ATOM   9911  O OD1 . ASN G  1 164 ? 1.854   71.595  200.481 1.00 66.67  ? 164  ASN G OD1 1 
ATOM   9912  N ND2 . ASN G  1 164 ? 3.317   73.316  200.490 1.00 65.00  ? 164  ASN G ND2 1 
ATOM   9913  N N   . CYS G  1 165 ? 3.011   72.124  204.955 1.00 71.27  ? 165  CYS G N   1 
ATOM   9914  C CA  . CYS G  1 165 ? 1.929   72.567  205.846 1.00 73.15  ? 165  CYS G CA  1 
ATOM   9915  C C   . CYS G  1 165 ? 2.220   73.965  206.444 1.00 73.80  ? 165  CYS G C   1 
ATOM   9916  O O   . CYS G  1 165 ? 1.335   74.826  206.526 1.00 72.93  ? 165  CYS G O   1 
ATOM   9917  C CB  . CYS G  1 165 ? 1.710   71.529  206.970 1.00 73.08  ? 165  CYS G CB  1 
ATOM   9918  S SG  . CYS G  1 165 ? 3.193   70.976  207.883 1.00 72.95  ? 165  CYS G SG  1 
ATOM   9919  N N   . ILE G  1 166 ? 3.485   74.169  206.804 1.00 75.15  ? 166  ILE G N   1 
ATOM   9920  C CA  . ILE G  1 166 ? 4.009   75.378  207.430 1.00 76.65  ? 166  ILE G CA  1 
ATOM   9921  C C   . ILE G  1 166 ? 3.391   76.743  207.141 1.00 77.78  ? 166  ILE G C   1 
ATOM   9922  O O   . ILE G  1 166 ? 3.452   77.642  207.973 1.00 78.24  ? 166  ILE G O   1 
ATOM   9923  C CB  . ILE G  1 166 ? 5.531   75.466  207.174 1.00 76.51  ? 166  ILE G CB  1 
ATOM   9924  C CG1 . ILE G  1 166 ? 6.279   75.690  208.498 1.00 76.75  ? 166  ILE G CG1 1 
ATOM   9925  C CG2 . ILE G  1 166 ? 5.819   76.547  206.158 1.00 76.22  ? 166  ILE G CG2 1 
ATOM   9926  C CD1 . ILE G  1 166 ? 6.075   77.067  209.112 1.00 77.03  ? 166  ILE G CD1 1 
ATOM   9927  N N   . LEU G  1 167 ? 2.801   76.928  205.977 1.00 79.50  ? 167  LEU G N   1 
ATOM   9928  C CA  . LEU G  1 167 ? 2.237   78.235  205.678 1.00 81.14  ? 167  LEU G CA  1 
ATOM   9929  C C   . LEU G  1 167 ? 0.710   78.206  205.586 1.00 81.74  ? 167  LEU G C   1 
ATOM   9930  O O   . LEU G  1 167 ? 0.069   79.208  205.246 1.00 81.70  ? 167  LEU G O   1 
ATOM   9931  C CB  . LEU G  1 167 ? 2.905   78.795  204.400 1.00 82.41  ? 167  LEU G CB  1 
ATOM   9932  C CG  . LEU G  1 167 ? 3.112   77.967  203.109 1.00 83.10  ? 167  LEU G CG  1 
ATOM   9933  C CD1 . LEU G  1 167 ? 3.611   76.537  203.401 1.00 83.22  ? 167  LEU G CD1 1 
ATOM   9934  C CD2 . LEU G  1 167 ? 1.795   77.919  202.355 1.00 83.47  ? 167  LEU G CD2 1 
ATOM   9935  N N   . ASP G  1 168 ? 0.151   77.043  205.925 1.00 82.42  ? 168  ASP G N   1 
ATOM   9936  C CA  . ASP G  1 168 ? -1.291  76.790  205.927 1.00 83.37  ? 168  ASP G CA  1 
ATOM   9937  C C   . ASP G  1 168 ? -1.875  77.368  207.226 1.00 83.95  ? 168  ASP G C   1 
ATOM   9938  O O   . ASP G  1 168 ? -1.723  76.788  208.303 1.00 84.18  ? 168  ASP G O   1 
ATOM   9939  C CB  . ASP G  1 168 ? -1.531  75.267  205.846 1.00 83.74  ? 168  ASP G CB  1 
ATOM   9940  C CG  . ASP G  1 168 ? -3.016  74.880  205.929 1.00 84.34  ? 168  ASP G CG  1 
ATOM   9941  O OD1 . ASP G  1 168 ? -3.307  73.657  205.872 1.00 83.13  ? 168  ASP G OD1 1 
ATOM   9942  O OD2 . ASP G  1 168 ? -3.880  75.785  206.045 1.00 84.41  ? 168  ASP G OD2 1 
ATOM   9943  N N   . LYS G  1 169 ? -2.542  78.509  207.126 1.00 84.31  ? 169  LYS G N   1 
ATOM   9944  C CA  . LYS G  1 169 ? -3.114  79.155  208.302 1.00 85.04  ? 169  LYS G CA  1 
ATOM   9945  C C   . LYS G  1 169 ? -3.984  78.282  209.208 1.00 84.72  ? 169  LYS G C   1 
ATOM   9946  O O   . LYS G  1 169 ? -3.988  78.478  210.417 1.00 84.46  ? 169  LYS G O   1 
ATOM   9947  C CB  . LYS G  1 169 ? -3.891  80.402  207.874 1.00 85.99  ? 169  LYS G CB  1 
ATOM   9948  C CG  . LYS G  1 169 ? -2.994  81.445  207.220 1.00 87.07  ? 169  LYS G CG  1 
ATOM   9949  C CD  . LYS G  1 169 ? -3.784  82.532  206.513 1.00 88.04  ? 169  LYS G CD  1 
ATOM   9950  C CE  . LYS G  1 169 ? -2.869  83.395  205.641 1.00 88.62  ? 169  LYS G CE  1 
ATOM   9951  N NZ  . LYS G  1 169 ? -3.628  84.418  204.855 1.00 89.18  ? 169  LYS G NZ  1 
ATOM   9952  N N   . ASP G  1 170 ? -4.715  77.328  208.642 1.00 84.56  ? 170  ASP G N   1 
ATOM   9953  C CA  . ASP G  1 170 ? -5.555  76.464  209.464 1.00 84.73  ? 170  ASP G CA  1 
ATOM   9954  C C   . ASP G  1 170 ? -4.704  75.503  210.282 1.00 84.65  ? 170  ASP G C   1 
ATOM   9955  O O   . ASP G  1 170 ? -5.089  75.091  211.380 1.00 85.50  ? 170  ASP G O   1 
ATOM   9956  C CB  . ASP G  1 170 ? -6.539  75.678  208.596 1.00 84.53  ? 170  ASP G CB  1 
ATOM   9957  C CG  . ASP G  1 170 ? -7.501  76.584  207.852 1.00 84.86  ? 170  ASP G CG  1 
ATOM   9958  O OD1 . ASP G  1 170 ? -8.156  77.427  208.493 1.00 84.99  ? 170  ASP G OD1 1 
ATOM   9959  O OD2 . ASP G  1 170 ? -7.604  76.456  206.617 1.00 85.58  ? 170  ASP G OD2 1 
ATOM   9960  N N   . TYR G  1 171 ? -3.552  75.141  209.734 1.00 83.85  ? 171  TYR G N   1 
ATOM   9961  C CA  . TYR G  1 171 ? -2.623  74.238  210.405 1.00 83.09  ? 171  TYR G CA  1 
ATOM   9962  C C   . TYR G  1 171 ? -1.945  75.019  211.529 1.00 84.39  ? 171  TYR G C   1 
ATOM   9963  O O   . TYR G  1 171 ? -1.781  74.518  212.643 1.00 84.93  ? 171  TYR G O   1 
ATOM   9964  C CB  . TYR G  1 171 ? -1.574  73.739  209.405 1.00 79.73  ? 171  TYR G CB  1 
ATOM   9965  C CG  . TYR G  1 171 ? -0.295  73.213  210.021 1.00 75.89  ? 171  TYR G CG  1 
ATOM   9966  C CD1 . TYR G  1 171 ? -0.200  71.894  210.479 1.00 74.64  ? 171  TYR G CD1 1 
ATOM   9967  C CD2 . TYR G  1 171 ? 0.821   74.039  210.150 1.00 73.56  ? 171  TYR G CD2 1 
ATOM   9968  C CE1 . TYR G  1 171 ? 0.980   71.415  211.049 1.00 72.91  ? 171  TYR G CE1 1 
ATOM   9969  C CE2 . TYR G  1 171 ? 1.990   73.571  210.714 1.00 72.33  ? 171  TYR G CE2 1 
ATOM   9970  C CZ  . TYR G  1 171 ? 2.067   72.262  211.162 1.00 71.99  ? 171  TYR G CZ  1 
ATOM   9971  O OH  . TYR G  1 171 ? 3.228   71.806  211.736 1.00 72.17  ? 171  TYR G OH  1 
ATOM   9972  N N   . LEU G  1 172 ? -1.540  76.249  211.227 1.00 85.67  ? 172  LEU G N   1 
ATOM   9973  C CA  . LEU G  1 172 ? -0.888  77.097  212.222 1.00 86.61  ? 172  LEU G CA  1 
ATOM   9974  C C   . LEU G  1 172 ? -1.824  77.317  213.410 1.00 87.19  ? 172  LEU G C   1 
ATOM   9975  O O   . LEU G  1 172 ? -1.436  77.174  214.573 1.00 86.85  ? 172  LEU G O   1 
ATOM   9976  C CB  . LEU G  1 172 ? -0.516  78.440  211.592 1.00 86.43  ? 172  LEU G CB  1 
ATOM   9977  C CG  . LEU G  1 172 ? 0.623   78.351  210.574 1.00 86.68  ? 172  LEU G CG  1 
ATOM   9978  C CD1 . LEU G  1 172 ? 0.897   79.728  209.981 1.00 86.00  ? 172  LEU G CD1 1 
ATOM   9979  C CD2 . LEU G  1 172 ? 1.875   77.787  211.259 1.00 86.37  ? 172  LEU G CD2 1 
ATOM   9980  N N   . ARG G  1 173 ? -3.064  77.657  213.082 1.00 88.32  ? 173  ARG G N   1 
ATOM   9981  C CA  . ARG G  1 173 ? -4.124  77.905  214.050 1.00 88.79  ? 173  ARG G CA  1 
ATOM   9982  C C   . ARG G  1 173 ? -4.291  76.733  215.009 1.00 87.91  ? 173  ARG G C   1 
ATOM   9983  O O   . ARG G  1 173 ? -4.225  76.904  216.219 1.00 87.75  ? 173  ARG G O   1 
ATOM   9984  C CB  . ARG G  1 173 ? -5.433  78.159  213.298 1.00 90.58  ? 173  ARG G CB  1 
ATOM   9985  C CG  . ARG G  1 173 ? -6.503  78.889  214.076 1.00 93.09  ? 173  ARG G CG  1 
ATOM   9986  C CD  . ARG G  1 173 ? -7.434  79.631  213.114 1.00 95.80  ? 173  ARG G CD  1 
ATOM   9987  N NE  . ARG G  1 173 ? -7.884  78.780  212.013 1.00 98.64  ? 173  ARG G NE  1 
ATOM   9988  C CZ  . ARG G  1 173 ? -8.560  77.641  212.167 1.00 100.36 ? 173  ARG G CZ  1 
ATOM   9989  N NH1 . ARG G  1 173 ? -8.874  77.207  213.387 1.00 100.93 ? 173  ARG G NH1 1 
ATOM   9990  N NH2 . ARG G  1 173 ? -8.917  76.927  211.100 1.00 101.37 ? 173  ARG G NH2 1 
ATOM   9991  N N   . SER G  1 174 ? -4.501  75.543  214.468 1.00 87.31  ? 174  SER G N   1 
ATOM   9992  C CA  . SER G  1 174 ? -4.668  74.375  215.306 1.00 87.49  ? 174  SER G CA  1 
ATOM   9993  C C   . SER G  1 174 ? -3.358  73.948  216.008 1.00 88.28  ? 174  SER G C   1 
ATOM   9994  O O   . SER G  1 174 ? -3.360  73.069  216.872 1.00 88.54  ? 174  SER G O   1 
ATOM   9995  C CB  . SER G  1 174 ? -5.249  73.233  214.467 1.00 86.76  ? 174  SER G CB  1 
ATOM   9996  O OG  . SER G  1 174 ? -4.344  72.152  214.367 1.00 86.39  ? 174  SER G OG  1 
ATOM   9997  N N   . LEU G  1 175 ? -2.241  74.572  215.647 1.00 89.04  ? 175  LEU G N   1 
ATOM   9998  C CA  . LEU G  1 175 ? -0.959  74.249  216.271 1.00 90.32  ? 175  LEU G CA  1 
ATOM   9999  C C   . LEU G  1 175 ? -0.909  75.041  217.566 1.00 91.70  ? 175  LEU G C   1 
ATOM   10000 O O   . LEU G  1 175 ? -0.397  74.567  218.588 1.00 92.08  ? 175  LEU G O   1 
ATOM   10001 C CB  . LEU G  1 175 ? 0.213   74.684  215.389 1.00 89.72  ? 175  LEU G CB  1 
ATOM   10002 C CG  . LEU G  1 175 ? 1.221   73.670  214.839 1.00 89.48  ? 175  LEU G CG  1 
ATOM   10003 C CD1 . LEU G  1 175 ? 2.404   74.462  214.330 1.00 88.90  ? 175  LEU G CD1 1 
ATOM   10004 C CD2 . LEU G  1 175 ? 1.682   72.668  215.896 1.00 89.31  ? 175  LEU G CD2 1 
ATOM   10005 N N   . ASN G  1 176 ? -1.440  76.261  217.500 1.00 93.04  ? 176  ASN G N   1 
ATOM   10006 C CA  . ASN G  1 176 ? -1.497  77.170  218.646 1.00 94.36  ? 176  ASN G CA  1 
ATOM   10007 C C   . ASN G  1 176 ? -2.351  76.628  219.772 1.00 94.93  ? 176  ASN G C   1 
ATOM   10008 O O   . ASN G  1 176 ? -2.091  76.894  220.942 1.00 95.76  ? 176  ASN G O   1 
ATOM   10009 C CB  . ASN G  1 176 ? -2.057  78.520  218.226 1.00 95.02  ? 176  ASN G CB  1 
ATOM   10010 C CG  . ASN G  1 176 ? -0.977  79.542  218.038 1.00 96.40  ? 176  ASN G CG  1 
ATOM   10011 O OD1 . ASN G  1 176 ? -0.413  80.051  219.011 1.00 97.21  ? 176  ASN G OD1 1 
ATOM   10012 N ND2 . ASN G  1 176 ? -0.655  79.838  216.782 1.00 97.16  ? 176  ASN G ND2 1 
ATOM   10013 N N   . LYS G  1 177 ? -3.386  75.878  219.407 1.00 95.26  ? 177  LYS G N   1 
ATOM   10014 C CA  . LYS G  1 177 ? -4.289  75.268  220.375 1.00 94.85  ? 177  LYS G CA  1 
ATOM   10015 C C   . LYS G  1 177 ? -3.662  74.027  221.028 1.00 95.31  ? 177  LYS G C   1 
ATOM   10016 O O   . LYS G  1 177 ? -4.360  73.085  221.391 1.00 95.63  ? 177  LYS G O   1 
ATOM   10017 C CB  . LYS G  1 177 ? -5.604  74.899  219.686 1.00 93.42  ? 177  LYS G CB  1 
ATOM   10018 C CG  . LYS G  1 177 ? -6.354  76.108  219.136 1.00 91.76  ? 177  LYS G CG  1 
ATOM   10019 C CD  . LYS G  1 177 ? -7.578  75.683  218.341 1.00 91.10  ? 177  LYS G CD  1 
ATOM   10020 C CE  . LYS G  1 177 ? -8.301  76.882  217.733 1.00 90.59  ? 177  LYS G CE  1 
ATOM   10021 N NZ  . LYS G  1 177 ? -9.481  76.493  216.882 1.00 89.43  ? 177  LYS G NZ  1 
ATOM   10022 N N   . LEU G  1 178 ? -2.343  74.023  221.168 1.00 95.58  ? 178  LEU G N   1 
ATOM   10023 C CA  . LEU G  1 178 ? -1.675  72.909  221.802 1.00 96.37  ? 178  LEU G CA  1 
ATOM   10024 C C   . LEU G  1 178 ? -0.869  73.412  222.983 1.00 97.95  ? 178  LEU G C   1 
ATOM   10025 O O   . LEU G  1 178 ? -0.609  74.613  223.097 1.00 98.00  ? 178  LEU G O   1 
ATOM   10026 C CB  . LEU G  1 178 ? -0.795  72.181  220.801 1.00 95.87  ? 178  LEU G CB  1 
ATOM   10027 C CG  . LEU G  1 178 ? -1.609  71.291  219.864 1.00 95.35  ? 178  LEU G CG  1 
ATOM   10028 C CD1 . LEU G  1 178 ? -0.679  70.312  219.178 1.00 95.29  ? 178  LEU G CD1 1 
ATOM   10029 C CD2 . LEU G  1 178 ? -2.650  70.520  220.657 1.00 94.81  ? 178  LEU G CD2 1 
ATOM   10030 N N   . PRO G  1 179 ? -0.457  72.501  223.883 1.00 99.63  ? 179  PRO G N   1 
ATOM   10031 C CA  . PRO G  1 179 ? 0.324   72.858  225.085 1.00 100.84 ? 179  PRO G CA  1 
ATOM   10032 C C   . PRO G  1 179 ? 1.691   73.482  224.785 1.00 102.07 ? 179  PRO G C   1 
ATOM   10033 O O   . PRO G  1 179 ? 2.325   73.115  223.793 1.00 102.24 ? 179  PRO G O   1 
ATOM   10034 C CB  . PRO G  1 179 ? 0.499   71.511  225.820 1.00 100.38 ? 179  PRO G CB  1 
ATOM   10035 C CG  . PRO G  1 179 ? -0.468  70.547  225.132 1.00 100.31 ? 179  PRO G CG  1 
ATOM   10036 C CD  . PRO G  1 179 ? -0.510  71.036  223.709 1.00 100.03 ? 179  PRO G CD  1 
ATOM   10037 N N   . ARG G  1 180 ? 2.149   74.419  225.621 1.00 103.20 ? 180  ARG G N   1 
ATOM   10038 C CA  . ARG G  1 180 ? 3.489   74.970  225.414 1.00 104.11 ? 180  ARG G CA  1 
ATOM   10039 C C   . ARG G  1 180 ? 4.356   73.710  225.431 1.00 104.21 ? 180  ARG G C   1 
ATOM   10040 O O   . ARG G  1 180 ? 3.882   72.620  225.778 1.00 103.77 ? 180  ARG G O   1 
ATOM   10041 C CB  . ARG G  1 180 ? 3.926   75.881  226.567 1.00 105.40 ? 180  ARG G CB  1 
ATOM   10042 C CG  . ARG G  1 180 ? 5.413   76.307  226.500 1.00 107.03 ? 180  ARG G CG  1 
ATOM   10043 C CD  . ARG G  1 180 ? 6.137   76.194  227.859 1.00 108.66 ? 180  ARG G CD  1 
ATOM   10044 N NE  . ARG G  1 180 ? 5.313   76.725  228.944 1.00 110.40 ? 180  ARG G NE  1 
ATOM   10045 C CZ  . ARG G  1 180 ? 5.756   77.077  230.151 1.00 110.95 ? 180  ARG G CZ  1 
ATOM   10046 N NH1 . ARG G  1 180 ? 7.050   76.965  230.465 1.00 110.78 ? 180  ARG G NH1 1 
ATOM   10047 N NH2 . ARG G  1 180 ? 4.888   77.550  231.047 1.00 110.85 ? 180  ARG G NH2 1 
ATOM   10048 N N   . GLN G  1 181 ? 5.626   73.838  225.087 1.00 104.92 ? 181  GLN G N   1 
ATOM   10049 C CA  . GLN G  1 181 ? 6.454   72.649  225.066 1.00 105.75 ? 181  GLN G CA  1 
ATOM   10050 C C   . GLN G  1 181 ? 7.914   72.878  225.420 1.00 105.89 ? 181  GLN G C   1 
ATOM   10051 O O   . GLN G  1 181 ? 8.605   73.710  224.817 1.00 106.31 ? 181  GLN G O   1 
ATOM   10052 C CB  . GLN G  1 181 ? 6.355   72.003  223.682 1.00 106.34 ? 181  GLN G CB  1 
ATOM   10053 C CG  . GLN G  1 181 ? 7.062   70.670  223.543 1.00 106.18 ? 181  GLN G CG  1 
ATOM   10054 C CD  . GLN G  1 181 ? 7.260   70.299  222.088 1.00 105.84 ? 181  GLN G CD  1 
ATOM   10055 O OE1 . GLN G  1 181 ? 7.377   69.118  221.744 1.00 105.53 ? 181  GLN G OE1 1 
ATOM   10056 N NE2 . GLN G  1 181 ? 7.306   71.313  221.223 1.00 105.19 ? 181  GLN G NE2 1 
ATOM   10057 N N   . LEU G  1 182 ? 8.373   72.124  226.410 1.00 105.50 ? 182  LEU G N   1 
ATOM   10058 C CA  . LEU G  1 182 ? 9.758   72.190  226.843 1.00 105.13 ? 182  LEU G CA  1 
ATOM   10059 C C   . LEU G  1 182 ? 10.625  71.568  225.717 1.00 104.61 ? 182  LEU G C   1 
ATOM   10060 O O   . LEU G  1 182 ? 10.299  70.485  225.200 1.00 104.83 ? 182  LEU G O   1 
ATOM   10061 C CB  . LEU G  1 182 ? 9.905   71.416  228.175 1.00 105.26 ? 182  LEU G CB  1 
ATOM   10062 C CG  . LEU G  1 182 ? 9.313   69.994  228.324 1.00 105.08 ? 182  LEU G CG  1 
ATOM   10063 C CD1 . LEU G  1 182 ? 9.735   69.400  229.657 1.00 104.90 ? 182  LEU G CD1 1 
ATOM   10064 C CD2 . LEU G  1 182 ? 7.790   70.026  228.224 1.00 104.63 ? 182  LEU G CD2 1 
ATOM   10065 N N   . PRO G  1 183 ? 11.717  72.253  225.302 1.00 103.61 ? 183  PRO G N   1 
ATOM   10066 C CA  . PRO G  1 183 ? 12.594  71.725  224.239 1.00 102.71 ? 183  PRO G CA  1 
ATOM   10067 C C   . PRO G  1 183 ? 13.259  70.403  224.650 1.00 102.28 ? 183  PRO G C   1 
ATOM   10068 O O   . PRO G  1 183 ? 14.158  70.395  225.501 1.00 102.09 ? 183  PRO G O   1 
ATOM   10069 C CB  . PRO G  1 183 ? 13.607  72.851  224.038 1.00 102.61 ? 183  PRO G CB  1 
ATOM   10070 C CG  . PRO G  1 183 ? 13.685  73.474  225.409 1.00 103.00 ? 183  PRO G CG  1 
ATOM   10071 C CD  . PRO G  1 183 ? 12.232  73.532  225.825 1.00 102.94 ? 183  PRO G CD  1 
ATOM   10072 N N   . LEU G  1 184 ? 12.822  69.298  224.037 1.00 101.61 ? 184  LEU G N   1 
ATOM   10073 C CA  . LEU G  1 184 ? 13.345  67.967  224.370 1.00 100.86 ? 184  LEU G CA  1 
ATOM   10074 C C   . LEU G  1 184 ? 14.848  67.943  224.603 1.00 100.43 ? 184  LEU G C   1 
ATOM   10075 O O   . LEU G  1 184 ? 15.630  68.587  223.896 1.00 100.30 ? 184  LEU G O   1 
ATOM   10076 C CB  . LEU G  1 184 ? 12.986  66.918  223.301 1.00 100.55 ? 184  LEU G CB  1 
ATOM   10077 C CG  . LEU G  1 184 ? 12.934  65.449  223.794 1.00 100.39 ? 184  LEU G CG  1 
ATOM   10078 C CD1 . LEU G  1 184 ? 12.388  64.580  222.685 1.00 100.16 ? 184  LEU G CD1 1 
ATOM   10079 C CD2 . LEU G  1 184 ? 14.302  64.923  224.237 1.00 99.50  ? 184  LEU G CD2 1 
ATOM   10080 N N   . GLU G  1 185 ? 15.233  67.174  225.614 1.00 99.63  ? 185  GLU G N   1 
ATOM   10081 C CA  . GLU G  1 185 ? 16.617  67.049  225.996 1.00 98.88  ? 185  GLU G CA  1 
ATOM   10082 C C   . GLU G  1 185 ? 17.420  66.187  225.046 1.00 98.09  ? 185  GLU G C   1 
ATOM   10083 O O   . GLU G  1 185 ? 16.959  65.133  224.586 1.00 98.37  ? 185  GLU G O   1 
ATOM   10084 C CB  . GLU G  1 185 ? 16.703  66.513  227.430 1.00 99.36  ? 185  GLU G CB  1 
ATOM   10085 C CG  . GLU G  1 185 ? 16.049  67.457  228.426 1.00 100.09 ? 185  GLU G CG  1 
ATOM   10086 C CD  . GLU G  1 185 ? 16.445  68.915  228.176 1.00 100.80 ? 185  GLU G CD  1 
ATOM   10087 O OE1 . GLU G  1 185 ? 17.563  69.312  228.594 1.00 100.71 ? 185  GLU G OE1 1 
ATOM   10088 O OE2 . GLU G  1 185 ? 15.640  69.651  227.545 1.00 100.64 ? 185  GLU G OE2 1 
ATOM   10089 N N   . VAL G  1 186 ? 18.631  66.657  224.757 1.00 96.57  ? 186  VAL G N   1 
ATOM   10090 C CA  . VAL G  1 186 ? 19.537  65.958  223.869 1.00 95.13  ? 186  VAL G CA  1 
ATOM   10091 C C   . VAL G  1 186 ? 20.389  64.905  224.625 1.00 94.01  ? 186  VAL G C   1 
ATOM   10092 O O   . VAL G  1 186 ? 21.305  65.213  225.409 1.00 92.97  ? 186  VAL G O   1 
ATOM   10093 C CB  . VAL G  1 186 ? 20.386  67.015  223.069 1.00 95.43  ? 186  VAL G CB  1 
ATOM   10094 C CG1 . VAL G  1 186 ? 21.482  66.349  222.229 1.00 95.39  ? 186  VAL G CG1 1 
ATOM   10095 C CG2 . VAL G  1 186 ? 19.451  67.796  222.146 1.00 94.49  ? 186  VAL G CG2 1 
ATOM   10096 N N   . ASP G  1 187 ? 20.034  63.647  224.386 1.00 92.60  ? 187  ASP G N   1 
ATOM   10097 C CA  . ASP G  1 187 ? 20.706  62.519  224.991 1.00 91.93  ? 187  ASP G CA  1 
ATOM   10098 C C   . ASP G  1 187 ? 22.006  62.192  224.246 1.00 91.09  ? 187  ASP G C   1 
ATOM   10099 O O   . ASP G  1 187 ? 22.005  61.434  223.274 1.00 90.52  ? 187  ASP G O   1 
ATOM   10100 C CB  . ASP G  1 187 ? 19.752  61.315  224.988 1.00 92.84  ? 187  ASP G CB  1 
ATOM   10101 C CG  . ASP G  1 187 ? 20.417  60.011  225.456 1.00 93.55  ? 187  ASP G CG  1 
ATOM   10102 O OD1 . ASP G  1 187 ? 19.696  58.992  225.570 1.00 93.64  ? 187  ASP G OD1 1 
ATOM   10103 O OD2 . ASP G  1 187 ? 21.648  59.989  225.699 1.00 93.67  ? 187  ASP G OD2 1 
ATOM   10104 N N   . LEU G  1 188 ? 23.115  62.760  224.722 1.00 90.32  ? 188  LEU G N   1 
ATOM   10105 C CA  . LEU G  1 188 ? 24.434  62.538  224.120 1.00 89.77  ? 188  LEU G CA  1 
ATOM   10106 C C   . LEU G  1 188 ? 25.134  61.266  224.612 1.00 89.22  ? 188  LEU G C   1 
ATOM   10107 O O   . LEU G  1 188 ? 26.367  61.154  224.556 1.00 88.89  ? 188  LEU G O   1 
ATOM   10108 C CB  . LEU G  1 188 ? 25.342  63.738  224.388 1.00 89.90  ? 188  LEU G CB  1 
ATOM   10109 C CG  . LEU G  1 188 ? 24.787  65.064  223.866 1.00 90.57  ? 188  LEU G CG  1 
ATOM   10110 C CD1 . LEU G  1 188 ? 25.784  66.187  224.135 1.00 90.42  ? 188  LEU G CD1 1 
ATOM   10111 C CD2 . LEU G  1 188 ? 24.496  64.934  222.367 1.00 90.70  ? 188  LEU G CD2 1 
ATOM   10112 N N   . THR G  1 189 ? 24.345  60.309  225.085 1.00 88.33  ? 189  THR G N   1 
ATOM   10113 C CA  . THR G  1 189 ? 24.895  59.066  225.582 1.00 87.77  ? 189  THR G CA  1 
ATOM   10114 C C   . THR G  1 189 ? 25.798  58.492  224.528 1.00 86.95  ? 189  THR G C   1 
ATOM   10115 O O   . THR G  1 189 ? 27.001  58.715  224.516 1.00 86.36  ? 189  THR G O   1 
ATOM   10116 C CB  . THR G  1 189 ? 23.782  58.021  225.868 1.00 88.58  ? 189  THR G CB  1 
ATOM   10117 O OG1 . THR G  1 189 ? 22.956  58.485  226.942 1.00 88.62  ? 189  THR G OG1 1 
ATOM   10118 C CG2 . THR G  1 189 ? 24.393  56.635  226.232 1.00 88.46  ? 189  THR G CG2 1 
ATOM   10119 N N   . LYS G  1 190 ? 25.157  57.760  223.633 1.00 87.25  ? 190  LYS G N   1 
ATOM   10120 C CA  . LYS G  1 190 ? 25.793  57.063  222.536 1.00 87.83  ? 190  LYS G CA  1 
ATOM   10121 C C   . LYS G  1 190 ? 26.518  57.940  221.489 1.00 88.19  ? 190  LYS G C   1 
ATOM   10122 O O   . LYS G  1 190 ? 27.085  57.407  220.513 1.00 87.89  ? 190  LYS G O   1 
ATOM   10123 C CB  . LYS G  1 190 ? 24.732  56.183  221.873 1.00 87.41  ? 190  LYS G CB  1 
ATOM   10124 C CG  . LYS G  1 190 ? 24.028  55.280  222.862 1.00 86.65  ? 190  LYS G CG  1 
ATOM   10125 C CD  . LYS G  1 190 ? 22.933  54.491  222.199 1.00 87.09  ? 190  LYS G CD  1 
ATOM   10126 C CE  . LYS G  1 190 ? 22.152  53.657  223.218 1.00 87.51  ? 190  LYS G CE  1 
ATOM   10127 N NZ  . LYS G  1 190 ? 20.790  53.239  222.712 1.00 86.91  ? 190  LYS G NZ  1 
ATOM   10128 N N   . ALA G  1 191 ? 26.521  59.265  221.707 1.00 87.80  ? 191  ALA G N   1 
ATOM   10129 C CA  . ALA G  1 191 ? 27.169  60.229  220.805 1.00 86.93  ? 191  ALA G CA  1 
ATOM   10130 C C   . ALA G  1 191 ? 28.530  59.738  220.275 1.00 87.02  ? 191  ALA G C   1 
ATOM   10131 O O   . ALA G  1 191 ? 29.349  59.186  221.022 1.00 87.58  ? 191  ALA G O   1 
ATOM   10132 C CB  . ALA G  1 191 ? 27.327  61.568  221.508 1.00 85.79  ? 191  ALA G CB  1 
ATOM   10133 N N   . LYS G  1 192 ? 28.752  59.950  218.978 1.00 86.50  ? 192  LYS G N   1 
ATOM   10134 C CA  . LYS G  1 192 ? 29.964  59.529  218.287 1.00 85.68  ? 192  LYS G CA  1 
ATOM   10135 C C   . LYS G  1 192 ? 31.239  60.142  218.839 1.00 85.95  ? 192  LYS G C   1 
ATOM   10136 O O   . LYS G  1 192 ? 31.346  61.359  218.968 1.00 85.50  ? 192  LYS G O   1 
ATOM   10137 C CB  . LYS G  1 192 ? 29.815  59.860  216.798 1.00 85.25  ? 192  LYS G CB  1 
ATOM   10138 C CG  . LYS G  1 192 ? 31.101  59.848  215.986 1.00 83.91  ? 192  LYS G CG  1 
ATOM   10139 C CD  . LYS G  1 192 ? 30.806  59.999  214.497 1.00 82.05  ? 192  LYS G CD  1 
ATOM   10140 C CE  . LYS G  1 192 ? 30.626  58.655  213.807 1.00 80.10  ? 192  LYS G CE  1 
ATOM   10141 N NZ  . LYS G  1 192 ? 31.936  58.075  213.412 1.00 78.64  ? 192  LYS G NZ  1 
ATOM   10142 N N   . ARG G  1 193 ? 32.204  59.286  219.166 1.00 86.64  ? 193  ARG G N   1 
ATOM   10143 C CA  . ARG G  1 193 ? 33.497  59.734  219.700 1.00 87.42  ? 193  ARG G CA  1 
ATOM   10144 C C   . ARG G  1 193 ? 34.612  59.224  218.798 1.00 87.67  ? 193  ARG G C   1 
ATOM   10145 O O   . ARG G  1 193 ? 35.783  59.560  218.965 1.00 87.42  ? 193  ARG G O   1 
ATOM   10146 C CB  . ARG G  1 193 ? 33.708  59.188  221.112 1.00 87.40  ? 193  ARG G CB  1 
ATOM   10147 C CG  . ARG G  1 193 ? 32.609  59.558  222.054 1.00 87.59  ? 193  ARG G CG  1 
ATOM   10148 C CD  . ARG G  1 193 ? 32.434  58.503  223.117 1.00 88.08  ? 193  ARG G CD  1 
ATOM   10149 N NE  . ARG G  1 193 ? 31.156  58.690  223.795 1.00 88.84  ? 193  ARG G NE  1 
ATOM   10150 C CZ  . ARG G  1 193 ? 30.823  59.793  224.464 1.00 89.21  ? 193  ARG G CZ  1 
ATOM   10151 N NH1 . ARG G  1 193 ? 31.689  60.805  224.543 1.00 88.76  ? 193  ARG G NH1 1 
ATOM   10152 N NH2 . ARG G  1 193 ? 29.622  59.892  225.046 1.00 88.58  ? 193  ARG G NH2 1 
ATOM   10153 N N   . GLN G  1 194 ? 34.227  58.410  217.829 1.00 88.41  ? 194  GLN G N   1 
ATOM   10154 C CA  . GLN G  1 194 ? 35.176  57.828  216.898 1.00 89.13  ? 194  GLN G CA  1 
ATOM   10155 C C   . GLN G  1 194 ? 34.869  58.129  215.422 1.00 88.78  ? 194  GLN G C   1 
ATOM   10156 O O   . GLN G  1 194 ? 33.711  58.316  215.039 1.00 88.84  ? 194  GLN G O   1 
ATOM   10157 C CB  . GLN G  1 194 ? 35.197  56.317  217.101 1.00 90.06  ? 194  GLN G CB  1 
ATOM   10158 C CG  . GLN G  1 194 ? 36.421  55.811  217.793 1.00 91.16  ? 194  GLN G CG  1 
ATOM   10159 C CD  . GLN G  1 194 ? 36.712  54.403  217.357 1.00 92.16  ? 194  GLN G CD  1 
ATOM   10160 O OE1 . GLN G  1 194 ? 37.749  53.828  217.694 1.00 92.78  ? 194  GLN G OE1 1 
ATOM   10161 N NE2 . GLN G  1 194 ? 35.789  53.833  216.591 1.00 91.56  ? 194  GLN G NE2 1 
ATOM   10162 N N   . ASP G  1 195 ? 35.916  58.180  214.599 1.00 87.95  ? 195  ASP G N   1 
ATOM   10163 C CA  . ASP G  1 195 ? 35.749  58.404  213.169 1.00 86.49  ? 195  ASP G CA  1 
ATOM   10164 C C   . ASP G  1 195 ? 35.290  57.038  212.637 1.00 86.45  ? 195  ASP G C   1 
ATOM   10165 O O   . ASP G  1 195 ? 34.253  56.923  211.970 1.00 86.65  ? 195  ASP G O   1 
ATOM   10166 C CB  . ASP G  1 195 ? 37.092  58.784  212.528 1.00 85.17  ? 195  ASP G CB  1 
ATOM   10167 C CG  . ASP G  1 195 ? 37.479  60.250  212.746 1.00 83.96  ? 195  ASP G CG  1 
ATOM   10168 O OD1 . ASP G  1 195 ? 38.666  60.573  212.495 1.00 82.53  ? 195  ASP G OD1 1 
ATOM   10169 O OD2 . ASP G  1 195 ? 36.614  61.071  213.142 1.00 82.58  ? 195  ASP G OD2 1 
ATOM   10170 N N   . LEU G  1 196 ? 36.075  56.013  212.978 1.00 86.05  ? 196  LEU G N   1 
ATOM   10171 C CA  . LEU G  1 196 ? 35.848  54.621  212.583 1.00 85.60  ? 196  LEU G CA  1 
ATOM   10172 C C   . LEU G  1 196 ? 34.380  54.171  212.693 1.00 85.33  ? 196  LEU G C   1 
ATOM   10173 O O   . LEU G  1 196 ? 33.656  54.597  213.602 1.00 85.03  ? 196  LEU G O   1 
ATOM   10174 C CB  . LEU G  1 196 ? 36.726  53.712  213.443 1.00 85.88  ? 196  LEU G CB  1 
ATOM   10175 C CG  . LEU G  1 196 ? 37.341  52.455  212.829 1.00 86.16  ? 196  LEU G CG  1 
ATOM   10176 C CD1 . LEU G  1 196 ? 36.272  51.597  212.203 1.00 86.67  ? 196  LEU G CD1 1 
ATOM   10177 C CD2 . LEU G  1 196 ? 38.357  52.859  211.791 1.00 86.76  ? 196  LEU G CD2 1 
ATOM   10178 N N   . GLU G  1 197 ? 33.961  53.303  211.766 1.00 84.52  ? 197  GLU G N   1 
ATOM   10179 C CA  . GLU G  1 197 ? 32.593  52.773  211.713 1.00 83.33  ? 197  GLU G CA  1 
ATOM   10180 C C   . GLU G  1 197 ? 32.649  51.359  211.168 1.00 83.19  ? 197  GLU G C   1 
ATOM   10181 O O   . GLU G  1 197 ? 32.226  51.105  210.048 1.00 82.56  ? 197  GLU G O   1 
ATOM   10182 C CB  . GLU G  1 197 ? 31.758  53.615  210.776 1.00 82.70  ? 197  GLU G CB  1 
ATOM   10183 C CG  . GLU G  1 197 ? 31.548  55.013  211.243 1.00 82.33  ? 197  GLU G CG  1 
ATOM   10184 C CD  . GLU G  1 197 ? 30.576  55.065  212.384 1.00 82.46  ? 197  GLU G CD  1 
ATOM   10185 O OE1 . GLU G  1 197 ? 29.617  54.262  212.372 1.00 82.03  ? 197  GLU G OE1 1 
ATOM   10186 O OE2 . GLU G  1 197 ? 30.761  55.911  213.281 1.00 83.08  ? 197  GLU G OE2 1 
ATOM   10187 N N   . PRO G  1 198 ? 33.143  50.410  211.977 1.00 83.77  ? 198  PRO G N   1 
ATOM   10188 C CA  . PRO G  1 198 ? 33.314  48.977  211.666 1.00 83.66  ? 198  PRO G CA  1 
ATOM   10189 C C   . PRO G  1 198 ? 32.241  48.230  210.870 1.00 82.95  ? 198  PRO G C   1 
ATOM   10190 O O   . PRO G  1 198 ? 32.570  47.287  210.145 1.00 82.29  ? 198  PRO G O   1 
ATOM   10191 C CB  . PRO G  1 198 ? 33.551  48.348  213.046 1.00 83.62  ? 198  PRO G CB  1 
ATOM   10192 C CG  . PRO G  1 198 ? 34.215  49.436  213.794 1.00 83.14  ? 198  PRO G CG  1 
ATOM   10193 C CD  . PRO G  1 198 ? 33.384  50.647  213.412 1.00 83.32  ? 198  PRO G CD  1 
ATOM   10194 N N   . SER G  1 199 ? 30.975  48.623  211.016 1.00 82.87  ? 199  SER G N   1 
ATOM   10195 C CA  . SER G  1 199 ? 29.906  47.946  210.283 1.00 83.09  ? 199  SER G CA  1 
ATOM   10196 C C   . SER G  1 199 ? 29.806  48.597  208.910 1.00 83.75  ? 199  SER G C   1 
ATOM   10197 O O   . SER G  1 199 ? 29.447  47.932  207.922 1.00 84.06  ? 199  SER G O   1 
ATOM   10198 C CB  . SER G  1 199 ? 28.563  48.042  211.020 1.00 82.22  ? 199  SER G CB  1 
ATOM   10199 O OG  . SER G  1 199 ? 28.033  49.351  210.978 1.00 81.49  ? 199  SER G OG  1 
ATOM   10200 N N   . VAL G  1 200 ? 30.120  49.897  208.852 1.00 83.57  ? 200  VAL G N   1 
ATOM   10201 C CA  . VAL G  1 200 ? 30.116  50.607  207.582 1.00 83.31  ? 200  VAL G CA  1 
ATOM   10202 C C   . VAL G  1 200 ? 31.342  50.042  206.860 1.00 84.57  ? 200  VAL G C   1 
ATOM   10203 O O   . VAL G  1 200 ? 31.235  49.549  205.736 1.00 84.69  ? 200  VAL G O   1 
ATOM   10204 C CB  . VAL G  1 200 ? 30.246  52.147  207.755 1.00 82.16  ? 200  VAL G CB  1 
ATOM   10205 C CG1 . VAL G  1 200 ? 30.229  52.817  206.402 1.00 81.45  ? 200  VAL G CG1 1 
ATOM   10206 C CG2 . VAL G  1 200 ? 29.096  52.689  208.575 1.00 81.34  ? 200  VAL G CG2 1 
ATOM   10207 N N   . GLU G  1 201 ? 32.501  50.070  207.517 1.00 85.59  ? 201  GLU G N   1 
ATOM   10208 C CA  . GLU G  1 201 ? 33.706  49.525  206.900 1.00 87.01  ? 201  GLU G CA  1 
ATOM   10209 C C   . GLU G  1 201 ? 33.513  48.042  206.576 1.00 87.63  ? 201  GLU G C   1 
ATOM   10210 O O   . GLU G  1 201 ? 34.179  47.496  205.692 1.00 87.92  ? 201  GLU G O   1 
ATOM   10211 C CB  . GLU G  1 201 ? 34.927  49.699  207.813 1.00 87.48  ? 201  GLU G CB  1 
ATOM   10212 C CG  . GLU G  1 201 ? 36.171  48.929  207.342 1.00 88.57  ? 201  GLU G CG  1 
ATOM   10213 C CD  . GLU G  1 201 ? 36.692  49.383  205.979 1.00 89.99  ? 201  GLU G CD  1 
ATOM   10214 O OE1 . GLU G  1 201 ? 37.343  48.555  205.280 1.00 90.13  ? 201  GLU G OE1 1 
ATOM   10215 O OE2 . GLU G  1 201 ? 36.457  50.568  205.622 1.00 90.19  ? 201  GLU G OE2 1 
ATOM   10216 N N   . GLU G  1 202 ? 32.602  47.387  207.287 1.00 88.35  ? 202  GLU G N   1 
ATOM   10217 C CA  . GLU G  1 202 ? 32.334  45.973  207.039 1.00 89.21  ? 202  GLU G CA  1 
ATOM   10218 C C   . GLU G  1 202 ? 31.627  45.813  205.703 1.00 89.56  ? 202  GLU G C   1 
ATOM   10219 O O   . GLU G  1 202 ? 32.176  45.235  204.761 1.00 89.67  ? 202  GLU G O   1 
ATOM   10220 C CB  . GLU G  1 202 ? 31.453  45.382  208.141 1.00 89.90  ? 202  GLU G CB  1 
ATOM   10221 C CG  . GLU G  1 202 ? 32.201  44.542  209.166 1.00 90.40  ? 202  GLU G CG  1 
ATOM   10222 C CD  . GLU G  1 202 ? 31.342  43.406  209.696 1.00 91.05  ? 202  GLU G CD  1 
ATOM   10223 O OE1 . GLU G  1 202 ? 31.106  42.423  208.942 1.00 90.09  ? 202  GLU G OE1 1 
ATOM   10224 O OE2 . GLU G  1 202 ? 30.895  43.513  210.864 1.00 91.32  ? 202  GLU G OE2 1 
ATOM   10225 N N   . ALA G  1 203 ? 30.401  46.327  205.646 1.00 89.67  ? 203  ALA G N   1 
ATOM   10226 C CA  . ALA G  1 203 ? 29.572  46.280  204.449 1.00 90.27  ? 203  ALA G CA  1 
ATOM   10227 C C   . ALA G  1 203 ? 30.300  46.739  203.179 1.00 90.63  ? 203  ALA G C   1 
ATOM   10228 O O   . ALA G  1 203 ? 30.308  46.042  202.156 1.00 90.18  ? 203  ALA G O   1 
ATOM   10229 C CB  . ALA G  1 203 ? 28.339  47.146  204.665 1.00 90.03  ? 203  ALA G CB  1 
ATOM   10230 N N   . ARG G  1 204 ? 30.894  47.928  203.263 1.00 91.26  ? 204  ARG G N   1 
ATOM   10231 C CA  . ARG G  1 204 ? 31.615  48.560  202.154 1.00 91.97  ? 204  ARG G CA  1 
ATOM   10232 C C   . ARG G  1 204 ? 32.828  47.780  201.712 1.00 93.58  ? 204  ARG G C   1 
ATOM   10233 O O   . ARG G  1 204 ? 33.388  48.050  200.654 1.00 93.63  ? 204  ARG G O   1 
ATOM   10234 C CB  . ARG G  1 204 ? 32.073  49.969  202.545 1.00 90.31  ? 204  ARG G CB  1 
ATOM   10235 C CG  . ARG G  1 204 ? 32.757  50.725  201.438 1.00 86.87  ? 204  ARG G CG  1 
ATOM   10236 C CD  . ARG G  1 204 ? 34.043  51.350  201.908 1.00 84.67  ? 204  ARG G CD  1 
ATOM   10237 N NE  . ARG G  1 204 ? 33.929  52.134  203.136 1.00 82.43  ? 204  ARG G NE  1 
ATOM   10238 C CZ  . ARG G  1 204 ? 32.964  53.006  203.389 1.00 81.73  ? 204  ARG G CZ  1 
ATOM   10239 N NH1 . ARG G  1 204 ? 32.950  53.682  204.525 1.00 81.96  ? 204  ARG G NH1 1 
ATOM   10240 N NH2 . ARG G  1 204 ? 31.993  53.186  202.518 1.00 82.05  ? 204  ARG G NH2 1 
ATOM   10241 N N   . TYR G  1 205 ? 33.255  46.834  202.538 1.00 95.83  ? 205  TYR G N   1 
ATOM   10242 C CA  . TYR G  1 205 ? 34.409  46.021  202.192 1.00 97.79  ? 205  TYR G CA  1 
ATOM   10243 C C   . TYR G  1 205 ? 33.910  44.843  201.369 1.00 98.82  ? 205  TYR G C   1 
ATOM   10244 O O   . TYR G  1 205 ? 34.632  44.310  200.516 1.00 98.95  ? 205  TYR G O   1 
ATOM   10245 C CB  . TYR G  1 205 ? 35.127  45.513  203.447 1.00 98.08  ? 205  TYR G CB  1 
ATOM   10246 C CG  . TYR G  1 205 ? 36.190  44.501  203.105 1.00 98.22  ? 205  TYR G CG  1 
ATOM   10247 C CD1 . TYR G  1 205 ? 37.331  44.878  202.394 1.00 98.04  ? 205  TYR G CD1 1 
ATOM   10248 C CD2 . TYR G  1 205 ? 36.005  43.146  203.395 1.00 98.04  ? 205  TYR G CD2 1 
ATOM   10249 C CE1 . TYR G  1 205 ? 38.252  43.933  201.971 1.00 97.92  ? 205  TYR G CE1 1 
ATOM   10250 C CE2 . TYR G  1 205 ? 36.920  42.199  202.978 1.00 97.95  ? 205  TYR G CE2 1 
ATOM   10251 C CZ  . TYR G  1 205 ? 38.038  42.597  202.263 1.00 97.78  ? 205  TYR G CZ  1 
ATOM   10252 O OH  . TYR G  1 205 ? 38.923  41.651  201.816 1.00 97.85  ? 205  TYR G OH  1 
ATOM   10253 N N   . ASN G  1 206 ? 32.666  44.447  201.634 1.00 100.23 ? 206  ASN G N   1 
ATOM   10254 C CA  . ASN G  1 206 ? 32.049  43.341  200.916 1.00 102.03 ? 206  ASN G CA  1 
ATOM   10255 C C   . ASN G  1 206 ? 31.472  43.815  199.584 1.00 103.59 ? 206  ASN G C   1 
ATOM   10256 O O   . ASN G  1 206 ? 31.381  43.031  198.637 1.00 103.83 ? 206  ASN G O   1 
ATOM   10257 C CB  . ASN G  1 206 ? 30.939  42.701  201.756 1.00 100.79 ? 206  ASN G CB  1 
ATOM   10258 C CG  . ASN G  1 206 ? 31.447  42.155  203.062 1.00 100.03 ? 206  ASN G CG  1 
ATOM   10259 O OD1 . ASN G  1 206 ? 32.472  41.466  203.104 1.00 99.29  ? 206  ASN G OD1 1 
ATOM   10260 N ND2 . ASN G  1 206 ? 30.731  42.452  204.144 1.00 99.42  ? 206  ASN G ND2 1 
ATOM   10261 N N   . SER G  1 207 ? 31.093  45.093  199.508 1.00 105.28 ? 207  SER G N   1 
ATOM   10262 C CA  . SER G  1 207 ? 30.520  45.643  198.278 1.00 107.21 ? 207  SER G CA  1 
ATOM   10263 C C   . SER G  1 207 ? 31.510  45.608  197.099 1.00 108.73 ? 207  SER G C   1 
ATOM   10264 O O   . SER G  1 207 ? 31.098  45.684  195.936 1.00 109.16 ? 207  SER G O   1 
ATOM   10265 C CB  . SER G  1 207 ? 30.000  47.080  198.510 1.00 107.07 ? 207  SER G CB  1 
ATOM   10266 O OG  . SER G  1 207 ? 30.931  48.077  198.118 1.00 107.09 ? 207  SER G OG  1 
ATOM   10267 N N   . CYS G  1 208 ? 32.807  45.483  197.389 1.00 110.26 ? 208  CYS G N   1 
ATOM   10268 C CA  . CYS G  1 208 ? 33.813  45.414  196.328 1.00 111.96 ? 208  CYS G CA  1 
ATOM   10269 C C   . CYS G  1 208 ? 33.903  43.985  195.817 1.00 113.24 ? 208  CYS G C   1 
ATOM   10270 O O   . CYS G  1 208 ? 34.823  43.629  195.071 1.00 113.39 ? 208  CYS G O   1 
ATOM   10271 C CB  . CYS G  1 208 ? 35.181  45.871  196.839 1.00 112.02 ? 208  CYS G CB  1 
ATOM   10272 S SG  . CYS G  1 208 ? 35.398  47.679  196.930 1.00 113.51 ? 208  CYS G SG  1 
ATOM   10273 N N   . ARG G  1 209 ? 32.926  43.180  196.240 1.00 114.70 ? 209  ARG G N   1 
ATOM   10274 C CA  . ARG G  1 209 ? 32.797  41.766  195.867 1.00 115.76 ? 209  ARG G CA  1 
ATOM   10275 C C   . ARG G  1 209 ? 31.382  41.498  195.321 1.00 115.81 ? 209  ARG G C   1 
ATOM   10276 O O   . ARG G  1 209 ? 30.433  41.259  196.084 1.00 115.63 ? 209  ARG G O   1 
ATOM   10277 C CB  . ARG G  1 209 ? 33.037  40.867  197.087 1.00 116.51 ? 209  ARG G CB  1 
ATOM   10278 C CG  . ARG G  1 209 ? 34.400  40.994  197.723 1.00 117.17 ? 209  ARG G CG  1 
ATOM   10279 C CD  . ARG G  1 209 ? 34.271  40.670  199.188 1.00 118.32 ? 209  ARG G CD  1 
ATOM   10280 N NE  . ARG G  1 209 ? 35.523  40.195  199.763 1.00 119.88 ? 209  ARG G NE  1 
ATOM   10281 C CZ  . ARG G  1 209 ? 35.688  39.911  201.055 1.00 120.63 ? 209  ARG G CZ  1 
ATOM   10282 N NH1 . ARG G  1 209 ? 34.673  40.062  201.909 1.00 120.66 ? 209  ARG G NH1 1 
ATOM   10283 N NH2 . ARG G  1 209 ? 36.861  39.458  201.492 1.00 120.61 ? 209  ARG G NH2 1 
ATOM   10284 N N   . LEU H  1 24  ? 32.173  51.229  186.026 1.00 75.23  ? 24   LEU H N   1 
ATOM   10285 C CA  . LEU H  1 24  ? 31.790  51.110  187.474 1.00 76.04  ? 24   LEU H CA  1 
ATOM   10286 C C   . LEU H  1 24  ? 32.674  51.995  188.387 1.00 76.10  ? 24   LEU H C   1 
ATOM   10287 O O   . LEU H  1 24  ? 32.957  51.678  189.563 1.00 77.02  ? 24   LEU H O   1 
ATOM   10288 C CB  . LEU H  1 24  ? 31.876  49.649  187.921 1.00 76.16  ? 24   LEU H CB  1 
ATOM   10289 C CG  . LEU H  1 24  ? 30.687  49.270  188.812 1.00 76.45  ? 24   LEU H CG  1 
ATOM   10290 C CD1 . LEU H  1 24  ? 30.691  50.076  190.105 1.00 76.50  ? 24   LEU H CD1 1 
ATOM   10291 C CD2 . LEU H  1 24  ? 29.396  49.539  188.044 1.00 76.07  ? 24   LEU H CD2 1 
ATOM   10292 N N   . CYS H  1 25  ? 33.094  53.116  187.809 1.00 75.16  ? 25   CYS H N   1 
ATOM   10293 C CA  . CYS H  1 25  ? 33.942  54.124  188.440 1.00 72.63  ? 25   CYS H CA  1 
ATOM   10294 C C   . CYS H  1 25  ? 33.137  55.079  189.343 1.00 71.20  ? 25   CYS H C   1 
ATOM   10295 O O   . CYS H  1 25  ? 31.925  54.921  189.532 1.00 71.22  ? 25   CYS H O   1 
ATOM   10296 C CB  . CYS H  1 25  ? 34.594  54.924  187.317 1.00 72.57  ? 25   CYS H CB  1 
ATOM   10297 S SG  . CYS H  1 25  ? 33.329  55.702  186.256 1.00 70.32  ? 25   CYS H SG  1 
ATOM   10298 N N   . PHE H  1 26  ? 33.814  56.091  189.868 1.00 69.12  ? 26   PHE H N   1 
ATOM   10299 C CA  . PHE H  1 26  ? 33.164  57.066  190.729 1.00 67.50  ? 26   PHE H CA  1 
ATOM   10300 C C   . PHE H  1 26  ? 31.976  57.727  190.045 1.00 67.30  ? 26   PHE H C   1 
ATOM   10301 O O   . PHE H  1 26  ? 32.062  58.128  188.895 1.00 67.33  ? 26   PHE H O   1 
ATOM   10302 C CB  . PHE H  1 26  ? 34.150  58.155  191.140 1.00 65.63  ? 26   PHE H CB  1 
ATOM   10303 C CG  . PHE H  1 26  ? 33.653  58.994  192.258 1.00 63.94  ? 26   PHE H CG  1 
ATOM   10304 C CD1 . PHE H  1 26  ? 33.813  58.581  193.578 1.00 63.20  ? 26   PHE H CD1 1 
ATOM   10305 C CD2 . PHE H  1 26  ? 32.927  60.149  192.004 1.00 64.18  ? 26   PHE H CD2 1 
ATOM   10306 C CE1 . PHE H  1 26  ? 33.248  59.303  194.636 1.00 62.05  ? 26   PHE H CE1 1 
ATOM   10307 C CE2 . PHE H  1 26  ? 32.356  60.880  193.058 1.00 64.01  ? 26   PHE H CE2 1 
ATOM   10308 C CZ  . PHE H  1 26  ? 32.519  60.447  194.380 1.00 62.26  ? 26   PHE H CZ  1 
ATOM   10309 N N   . GLY H  1 27  ? 30.873  57.851  190.768 1.00 67.51  ? 27   GLY H N   1 
ATOM   10310 C CA  . GLY H  1 27  ? 29.689  58.480  190.224 1.00 68.14  ? 27   GLY H CA  1 
ATOM   10311 C C   . GLY H  1 27  ? 28.728  57.482  189.614 1.00 69.07  ? 27   GLY H C   1 
ATOM   10312 O O   . GLY H  1 27  ? 27.578  57.803  189.322 1.00 69.15  ? 27   GLY H O   1 
ATOM   10313 N N   . GLN H  1 28  ? 29.196  56.256  189.429 1.00 70.25  ? 28   GLN H N   1 
ATOM   10314 C CA  . GLN H  1 28  ? 28.361  55.222  188.835 1.00 71.91  ? 28   GLN H CA  1 
ATOM   10315 C C   . GLN H  1 28  ? 28.130  54.001  189.687 1.00 72.65  ? 28   GLN H C   1 
ATOM   10316 O O   . GLN H  1 28  ? 27.631  52.992  189.186 1.00 73.04  ? 28   GLN H O   1 
ATOM   10317 C CB  . GLN H  1 28  ? 28.966  54.756  187.537 1.00 72.33  ? 28   GLN H CB  1 
ATOM   10318 C CG  . GLN H  1 28  ? 28.886  55.760  186.452 1.00 73.15  ? 28   GLN H CG  1 
ATOM   10319 C CD  . GLN H  1 28  ? 29.731  55.358  185.260 1.00 74.06  ? 28   GLN H CD  1 
ATOM   10320 O OE1 . GLN H  1 28  ? 29.670  55.999  184.220 1.00 76.20  ? 28   GLN H OE1 1 
ATOM   10321 N NE2 . GLN H  1 28  ? 30.531  54.295  185.402 1.00 73.21  ? 28   GLN H NE2 1 
ATOM   10322 N N   . CYS H  1 29  ? 28.532  54.063  190.950 1.00 73.33  ? 29   CYS H N   1 
ATOM   10323 C CA  . CYS H  1 29  ? 28.322  52.942  191.844 1.00 73.21  ? 29   CYS H CA  1 
ATOM   10324 C C   . CYS H  1 29  ? 26.924  53.062  192.355 1.00 72.77  ? 29   CYS H C   1 
ATOM   10325 O O   . CYS H  1 29  ? 26.300  54.110  192.252 1.00 73.13  ? 29   CYS H O   1 
ATOM   10326 C CB  . CYS H  1 29  ? 29.279  52.988  193.022 1.00 73.40  ? 29   CYS H CB  1 
ATOM   10327 S SG  . CYS H  1 29  ? 30.955  52.479  192.584 1.00 75.43  ? 29   CYS H SG  1 
ATOM   10328 N N   . GLN H  1 30  ? 26.414  51.965  192.872 1.00 72.63  ? 30   GLN H N   1 
ATOM   10329 C CA  . GLN H  1 30  ? 25.096  51.977  193.443 1.00 72.75  ? 30   GLN H CA  1 
ATOM   10330 C C   . GLN H  1 30  ? 25.388  51.329  194.776 1.00 72.28  ? 30   GLN H C   1 
ATOM   10331 O O   . GLN H  1 30  ? 26.119  50.335  194.840 1.00 72.29  ? 30   GLN H O   1 
ATOM   10332 C CB  . GLN H  1 30  ? 24.127  51.140  192.611 1.00 73.30  ? 30   GLN H CB  1 
ATOM   10333 C CG  . GLN H  1 30  ? 22.670  51.347  193.053 1.00 74.18  ? 30   GLN H CG  1 
ATOM   10334 C CD  . GLN H  1 30  ? 21.676  50.372  192.418 1.00 74.57  ? 30   GLN H CD  1 
ATOM   10335 O OE1 . GLN H  1 30  ? 20.514  50.301  192.848 1.00 73.01  ? 30   GLN H OE1 1 
ATOM   10336 N NE2 . GLN H  1 30  ? 22.123  49.623  191.389 1.00 75.72  ? 30   GLN H NE2 1 
ATOM   10337 N N   . TYR H  1 31  ? 24.874  51.903  195.853 1.00 71.71  ? 31   TYR H N   1 
ATOM   10338 C CA  . TYR H  1 31  ? 25.154  51.310  197.146 1.00 71.42  ? 31   TYR H CA  1 
ATOM   10339 C C   . TYR H  1 31  ? 24.483  49.958  197.285 1.00 72.29  ? 31   TYR H C   1 
ATOM   10340 O O   . TYR H  1 31  ? 23.342  49.765  196.835 1.00 71.90  ? 31   TYR H O   1 
ATOM   10341 C CB  . TYR H  1 31  ? 24.692  52.228  198.274 1.00 69.56  ? 31   TYR H CB  1 
ATOM   10342 C CG  . TYR H  1 31  ? 25.659  53.345  198.568 1.00 67.77  ? 31   TYR H CG  1 
ATOM   10343 C CD1 . TYR H  1 31  ? 25.399  54.644  198.157 1.00 66.38  ? 31   TYR H CD1 1 
ATOM   10344 C CD2 . TYR H  1 31  ? 26.853  53.093  199.244 1.00 66.86  ? 31   TYR H CD2 1 
ATOM   10345 C CE1 . TYR H  1 31  ? 26.296  55.660  198.411 1.00 65.88  ? 31   TYR H CE1 1 
ATOM   10346 C CE2 . TYR H  1 31  ? 27.756  54.104  199.499 1.00 65.57  ? 31   TYR H CE2 1 
ATOM   10347 C CZ  . TYR H  1 31  ? 27.470  55.382  199.081 1.00 65.39  ? 31   TYR H CZ  1 
ATOM   10348 O OH  . TYR H  1 31  ? 28.353  56.395  199.334 1.00 65.28  ? 31   TYR H OH  1 
ATOM   10349 N N   . THR H  1 32  ? 25.206  49.012  197.882 1.00 73.16  ? 32   THR H N   1 
ATOM   10350 C CA  . THR H  1 32  ? 24.645  47.684  198.135 1.00 73.90  ? 32   THR H CA  1 
ATOM   10351 C C   . THR H  1 32  ? 23.703  47.882  199.315 1.00 74.01  ? 32   THR H C   1 
ATOM   10352 O O   . THR H  1 32  ? 23.880  48.816  200.101 1.00 74.63  ? 32   THR H O   1 
ATOM   10353 C CB  . THR H  1 32  ? 25.723  46.687  198.540 1.00 73.82  ? 32   THR H CB  1 
ATOM   10354 O OG1 . THR H  1 32  ? 26.338  47.109  199.768 1.00 74.38  ? 32   THR H OG1 1 
ATOM   10355 C CG2 . THR H  1 32  ? 26.781  46.610  197.449 1.00 74.51  ? 32   THR H CG2 1 
ATOM   10356 N N   . ALA H  1 33  ? 22.699  47.032  199.448 1.00 73.71  ? 33   ALA H N   1 
ATOM   10357 C CA  . ALA H  1 33  ? 21.778  47.204  200.554 1.00 74.22  ? 33   ALA H CA  1 
ATOM   10358 C C   . ALA H  1 33  ? 22.518  47.274  201.884 1.00 74.25  ? 33   ALA H C   1 
ATOM   10359 O O   . ALA H  1 33  ? 22.194  48.100  202.760 1.00 73.41  ? 33   ALA H O   1 
ATOM   10360 C CB  . ALA H  1 33  ? 20.788  46.066  200.573 1.00 74.75  ? 33   ALA H CB  1 
ATOM   10361 N N   . GLU H  1 34  ? 23.527  46.419  202.022 1.00 74.64  ? 34   GLU H N   1 
ATOM   10362 C CA  . GLU H  1 34  ? 24.270  46.370  203.255 1.00 75.81  ? 34   GLU H CA  1 
ATOM   10363 C C   . GLU H  1 34  ? 24.999  47.682  203.569 1.00 75.22  ? 34   GLU H C   1 
ATOM   10364 O O   . GLU H  1 34  ? 24.873  48.226  204.677 1.00 75.54  ? 34   GLU H O   1 
ATOM   10365 C CB  . GLU H  1 34  ? 25.239  45.183  203.242 1.00 77.88  ? 34   GLU H CB  1 
ATOM   10366 C CG  . GLU H  1 34  ? 25.592  44.707  204.675 1.00 81.74  ? 34   GLU H CG  1 
ATOM   10367 C CD  . GLU H  1 34  ? 26.808  43.757  204.758 1.00 83.85  ? 34   GLU H CD  1 
ATOM   10368 O OE1 . GLU H  1 34  ? 27.396  43.649  205.868 1.00 85.43  ? 34   GLU H OE1 1 
ATOM   10369 O OE2 . GLU H  1 34  ? 27.174  43.120  203.737 1.00 84.87  ? 34   GLU H OE2 1 
ATOM   10370 N N   . GLU H  1 35  ? 25.742  48.214  202.607 1.00 74.17  ? 35   GLU H N   1 
ATOM   10371 C CA  . GLU H  1 35  ? 26.455  49.451  202.874 1.00 73.23  ? 35   GLU H CA  1 
ATOM   10372 C C   . GLU H  1 35  ? 25.470  50.595  203.099 1.00 72.20  ? 35   GLU H C   1 
ATOM   10373 O O   . GLU H  1 35  ? 25.639  51.410  204.010 1.00 71.33  ? 35   GLU H O   1 
ATOM   10374 C CB  . GLU H  1 35  ? 27.421  49.771  201.725 1.00 73.61  ? 35   GLU H CB  1 
ATOM   10375 C CG  . GLU H  1 35  ? 28.365  50.941  202.047 1.00 74.56  ? 35   GLU H CG  1 
ATOM   10376 C CD  . GLU H  1 35  ? 29.429  51.227  200.967 1.00 74.63  ? 35   GLU H CD  1 
ATOM   10377 O OE1 . GLU H  1 35  ? 30.189  52.202  201.156 1.00 73.78  ? 35   GLU H OE1 1 
ATOM   10378 O OE2 . GLU H  1 35  ? 29.512  50.494  199.947 1.00 74.02  ? 35   GLU H OE2 1 
ATOM   10379 N N   . TYR H  1 36  ? 24.429  50.641  202.275 1.00 71.64  ? 36   TYR H N   1 
ATOM   10380 C CA  . TYR H  1 36  ? 23.422  51.688  202.385 1.00 70.81  ? 36   TYR H CA  1 
ATOM   10381 C C   . TYR H  1 36  ? 22.880  51.721  203.796 1.00 71.05  ? 36   TYR H C   1 
ATOM   10382 O O   . TYR H  1 36  ? 22.854  52.760  204.454 1.00 70.60  ? 36   TYR H O   1 
ATOM   10383 C CB  . TYR H  1 36  ? 22.250  51.448  201.416 1.00 69.34  ? 36   TYR H CB  1 
ATOM   10384 C CG  . TYR H  1 36  ? 21.005  52.171  201.871 1.00 67.99  ? 36   TYR H CG  1 
ATOM   10385 C CD1 . TYR H  1 36  ? 20.924  53.563  201.812 1.00 67.84  ? 36   TYR H CD1 1 
ATOM   10386 C CD2 . TYR H  1 36  ? 19.986  51.487  202.533 1.00 66.96  ? 36   TYR H CD2 1 
ATOM   10387 C CE1 . TYR H  1 36  ? 19.867  54.255  202.423 1.00 67.23  ? 36   TYR H CE1 1 
ATOM   10388 C CE2 . TYR H  1 36  ? 18.932  52.166  203.139 1.00 65.94  ? 36   TYR H CE2 1 
ATOM   10389 C CZ  . TYR H  1 36  ? 18.878  53.548  203.090 1.00 66.73  ? 36   TYR H CZ  1 
ATOM   10390 O OH  . TYR H  1 36  ? 17.865  54.226  203.746 1.00 67.24  ? 36   TYR H OH  1 
ATOM   10391 N N   . GLN H  1 37  ? 22.437  50.562  204.254 1.00 72.35  ? 37   GLN H N   1 
ATOM   10392 C CA  . GLN H  1 37  ? 21.862  50.464  205.583 1.00 73.96  ? 37   GLN H CA  1 
ATOM   10393 C C   . GLN H  1 37  ? 22.822  50.893  206.696 1.00 74.01  ? 37   GLN H C   1 
ATOM   10394 O O   . GLN H  1 37  ? 22.452  51.658  207.599 1.00 72.75  ? 37   GLN H O   1 
ATOM   10395 C CB  . GLN H  1 37  ? 21.381  49.039  205.836 1.00 75.47  ? 37   GLN H CB  1 
ATOM   10396 C CG  . GLN H  1 37  ? 20.534  48.924  207.099 1.00 78.02  ? 37   GLN H CG  1 
ATOM   10397 C CD  . GLN H  1 37  ? 20.432  47.487  207.630 1.00 79.26  ? 37   GLN H CD  1 
ATOM   10398 O OE1 . GLN H  1 37  ? 19.588  46.700  207.184 1.00 79.63  ? 37   GLN H OE1 1 
ATOM   10399 N NE2 . GLN H  1 37  ? 21.305  47.143  208.584 1.00 79.07  ? 37   GLN H NE2 1 
ATOM   10400 N N   . ALA H  1 38  ? 24.057  50.406  206.627 1.00 73.96  ? 38   ALA H N   1 
ATOM   10401 C CA  . ALA H  1 38  ? 25.037  50.759  207.632 1.00 74.06  ? 38   ALA H CA  1 
ATOM   10402 C C   . ALA H  1 38  ? 25.222  52.265  207.691 1.00 74.81  ? 38   ALA H C   1 
ATOM   10403 O O   . ALA H  1 38  ? 25.213  52.860  208.771 1.00 75.76  ? 38   ALA H O   1 
ATOM   10404 C CB  . ALA H  1 38  ? 26.359  50.081  207.332 1.00 73.39  ? 38   ALA H CB  1 
ATOM   10405 N N   . ILE H  1 39  ? 25.366  52.891  206.530 1.00 74.94  ? 39   ILE H N   1 
ATOM   10406 C CA  . ILE H  1 39  ? 25.586  54.329  206.489 1.00 75.21  ? 39   ILE H CA  1 
ATOM   10407 C C   . ILE H  1 39  ? 24.376  55.133  206.932 1.00 75.71  ? 39   ILE H C   1 
ATOM   10408 O O   . ILE H  1 39  ? 24.523  56.115  207.658 1.00 75.34  ? 39   ILE H O   1 
ATOM   10409 C CB  . ILE H  1 39  ? 26.055  54.772  205.073 1.00 75.57  ? 39   ILE H CB  1 
ATOM   10410 C CG1 . ILE H  1 39  ? 27.464  54.224  204.814 1.00 75.94  ? 39   ILE H CG1 1 
ATOM   10411 C CG2 . ILE H  1 39  ? 26.062  56.295  204.952 1.00 75.39  ? 39   ILE H CG2 1 
ATOM   10412 C CD1 . ILE H  1 39  ? 27.972  54.415  203.400 1.00 76.02  ? 39   ILE H CD1 1 
ATOM   10413 N N   . GLN H  1 40  ? 23.183  54.724  206.507 1.00 76.53  ? 40   GLN H N   1 
ATOM   10414 C CA  . GLN H  1 40  ? 21.967  55.440  206.900 1.00 77.36  ? 40   GLN H CA  1 
ATOM   10415 C C   . GLN H  1 40  ? 21.944  55.565  208.417 1.00 77.54  ? 40   GLN H C   1 
ATOM   10416 O O   . GLN H  1 40  ? 21.679  56.641  208.950 1.00 77.29  ? 40   GLN H O   1 
ATOM   10417 C CB  . GLN H  1 40  ? 20.704  54.682  206.458 1.00 78.66  ? 40   GLN H CB  1 
ATOM   10418 C CG  . GLN H  1 40  ? 19.750  55.413  205.505 1.00 79.44  ? 40   GLN H CG  1 
ATOM   10419 C CD  . GLN H  1 40  ? 19.244  56.763  206.007 1.00 79.98  ? 40   GLN H CD  1 
ATOM   10420 O OE1 . GLN H  1 40  ? 18.087  57.111  205.793 1.00 80.15  ? 40   GLN H OE1 1 
ATOM   10421 N NE2 . GLN H  1 40  ? 20.112  57.533  206.653 1.00 80.98  ? 40   GLN H NE2 1 
ATOM   10422 N N   . LYS H  1 41  ? 22.209  54.448  209.099 1.00 78.09  ? 41   LYS H N   1 
ATOM   10423 C CA  . LYS H  1 41  ? 22.230  54.407  210.561 1.00 78.43  ? 41   LYS H CA  1 
ATOM   10424 C C   . LYS H  1 41  ? 23.372  55.228  211.149 1.00 78.67  ? 41   LYS H C   1 
ATOM   10425 O O   . LYS H  1 41  ? 23.142  56.085  212.006 1.00 78.18  ? 41   LYS H O   1 
ATOM   10426 C CB  . LYS H  1 41  ? 22.334  52.964  211.052 1.00 79.29  ? 41   LYS H CB  1 
ATOM   10427 C CG  . LYS H  1 41  ? 21.049  52.173  210.865 1.00 80.91  ? 41   LYS H CG  1 
ATOM   10428 C CD  . LYS H  1 41  ? 21.249  50.676  211.111 1.00 81.92  ? 41   LYS H CD  1 
ATOM   10429 C CE  . LYS H  1 41  ? 19.952  49.895  210.872 1.00 82.15  ? 41   LYS H CE  1 
ATOM   10430 N NZ  . LYS H  1 41  ? 20.165  48.415  211.016 1.00 82.75  ? 41   LYS H NZ  1 
ATOM   10431 N N   . ALA H  1 42  ? 24.597  54.982  210.689 1.00 78.54  ? 42   ALA H N   1 
ATOM   10432 C CA  . ALA H  1 42  ? 25.742  55.720  211.202 1.00 79.08  ? 42   ALA H CA  1 
ATOM   10433 C C   . ALA H  1 42  ? 25.570  57.251  211.101 1.00 79.90  ? 42   ALA H C   1 
ATOM   10434 O O   . ALA H  1 42  ? 25.960  57.991  212.014 1.00 80.02  ? 42   ALA H O   1 
ATOM   10435 C CB  . ALA H  1 42  ? 27.002  55.282  210.472 1.00 78.63  ? 42   ALA H CB  1 
ATOM   10436 N N   . LEU H  1 43  ? 24.977  57.724  210.004 1.00 80.24  ? 43   LEU H N   1 
ATOM   10437 C CA  . LEU H  1 43  ? 24.794  59.162  209.801 1.00 80.45  ? 43   LEU H CA  1 
ATOM   10438 C C   . LEU H  1 43  ? 23.890  59.840  210.815 1.00 80.13  ? 43   LEU H C   1 
ATOM   10439 O O   . LEU H  1 43  ? 23.982  61.055  211.014 1.00 79.55  ? 43   LEU H O   1 
ATOM   10440 C CB  . LEU H  1 43  ? 24.272  59.436  208.385 1.00 81.65  ? 43   LEU H CB  1 
ATOM   10441 C CG  . LEU H  1 43  ? 25.313  59.219  207.279 1.00 82.19  ? 43   LEU H CG  1 
ATOM   10442 C CD1 . LEU H  1 43  ? 24.669  59.317  205.903 1.00 82.13  ? 43   LEU H CD1 1 
ATOM   10443 C CD2 . LEU H  1 43  ? 26.421  60.254  207.447 1.00 81.87  ? 43   LEU H CD2 1 
ATOM   10444 N N   . ARG H  1 44  ? 23.017  59.057  211.447 1.00 79.79  ? 44   ARG H N   1 
ATOM   10445 C CA  . ARG H  1 44  ? 22.098  59.584  212.447 1.00 79.40  ? 44   ARG H CA  1 
ATOM   10446 C C   . ARG H  1 44  ? 22.798  60.048  213.747 1.00 79.12  ? 44   ARG H C   1 
ATOM   10447 O O   . ARG H  1 44  ? 22.358  61.009  214.379 1.00 78.74  ? 44   ARG H O   1 
ATOM   10448 C CB  . ARG H  1 44  ? 21.022  58.536  212.766 1.00 79.48  ? 44   ARG H CB  1 
ATOM   10449 C CG  . ARG H  1 44  ? 20.036  58.304  211.636 1.00 80.30  ? 44   ARG H CG  1 
ATOM   10450 C CD  . ARG H  1 44  ? 18.805  57.561  212.116 1.00 80.62  ? 44   ARG H CD  1 
ATOM   10451 N NE  . ARG H  1 44  ? 18.827  56.128  211.802 1.00 80.63  ? 44   ARG H NE  1 
ATOM   10452 C CZ  . ARG H  1 44  ? 18.184  55.569  210.771 1.00 80.84  ? 44   ARG H CZ  1 
ATOM   10453 N NH1 . ARG H  1 44  ? 17.468  56.317  209.939 1.00 80.73  ? 44   ARG H NH1 1 
ATOM   10454 N NH2 . ARG H  1 44  ? 18.223  54.252  210.583 1.00 80.04  ? 44   ARG H NH2 1 
ATOM   10455 N N   . GLN H  1 45  ? 23.898  59.391  214.130 1.00 78.61  ? 45   GLN H N   1 
ATOM   10456 C CA  . GLN H  1 45  ? 24.623  59.728  215.359 1.00 77.45  ? 45   GLN H CA  1 
ATOM   10457 C C   . GLN H  1 45  ? 24.984  61.190  215.495 1.00 78.26  ? 45   GLN H C   1 
ATOM   10458 O O   . GLN H  1 45  ? 25.344  61.827  214.518 1.00 78.29  ? 45   GLN H O   1 
ATOM   10459 C CB  . GLN H  1 45  ? 25.907  58.932  215.441 1.00 75.66  ? 45   GLN H CB  1 
ATOM   10460 C CG  . GLN H  1 45  ? 25.733  57.464  215.248 1.00 74.89  ? 45   GLN H CG  1 
ATOM   10461 C CD  . GLN H  1 45  ? 27.061  56.759  215.138 1.00 75.24  ? 45   GLN H CD  1 
ATOM   10462 O OE1 . GLN H  1 45  ? 27.118  55.533  215.042 1.00 75.13  ? 45   GLN H OE1 1 
ATOM   10463 N NE2 . GLN H  1 45  ? 28.145  57.532  215.142 1.00 74.93  ? 45   GLN H NE2 1 
ATOM   10464 N N   . ARG H  1 46  ? 24.878  61.723  216.710 1.00 79.88  ? 46   ARG H N   1 
ATOM   10465 C CA  . ARG H  1 46  ? 25.261  63.116  216.968 1.00 81.43  ? 46   ARG H CA  1 
ATOM   10466 C C   . ARG H  1 46  ? 26.708  62.929  217.358 1.00 81.71  ? 46   ARG H C   1 
ATOM   10467 O O   . ARG H  1 46  ? 27.092  61.836  217.769 1.00 80.89  ? 46   ARG H O   1 
ATOM   10468 C CB  . ARG H  1 46  ? 24.518  63.707  218.163 1.00 82.26  ? 46   ARG H CB  1 
ATOM   10469 C CG  . ARG H  1 46  ? 23.035  63.469  218.160 1.00 83.46  ? 46   ARG H CG  1 
ATOM   10470 C CD  . ARG H  1 46  ? 22.313  64.769  218.062 1.00 84.46  ? 46   ARG H CD  1 
ATOM   10471 N NE  . ARG H  1 46  ? 20.894  64.582  218.310 1.00 86.00  ? 46   ARG H NE  1 
ATOM   10472 C CZ  . ARG H  1 46  ? 19.948  65.416  217.887 1.00 87.11  ? 46   ARG H CZ  1 
ATOM   10473 N NH1 . ARG H  1 46  ? 20.272  66.502  217.184 1.00 87.45  ? 46   ARG H NH1 1 
ATOM   10474 N NH2 . ARG H  1 46  ? 18.674  65.166  218.175 1.00 87.33  ? 46   ARG H NH2 1 
ATOM   10475 N N   . LEU H  1 47  ? 27.535  63.955  217.238 1.00 82.92  ? 47   LEU H N   1 
ATOM   10476 C CA  . LEU H  1 47  ? 28.912  63.708  217.611 1.00 84.10  ? 47   LEU H CA  1 
ATOM   10477 C C   . LEU H  1 47  ? 29.275  64.200  219.002 1.00 84.31  ? 47   LEU H C   1 
ATOM   10478 O O   . LEU H  1 47  ? 28.748  65.207  219.492 1.00 83.75  ? 47   LEU H O   1 
ATOM   10479 C CB  . LEU H  1 47  ? 29.917  64.223  216.549 1.00 84.72  ? 47   LEU H CB  1 
ATOM   10480 C CG  . LEU H  1 47  ? 29.665  65.222  215.417 1.00 85.68  ? 47   LEU H CG  1 
ATOM   10481 C CD1 . LEU H  1 47  ? 30.787  65.086  214.418 1.00 85.22  ? 47   LEU H CD1 1 
ATOM   10482 C CD2 . LEU H  1 47  ? 28.372  64.943  214.717 1.00 85.80  ? 47   LEU H CD2 1 
ATOM   10483 N N   . GLY H  1 48  ? 30.164  63.433  219.631 1.00 83.90  ? 48   GLY H N   1 
ATOM   10484 C CA  . GLY H  1 48  ? 30.631  63.733  220.968 1.00 83.93  ? 48   GLY H CA  1 
ATOM   10485 C C   . GLY H  1 48  ? 31.409  65.034  221.104 1.00 83.53  ? 48   GLY H C   1 
ATOM   10486 O O   . GLY H  1 48  ? 31.722  65.695  220.106 1.00 83.81  ? 48   GLY H O   1 
ATOM   10487 N N   . PRO H  1 49  ? 31.742  65.417  222.348 1.00 82.55  ? 49   PRO H N   1 
ATOM   10488 C CA  . PRO H  1 49  ? 32.479  66.636  222.665 1.00 81.70  ? 49   PRO H CA  1 
ATOM   10489 C C   . PRO H  1 49  ? 33.858  66.645  222.016 1.00 81.15  ? 49   PRO H C   1 
ATOM   10490 O O   . PRO H  1 49  ? 34.442  67.710  221.780 1.00 80.18  ? 49   PRO H O   1 
ATOM   10491 C CB  . PRO H  1 49  ? 32.572  66.598  224.190 1.00 81.75  ? 49   PRO H CB  1 
ATOM   10492 C CG  . PRO H  1 49  ? 31.447  65.721  224.602 1.00 81.89  ? 49   PRO H CG  1 
ATOM   10493 C CD  . PRO H  1 49  ? 31.470  64.647  223.574 1.00 82.31  ? 49   PRO H CD  1 
ATOM   10494 N N   . GLU H  1 50  ? 34.389  65.463  221.729 1.00 80.63  ? 50   GLU H N   1 
ATOM   10495 C CA  . GLU H  1 50  ? 35.713  65.422  221.130 1.00 81.33  ? 50   GLU H CA  1 
ATOM   10496 C C   . GLU H  1 50  ? 35.805  66.013  219.718 1.00 81.36  ? 50   GLU H C   1 
ATOM   10497 O O   . GLU H  1 50  ? 36.904  66.193  219.176 1.00 80.95  ? 50   GLU H O   1 
ATOM   10498 C CB  . GLU H  1 50  ? 36.301  63.992  221.153 1.00 81.62  ? 50   GLU H CB  1 
ATOM   10499 C CG  . GLU H  1 50  ? 35.343  62.832  220.930 1.00 82.12  ? 50   GLU H CG  1 
ATOM   10500 C CD  . GLU H  1 50  ? 34.524  62.505  222.158 1.00 82.49  ? 50   GLU H CD  1 
ATOM   10501 O OE1 . GLU H  1 50  ? 33.468  63.142  222.360 1.00 81.93  ? 50   GLU H OE1 1 
ATOM   10502 O OE2 . GLU H  1 50  ? 34.954  61.616  222.925 1.00 82.82  ? 50   GLU H OE2 1 
ATOM   10503 N N   . TYR H  1 51  ? 34.653  66.343  219.138 1.00 81.21  ? 51   TYR H N   1 
ATOM   10504 C CA  . TYR H  1 51  ? 34.607  66.913  217.796 1.00 80.03  ? 51   TYR H CA  1 
ATOM   10505 C C   . TYR H  1 51  ? 34.383  68.406  217.809 1.00 79.06  ? 51   TYR H C   1 
ATOM   10506 O O   . TYR H  1 51  ? 34.920  69.134  216.982 1.00 79.99  ? 51   TYR H O   1 
ATOM   10507 C CB  . TYR H  1 51  ? 33.480  66.273  216.980 1.00 79.88  ? 51   TYR H CB  1 
ATOM   10508 C CG  . TYR H  1 51  ? 33.788  64.880  216.536 1.00 79.60  ? 51   TYR H CG  1 
ATOM   10509 C CD1 . TYR H  1 51  ? 33.265  63.779  217.201 1.00 79.85  ? 51   TYR H CD1 1 
ATOM   10510 C CD2 . TYR H  1 51  ? 34.633  64.660  215.453 1.00 79.88  ? 51   TYR H CD2 1 
ATOM   10511 C CE1 . TYR H  1 51  ? 33.581  62.480  216.786 1.00 79.90  ? 51   TYR H CE1 1 
ATOM   10512 C CE2 . TYR H  1 51  ? 34.956  63.377  215.037 1.00 79.51  ? 51   TYR H CE2 1 
ATOM   10513 C CZ  . TYR H  1 51  ? 34.430  62.296  215.701 1.00 79.17  ? 51   TYR H CZ  1 
ATOM   10514 O OH  . TYR H  1 51  ? 34.757  61.039  215.269 1.00 78.88  ? 51   TYR H OH  1 
ATOM   10515 N N   . ILE H  1 52  ? 33.594  68.858  218.764 1.00 77.72  ? 52   ILE H N   1 
ATOM   10516 C CA  . ILE H  1 52  ? 33.238  70.256  218.839 1.00 77.07  ? 52   ILE H CA  1 
ATOM   10517 C C   . ILE H  1 52  ? 34.267  71.179  219.455 1.00 76.70  ? 52   ILE H C   1 
ATOM   10518 O O   . ILE H  1 52  ? 34.870  70.859  220.467 1.00 77.13  ? 52   ILE H O   1 
ATOM   10519 C CB  . ILE H  1 52  ? 31.935  70.411  219.623 1.00 77.10  ? 52   ILE H CB  1 
ATOM   10520 C CG1 . ILE H  1 52  ? 30.954  69.305  219.234 1.00 76.70  ? 52   ILE H CG1 1 
ATOM   10521 C CG2 . ILE H  1 52  ? 31.348  71.767  219.369 1.00 77.93  ? 52   ILE H CG2 1 
ATOM   10522 C CD1 . ILE H  1 52  ? 30.661  69.225  217.764 1.00 76.01  ? 52   ILE H CD1 1 
ATOM   10523 N N   . SER H  1 53  ? 34.472  72.328  218.829 1.00 76.77  ? 53   SER H N   1 
ATOM   10524 C CA  . SER H  1 53  ? 35.386  73.323  219.359 1.00 77.55  ? 53   SER H CA  1 
ATOM   10525 C C   . SER H  1 53  ? 34.646  74.646  219.296 1.00 78.17  ? 53   SER H C   1 
ATOM   10526 O O   . SER H  1 53  ? 33.549  74.706  218.765 1.00 76.85  ? 53   SER H O   1 
ATOM   10527 C CB  . SER H  1 53  ? 36.714  73.349  218.588 1.00 77.20  ? 53   SER H CB  1 
ATOM   10528 O OG  . SER H  1 53  ? 36.532  73.281  217.196 1.00 77.72  ? 53   SER H OG  1 
ATOM   10529 N N   . SER H  1 54  ? 35.210  75.702  219.863 1.00 80.63  ? 54   SER H N   1 
ATOM   10530 C CA  . SER H  1 54  ? 34.503  76.979  219.864 1.00 83.30  ? 54   SER H CA  1 
ATOM   10531 C C   . SER H  1 54  ? 35.405  78.190  219.824 1.00 84.97  ? 54   SER H C   1 
ATOM   10532 O O   . SER H  1 54  ? 36.601  78.096  220.084 1.00 84.98  ? 54   SER H O   1 
ATOM   10533 C CB  . SER H  1 54  ? 33.599  77.080  221.096 1.00 83.69  ? 54   SER H CB  1 
ATOM   10534 O OG  . SER H  1 54  ? 34.350  76.880  222.282 1.00 84.38  ? 54   SER H OG  1 
ATOM   10535 N N   . ARG H  1 55  ? 34.811  79.327  219.488 1.00 87.19  ? 55   ARG H N   1 
ATOM   10536 C CA  . ARG H  1 55  ? 35.537  80.579  219.411 1.00 90.63  ? 55   ARG H CA  1 
ATOM   10537 C C   . ARG H  1 55  ? 34.630  81.688  219.894 1.00 92.16  ? 55   ARG H C   1 
ATOM   10538 O O   . ARG H  1 55  ? 33.428  81.482  220.084 1.00 92.40  ? 55   ARG H O   1 
ATOM   10539 C CB  . ARG H  1 55  ? 35.970  80.883  217.975 1.00 92.03  ? 55   ARG H CB  1 
ATOM   10540 C CG  . ARG H  1 55  ? 34.808  81.035  217.004 1.00 94.43  ? 55   ARG H CG  1 
ATOM   10541 C CD  . ARG H  1 55  ? 35.210  81.723  215.697 1.00 96.47  ? 55   ARG H CD  1 
ATOM   10542 N NE  . ARG H  1 55  ? 34.172  81.607  214.662 1.00 98.47  ? 55   ARG H NE  1 
ATOM   10543 C CZ  . ARG H  1 55  ? 33.958  80.518  213.911 1.00 99.46  ? 55   ARG H CZ  1 
ATOM   10544 N NH1 . ARG H  1 55  ? 34.709  79.429  214.060 1.00 100.23 ? 55   ARG H NH1 1 
ATOM   10545 N NH2 . ARG H  1 55  ? 32.986  80.508  213.003 1.00 99.15  ? 55   ARG H NH2 1 
ATOM   10546 N N   . MET H  1 56  ? 35.210  82.865  220.081 1.00 94.18  ? 56   MET H N   1 
ATOM   10547 C CA  . MET H  1 56  ? 34.448  84.002  220.547 1.00 96.70  ? 56   MET H CA  1 
ATOM   10548 C C   . MET H  1 56  ? 33.954  84.878  219.426 1.00 97.30  ? 56   MET H C   1 
ATOM   10549 O O   . MET H  1 56  ? 34.744  85.435  218.671 1.00 96.82  ? 56   MET H O   1 
ATOM   10550 C CB  . MET H  1 56  ? 35.271  84.849  221.524 1.00 98.36  ? 56   MET H CB  1 
ATOM   10551 C CG  . MET H  1 56  ? 35.056  84.469  222.994 1.00 100.65 ? 56   MET H CG  1 
ATOM   10552 S SD  . MET H  1 56  ? 33.275  84.354  223.477 1.00 102.74 ? 56   MET H SD  1 
ATOM   10553 C CE  . MET H  1 56  ? 33.127  82.536  223.752 1.00 102.84 ? 56   MET H CE  1 
ATOM   10554 N N   . ALA H  1 57  ? 32.635  84.995  219.331 1.00 98.44  ? 57   ALA H N   1 
ATOM   10555 C CA  . ALA H  1 57  ? 32.023  85.834  218.319 1.00 99.99  ? 57   ALA H CA  1 
ATOM   10556 C C   . ALA H  1 57  ? 32.219  87.276  218.762 1.00 101.13 ? 57   ALA H C   1 
ATOM   10557 O O   . ALA H  1 57  ? 32.516  87.538  219.929 1.00 101.24 ? 57   ALA H O   1 
ATOM   10558 C CB  . ALA H  1 57  ? 30.535  85.518  218.200 1.00 100.15 ? 57   ALA H CB  1 
ATOM   10559 N N   . GLY H  1 58  ? 32.052  88.207  217.829 1.00 102.44 ? 58   GLY H N   1 
ATOM   10560 C CA  . GLY H  1 58  ? 32.205  89.615  218.155 1.00 103.69 ? 58   GLY H CA  1 
ATOM   10561 C C   . GLY H  1 58  ? 31.256  90.048  219.266 1.00 104.34 ? 58   GLY H C   1 
ATOM   10562 O O   . GLY H  1 58  ? 31.604  90.899  220.103 1.00 104.41 ? 58   GLY H O   1 
ATOM   10563 N N   . GLY H  1 59  ? 30.056  89.461  219.279 1.00 104.51 ? 59   GLY H N   1 
ATOM   10564 C CA  . GLY H  1 59  ? 29.073  89.790  220.296 1.00 104.43 ? 59   GLY H CA  1 
ATOM   10565 C C   . GLY H  1 59  ? 29.443  89.205  221.645 1.00 104.52 ? 59   GLY H C   1 
ATOM   10566 O O   . GLY H  1 59  ? 28.598  89.080  222.534 1.00 103.91 ? 59   GLY H O   1 
ATOM   10567 N N   . GLY H  1 60  ? 30.719  88.858  221.797 1.00 104.91 ? 60   GLY H N   1 
ATOM   10568 C CA  . GLY H  1 60  ? 31.191  88.273  223.035 1.00 105.26 ? 60   GLY H CA  1 
ATOM   10569 C C   . GLY H  1 60  ? 30.392  87.019  223.325 1.00 105.78 ? 60   GLY H C   1 
ATOM   10570 O O   . GLY H  1 60  ? 30.048  86.744  224.477 1.00 106.09 ? 60   GLY H O   1 
ATOM   10571 N N   . GLN H  1 61  ? 30.093  86.252  222.276 1.00 105.77 ? 61   GLN H N   1 
ATOM   10572 C CA  . GLN H  1 61  ? 29.314  85.024  222.426 1.00 105.04 ? 61   GLN H CA  1 
ATOM   10573 C C   . GLN H  1 61  ? 29.937  83.799  221.770 1.00 103.82 ? 61   GLN H C   1 
ATOM   10574 O O   . GLN H  1 61  ? 30.459  83.853  220.652 1.00 103.80 ? 61   GLN H O   1 
ATOM   10575 C CB  . GLN H  1 61  ? 27.919  85.234  221.869 1.00 106.24 ? 61   GLN H CB  1 
ATOM   10576 C CG  . GLN H  1 61  ? 27.936  85.781  220.468 1.00 107.86 ? 61   GLN H CG  1 
ATOM   10577 C CD  . GLN H  1 61  ? 26.544  85.913  219.905 1.00 109.34 ? 61   GLN H CD  1 
ATOM   10578 O OE1 . GLN H  1 61  ? 26.366  86.273  218.739 1.00 110.44 ? 61   GLN H OE1 1 
ATOM   10579 N NE2 . GLN H  1 61  ? 25.536  85.619  220.733 1.00 109.80 ? 61   GLN H NE2 1 
ATOM   10580 N N   . LYS H  1 62  ? 29.852  82.689  222.492 1.00 102.27 ? 62   LYS H N   1 
ATOM   10581 C CA  . LYS H  1 62  ? 30.402  81.416  222.059 1.00 100.64 ? 62   LYS H CA  1 
ATOM   10582 C C   . LYS H  1 62  ? 29.805  80.946  220.737 1.00 99.27  ? 62   LYS H C   1 
ATOM   10583 O O   . LYS H  1 62  ? 28.607  81.083  220.493 1.00 99.32  ? 62   LYS H O   1 
ATOM   10584 C CB  . LYS H  1 62  ? 30.153  80.366  223.151 1.00 100.65 ? 62   LYS H CB  1 
ATOM   10585 C CG  . LYS H  1 62  ? 31.055  79.136  223.103 1.00 100.31 ? 62   LYS H CG  1 
ATOM   10586 C CD  . LYS H  1 62  ? 30.578  78.128  224.126 1.00 100.08 ? 62   LYS H CD  1 
ATOM   10587 C CE  . LYS H  1 62  ? 31.454  76.901  224.150 1.00 100.55 ? 62   LYS H CE  1 
ATOM   10588 N NZ  . LYS H  1 62  ? 30.846  75.841  225.002 1.00 101.72 ? 62   LYS H NZ  1 
ATOM   10589 N N   . VAL H  1 63  ? 30.663  80.400  219.886 1.00 97.35  ? 63   VAL H N   1 
ATOM   10590 C CA  . VAL H  1 63  ? 30.246  79.880  218.601 1.00 95.03  ? 63   VAL H CA  1 
ATOM   10591 C C   . VAL H  1 63  ? 30.891  78.518  218.441 1.00 93.70  ? 63   VAL H C   1 
ATOM   10592 O O   . VAL H  1 63  ? 32.113  78.393  218.445 1.00 93.49  ? 63   VAL H O   1 
ATOM   10593 C CB  . VAL H  1 63  ? 30.707  80.783  217.459 1.00 94.92  ? 63   VAL H CB  1 
ATOM   10594 C CG1 . VAL H  1 63  ? 30.396  80.131  216.121 1.00 94.87  ? 63   VAL H CG1 1 
ATOM   10595 C CG2 . VAL H  1 63  ? 30.023  82.123  217.569 1.00 94.89  ? 63   VAL H CG2 1 
ATOM   10596 N N   . CYS H  1 64  ? 30.065  77.494  218.317 1.00 91.90  ? 64   CYS H N   1 
ATOM   10597 C CA  . CYS H  1 64  ? 30.578  76.151  218.153 1.00 90.60  ? 64   CYS H CA  1 
ATOM   10598 C C   . CYS H  1 64  ? 30.780  75.803  216.683 1.00 89.42  ? 64   CYS H C   1 
ATOM   10599 O O   . CYS H  1 64  ? 30.091  76.322  215.808 1.00 89.87  ? 64   CYS H O   1 
ATOM   10600 C CB  . CYS H  1 64  ? 29.624  75.160  218.813 1.00 90.67  ? 64   CYS H CB  1 
ATOM   10601 S SG  . CYS H  1 64  ? 29.547  75.359  220.596 1.00 90.85  ? 64   CYS H SG  1 
ATOM   10602 N N   . TYR H  1 65  ? 31.728  74.918  216.413 1.00 87.42  ? 65   TYR H N   1 
ATOM   10603 C CA  . TYR H  1 65  ? 32.004  74.524  215.045 1.00 85.42  ? 65   TYR H CA  1 
ATOM   10604 C C   . TYR H  1 65  ? 32.903  73.310  215.043 1.00 84.39  ? 65   TYR H C   1 
ATOM   10605 O O   . TYR H  1 65  ? 33.476  72.964  216.073 1.00 85.21  ? 65   TYR H O   1 
ATOM   10606 C CB  . TYR H  1 65  ? 32.691  75.677  214.317 1.00 84.84  ? 65   TYR H CB  1 
ATOM   10607 C CG  . TYR H  1 65  ? 34.113  75.953  214.774 1.00 84.19  ? 65   TYR H CG  1 
ATOM   10608 C CD1 . TYR H  1 65  ? 35.207  75.353  214.138 1.00 84.23  ? 65   TYR H CD1 1 
ATOM   10609 C CD2 . TYR H  1 65  ? 34.369  76.817  215.833 1.00 84.15  ? 65   TYR H CD2 1 
ATOM   10610 C CE1 . TYR H  1 65  ? 36.522  75.612  214.543 1.00 83.35  ? 65   TYR H CE1 1 
ATOM   10611 C CE2 . TYR H  1 65  ? 35.687  77.081  216.250 1.00 83.48  ? 65   TYR H CE2 1 
ATOM   10612 C CZ  . TYR H  1 65  ? 36.750  76.472  215.595 1.00 83.38  ? 65   TYR H CZ  1 
ATOM   10613 O OH  . TYR H  1 65  ? 38.039  76.716  215.987 1.00 82.57  ? 65   TYR H OH  1 
ATOM   10614 N N   . ILE H  1 66  ? 33.026  72.659  213.891 1.00 82.62  ? 66   ILE H N   1 
ATOM   10615 C CA  . ILE H  1 66  ? 33.897  71.495  213.772 1.00 81.31  ? 66   ILE H CA  1 
ATOM   10616 C C   . ILE H  1 66  ? 35.065  71.879  212.881 1.00 80.62  ? 66   ILE H C   1 
ATOM   10617 O O   . ILE H  1 66  ? 34.894  72.562  211.870 1.00 80.45  ? 66   ILE H O   1 
ATOM   10618 C CB  . ILE H  1 66  ? 33.158  70.298  213.156 1.00 80.75  ? 66   ILE H CB  1 
ATOM   10619 C CG1 . ILE H  1 66  ? 31.846  70.078  213.919 1.00 81.04  ? 66   ILE H CG1 1 
ATOM   10620 C CG2 . ILE H  1 66  ? 34.056  69.051  213.186 1.00 79.92  ? 66   ILE H CG2 1 
ATOM   10621 C CD1 . ILE H  1 66  ? 30.893  69.071  213.296 1.00 81.05  ? 66   ILE H CD1 1 
ATOM   10622 N N   . GLU H  1 67  ? 36.258  71.459  213.259 1.00 79.92  ? 67   GLU H N   1 
ATOM   10623 C CA  . GLU H  1 67  ? 37.410  71.800  212.458 1.00 80.06  ? 67   GLU H CA  1 
ATOM   10624 C C   . GLU H  1 67  ? 37.448  70.972  211.195 1.00 79.02  ? 67   GLU H C   1 
ATOM   10625 O O   . GLU H  1 67  ? 37.163  69.769  211.215 1.00 78.47  ? 67   GLU H O   1 
ATOM   10626 C CB  . GLU H  1 67  ? 38.692  71.622  213.268 1.00 81.65  ? 67   GLU H CB  1 
ATOM   10627 C CG  . GLU H  1 67  ? 38.810  72.652  214.387 1.00 84.34  ? 67   GLU H CG  1 
ATOM   10628 C CD  . GLU H  1 67  ? 40.077  72.498  215.228 1.00 85.79  ? 67   GLU H CD  1 
ATOM   10629 O OE1 . GLU H  1 67  ? 40.260  71.422  215.860 1.00 85.57  ? 67   GLU H OE1 1 
ATOM   10630 O OE2 . GLU H  1 67  ? 40.885  73.466  215.255 1.00 86.75  ? 67   GLU H OE2 1 
ATOM   10631 N N   . GLY H  1 68  ? 37.806  71.644  210.105 1.00 77.60  ? 68   GLY H N   1 
ATOM   10632 C CA  . GLY H  1 68  ? 37.870  71.008  208.810 1.00 76.32  ? 68   GLY H CA  1 
ATOM   10633 C C   . GLY H  1 68  ? 38.522  69.650  208.767 1.00 75.36  ? 68   GLY H C   1 
ATOM   10634 O O   . GLY H  1 68  ? 37.991  68.719  208.153 1.00 75.06  ? 68   GLY H O   1 
ATOM   10635 N N   . HIS H  1 69  ? 39.666  69.510  209.418 1.00 74.98  ? 69   HIS H N   1 
ATOM   10636 C CA  . HIS H  1 69  ? 40.327  68.221  209.361 1.00 75.48  ? 69   HIS H CA  1 
ATOM   10637 C C   . HIS H  1 69  ? 39.509  67.105  210.009 1.00 74.82  ? 69   HIS H C   1 
ATOM   10638 O O   . HIS H  1 69  ? 39.620  65.940  209.616 1.00 74.89  ? 69   HIS H O   1 
ATOM   10639 C CB  . HIS H  1 69  ? 41.745  68.286  209.961 1.00 77.22  ? 69   HIS H CB  1 
ATOM   10640 C CG  . HIS H  1 69  ? 41.778  68.432  211.451 1.00 78.71  ? 69   HIS H CG  1 
ATOM   10641 N ND1 . HIS H  1 69  ? 41.724  69.658  212.081 1.00 79.37  ? 69   HIS H ND1 1 
ATOM   10642 C CD2 . HIS H  1 69  ? 41.838  67.500  212.435 1.00 78.66  ? 69   HIS H CD2 1 
ATOM   10643 C CE1 . HIS H  1 69  ? 41.749  69.475  213.392 1.00 79.43  ? 69   HIS H CE1 1 
ATOM   10644 N NE2 . HIS H  1 69  ? 41.815  68.177  213.631 1.00 79.30  ? 69   HIS H NE2 1 
ATOM   10645 N N   . ARG H  1 70  ? 38.675  67.445  210.986 1.00 74.00  ? 70   ARG H N   1 
ATOM   10646 C CA  . ARG H  1 70  ? 37.851  66.419  211.627 1.00 73.27  ? 70   ARG H CA  1 
ATOM   10647 C C   . ARG H  1 70  ? 36.748  65.974  210.651 1.00 70.91  ? 70   ARG H C   1 
ATOM   10648 O O   . ARG H  1 70  ? 36.422  64.783  210.531 1.00 69.77  ? 70   ARG H O   1 
ATOM   10649 C CB  . ARG H  1 70  ? 37.224  66.967  212.925 1.00 75.86  ? 70   ARG H CB  1 
ATOM   10650 C CG  . ARG H  1 70  ? 38.230  67.319  214.009 1.00 77.88  ? 70   ARG H CG  1 
ATOM   10651 C CD  . ARG H  1 70  ? 38.125  66.428  215.264 1.00 80.44  ? 70   ARG H CD  1 
ATOM   10652 N NE  . ARG H  1 70  ? 39.209  66.767  216.183 1.00 82.23  ? 70   ARG H NE  1 
ATOM   10653 C CZ  . ARG H  1 70  ? 39.395  67.987  216.689 1.00 83.21  ? 70   ARG H CZ  1 
ATOM   10654 N NH1 . ARG H  1 70  ? 38.557  68.978  216.388 1.00 82.84  ? 70   ARG H NH1 1 
ATOM   10655 N NH2 . ARG H  1 70  ? 40.464  68.244  217.436 1.00 83.46  ? 70   ARG H NH2 1 
ATOM   10656 N N   . VAL H  1 71  ? 36.173  66.956  209.963 1.00 68.79  ? 71   VAL H N   1 
ATOM   10657 C CA  . VAL H  1 71  ? 35.125  66.697  208.989 1.00 66.08  ? 71   VAL H CA  1 
ATOM   10658 C C   . VAL H  1 71  ? 35.667  65.843  207.841 1.00 64.36  ? 71   VAL H C   1 
ATOM   10659 O O   . VAL H  1 71  ? 35.008  64.913  207.378 1.00 64.14  ? 71   VAL H O   1 
ATOM   10660 C CB  . VAL H  1 71  ? 34.567  67.994  208.429 1.00 65.54  ? 71   VAL H CB  1 
ATOM   10661 C CG1 . VAL H  1 71  ? 33.569  67.682  207.367 1.00 65.06  ? 71   VAL H CG1 1 
ATOM   10662 C CG2 . VAL H  1 71  ? 33.917  68.799  209.539 1.00 64.96  ? 71   VAL H CG2 1 
ATOM   10663 N N   . ILE H  1 72  ? 36.873  66.145  207.388 1.00 62.26  ? 72   ILE H N   1 
ATOM   10664 C CA  . ILE H  1 72  ? 37.462  65.355  206.319 1.00 61.18  ? 72   ILE H CA  1 
ATOM   10665 C C   . ILE H  1 72  ? 37.617  63.899  206.741 1.00 61.69  ? 72   ILE H C   1 
ATOM   10666 O O   . ILE H  1 72  ? 37.301  62.987  205.965 1.00 61.01  ? 72   ILE H O   1 
ATOM   10667 C CB  . ILE H  1 72  ? 38.827  65.928  205.899 1.00 60.52  ? 72   ILE H CB  1 
ATOM   10668 C CG1 . ILE H  1 72  ? 38.593  67.217  205.111 1.00 59.38  ? 72   ILE H CG1 1 
ATOM   10669 C CG2 . ILE H  1 72  ? 39.628  64.900  205.093 1.00 57.52  ? 72   ILE H CG2 1 
ATOM   10670 C CD1 . ILE H  1 72  ? 39.853  68.006  204.834 1.00 59.92  ? 72   ILE H CD1 1 
ATOM   10671 N N   . ASN H  1 73  ? 38.082  63.674  207.972 1.00 62.28  ? 73   ASN H N   1 
ATOM   10672 C CA  . ASN H  1 73  ? 38.246  62.302  208.443 1.00 63.00  ? 73   ASN H CA  1 
ATOM   10673 C C   . ASN H  1 73  ? 36.910  61.627  208.678 1.00 61.78  ? 73   ASN H C   1 
ATOM   10674 O O   . ASN H  1 73  ? 36.758  60.434  208.433 1.00 59.65  ? 73   ASN H O   1 
ATOM   10675 C CB  . ASN H  1 73  ? 39.100  62.246  209.707 1.00 66.13  ? 73   ASN H CB  1 
ATOM   10676 C CG  . ASN H  1 73  ? 40.593  62.354  209.408 1.00 69.21  ? 73   ASN H CG  1 
ATOM   10677 O OD1 . ASN H  1 73  ? 41.060  61.957  208.319 1.00 70.19  ? 73   ASN H OD1 1 
ATOM   10678 N ND2 . ASN H  1 73  ? 41.358  62.873  210.383 1.00 70.10  ? 73   ASN H ND2 1 
ATOM   10679 N N   . LEU H  1 74  ? 35.937  62.389  209.155 1.00 61.58  ? 74   LEU H N   1 
ATOM   10680 C CA  . LEU H  1 74  ? 34.620  61.817  209.352 1.00 62.64  ? 74   LEU H CA  1 
ATOM   10681 C C   . LEU H  1 74  ? 34.162  61.286  207.996 1.00 62.72  ? 74   LEU H C   1 
ATOM   10682 O O   . LEU H  1 74  ? 33.737  60.140  207.864 1.00 61.95  ? 74   LEU H O   1 
ATOM   10683 C CB  . LEU H  1 74  ? 33.650  62.886  209.853 1.00 62.71  ? 74   LEU H CB  1 
ATOM   10684 C CG  . LEU H  1 74  ? 33.631  63.127  211.358 1.00 62.96  ? 74   LEU H CG  1 
ATOM   10685 C CD1 . LEU H  1 74  ? 32.900  64.407  211.610 1.00 63.11  ? 74   LEU H CD1 1 
ATOM   10686 C CD2 . LEU H  1 74  ? 32.954  61.952  212.094 1.00 62.95  ? 74   LEU H CD2 1 
ATOM   10687 N N   . ALA H  1 75  ? 34.294  62.130  206.978 1.00 63.74  ? 75   ALA H N   1 
ATOM   10688 C CA  . ALA H  1 75  ? 33.894  61.776  205.619 1.00 64.42  ? 75   ALA H CA  1 
ATOM   10689 C C   . ALA H  1 75  ? 34.622  60.546  205.086 1.00 64.53  ? 75   ALA H C   1 
ATOM   10690 O O   . ALA H  1 75  ? 33.998  59.602  204.564 1.00 63.20  ? 75   ALA H O   1 
ATOM   10691 C CB  . ALA H  1 75  ? 34.125  62.957  204.697 1.00 64.26  ? 75   ALA H CB  1 
ATOM   10692 N N   . ASN H  1 76  ? 35.942  60.560  205.209 1.00 65.10  ? 76   ASN H N   1 
ATOM   10693 C CA  . ASN H  1 76  ? 36.713  59.433  204.725 1.00 67.01  ? 76   ASN H CA  1 
ATOM   10694 C C   . ASN H  1 76  ? 36.329  58.113  205.395 1.00 67.59  ? 76   ASN H C   1 
ATOM   10695 O O   . ASN H  1 76  ? 36.279  57.071  204.737 1.00 68.07  ? 76   ASN H O   1 
ATOM   10696 C CB  . ASN H  1 76  ? 38.217  59.694  204.890 1.00 67.94  ? 76   ASN H CB  1 
ATOM   10697 C CG  . ASN H  1 76  ? 38.756  60.672  203.854 1.00 69.28  ? 76   ASN H CG  1 
ATOM   10698 O OD1 . ASN H  1 76  ? 38.387  60.613  202.668 1.00 69.48  ? 76   ASN H OD1 1 
ATOM   10699 N ND2 . ASN H  1 76  ? 39.648  61.567  204.286 1.00 70.19  ? 76   ASN H ND2 1 
ATOM   10700 N N   . GLU H  1 77  ? 36.058  58.153  206.700 1.00 68.08  ? 77   GLU H N   1 
ATOM   10701 C CA  . GLU H  1 77  ? 35.692  56.941  207.425 1.00 67.57  ? 77   GLU H CA  1 
ATOM   10702 C C   . GLU H  1 77  ? 34.258  56.542  207.154 1.00 67.27  ? 77   GLU H C   1 
ATOM   10703 O O   . GLU H  1 77  ? 33.949  55.352  207.099 1.00 68.59  ? 77   GLU H O   1 
ATOM   10704 C CB  . GLU H  1 77  ? 35.922  57.126  208.926 1.00 68.13  ? 77   GLU H CB  1 
ATOM   10705 C CG  . GLU H  1 77  ? 37.400  57.344  209.270 1.00 67.33  ? 77   GLU H CG  1 
ATOM   10706 C CD  . GLU H  1 77  ? 38.268  56.160  208.871 1.00 67.25  ? 77   GLU H CD  1 
ATOM   10707 O OE1 . GLU H  1 77  ? 39.494  56.353  208.679 1.00 66.70  ? 77   GLU H OE1 1 
ATOM   10708 O OE2 . GLU H  1 77  ? 37.716  55.040  208.760 1.00 66.32  ? 77   GLU H OE2 1 
ATOM   10709 N N   . MET H  1 78  ? 33.383  57.524  206.970 1.00 65.65  ? 78   MET H N   1 
ATOM   10710 C CA  . MET H  1 78  ? 31.985  57.228  206.669 1.00 63.90  ? 78   MET H CA  1 
ATOM   10711 C C   . MET H  1 78  ? 31.801  56.628  205.258 1.00 61.41  ? 78   MET H C   1 
ATOM   10712 O O   . MET H  1 78  ? 31.113  55.623  205.102 1.00 60.86  ? 78   MET H O   1 
ATOM   10713 C CB  . MET H  1 78  ? 31.150  58.513  206.789 1.00 65.92  ? 78   MET H CB  1 
ATOM   10714 C CG  . MET H  1 78  ? 29.641  58.307  206.718 1.00 68.69  ? 78   MET H CG  1 
ATOM   10715 S SD  . MET H  1 78  ? 28.954  57.232  208.037 1.00 73.82  ? 78   MET H SD  1 
ATOM   10716 C CE  . MET H  1 78  ? 29.107  58.341  209.501 1.00 70.79  ? 78   MET H CE  1 
ATOM   10717 N N   . PHE H  1 79  ? 32.444  57.230  204.246 1.00 58.62  ? 79   PHE H N   1 
ATOM   10718 C CA  . PHE H  1 79  ? 32.287  56.798  202.844 1.00 55.53  ? 79   PHE H CA  1 
ATOM   10719 C C   . PHE H  1 79  ? 33.457  56.116  202.155 1.00 54.79  ? 79   PHE H C   1 
ATOM   10720 O O   . PHE H  1 79  ? 33.305  55.568  201.066 1.00 53.50  ? 79   PHE H O   1 
ATOM   10721 C CB  . PHE H  1 79  ? 31.896  57.992  201.974 1.00 51.20  ? 79   PHE H CB  1 
ATOM   10722 C CG  . PHE H  1 79  ? 30.763  58.810  202.522 1.00 47.21  ? 79   PHE H CG  1 
ATOM   10723 C CD1 . PHE H  1 79  ? 29.464  58.314  202.543 1.00 46.32  ? 79   PHE H CD1 1 
ATOM   10724 C CD2 . PHE H  1 79  ? 30.991  60.107  202.957 1.00 45.03  ? 79   PHE H CD2 1 
ATOM   10725 C CE1 . PHE H  1 79  ? 28.396  59.127  202.983 1.00 45.64  ? 79   PHE H CE1 1 
ATOM   10726 C CE2 . PHE H  1 79  ? 29.948  60.922  203.393 1.00 44.19  ? 79   PHE H CE2 1 
ATOM   10727 C CZ  . PHE H  1 79  ? 28.648  60.438  203.406 1.00 44.15  ? 79   PHE H CZ  1 
ATOM   10728 N N   . GLY H  1 80  ? 34.618  56.151  202.783 1.00 54.69  ? 80   GLY H N   1 
ATOM   10729 C CA  . GLY H  1 80  ? 35.785  55.552  202.173 1.00 54.41  ? 80   GLY H CA  1 
ATOM   10730 C C   . GLY H  1 80  ? 36.511  56.687  201.479 1.00 54.46  ? 80   GLY H C   1 
ATOM   10731 O O   . GLY H  1 80  ? 35.875  57.640  201.023 1.00 54.02  ? 80   GLY H O   1 
ATOM   10732 N N   . TYR H  1 81  ? 37.837  56.610  201.413 1.00 54.77  ? 81   TYR H N   1 
ATOM   10733 C CA  . TYR H  1 81  ? 38.610  57.655  200.768 1.00 54.83  ? 81   TYR H CA  1 
ATOM   10734 C C   . TYR H  1 81  ? 38.134  57.857  199.320 1.00 54.89  ? 81   TYR H C   1 
ATOM   10735 O O   . TYR H  1 81  ? 38.237  58.950  198.770 1.00 54.51  ? 81   TYR H O   1 
ATOM   10736 C CB  . TYR H  1 81  ? 40.090  57.294  200.776 1.00 54.83  ? 81   TYR H CB  1 
ATOM   10737 C CG  . TYR H  1 81  ? 40.454  56.149  199.860 1.00 56.41  ? 81   TYR H CG  1 
ATOM   10738 C CD1 . TYR H  1 81  ? 40.425  54.827  200.313 1.00 57.73  ? 81   TYR H CD1 1 
ATOM   10739 C CD2 . TYR H  1 81  ? 40.851  56.379  198.540 1.00 56.31  ? 81   TYR H CD2 1 
ATOM   10740 C CE1 . TYR H  1 81  ? 40.786  53.759  199.475 1.00 57.41  ? 81   TYR H CE1 1 
ATOM   10741 C CE2 . TYR H  1 81  ? 41.215  55.325  197.699 1.00 57.15  ? 81   TYR H CE2 1 
ATOM   10742 C CZ  . TYR H  1 81  ? 41.180  54.015  198.171 1.00 57.49  ? 81   TYR H CZ  1 
ATOM   10743 O OH  . TYR H  1 81  ? 41.537  52.961  197.344 1.00 57.55  ? 81   TYR H OH  1 
ATOM   10744 N N   . ASN H  1 82  ? 37.609  56.800  198.714 1.00 54.03  ? 82   ASN H N   1 
ATOM   10745 C CA  . ASN H  1 82  ? 37.130  56.867  197.349 1.00 53.74  ? 82   ASN H CA  1 
ATOM   10746 C C   . ASN H  1 82  ? 35.598  56.866  197.264 1.00 53.47  ? 82   ASN H C   1 
ATOM   10747 O O   . ASN H  1 82  ? 35.025  56.523  196.222 1.00 53.76  ? 82   ASN H O   1 
ATOM   10748 C CB  . ASN H  1 82  ? 37.665  55.673  196.571 1.00 54.33  ? 82   ASN H CB  1 
ATOM   10749 C CG  . ASN H  1 82  ? 37.039  54.366  197.011 1.00 55.62  ? 82   ASN H CG  1 
ATOM   10750 O OD1 . ASN H  1 82  ? 37.064  53.358  196.282 1.00 55.70  ? 82   ASN H OD1 1 
ATOM   10751 N ND2 . ASN H  1 82  ? 36.478  54.365  198.219 1.00 57.43  ? 82   ASN H ND2 1 
ATOM   10752 N N   . GLY H  1 83  ? 34.933  57.253  198.343 1.00 52.00  ? 83   GLY H N   1 
ATOM   10753 C CA  . GLY H  1 83  ? 33.489  57.227  198.326 1.00 51.13  ? 83   GLY H CA  1 
ATOM   10754 C C   . GLY H  1 83  ? 32.806  58.570  198.281 1.00 50.78  ? 83   GLY H C   1 
ATOM   10755 O O   . GLY H  1 83  ? 31.574  58.651  198.149 1.00 51.33  ? 83   GLY H O   1 
ATOM   10756 N N   . TRP H  1 84  ? 33.578  59.637  198.417 1.00 50.04  ? 84   TRP H N   1 
ATOM   10757 C CA  . TRP H  1 84  ? 32.987  60.976  198.353 1.00 49.35  ? 84   TRP H CA  1 
ATOM   10758 C C   . TRP H  1 84  ? 34.011  61.849  197.639 1.00 49.55  ? 84   TRP H C   1 
ATOM   10759 O O   . TRP H  1 84  ? 35.202  61.478  197.534 1.00 49.56  ? 84   TRP H O   1 
ATOM   10760 C CB  . TRP H  1 84  ? 32.686  61.544  199.756 1.00 49.15  ? 84   TRP H CB  1 
ATOM   10761 C CG  . TRP H  1 84  ? 33.941  61.838  200.607 1.00 49.70  ? 84   TRP H CG  1 
ATOM   10762 C CD1 . TRP H  1 84  ? 34.789  60.924  201.186 1.00 47.95  ? 84   TRP H CD1 1 
ATOM   10763 C CD2 . TRP H  1 84  ? 34.534  63.128  200.832 1.00 49.80  ? 84   TRP H CD2 1 
ATOM   10764 N NE1 . TRP H  1 84  ? 35.868  61.571  201.737 1.00 48.39  ? 84   TRP H NE1 1 
ATOM   10765 C CE2 . TRP H  1 84  ? 35.738  62.921  201.537 1.00 48.58  ? 84   TRP H CE2 1 
ATOM   10766 C CE3 . TRP H  1 84  ? 34.160  64.444  200.499 1.00 50.48  ? 84   TRP H CE3 1 
ATOM   10767 C CZ2 . TRP H  1 84  ? 36.576  63.966  201.914 1.00 49.22  ? 84   TRP H CZ2 1 
ATOM   10768 C CZ3 . TRP H  1 84  ? 34.997  65.499  200.876 1.00 50.62  ? 84   TRP H CZ3 1 
ATOM   10769 C CH2 . TRP H  1 84  ? 36.193  65.247  201.579 1.00 50.80  ? 84   TRP H CH2 1 
ATOM   10770 N N   . ALA H  1 85  ? 33.550  62.989  197.133 1.00 48.06  ? 85   ALA H N   1 
ATOM   10771 C CA  . ALA H  1 85  ? 34.434  63.888  196.434 1.00 47.63  ? 85   ALA H CA  1 
ATOM   10772 C C   . ALA H  1 85  ? 33.825  65.266  196.543 1.00 48.02  ? 85   ALA H C   1 
ATOM   10773 O O   . ALA H  1 85  ? 32.666  65.419  196.965 1.00 47.97  ? 85   ALA H O   1 
ATOM   10774 C CB  . ALA H  1 85  ? 34.559  63.454  194.957 1.00 46.39  ? 85   ALA H CB  1 
ATOM   10775 N N   . HIS H  1 86  ? 34.605  66.275  196.190 1.00 47.33  ? 86   HIS H N   1 
ATOM   10776 C CA  . HIS H  1 86  ? 34.071  67.623  196.215 1.00 47.07  ? 86   HIS H CA  1 
ATOM   10777 C C   . HIS H  1 86  ? 34.848  68.488  195.217 1.00 47.26  ? 86   HIS H C   1 
ATOM   10778 O O   . HIS H  1 86  ? 36.035  68.237  194.927 1.00 46.80  ? 86   HIS H O   1 
ATOM   10779 C CB  . HIS H  1 86  ? 34.131  68.222  197.645 1.00 44.54  ? 86   HIS H CB  1 
ATOM   10780 C CG  . HIS H  1 86  ? 35.493  68.693  198.063 1.00 42.69  ? 86   HIS H CG  1 
ATOM   10781 N ND1 . HIS H  1 86  ? 36.527  67.827  198.353 1.00 42.21  ? 86   HIS H ND1 1 
ATOM   10782 C CD2 . HIS H  1 86  ? 35.997  69.941  198.224 1.00 41.65  ? 86   HIS H CD2 1 
ATOM   10783 C CE1 . HIS H  1 86  ? 37.606  68.519  198.672 1.00 41.67  ? 86   HIS H CE1 1 
ATOM   10784 N NE2 . HIS H  1 86  ? 37.311  69.807  198.602 1.00 41.95  ? 86   HIS H NE2 1 
ATOM   10785 N N   . SER H  1 87  ? 34.155  69.484  194.679 1.00 47.21  ? 87   SER H N   1 
ATOM   10786 C CA  . SER H  1 87  ? 34.755  70.415  193.744 1.00 47.59  ? 87   SER H CA  1 
ATOM   10787 C C   . SER H  1 87  ? 34.291  71.836  194.095 1.00 47.47  ? 87   SER H C   1 
ATOM   10788 O O   . SER H  1 87  ? 33.309  72.015  194.812 1.00 48.08  ? 87   SER H O   1 
ATOM   10789 C CB  . SER H  1 87  ? 34.352  70.036  192.315 1.00 46.61  ? 87   SER H CB  1 
ATOM   10790 O OG  . SER H  1 87  ? 32.953  70.126  192.145 1.00 47.54  ? 87   SER H OG  1 
ATOM   10791 N N   . ILE H  1 88  ? 35.013  72.844  193.626 1.00 47.33  ? 88   ILE H N   1 
ATOM   10792 C CA  . ILE H  1 88  ? 34.612  74.221  193.873 1.00 48.54  ? 88   ILE H CA  1 
ATOM   10793 C C   . ILE H  1 88  ? 33.894  74.700  192.609 1.00 50.25  ? 88   ILE H C   1 
ATOM   10794 O O   . ILE H  1 88  ? 34.525  74.956  191.577 1.00 51.28  ? 88   ILE H O   1 
ATOM   10795 C CB  . ILE H  1 88  ? 35.838  75.103  194.141 1.00 47.34  ? 88   ILE H CB  1 
ATOM   10796 C CG1 . ILE H  1 88  ? 36.496  74.653  195.443 1.00 46.01  ? 88   ILE H CG1 1 
ATOM   10797 C CG2 . ILE H  1 88  ? 35.432  76.573  194.180 1.00 45.74  ? 88   ILE H CG2 1 
ATOM   10798 C CD1 . ILE H  1 88  ? 37.965  74.969  195.554 1.00 45.75  ? 88   ILE H CD1 1 
ATOM   10799 N N   . THR H  1 89  ? 32.576  74.806  192.665 1.00 51.16  ? 89   THR H N   1 
ATOM   10800 C CA  . THR H  1 89  ? 31.879  75.236  191.473 1.00 53.17  ? 89   THR H CA  1 
ATOM   10801 C C   . THR H  1 89  ? 32.252  76.685  191.171 1.00 55.43  ? 89   THR H C   1 
ATOM   10802 O O   . THR H  1 89  ? 32.376  77.087  189.998 1.00 56.42  ? 89   THR H O   1 
ATOM   10803 C CB  . THR H  1 89  ? 30.335  75.032  191.600 1.00 52.01  ? 89   THR H CB  1 
ATOM   10804 O OG1 . THR H  1 89  ? 29.862  75.622  192.800 1.00 50.34  ? 89   THR H OG1 1 
ATOM   10805 C CG2 . THR H  1 89  ? 29.989  73.529  191.638 1.00 51.91  ? 89   THR H CG2 1 
ATOM   10806 N N   . GLN H  1 90  ? 32.476  77.461  192.225 1.00 57.21  ? 90   GLN H N   1 
ATOM   10807 C CA  . GLN H  1 90  ? 32.860  78.851  192.044 1.00 58.97  ? 90   GLN H CA  1 
ATOM   10808 C C   . GLN H  1 90  ? 33.317  79.541  193.326 1.00 59.31  ? 90   GLN H C   1 
ATOM   10809 O O   . GLN H  1 90  ? 32.834  79.232  194.408 1.00 59.15  ? 90   GLN H O   1 
ATOM   10810 C CB  . GLN H  1 90  ? 31.704  79.647  191.451 1.00 58.82  ? 90   GLN H CB  1 
ATOM   10811 C CG  . GLN H  1 90  ? 32.157  80.990  190.959 1.00 62.27  ? 90   GLN H CG  1 
ATOM   10812 C CD  . GLN H  1 90  ? 31.021  81.947  190.688 1.00 63.97  ? 90   GLN H CD  1 
ATOM   10813 O OE1 . GLN H  1 90  ? 30.088  81.624  189.960 1.00 66.31  ? 90   GLN H OE1 1 
ATOM   10814 N NE2 . GLN H  1 90  ? 31.100  83.148  191.267 1.00 65.52  ? 90   GLN H NE2 1 
ATOM   10815 N N   . GLN H  1 91  ? 34.273  80.454  193.201 1.00 59.57  ? 91   GLN H N   1 
ATOM   10816 C CA  . GLN H  1 91  ? 34.723  81.220  194.342 1.00 59.86  ? 91   GLN H CA  1 
ATOM   10817 C C   . GLN H  1 91  ? 34.748  82.643  193.916 1.00 61.16  ? 91   GLN H C   1 
ATOM   10818 O O   . GLN H  1 91  ? 35.376  82.995  192.926 1.00 62.57  ? 91   GLN H O   1 
ATOM   10819 C CB  . GLN H  1 91  ? 36.121  80.868  194.818 1.00 59.07  ? 91   GLN H CB  1 
ATOM   10820 C CG  . GLN H  1 91  ? 36.489  81.742  196.024 1.00 57.64  ? 91   GLN H CG  1 
ATOM   10821 C CD  . GLN H  1 91  ? 37.744  81.303  196.724 1.00 57.25  ? 91   GLN H CD  1 
ATOM   10822 O OE1 . GLN H  1 91  ? 38.842  81.543  196.241 1.00 56.58  ? 91   GLN H OE1 1 
ATOM   10823 N NE2 . GLN H  1 91  ? 37.588  80.645  197.870 1.00 57.53  ? 91   GLN H NE2 1 
ATOM   10824 N N   . ASN H  1 92  ? 34.090  83.483  194.685 1.00 62.81  ? 92   ASN H N   1 
ATOM   10825 C CA  . ASN H  1 92  ? 34.043  84.880  194.343 1.00 63.87  ? 92   ASN H CA  1 
ATOM   10826 C C   . ASN H  1 92  ? 34.494  85.801  195.477 1.00 63.82  ? 92   ASN H C   1 
ATOM   10827 O O   . ASN H  1 92  ? 34.056  85.679  196.623 1.00 64.80  ? 92   ASN H O   1 
ATOM   10828 C CB  . ASN H  1 92  ? 32.629  85.208  193.893 1.00 65.20  ? 92   ASN H CB  1 
ATOM   10829 C CG  . ASN H  1 92  ? 32.526  86.582  193.311 1.00 67.29  ? 92   ASN H CG  1 
ATOM   10830 O OD1 . ASN H  1 92  ? 32.456  87.571  194.039 1.00 67.71  ? 92   ASN H OD1 1 
ATOM   10831 N ND2 . ASN H  1 92  ? 32.542  86.665  191.981 1.00 68.57  ? 92   ASN H ND2 1 
ATOM   10832 N N   . VAL H  1 93  ? 35.403  86.711  195.168 1.00 63.49  ? 93   VAL H N   1 
ATOM   10833 C CA  . VAL H  1 93  ? 35.868  87.649  196.179 1.00 62.68  ? 93   VAL H CA  1 
ATOM   10834 C C   . VAL H  1 93  ? 34.872  88.791  196.213 1.00 64.19  ? 93   VAL H C   1 
ATOM   10835 O O   . VAL H  1 93  ? 34.797  89.575  195.265 1.00 64.56  ? 93   VAL H O   1 
ATOM   10836 C CB  . VAL H  1 93  ? 37.229  88.225  195.833 1.00 60.14  ? 93   VAL H CB  1 
ATOM   10837 C CG1 . VAL H  1 93  ? 37.551  89.317  196.784 1.00 60.20  ? 93   VAL H CG1 1 
ATOM   10838 C CG2 . VAL H  1 93  ? 38.279  87.155  195.905 1.00 58.55  ? 93   VAL H CG2 1 
ATOM   10839 N N   . ASP H  1 94  ? 34.116  88.898  197.300 1.00 65.00  ? 94   ASP H N   1 
ATOM   10840 C CA  . ASP H  1 94  ? 33.116  89.956  197.411 1.00 66.28  ? 94   ASP H CA  1 
ATOM   10841 C C   . ASP H  1 94  ? 33.651  91.370  197.494 1.00 66.33  ? 94   ASP H C   1 
ATOM   10842 O O   . ASP H  1 94  ? 33.057  92.291  196.932 1.00 66.29  ? 94   ASP H O   1 
ATOM   10843 C CB  . ASP H  1 94  ? 32.213  89.692  198.611 1.00 67.68  ? 94   ASP H CB  1 
ATOM   10844 C CG  . ASP H  1 94  ? 31.217  88.590  198.344 1.00 68.76  ? 94   ASP H CG  1 
ATOM   10845 O OD1 . ASP H  1 94  ? 30.568  88.098  199.289 1.00 68.59  ? 94   ASP H OD1 1 
ATOM   10846 O OD2 . ASP H  1 94  ? 31.076  88.224  197.162 1.00 71.00  ? 94   ASP H OD2 1 
ATOM   10847 N N   . PHE H  1 95  ? 34.764  91.534  198.205 1.00 66.89  ? 95   PHE H N   1 
ATOM   10848 C CA  . PHE H  1 95  ? 35.370  92.844  198.383 1.00 67.06  ? 95   PHE H CA  1 
ATOM   10849 C C   . PHE H  1 95  ? 36.727  92.774  199.087 1.00 66.82  ? 95   PHE H C   1 
ATOM   10850 O O   . PHE H  1 95  ? 37.036  91.833  199.820 1.00 65.97  ? 95   PHE H O   1 
ATOM   10851 C CB  . PHE H  1 95  ? 34.421  93.766  199.190 1.00 67.28  ? 95   PHE H CB  1 
ATOM   10852 C CG  . PHE H  1 95  ? 34.194  93.314  200.613 1.00 67.54  ? 95   PHE H CG  1 
ATOM   10853 C CD1 . PHE H  1 95  ? 35.097  93.643  201.614 1.00 67.70  ? 95   PHE H CD1 1 
ATOM   10854 C CD2 . PHE H  1 95  ? 33.104  92.519  200.940 1.00 68.03  ? 95   PHE H CD2 1 
ATOM   10855 C CE1 . PHE H  1 95  ? 34.923  93.186  202.912 1.00