data_1H4L
# 
_entry.id   1H4L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H4L         
PDBE  EBI-8025     
WWPDB D_1290008025 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1LFR 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'THEORETICAL STRUCTURE OF HUMAN-CYCLIN DEPENDENT KINASE 5(CDK5)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H4L 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tarricone, C.' 1 
'Dhavan, R.'    2 
'Peng, J.'      3 
'Areces, L.B.'  4 
'Tsai, L.-H.'   5 
'Musacchio, A.' 6 
# 
_citation.id                        primary 
_citation.title                     'Structure and Regulation of the Cdk5-P25(Nck5A) Complex' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            8 
_citation.page_first                657 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11583627 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(01)00343-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tarricone, C.' 1 ? 
primary 'Dhavan, R.'    2 ? 
primary 'Peng, J.'      3 ? 
primary 'Areces, L.B.'  4 ? 
primary 'Tsai, L.-H.'   5 ? 
primary 'Musacchio, A.' 6 ? 
# 
_cell.entry_id           1H4L 
_cell.length_a           149.090 
_cell.length_b           89.760 
_cell.length_c           82.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.08 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H4L 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CELL DIVISION PROTEIN KINASE 5'      33364.492 2  ? ? ?                  ? 
2 polymer man 'CYCLIN-DEPENDENT KINASE 5 ACTIVATOR' 17017.645 2  ? ? 'RESIDUES 147-293' ? 
3 water   nat water                                 18.015    69 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TAU PROTEIN KINASE II CATALYTIC SUBUNIT, CDK5' 
2 
;CDK5 ACTIVATOR 1, CYCLIN-DEPENDENT KINASE 5 REGULATORY SUBUNIT 1, TAU PROTEIN KINASE II 23 KDA SUBUNIT, TPKII REGULATORY SUBUNIT, P23, P25, P35
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVF
EFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSA
EVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
;
;MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVF
EFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSA
EVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
;
A,B ? 
2 'polypeptide(L)' no no 
;STSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVL
LTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES
;
;STSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVL
LTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES
;
D,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLN n 
1 3   LYS n 
1 4   TYR n 
1 5   GLU n 
1 6   LYS n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ILE n 
1 11  GLY n 
1 12  GLU n 
1 13  GLY n 
1 14  THR n 
1 15  TYR n 
1 16  GLY n 
1 17  THR n 
1 18  VAL n 
1 19  PHE n 
1 20  LYS n 
1 21  ALA n 
1 22  LYS n 
1 23  ASN n 
1 24  ARG n 
1 25  GLU n 
1 26  THR n 
1 27  HIS n 
1 28  GLU n 
1 29  ILE n 
1 30  VAL n 
1 31  ALA n 
1 32  LEU n 
1 33  LYS n 
1 34  ARG n 
1 35  VAL n 
1 36  ARG n 
1 37  LEU n 
1 38  ASP n 
1 39  ASP n 
1 40  ASP n 
1 41  ASP n 
1 42  GLU n 
1 43  GLY n 
1 44  VAL n 
1 45  PRO n 
1 46  SER n 
1 47  SER n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  CYS n 
1 54  LEU n 
1 55  LEU n 
1 56  LYS n 
1 57  GLU n 
1 58  LEU n 
1 59  LYS n 
1 60  HIS n 
1 61  LYS n 
1 62  ASN n 
1 63  ILE n 
1 64  VAL n 
1 65  ARG n 
1 66  LEU n 
1 67  HIS n 
1 68  ASP n 
1 69  VAL n 
1 70  LEU n 
1 71  HIS n 
1 72  SER n 
1 73  ASP n 
1 74  LYS n 
1 75  LYS n 
1 76  LEU n 
1 77  THR n 
1 78  LEU n 
1 79  VAL n 
1 80  PHE n 
1 81  GLU n 
1 82  PHE n 
1 83  CYS n 
1 84  ASP n 
1 85  GLN n 
1 86  ASP n 
1 87  LEU n 
1 88  LYS n 
1 89  LYS n 
1 90  TYR n 
1 91  PHE n 
1 92  ASP n 
1 93  SER n 
1 94  CYS n 
1 95  ASN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  ASP n 
1 100 PRO n 
1 101 GLU n 
1 102 ILE n 
1 103 VAL n 
1 104 LYS n 
1 105 SER n 
1 106 PHE n 
1 107 LEU n 
1 108 PHE n 
1 109 GLN n 
1 110 LEU n 
1 111 LEU n 
1 112 LYS n 
1 113 GLY n 
1 114 LEU n 
1 115 GLY n 
1 116 PHE n 
1 117 CYS n 
1 118 HIS n 
1 119 SER n 
1 120 ARG n 
1 121 ASN n 
1 122 VAL n 
1 123 LEU n 
1 124 HIS n 
1 125 ARG n 
1 126 ASP n 
1 127 LEU n 
1 128 LYS n 
1 129 PRO n 
1 130 GLN n 
1 131 ASN n 
1 132 LEU n 
1 133 LEU n 
1 134 ILE n 
1 135 ASN n 
1 136 ARG n 
1 137 ASN n 
1 138 GLY n 
1 139 GLU n 
1 140 LEU n 
1 141 LYS n 
1 142 LEU n 
1 143 ALA n 
1 144 ASP n 
1 145 PHE n 
1 146 GLY n 
1 147 LEU n 
1 148 ALA n 
1 149 ARG n 
1 150 ALA n 
1 151 PHE n 
1 152 GLY n 
1 153 ILE n 
1 154 PRO n 
1 155 VAL n 
1 156 ARG n 
1 157 CYS n 
1 158 TYR n 
1 159 SER n 
1 160 ALA n 
1 161 GLU n 
1 162 VAL n 
1 163 VAL n 
1 164 THR n 
1 165 LEU n 
1 166 TRP n 
1 167 TYR n 
1 168 ARG n 
1 169 PRO n 
1 170 PRO n 
1 171 ASP n 
1 172 VAL n 
1 173 LEU n 
1 174 PHE n 
1 175 GLY n 
1 176 ALA n 
1 177 LYS n 
1 178 LEU n 
1 179 TYR n 
1 180 SER n 
1 181 THR n 
1 182 SER n 
1 183 ILE n 
1 184 ASP n 
1 185 MET n 
1 186 TRP n 
1 187 SER n 
1 188 ALA n 
1 189 GLY n 
1 190 CYS n 
1 191 ILE n 
1 192 PHE n 
1 193 ALA n 
1 194 GLU n 
1 195 LEU n 
1 196 ALA n 
1 197 ASN n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PRO n 
1 202 LEU n 
1 203 PHE n 
1 204 PRO n 
1 205 GLY n 
1 206 ASN n 
1 207 ASP n 
1 208 VAL n 
1 209 ASP n 
1 210 ASP n 
1 211 GLN n 
1 212 LEU n 
1 213 LYS n 
1 214 ARG n 
1 215 ILE n 
1 216 PHE n 
1 217 ARG n 
1 218 LEU n 
1 219 LEU n 
1 220 GLY n 
1 221 THR n 
1 222 PRO n 
1 223 THR n 
1 224 GLU n 
1 225 GLU n 
1 226 GLN n 
1 227 TRP n 
1 228 PRO n 
1 229 SER n 
1 230 MET n 
1 231 THR n 
1 232 LYS n 
1 233 LEU n 
1 234 PRO n 
1 235 ASP n 
1 236 TYR n 
1 237 LYS n 
1 238 PRO n 
1 239 TYR n 
1 240 PRO n 
1 241 MET n 
1 242 TYR n 
1 243 PRO n 
1 244 ALA n 
1 245 THR n 
1 246 THR n 
1 247 SER n 
1 248 LEU n 
1 249 VAL n 
1 250 ASN n 
1 251 VAL n 
1 252 VAL n 
1 253 PRO n 
1 254 LYS n 
1 255 LEU n 
1 256 ASN n 
1 257 ALA n 
1 258 THR n 
1 259 GLY n 
1 260 ARG n 
1 261 ASP n 
1 262 LEU n 
1 263 LEU n 
1 264 GLN n 
1 265 ASN n 
1 266 LEU n 
1 267 LEU n 
1 268 LYS n 
1 269 CYS n 
1 270 ASN n 
1 271 PRO n 
1 272 VAL n 
1 273 GLN n 
1 274 ARG n 
1 275 ILE n 
1 276 SER n 
1 277 ALA n 
1 278 GLU n 
1 279 GLU n 
1 280 ALA n 
1 281 LEU n 
1 282 GLN n 
1 283 HIS n 
1 284 PRO n 
1 285 TYR n 
1 286 PHE n 
1 287 SER n 
1 288 ASP n 
1 289 PHE n 
1 290 CYS n 
1 291 PRO n 
1 292 PRO n 
2 1   SER n 
2 2   THR n 
2 3   SER n 
2 4   GLU n 
2 5   LEU n 
2 6   LEU n 
2 7   ARG n 
2 8   CYS n 
2 9   LEU n 
2 10  GLY n 
2 11  GLU n 
2 12  PHE n 
2 13  LEU n 
2 14  CYS n 
2 15  ARG n 
2 16  ARG n 
2 17  CYS n 
2 18  TYR n 
2 19  ARG n 
2 20  LEU n 
2 21  LYS n 
2 22  HIS n 
2 23  LEU n 
2 24  SER n 
2 25  PRO n 
2 26  THR n 
2 27  ASP n 
2 28  PRO n 
2 29  VAL n 
2 30  LEU n 
2 31  TRP n 
2 32  LEU n 
2 33  ARG n 
2 34  SER n 
2 35  VAL n 
2 36  ASP n 
2 37  ARG n 
2 38  SER n 
2 39  LEU n 
2 40  LEU n 
2 41  LEU n 
2 42  GLN n 
2 43  GLY n 
2 44  TRP n 
2 45  GLN n 
2 46  ASP n 
2 47  GLN n 
2 48  GLY n 
2 49  PHE n 
2 50  ILE n 
2 51  THR n 
2 52  PRO n 
2 53  ALA n 
2 54  ASN n 
2 55  VAL n 
2 56  VAL n 
2 57  PHE n 
2 58  LEU n 
2 59  TYR n 
2 60  MET n 
2 61  LEU n 
2 62  CYS n 
2 63  ARG n 
2 64  ASP n 
2 65  VAL n 
2 66  ILE n 
2 67  SER n 
2 68  SER n 
2 69  GLU n 
2 70  VAL n 
2 71  GLY n 
2 72  SER n 
2 73  ASP n 
2 74  HIS n 
2 75  GLU n 
2 76  LEU n 
2 77  GLN n 
2 78  ALA n 
2 79  VAL n 
2 80  LEU n 
2 81  LEU n 
2 82  THR n 
2 83  CYS n 
2 84  LEU n 
2 85  TYR n 
2 86  LEU n 
2 87  SER n 
2 88  TYR n 
2 89  SER n 
2 90  TYR n 
2 91  MET n 
2 92  GLY n 
2 93  ASN n 
2 94  GLU n 
2 95  ILE n 
2 96  SER n 
2 97  TYR n 
2 98  PRO n 
2 99  LEU n 
2 100 LYS n 
2 101 PRO n 
2 102 PHE n 
2 103 LEU n 
2 104 VAL n 
2 105 GLU n 
2 106 SER n 
2 107 CYS n 
2 108 LYS n 
2 109 GLU n 
2 110 ALA n 
2 111 PHE n 
2 112 TRP n 
2 113 ASP n 
2 114 ARG n 
2 115 CYS n 
2 116 LEU n 
2 117 SER n 
2 118 VAL n 
2 119 ILE n 
2 120 ASN n 
2 121 LEU n 
2 122 MET n 
2 123 SER n 
2 124 SER n 
2 125 LYS n 
2 126 MET n 
2 127 LEU n 
2 128 GLN n 
2 129 ILE n 
2 130 ASN n 
2 131 ALA n 
2 132 ASP n 
2 133 PRO n 
2 134 HIS n 
2 135 TYR n 
2 136 PHE n 
2 137 THR n 
2 138 GLN n 
2 139 VAL n 
2 140 PHE n 
2 141 SER n 
2 142 ASP n 
2 143 LEU n 
2 144 LYS n 
2 145 ASN n 
2 146 GLU n 
2 147 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? SF9 ? ? ? 
? ? BACULOVIRUS ? ? ? PBAC4X-1 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'SPODOPTERA FRUGIPERDA' 7108 ? ? ? ? ? ? ? ? SF9 ? ? ? 
? ? BACULOVIRUS ? ? ? PBAC4X-1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CDK5_HUMAN 1 ? ? Q00535 ? 
2 UNP CD5R_HUMAN 2 ? ? Q15078 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1H4L A 1 ? 292 ? Q00535 1   ? 292 ? 1   292 
2 1 1H4L B 1 ? 292 ? Q00535 1   ? 292 ? 1   292 
3 2 1H4L D 1 ? 147 ? Q15078 147 ? 293 ? 147 293 
4 2 1H4L E 1 ? 147 ? Q15078 147 ? 293 ? 147 293 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1H4L ALA A 199 ? UNP Q00535 GLY 199 conflict 199 1 
2 1H4L ALA B 199 ? UNP Q00535 GLY 199 conflict 199 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H4L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   55.07 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'MICROSEEDING - PEG3350, 100 MM TRIS PH 7.6, 200 MM KI, 10 MM DTT, PROTEIN CONC.:7 MG/ML HANGING DROP 2+2 UL. TEMPERATURE 293K.' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0079 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7A' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW7A 
_diffrn_source.pdbx_wavelength             1.0079 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H4L 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.650 
_reflns.number_obs                   32449 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.0 
_reflns.pdbx_Rmerge_I_obs            0.04300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.0000 
_reflns.B_iso_Wilson_estimate        63.8 
_reflns.pdbx_redundancy              2.260 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   78.5 
_reflns_shell.Rmerge_I_obs           0.23300 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.600 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H4L 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30224 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1578110.04 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.22 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    95.4 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.236 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1506 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               59.8 
_refine.aniso_B[1][1]                            2.83 
_refine.aniso_B[2][2]                            -7.23 
_refine.aniso_B[3][3]                            4.40 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.80 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.324771 
_refine.solvent_model_param_bsol                 42.2707 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1FIN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1H4L 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.37 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.49 
_refine_analyze.Luzzati_sigma_a_free            0.51 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6868 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             69 
_refine_hist.number_atoms_total               6937 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        19.22 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.0  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.84  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             4814 
_refine_ls_shell.R_factor_R_work                  0.351 
_refine_ls_shell.percent_reflns_obs               96.5 
_refine_ls_shell.R_factor_R_free                  0.410 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             233 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM ? 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.993760 
_struct_ncs_oper.matrix[1][2]   0.016980 
_struct_ncs_oper.matrix[1][3]   0.110210 
_struct_ncs_oper.matrix[2][1]   0.015630 
_struct_ncs_oper.matrix[2][2]   -0.999790 
_struct_ncs_oper.matrix[2][3]   0.013080 
_struct_ncs_oper.matrix[3][1]   0.110410 
_struct_ncs_oper.matrix[3][2]   -0.011280 
_struct_ncs_oper.matrix[3][3]   -0.993820 
_struct_ncs_oper.vector[1]      -1.77662 
_struct_ncs_oper.vector[2]      -28.69763 
_struct_ncs_oper.vector[3]      36.80953 
# 
_struct.entry_id                  1H4L 
_struct.title                     'Structure and regulation of the CDK5-p25(nck5a) complex' 
_struct.pdbx_descriptor           'CELL DIVISION PROTEIN KINASE 5, CYCLIN-DEPENDENT KINASE 5 ACTIVATOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H4L 
_struct_keywords.pdbx_keywords   'KINASE/KINASE ACTIVATOR' 
_struct_keywords.text            
;KINASE-KINASE ACTIVATOR COMPLEX, COMPLEX(CYCLINS-CDK), CYCLINS, CYCLIN-DEPENDENT KINASES, CDK5, P35, P25, TRANSFERASE, ATP-BINDING, CELL CYCLE, CELL DIVISION, PHOSPHORYLATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 43  ? LYS A 56  ? GLY A 43  LYS A 56  1 ? 14 
HELX_P HELX_P2  2  LEU A 87  ? CYS A 94  ? LEU A 87  CYS A 94  1 ? 8  
HELX_P HELX_P3  3  ASP A 99  ? ARG A 120 ? ASP A 99  ARG A 120 1 ? 22 
HELX_P HELX_P4  4  LYS A 128 ? GLN A 130 ? LYS A 128 GLN A 130 5 ? 3  
HELX_P HELX_P5  5  ASP A 144 ? ALA A 148 ? ASP A 144 ALA A 148 5 ? 5  
HELX_P HELX_P6  6  THR A 164 ? ARG A 168 ? THR A 164 ARG A 168 5 ? 5  
HELX_P HELX_P7  7  PRO A 169 ? PHE A 174 ? PRO A 169 PHE A 174 1 ? 6  
HELX_P HELX_P8  8  THR A 181 ? ALA A 196 ? THR A 181 ALA A 196 1 ? 16 
HELX_P HELX_P9  9  ASP A 207 ? GLY A 220 ? ASP A 207 GLY A 220 1 ? 14 
HELX_P HELX_P10 10 TRP A 227 ? LEU A 233 ? TRP A 227 LEU A 233 5 ? 7  
HELX_P HELX_P11 11 SER A 247 ? VAL A 252 ? SER A 247 VAL A 252 5 ? 6  
HELX_P HELX_P12 12 ASN A 256 ? LEU A 267 ? ASN A 256 LEU A 267 1 ? 12 
HELX_P HELX_P13 13 ASN A 270 ? ARG A 274 ? ASN A 270 ARG A 274 5 ? 5  
HELX_P HELX_P14 14 SER A 276 ? GLN A 282 ? SER A 276 GLN A 282 1 ? 7  
HELX_P HELX_P15 15 GLY B 43  ? GLU B 57  ? GLY B 43  GLU B 57  1 ? 15 
HELX_P HELX_P16 16 LEU B 87  ? CYS B 94  ? LEU B 87  CYS B 94  1 ? 8  
HELX_P HELX_P17 17 ASP B 99  ? ARG B 120 ? ASP B 99  ARG B 120 1 ? 22 
HELX_P HELX_P18 18 LYS B 128 ? GLN B 130 ? LYS B 128 GLN B 130 5 ? 3  
HELX_P HELX_P19 19 ASP B 144 ? ALA B 148 ? ASP B 144 ALA B 148 5 ? 5  
HELX_P HELX_P20 20 THR B 164 ? ARG B 168 ? THR B 164 ARG B 168 5 ? 5  
HELX_P HELX_P21 21 PRO B 169 ? PHE B 174 ? PRO B 169 PHE B 174 1 ? 6  
HELX_P HELX_P22 22 THR B 181 ? ASN B 197 ? THR B 181 ASN B 197 1 ? 17 
HELX_P HELX_P23 23 ASP B 207 ? GLY B 220 ? ASP B 207 GLY B 220 1 ? 14 
HELX_P HELX_P24 24 SER B 247 ? VAL B 251 ? SER B 247 VAL B 251 5 ? 5  
HELX_P HELX_P25 25 ASN B 256 ? LEU B 267 ? ASN B 256 LEU B 267 1 ? 12 
HELX_P HELX_P26 26 ASN B 270 ? ARG B 274 ? ASN B 270 ARG B 274 5 ? 5  
HELX_P HELX_P27 27 SER B 276 ? GLN B 282 ? SER B 276 GLN B 282 1 ? 7  
HELX_P HELX_P28 28 SER C 1   ? CYS C 17  ? SER D 147 CYS D 163 1 ? 17 
HELX_P HELX_P29 29 PRO C 25  ? LEU C 39  ? PRO D 171 LEU D 185 1 ? 15 
HELX_P HELX_P30 30 THR C 51  ? ILE C 66  ? THR D 197 ILE D 212 1 ? 16 
HELX_P HELX_P31 31 SER C 72  ? GLY C 92  ? SER D 218 GLY D 238 1 ? 21 
HELX_P HELX_P32 32 CYS C 107 ? SER C 123 ? CYS D 253 SER D 269 1 ? 17 
HELX_P HELX_P33 33 MET C 122 ? ASP C 132 ? MET D 268 ASP D 278 1 ? 11 
HELX_P HELX_P34 34 ASP C 132 ? ASN C 145 ? ASP D 278 ASN D 291 1 ? 14 
HELX_P HELX_P35 35 SER D 1   ? CYS D 17  ? SER E 147 CYS E 163 1 ? 17 
HELX_P HELX_P36 36 PRO D 25  ? LEU D 41  ? PRO E 171 LEU E 187 1 ? 17 
HELX_P HELX_P37 37 THR D 51  ? ILE D 66  ? THR E 197 ILE E 212 1 ? 16 
HELX_P HELX_P38 38 SER D 72  ? GLY D 92  ? SER E 218 GLY E 238 1 ? 21 
HELX_P HELX_P39 39 CYS D 107 ? SER D 123 ? CYS E 253 SER E 269 1 ? 17 
HELX_P HELX_P40 40 MET D 122 ? ASP D 132 ? MET E 268 ASP E 278 1 ? 11 
HELX_P HELX_P41 41 ASP D 132 ? GLU D 146 ? ASP E 278 GLU E 292 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 5 ? 
AC ? 3 ? 
AD ? 2 ? 
BA ? 5 ? 
BB ? 3 ? 
BC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 5   ? LYS A 6   ? GLU A 5   LYS A 6   
AA 2 PHE A 19  ? LYS A 22  ? PHE A 19  LYS A 22  
AA 3 ILE A 29  ? LEU A 32  ? ILE A 29  LEU A 32  
AA 4 LYS A 75  ? GLU A 81  ? LYS A 75  GLU A 81  
AA 5 VAL A 35  ? ARG A 36  ? VAL A 35  ARG A 36  
AB 1 GLU A 5   ? LYS A 6   ? GLU A 5   LYS A 6   
AB 2 PHE A 19  ? LYS A 22  ? PHE A 19  LYS A 22  
AB 3 ILE A 29  ? LEU A 32  ? ILE A 29  LEU A 32  
AB 4 LYS A 75  ? GLU A 81  ? LYS A 75  GLU A 81  
AB 5 LEU A 66  ? SER A 72  ? LEU A 66  SER A 72  
AC 1 GLN A 85  ? ASP A 86  ? GLN A 85  ASP A 86  
AC 2 LEU A 132 ? ILE A 134 ? LEU A 132 ILE A 134 
AC 3 LEU A 140 ? LEU A 142 ? LEU A 140 LEU A 142 
AD 1 VAL A 122 ? LEU A 123 ? VAL A 122 LEU A 123 
AD 2 ARG A 149 ? ALA A 150 ? ARG A 149 ALA A 150 
BA 1 GLU B 5   ? LYS B 9   ? GLU B 5   LYS B 9   
BA 2 VAL B 18  ? LYS B 22  ? VAL B 18  LYS B 22  
BA 3 ILE B 29  ? ARG B 36  ? ILE B 29  ARG B 36  
BA 4 LYS B 75  ? GLU B 81  ? LYS B 75  GLU B 81  
BA 5 LEU B 66  ? HIS B 71  ? LEU B 66  HIS B 71  
BB 1 GLN B 85  ? ASP B 86  ? GLN B 85  ASP B 86  
BB 2 LEU B 132 ? ILE B 134 ? LEU B 132 ILE B 134 
BB 3 LEU B 140 ? LEU B 142 ? LEU B 140 LEU B 142 
BC 1 VAL B 122 ? LEU B 123 ? VAL B 122 LEU B 123 
BC 2 ARG B 149 ? ALA B 150 ? ARG B 149 ALA B 150 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 5   ? N GLU A 5   O LYS A 22  ? O LYS A 22  
AA 2 3 N ALA A 21  ? N ALA A 21  O VAL A 30  ? O VAL A 30  
AA 3 4 N ALA A 31  ? N ALA A 31  O PHE A 80  ? O PHE A 80  
AA 4 5 N LEU A 76  ? N LEU A 76  O VAL A 35  ? O VAL A 35  
AB 1 2 N GLU A 5   ? N GLU A 5   O LYS A 22  ? O LYS A 22  
AB 2 3 N ALA A 21  ? N ALA A 21  O VAL A 30  ? O VAL A 30  
AB 3 4 N ALA A 31  ? N ALA A 31  O PHE A 80  ? O PHE A 80  
AB 4 5 O VAL A 79  ? O VAL A 79  N HIS A 67  ? N HIS A 67  
AC 1 2 N GLN A 85  ? N GLN A 85  O ILE A 134 ? O ILE A 134 
AC 2 3 N LEU A 133 ? N LEU A 133 O LYS A 141 ? O LYS A 141 
AD 1 2 N LEU A 123 ? N LEU A 123 O ARG A 149 ? O ARG A 149 
BA 1 2 N LEU B 7   ? N LEU B 7   O LYS B 20  ? O LYS B 20  
BA 2 3 N ALA B 21  ? N ALA B 21  O VAL B 30  ? O VAL B 30  
BA 3 4 N VAL B 35  ? N VAL B 35  O LEU B 76  ? O LEU B 76  
BA 4 5 O VAL B 79  ? O VAL B 79  N HIS B 67  ? N HIS B 67  
BB 1 2 N GLN B 85  ? N GLN B 85  O ILE B 134 ? O ILE B 134 
BB 2 3 N LEU B 133 ? N LEU B 133 O LYS B 141 ? O LYS B 141 
BC 1 2 N LEU B 123 ? N LEU B 123 O ARG B 149 ? O ARG B 149 
# 
_database_PDB_matrix.entry_id          1H4L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H4L 
_atom_sites.fract_transf_matrix[1][1]   0.006707 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000361 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011141 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012128 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 2   ? 20.806 -13.382 37.794 1.00 98.91  ? 2    GLN A N   1 
ATOM   2    C CA  . GLN A 1 2   ? 20.589 -11.928 38.075 1.00 98.91  ? 2    GLN A CA  1 
ATOM   3    C C   . GLN A 1 2   ? 21.351 -11.413 39.297 1.00 98.91  ? 2    GLN A C   1 
ATOM   4    O O   . GLN A 1 2   ? 21.697 -10.232 39.362 1.00 98.91  ? 2    GLN A O   1 
ATOM   5    C CB  . GLN A 1 2   ? 19.096 -11.641 38.259 1.00 95.36  ? 2    GLN A CB  1 
ATOM   6    C CG  . GLN A 1 2   ? 18.418 -12.489 39.317 1.00 95.36  ? 2    GLN A CG  1 
ATOM   7    C CD  . GLN A 1 2   ? 16.991 -12.053 39.565 1.00 95.36  ? 2    GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 2   ? 16.205 -11.899 38.628 1.00 95.36  ? 2    GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 2   ? 16.644 -11.853 40.832 1.00 95.36  ? 2    GLN A NE2 1 
ATOM   10   N N   . LYS A 1 3   ? 21.599 -12.294 40.265 1.00 91.52  ? 3    LYS A N   1 
ATOM   11   C CA  . LYS A 1 3   ? 22.329 -11.917 41.474 1.00 91.52  ? 3    LYS A CA  1 
ATOM   12   C C   . LYS A 1 3   ? 23.776 -11.567 41.141 1.00 91.52  ? 3    LYS A C   1 
ATOM   13   O O   . LYS A 1 3   ? 24.661 -11.741 41.974 1.00 91.52  ? 3    LYS A O   1 
ATOM   14   C CB  . LYS A 1 3   ? 22.321 -13.063 42.494 1.00 106.46 ? 3    LYS A CB  1 
ATOM   15   C CG  . LYS A 1 3   ? 20.983 -13.327 43.171 1.00 106.46 ? 3    LYS A CG  1 
ATOM   16   C CD  . LYS A 1 3   ? 21.146 -14.343 44.300 1.00 106.46 ? 3    LYS A CD  1 
ATOM   17   C CE  . LYS A 1 3   ? 19.852 -14.571 45.071 1.00 106.46 ? 3    LYS A CE  1 
ATOM   18   N NZ  . LYS A 1 3   ? 18.816 -15.250 44.252 1.00 106.46 ? 3    LYS A NZ  1 
ATOM   19   N N   . TYR A 1 4   ? 24.009 -11.074 39.928 1.00 81.17  ? 4    TYR A N   1 
ATOM   20   C CA  . TYR A 1 4   ? 25.353 -10.714 39.496 1.00 81.17  ? 4    TYR A CA  1 
ATOM   21   C C   . TYR A 1 4   ? 25.446 -9.298  38.955 1.00 81.17  ? 4    TYR A C   1 
ATOM   22   O O   . TYR A 1 4   ? 24.447 -8.698  38.567 1.00 81.17  ? 4    TYR A O   1 
ATOM   23   C CB  . TYR A 1 4   ? 25.843 -11.709 38.440 1.00 42.62  ? 4    TYR A CB  1 
ATOM   24   C CG  . TYR A 1 4   ? 25.961 -13.110 38.991 1.00 42.62  ? 4    TYR A CG  1 
ATOM   25   C CD1 . TYR A 1 4   ? 27.093 -13.506 39.708 1.00 42.62  ? 4    TYR A CD1 1 
ATOM   26   C CD2 . TYR A 1 4   ? 24.906 -14.019 38.873 1.00 42.62  ? 4    TYR A CD2 1 
ATOM   27   C CE1 . TYR A 1 4   ? 27.167 -14.768 40.296 1.00 42.62  ? 4    TYR A CE1 1 
ATOM   28   C CE2 . TYR A 1 4   ? 24.974 -15.277 39.463 1.00 42.62  ? 4    TYR A CE2 1 
ATOM   29   C CZ  . TYR A 1 4   ? 26.105 -15.640 40.171 1.00 42.62  ? 4    TYR A CZ  1 
ATOM   30   O OH  . TYR A 1 4   ? 26.169 -16.871 40.758 1.00 42.62  ? 4    TYR A OH  1 
ATOM   31   N N   . GLU A 1 5   ? 26.665 -8.773  38.947 1.00 65.28  ? 5    GLU A N   1 
ATOM   32   C CA  . GLU A 1 5   ? 26.935 -7.434  38.457 1.00 65.28  ? 5    GLU A CA  1 
ATOM   33   C C   . GLU A 1 5   ? 28.009 -7.518  37.369 1.00 65.28  ? 5    GLU A C   1 
ATOM   34   O O   . GLU A 1 5   ? 29.191 -7.684  37.670 1.00 65.28  ? 5    GLU A O   1 
ATOM   35   C CB  . GLU A 1 5   ? 27.418 -6.553  39.613 1.00 85.61  ? 5    GLU A CB  1 
ATOM   36   C CG  . GLU A 1 5   ? 27.654 -5.092  39.249 1.00 85.61  ? 5    GLU A CG  1 
ATOM   37   C CD  . GLU A 1 5   ? 27.983 -4.222  40.460 1.00 85.61  ? 5    GLU A CD  1 
ATOM   38   O OE1 . GLU A 1 5   ? 28.152 -2.994  40.289 1.00 85.61  ? 5    GLU A OE1 1 
ATOM   39   O OE2 . GLU A 1 5   ? 28.071 -4.760  41.587 1.00 85.61  ? 5    GLU A OE2 1 
ATOM   40   N N   . LYS A 1 6   ? 27.592 -7.422  36.108 1.00 71.67  ? 6    LYS A N   1 
ATOM   41   C CA  . LYS A 1 6   ? 28.526 -7.468  34.990 1.00 71.67  ? 6    LYS A CA  1 
ATOM   42   C C   . LYS A 1 6   ? 29.511 -6.301  35.066 1.00 71.67  ? 6    LYS A C   1 
ATOM   43   O O   . LYS A 1 6   ? 29.160 -5.209  35.513 1.00 71.67  ? 6    LYS A O   1 
ATOM   44   C CB  . LYS A 1 6   ? 27.775 -7.409  33.661 1.00 108.28 ? 6    LYS A CB  1 
ATOM   45   C CG  . LYS A 1 6   ? 27.023 -8.674  33.306 1.00 108.28 ? 6    LYS A CG  1 
ATOM   46   C CD  . LYS A 1 6   ? 26.420 -8.535  31.923 1.00 108.28 ? 6    LYS A CD  1 
ATOM   47   C CE  . LYS A 1 6   ? 25.633 -9.765  31.515 1.00 108.28 ? 6    LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 6   ? 24.970 -9.561  30.194 1.00 108.28 ? 6    LYS A NZ  1 
ATOM   49   N N   . LEU A 1 7   ? 30.744 -6.542  34.624 1.00 87.05  ? 7    LEU A N   1 
ATOM   50   C CA  . LEU A 1 7   ? 31.796 -5.527  34.638 1.00 87.04  ? 7    LEU A CA  1 
ATOM   51   C C   . LEU A 1 7   ? 32.511 -5.554  33.294 1.00 96.01  ? 7    LEU A C   1 
ATOM   52   O O   . LEU A 1 7   ? 31.893 -5.834  32.266 1.00 100.18 ? 7    LEU A O   1 
ATOM   53   C CB  . LEU A 1 7   ? 32.800 -5.826  35.756 1.00 99.86  ? 7    LEU A CB  1 
ATOM   54   C CG  . LEU A 1 7   ? 32.223 -6.253  37.112 1.00 90.11  ? 7    LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 7   ? 33.354 -6.659  38.037 1.00 90.11  ? 7    LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 7   ? 31.408 -5.122  37.719 1.00 90.11  ? 7    LEU A CD2 1 
ATOM   57   N N   . GLU A 1 8   ? 33.808 -5.258  33.304 1.00 101.41 ? 8    GLU A N   1 
ATOM   58   C CA  . GLU A 1 8   ? 34.598 -5.281  32.078 1.00 102.44 ? 8    GLU A CA  1 
ATOM   59   C C   . GLU A 1 8   ? 34.320 -6.604  31.370 1.00 101.66 ? 8    GLU A C   1 
ATOM   60   O O   . GLU A 1 8   ? 34.349 -7.656  32.001 1.00 101.20 ? 8    GLU A O   1 
ATOM   61   C CB  . GLU A 1 8   ? 36.093 -5.167  32.409 1.00 76.47  ? 8    GLU A CB  1 
ATOM   62   C CG  . GLU A 1 8   ? 36.554 -6.098  33.529 1.00 82.44  ? 8    GLU A CG  1 
ATOM   63   C CD  . GLU A 1 8   ? 38.064 -6.320  33.548 1.00 91.67  ? 8    GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 8   ? 38.563 -6.951  34.511 1.00 91.63  ? 8    GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 8   ? 38.746 -5.869  32.599 1.00 97.28  ? 8    GLU A OE2 1 
ATOM   66   N N   . LYS A 1 9   ? 34.044 -6.559  30.070 1.00 69.97  ? 9    LYS A N   1 
ATOM   67   C CA  . LYS A 1 9   ? 33.753 -7.786  29.335 1.00 72.85  ? 9    LYS A CA  1 
ATOM   68   C C   . LYS A 1 9   ? 34.973 -8.426  28.690 1.00 70.23  ? 9    LYS A C   1 
ATOM   69   O O   . LYS A 1 9   ? 35.519 -7.904  27.723 1.00 71.64  ? 9    LYS A O   1 
ATOM   70   C CB  . LYS A 1 9   ? 32.693 -7.535  28.258 1.00 105.48 ? 9    LYS A CB  1 
ATOM   71   C CG  . LYS A 1 9   ? 33.105 -6.578  27.152 1.00 114.99 ? 9    LYS A CG  1 
ATOM   72   C CD  . LYS A 1 9   ? 32.059 -6.581  26.048 1.00 121.65 ? 9    LYS A CD  1 
ATOM   73   C CE  . LYS A 1 9   ? 32.419 -5.620  24.936 1.00 125.81 ? 9    LYS A CE  1 
ATOM   74   N NZ  . LYS A 1 9   ? 31.414 -5.688  23.841 1.00 125.81 ? 9    LYS A NZ  1 
ATOM   75   N N   . ILE A 1 10  ? 35.386 -9.574  29.215 1.00 64.00  ? 10   ILE A N   1 
ATOM   76   C CA  . ILE A 1 10  ? 36.543 -10.282 28.680 1.00 67.62  ? 10   ILE A CA  1 
ATOM   77   C C   . ILE A 1 10  ? 36.169 -11.025 27.400 1.00 74.00  ? 10   ILE A C   1 
ATOM   78   O O   . ILE A 1 10  ? 36.923 -11.864 26.914 1.00 74.63  ? 10   ILE A O   1 
ATOM   79   C CB  . ILE A 1 10  ? 37.082 -11.302 29.692 1.00 95.71  ? 10   ILE A CB  1 
ATOM   80   C CG1 . ILE A 1 10  ? 37.218 -10.641 31.064 1.00 94.88  ? 10   ILE A CG1 1 
ATOM   81   C CG2 . ILE A 1 10  ? 38.435 -11.830 29.224 1.00 97.89  ? 10   ILE A CG2 1 
ATOM   82   C CD1 . ILE A 1 10  ? 37.455 -11.625 32.198 1.00 91.02  ? 10   ILE A CD1 1 
ATOM   83   N N   . TYR A 1 15  ? 32.117 -20.440 23.538 1.00 124.37 ? 15   TYR A N   1 
ATOM   84   C CA  . TYR A 1 15  ? 30.735 -20.228 23.131 1.00 125.64 ? 15   TYR A CA  1 
ATOM   85   C C   . TYR A 1 15  ? 30.468 -18.737 23.058 1.00 125.64 ? 15   TYR A C   1 
ATOM   86   O O   . TYR A 1 15  ? 31.141 -18.017 22.324 1.00 125.64 ? 15   TYR A O   1 
ATOM   87   C CB  . TYR A 1 15  ? 29.773 -20.857 24.137 1.00 174.65 ? 15   TYR A CB  1 
ATOM   88   C CG  . TYR A 1 15  ? 30.215 -22.202 24.641 1.00 100.06 ? 15   TYR A CG  1 
ATOM   89   C CD1 . TYR A 1 15  ? 31.277 -22.313 25.535 1.00 100.06 ? 15   TYR A CD1 1 
ATOM   90   C CD2 . TYR A 1 15  ? 29.585 -23.366 24.219 1.00 100.06 ? 15   TYR A CD2 1 
ATOM   91   C CE1 . TYR A 1 15  ? 31.701 -23.547 25.998 1.00 100.06 ? 15   TYR A CE1 1 
ATOM   92   C CE2 . TYR A 1 15  ? 30.004 -24.609 24.673 1.00 100.06 ? 15   TYR A CE2 1 
ATOM   93   C CZ  . TYR A 1 15  ? 31.062 -24.694 25.564 1.00 100.06 ? 15   TYR A CZ  1 
ATOM   94   O OH  . TYR A 1 15  ? 31.478 -25.923 26.024 1.00 100.06 ? 15   TYR A OH  1 
ATOM   95   N N   . GLY A 1 16  ? 29.485 -18.279 23.827 1.00 99.63  ? 16   GLY A N   1 
ATOM   96   C CA  . GLY A 1 16  ? 29.150 -16.867 23.841 1.00 99.99  ? 16   GLY A CA  1 
ATOM   97   C C   . GLY A 1 16  ? 30.323 -16.023 24.303 1.00 100.22 ? 16   GLY A C   1 
ATOM   98   O O   . GLY A 1 16  ? 31.481 -16.402 24.118 1.00 101.07 ? 16   GLY A O   1 
ATOM   99   N N   . THR A 1 17  ? 30.031 -14.876 24.909 1.00 88.35  ? 17   THR A N   1 
ATOM   100  C CA  . THR A 1 17  ? 31.085 -13.991 25.388 1.00 84.22  ? 17   THR A CA  1 
ATOM   101  C C   . THR A 1 17  ? 31.290 -14.132 26.896 1.00 77.85  ? 17   THR A C   1 
ATOM   102  O O   . THR A 1 17  ? 30.349 -14.433 27.635 1.00 77.48  ? 17   THR A O   1 
ATOM   103  C CB  . THR A 1 17  ? 30.768 -12.528 25.050 1.00 150.28 ? 17   THR A CB  1 
ATOM   104  O OG1 . THR A 1 17  ? 31.733 -11.675 25.676 1.00 95.44  ? 17   THR A OG1 1 
ATOM   105  C CG2 . THR A 1 17  ? 29.366 -12.165 25.519 1.00 153.32 ? 17   THR A CG2 1 
ATOM   106  N N   . VAL A 1 18  ? 32.525 -13.913 27.343 1.00 55.94  ? 18   VAL A N   1 
ATOM   107  C CA  . VAL A 1 18  ? 32.873 -14.028 28.757 1.00 49.76  ? 18   VAL A CA  1 
ATOM   108  C C   . VAL A 1 18  ? 32.857 -12.691 29.481 1.00 48.70  ? 18   VAL A C   1 
ATOM   109  O O   . VAL A 1 18  ? 33.267 -11.668 28.933 1.00 50.15  ? 18   VAL A O   1 
ATOM   110  C CB  . VAL A 1 18  ? 34.267 -14.638 28.931 1.00 62.57  ? 18   VAL A CB  1 
ATOM   111  C CG1 . VAL A 1 18  ? 34.489 -15.008 30.381 1.00 58.16  ? 18   VAL A CG1 1 
ATOM   112  C CG2 . VAL A 1 18  ? 34.418 -15.852 28.041 1.00 65.43  ? 18   VAL A CG2 1 
ATOM   113  N N   . PHE A 1 19  ? 32.379 -12.710 30.720 1.00 65.26  ? 19   PHE A N   1 
ATOM   114  C CA  . PHE A 1 19  ? 32.316 -11.506 31.539 1.00 61.67  ? 19   PHE A CA  1 
ATOM   115  C C   . PHE A 1 19  ? 32.879 -11.743 32.933 1.00 58.71  ? 19   PHE A C   1 
ATOM   116  O O   . PHE A 1 19  ? 32.857 -12.861 33.453 1.00 59.22  ? 19   PHE A O   1 
ATOM   117  C CB  . PHE A 1 19  ? 30.876 -11.021 31.708 1.00 67.99  ? 19   PHE A CB  1 
ATOM   118  C CG  . PHE A 1 19  ? 30.209 -10.622 30.434 1.00 78.25  ? 19   PHE A CG  1 
ATOM   119  C CD1 . PHE A 1 19  ? 29.343 -11.497 29.788 1.00 83.83  ? 19   PHE A CD1 1 
ATOM   120  C CD2 . PHE A 1 19  ? 30.425 -9.363  29.888 1.00 80.78  ? 19   PHE A CD2 1 
ATOM   121  C CE1 . PHE A 1 19  ? 28.697 -11.123 28.616 1.00 86.66  ? 19   PHE A CE1 1 
ATOM   122  C CE2 . PHE A 1 19  ? 29.785 -8.977  28.716 1.00 85.64  ? 19   PHE A CE2 1 
ATOM   123  C CZ  . PHE A 1 19  ? 28.917 -9.859  28.078 1.00 91.24  ? 19   PHE A CZ  1 
ATOM   124  N N   . LYS A 1 20  ? 33.381 -10.672 33.533 1.00 58.16  ? 20   LYS A N   1 
ATOM   125  C CA  . LYS A 1 20  ? 33.909 -10.702 34.892 1.00 55.22  ? 20   LYS A CA  1 
ATOM   126  C C   . LYS A 1 20  ? 32.723 -10.177 35.709 1.00 56.95  ? 20   LYS A C   1 
ATOM   127  O O   . LYS A 1 20  ? 31.853 -9.508  35.154 1.00 54.89  ? 20   LYS A O   1 
ATOM   128  C CB  . LYS A 1 20  ? 35.108 -9.755  34.999 1.00 62.58  ? 20   LYS A CB  1 
ATOM   129  C CG  . LYS A 1 20  ? 35.764 -9.680  36.369 1.00 66.68  ? 20   LYS A CG  1 
ATOM   130  C CD  . LYS A 1 20  ? 37.001 -8.799  36.310 1.00 72.57  ? 20   LYS A CD  1 
ATOM   131  C CE  . LYS A 1 20  ? 37.710 -8.742  37.645 1.00 75.79  ? 20   LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 20  ? 38.937 -7.912  37.559 1.00 75.66  ? 20   LYS A NZ  1 
ATOM   133  N N   . ALA A 1 21  ? 32.651 -10.481 37.000 1.00 74.69  ? 21   ALA A N   1 
ATOM   134  C CA  . ALA A 1 21  ? 31.520 -9.987  37.784 1.00 73.15  ? 21   ALA A CA  1 
ATOM   135  C C   . ALA A 1 21  ? 31.650 -10.191 39.285 1.00 77.43  ? 21   ALA A C   1 
ATOM   136  O O   . ALA A 1 21  ? 32.537 -10.901 39.753 1.00 76.22  ? 21   ALA A O   1 
ATOM   137  C CB  . ALA A 1 21  ? 30.227 -10.626 37.284 1.00 66.35  ? 21   ALA A CB  1 
ATOM   138  N N   . LYS A 1 22  ? 30.757 -9.544  40.029 1.00 75.41  ? 22   LYS A N   1 
ATOM   139  C CA  . LYS A 1 22  ? 30.721 -9.640  41.486 1.00 76.18  ? 22   LYS A CA  1 
ATOM   140  C C   . LYS A 1 22  ? 29.386 -10.264 41.855 1.00 70.76  ? 22   LYS A C   1 
ATOM   141  O O   . LYS A 1 22  ? 28.354 -9.905  41.293 1.00 68.18  ? 22   LYS A O   1 
ATOM   142  C CB  . LYS A 1 22  ? 30.810 -8.255  42.135 1.00 129.57 ? 22   LYS A CB  1 
ATOM   143  C CG  . LYS A 1 22  ? 32.142 -7.537  41.969 1.00 136.71 ? 22   LYS A CG  1 
ATOM   144  C CD  . LYS A 1 22  ? 32.113 -6.201  42.704 1.00 146.97 ? 22   LYS A CD  1 
ATOM   145  C CE  . LYS A 1 22  ? 33.422 -5.443  42.564 1.00 99.66  ? 22   LYS A CE  1 
ATOM   146  N NZ  . LYS A 1 22  ? 33.387 -4.142  43.297 1.00 99.66  ? 22   LYS A NZ  1 
ATOM   147  N N   . ASN A 1 23  ? 29.391 -11.195 42.799 1.00 99.05  ? 23   ASN A N   1 
ATOM   148  C CA  . ASN A 1 23  ? 28.140 -11.831 43.166 1.00 97.88  ? 23   ASN A CA  1 
ATOM   149  C C   . ASN A 1 23  ? 27.149 -10.791 43.674 1.00 99.91  ? 23   ASN A C   1 
ATOM   150  O O   . ASN A 1 23  ? 25.957 -11.064 43.793 1.00 100.30 ? 23   ASN A O   1 
ATOM   151  C CB  . ASN A 1 23  ? 28.370 -12.916 44.219 1.00 102.49 ? 23   ASN A CB  1 
ATOM   152  C CG  . ASN A 1 23  ? 27.144 -13.789 44.431 1.00 109.06 ? 23   ASN A CG  1 
ATOM   153  O OD1 . ASN A 1 23  ? 26.324 -13.961 43.529 1.00 111.28 ? 23   ASN A OD1 1 
ATOM   154  N ND2 . ASN A 1 23  ? 27.026 -14.363 45.623 1.00 112.96 ? 23   ASN A ND2 1 
ATOM   155  N N   . ARG A 1 24  ? 27.648 -9.592  43.960 1.00 82.83  ? 24   ARG A N   1 
ATOM   156  C CA  . ARG A 1 24  ? 26.818 -8.494  44.454 1.00 83.68  ? 24   ARG A CA  1 
ATOM   157  C C   . ARG A 1 24  ? 26.213 -8.808  45.818 1.00 87.80  ? 24   ARG A C   1 
ATOM   158  O O   . ARG A 1 24  ? 26.129 -7.939  46.687 1.00 92.33  ? 24   ARG A O   1 
ATOM   159  C CB  . ARG A 1 24  ? 25.693 -8.173  43.465 1.00 192.65 ? 24   ARG A CB  1 
ATOM   160  C CG  . ARG A 1 24  ? 24.918 -6.934  43.857 1.00 195.33 ? 24   ARG A CG  1 
ATOM   161  C CD  . ARG A 1 24  ? 23.902 -6.521  42.807 1.00 195.68 ? 24   ARG A CD  1 
ATOM   162  N NE  . ARG A 1 24  ? 23.283 -5.247  43.171 1.00 181.35 ? 24   ARG A NE  1 
ATOM   163  C CZ  . ARG A 1 24  ? 22.337 -4.638  42.463 1.00 181.35 ? 24   ARG A CZ  1 
ATOM   164  N NH1 . ARG A 1 24  ? 21.891 -5.190  41.339 1.00 181.35 ? 24   ARG A NH1 1 
ATOM   165  N NH2 . ARG A 1 24  ? 21.836 -3.477  42.882 1.00 181.35 ? 24   ARG A NH2 1 
ATOM   166  N N   . GLU A 1 25  ? 25.789 -10.054 46.000 1.00 116.24 ? 25   GLU A N   1 
ATOM   167  C CA  . GLU A 1 25  ? 25.192 -10.480 47.255 1.00 116.66 ? 25   GLU A CA  1 
ATOM   168  C C   . GLU A 1 25  ? 26.268 -10.970 48.218 1.00 120.09 ? 25   GLU A C   1 
ATOM   169  O O   . GLU A 1 25  ? 26.280 -10.585 49.385 1.00 124.11 ? 25   GLU A O   1 
ATOM   170  C CB  . GLU A 1 25  ? 24.173 -11.589 47.001 1.00 140.65 ? 25   GLU A CB  1 
ATOM   171  C CG  . GLU A 1 25  ? 23.300 -11.886 48.199 1.00 141.49 ? 25   GLU A CG  1 
ATOM   172  C CD  . GLU A 1 25  ? 22.253 -12.936 47.917 1.00 121.23 ? 25   GLU A CD  1 
ATOM   173  O OE1 . GLU A 1 25  ? 22.628 -14.098 47.651 1.00 121.23 ? 25   GLU A OE1 1 
ATOM   174  O OE2 . GLU A 1 25  ? 21.053 -12.594 47.960 1.00 121.23 ? 25   GLU A OE2 1 
ATOM   175  N N   . THR A 1 26  ? 27.167 -11.821 47.725 1.00 101.40 ? 26   THR A N   1 
ATOM   176  C CA  . THR A 1 26  ? 28.254 -12.353 48.548 1.00 99.05  ? 26   THR A CA  1 
ATOM   177  C C   . THR A 1 26  ? 29.577 -11.682 48.182 1.00 96.65  ? 26   THR A C   1 
ATOM   178  O O   . THR A 1 26  ? 30.628 -12.046 48.705 1.00 96.93  ? 26   THR A O   1 
ATOM   179  C CB  . THR A 1 26  ? 28.417 -13.888 48.379 1.00 94.82  ? 26   THR A CB  1 
ATOM   180  O OG1 . THR A 1 26  ? 29.033 -14.175 47.118 1.00 94.95  ? 26   THR A OG1 1 
ATOM   181  C CG2 . THR A 1 26  ? 27.059 -14.584 48.449 1.00 92.09  ? 26   THR A CG2 1 
ATOM   182  N N   . HIS A 1 27  ? 29.499 -10.713 47.269 1.00 85.07  ? 27   HIS A N   1 
ATOM   183  C CA  . HIS A 1 27  ? 30.641 -9.928  46.783 1.00 85.07  ? 27   HIS A CA  1 
ATOM   184  C C   . HIS A 1 27  ? 31.784 -10.677 46.090 1.00 85.07  ? 27   HIS A C   1 
ATOM   185  O O   . HIS A 1 27  ? 32.778 -10.057 45.727 1.00 85.07  ? 27   HIS A O   1 
ATOM   186  C CB  . HIS A 1 27  ? 31.234 -9.077  47.919 1.00 191.04 ? 27   HIS A CB  1 
ATOM   187  C CG  . HIS A 1 27  ? 32.189 -9.817  48.804 1.00 191.04 ? 27   HIS A CG  1 
ATOM   188  N ND1 . HIS A 1 27  ? 31.815 -10.375 50.011 1.00 191.04 ? 27   HIS A ND1 1 
ATOM   189  C CD2 . HIS A 1 27  ? 33.507 -10.107 48.657 1.00 191.04 ? 27   HIS A CD2 1 
ATOM   190  C CE1 . HIS A 1 27  ? 32.852 -10.971 50.563 1.00 191.04 ? 27   HIS A CE1 1 
ATOM   191  N NE2 . HIS A 1 27  ? 33.895 -10.823 49.759 1.00 191.04 ? 27   HIS A NE2 1 
ATOM   192  N N   . GLU A 1 28  ? 31.658 -11.988 45.897 1.00 68.46  ? 28   GLU A N   1 
ATOM   193  C CA  . GLU A 1 28  ? 32.730 -12.744 45.243 1.00 68.46  ? 28   GLU A CA  1 
ATOM   194  C C   . GLU A 1 28  ? 32.751 -12.475 43.736 1.00 68.46  ? 28   GLU A C   1 
ATOM   195  O O   . GLU A 1 28  ? 31.701 -12.321 43.110 1.00 68.46  ? 28   GLU A O   1 
ATOM   196  C CB  . GLU A 1 28  ? 32.561 -14.247 45.487 1.00 69.72  ? 28   GLU A CB  1 
ATOM   197  C CG  . GLU A 1 28  ? 33.755 -15.084 45.033 1.00 69.72  ? 28   GLU A CG  1 
ATOM   198  C CD  . GLU A 1 28  ? 33.525 -16.589 45.173 1.00 69.72  ? 28   GLU A CD  1 
ATOM   199  O OE1 . GLU A 1 28  ? 34.517 -17.354 45.111 1.00 69.72  ? 28   GLU A OE1 1 
ATOM   200  O OE2 . GLU A 1 28  ? 32.356 -17.009 45.332 1.00 69.72  ? 28   GLU A OE2 1 
ATOM   201  N N   . ILE A 1 29  ? 33.947 -12.409 43.154 1.00 83.91  ? 29   ILE A N   1 
ATOM   202  C CA  . ILE A 1 29  ? 34.066 -12.170 41.720 1.00 83.91  ? 29   ILE A CA  1 
ATOM   203  C C   . ILE A 1 29  ? 34.177 -13.475 40.938 1.00 83.91  ? 29   ILE A C   1 
ATOM   204  O O   . ILE A 1 29  ? 35.003 -14.332 41.245 1.00 83.91  ? 29   ILE A O   1 
ATOM   205  C CB  . ILE A 1 29  ? 35.275 -11.282 41.390 1.00 54.74  ? 29   ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 29  ? 35.023 -9.870  41.923 1.00 54.74  ? 29   ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 29  ? 35.502 -11.256 39.884 1.00 54.74  ? 29   ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 29  ? 36.131 -8.884  41.631 1.00 54.74  ? 29   ILE A CD1 1 
ATOM   209  N N   . VAL A 1 30  ? 33.334 -13.611 39.923 1.00 54.01  ? 30   VAL A N   1 
ATOM   210  C CA  . VAL A 1 30  ? 33.302 -14.802 39.092 1.00 54.01  ? 30   VAL A CA  1 
ATOM   211  C C   . VAL A 1 30  ? 33.560 -14.426 37.648 1.00 54.01  ? 30   VAL A C   1 
ATOM   212  O O   . VAL A 1 30  ? 34.069 -13.345 37.357 1.00 54.01  ? 30   VAL A O   1 
ATOM   213  C CB  . VAL A 1 30  ? 31.913 -15.478 39.140 1.00 58.92  ? 30   VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 30  ? 31.543 -15.816 40.570 1.00 58.92  ? 30   VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 30  ? 30.867 -14.548 38.521 1.00 58.92  ? 30   VAL A CG2 1 
ATOM   216  N N   . ALA A 1 31  ? 33.201 -15.339 36.751 1.00 43.45  ? 31   ALA A N   1 
ATOM   217  C CA  . ALA A 1 31  ? 33.317 -15.136 35.309 1.00 43.45  ? 31   ALA A CA  1 
ATOM   218  C C   . ALA A 1 31  ? 32.065 -15.799 34.726 1.00 43.45  ? 31   ALA A C   1 
ATOM   219  O O   . ALA A 1 31  ? 31.714 -16.920 35.115 1.00 43.45  ? 31   ALA A O   1 
ATOM   220  C CB  . ALA A 1 31  ? 34.591 -15.800 34.769 1.00 24.36  ? 31   ALA A CB  1 
ATOM   221  N N   . LEU A 1 32  ? 31.378 -15.100 33.826 1.00 40.66  ? 32   LEU A N   1 
ATOM   222  C CA  . LEU A 1 32  ? 30.160 -15.640 33.214 1.00 40.66  ? 32   LEU A CA  1 
ATOM   223  C C   . LEU A 1 32  ? 30.390 -15.959 31.739 1.00 40.66  ? 32   LEU A C   1 
ATOM   224  O O   . LEU A 1 32  ? 31.022 -15.175 31.038 1.00 40.66  ? 32   LEU A O   1 
ATOM   225  C CB  . LEU A 1 32  ? 29.014 -14.633 33.361 1.00 51.67  ? 32   LEU A CB  1 
ATOM   226  C CG  . LEU A 1 32  ? 28.683 -14.200 34.788 1.00 51.67  ? 32   LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 32  ? 27.633 -13.094 34.764 1.00 51.67  ? 32   LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 32  ? 28.196 -15.391 35.597 1.00 51.67  ? 32   LEU A CD2 1 
ATOM   229  N N   . LYS A 1 33  ? 29.876 -17.091 31.262 1.00 60.30  ? 33   LYS A N   1 
ATOM   230  C CA  . LYS A 1 33  ? 30.081 -17.460 29.867 1.00 60.30  ? 33   LYS A CA  1 
ATOM   231  C C   . LYS A 1 33  ? 28.928 -17.084 28.931 1.00 60.30  ? 33   LYS A C   1 
ATOM   232  O O   . LYS A 1 33  ? 29.178 -16.643 27.800 1.00 60.30  ? 33   LYS A O   1 
ATOM   233  C CB  . LYS A 1 33  ? 30.390 -18.956 29.752 1.00 56.65  ? 33   LYS A CB  1 
ATOM   234  C CG  . LYS A 1 33  ? 30.625 -19.446 28.325 1.00 56.65  ? 33   LYS A CG  1 
ATOM   235  C CD  . LYS A 1 33  ? 31.250 -20.847 28.277 1.00 56.65  ? 33   LYS A CD  1 
ATOM   236  C CE  . LYS A 1 33  ? 32.748 -20.836 28.621 1.00 56.65  ? 33   LYS A CE  1 
ATOM   237  N NZ  . LYS A 1 33  ? 33.424 -22.169 28.450 1.00 56.65  ? 33   LYS A NZ  1 
ATOM   238  N N   . ARG A 1 34  ? 27.682 -17.244 29.376 1.00 60.85  ? 34   ARG A N   1 
ATOM   239  C CA  . ARG A 1 34  ? 26.517 -16.886 28.551 1.00 60.85  ? 34   ARG A CA  1 
ATOM   240  C C   . ARG A 1 34  ? 26.542 -17.510 27.151 1.00 60.85  ? 34   ARG A C   1 
ATOM   241  O O   . ARG A 1 34  ? 27.224 -17.034 26.243 1.00 60.85  ? 34   ARG A O   1 
ATOM   242  C CB  . ARG A 1 34  ? 26.395 -15.359 28.446 1.00 53.89  ? 34   ARG A CB  1 
ATOM   243  C CG  . ARG A 1 34  ? 26.514 -14.640 29.803 1.00 53.89  ? 34   ARG A CG  1 
ATOM   244  C CD  . ARG A 1 34  ? 25.551 -13.473 29.993 1.00 53.89  ? 34   ARG A CD  1 
ATOM   245  N NE  . ARG A 1 34  ? 24.190 -13.953 30.160 1.00 53.89  ? 34   ARG A NE  1 
ATOM   246  C CZ  . ARG A 1 34  ? 23.148 -13.185 30.473 1.00 53.89  ? 34   ARG A CZ  1 
ATOM   247  N NH1 . ARG A 1 34  ? 23.312 -11.879 30.658 1.00 53.89  ? 34   ARG A NH1 1 
ATOM   248  N NH2 . ARG A 1 34  ? 21.936 -13.722 30.598 1.00 53.89  ? 34   ARG A NH2 1 
ATOM   249  N N   . VAL A 1 35  ? 25.773 -18.582 26.989 1.00 43.50  ? 35   VAL A N   1 
ATOM   250  C CA  . VAL A 1 35  ? 25.706 -19.316 25.732 1.00 43.50  ? 35   VAL A CA  1 
ATOM   251  C C   . VAL A 1 35  ? 24.364 -19.062 25.067 1.00 43.50  ? 35   VAL A C   1 
ATOM   252  O O   . VAL A 1 35  ? 23.324 -19.157 25.711 1.00 43.50  ? 35   VAL A O   1 
ATOM   253  C CB  . VAL A 1 35  ? 25.854 -20.836 25.993 1.00 45.07  ? 35   VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 35  ? 25.853 -21.600 24.682 1.00 45.07  ? 35   VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 35  ? 27.142 -21.095 26.755 1.00 45.07  ? 35   VAL A CG2 1 
ATOM   256  N N   . ARG A 1 36  ? 24.384 -18.741 23.780 1.00 74.41  ? 36   ARG A N   1 
ATOM   257  C CA  . ARG A 1 36  ? 23.150 -18.498 23.046 1.00 74.41  ? 36   ARG A CA  1 
ATOM   258  C C   . ARG A 1 36  ? 22.446 -19.829 22.820 1.00 74.41  ? 36   ARG A C   1 
ATOM   259  O O   . ARG A 1 36  ? 23.066 -20.794 22.394 1.00 74.41  ? 36   ARG A O   1 
ATOM   260  C CB  . ARG A 1 36  ? 23.449 -17.846 21.692 1.00 130.19 ? 36   ARG A CB  1 
ATOM   261  C CG  . ARG A 1 36  ? 23.832 -16.376 21.754 1.00 130.19 ? 36   ARG A CG  1 
ATOM   262  C CD  . ARG A 1 36  ? 22.665 -15.524 22.231 1.00 130.19 ? 36   ARG A CD  1 
ATOM   263  N NE  . ARG A 1 36  ? 22.904 -14.097 22.036 1.00 130.19 ? 36   ARG A NE  1 
ATOM   264  C CZ  . ARG A 1 36  ? 23.960 -13.443 22.506 1.00 130.19 ? 36   ARG A CZ  1 
ATOM   265  N NH1 . ARG A 1 36  ? 24.889 -14.084 23.205 1.00 130.19 ? 36   ARG A NH1 1 
ATOM   266  N NH2 . ARG A 1 36  ? 24.086 -12.142 22.283 1.00 130.19 ? 36   ARG A NH2 1 
ATOM   267  N N   . LEU A 1 37  ? 21.153 -19.884 23.108 1.00 58.35  ? 37   LEU A N   1 
ATOM   268  C CA  . LEU A 1 37  ? 20.412 -21.114 22.903 1.00 58.35  ? 37   LEU A CA  1 
ATOM   269  C C   . LEU A 1 37  ? 19.631 -21.082 21.593 1.00 58.35  ? 37   LEU A C   1 
ATOM   270  O O   . LEU A 1 37  ? 18.627 -21.781 21.444 1.00 58.35  ? 37   LEU A O   1 
ATOM   271  C CB  . LEU A 1 37  ? 19.470 -21.362 24.080 1.00 44.59  ? 37   LEU A CB  1 
ATOM   272  C CG  . LEU A 1 37  ? 20.203 -21.619 25.399 1.00 44.59  ? 37   LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 37  ? 19.191 -21.678 26.532 1.00 44.59  ? 37   LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 37  ? 21.006 -22.911 25.303 1.00 44.59  ? 37   LEU A CD2 1 
ATOM   275  N N   . ASP A 1 38  ? 20.107 -20.280 20.642 1.00 95.81  ? 38   ASP A N   1 
ATOM   276  C CA  . ASP A 1 38  ? 19.455 -20.154 19.340 1.00 95.81  ? 38   ASP A CA  1 
ATOM   277  C C   . ASP A 1 38  ? 20.352 -19.430 18.336 1.00 95.81  ? 38   ASP A C   1 
ATOM   278  O O   . ASP A 1 38  ? 20.962 -20.051 17.465 1.00 95.81  ? 38   ASP A O   1 
ATOM   279  C CB  . ASP A 1 38  ? 18.133 -19.397 19.491 1.00 82.11  ? 38   ASP A CB  1 
ATOM   280  C CG  . ASP A 1 38  ? 18.328 -17.962 19.948 1.00 82.11  ? 38   ASP A CG  1 
ATOM   281  O OD1 . ASP A 1 38  ? 19.083 -17.737 20.918 1.00 82.11  ? 38   ASP A OD1 1 
ATOM   282  O OD2 . ASP A 1 38  ? 17.718 -17.056 19.344 1.00 82.11  ? 38   ASP A OD2 1 
ATOM   283  N N   . GLY A 1 43  ? 24.964 -26.523 17.227 1.00 63.37  ? 43   GLY A N   1 
ATOM   284  C CA  . GLY A 1 43  ? 25.684 -27.505 18.020 1.00 63.37  ? 43   GLY A CA  1 
ATOM   285  C C   . GLY A 1 43  ? 26.249 -26.937 19.317 1.00 63.37  ? 43   GLY A C   1 
ATOM   286  O O   . GLY A 1 43  ? 26.443 -27.669 20.290 1.00 63.37  ? 43   GLY A O   1 
ATOM   287  N N   . VAL A 1 44  ? 26.506 -25.631 19.325 1.00 66.16  ? 44   VAL A N   1 
ATOM   288  C CA  . VAL A 1 44  ? 27.052 -24.922 20.482 1.00 66.16  ? 44   VAL A CA  1 
ATOM   289  C C   . VAL A 1 44  ? 26.418 -25.333 21.816 1.00 66.16  ? 44   VAL A C   1 
ATOM   290  O O   . VAL A 1 44  ? 27.128 -25.597 22.791 1.00 66.16  ? 44   VAL A O   1 
ATOM   291  C CB  . VAL A 1 44  ? 26.920 -23.384 20.278 1.00 41.31  ? 44   VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 44  ? 27.176 -22.634 21.575 1.00 41.31  ? 44   VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 44  ? 27.896 -22.939 19.212 1.00 41.31  ? 44   VAL A CG2 1 
ATOM   294  N N   . PRO A 1 45  ? 25.077 -25.390 21.879 1.00 64.81  ? 45   PRO A N   1 
ATOM   295  C CA  . PRO A 1 45  ? 24.436 -25.784 23.140 1.00 64.81  ? 45   PRO A CA  1 
ATOM   296  C C   . PRO A 1 45  ? 24.863 -27.167 23.631 1.00 64.81  ? 45   PRO A C   1 
ATOM   297  O O   . PRO A 1 45  ? 25.250 -27.339 24.791 1.00 64.81  ? 45   PRO A O   1 
ATOM   298  C CB  . PRO A 1 45  ? 22.942 -25.723 22.805 1.00 45.21  ? 45   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 45  ? 22.877 -24.592 21.814 1.00 45.21  ? 45   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 45  ? 24.076 -24.896 20.914 1.00 45.21  ? 45   PRO A CD  1 
ATOM   301  N N   . SER A 1 46  ? 24.794 -28.153 22.746 1.00 32.66  ? 46   SER A N   1 
ATOM   302  C CA  . SER A 1 46  ? 25.155 -29.517 23.119 1.00 32.66  ? 46   SER A CA  1 
ATOM   303  C C   . SER A 1 46  ? 26.591 -29.575 23.618 1.00 32.66  ? 46   SER A C   1 
ATOM   304  O O   . SER A 1 46  ? 26.915 -30.377 24.479 1.00 32.66  ? 46   SER A O   1 
ATOM   305  C CB  . SER A 1 46  ? 24.984 -30.468 21.931 1.00 48.41  ? 46   SER A CB  1 
ATOM   306  O OG  . SER A 1 46  ? 25.960 -30.214 20.933 1.00 48.41  ? 46   SER A OG  1 
ATOM   307  N N   . SER A 1 47  ? 27.460 -28.737 23.066 1.00 36.57  ? 47   SER A N   1 
ATOM   308  C CA  . SER A 1 47  ? 28.842 -28.722 23.505 1.00 36.57  ? 47   SER A CA  1 
ATOM   309  C C   . SER A 1 47  ? 28.834 -28.166 24.921 1.00 36.57  ? 47   SER A C   1 
ATOM   310  O O   . SER A 1 47  ? 29.468 -28.717 25.813 1.00 36.57  ? 47   SER A O   1 
ATOM   311  C CB  . SER A 1 47  ? 29.693 -27.832 22.592 1.00 50.55  ? 47   SER A CB  1 
ATOM   312  O OG  . SER A 1 47  ? 31.017 -27.685 23.093 1.00 50.55  ? 47   SER A OG  1 
ATOM   313  N N   . ALA A 1 48  ? 28.100 -27.077 25.122 1.00 35.37  ? 48   ALA A N   1 
ATOM   314  C CA  . ALA A 1 48  ? 28.005 -26.442 26.431 1.00 35.37  ? 48   ALA A CA  1 
ATOM   315  C C   . ALA A 1 48  ? 27.462 -27.399 27.493 1.00 35.37  ? 48   ALA A C   1 
ATOM   316  O O   . ALA A 1 48  ? 28.000 -27.463 28.613 1.00 35.37  ? 48   ALA A O   1 
ATOM   317  C CB  . ALA A 1 48  ? 27.114 -25.187 26.356 1.00 9.79   ? 48   ALA A CB  1 
ATOM   318  N N   . LEU A 1 49  ? 26.403 -28.138 27.161 1.00 52.50  ? 49   LEU A N   1 
ATOM   319  C CA  . LEU A 1 49  ? 25.837 -29.063 28.130 1.00 52.50  ? 49   LEU A CA  1 
ATOM   320  C C   . LEU A 1 49  ? 26.829 -30.164 28.492 1.00 52.50  ? 49   LEU A C   1 
ATOM   321  O O   . LEU A 1 49  ? 26.786 -30.710 29.598 1.00 52.50  ? 49   LEU A O   1 
ATOM   322  C CB  . LEU A 1 49  ? 24.529 -29.655 27.611 1.00 38.77  ? 49   LEU A CB  1 
ATOM   323  C CG  . LEU A 1 49  ? 23.400 -28.623 27.515 1.00 38.77  ? 49   LEU A CG  1 
ATOM   324  C CD1 . LEU A 1 49  ? 22.116 -29.290 27.042 1.00 38.77  ? 49   LEU A CD1 1 
ATOM   325  C CD2 . LEU A 1 49  ? 23.197 -27.964 28.869 1.00 38.77  ? 49   LEU A CD2 1 
ATOM   326  N N   . ARG A 1 50  ? 27.737 -30.482 27.577 1.00 36.16  ? 50   ARG A N   1 
ATOM   327  C CA  . ARG A 1 50  ? 28.730 -31.512 27.874 1.00 36.16  ? 50   ARG A CA  1 
ATOM   328  C C   . ARG A 1 50  ? 29.738 -30.943 28.875 1.00 36.16  ? 50   ARG A C   1 
ATOM   329  O O   . ARG A 1 50  ? 30.061 -31.583 29.880 1.00 36.16  ? 50   ARG A O   1 
ATOM   330  C CB  . ARG A 1 50  ? 29.459 -31.979 26.606 1.00 42.92  ? 50   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 50  ? 30.305 -33.218 26.840 1.00 42.92  ? 50   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 50  ? 30.753 -33.893 25.560 1.00 42.92  ? 50   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 50  ? 31.634 -33.043 24.782 1.00 42.92  ? 50   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 50  ? 31.306 -32.490 23.620 1.00 42.92  ? 50   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 50  ? 30.106 -32.703 23.091 1.00 42.92  ? 50   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 50  ? 32.177 -31.711 22.990 1.00 42.92  ? 50   ARG A NH2 1 
ATOM   337  N N   . GLU A 1 51  ? 30.226 -29.734 28.604 1.00 31.95  ? 51   GLU A N   1 
ATOM   338  C CA  . GLU A 1 51  ? 31.169 -29.103 29.500 1.00 31.95  ? 51   GLU A CA  1 
ATOM   339  C C   . GLU A 1 51  ? 30.587 -29.116 30.919 1.00 31.95  ? 51   GLU A C   1 
ATOM   340  O O   . GLU A 1 51  ? 31.236 -29.561 31.865 1.00 31.95  ? 51   GLU A O   1 
ATOM   341  C CB  . GLU A 1 51  ? 31.424 -27.677 29.058 1.00 54.67  ? 51   GLU A CB  1 
ATOM   342  C CG  . GLU A 1 51  ? 32.522 -27.024 29.839 1.00 54.67  ? 51   GLU A CG  1 
ATOM   343  C CD  . GLU A 1 51  ? 32.839 -25.645 29.331 1.00 54.67  ? 51   GLU A CD  1 
ATOM   344  O OE1 . GLU A 1 51  ? 33.888 -25.097 29.738 1.00 54.67  ? 51   GLU A OE1 1 
ATOM   345  O OE2 . GLU A 1 51  ? 32.041 -25.112 28.531 1.00 54.67  ? 51   GLU A OE2 1 
ATOM   346  N N   . ILE A 1 52  ? 29.354 -28.635 31.060 1.00 46.81  ? 52   ILE A N   1 
ATOM   347  C CA  . ILE A 1 52  ? 28.697 -28.605 32.360 1.00 46.81  ? 52   ILE A CA  1 
ATOM   348  C C   . ILE A 1 52  ? 28.726 -29.986 33.019 1.00 46.81  ? 52   ILE A C   1 
ATOM   349  O O   . ILE A 1 52  ? 29.166 -30.110 34.168 1.00 46.81  ? 52   ILE A O   1 
ATOM   350  C CB  . ILE A 1 52  ? 27.235 -28.138 32.234 1.00 38.24  ? 52   ILE A CB  1 
ATOM   351  C CG1 . ILE A 1 52  ? 27.204 -26.687 31.755 1.00 38.24  ? 52   ILE A CG1 1 
ATOM   352  C CG2 . ILE A 1 52  ? 26.523 -28.279 33.574 1.00 38.24  ? 52   ILE A CG2 1 
ATOM   353  C CD1 . ILE A 1 52  ? 25.851 -26.234 31.259 1.00 38.24  ? 52   ILE A CD1 1 
ATOM   354  N N   . CYS A 1 53  ? 28.264 -31.010 32.291 1.00 47.01  ? 53   CYS A N   1 
ATOM   355  C CA  . CYS A 1 53  ? 28.242 -32.394 32.793 1.00 47.01  ? 53   CYS A CA  1 
ATOM   356  C C   . CYS A 1 53  ? 29.593 -32.875 33.305 1.00 47.01  ? 53   CYS A C   1 
ATOM   357  O O   . CYS A 1 53  ? 29.688 -33.474 34.382 1.00 47.01  ? 53   CYS A O   1 
ATOM   358  C CB  . CYS A 1 53  ? 27.797 -33.370 31.703 1.00 45.32  ? 53   CYS A CB  1 
ATOM   359  S SG  . CYS A 1 53  ? 26.033 -33.619 31.552 1.00 45.32  ? 53   CYS A SG  1 
ATOM   360  N N   . LEU A 1 54  ? 30.636 -32.627 32.522 1.00 34.08  ? 54   LEU A N   1 
ATOM   361  C CA  . LEU A 1 54  ? 31.974 -33.055 32.892 1.00 34.08  ? 54   LEU A CA  1 
ATOM   362  C C   . LEU A 1 54  ? 32.516 -32.260 34.078 1.00 34.08  ? 54   LEU A C   1 
ATOM   363  O O   . LEU A 1 54  ? 32.979 -32.836 35.065 1.00 34.08  ? 54   LEU A O   1 
ATOM   364  C CB  . LEU A 1 54  ? 32.913 -32.929 31.682 1.00 27.11  ? 54   LEU A CB  1 
ATOM   365  C CG  . LEU A 1 54  ? 32.487 -33.791 30.485 1.00 27.11  ? 54   LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 54  ? 33.476 -33.644 29.348 1.00 27.11  ? 54   LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 54  ? 32.394 -35.233 30.896 1.00 27.11  ? 54   LEU A CD2 1 
ATOM   368  N N   . LEU A 1 55  ? 32.447 -30.938 33.982 1.00 34.22  ? 55   LEU A N   1 
ATOM   369  C CA  . LEU A 1 55  ? 32.939 -30.077 35.044 1.00 34.22  ? 55   LEU A CA  1 
ATOM   370  C C   . LEU A 1 55  ? 32.344 -30.456 36.389 1.00 34.22  ? 55   LEU A C   1 
ATOM   371  O O   . LEU A 1 55  ? 33.073 -30.560 37.380 1.00 34.22  ? 55   LEU A O   1 
ATOM   372  C CB  . LEU A 1 55  ? 32.639 -28.609 34.718 1.00 36.26  ? 55   LEU A CB  1 
ATOM   373  C CG  . LEU A 1 55  ? 33.854 -27.722 34.418 1.00 36.26  ? 55   LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 55  ? 35.044 -28.578 34.008 1.00 36.26  ? 55   LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 55  ? 33.496 -26.709 33.333 1.00 36.26  ? 55   LEU A CD2 1 
ATOM   376  N N   . LYS A 1 56  ? 31.028 -30.675 36.431 1.00 40.57  ? 56   LYS A N   1 
ATOM   377  C CA  . LYS A 1 56  ? 30.369 -31.040 37.684 1.00 40.57  ? 56   LYS A CA  1 
ATOM   378  C C   . LYS A 1 56  ? 31.050 -32.206 38.389 1.00 40.57  ? 56   LYS A C   1 
ATOM   379  O O   . LYS A 1 56  ? 30.940 -32.332 39.598 1.00 40.57  ? 56   LYS A O   1 
ATOM   380  C CB  . LYS A 1 56  ? 28.895 -31.365 37.449 1.00 37.99  ? 56   LYS A CB  1 
ATOM   381  C CG  . LYS A 1 56  ? 28.045 -30.130 37.242 1.00 37.99  ? 56   LYS A CG  1 
ATOM   382  C CD  . LYS A 1 56  ? 26.625 -30.458 36.826 1.00 37.99  ? 56   LYS A CD  1 
ATOM   383  C CE  . LYS A 1 56  ? 25.833 -31.066 37.966 1.00 37.99  ? 56   LYS A CE  1 
ATOM   384  N NZ  . LYS A 1 56  ? 25.711 -30.124 39.144 1.00 37.99  ? 56   LYS A NZ  1 
ATOM   385  N N   . GLU A 1 57  ? 31.771 -33.038 37.640 1.00 35.92  ? 57   GLU A N   1 
ATOM   386  C CA  . GLU A 1 57  ? 32.481 -34.195 38.194 1.00 35.92  ? 57   GLU A CA  1 
ATOM   387  C C   . GLU A 1 57  ? 34.019 -34.054 38.163 1.00 35.92  ? 57   GLU A C   1 
ATOM   388  O O   . GLU A 1 57  ? 34.743 -35.035 38.350 1.00 35.92  ? 57   GLU A O   1 
ATOM   389  C CB  . GLU A 1 57  ? 32.091 -35.443 37.408 1.00 48.82  ? 57   GLU A CB  1 
ATOM   390  C CG  . GLU A 1 57  ? 30.609 -35.627 37.273 1.00 48.82  ? 57   GLU A CG  1 
ATOM   391  C CD  . GLU A 1 57  ? 29.908 -35.576 38.607 1.00 48.82  ? 57   GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 57  ? 30.198 -36.431 39.474 1.00 48.82  ? 57   GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 57  ? 29.069 -34.674 38.784 1.00 48.82  ? 57   GLU A OE2 1 
ATOM   394  N N   . LEU A 1 58  ? 34.519 -32.847 37.921 1.00 50.45  ? 58   LEU A N   1 
ATOM   395  C CA  . LEU A 1 58  ? 35.963 -32.622 37.880 1.00 50.45  ? 58   LEU A CA  1 
ATOM   396  C C   . LEU A 1 58  ? 36.343 -31.510 38.840 1.00 50.45  ? 58   LEU A C   1 
ATOM   397  O O   . LEU A 1 58  ? 36.543 -30.377 38.415 1.00 50.45  ? 58   LEU A O   1 
ATOM   398  C CB  . LEU A 1 58  ? 36.414 -32.212 36.477 1.00 61.44  ? 58   LEU A CB  1 
ATOM   399  C CG  . LEU A 1 58  ? 36.118 -33.113 35.281 1.00 61.44  ? 58   LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 58  ? 36.878 -32.589 34.084 1.00 61.44  ? 58   LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 58  ? 36.547 -34.533 35.575 1.00 61.44  ? 58   LEU A CD2 1 
ATOM   402  N N   . LYS A 1 59  ? 36.435 -31.808 40.131 1.00 41.27  ? 59   LYS A N   1 
ATOM   403  C CA  . LYS A 1 59  ? 36.798 -30.769 41.085 1.00 41.27  ? 59   LYS A CA  1 
ATOM   404  C C   . LYS A 1 59  ? 38.222 -30.973 41.579 1.00 41.27  ? 59   LYS A C   1 
ATOM   405  O O   . LYS A 1 59  ? 38.527 -31.952 42.258 1.00 41.27  ? 59   LYS A O   1 
ATOM   406  C CB  . LYS A 1 59  ? 35.784 -30.753 42.219 1.00 56.23  ? 59   LYS A CB  1 
ATOM   407  C CG  . LYS A 1 59  ? 34.391 -30.366 41.714 1.00 56.23  ? 59   LYS A CG  1 
ATOM   408  C CD  . LYS A 1 59  ? 33.437 -30.077 42.853 1.00 56.23  ? 59   LYS A CD  1 
ATOM   409  C CE  . LYS A 1 59  ? 32.019 -29.802 42.364 1.00 56.23  ? 59   LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 59  ? 31.048 -29.877 43.513 1.00 56.23  ? 59   LYS A NZ  1 
ATOM   411  N N   . HIS A 1 60  ? 39.093 -30.036 41.218 1.00 33.08  ? 60   HIS A N   1 
ATOM   412  C CA  . HIS A 1 60  ? 40.512 -30.115 41.561 1.00 33.08  ? 60   HIS A CA  1 
ATOM   413  C C   . HIS A 1 60  ? 41.118 -28.706 41.457 1.00 33.08  ? 60   HIS A C   1 
ATOM   414  O O   . HIS A 1 60  ? 40.829 -27.973 40.510 1.00 33.08  ? 60   HIS A O   1 
ATOM   415  C CB  . HIS A 1 60  ? 41.168 -31.090 40.563 1.00 37.43  ? 60   HIS A CB  1 
ATOM   416  C CG  . HIS A 1 60  ? 42.636 -31.311 40.765 1.00 37.43  ? 60   HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 60  ? 43.579 -30.326 40.547 1.00 37.43  ? 60   HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 60  ? 43.330 -32.431 41.089 1.00 37.43  ? 60   HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 60  ? 44.789 -30.832 40.722 1.00 37.43  ? 60   HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 60  ? 44.667 -32.106 41.051 1.00 37.43  ? 60   HIS A NE2 1 
ATOM   421  N N   . LYS A 1 61  ? 41.949 -28.321 42.417 1.00 56.70  ? 61   LYS A N   1 
ATOM   422  C CA  . LYS A 1 61  ? 42.558 -26.991 42.396 1.00 56.70  ? 61   LYS A CA  1 
ATOM   423  C C   . LYS A 1 61  ? 43.161 -26.619 41.044 1.00 56.70  ? 61   LYS A C   1 
ATOM   424  O O   . LYS A 1 61  ? 43.330 -25.439 40.742 1.00 56.70  ? 61   LYS A O   1 
ATOM   425  C CB  . LYS A 1 61  ? 43.647 -26.871 43.471 1.00 50.63  ? 61   LYS A CB  1 
ATOM   426  C CG  . LYS A 1 61  ? 44.855 -27.766 43.248 1.00 50.63  ? 61   LYS A CG  1 
ATOM   427  C CD  . LYS A 1 61  ? 45.925 -27.521 44.308 1.00 50.63  ? 61   LYS A CD  1 
ATOM   428  C CE  . LYS A 1 61  ? 47.026 -28.591 44.287 1.00 50.63  ? 61   LYS A CE  1 
ATOM   429  N NZ  . LYS A 1 61  ? 48.108 -28.307 45.290 1.00 50.63  ? 61   LYS A NZ  1 
ATOM   430  N N   . ASN A 1 62  ? 43.486 -27.611 40.223 1.00 47.93  ? 62   ASN A N   1 
ATOM   431  C CA  . ASN A 1 62  ? 44.078 -27.303 38.929 1.00 47.93  ? 62   ASN A CA  1 
ATOM   432  C C   . ASN A 1 62  ? 43.116 -27.413 37.754 1.00 47.93  ? 62   ASN A C   1 
ATOM   433  O O   . ASN A 1 62  ? 43.529 -27.482 36.590 1.00 47.93  ? 62   ASN A O   1 
ATOM   434  C CB  . ASN A 1 62  ? 45.320 -28.167 38.709 1.00 40.79  ? 62   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 62  ? 46.417 -27.851 39.712 1.00 40.79  ? 62   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 62  ? 46.903 -26.716 39.792 1.00 40.79  ? 62   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 62  ? 46.809 -28.849 40.484 1.00 40.79  ? 62   ASN A ND2 1 
ATOM   438  N N   . ILE A 1 63  ? 41.827 -27.433 38.072 1.00 42.43  ? 63   ILE A N   1 
ATOM   439  C CA  . ILE A 1 63  ? 40.784 -27.481 37.054 1.00 42.43  ? 63   ILE A CA  1 
ATOM   440  C C   . ILE A 1 63  ? 39.794 -26.394 37.417 1.00 42.43  ? 63   ILE A C   1 
ATOM   441  O O   . ILE A 1 63  ? 39.240 -26.399 38.519 1.00 42.43  ? 63   ILE A O   1 
ATOM   442  C CB  . ILE A 1 63  ? 40.067 -28.844 37.021 1.00 24.61  ? 63   ILE A CB  1 
ATOM   443  C CG1 . ILE A 1 63  ? 41.023 -29.909 36.452 1.00 24.61  ? 63   ILE A CG1 1 
ATOM   444  C CG2 . ILE A 1 63  ? 38.797 -28.744 36.192 1.00 24.61  ? 63   ILE A CG2 1 
ATOM   445  C CD1 . ILE A 1 63  ? 40.405 -31.299 36.361 1.00 24.61  ? 63   ILE A CD1 1 
ATOM   446  N N   . VAL A 1 64  ? 39.592 -25.448 36.506 1.00 26.55  ? 64   VAL A N   1 
ATOM   447  C CA  . VAL A 1 64  ? 38.676 -24.341 36.764 1.00 26.55  ? 64   VAL A CA  1 
ATOM   448  C C   . VAL A 1 64  ? 37.356 -24.801 37.400 1.00 26.55  ? 64   VAL A C   1 
ATOM   449  O O   . VAL A 1 64  ? 36.782 -25.821 37.029 1.00 26.55  ? 64   VAL A O   1 
ATOM   450  C CB  . VAL A 1 64  ? 38.386 -23.555 35.456 1.00 37.44  ? 64   VAL A CB  1 
ATOM   451  C CG1 . VAL A 1 64  ? 37.715 -24.460 34.435 1.00 37.44  ? 64   VAL A CG1 1 
ATOM   452  C CG2 . VAL A 1 64  ? 37.527 -22.328 35.769 1.00 37.44  ? 64   VAL A CG2 1 
ATOM   453  N N   . ARG A 1 65  ? 36.866 -24.049 38.369 1.00 36.43  ? 65   ARG A N   1 
ATOM   454  C CA  . ARG A 1 65  ? 35.632 -24.456 39.001 1.00 36.43  ? 65   ARG A CA  1 
ATOM   455  C C   . ARG A 1 65  ? 34.402 -23.849 38.348 1.00 36.43  ? 65   ARG A C   1 
ATOM   456  O O   . ARG A 1 65  ? 34.441 -22.734 37.827 1.00 36.43  ? 65   ARG A O   1 
ATOM   457  C CB  . ARG A 1 65  ? 35.653 -24.117 40.493 1.00 186.29 ? 65   ARG A CB  1 
ATOM   458  C CG  . ARG A 1 65  ? 34.531 -24.794 41.259 1.00 139.33 ? 65   ARG A CG  1 
ATOM   459  C CD  . ARG A 1 65  ? 34.769 -24.805 42.757 1.00 139.33 ? 65   ARG A CD  1 
ATOM   460  N NE  . ARG A 1 65  ? 33.883 -25.764 43.415 1.00 139.33 ? 65   ARG A NE  1 
ATOM   461  C CZ  . ARG A 1 65  ? 33.880 -26.017 44.721 1.00 139.33 ? 65   ARG A CZ  1 
ATOM   462  N NH1 . ARG A 1 65  ? 34.719 -25.379 45.527 1.00 139.33 ? 65   ARG A NH1 1 
ATOM   463  N NH2 . ARG A 1 65  ? 33.041 -26.917 45.220 1.00 139.33 ? 65   ARG A NH2 1 
ATOM   464  N N   . LEU A 1 66  ? 33.312 -24.608 38.390 1.00 59.16  ? 66   LEU A N   1 
ATOM   465  C CA  . LEU A 1 66  ? 32.031 -24.197 37.838 1.00 59.16  ? 66   LEU A CA  1 
ATOM   466  C C   . LEU A 1 66  ? 31.065 -24.017 39.012 1.00 59.16  ? 66   LEU A C   1 
ATOM   467  O O   . LEU A 1 66  ? 30.486 -24.984 39.490 1.00 59.16  ? 66   LEU A O   1 
ATOM   468  C CB  . LEU A 1 66  ? 31.511 -25.284 36.902 1.00 27.40  ? 66   LEU A CB  1 
ATOM   469  C CG  . LEU A 1 66  ? 30.073 -25.095 36.425 1.00 27.40  ? 66   LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 66  ? 30.023 -23.873 35.520 1.00 27.40  ? 66   LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 66  ? 29.585 -26.352 35.685 1.00 27.40  ? 66   LEU A CD2 1 
ATOM   472  N N   . HIS A 1 67  ? 30.886 -22.788 39.479 1.00 49.48  ? 67   HIS A N   1 
ATOM   473  C CA  . HIS A 1 67  ? 30.002 -22.542 40.618 1.00 49.48  ? 67   HIS A CA  1 
ATOM   474  C C   . HIS A 1 67  ? 28.542 -22.853 40.378 1.00 49.48  ? 67   HIS A C   1 
ATOM   475  O O   . HIS A 1 67  ? 27.925 -23.540 41.186 1.00 49.48  ? 67   HIS A O   1 
ATOM   476  C CB  . HIS A 1 67  ? 30.120 -21.097 41.089 1.00 41.09  ? 67   HIS A CB  1 
ATOM   477  C CG  . HIS A 1 67  ? 31.497 -20.727 41.536 1.00 41.09  ? 67   HIS A CG  1 
ATOM   478  N ND1 . HIS A 1 67  ? 32.154 -19.604 41.073 1.00 41.09  ? 67   HIS A ND1 1 
ATOM   479  C CD2 . HIS A 1 67  ? 32.350 -21.337 42.393 1.00 41.09  ? 67   HIS A CD2 1 
ATOM   480  C CE1 . HIS A 1 67  ? 33.353 -19.541 41.626 1.00 41.09  ? 67   HIS A CE1 1 
ATOM   481  N NE2 . HIS A 1 67  ? 33.498 -20.580 42.431 1.00 41.09  ? 67   HIS A NE2 1 
ATOM   482  N N   . ASP A 1 68  ? 27.981 -22.365 39.277 1.00 55.33  ? 68   ASP A N   1 
ATOM   483  C CA  . ASP A 1 68  ? 26.566 -22.600 39.005 1.00 55.33  ? 68   ASP A CA  1 
ATOM   484  C C   . ASP A 1 68  ? 26.269 -22.620 37.504 1.00 55.33  ? 68   ASP A C   1 
ATOM   485  O O   . ASP A 1 68  ? 27.178 -22.603 36.670 1.00 55.33  ? 68   ASP A O   1 
ATOM   486  C CB  . ASP A 1 68  ? 25.758 -21.491 39.687 1.00 54.19  ? 68   ASP A CB  1 
ATOM   487  C CG  . ASP A 1 68  ? 24.289 -21.845 39.878 1.00 54.19  ? 68   ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 68  ? 23.584 -21.028 40.512 1.00 54.19  ? 68   ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 68  ? 23.832 -22.916 39.412 1.00 54.19  ? 68   ASP A OD2 1 
ATOM   490  N N   . VAL A 1 69  ? 24.989 -22.691 37.166 1.00 40.96  ? 69   VAL A N   1 
ATOM   491  C CA  . VAL A 1 69  ? 24.552 -22.651 35.781 1.00 40.96  ? 69   VAL A CA  1 
ATOM   492  C C   . VAL A 1 69  ? 23.147 -22.096 35.814 1.00 40.96  ? 69   VAL A C   1 
ATOM   493  O O   . VAL A 1 69  ? 22.297 -22.629 36.518 1.00 40.96  ? 69   VAL A O   1 
ATOM   494  C CB  . VAL A 1 69  ? 24.533 -24.029 35.127 1.00 29.08  ? 69   VAL A CB  1 
ATOM   495  C CG1 . VAL A 1 69  ? 23.873 -23.925 33.751 1.00 29.08  ? 69   VAL A CG1 1 
ATOM   496  C CG2 . VAL A 1 69  ? 25.958 -24.551 34.973 1.00 29.08  ? 69   VAL A CG2 1 
ATOM   497  N N   . LEU A 1 70  ? 22.918 -21.018 35.066 1.00 50.53  ? 70   LEU A N   1 
ATOM   498  C CA  . LEU A 1 70  ? 21.617 -20.353 35.026 1.00 50.53  ? 70   LEU A CA  1 
ATOM   499  C C   . LEU A 1 70  ? 20.982 -20.399 33.654 1.00 50.53  ? 70   LEU A C   1 
ATOM   500  O O   . LEU A 1 70  ? 21.671 -20.308 32.641 1.00 50.53  ? 70   LEU A O   1 
ATOM   501  C CB  . LEU A 1 70  ? 21.764 -18.887 35.420 1.00 57.39  ? 70   LEU A CB  1 
ATOM   502  C CG  . LEU A 1 70  ? 22.496 -18.573 36.718 1.00 57.39  ? 70   LEU A CG  1 
ATOM   503  C CD1 . LEU A 1 70  ? 22.618 -17.074 36.866 1.00 57.39  ? 70   LEU A CD1 1 
ATOM   504  C CD2 . LEU A 1 70  ? 21.740 -19.173 37.889 1.00 57.39  ? 70   LEU A CD2 1 
ATOM   505  N N   . HIS A 1 71  ? 19.660 -20.523 33.626 1.00 48.69  ? 71   HIS A N   1 
ATOM   506  C CA  . HIS A 1 71  ? 18.916 -20.553 32.371 1.00 48.69  ? 71   HIS A CA  1 
ATOM   507  C C   . HIS A 1 71  ? 17.983 -19.340 32.349 1.00 48.69  ? 71   HIS A C   1 
ATOM   508  O O   . HIS A 1 71  ? 16.860 -19.408 32.837 1.00 48.69  ? 71   HIS A O   1 
ATOM   509  C CB  . HIS A 1 71  ? 18.093 -21.839 32.267 1.00 44.96  ? 71   HIS A CB  1 
ATOM   510  C CG  . HIS A 1 71  ? 17.170 -21.870 31.088 1.00 44.96  ? 71   HIS A CG  1 
ATOM   511  N ND1 . HIS A 1 71  ? 16.023 -22.632 31.062 1.00 44.96  ? 71   HIS A ND1 1 
ATOM   512  C CD2 . HIS A 1 71  ? 17.213 -21.215 29.903 1.00 44.96  ? 71   HIS A CD2 1 
ATOM   513  C CE1 . HIS A 1 71  ? 15.396 -22.442 29.915 1.00 44.96  ? 71   HIS A CE1 1 
ATOM   514  N NE2 . HIS A 1 71  ? 16.097 -21.587 29.193 1.00 44.96  ? 71   HIS A NE2 1 
ATOM   515  N N   . SER A 1 72  ? 18.444 -18.236 31.775 1.00 72.46  ? 72   SER A N   1 
ATOM   516  C CA  . SER A 1 72  ? 17.632 -17.025 31.726 1.00 72.46  ? 72   SER A CA  1 
ATOM   517  C C   . SER A 1 72  ? 17.653 -16.353 30.360 1.00 72.46  ? 72   SER A C   1 
ATOM   518  O O   . SER A 1 72  ? 18.644 -16.430 29.633 1.00 72.46  ? 72   SER A O   1 
ATOM   519  C CB  . SER A 1 72  ? 18.119 -16.018 32.776 1.00 79.70  ? 72   SER A CB  1 
ATOM   520  O OG  . SER A 1 72  ? 19.382 -15.469 32.413 1.00 79.70  ? 72   SER A OG  1 
ATOM   521  N N   . ASP A 1 73  ? 16.558 -15.677 30.028 1.00 55.96  ? 73   ASP A N   1 
ATOM   522  C CA  . ASP A 1 73  ? 16.442 -14.977 28.757 1.00 55.96  ? 73   ASP A CA  1 
ATOM   523  C C   . ASP A 1 73  ? 16.846 -15.836 27.573 1.00 55.96  ? 73   ASP A C   1 
ATOM   524  O O   . ASP A 1 73  ? 17.478 -15.353 26.635 1.00 55.96  ? 73   ASP A O   1 
ATOM   525  C CB  . ASP A 1 73  ? 17.295 -13.707 28.770 1.00 110.27 ? 73   ASP A CB  1 
ATOM   526  C CG  . ASP A 1 73  ? 16.665 -12.588 29.575 1.00 110.27 ? 73   ASP A CG  1 
ATOM   527  O OD1 . ASP A 1 73  ? 17.260 -11.491 29.623 1.00 110.27 ? 73   ASP A OD1 1 
ATOM   528  O OD2 . ASP A 1 73  ? 15.580 -12.802 30.157 1.00 110.27 ? 73   ASP A OD2 1 
ATOM   529  N N   . LYS A 1 74  ? 16.498 -17.114 27.612 1.00 95.47  ? 74   LYS A N   1 
ATOM   530  C CA  . LYS A 1 74  ? 16.829 -17.990 26.499 1.00 95.47  ? 74   LYS A CA  1 
ATOM   531  C C   . LYS A 1 74  ? 18.342 -18.020 26.250 1.00 95.47  ? 74   LYS A C   1 
ATOM   532  O O   . LYS A 1 74  ? 18.821 -17.951 25.116 1.00 95.47  ? 74   LYS A O   1 
ATOM   533  C CB  . LYS A 1 74  ? 16.050 -17.516 25.266 1.00 104.84 ? 74   LYS A CB  1 
ATOM   534  C CG  . LYS A 1 74  ? 14.575 -17.280 25.640 1.00 104.84 ? 74   LYS A CG  1 
ATOM   535  C CD  . LYS A 1 74  ? 13.638 -16.935 24.481 1.00 104.84 ? 74   LYS A CD  1 
ATOM   536  C CE  . LYS A 1 74  ? 12.183 -16.855 25.020 1.00 104.84 ? 74   LYS A CE  1 
ATOM   537  N NZ  . LYS A 1 74  ? 11.126 -16.638 23.954 1.00 104.84 ? 74   LYS A NZ  1 
ATOM   538  N N   . LYS A 1 75  ? 19.079 -18.125 27.350 1.00 83.32  ? 75   LYS A N   1 
ATOM   539  C CA  . LYS A 1 75  ? 20.532 -18.193 27.341 1.00 83.32  ? 75   LYS A CA  1 
ATOM   540  C C   . LYS A 1 75  ? 20.958 -19.008 28.557 1.00 83.32  ? 75   LYS A C   1 
ATOM   541  O O   . LYS A 1 75  ? 20.275 -19.022 29.586 1.00 83.32  ? 75   LYS A O   1 
ATOM   542  C CB  . LYS A 1 75  ? 21.151 -16.798 27.464 1.00 90.90  ? 75   LYS A CB  1 
ATOM   543  C CG  . LYS A 1 75  ? 21.010 -15.894 26.255 1.00 90.90  ? 75   LYS A CG  1 
ATOM   544  C CD  . LYS A 1 75  ? 21.682 -14.546 26.535 1.00 90.90  ? 75   LYS A CD  1 
ATOM   545  C CE  . LYS A 1 75  ? 21.632 -13.613 25.334 1.00 90.90  ? 75   LYS A CE  1 
ATOM   546  N NZ  . LYS A 1 75  ? 22.210 -12.274 25.645 1.00 90.90  ? 75   LYS A NZ  1 
ATOM   547  N N   . LEU A 1 76  ? 22.078 -19.705 28.431 1.00 63.00  ? 76   LEU A N   1 
ATOM   548  C CA  . LEU A 1 76  ? 22.621 -20.469 29.547 1.00 63.00  ? 76   LEU A CA  1 
ATOM   549  C C   . LEU A 1 76  ? 23.869 -19.742 29.995 1.00 63.00  ? 76   LEU A C   1 
ATOM   550  O O   . LEU A 1 76  ? 24.778 -19.511 29.198 1.00 63.00  ? 76   LEU A O   1 
ATOM   551  C CB  . LEU A 1 76  ? 22.988 -21.893 29.136 1.00 48.35  ? 76   LEU A CB  1 
ATOM   552  C CG  . LEU A 1 76  ? 21.828 -22.880 29.129 1.00 48.35  ? 76   LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 76  ? 22.368 -24.277 28.909 1.00 48.35  ? 76   LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 76  ? 21.073 -22.810 30.459 1.00 48.35  ? 76   LEU A CD2 1 
ATOM   555  N N   . THR A 1 77  ? 23.902 -19.350 31.262 1.00 47.52  ? 77   THR A N   1 
ATOM   556  C CA  . THR A 1 77  ? 25.068 -18.664 31.789 1.00 47.52  ? 77   THR A CA  1 
ATOM   557  C C   . THR A 1 77  ? 25.801 -19.571 32.758 1.00 47.52  ? 77   THR A C   1 
ATOM   558  O O   . THR A 1 77  ? 25.261 -19.936 33.801 1.00 47.52  ? 77   THR A O   1 
ATOM   559  C CB  . THR A 1 77  ? 24.703 -17.374 32.536 1.00 48.64  ? 77   THR A CB  1 
ATOM   560  O OG1 . THR A 1 77  ? 24.029 -16.469 31.650 1.00 48.64  ? 77   THR A OG1 1 
ATOM   561  C CG2 . THR A 1 77  ? 25.974 -16.715 33.070 1.00 48.64  ? 77   THR A CG2 1 
ATOM   562  N N   . LEU A 1 78  ? 27.020 -19.953 32.396 1.00 30.29  ? 78   LEU A N   1 
ATOM   563  C CA  . LEU A 1 78  ? 27.826 -20.797 33.259 1.00 30.29  ? 78   LEU A CA  1 
ATOM   564  C C   . LEU A 1 78  ? 28.559 -19.836 34.180 1.00 30.29  ? 78   LEU A C   1 
ATOM   565  O O   . LEU A 1 78  ? 29.312 -18.986 33.719 1.00 30.29  ? 78   LEU A O   1 
ATOM   566  C CB  . LEU A 1 78  ? 28.857 -21.601 32.463 1.00 44.68  ? 78   LEU A CB  1 
ATOM   567  C CG  . LEU A 1 78  ? 28.482 -22.249 31.126 1.00 44.68  ? 78   LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 78  ? 29.331 -23.507 30.954 1.00 44.68  ? 78   LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 78  ? 26.990 -22.588 31.070 1.00 44.68  ? 78   LEU A CD2 1 
ATOM   570  N N   . VAL A 1 79  ? 28.319 -19.942 35.478 1.00 44.39  ? 79   VAL A N   1 
ATOM   571  C CA  . VAL A 1 79  ? 28.993 -19.062 36.407 1.00 44.39  ? 79   VAL A CA  1 
ATOM   572  C C   . VAL A 1 79  ? 30.272 -19.781 36.794 1.00 44.39  ? 79   VAL A C   1 
ATOM   573  O O   . VAL A 1 79  ? 30.241 -20.757 37.546 1.00 44.39  ? 79   VAL A O   1 
ATOM   574  C CB  . VAL A 1 79  ? 28.119 -18.784 37.658 1.00 44.34  ? 79   VAL A CB  1 
ATOM   575  C CG1 . VAL A 1 79  ? 28.715 -17.623 38.470 1.00 44.34  ? 79   VAL A CG1 1 
ATOM   576  C CG2 . VAL A 1 79  ? 26.699 -18.441 37.231 1.00 44.34  ? 79   VAL A CG2 1 
ATOM   577  N N   . PHE A 1 80  ? 31.389 -19.308 36.247 1.00 47.60  ? 80   PHE A N   1 
ATOM   578  C CA  . PHE A 1 80  ? 32.701 -19.899 36.513 1.00 47.60  ? 80   PHE A CA  1 
ATOM   579  C C   . PHE A 1 80  ? 33.472 -19.089 37.527 1.00 47.60  ? 80   PHE A C   1 
ATOM   580  O O   . PHE A 1 80  ? 33.149 -17.929 37.763 1.00 47.60  ? 80   PHE A O   1 
ATOM   581  C CB  . PHE A 1 80  ? 33.560 -19.930 35.254 1.00 34.88  ? 80   PHE A CB  1 
ATOM   582  C CG  . PHE A 1 80  ? 33.352 -21.133 34.393 1.00 34.88  ? 80   PHE A CG  1 
ATOM   583  C CD1 . PHE A 1 80  ? 32.747 -21.014 33.141 1.00 34.88  ? 80   PHE A CD1 1 
ATOM   584  C CD2 . PHE A 1 80  ? 33.834 -22.377 34.793 1.00 34.88  ? 80   PHE A CD2 1 
ATOM   585  C CE1 . PHE A 1 80  ? 32.631 -22.114 32.299 1.00 34.88  ? 80   PHE A CE1 1 
ATOM   586  C CE2 . PHE A 1 80  ? 33.723 -23.482 33.956 1.00 34.88  ? 80   PHE A CE2 1 
ATOM   587  C CZ  . PHE A 1 80  ? 33.118 -23.343 32.699 1.00 34.88  ? 80   PHE A CZ  1 
ATOM   588  N N   . GLU A 1 81  ? 34.502 -19.703 38.110 1.00 43.68  ? 81   GLU A N   1 
ATOM   589  C CA  . GLU A 1 81  ? 35.359 -19.009 39.055 1.00 43.68  ? 81   GLU A CA  1 
ATOM   590  C C   . GLU A 1 81  ? 36.138 -18.083 38.144 1.00 43.68  ? 81   GLU A C   1 
ATOM   591  O O   . GLU A 1 81  ? 36.140 -18.270 36.925 1.00 43.68  ? 81   GLU A O   1 
ATOM   592  C CB  . GLU A 1 81  ? 36.324 -19.969 39.749 1.00 54.99  ? 81   GLU A CB  1 
ATOM   593  C CG  . GLU A 1 81  ? 37.451 -20.464 38.871 1.00 54.99  ? 81   GLU A CG  1 
ATOM   594  C CD  . GLU A 1 81  ? 38.536 -21.177 39.660 1.00 54.99  ? 81   GLU A CD  1 
ATOM   595  O OE1 . GLU A 1 81  ? 39.298 -20.498 40.380 1.00 54.99  ? 81   GLU A OE1 1 
ATOM   596  O OE2 . GLU A 1 81  ? 38.627 -22.419 39.565 1.00 54.99  ? 81   GLU A OE2 1 
ATOM   597  N N   . PHE A 1 82  ? 36.807 -17.100 38.729 1.00 39.74  ? 82   PHE A N   1 
ATOM   598  C CA  . PHE A 1 82  ? 37.560 -16.122 37.960 1.00 39.74  ? 82   PHE A CA  1 
ATOM   599  C C   . PHE A 1 82  ? 39.073 -16.243 38.092 1.00 39.74  ? 82   PHE A C   1 
ATOM   600  O O   . PHE A 1 82  ? 39.610 -16.401 39.190 1.00 39.74  ? 82   PHE A O   1 
ATOM   601  C CB  . PHE A 1 82  ? 37.121 -14.711 38.377 1.00 59.38  ? 82   PHE A CB  1 
ATOM   602  C CG  . PHE A 1 82  ? 37.843 -13.613 37.656 1.00 59.38  ? 82   PHE A CG  1 
ATOM   603  C CD1 . PHE A 1 82  ? 39.065 -13.143 38.119 1.00 59.38  ? 82   PHE A CD1 1 
ATOM   604  C CD2 . PHE A 1 82  ? 37.307 -13.063 36.497 1.00 59.38  ? 82   PHE A CD2 1 
ATOM   605  C CE1 . PHE A 1 82  ? 39.748 -12.134 37.434 1.00 59.38  ? 82   PHE A CE1 1 
ATOM   606  C CE2 . PHE A 1 82  ? 37.974 -12.060 35.802 1.00 59.38  ? 82   PHE A CE2 1 
ATOM   607  C CZ  . PHE A 1 82  ? 39.200 -11.591 36.272 1.00 59.38  ? 82   PHE A CZ  1 
ATOM   608  N N   . CYS A 1 83  ? 39.750 -16.158 36.950 1.00 61.38  ? 83   CYS A N   1 
ATOM   609  C CA  . CYS A 1 83  ? 41.207 -16.212 36.895 1.00 61.38  ? 83   CYS A CA  1 
ATOM   610  C C   . CYS A 1 83  ? 41.736 -14.942 36.241 1.00 61.38  ? 83   CYS A C   1 
ATOM   611  O O   . CYS A 1 83  ? 41.197 -14.438 35.252 1.00 61.38  ? 83   CYS A O   1 
ATOM   612  C CB  . CYS A 1 83  ? 41.675 -17.458 36.146 1.00 47.18  ? 83   CYS A CB  1 
ATOM   613  S SG  . CYS A 1 83  ? 41.306 -18.947 37.085 1.00 47.18  ? 83   CYS A SG  1 
ATOM   614  N N   . ASP A 1 84  ? 42.804 -14.425 36.819 1.00 47.54  ? 84   ASP A N   1 
ATOM   615  C CA  . ASP A 1 84  ? 43.386 -13.191 36.354 1.00 47.54  ? 84   ASP A CA  1 
ATOM   616  C C   . ASP A 1 84  ? 43.662 -13.166 34.857 1.00 47.54  ? 84   ASP A C   1 
ATOM   617  O O   . ASP A 1 84  ? 43.308 -12.206 34.188 1.00 47.54  ? 84   ASP A O   1 
ATOM   618  C CB  . ASP A 1 84  ? 44.623 -12.899 37.207 1.00 55.80  ? 84   ASP A CB  1 
ATOM   619  C CG  . ASP A 1 84  ? 44.300 -12.938 38.706 1.00 55.80  ? 84   ASP A CG  1 
ATOM   620  O OD1 . ASP A 1 84  ? 43.440 -12.150 39.153 1.00 55.80  ? 84   ASP A OD1 1 
ATOM   621  O OD2 . ASP A 1 84  ? 44.884 -13.770 39.436 1.00 55.80  ? 84   ASP A OD2 1 
ATOM   622  N N   . GLN A 1 85  ? 44.247 -14.219 34.305 1.00 53.96  ? 85   GLN A N   1 
ATOM   623  C CA  . GLN A 1 85  ? 44.503 -14.213 32.873 1.00 53.96  ? 85   GLN A CA  1 
ATOM   624  C C   . GLN A 1 85  ? 44.842 -15.591 32.329 1.00 53.96  ? 85   GLN A C   1 
ATOM   625  O O   . GLN A 1 85  ? 45.170 -16.496 33.094 1.00 53.96  ? 85   GLN A O   1 
ATOM   626  C CB  . GLN A 1 85  ? 45.639 -13.237 32.552 1.00 57.70  ? 85   GLN A CB  1 
ATOM   627  C CG  . GLN A 1 85  ? 47.018 -13.695 33.013 1.00 57.70  ? 85   GLN A CG  1 
ATOM   628  C CD  . GLN A 1 85  ? 48.090 -12.630 32.803 1.00 57.70  ? 85   GLN A CD  1 
ATOM   629  O OE1 . GLN A 1 85  ? 48.110 -11.948 31.774 1.00 57.70  ? 85   GLN A OE1 1 
ATOM   630  N NE2 . GLN A 1 85  ? 48.994 -12.498 33.774 1.00 57.70  ? 85   GLN A NE2 1 
ATOM   631  N N   . ASP A 1 86  ? 44.744 -15.746 31.006 1.00 45.40  ? 86   ASP A N   1 
ATOM   632  C CA  . ASP A 1 86  ? 45.071 -17.011 30.355 1.00 45.40  ? 86   ASP A CA  1 
ATOM   633  C C   . ASP A 1 86  ? 46.579 -17.033 30.085 1.00 45.40  ? 86   ASP A C   1 
ATOM   634  O O   . ASP A 1 86  ? 47.215 -15.984 29.956 1.00 45.40  ? 86   ASP A O   1 
ATOM   635  C CB  . ASP A 1 86  ? 44.273 -17.187 29.047 1.00 60.28  ? 86   ASP A CB  1 
ATOM   636  C CG  . ASP A 1 86  ? 44.703 -16.226 27.940 1.00 60.28  ? 86   ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 86  ? 45.903 -16.171 27.602 1.00 60.28  ? 86   ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 86  ? 43.831 -15.536 27.381 1.00 60.28  ? 86   ASP A OD2 1 
ATOM   639  N N   . LEU A 1 87  ? 47.151 -18.227 30.002 1.00 35.74  ? 87   LEU A N   1 
ATOM   640  C CA  . LEU A 1 87  ? 48.586 -18.358 29.789 1.00 35.74  ? 87   LEU A CA  1 
ATOM   641  C C   . LEU A 1 87  ? 49.097 -17.646 28.553 1.00 35.74  ? 87   LEU A C   1 
ATOM   642  O O   . LEU A 1 87  ? 50.258 -17.208 28.507 1.00 35.74  ? 87   LEU A O   1 
ATOM   643  C CB  . LEU A 1 87  ? 48.976 -19.831 29.712 1.00 34.67  ? 87   LEU A CB  1 
ATOM   644  C CG  . LEU A 1 87  ? 50.467 -20.076 29.477 1.00 34.67  ? 87   LEU A CG  1 
ATOM   645  C CD1 . LEU A 1 87  ? 51.286 -19.511 30.621 1.00 34.67  ? 87   LEU A CD1 1 
ATOM   646  C CD2 . LEU A 1 87  ? 50.694 -21.576 29.344 1.00 34.67  ? 87   LEU A CD2 1 
ATOM   647  N N   . LYS A 1 88  ? 48.246 -17.543 27.540 1.00 44.92  ? 88   LYS A N   1 
ATOM   648  C CA  . LYS A 1 88  ? 48.649 -16.874 26.313 1.00 44.92  ? 88   LYS A CA  1 
ATOM   649  C C   . LYS A 1 88  ? 48.945 -15.406 26.638 1.00 44.92  ? 88   LYS A C   1 
ATOM   650  O O   . LYS A 1 88  ? 49.987 -14.869 26.263 1.00 44.92  ? 88   LYS A O   1 
ATOM   651  C CB  . LYS A 1 88  ? 47.540 -16.967 25.270 1.00 60.93  ? 88   LYS A CB  1 
ATOM   652  C CG  . LYS A 1 88  ? 47.934 -16.484 23.890 1.00 60.93  ? 88   LYS A CG  1 
ATOM   653  C CD  . LYS A 1 88  ? 48.737 -17.526 23.145 1.00 60.93  ? 88   LYS A CD  1 
ATOM   654  C CE  . LYS A 1 88  ? 48.706 -17.234 21.658 1.00 60.93  ? 88   LYS A CE  1 
ATOM   655  N NZ  . LYS A 1 88  ? 48.925 -18.473 20.874 1.00 60.93  ? 88   LYS A NZ  1 
ATOM   656  N N   . LYS A 1 89  ? 48.031 -14.758 27.347 1.00 45.51  ? 89   LYS A N   1 
ATOM   657  C CA  . LYS A 1 89  ? 48.238 -13.365 27.711 1.00 45.51  ? 89   LYS A CA  1 
ATOM   658  C C   . LYS A 1 89  ? 49.434 -13.269 28.662 1.00 45.51  ? 89   LYS A C   1 
ATOM   659  O O   . LYS A 1 89  ? 50.198 -12.310 28.610 1.00 45.51  ? 89   LYS A O   1 
ATOM   660  C CB  . LYS A 1 89  ? 46.981 -12.799 28.371 1.00 50.84  ? 89   LYS A CB  1 
ATOM   661  C CG  . LYS A 1 89  ? 46.972 -11.290 28.483 1.00 50.84  ? 89   LYS A CG  1 
ATOM   662  C CD  . LYS A 1 89  ? 45.656 -10.807 29.060 1.00 50.84  ? 89   LYS A CD  1 
ATOM   663  C CE  . LYS A 1 89  ? 45.593 -9.287  29.091 1.00 50.84  ? 89   LYS A CE  1 
ATOM   664  N NZ  . LYS A 1 89  ? 44.335 -8.804  29.731 1.00 50.84  ? 89   LYS A NZ  1 
ATOM   665  N N   . TYR A 1 90  ? 49.590 -14.268 29.529 1.00 42.98  ? 90   TYR A N   1 
ATOM   666  C CA  . TYR A 1 90  ? 50.714 -14.290 30.458 1.00 42.98  ? 90   TYR A CA  1 
ATOM   667  C C   . TYR A 1 90  ? 51.990 -14.155 29.634 1.00 42.98  ? 90   TYR A C   1 
ATOM   668  O O   . TYR A 1 90  ? 52.836 -13.316 29.935 1.00 42.98  ? 90   TYR A O   1 
ATOM   669  C CB  . TYR A 1 90  ? 50.764 -15.610 31.218 1.00 51.41  ? 90   TYR A CB  1 
ATOM   670  C CG  . TYR A 1 90  ? 51.868 -15.677 32.247 1.00 51.41  ? 90   TYR A CG  1 
ATOM   671  C CD1 . TYR A 1 90  ? 51.616 -15.382 33.586 1.00 51.41  ? 90   TYR A CD1 1 
ATOM   672  C CD2 . TYR A 1 90  ? 53.167 -16.028 31.886 1.00 51.41  ? 90   TYR A CD2 1 
ATOM   673  C CE1 . TYR A 1 90  ? 52.625 -15.438 34.536 1.00 51.41  ? 90   TYR A CE1 1 
ATOM   674  C CE2 . TYR A 1 90  ? 54.190 -16.087 32.832 1.00 51.41  ? 90   TYR A CE2 1 
ATOM   675  C CZ  . TYR A 1 90  ? 53.910 -15.793 34.154 1.00 51.41  ? 90   TYR A CZ  1 
ATOM   676  O OH  . TYR A 1 90  ? 54.902 -15.875 35.111 1.00 51.41  ? 90   TYR A OH  1 
ATOM   677  N N   . PHE A 1 91  ? 52.120 -14.982 28.594 1.00 41.24  ? 91   PHE A N   1 
ATOM   678  C CA  . PHE A 1 91  ? 53.295 -14.940 27.733 1.00 41.24  ? 91   PHE A CA  1 
ATOM   679  C C   . PHE A 1 91  ? 53.566 -13.528 27.214 1.00 41.24  ? 91   PHE A C   1 
ATOM   680  O O   . PHE A 1 91  ? 54.711 -13.166 26.964 1.00 41.24  ? 91   PHE A O   1 
ATOM   681  C CB  . PHE A 1 91  ? 53.138 -15.914 26.552 1.00 46.89  ? 91   PHE A CB  1 
ATOM   682  C CG  . PHE A 1 91  ? 53.462 -17.354 26.888 1.00 46.89  ? 91   PHE A CG  1 
ATOM   683  C CD1 . PHE A 1 91  ? 53.007 -18.388 26.074 1.00 46.89  ? 91   PHE A CD1 1 
ATOM   684  C CD2 . PHE A 1 91  ? 54.234 -17.681 28.000 1.00 46.89  ? 91   PHE A CD2 1 
ATOM   685  C CE1 . PHE A 1 91  ? 53.316 -19.724 26.363 1.00 46.89  ? 91   PHE A CE1 1 
ATOM   686  C CE2 . PHE A 1 91  ? 54.547 -19.021 28.298 1.00 46.89  ? 91   PHE A CE2 1 
ATOM   687  C CZ  . PHE A 1 91  ? 54.087 -20.038 27.476 1.00 46.89  ? 91   PHE A CZ  1 
ATOM   688  N N   . ASP A 1 92  ? 52.515 -12.732 27.045 1.00 59.97  ? 92   ASP A N   1 
ATOM   689  C CA  . ASP A 1 92  ? 52.673 -11.351 26.582 1.00 59.97  ? 92   ASP A CA  1 
ATOM   690  C C   . ASP A 1 92  ? 53.021 -10.436 27.762 1.00 59.97  ? 92   ASP A C   1 
ATOM   691  O O   . ASP A 1 92  ? 53.762 -9.466  27.599 1.00 59.97  ? 92   ASP A O   1 
ATOM   692  C CB  . ASP A 1 92  ? 51.386 -10.854 25.918 1.00 56.59  ? 92   ASP A CB  1 
ATOM   693  C CG  . ASP A 1 92  ? 51.357 -11.101 24.421 1.00 56.59  ? 92   ASP A CG  1 
ATOM   694  O OD1 . ASP A 1 92  ? 50.257 -11.020 23.837 1.00 56.59  ? 92   ASP A OD1 1 
ATOM   695  O OD2 . ASP A 1 92  ? 52.418 -11.361 23.818 1.00 56.59  ? 92   ASP A OD2 1 
ATOM   696  N N   . SER A 1 93  ? 52.477 -10.745 28.943 1.00 77.42  ? 93   SER A N   1 
ATOM   697  C CA  . SER A 1 93  ? 52.738 -9.961  30.148 1.00 77.42  ? 93   SER A CA  1 
ATOM   698  C C   . SER A 1 93  ? 54.240 -9.813  30.236 1.00 77.42  ? 93   SER A C   1 
ATOM   699  O O   . SER A 1 93  ? 54.780 -8.736  29.996 1.00 77.42  ? 93   SER A O   1 
ATOM   700  C CB  . SER A 1 93  ? 52.210 -10.683 31.388 1.00 77.96  ? 93   SER A CB  1 
ATOM   701  O OG  . SER A 1 93  ? 50.806 -10.850 31.320 1.00 77.96  ? 93   SER A OG  1 
ATOM   702  N N   . CYS A 1 94  ? 54.918 -10.896 30.593 1.00 95.86  ? 94   CYS A N   1 
ATOM   703  C CA  . CYS A 1 94  ? 56.373 -10.877 30.632 1.00 95.86  ? 94   CYS A CA  1 
ATOM   704  C C   . CYS A 1 94  ? 56.670 -11.046 29.154 1.00 95.86  ? 94   CYS A C   1 
ATOM   705  O O   . CYS A 1 94  ? 55.754 -10.951 28.336 1.00 95.86  ? 94   CYS A O   1 
ATOM   706  C CB  . CYS A 1 94  ? 56.922 -12.068 31.420 1.00 74.67  ? 94   CYS A CB  1 
ATOM   707  S SG  . CYS A 1 94  ? 56.359 -13.676 30.826 1.00 74.67  ? 94   CYS A SG  1 
ATOM   708  N N   . ASN A 1 95  ? 57.914 -11.304 28.781 1.00 101.25 ? 95   ASN A N   1 
ATOM   709  C CA  . ASN A 1 95  ? 58.183 -11.459 27.357 1.00 101.25 ? 95   ASN A CA  1 
ATOM   710  C C   . ASN A 1 95  ? 59.399 -12.320 27.092 1.00 101.25 ? 95   ASN A C   1 
ATOM   711  O O   . ASN A 1 95  ? 60.342 -12.322 27.884 1.00 101.25 ? 95   ASN A O   1 
ATOM   712  C CB  . ASN A 1 95  ? 58.383 -10.092 26.712 1.00 82.66  ? 95   ASN A CB  1 
ATOM   713  C CG  . ASN A 1 95  ? 59.686 -9.451  27.105 1.00 82.66  ? 95   ASN A CG  1 
ATOM   714  O OD1 . ASN A 1 95  ? 59.932 -9.187  28.275 1.00 82.66  ? 95   ASN A OD1 1 
ATOM   715  N ND2 . ASN A 1 95  ? 60.542 -9.203  26.117 1.00 82.66  ? 95   ASN A ND2 1 
ATOM   716  N N   . GLY A 1 96  ? 59.366 -13.059 25.987 1.00 158.62 ? 96   GLY A N   1 
ATOM   717  C CA  . GLY A 1 96  ? 60.479 -13.912 25.607 1.00 158.62 ? 96   GLY A CA  1 
ATOM   718  C C   . GLY A 1 96  ? 61.158 -14.761 26.670 1.00 158.62 ? 96   GLY A C   1 
ATOM   719  O O   . GLY A 1 96  ? 62.115 -15.469 26.347 1.00 158.62 ? 96   GLY A O   1 
ATOM   720  N N   . ASP A 1 97  ? 60.702 -14.707 27.923 1.00 105.85 ? 97   ASP A N   1 
ATOM   721  C CA  . ASP A 1 97  ? 61.341 -15.519 28.960 1.00 105.85 ? 97   ASP A CA  1 
ATOM   722  C C   . ASP A 1 97  ? 60.642 -15.639 30.311 1.00 105.85 ? 97   ASP A C   1 
ATOM   723  O O   . ASP A 1 97  ? 60.048 -14.688 30.815 1.00 105.85 ? 97   ASP A O   1 
ATOM   724  C CB  . ASP A 1 97  ? 62.769 -15.035 29.211 1.00 123.81 ? 97   ASP A CB  1 
ATOM   725  C CG  . ASP A 1 97  ? 63.636 -16.103 29.852 1.00 123.81 ? 97   ASP A CG  1 
ATOM   726  O OD1 . ASP A 1 97  ? 64.759 -15.776 30.294 1.00 123.81 ? 97   ASP A OD1 1 
ATOM   727  O OD2 . ASP A 1 97  ? 63.200 -17.276 29.907 1.00 123.81 ? 97   ASP A OD2 1 
ATOM   728  N N   . LEU A 1 98  ? 60.749 -16.834 30.887 1.00 42.97  ? 98   LEU A N   1 
ATOM   729  C CA  . LEU A 1 98  ? 60.174 -17.165 32.183 1.00 42.97  ? 98   LEU A CA  1 
ATOM   730  C C   . LEU A 1 98  ? 61.242 -17.868 32.998 1.00 42.97  ? 98   LEU A C   1 
ATOM   731  O O   . LEU A 1 98  ? 61.946 -18.748 32.493 1.00 42.97  ? 98   LEU A O   1 
ATOM   732  C CB  . LEU A 1 98  ? 58.988 -18.127 32.051 1.00 59.49  ? 98   LEU A CB  1 
ATOM   733  C CG  . LEU A 1 98  ? 57.717 -17.729 31.307 1.00 59.49  ? 98   LEU A CG  1 
ATOM   734  C CD1 . LEU A 1 98  ? 58.005 -17.493 29.830 1.00 59.49  ? 98   LEU A CD1 1 
ATOM   735  C CD2 . LEU A 1 98  ? 56.701 -18.847 31.475 1.00 59.49  ? 98   LEU A CD2 1 
ATOM   736  N N   . ASP A 1 99  ? 61.358 -17.470 34.258 1.00 65.67  ? 99   ASP A N   1 
ATOM   737  C CA  . ASP A 1 99  ? 62.310 -18.077 35.173 1.00 65.67  ? 99   ASP A CA  1 
ATOM   738  C C   . ASP A 1 99  ? 62.090 -19.591 35.016 1.00 65.67  ? 99   ASP A C   1 
ATOM   739  O O   . ASP A 1 99  ? 60.950 -20.068 35.085 1.00 65.67  ? 99   ASP A O   1 
ATOM   740  C CB  . ASP A 1 99  ? 61.983 -17.618 36.607 1.00 80.32  ? 99   ASP A CB  1 
ATOM   741  C CG  . ASP A 1 99  ? 62.968 -18.139 37.649 1.00 80.32  ? 99   ASP A CG  1 
ATOM   742  O OD1 . ASP A 1 99  ? 62.740 -17.883 38.854 1.00 80.32  ? 99   ASP A OD1 1 
ATOM   743  O OD2 . ASP A 1 99  ? 63.964 -18.796 37.276 1.00 80.32  ? 99   ASP A OD2 1 
ATOM   744  N N   . PRO A 1 100 ? 63.169 -20.359 34.775 1.00 66.97  ? 100  PRO A N   1 
ATOM   745  C CA  . PRO A 1 100 ? 63.081 -21.816 34.608 1.00 66.97  ? 100  PRO A CA  1 
ATOM   746  C C   . PRO A 1 100 ? 62.235 -22.482 35.693 1.00 66.97  ? 100  PRO A C   1 
ATOM   747  O O   . PRO A 1 100 ? 61.735 -23.599 35.517 1.00 66.97  ? 100  PRO A O   1 
ATOM   748  C CB  . PRO A 1 100 ? 64.538 -22.249 34.671 1.00 49.34  ? 100  PRO A CB  1 
ATOM   749  C CG  . PRO A 1 100 ? 65.226 -21.124 33.972 1.00 49.34  ? 100  PRO A CG  1 
ATOM   750  C CD  . PRO A 1 100 ? 64.557 -19.898 34.588 1.00 49.34  ? 100  PRO A CD  1 
ATOM   751  N N   . GLU A 1 101 ? 62.083 -21.779 36.813 1.00 67.44  ? 101  GLU A N   1 
ATOM   752  C CA  . GLU A 1 101 ? 61.303 -22.266 37.944 1.00 67.44  ? 101  GLU A CA  1 
ATOM   753  C C   . GLU A 1 101 ? 59.799 -22.142 37.672 1.00 67.44  ? 101  GLU A C   1 
ATOM   754  O O   . GLU A 1 101 ? 59.010 -23.010 38.061 1.00 67.44  ? 101  GLU A O   1 
ATOM   755  C CB  . GLU A 1 101 ? 61.676 -21.479 39.201 1.00 108.33 ? 101  GLU A CB  1 
ATOM   756  C CG  . GLU A 1 101 ? 61.906 -22.331 40.448 1.00 108.33 ? 101  GLU A CG  1 
ATOM   757  C CD  . GLU A 1 101 ? 63.102 -23.265 40.321 1.00 108.33 ? 101  GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 101 ? 62.960 -24.357 39.726 1.00 108.33 ? 101  GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 101 ? 64.192 -22.901 40.815 1.00 108.33 ? 101  GLU A OE2 1 
ATOM   760  N N   . ILE A 1 102 ? 59.397 -21.058 37.017 1.00 48.14  ? 102  ILE A N   1 
ATOM   761  C CA  . ILE A 1 102 ? 57.987 -20.872 36.694 1.00 48.14  ? 102  ILE A CA  1 
ATOM   762  C C   . ILE A 1 102 ? 57.600 -21.968 35.707 1.00 48.14  ? 102  ILE A C   1 
ATOM   763  O O   . ILE A 1 102 ? 56.537 -22.589 35.809 1.00 48.14  ? 102  ILE A O   1 
ATOM   764  C CB  . ILE A 1 102 ? 57.751 -19.497 36.060 1.00 53.53  ? 102  ILE A CB  1 
ATOM   765  C CG1 . ILE A 1 102 ? 57.978 -18.404 37.117 1.00 53.53  ? 102  ILE A CG1 1 
ATOM   766  C CG2 . ILE A 1 102 ? 56.354 -19.422 35.480 1.00 53.53  ? 102  ILE A CG2 1 
ATOM   767  C CD1 . ILE A 1 102 ? 57.851 -16.978 36.592 1.00 53.53  ? 102  ILE A CD1 1 
ATOM   768  N N   . VAL A 1 103 ? 58.499 -22.206 34.760 1.00 39.94  ? 103  VAL A N   1 
ATOM   769  C CA  . VAL A 1 103 ? 58.307 -23.218 33.737 1.00 39.94  ? 103  VAL A CA  1 
ATOM   770  C C   . VAL A 1 103 ? 57.953 -24.536 34.404 1.00 39.94  ? 103  VAL A C   1 
ATOM   771  O O   . VAL A 1 103 ? 57.015 -25.220 33.996 1.00 39.94  ? 103  VAL A O   1 
ATOM   772  C CB  . VAL A 1 103 ? 59.598 -23.377 32.896 1.00 24.44  ? 103  VAL A CB  1 
ATOM   773  C CG1 . VAL A 1 103 ? 59.534 -24.640 32.031 1.00 24.44  ? 103  VAL A CG1 1 
ATOM   774  C CG2 . VAL A 1 103 ? 59.792 -22.118 32.008 1.00 24.44  ? 103  VAL A CG2 1 
ATOM   775  N N   . LYS A 1 104 ? 58.702 -24.877 35.444 1.00 42.46  ? 104  LYS A N   1 
ATOM   776  C CA  . LYS A 1 104 ? 58.475 -26.112 36.169 1.00 42.46  ? 104  LYS A CA  1 
ATOM   777  C C   . LYS A 1 104 ? 57.105 -26.080 36.845 1.00 42.46  ? 104  LYS A C   1 
ATOM   778  O O   . LYS A 1 104 ? 56.287 -26.990 36.674 1.00 42.46  ? 104  LYS A O   1 
ATOM   779  C CB  . LYS A 1 104 ? 59.574 -26.302 37.219 1.00 53.04  ? 104  LYS A CB  1 
ATOM   780  C CG  . LYS A 1 104 ? 59.918 -27.754 37.543 1.00 53.04  ? 104  LYS A CG  1 
ATOM   781  C CD  . LYS A 1 104 ? 61.041 -27.818 38.568 1.00 53.04  ? 104  LYS A CD  1 
ATOM   782  C CE  . LYS A 1 104 ? 62.163 -28.746 38.114 1.00 53.04  ? 104  LYS A CE  1 
ATOM   783  N NZ  . LYS A 1 104 ? 63.285 -28.862 39.105 1.00 53.04  ? 104  LYS A NZ  1 
ATOM   784  N N   . SER A 1 105 ? 56.846 -25.024 37.603 1.00 41.06  ? 105  SER A N   1 
ATOM   785  C CA  . SER A 1 105 ? 55.579 -24.922 38.313 1.00 41.06  ? 105  SER A CA  1 
ATOM   786  C C   . SER A 1 105 ? 54.386 -25.102 37.380 1.00 41.06  ? 105  SER A C   1 
ATOM   787  O O   . SER A 1 105 ? 53.501 -25.924 37.634 1.00 41.06  ? 105  SER A O   1 
ATOM   788  C CB  . SER A 1 105 ? 55.475 -23.575 39.028 1.00 47.47  ? 105  SER A CB  1 
ATOM   789  O OG  . SER A 1 105 ? 54.198 -23.414 39.630 1.00 47.47  ? 105  SER A OG  1 
ATOM   790  N N   . PHE A 1 106 ? 54.369 -24.333 36.299 1.00 36.75  ? 106  PHE A N   1 
ATOM   791  C CA  . PHE A 1 106 ? 53.277 -24.406 35.347 1.00 36.75  ? 106  PHE A CA  1 
ATOM   792  C C   . PHE A 1 106 ? 53.088 -25.805 34.795 1.00 36.75  ? 106  PHE A C   1 
ATOM   793  O O   . PHE A 1 106 ? 51.963 -26.308 34.770 1.00 36.75  ? 106  PHE A O   1 
ATOM   794  C CB  . PHE A 1 106 ? 53.498 -23.400 34.211 1.00 39.20  ? 106  PHE A CB  1 
ATOM   795  C CG  . PHE A 1 106 ? 53.237 -21.974 34.612 1.00 39.20  ? 106  PHE A CG  1 
ATOM   796  C CD1 . PHE A 1 106 ? 52.656 -21.681 35.850 1.00 39.20  ? 106  PHE A CD1 1 
ATOM   797  C CD2 . PHE A 1 106 ? 53.525 -20.925 33.740 1.00 39.20  ? 106  PHE A CD2 1 
ATOM   798  C CE1 . PHE A 1 106 ? 52.360 -20.363 36.214 1.00 39.20  ? 106  PHE A CE1 1 
ATOM   799  C CE2 . PHE A 1 106 ? 53.234 -19.603 34.089 1.00 39.20  ? 106  PHE A CE2 1 
ATOM   800  C CZ  . PHE A 1 106 ? 52.649 -19.324 35.331 1.00 39.20  ? 106  PHE A CZ  1 
ATOM   801  N N   . LEU A 1 107 ? 54.178 -26.438 34.368 1.00 45.30  ? 107  LEU A N   1 
ATOM   802  C CA  . LEU A 1 107 ? 54.080 -27.784 33.824 1.00 45.30  ? 107  LEU A CA  1 
ATOM   803  C C   . LEU A 1 107 ? 53.576 -28.737 34.889 1.00 45.30  ? 107  LEU A C   1 
ATOM   804  O O   . LEU A 1 107 ? 52.740 -29.612 34.614 1.00 45.30  ? 107  LEU A O   1 
ATOM   805  C CB  . LEU A 1 107 ? 55.428 -28.289 33.304 1.00 39.35  ? 107  LEU A CB  1 
ATOM   806  C CG  . LEU A 1 107 ? 55.288 -29.625 32.557 1.00 39.35  ? 107  LEU A CG  1 
ATOM   807  C CD1 . LEU A 1 107 ? 54.406 -29.388 31.355 1.00 39.35  ? 107  LEU A CD1 1 
ATOM   808  C CD2 . LEU A 1 107 ? 56.647 -30.177 32.110 1.00 39.35  ? 107  LEU A CD2 1 
ATOM   809  N N   . PHE A 1 108 ? 54.087 -28.569 36.105 1.00 40.89  ? 108  PHE A N   1 
ATOM   810  C CA  . PHE A 1 108 ? 53.678 -29.423 37.206 1.00 40.89  ? 108  PHE A CA  1 
ATOM   811  C C   . PHE A 1 108 ? 52.160 -29.372 37.371 1.00 40.89  ? 108  PHE A C   1 
ATOM   812  O O   . PHE A 1 108 ? 51.483 -30.392 37.266 1.00 40.89  ? 108  PHE A O   1 
ATOM   813  C CB  . PHE A 1 108 ? 54.348 -28.976 38.514 1.00 35.36  ? 108  PHE A CB  1 
ATOM   814  C CG  . PHE A 1 108 ? 54.055 -29.880 39.689 1.00 35.36  ? 108  PHE A CG  1 
ATOM   815  C CD1 . PHE A 1 108 ? 54.692 -31.105 39.817 1.00 35.36  ? 108  PHE A CD1 1 
ATOM   816  C CD2 . PHE A 1 108 ? 53.104 -29.520 40.645 1.00 35.36  ? 108  PHE A CD2 1 
ATOM   817  C CE1 . PHE A 1 108 ? 54.380 -31.966 40.885 1.00 35.36  ? 108  PHE A CE1 1 
ATOM   818  C CE2 . PHE A 1 108 ? 52.792 -30.373 41.708 1.00 35.36  ? 108  PHE A CE2 1 
ATOM   819  C CZ  . PHE A 1 108 ? 53.435 -31.597 41.822 1.00 35.36  ? 108  PHE A CZ  1 
ATOM   820  N N   . GLN A 1 109 ? 51.628 -28.181 37.616 1.00 40.65  ? 109  GLN A N   1 
ATOM   821  C CA  . GLN A 1 109 ? 50.195 -28.027 37.820 1.00 40.65  ? 109  GLN A CA  1 
ATOM   822  C C   . GLN A 1 109 ? 49.377 -28.493 36.623 1.00 40.65  ? 109  GLN A C   1 
ATOM   823  O O   . GLN A 1 109 ? 48.320 -29.114 36.793 1.00 40.65  ? 109  GLN A O   1 
ATOM   824  C CB  . GLN A 1 109 ? 49.861 -26.576 38.157 1.00 33.87  ? 109  GLN A CB  1 
ATOM   825  C CG  . GLN A 1 109 ? 50.421 -26.113 39.503 1.00 33.87  ? 109  GLN A CG  1 
ATOM   826  C CD  . GLN A 1 109 ? 49.988 -24.702 39.845 1.00 33.87  ? 109  GLN A CD  1 
ATOM   827  O OE1 . GLN A 1 109 ? 48.849 -24.468 40.270 1.00 33.87  ? 109  GLN A OE1 1 
ATOM   828  N NE2 . GLN A 1 109 ? 50.891 -23.743 39.636 1.00 33.87  ? 109  GLN A NE2 1 
ATOM   829  N N   . LEU A 1 110 ? 49.854 -28.193 35.415 1.00 43.63  ? 110  LEU A N   1 
ATOM   830  C CA  . LEU A 1 110 ? 49.145 -28.637 34.229 1.00 43.63  ? 110  LEU A CA  1 
ATOM   831  C C   . LEU A 1 110 ? 49.135 -30.151 34.286 1.00 43.63  ? 110  LEU A C   1 
ATOM   832  O O   . LEU A 1 110 ? 48.073 -30.765 34.261 1.00 43.63  ? 110  LEU A O   1 
ATOM   833  C CB  . LEU A 1 110 ? 49.847 -28.184 32.956 1.00 31.69  ? 110  LEU A CB  1 
ATOM   834  C CG  . LEU A 1 110 ? 49.284 -28.837 31.688 1.00 31.69  ? 110  LEU A CG  1 
ATOM   835  C CD1 . LEU A 1 110 ? 47.889 -28.329 31.427 1.00 31.69  ? 110  LEU A CD1 1 
ATOM   836  C CD2 . LEU A 1 110 ? 50.176 -28.522 30.520 1.00 31.69  ? 110  LEU A CD2 1 
ATOM   837  N N   . LEU A 1 111 ? 50.322 -30.750 34.381 1.00 41.21  ? 111  LEU A N   1 
ATOM   838  C CA  . LEU A 1 111 ? 50.432 -32.200 34.438 1.00 41.21  ? 111  LEU A CA  1 
ATOM   839  C C   . LEU A 1 111 ? 49.604 -32.782 35.562 1.00 41.21  ? 111  LEU A C   1 
ATOM   840  O O   . LEU A 1 111 ? 49.129 -33.908 35.459 1.00 41.21  ? 111  LEU A O   1 
ATOM   841  C CB  . LEU A 1 111 ? 51.881 -32.632 34.619 1.00 22.33  ? 111  LEU A CB  1 
ATOM   842  C CG  . LEU A 1 111 ? 52.766 -32.601 33.376 1.00 22.33  ? 111  LEU A CG  1 
ATOM   843  C CD1 . LEU A 1 111 ? 54.169 -33.128 33.744 1.00 22.33  ? 111  LEU A CD1 1 
ATOM   844  C CD2 . LEU A 1 111 ? 52.131 -33.437 32.258 1.00 22.33  ? 111  LEU A CD2 1 
ATOM   845  N N   . LYS A 1 112 ? 49.422 -32.028 36.641 1.00 42.77  ? 112  LYS A N   1 
ATOM   846  C CA  . LYS A 1 112 ? 48.633 -32.553 37.741 1.00 42.77  ? 112  LYS A CA  1 
ATOM   847  C C   . LYS A 1 112 ? 47.159 -32.424 37.408 1.00 42.77  ? 112  LYS A C   1 
ATOM   848  O O   . LYS A 1 112 ? 46.415 -33.399 37.492 1.00 42.77  ? 112  LYS A O   1 
ATOM   849  C CB  . LYS A 1 112 ? 48.957 -31.846 39.056 1.00 72.68  ? 112  LYS A CB  1 
ATOM   850  C CG  . LYS A 1 112 ? 48.513 -32.655 40.258 1.00 72.68  ? 112  LYS A CG  1 
ATOM   851  C CD  . LYS A 1 112 ? 49.068 -32.124 41.566 1.00 72.68  ? 112  LYS A CD  1 
ATOM   852  C CE  . LYS A 1 112 ? 48.598 -32.986 42.746 1.00 72.68  ? 112  LYS A CE  1 
ATOM   853  N NZ  . LYS A 1 112 ? 49.061 -32.477 44.072 1.00 72.68  ? 112  LYS A NZ  1 
ATOM   854  N N   . GLY A 1 113 ? 46.732 -31.236 37.010 1.00 41.20  ? 113  GLY A N   1 
ATOM   855  C CA  . GLY A 1 113 ? 45.337 -31.068 36.660 1.00 41.20  ? 113  GLY A CA  1 
ATOM   856  C C   . GLY A 1 113 ? 44.934 -31.978 35.508 1.00 41.20  ? 113  GLY A C   1 
ATOM   857  O O   . GLY A 1 113 ? 43.778 -32.402 35.395 1.00 41.20  ? 113  GLY A O   1 
ATOM   858  N N   . LEU A 1 114 ? 45.891 -32.291 34.645 1.00 39.85  ? 114  LEU A N   1 
ATOM   859  C CA  . LEU A 1 114 ? 45.607 -33.144 33.510 1.00 39.85  ? 114  LEU A CA  1 
ATOM   860  C C   . LEU A 1 114 ? 45.606 -34.592 33.957 1.00 39.85  ? 114  LEU A C   1 
ATOM   861  O O   . LEU A 1 114 ? 44.774 -35.393 33.503 1.00 39.85  ? 114  LEU A O   1 
ATOM   862  C CB  . LEU A 1 114 ? 46.655 -32.944 32.421 1.00 47.85  ? 114  LEU A CB  1 
ATOM   863  C CG  . LEU A 1 114 ? 46.375 -33.648 31.095 1.00 47.85  ? 114  LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 114 ? 45.034 -33.194 30.563 1.00 47.85  ? 114  LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 114 ? 47.476 -33.326 30.103 1.00 47.85  ? 114  LEU A CD2 1 
ATOM   866  N N   . GLY A 1 115 ? 46.550 -34.937 34.833 1.00 27.47  ? 115  GLY A N   1 
ATOM   867  C CA  . GLY A 1 115 ? 46.606 -36.305 35.326 1.00 27.47  ? 115  GLY A CA  1 
ATOM   868  C C   . GLY A 1 115 ? 45.283 -36.638 36.007 1.00 27.47  ? 115  GLY A C   1 
ATOM   869  O O   . GLY A 1 115 ? 44.791 -37.774 35.957 1.00 27.47  ? 115  GLY A O   1 
ATOM   870  N N   . PHE A 1 116 ? 44.685 -35.635 36.633 1.00 36.90  ? 116  PHE A N   1 
ATOM   871  C CA  . PHE A 1 116 ? 43.427 -35.864 37.312 1.00 36.90  ? 116  PHE A CA  1 
ATOM   872  C C   . PHE A 1 116 ? 42.294 -36.223 36.342 1.00 36.90  ? 116  PHE A C   1 
ATOM   873  O O   . PHE A 1 116 ? 41.536 -37.162 36.590 1.00 36.90  ? 116  PHE A O   1 
ATOM   874  C CB  . PHE A 1 116 ? 43.022 -34.633 38.114 1.00 35.98  ? 116  PHE A CB  1 
ATOM   875  C CG  . PHE A 1 116 ? 41.742 -34.816 38.868 1.00 35.98  ? 116  PHE A CG  1 
ATOM   876  C CD1 . PHE A 1 116 ? 41.718 -35.552 40.048 1.00 35.98  ? 116  PHE A CD1 1 
ATOM   877  C CD2 . PHE A 1 116 ? 40.549 -34.280 38.383 1.00 35.98  ? 116  PHE A CD2 1 
ATOM   878  C CE1 . PHE A 1 116 ? 40.518 -35.755 40.741 1.00 35.98  ? 116  PHE A CE1 1 
ATOM   879  C CE2 . PHE A 1 116 ? 39.340 -34.474 39.063 1.00 35.98  ? 116  PHE A CE2 1 
ATOM   880  C CZ  . PHE A 1 116 ? 39.325 -35.214 40.244 1.00 35.98  ? 116  PHE A CZ  1 
ATOM   881  N N   . CYS A 1 117 ? 42.175 -35.464 35.251 1.00 45.66  ? 117  CYS A N   1 
ATOM   882  C CA  . CYS A 1 117 ? 41.121 -35.697 34.268 1.00 45.66  ? 117  CYS A CA  1 
ATOM   883  C C   . CYS A 1 117 ? 41.209 -37.104 33.728 1.00 45.66  ? 117  CYS A C   1 
ATOM   884  O O   . CYS A 1 117 ? 40.204 -37.812 33.616 1.00 45.66  ? 117  CYS A O   1 
ATOM   885  C CB  . CYS A 1 117 ? 41.219 -34.695 33.110 1.00 56.03  ? 117  CYS A CB  1 
ATOM   886  S SG  . CYS A 1 117 ? 40.649 -33.029 33.505 1.00 56.03  ? 117  CYS A SG  1 
ATOM   887  N N   . HIS A 1 118 ? 42.420 -37.512 33.391 1.00 35.88  ? 118  HIS A N   1 
ATOM   888  C CA  . HIS A 1 118 ? 42.598 -38.846 32.869 1.00 35.88  ? 118  HIS A CA  1 
ATOM   889  C C   . HIS A 1 118 ? 42.129 -39.843 33.928 1.00 35.88  ? 118  HIS A C   1 
ATOM   890  O O   . HIS A 1 118 ? 41.383 -40.761 33.617 1.00 35.88  ? 118  HIS A O   1 
ATOM   891  C CB  . HIS A 1 118 ? 44.061 -39.084 32.468 1.00 36.78  ? 118  HIS A CB  1 
ATOM   892  C CG  . HIS A 1 118 ? 44.538 -38.193 31.359 1.00 36.78  ? 118  HIS A CG  1 
ATOM   893  N ND1 . HIS A 1 118 ? 43.675 -37.574 30.474 1.00 36.78  ? 118  HIS A ND1 1 
ATOM   894  C CD2 . HIS A 1 118 ? 45.788 -37.845 30.965 1.00 36.78  ? 118  HIS A CD2 1 
ATOM   895  C CE1 . HIS A 1 118 ? 44.373 -36.886 29.585 1.00 36.78  ? 118  HIS A CE1 1 
ATOM   896  N NE2 . HIS A 1 118 ? 45.657 -37.034 29.860 1.00 36.78  ? 118  HIS A NE2 1 
ATOM   897  N N   . SER A 1 119 ? 42.507 -39.649 35.186 1.00 47.62  ? 119  SER A N   1 
ATOM   898  C CA  . SER A 1 119 ? 42.074 -40.608 36.202 1.00 47.62  ? 119  SER A CA  1 
ATOM   899  C C   . SER A 1 119 ? 40.549 -40.670 36.346 1.00 47.62  ? 119  SER A C   1 
ATOM   900  O O   . SER A 1 119 ? 39.986 -41.728 36.652 1.00 47.62  ? 119  SER A O   1 
ATOM   901  C CB  . SER A 1 119 ? 42.718 -40.300 37.556 1.00 52.63  ? 119  SER A CB  1 
ATOM   902  O OG  . SER A 1 119 ? 42.276 -39.060 38.065 1.00 52.63  ? 119  SER A OG  1 
ATOM   903  N N   . ARG A 1 120 ? 39.878 -39.546 36.117 1.00 45.52  ? 120  ARG A N   1 
ATOM   904  C CA  . ARG A 1 120 ? 38.425 -39.505 36.209 1.00 45.52  ? 120  ARG A CA  1 
ATOM   905  C C   . ARG A 1 120 ? 37.799 -39.873 34.856 1.00 45.52  ? 120  ARG A C   1 
ATOM   906  O O   . ARG A 1 120 ? 36.595 -39.696 34.655 1.00 45.52  ? 120  ARG A O   1 
ATOM   907  C CB  . ARG A 1 120 ? 37.959 -38.110 36.648 1.00 59.05  ? 120  ARG A CB  1 
ATOM   908  C CG  . ARG A 1 120 ? 38.386 -37.714 38.066 1.00 59.05  ? 120  ARG A CG  1 
ATOM   909  C CD  . ARG A 1 120 ? 37.451 -38.312 39.106 1.00 59.05  ? 120  ARG A CD  1 
ATOM   910  N NE  . ARG A 1 120 ? 36.129 -37.680 39.062 1.00 59.05  ? 120  ARG A NE  1 
ATOM   911  C CZ  . ARG A 1 120 ? 35.021 -38.218 39.567 1.00 59.05  ? 120  ARG A CZ  1 
ATOM   912  N NH1 . ARG A 1 120 ? 35.070 -39.408 40.159 1.00 59.05  ? 120  ARG A NH1 1 
ATOM   913  N NH2 . ARG A 1 120 ? 33.863 -37.571 39.475 1.00 59.05  ? 120  ARG A NH2 1 
ATOM   914  N N   . ASN A 1 121 ? 38.622 -40.366 33.927 1.00 29.83  ? 121  ASN A N   1 
ATOM   915  C CA  . ASN A 1 121 ? 38.137 -40.794 32.614 1.00 29.83  ? 121  ASN A CA  1 
ATOM   916  C C   . ASN A 1 121 ? 37.681 -39.687 31.674 1.00 29.83  ? 121  ASN A C   1 
ATOM   917  O O   . ASN A 1 121 ? 36.654 -39.815 31.023 1.00 29.83  ? 121  ASN A O   1 
ATOM   918  C CB  . ASN A 1 121 ? 36.991 -41.804 32.784 1.00 44.77  ? 121  ASN A CB  1 
ATOM   919  C CG  . ASN A 1 121 ? 37.483 -43.244 32.864 1.00 44.77  ? 121  ASN A CG  1 
ATOM   920  O OD1 . ASN A 1 121 ? 37.303 -44.025 31.929 1.00 44.77  ? 121  ASN A OD1 1 
ATOM   921  N ND2 . ASN A 1 121 ? 38.122 -43.595 33.980 1.00 44.77  ? 121  ASN A ND2 1 
ATOM   922  N N   . VAL A 1 122 ? 38.452 -38.612 31.580 1.00 28.91  ? 122  VAL A N   1 
ATOM   923  C CA  . VAL A 1 122 ? 38.097 -37.509 30.703 1.00 28.91  ? 122  VAL A CA  1 
ATOM   924  C C   . VAL A 1 122 ? 39.246 -37.060 29.807 1.00 28.91  ? 122  VAL A C   1 
ATOM   925  O O   . VAL A 1 122 ? 40.375 -36.911 30.247 1.00 28.91  ? 122  VAL A O   1 
ATOM   926  C CB  . VAL A 1 122 ? 37.607 -36.300 31.525 1.00 30.93  ? 122  VAL A CB  1 
ATOM   927  C CG1 . VAL A 1 122 ? 37.429 -35.093 30.621 1.00 30.93  ? 122  VAL A CG1 1 
ATOM   928  C CG2 . VAL A 1 122 ? 36.285 -36.637 32.216 1.00 30.93  ? 122  VAL A CG2 1 
ATOM   929  N N   . LEU A 1 123 ? 38.963 -36.872 28.528 1.00 35.33  ? 123  LEU A N   1 
ATOM   930  C CA  . LEU A 1 123 ? 39.975 -36.391 27.600 1.00 35.33  ? 123  LEU A CA  1 
ATOM   931  C C   . LEU A 1 123 ? 39.594 -34.943 27.436 1.00 35.33  ? 123  LEU A C   1 
ATOM   932  O O   . LEU A 1 123 ? 38.411 -34.627 27.259 1.00 35.33  ? 123  LEU A O   1 
ATOM   933  C CB  . LEU A 1 123 ? 39.851 -37.075 26.255 1.00 30.33  ? 123  LEU A CB  1 
ATOM   934  C CG  . LEU A 1 123 ? 39.904 -38.594 26.262 1.00 30.33  ? 123  LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 123 ? 39.547 -39.124 24.863 1.00 30.33  ? 123  LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 123 ? 41.297 -39.044 26.711 1.00 30.33  ? 123  LEU A CD2 1 
ATOM   937  N N   . HIS A 1 124 ? 40.576 -34.061 27.517 1.00 37.72  ? 124  HIS A N   1 
ATOM   938  C CA  . HIS A 1 124 ? 40.307 -32.637 27.374 1.00 37.72  ? 124  HIS A CA  1 
ATOM   939  C C   . HIS A 1 124 ? 40.212 -32.330 25.878 1.00 37.72  ? 124  HIS A C   1 
ATOM   940  O O   . HIS A 1 124 ? 39.277 -31.673 25.423 1.00 37.72  ? 124  HIS A O   1 
ATOM   941  C CB  . HIS A 1 124 ? 41.429 -31.833 28.046 1.00 29.08  ? 124  HIS A CB  1 
ATOM   942  C CG  . HIS A 1 124 ? 41.164 -30.363 28.107 1.00 29.08  ? 124  HIS A CG  1 
ATOM   943  N ND1 . HIS A 1 124 ? 41.411 -29.519 27.045 1.00 29.08  ? 124  HIS A ND1 1 
ATOM   944  C CD2 . HIS A 1 124 ? 40.665 -29.590 29.103 1.00 29.08  ? 124  HIS A CD2 1 
ATOM   945  C CE1 . HIS A 1 124 ? 41.075 -28.285 27.387 1.00 29.08  ? 124  HIS A CE1 1 
ATOM   946  N NE2 . HIS A 1 124 ? 40.620 -28.302 28.629 1.00 29.08  ? 124  HIS A NE2 1 
ATOM   947  N N   . ARG A 1 125 ? 41.192 -32.818 25.125 1.00 29.39  ? 125  ARG A N   1 
ATOM   948  C CA  . ARG A 1 125 ? 41.234 -32.664 23.675 1.00 29.39  ? 125  ARG A CA  1 
ATOM   949  C C   . ARG A 1 125 ? 41.280 -31.256 23.122 1.00 29.39  ? 125  ARG A C   1 
ATOM   950  O O   . ARG A 1 125 ? 40.951 -31.057 21.954 1.00 29.39  ? 125  ARG A O   1 
ATOM   951  C CB  . ARG A 1 125 ? 40.052 -33.399 23.030 1.00 39.75  ? 125  ARG A CB  1 
ATOM   952  C CG  . ARG A 1 125 ? 39.970 -34.877 23.383 1.00 39.75  ? 125  ARG A CG  1 
ATOM   953  C CD  . ARG A 1 125 ? 38.900 -35.579 22.574 1.00 39.75  ? 125  ARG A CD  1 
ATOM   954  N NE  . ARG A 1 125 ? 37.595 -34.956 22.732 1.00 39.75  ? 125  ARG A NE  1 
ATOM   955  C CZ  . ARG A 1 125 ? 36.521 -35.295 22.032 1.00 39.75  ? 125  ARG A CZ  1 
ATOM   956  N NH1 . ARG A 1 125 ? 36.595 -36.251 21.127 1.00 39.75  ? 125  ARG A NH1 1 
ATOM   957  N NH2 . ARG A 1 125 ? 35.373 -34.681 22.239 1.00 39.75  ? 125  ARG A NH2 1 
ATOM   958  N N   . ASP A 1 126 ? 41.688 -30.284 23.934 1.00 31.22  ? 126  ASP A N   1 
ATOM   959  C CA  . ASP A 1 126 ? 41.788 -28.906 23.471 1.00 31.22  ? 126  ASP A CA  1 
ATOM   960  C C   . ASP A 1 126 ? 42.827 -28.188 24.322 1.00 31.22  ? 126  ASP A C   1 
ATOM   961  O O   . ASP A 1 126 ? 42.610 -27.070 24.814 1.00 31.22  ? 126  ASP A O   1 
ATOM   962  C CB  . ASP A 1 126 ? 40.432 -28.202 23.583 1.00 40.01  ? 126  ASP A CB  1 
ATOM   963  C CG  . ASP A 1 126 ? 40.393 -26.872 22.837 1.00 40.01  ? 126  ASP A CG  1 
ATOM   964  O OD1 . ASP A 1 126 ? 39.472 -26.075 23.122 1.00 40.01  ? 126  ASP A OD1 1 
ATOM   965  O OD2 . ASP A 1 126 ? 41.262 -26.618 21.969 1.00 40.01  ? 126  ASP A OD2 1 
ATOM   966  N N   . LEU A 1 127 ? 43.975 -28.825 24.489 1.00 42.76  ? 127  LEU A N   1 
ATOM   967  C CA  . LEU A 1 127 ? 45.025 -28.230 25.290 1.00 42.76  ? 127  LEU A CA  1 
ATOM   968  C C   . LEU A 1 127 ? 45.887 -27.249 24.511 1.00 42.76  ? 127  LEU A C   1 
ATOM   969  O O   . LEU A 1 127 ? 46.627 -27.635 23.604 1.00 42.76  ? 127  LEU A O   1 
ATOM   970  C CB  . LEU A 1 127 ? 45.901 -29.328 25.877 1.00 64.53  ? 127  LEU A CB  1 
ATOM   971  C CG  . LEU A 1 127 ? 46.128 -29.207 27.381 1.00 64.53  ? 127  LEU A CG  1 
ATOM   972  C CD1 . LEU A 1 127 ? 44.795 -28.999 28.083 1.00 64.53  ? 127  LEU A CD1 1 
ATOM   973  C CD2 . LEU A 1 127 ? 46.819 -30.459 27.887 1.00 64.53  ? 127  LEU A CD2 1 
ATOM   974  N N   . LYS A 1 128 ? 45.774 -25.976 24.869 1.00 33.42  ? 128  LYS A N   1 
ATOM   975  C CA  . LYS A 1 128 ? 46.566 -24.913 24.262 1.00 33.42  ? 128  LYS A CA  1 
ATOM   976  C C   . LYS A 1 128 ? 46.709 -23.786 25.291 1.00 33.42  ? 128  LYS A C   1 
ATOM   977  O O   . LYS A 1 128 ? 45.906 -23.680 26.216 1.00 33.42  ? 128  LYS A O   1 
ATOM   978  C CB  . LYS A 1 128 ? 45.904 -24.413 22.984 1.00 36.64  ? 128  LYS A CB  1 
ATOM   979  C CG  . LYS A 1 128 ? 44.415 -24.144 23.095 1.00 36.64  ? 128  LYS A CG  1 
ATOM   980  C CD  . LYS A 1 128 ? 43.889 -23.617 21.764 1.00 36.64  ? 128  LYS A CD  1 
ATOM   981  C CE  . LYS A 1 128 ? 42.414 -23.278 21.832 1.00 36.64  ? 128  LYS A CE  1 
ATOM   982  N NZ  . LYS A 1 128 ? 41.988 -22.431 20.681 1.00 36.64  ? 128  LYS A NZ  1 
ATOM   983  N N   . PRO A 1 129 ? 47.731 -22.929 25.146 1.00 34.18  ? 129  PRO A N   1 
ATOM   984  C CA  . PRO A 1 129 ? 47.924 -21.839 26.109 1.00 34.18  ? 129  PRO A CA  1 
ATOM   985  C C   . PRO A 1 129 ? 46.696 -21.015 26.456 1.00 34.18  ? 129  PRO A C   1 
ATOM   986  O O   . PRO A 1 129 ? 46.497 -20.637 27.612 1.00 34.18  ? 129  PRO A O   1 
ATOM   987  C CB  . PRO A 1 129 ? 49.034 -21.020 25.473 1.00 34.76  ? 129  PRO A CB  1 
ATOM   988  C CG  . PRO A 1 129 ? 49.882 -22.098 24.813 1.00 34.76  ? 129  PRO A CG  1 
ATOM   989  C CD  . PRO A 1 129 ? 48.813 -22.941 24.142 1.00 34.76  ? 129  PRO A CD  1 
ATOM   990  N N   . GLN A 1 130 ? 45.862 -20.728 25.473 1.00 36.98  ? 130  GLN A N   1 
ATOM   991  C CA  . GLN A 1 130 ? 44.670 -19.944 25.745 1.00 36.98  ? 130  GLN A CA  1 
ATOM   992  C C   . GLN A 1 130 ? 43.673 -20.647 26.673 1.00 36.98  ? 130  GLN A C   1 
ATOM   993  O O   . GLN A 1 130 ? 42.850 -19.988 27.303 1.00 36.98  ? 130  GLN A O   1 
ATOM   994  C CB  . GLN A 1 130 ? 43.981 -19.542 24.434 1.00 60.98  ? 130  GLN A CB  1 
ATOM   995  C CG  . GLN A 1 130 ? 44.189 -20.508 23.267 1.00 60.98  ? 130  GLN A CG  1 
ATOM   996  C CD  . GLN A 1 130 ? 45.539 -20.331 22.579 1.00 60.98  ? 130  GLN A CD  1 
ATOM   997  O OE1 . GLN A 1 130 ? 46.584 -20.672 23.132 1.00 60.98  ? 130  GLN A OE1 1 
ATOM   998  N NE2 . GLN A 1 130 ? 45.516 -19.786 21.368 1.00 60.98  ? 130  GLN A NE2 1 
ATOM   999  N N   . ASN A 1 131 ? 43.736 -21.972 26.769 1.00 38.62  ? 131  ASN A N   1 
ATOM   1000 C CA  . ASN A 1 131 ? 42.814 -22.691 27.653 1.00 38.62  ? 131  ASN A CA  1 
ATOM   1001 C C   . ASN A 1 131 ? 43.413 -23.010 29.035 1.00 38.62  ? 131  ASN A C   1 
ATOM   1002 O O   . ASN A 1 131 ? 42.871 -23.828 29.788 1.00 38.62  ? 131  ASN A O   1 
ATOM   1003 C CB  . ASN A 1 131 ? 42.325 -23.981 26.985 1.00 36.61  ? 131  ASN A CB  1 
ATOM   1004 C CG  . ASN A 1 131 ? 41.373 -23.714 25.831 1.00 36.61  ? 131  ASN A CG  1 
ATOM   1005 O OD1 . ASN A 1 131 ? 40.953 -24.638 25.116 1.00 36.61  ? 131  ASN A OD1 1 
ATOM   1006 N ND2 . ASN A 1 131 ? 41.030 -22.443 25.638 1.00 36.61  ? 131  ASN A ND2 1 
ATOM   1007 N N   . LEU A 1 132 ? 44.538 -22.377 29.350 1.00 42.13  ? 132  LEU A N   1 
ATOM   1008 C CA  . LEU A 1 132 ? 45.186 -22.558 30.641 1.00 42.13  ? 132  LEU A CA  1 
ATOM   1009 C C   . LEU A 1 132 ? 45.074 -21.239 31.378 1.00 42.13  ? 132  LEU A C   1 
ATOM   1010 O O   . LEU A 1 132 ? 45.531 -20.200 30.889 1.00 42.13  ? 132  LEU A O   1 
ATOM   1011 C CB  . LEU A 1 132 ? 46.657 -22.924 30.464 1.00 31.18  ? 132  LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 132 ? 46.970 -24.413 30.507 1.00 31.18  ? 132  LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 132 ? 45.834 -25.207 29.901 1.00 31.18  ? 132  LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 132 ? 48.271 -24.658 29.796 1.00 31.18  ? 132  LEU A CD2 1 
ATOM   1015 N N   . LEU A 1 133 ? 44.448 -21.271 32.545 1.00 34.90  ? 133  LEU A N   1 
ATOM   1016 C CA  . LEU A 1 133 ? 44.275 -20.057 33.329 1.00 34.90  ? 133  LEU A CA  1 
ATOM   1017 C C   . LEU A 1 133 ? 45.353 -19.938 34.406 1.00 34.90  ? 133  LEU A C   1 
ATOM   1018 O O   . LEU A 1 133 ? 45.802 -20.947 34.973 1.00 34.90  ? 133  LEU A O   1 
ATOM   1019 C CB  . LEU A 1 133 ? 42.880 -20.042 33.966 1.00 44.58  ? 133  LEU A CB  1 
ATOM   1020 C CG  . LEU A 1 133 ? 41.720 -20.184 32.978 1.00 44.58  ? 133  LEU A CG  1 
ATOM   1021 C CD1 . LEU A 1 133 ? 40.389 -19.910 33.669 1.00 44.58  ? 133  LEU A CD1 1 
ATOM   1022 C CD2 . LEU A 1 133 ? 41.924 -19.225 31.845 1.00 44.58  ? 133  LEU A CD2 1 
ATOM   1023 N N   . ILE A 1 134 ? 45.769 -18.702 34.675 1.00 43.83  ? 134  ILE A N   1 
ATOM   1024 C CA  . ILE A 1 134 ? 46.786 -18.438 35.685 1.00 43.83  ? 134  ILE A CA  1 
ATOM   1025 C C   . ILE A 1 134 ? 46.436 -17.253 36.582 1.00 43.83  ? 134  ILE A C   1 
ATOM   1026 O O   . ILE A 1 134 ? 46.072 -16.187 36.095 1.00 43.83  ? 134  ILE A O   1 
ATOM   1027 C CB  . ILE A 1 134 ? 48.144 -18.157 35.024 1.00 56.67  ? 134  ILE A CB  1 
ATOM   1028 C CG1 . ILE A 1 134 ? 48.608 -19.398 34.272 1.00 56.67  ? 134  ILE A CG1 1 
ATOM   1029 C CG2 . ILE A 1 134 ? 49.154 -17.714 36.083 1.00 56.67  ? 134  ILE A CG2 1 
ATOM   1030 C CD1 . ILE A 1 134 ? 49.881 -19.211 33.508 1.00 56.67  ? 134  ILE A CD1 1 
ATOM   1031 N N   . ASN A 1 135 ? 46.531 -17.453 37.889 1.00 46.28  ? 135  ASN A N   1 
ATOM   1032 C CA  . ASN A 1 135 ? 46.267 -16.385 38.847 1.00 46.28  ? 135  ASN A CA  1 
ATOM   1033 C C   . ASN A 1 135 ? 47.594 -15.700 39.213 1.00 46.28  ? 135  ASN A C   1 
ATOM   1034 O O   . ASN A 1 135 ? 48.665 -16.294 39.053 1.00 46.28  ? 135  ASN A O   1 
ATOM   1035 C CB  . ASN A 1 135 ? 45.647 -16.956 40.126 1.00 45.00  ? 135  ASN A CB  1 
ATOM   1036 C CG  . ASN A 1 135 ? 44.224 -17.397 39.941 1.00 45.00  ? 135  ASN A CG  1 
ATOM   1037 O OD1 . ASN A 1 135 ? 43.712 -18.199 40.717 1.00 45.00  ? 135  ASN A OD1 1 
ATOM   1038 N ND2 . ASN A 1 135 ? 43.567 -16.875 38.919 1.00 45.00  ? 135  ASN A ND2 1 
ATOM   1039 N N   . ARG A 1 136 ? 47.533 -14.467 39.712 1.00 54.12  ? 136  ARG A N   1 
ATOM   1040 C CA  . ARG A 1 136 ? 48.759 -13.778 40.114 1.00 54.12  ? 136  ARG A CA  1 
ATOM   1041 C C   . ARG A 1 136 ? 49.418 -14.619 41.212 1.00 54.12  ? 136  ARG A C   1 
ATOM   1042 O O   . ARG A 1 136 ? 50.641 -14.631 41.361 1.00 54.12  ? 136  ARG A O   1 
ATOM   1043 C CB  . ARG A 1 136 ? 48.442 -12.376 40.639 1.00 126.17 ? 136  ARG A CB  1 
ATOM   1044 C CG  . ARG A 1 136 ? 49.680 -11.555 40.963 1.00 126.17 ? 136  ARG A CG  1 
ATOM   1045 C CD  . ARG A 1 136 ? 49.341 -10.129 41.368 1.00 126.17 ? 136  ARG A CD  1 
ATOM   1046 N NE  . ARG A 1 136 ? 50.558 -9.367  41.635 1.00 126.17 ? 136  ARG A NE  1 
ATOM   1047 C CZ  . ARG A 1 136 ? 50.586 -8.090  42.004 1.00 126.17 ? 136  ARG A CZ  1 
ATOM   1048 N NH1 . ARG A 1 136 ? 49.454 -7.416  42.154 1.00 126.17 ? 136  ARG A NH1 1 
ATOM   1049 N NH2 . ARG A 1 136 ? 51.749 -7.485  42.221 1.00 126.17 ? 136  ARG A NH2 1 
ATOM   1050 N N   . ASN A 1 137 ? 48.588 -15.337 41.966 1.00 54.92  ? 137  ASN A N   1 
ATOM   1051 C CA  . ASN A 1 137 ? 49.064 -16.192 43.044 1.00 54.92  ? 137  ASN A CA  1 
ATOM   1052 C C   . ASN A 1 137 ? 49.940 -17.301 42.487 1.00 54.92  ? 137  ASN A C   1 
ATOM   1053 O O   . ASN A 1 137 ? 50.344 -18.201 43.228 1.00 54.92  ? 137  ASN A O   1 
ATOM   1054 C CB  . ASN A 1 137 ? 47.886 -16.828 43.789 1.00 123.52 ? 137  ASN A CB  1 
ATOM   1055 C CG  . ASN A 1 137 ? 46.743 -15.859 44.017 1.00 123.52 ? 137  ASN A CG  1 
ATOM   1056 O OD1 . ASN A 1 137 ? 46.079 -15.425 43.075 1.00 123.52 ? 137  ASN A OD1 1 
ATOM   1057 N ND2 . ASN A 1 137 ? 46.509 -15.511 45.277 1.00 123.52 ? 137  ASN A ND2 1 
ATOM   1058 N N   . GLY A 1 138 ? 50.210 -17.247 41.181 1.00 42.99  ? 138  GLY A N   1 
ATOM   1059 C CA  . GLY A 1 138 ? 51.038 -18.254 40.534 1.00 42.99  ? 138  GLY A CA  1 
ATOM   1060 C C   . GLY A 1 138 ? 50.429 -19.622 40.234 1.00 42.99  ? 138  GLY A C   1 
ATOM   1061 O O   . GLY A 1 138 ? 51.122 -20.487 39.701 1.00 42.99  ? 138  GLY A O   1 
ATOM   1062 N N   . GLU A 1 139 ? 49.159 -19.854 40.555 1.00 46.64  ? 139  GLU A N   1 
ATOM   1063 C CA  . GLU A 1 139 ? 48.594 -21.164 40.248 1.00 46.64  ? 139  GLU A CA  1 
ATOM   1064 C C   . GLU A 1 139 ? 47.859 -21.238 38.892 1.00 46.64  ? 139  GLU A C   1 
ATOM   1065 O O   . GLU A 1 139 ? 47.206 -20.284 38.452 1.00 46.64  ? 139  GLU A O   1 
ATOM   1066 C CB  . GLU A 1 139 ? 47.709 -21.667 41.399 1.00 67.84  ? 139  GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 139 ? 46.678 -20.715 41.929 1.00 67.84  ? 139  GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 139 ? 45.902 -21.331 43.077 1.00 67.84  ? 139  GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 139 ? 45.414 -22.470 42.913 1.00 67.84  ? 139  GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 139 ? 45.776 -20.684 44.139 1.00 67.84  ? 139  GLU A OE2 1 
ATOM   1071 N N   . LEU A 1 140 ? 48.001 -22.390 38.237 1.00 52.85  ? 140  LEU A N   1 
ATOM   1072 C CA  . LEU A 1 140 ? 47.432 -22.641 36.914 1.00 52.85  ? 140  LEU A CA  1 
ATOM   1073 C C   . LEU A 1 140 ? 46.283 -23.640 36.918 1.00 52.85  ? 140  LEU A C   1 
ATOM   1074 O O   . LEU A 1 140 ? 46.343 -24.678 37.586 1.00 52.85  ? 140  LEU A O   1 
ATOM   1075 C CB  . LEU A 1 140 ? 48.549 -23.127 35.988 1.00 33.67  ? 140  LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 140 ? 48.241 -23.745 34.628 1.00 33.67  ? 140  LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 140 ? 49.520 -23.792 33.802 1.00 33.67  ? 140  LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 140 ? 47.675 -25.148 34.805 1.00 33.67  ? 140  LEU A CD2 1 
ATOM   1079 N N   . LYS A 1 141 ? 45.246 -23.337 36.145 1.00 38.54  ? 141  LYS A N   1 
ATOM   1080 C CA  . LYS A 1 141 ? 44.079 -24.208 36.085 1.00 38.54  ? 141  LYS A CA  1 
ATOM   1081 C C   . LYS A 1 141 ? 43.646 -24.467 34.654 1.00 38.54  ? 141  LYS A C   1 
ATOM   1082 O O   . LYS A 1 141 ? 43.696 -23.566 33.816 1.00 38.54  ? 141  LYS A O   1 
ATOM   1083 C CB  . LYS A 1 141 ? 42.901 -23.581 36.833 1.00 37.16  ? 141  LYS A CB  1 
ATOM   1084 C CG  . LYS A 1 141 ? 43.113 -23.289 38.306 1.00 37.16  ? 141  LYS A CG  1 
ATOM   1085 C CD  . LYS A 1 141 ? 42.066 -22.280 38.752 1.00 37.16  ? 141  LYS A CD  1 
ATOM   1086 C CE  . LYS A 1 141 ? 41.586 -22.514 40.170 1.00 37.16  ? 141  LYS A CE  1 
ATOM   1087 N NZ  . LYS A 1 141 ? 42.640 -22.256 41.153 1.00 37.16  ? 141  LYS A NZ  1 
ATOM   1088 N N   . LEU A 1 142 ? 43.219 -25.704 34.397 1.00 42.83  ? 142  LEU A N   1 
ATOM   1089 C CA  . LEU A 1 142 ? 42.733 -26.118 33.085 1.00 42.83  ? 142  LEU A CA  1 
ATOM   1090 C C   . LEU A 1 142 ? 41.349 -25.504 32.920 1.00 42.83  ? 142  LEU A C   1 
ATOM   1091 O O   . LEU A 1 142 ? 40.588 -25.411 33.884 1.00 42.83  ? 142  LEU A O   1 
ATOM   1092 C CB  . LEU A 1 142 ? 42.591 -27.638 33.010 1.00 52.49  ? 142  LEU A CB  1 
ATOM   1093 C CG  . LEU A 1 142 ? 43.800 -28.577 33.104 1.00 52.49  ? 142  LEU A CG  1 
ATOM   1094 C CD1 . LEU A 1 142 ? 43.305 -29.974 33.450 1.00 52.49  ? 142  LEU A CD1 1 
ATOM   1095 C CD2 . LEU A 1 142 ? 44.555 -28.606 31.794 1.00 52.49  ? 142  LEU A CD2 1 
ATOM   1096 N N   . ALA A 1 143 ? 41.025 -25.084 31.704 1.00 39.66  ? 143  ALA A N   1 
ATOM   1097 C CA  . ALA A 1 143 ? 39.724 -24.491 31.439 1.00 39.66  ? 143  ALA A CA  1 
ATOM   1098 C C   . ALA A 1 143 ? 39.193 -24.874 30.071 1.00 39.66  ? 143  ALA A C   1 
ATOM   1099 O O   . ALA A 1 143 ? 39.864 -25.561 29.295 1.00 39.66  ? 143  ALA A O   1 
ATOM   1100 C CB  . ALA A 1 143 ? 39.805 -22.981 31.553 1.00 55.57  ? 143  ALA A CB  1 
ATOM   1101 N N   . ASP A 1 144 ? 37.972 -24.428 29.800 1.00 34.90  ? 144  ASP A N   1 
ATOM   1102 C CA  . ASP A 1 144 ? 37.302 -24.670 28.527 1.00 34.90  ? 144  ASP A CA  1 
ATOM   1103 C C   . ASP A 1 144 ? 37.240 -26.144 28.105 1.00 34.90  ? 144  ASP A C   1 
ATOM   1104 O O   . ASP A 1 144 ? 37.980 -26.585 27.229 1.00 34.90  ? 144  ASP A O   1 
ATOM   1105 C CB  . ASP A 1 144 ? 37.965 -23.798 27.450 1.00 46.76  ? 144  ASP A CB  1 
ATOM   1106 C CG  . ASP A 1 144 ? 37.908 -22.300 27.797 1.00 46.76  ? 144  ASP A CG  1 
ATOM   1107 O OD1 . ASP A 1 144 ? 36.796 -21.752 27.890 1.00 46.76  ? 144  ASP A OD1 1 
ATOM   1108 O OD2 . ASP A 1 144 ? 38.966 -21.665 27.995 1.00 46.76  ? 144  ASP A OD2 1 
ATOM   1109 N N   . PHE A 1 145 ? 36.342 -26.892 28.747 1.00 30.89  ? 145  PHE A N   1 
ATOM   1110 C CA  . PHE A 1 145 ? 36.143 -28.308 28.464 1.00 30.89  ? 145  PHE A CA  1 
ATOM   1111 C C   . PHE A 1 145 ? 35.138 -28.532 27.327 1.00 30.89  ? 145  PHE A C   1 
ATOM   1112 O O   . PHE A 1 145 ? 34.615 -29.633 27.143 1.00 30.89  ? 145  PHE A O   1 
ATOM   1113 C CB  . PHE A 1 145 ? 35.674 -29.028 29.736 1.00 32.48  ? 145  PHE A CB  1 
ATOM   1114 C CG  . PHE A 1 145 ? 36.783 -29.324 30.709 1.00 32.48  ? 145  PHE A CG  1 
ATOM   1115 C CD1 . PHE A 1 145 ? 37.448 -28.299 31.360 1.00 32.48  ? 145  PHE A CD1 1 
ATOM   1116 C CD2 . PHE A 1 145 ? 37.227 -30.631 30.902 1.00 32.48  ? 145  PHE A CD2 1 
ATOM   1117 C CE1 . PHE A 1 145 ? 38.546 -28.569 32.180 1.00 32.48  ? 145  PHE A CE1 1 
ATOM   1118 C CE2 . PHE A 1 145 ? 38.327 -30.907 31.721 1.00 32.48  ? 145  PHE A CE2 1 
ATOM   1119 C CZ  . PHE A 1 145 ? 38.986 -29.874 32.357 1.00 32.48  ? 145  PHE A CZ  1 
ATOM   1120 N N   . GLY A 1 146 ? 34.890 -27.481 26.551 1.00 38.38  ? 146  GLY A N   1 
ATOM   1121 C CA  . GLY A 1 146 ? 33.941 -27.568 25.456 1.00 38.38  ? 146  GLY A CA  1 
ATOM   1122 C C   . GLY A 1 146 ? 34.184 -28.712 24.498 1.00 38.38  ? 146  GLY A C   1 
ATOM   1123 O O   . GLY A 1 146 ? 33.246 -29.226 23.881 1.00 38.38  ? 146  GLY A O   1 
ATOM   1124 N N   . LEU A 1 147 ? 35.443 -29.112 24.376 1.00 26.36  ? 147  LEU A N   1 
ATOM   1125 C CA  . LEU A 1 147 ? 35.817 -30.201 23.483 1.00 26.36  ? 147  LEU A CA  1 
ATOM   1126 C C   . LEU A 1 147 ? 36.053 -31.508 24.237 1.00 26.36  ? 147  LEU A C   1 
ATOM   1127 O O   . LEU A 1 147 ? 36.304 -32.541 23.633 1.00 26.36  ? 147  LEU A O   1 
ATOM   1128 C CB  . LEU A 1 147 ? 37.083 -29.832 22.724 1.00 70.20  ? 147  LEU A CB  1 
ATOM   1129 C CG  . LEU A 1 147 ? 36.847 -29.744 21.223 1.00 70.20  ? 147  LEU A CG  1 
ATOM   1130 C CD1 . LEU A 1 147 ? 35.667 -28.814 20.961 1.00 70.20  ? 147  LEU A CD1 1 
ATOM   1131 C CD2 . LEU A 1 147 ? 38.114 -29.254 20.524 1.00 70.20  ? 147  LEU A CD2 1 
ATOM   1132 N N   . ALA A 1 148 ? 35.978 -31.454 25.557 1.00 27.16  ? 148  ALA A N   1 
ATOM   1133 C CA  . ALA A 1 148 ? 36.218 -32.629 26.362 1.00 27.16  ? 148  ALA A CA  1 
ATOM   1134 C C   . ALA A 1 148 ? 35.142 -33.679 26.176 1.00 27.16  ? 148  ALA A C   1 
ATOM   1135 O O   . ALA A 1 148 ? 34.126 -33.431 25.536 1.00 27.16  ? 148  ALA A O   1 
ATOM   1136 C CB  . ALA A 1 148 ? 36.301 -32.229 27.832 1.00 21.14  ? 148  ALA A CB  1 
ATOM   1137 N N   . ARG A 1 149 ? 35.378 -34.863 26.727 1.00 34.93  ? 149  ARG A N   1 
ATOM   1138 C CA  . ARG A 1 149 ? 34.402 -35.942 26.670 1.00 34.93  ? 149  ARG A CA  1 
ATOM   1139 C C   . ARG A 1 149 ? 34.853 -37.060 27.582 1.00 34.93  ? 149  ARG A C   1 
ATOM   1140 O O   . ARG A 1 149 ? 36.028 -37.156 27.928 1.00 34.93  ? 149  ARG A O   1 
ATOM   1141 C CB  . ARG A 1 149 ? 34.218 -36.469 25.245 1.00 46.97  ? 149  ARG A CB  1 
ATOM   1142 C CG  . ARG A 1 149 ? 35.282 -37.415 24.748 1.00 46.97  ? 149  ARG A CG  1 
ATOM   1143 C CD  . ARG A 1 149 ? 34.762 -38.180 23.543 1.00 46.97  ? 149  ARG A CD  1 
ATOM   1144 N NE  . ARG A 1 149 ? 33.807 -39.219 23.928 1.00 46.97  ? 149  ARG A NE  1 
ATOM   1145 C CZ  . ARG A 1 149 ? 32.899 -39.750 23.111 1.00 46.97  ? 149  ARG A CZ  1 
ATOM   1146 N NH1 . ARG A 1 149 ? 32.811 -39.334 21.853 1.00 46.97  ? 149  ARG A NH1 1 
ATOM   1147 N NH2 . ARG A 1 149 ? 32.084 -40.706 23.544 1.00 46.97  ? 149  ARG A NH2 1 
ATOM   1148 N N   . ALA A 1 150 ? 33.907 -37.888 27.994 1.00 37.31  ? 150  ALA A N   1 
ATOM   1149 C CA  . ALA A 1 150 ? 34.199 -39.005 28.870 1.00 37.31  ? 150  ALA A CA  1 
ATOM   1150 C C   . ALA A 1 150 ? 34.591 -40.145 27.968 1.00 37.31  ? 150  ALA A C   1 
ATOM   1151 O O   . ALA A 1 150 ? 34.300 -40.099 26.773 1.00 37.31  ? 150  ALA A O   1 
ATOM   1152 C CB  . ALA A 1 150 ? 32.968 -39.381 29.657 1.00 33.19  ? 150  ALA A CB  1 
ATOM   1153 N N   . PHE A 1 151 ? 35.268 -41.150 28.520 1.00 45.88  ? 151  PHE A N   1 
ATOM   1154 C CA  . PHE A 1 151 ? 35.655 -42.325 27.746 1.00 45.88  ? 151  PHE A CA  1 
ATOM   1155 C C   . PHE A 1 151 ? 35.684 -43.508 28.673 1.00 45.88  ? 151  PHE A C   1 
ATOM   1156 O O   . PHE A 1 151 ? 35.883 -43.353 29.873 1.00 45.88  ? 151  PHE A O   1 
ATOM   1157 C CB  . PHE A 1 151 ? 37.034 -42.173 27.098 1.00 35.82  ? 151  PHE A CB  1 
ATOM   1158 C CG  . PHE A 1 151 ? 38.175 -42.251 28.062 1.00 35.82  ? 151  PHE A CG  1 
ATOM   1159 C CD1 . PHE A 1 151 ? 38.645 -41.108 28.705 1.00 35.82  ? 151  PHE A CD1 1 
ATOM   1160 C CD2 . PHE A 1 151 ? 38.791 -43.480 28.331 1.00 35.82  ? 151  PHE A CD2 1 
ATOM   1161 C CE1 . PHE A 1 151 ? 39.722 -41.192 29.603 1.00 35.82  ? 151  PHE A CE1 1 
ATOM   1162 C CE2 . PHE A 1 151 ? 39.867 -43.571 29.229 1.00 35.82  ? 151  PHE A CE2 1 
ATOM   1163 C CZ  . PHE A 1 151 ? 40.329 -42.429 29.864 1.00 35.82  ? 151  PHE A CZ  1 
ATOM   1164 N N   . GLY A 1 152 ? 35.489 -44.690 28.105 1.00 53.84  ? 152  GLY A N   1 
ATOM   1165 C CA  . GLY A 1 152 ? 35.496 -45.905 28.894 1.00 53.84  ? 152  GLY A CA  1 
ATOM   1166 C C   . GLY A 1 152 ? 34.713 -46.959 28.155 1.00 53.84  ? 152  GLY A C   1 
ATOM   1167 O O   . GLY A 1 152 ? 35.148 -48.097 28.014 1.00 53.84  ? 152  GLY A O   1 
ATOM   1168 N N   . ILE A 1 153 ? 33.542 -46.568 27.678 1.00 58.53  ? 153  ILE A N   1 
ATOM   1169 C CA  . ILE A 1 153 ? 32.691 -47.473 26.925 1.00 58.53  ? 153  ILE A CA  1 
ATOM   1170 C C   . ILE A 1 153 ? 33.369 -47.814 25.593 1.00 58.53  ? 153  ILE A C   1 
ATOM   1171 O O   . ILE A 1 153 ? 33.859 -46.928 24.883 1.00 58.53  ? 153  ILE A O   1 
ATOM   1172 C CB  . ILE A 1 153 ? 31.317 -46.813 26.661 1.00 52.51  ? 153  ILE A CB  1 
ATOM   1173 C CG1 . ILE A 1 153 ? 30.582 -46.652 27.998 1.00 52.51  ? 153  ILE A CG1 1 
ATOM   1174 C CG2 . ILE A 1 153 ? 30.514 -47.625 25.641 1.00 52.51  ? 153  ILE A CG2 1 
ATOM   1175 C CD1 . ILE A 1 153 ? 29.204 -46.052 27.889 1.00 52.51  ? 153  ILE A CD1 1 
ATOM   1176 N N   . PRO A 1 154 ? 33.431 -49.106 25.245 1.00 128.18 ? 154  PRO A N   1 
ATOM   1177 C CA  . PRO A 1 154 ? 34.066 -49.473 23.978 1.00 128.18 ? 154  PRO A CA  1 
ATOM   1178 C C   . PRO A 1 154 ? 33.393 -48.774 22.803 1.00 128.18 ? 154  PRO A C   1 
ATOM   1179 O O   . PRO A 1 154 ? 32.410 -49.271 22.257 1.00 128.18 ? 154  PRO A O   1 
ATOM   1180 C CB  . PRO A 1 154 ? 33.885 -50.984 23.935 1.00 129.01 ? 154  PRO A CB  1 
ATOM   1181 C CG  . PRO A 1 154 ? 34.005 -51.355 25.378 1.00 129.01 ? 154  PRO A CG  1 
ATOM   1182 C CD  . PRO A 1 154 ? 33.144 -50.306 26.051 1.00 129.01 ? 154  PRO A CD  1 
ATOM   1183 N N   . VAL A 1 155 ? 33.921 -47.616 22.424 1.00 77.53  ? 155  VAL A N   1 
ATOM   1184 C CA  . VAL A 1 155 ? 33.369 -46.853 21.314 1.00 77.53  ? 155  VAL A CA  1 
ATOM   1185 C C   . VAL A 1 155 ? 34.018 -47.291 20.019 1.00 77.53  ? 155  VAL A C   1 
ATOM   1186 O O   . VAL A 1 155 ? 35.159 -47.748 20.009 1.00 77.53  ? 155  VAL A O   1 
ATOM   1187 C CB  . VAL A 1 155 ? 33.634 -45.352 21.466 1.00 57.10  ? 155  VAL A CB  1 
ATOM   1188 C CG1 . VAL A 1 155 ? 32.954 -44.597 20.348 1.00 57.10  ? 155  VAL A CG1 1 
ATOM   1189 C CG2 . VAL A 1 155 ? 33.144 -44.868 22.806 1.00 57.10  ? 155  VAL A CG2 1 
ATOM   1190 N N   . ARG A 1 156 ? 33.289 -47.147 18.923 1.00 63.59  ? 156  ARG A N   1 
ATOM   1191 C CA  . ARG A 1 156 ? 33.825 -47.520 17.631 1.00 63.59  ? 156  ARG A CA  1 
ATOM   1192 C C   . ARG A 1 156 ? 34.964 -46.550 17.307 1.00 63.59  ? 156  ARG A C   1 
ATOM   1193 O O   . ARG A 1 156 ? 36.039 -46.964 16.864 1.00 63.59  ? 156  ARG A O   1 
ATOM   1194 C CB  . ARG A 1 156 ? 32.720 -47.443 16.577 1.00 150.80 ? 156  ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 156 ? 31.473 -48.251 16.937 1.00 150.80 ? 156  ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 156 ? 30.391 -48.120 15.871 1.00 150.80 ? 156  ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 156 ? 29.300 -49.072 16.068 1.00 150.80 ? 156  ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 156 ? 28.240 -49.180 15.271 1.00 150.80 ? 156  ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 156 ? 28.116 -48.391 14.212 1.00 150.80 ? 156  ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 156 ? 27.306 -50.086 15.530 1.00 150.80 ? 156  ARG A NH2 1 
ATOM   1201 N N   . CYS A 1 157 ? 34.715 -45.261 17.555 1.00 78.21  ? 157  CYS A N   1 
ATOM   1202 C CA  . CYS A 1 157 ? 35.684 -44.182 17.318 1.00 78.21  ? 157  CYS A CA  1 
ATOM   1203 C C   . CYS A 1 157 ? 35.112 -42.867 17.849 1.00 78.21  ? 157  CYS A C   1 
ATOM   1204 O O   . CYS A 1 157 ? 33.912 -42.771 18.108 1.00 78.21  ? 157  CYS A O   1 
ATOM   1205 C CB  . CYS A 1 157 ? 35.959 -44.022 15.822 1.00 58.72  ? 157  CYS A CB  1 
ATOM   1206 S SG  . CYS A 1 157 ? 34.502 -43.540 14.884 1.00 58.72  ? 157  CYS A SG  1 
ATOM   1207 N N   . TYR A 1 158 ? 35.968 -41.861 18.013 1.00 48.77  ? 158  TYR A N   1 
ATOM   1208 C CA  . TYR A 1 158 ? 35.523 -40.550 18.496 1.00 48.77  ? 158  TYR A CA  1 
ATOM   1209 C C   . TYR A 1 158 ? 35.431 -39.633 17.285 1.00 48.77  ? 158  TYR A C   1 
ATOM   1210 O O   . TYR A 1 158 ? 34.700 -39.924 16.351 1.00 48.77  ? 158  TYR A O   1 
ATOM   1211 C CB  . TYR A 1 158 ? 36.511 -39.974 19.529 1.00 48.12  ? 158  TYR A CB  1 
ATOM   1212 C CG  . TYR A 1 158 ? 36.674 -40.838 20.757 1.00 48.12  ? 158  TYR A CG  1 
ATOM   1213 C CD1 . TYR A 1 158 ? 37.932 -41.275 21.165 1.00 48.12  ? 158  TYR A CD1 1 
ATOM   1214 C CD2 . TYR A 1 158 ? 35.561 -41.268 21.482 1.00 48.12  ? 158  TYR A CD2 1 
ATOM   1215 C CE1 . TYR A 1 158 ? 38.075 -42.128 22.255 1.00 48.12  ? 158  TYR A CE1 1 
ATOM   1216 C CE2 . TYR A 1 158 ? 35.698 -42.114 22.572 1.00 48.12  ? 158  TYR A CE2 1 
ATOM   1217 C CZ  . TYR A 1 158 ? 36.954 -42.543 22.950 1.00 48.12  ? 158  TYR A CZ  1 
ATOM   1218 O OH  . TYR A 1 158 ? 37.075 -43.410 24.010 1.00 48.12  ? 158  TYR A OH  1 
ATOM   1219 N N   . SER A 1 159 ? 36.178 -38.536 17.291 1.00 44.63  ? 159  SER A N   1 
ATOM   1220 C CA  . SER A 1 159 ? 36.161 -37.602 16.171 1.00 44.63  ? 159  SER A CA  1 
ATOM   1221 C C   . SER A 1 159 ? 37.546 -37.037 15.959 1.00 44.63  ? 159  SER A C   1 
ATOM   1222 O O   . SER A 1 159 ? 38.270 -36.806 16.912 1.00 44.63  ? 159  SER A O   1 
ATOM   1223 C CB  . SER A 1 159 ? 35.190 -36.452 16.442 1.00 53.49  ? 159  SER A CB  1 
ATOM   1224 O OG  . SER A 1 159 ? 35.323 -35.433 15.464 1.00 53.49  ? 159  SER A OG  1 
ATOM   1225 N N   . ALA A 1 160 ? 37.915 -36.801 14.711 1.00 58.33  ? 160  ALA A N   1 
ATOM   1226 C CA  . ALA A 1 160 ? 39.237 -36.263 14.432 1.00 58.33  ? 160  ALA A CA  1 
ATOM   1227 C C   . ALA A 1 160 ? 39.274 -34.737 14.415 1.00 58.33  ? 160  ALA A C   1 
ATOM   1228 O O   . ALA A 1 160 ? 40.341 -34.151 14.197 1.00 58.33  ? 160  ALA A O   1 
ATOM   1229 C CB  . ALA A 1 160 ? 39.760 -36.819 13.111 1.00 49.78  ? 160  ALA A CB  1 
ATOM   1230 N N   . GLU A 1 161 ? 38.128 -34.090 14.648 1.00 44.10  ? 161  GLU A N   1 
ATOM   1231 C CA  . GLU A 1 161 ? 38.111 -32.623 14.644 1.00 44.10  ? 161  GLU A CA  1 
ATOM   1232 C C   . GLU A 1 161 ? 38.295 -32.065 16.060 1.00 44.10  ? 161  GLU A C   1 
ATOM   1233 O O   . GLU A 1 161 ? 37.505 -31.253 16.571 1.00 44.10  ? 161  GLU A O   1 
ATOM   1234 C CB  . GLU A 1 161 ? 36.839 -32.076 13.970 1.00 142.90 ? 161  GLU A CB  1 
ATOM   1235 C CG  . GLU A 1 161 ? 35.563 -32.064 14.784 1.00 142.90 ? 161  GLU A CG  1 
ATOM   1236 C CD  . GLU A 1 161 ? 34.448 -31.301 14.070 1.00 142.90 ? 161  GLU A CD  1 
ATOM   1237 O OE1 . GLU A 1 161 ? 34.011 -31.749 12.984 1.00 142.90 ? 161  GLU A OE1 1 
ATOM   1238 O OE2 . GLU A 1 161 ? 34.019 -30.247 14.588 1.00 142.90 ? 161  GLU A OE2 1 
ATOM   1239 N N   . VAL A 1 162 ? 39.392 -32.497 16.670 1.00 56.65  ? 162  VAL A N   1 
ATOM   1240 C CA  . VAL A 1 162 ? 39.726 -32.102 18.025 1.00 56.65  ? 162  VAL A CA  1 
ATOM   1241 C C   . VAL A 1 162 ? 41.106 -31.469 18.134 1.00 56.65  ? 162  VAL A C   1 
ATOM   1242 O O   . VAL A 1 162 ? 42.005 -31.784 17.357 1.00 56.65  ? 162  VAL A O   1 
ATOM   1243 C CB  . VAL A 1 162 ? 39.654 -33.331 18.978 1.00 64.09  ? 162  VAL A CB  1 
ATOM   1244 C CG1 . VAL A 1 162 ? 38.246 -33.908 18.975 1.00 64.09  ? 162  VAL A CG1 1 
ATOM   1245 C CG2 . VAL A 1 162 ? 40.658 -34.393 18.542 1.00 64.09  ? 162  VAL A CG2 1 
ATOM   1246 N N   . VAL A 1 163 ? 41.261 -30.574 19.108 1.00 35.58  ? 163  VAL A N   1 
ATOM   1247 C CA  . VAL A 1 163 ? 42.531 -29.903 19.355 1.00 35.58  ? 163  VAL A CA  1 
ATOM   1248 C C   . VAL A 1 163 ? 42.914 -28.950 18.223 1.00 35.58  ? 163  VAL A C   1 
ATOM   1249 O O   . VAL A 1 163 ? 42.955 -29.342 17.061 1.00 35.58  ? 163  VAL A O   1 
ATOM   1250 C CB  . VAL A 1 163 ? 43.699 -30.926 19.510 1.00 30.31  ? 163  VAL A CB  1 
ATOM   1251 C CG1 . VAL A 1 163 ? 44.871 -30.263 20.203 1.00 30.31  ? 163  VAL A CG1 1 
ATOM   1252 C CG2 . VAL A 1 163 ? 43.229 -32.181 20.264 1.00 30.31  ? 163  VAL A CG2 1 
ATOM   1253 N N   . THR A 1 164 ? 43.202 -27.701 18.575 1.00 33.06  ? 164  THR A N   1 
ATOM   1254 C CA  . THR A 1 164 ? 43.630 -26.699 17.612 1.00 33.06  ? 164  THR A CA  1 
ATOM   1255 C C   . THR A 1 164 ? 44.847 -27.228 16.844 1.00 33.06  ? 164  THR A C   1 
ATOM   1256 O O   . THR A 1 164 ? 45.659 -28.012 17.381 1.00 33.06  ? 164  THR A O   1 
ATOM   1257 C CB  . THR A 1 164 ? 44.046 -25.404 18.314 1.00 37.84  ? 164  THR A CB  1 
ATOM   1258 O OG1 . THR A 1 164 ? 43.006 -25.000 19.213 1.00 37.84  ? 164  THR A OG1 1 
ATOM   1259 C CG2 . THR A 1 164 ? 44.305 -24.309 17.290 1.00 37.84  ? 164  THR A CG2 1 
ATOM   1260 N N   . LEU A 1 165 ? 44.974 -26.772 15.596 1.00 28.87  ? 165  LEU A N   1 
ATOM   1261 C CA  . LEU A 1 165 ? 46.051 -27.198 14.712 1.00 28.87  ? 165  LEU A CA  1 
ATOM   1262 C C   . LEU A 1 165 ? 47.435 -27.346 15.349 1.00 28.87  ? 165  LEU A C   1 
ATOM   1263 O O   . LEU A 1 165 ? 48.004 -28.438 15.367 1.00 28.87  ? 165  LEU A O   1 
ATOM   1264 C CB  . LEU A 1 165 ? 46.144 -26.245 13.516 1.00 34.06  ? 165  LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 165 ? 47.250 -26.509 12.484 1.00 34.06  ? 165  LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 165 ? 47.193 -27.947 11.980 1.00 34.06  ? 165  LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 165 ? 47.080 -25.538 11.325 1.00 34.06  ? 165  LEU A CD2 1 
ATOM   1268 N N   . TRP A 1 166 ? 47.971 -26.253 15.877 1.00 37.46  ? 166  TRP A N   1 
ATOM   1269 C CA  . TRP A 1 166 ? 49.309 -26.284 16.457 1.00 37.46  ? 166  TRP A CA  1 
ATOM   1270 C C   . TRP A 1 166 ? 49.556 -27.198 17.643 1.00 37.46  ? 166  TRP A C   1 
ATOM   1271 O O   . TRP A 1 166 ? 50.691 -27.351 18.071 1.00 37.46  ? 166  TRP A O   1 
ATOM   1272 C CB  . TRP A 1 166 ? 49.739 -24.883 16.841 1.00 30.79  ? 166  TRP A CB  1 
ATOM   1273 C CG  . TRP A 1 166 ? 49.714 -23.912 15.727 1.00 30.79  ? 166  TRP A CG  1 
ATOM   1274 C CD1 . TRP A 1 166 ? 49.686 -24.179 14.377 1.00 30.79  ? 166  TRP A CD1 1 
ATOM   1275 C CD2 . TRP A 1 166 ? 49.739 -22.492 15.856 1.00 30.79  ? 166  TRP A CD2 1 
ATOM   1276 N NE1 . TRP A 1 166 ? 49.695 -22.998 13.659 1.00 30.79  ? 166  TRP A NE1 1 
ATOM   1277 C CE2 . TRP A 1 166 ? 49.728 -21.950 14.543 1.00 30.79  ? 166  TRP A CE2 1 
ATOM   1278 C CE3 . TRP A 1 166 ? 49.772 -21.621 16.957 1.00 30.79  ? 166  TRP A CE3 1 
ATOM   1279 C CZ2 . TRP A 1 166 ? 49.742 -20.581 14.306 1.00 30.79  ? 166  TRP A CZ2 1 
ATOM   1280 C CZ3 . TRP A 1 166 ? 49.785 -20.265 16.725 1.00 30.79  ? 166  TRP A CZ3 1 
ATOM   1281 C CH2 . TRP A 1 166 ? 49.772 -19.752 15.403 1.00 30.79  ? 166  TRP A CH2 1 
ATOM   1282 N N   . TYR A 1 167 ? 48.518 -27.802 18.192 1.00 42.11  ? 167  TYR A N   1 
ATOM   1283 C CA  . TYR A 1 167 ? 48.731 -28.686 19.328 1.00 42.11  ? 167  TYR A CA  1 
ATOM   1284 C C   . TYR A 1 167 ? 48.227 -30.082 18.996 1.00 42.11  ? 167  TYR A C   1 
ATOM   1285 O O   . TYR A 1 167 ? 48.299 -30.991 19.818 1.00 42.11  ? 167  TYR A O   1 
ATOM   1286 C CB  . TYR A 1 167 ? 48.029 -28.113 20.558 1.00 30.24  ? 167  TYR A CB  1 
ATOM   1287 C CG  . TYR A 1 167 ? 48.530 -26.734 20.866 1.00 30.24  ? 167  TYR A CG  1 
ATOM   1288 C CD1 . TYR A 1 167 ? 49.640 -26.545 21.696 1.00 30.24  ? 167  TYR A CD1 1 
ATOM   1289 C CD2 . TYR A 1 167 ? 47.997 -25.621 20.214 1.00 30.24  ? 167  TYR A CD2 1 
ATOM   1290 C CE1 . TYR A 1 167 ? 50.215 -25.281 21.854 1.00 30.24  ? 167  TYR A CE1 1 
ATOM   1291 C CE2 . TYR A 1 167 ? 48.567 -24.357 20.362 1.00 30.24  ? 167  TYR A CE2 1 
ATOM   1292 C CZ  . TYR A 1 167 ? 49.675 -24.194 21.178 1.00 30.24  ? 167  TYR A CZ  1 
ATOM   1293 O OH  . TYR A 1 167 ? 50.255 -22.948 21.308 1.00 30.24  ? 167  TYR A OH  1 
ATOM   1294 N N   . ARG A 1 168 ? 47.742 -30.242 17.770 1.00 32.35  ? 168  ARG A N   1 
ATOM   1295 C CA  . ARG A 1 168 ? 47.223 -31.520 17.319 1.00 32.35  ? 168  ARG A CA  1 
ATOM   1296 C C   . ARG A 1 168 ? 48.349 -32.547 17.135 1.00 32.35  ? 168  ARG A C   1 
ATOM   1297 O O   . ARG A 1 168 ? 49.348 -32.267 16.474 1.00 32.35  ? 168  ARG A O   1 
ATOM   1298 C CB  . ARG A 1 168 ? 46.460 -31.321 16.013 1.00 53.84  ? 168  ARG A CB  1 
ATOM   1299 C CG  . ARG A 1 168 ? 45.499 -32.441 15.687 1.00 53.84  ? 168  ARG A CG  1 
ATOM   1300 C CD  . ARG A 1 168 ? 44.217 -31.874 15.114 1.00 53.84  ? 168  ARG A CD  1 
ATOM   1301 N NE  . ARG A 1 168 ? 44.495 -31.093 13.918 1.00 53.84  ? 168  ARG A NE  1 
ATOM   1302 C CZ  . ARG A 1 168 ? 43.686 -30.165 13.429 1.00 53.84  ? 168  ARG A CZ  1 
ATOM   1303 N NH1 . ARG A 1 168 ? 42.536 -29.898 14.038 1.00 53.84  ? 168  ARG A NH1 1 
ATOM   1304 N NH2 . ARG A 1 168 ? 44.033 -29.503 12.333 1.00 53.84  ? 168  ARG A NH2 1 
ATOM   1305 N N   . PRO A 1 169 ? 48.214 -33.741 17.741 1.00 50.33  ? 169  PRO A N   1 
ATOM   1306 C CA  . PRO A 1 169 ? 49.279 -34.738 17.575 1.00 50.33  ? 169  PRO A CA  1 
ATOM   1307 C C   . PRO A 1 169 ? 49.277 -35.322 16.162 1.00 50.33  ? 169  PRO A C   1 
ATOM   1308 O O   . PRO A 1 169 ? 48.227 -35.390 15.494 1.00 50.33  ? 169  PRO A O   1 
ATOM   1309 C CB  . PRO A 1 169 ? 48.969 -35.774 18.657 1.00 28.77  ? 169  PRO A CB  1 
ATOM   1310 C CG  . PRO A 1 169 ? 47.467 -35.708 18.767 1.00 28.77  ? 169  PRO A CG  1 
ATOM   1311 C CD  . PRO A 1 169 ? 47.173 -34.216 18.673 1.00 28.77  ? 169  PRO A CD  1 
ATOM   1312 N N   . PRO A 1 170 ? 50.458 -35.740 15.678 1.00 48.23  ? 170  PRO A N   1 
ATOM   1313 C CA  . PRO A 1 170 ? 50.566 -36.305 14.336 1.00 48.23  ? 170  PRO A CA  1 
ATOM   1314 C C   . PRO A 1 170 ? 49.584 -37.412 13.978 1.00 48.23  ? 170  PRO A C   1 
ATOM   1315 O O   . PRO A 1 170 ? 49.089 -37.426 12.857 1.00 48.23  ? 170  PRO A O   1 
ATOM   1316 C CB  . PRO A 1 170 ? 52.036 -36.732 14.251 1.00 41.72  ? 170  PRO A CB  1 
ATOM   1317 C CG  . PRO A 1 170 ? 52.472 -36.834 15.674 1.00 41.72  ? 170  PRO A CG  1 
ATOM   1318 C CD  . PRO A 1 170 ? 51.771 -35.703 16.339 1.00 41.72  ? 170  PRO A CD  1 
ATOM   1319 N N   . ASP A 1 171 ? 49.278 -38.325 14.898 1.00 36.27  ? 171  ASP A N   1 
ATOM   1320 C CA  . ASP A 1 171 ? 48.331 -39.404 14.570 1.00 36.27  ? 171  ASP A CA  1 
ATOM   1321 C C   . ASP A 1 171 ? 46.972 -38.846 14.151 1.00 36.27  ? 171  ASP A C   1 
ATOM   1322 O O   . ASP A 1 171 ? 46.370 -39.304 13.179 1.00 36.27  ? 171  ASP A O   1 
ATOM   1323 C CB  . ASP A 1 171 ? 48.140 -40.369 15.745 1.00 43.56  ? 171  ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 171 ? 47.588 -39.685 16.979 1.00 43.56  ? 171  ASP A CG  1 
ATOM   1325 O OD1 . ASP A 1 171 ? 46.632 -40.224 17.584 1.00 43.56  ? 171  ASP A OD1 1 
ATOM   1326 O OD2 . ASP A 1 171 ? 48.119 -38.612 17.344 1.00 43.56  ? 171  ASP A OD2 1 
ATOM   1327 N N   . VAL A 1 172 ? 46.492 -37.850 14.885 1.00 38.28  ? 172  VAL A N   1 
ATOM   1328 C CA  . VAL A 1 172 ? 45.214 -37.233 14.580 1.00 38.28  ? 172  VAL A CA  1 
ATOM   1329 C C   . VAL A 1 172 ? 45.329 -36.476 13.255 1.00 38.28  ? 172  VAL A C   1 
ATOM   1330 O O   . VAL A 1 172 ? 44.381 -36.417 12.472 1.00 38.28  ? 172  VAL A O   1 
ATOM   1331 C CB  . VAL A 1 172 ? 44.821 -36.258 15.705 1.00 31.19  ? 172  VAL A CB  1 
ATOM   1332 C CG1 . VAL A 1 172 ? 43.439 -35.669 15.452 1.00 31.19  ? 172  VAL A CG1 1 
ATOM   1333 C CG2 . VAL A 1 172 ? 44.891 -36.976 17.036 1.00 31.19  ? 172  VAL A CG2 1 
ATOM   1334 N N   . LEU A 1 173 ? 46.493 -35.879 13.014 1.00 37.69  ? 173  LEU A N   1 
ATOM   1335 C CA  . LEU A 1 173 ? 46.714 -35.141 11.775 1.00 37.69  ? 173  LEU A CA  1 
ATOM   1336 C C   . LEU A 1 173 ? 46.574 -36.161 10.659 1.00 37.69  ? 173  LEU A C   1 
ATOM   1337 O O   . LEU A 1 173 ? 46.037 -35.871 9.595  1.00 37.69  ? 173  LEU A O   1 
ATOM   1338 C CB  . LEU A 1 173 ? 48.107 -34.503 11.767 1.00 21.15  ? 173  LEU A CB  1 
ATOM   1339 C CG  . LEU A 1 173 ? 48.319 -33.357 12.787 1.00 21.15  ? 173  LEU A CG  1 
ATOM   1340 C CD1 . LEU A 1 173 ? 49.784 -32.895 12.777 1.00 21.15  ? 173  LEU A CD1 1 
ATOM   1341 C CD2 . LEU A 1 173 ? 47.401 -32.178 12.465 1.00 21.15  ? 173  LEU A CD2 1 
ATOM   1342 N N   . PHE A 1 174 ? 47.033 -37.374 10.929 1.00 32.88  ? 174  PHE A N   1 
ATOM   1343 C CA  . PHE A 1 174 ? 46.949 -38.453 9.965  1.00 32.88  ? 174  PHE A CA  1 
ATOM   1344 C C   . PHE A 1 174 ? 45.529 -38.980 9.901  1.00 32.88  ? 174  PHE A C   1 
ATOM   1345 O O   . PHE A 1 174 ? 45.311 -40.117 9.474  1.00 32.88  ? 174  PHE A O   1 
ATOM   1346 C CB  . PHE A 1 174 ? 47.893 -39.587 10.367 1.00 39.53  ? 174  PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 174 ? 49.323 -39.363 9.967  1.00 39.53  ? 174  PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 174 ? 50.348 -40.012 10.640 1.00 39.53  ? 174  PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 174 ? 49.640 -38.543 8.889  1.00 39.53  ? 174  PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 174 ? 51.672 -39.849 10.247 1.00 39.53  ? 174  PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 174 ? 50.950 -38.374 8.489  1.00 39.53  ? 174  PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 174 ? 51.977 -39.030 9.166  1.00 39.53  ? 174  PHE A CZ  1 
ATOM   1353 N N   . GLY A 1 175 ? 44.571 -38.176 10.357 1.00 52.51  ? 175  GLY A N   1 
ATOM   1354 C CA  . GLY A 1 175 ? 43.172 -38.582 10.328 1.00 52.51  ? 175  GLY A CA  1 
ATOM   1355 C C   . GLY A 1 175 ? 42.658 -39.605 11.344 1.00 52.51  ? 175  GLY A C   1 
ATOM   1356 O O   . GLY A 1 175 ? 41.505 -40.036 11.253 1.00 52.51  ? 175  GLY A O   1 
ATOM   1357 N N   . ALA A 1 176 ? 43.481 -40.000 12.314 1.00 49.25  ? 176  ALA A N   1 
ATOM   1358 C CA  . ALA A 1 176 ? 43.033 -40.976 13.309 1.00 49.25  ? 176  ALA A CA  1 
ATOM   1359 C C   . ALA A 1 176 ? 41.771 -40.494 14.028 1.00 49.25  ? 176  ALA A C   1 
ATOM   1360 O O   . ALA A 1 176 ? 41.734 -39.376 14.550 1.00 49.25  ? 176  ALA A O   1 
ATOM   1361 C CB  . ALA A 1 176 ? 44.137 -41.237 14.315 1.00 25.08  ? 176  ALA A CB  1 
ATOM   1362 N N   . LYS A 1 177 ? 40.737 -41.335 14.038 1.00 57.73  ? 177  LYS A N   1 
ATOM   1363 C CA  . LYS A 1 177 ? 39.468 -41.003 14.695 1.00 57.73  ? 177  LYS A CA  1 
ATOM   1364 C C   . LYS A 1 177 ? 39.388 -41.604 16.089 1.00 57.73  ? 177  LYS A C   1 
ATOM   1365 O O   . LYS A 1 177 ? 38.539 -41.213 16.900 1.00 57.73  ? 177  LYS A O   1 
ATOM   1366 C CB  . LYS A 1 177 ? 38.274 -41.506 13.879 1.00 82.18  ? 177  LYS A CB  1 
ATOM   1367 C CG  . LYS A 1 177 ? 37.832 -40.575 12.765 1.00 82.18  ? 177  LYS A CG  1 
ATOM   1368 C CD  . LYS A 1 177 ? 36.419 -40.906 12.321 1.00 82.18  ? 177  LYS A CD  1 
ATOM   1369 C CE  . LYS A 1 177 ? 35.891 -39.852 11.369 1.00 82.18  ? 177  LYS A CE  1 
ATOM   1370 N NZ  . LYS A 1 177 ? 34.461 -40.072 11.036 1.00 82.18  ? 177  LYS A NZ  1 
ATOM   1371 N N   . LEU A 1 178 ? 40.264 -42.567 16.361 1.00 41.44  ? 178  LEU A N   1 
ATOM   1372 C CA  . LEU A 1 178 ? 40.298 -43.216 17.659 1.00 41.44  ? 178  LEU A CA  1 
ATOM   1373 C C   . LEU A 1 178 ? 41.622 -42.870 18.336 1.00 41.44  ? 178  LEU A C   1 
ATOM   1374 O O   . LEU A 1 178 ? 42.679 -42.983 17.721 1.00 41.44  ? 178  LEU A O   1 
ATOM   1375 C CB  . LEU A 1 178 ? 40.164 -44.731 17.486 1.00 82.63  ? 178  LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 178 ? 39.966 -45.584 18.742 1.00 82.63  ? 178  LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 178 ? 39.535 -46.979 18.322 1.00 82.63  ? 178  LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 178 ? 41.245 -45.633 19.575 1.00 82.63  ? 178  LEU A CD2 1 
ATOM   1379 N N   . TYR A 1 179 ? 41.559 -42.453 19.599 1.00 40.06  ? 179  TYR A N   1 
ATOM   1380 C CA  . TYR A 1 179 ? 42.755 -42.092 20.365 1.00 40.06  ? 179  TYR A CA  1 
ATOM   1381 C C   . TYR A 1 179 ? 42.547 -42.254 21.867 1.00 40.06  ? 179  TYR A C   1 
ATOM   1382 O O   . TYR A 1 179 ? 41.430 -42.449 22.340 1.00 40.06  ? 179  TYR A O   1 
ATOM   1383 C CB  . TYR A 1 179 ? 43.147 -40.650 20.067 1.00 38.70  ? 179  TYR A CB  1 
ATOM   1384 C CG  . TYR A 1 179 ? 41.966 -39.711 20.017 1.00 38.70  ? 179  TYR A CG  1 
ATOM   1385 C CD1 . TYR A 1 179 ? 41.232 -39.419 21.162 1.00 38.70  ? 179  TYR A CD1 1 
ATOM   1386 C CD2 . TYR A 1 179 ? 41.565 -39.137 18.813 1.00 38.70  ? 179  TYR A CD2 1 
ATOM   1387 C CE1 . TYR A 1 179 ? 40.138 -38.580 21.112 1.00 38.70  ? 179  TYR A CE1 1 
ATOM   1388 C CE2 . TYR A 1 179 ? 40.466 -38.294 18.752 1.00 38.70  ? 179  TYR A CE2 1 
ATOM   1389 C CZ  . TYR A 1 179 ? 39.756 -38.019 19.905 1.00 38.70  ? 179  TYR A CZ  1 
ATOM   1390 O OH  . TYR A 1 179 ? 38.677 -37.166 19.849 1.00 38.70  ? 179  TYR A OH  1 
ATOM   1391 N N   . SER A 1 180 ? 43.631 -42.151 22.622 1.00 38.97  ? 180  SER A N   1 
ATOM   1392 C CA  . SER A 1 180 ? 43.552 -42.303 24.066 1.00 38.97  ? 180  SER A CA  1 
ATOM   1393 C C   . SER A 1 180 ? 43.975 -41.005 24.743 1.00 38.97  ? 180  SER A C   1 
ATOM   1394 O O   . SER A 1 180 ? 44.037 -39.959 24.098 1.00 38.97  ? 180  SER A O   1 
ATOM   1395 C CB  . SER A 1 180 ? 44.468 -43.445 24.505 1.00 38.63  ? 180  SER A CB  1 
ATOM   1396 O OG  . SER A 1 180 ? 45.829 -43.148 24.217 1.00 38.63  ? 180  SER A OG  1 
ATOM   1397 N N   . THR A 1 181 ? 44.268 -41.087 26.041 1.00 37.65  ? 181  THR A N   1 
ATOM   1398 C CA  . THR A 1 181 ? 44.710 -39.936 26.823 1.00 37.65  ? 181  THR A CA  1 
ATOM   1399 C C   . THR A 1 181 ? 46.033 -39.396 26.270 1.00 37.65  ? 181  THR A C   1 
ATOM   1400 O O   . THR A 1 181 ? 46.393 -38.241 26.508 1.00 37.65  ? 181  THR A O   1 
ATOM   1401 C CB  . THR A 1 181 ? 44.934 -40.308 28.300 1.00 41.75  ? 181  THR A CB  1 
ATOM   1402 O OG1 . THR A 1 181 ? 45.837 -41.420 28.366 1.00 41.75  ? 181  THR A OG1 1 
ATOM   1403 C CG2 . THR A 1 181 ? 43.634 -40.666 28.981 1.00 41.75  ? 181  THR A CG2 1 
ATOM   1404 N N   . SER A 1 182 ? 46.757 -40.225 25.525 1.00 35.55  ? 182  SER A N   1 
ATOM   1405 C CA  . SER A 1 182 ? 48.019 -39.787 24.950 1.00 35.55  ? 182  SER A CA  1 
ATOM   1406 C C   . SER A 1 182 ? 47.823 -38.526 24.108 1.00 35.55  ? 182  SER A C   1 
ATOM   1407 O O   . SER A 1 182 ? 48.770 -37.756 23.901 1.00 35.55  ? 182  SER A O   1 
ATOM   1408 C CB  . SER A 1 182 ? 48.625 -40.890 24.083 1.00 55.93  ? 182  SER A CB  1 
ATOM   1409 O OG  . SER A 1 182 ? 47.932 -41.005 22.856 1.00 55.93  ? 182  SER A OG  1 
ATOM   1410 N N   . ILE A 1 183 ? 46.598 -38.307 23.633 1.00 31.26  ? 183  ILE A N   1 
ATOM   1411 C CA  . ILE A 1 183 ? 46.311 -37.132 22.806 1.00 31.26  ? 183  ILE A CA  1 
ATOM   1412 C C   . ILE A 1 183 ? 46.489 -35.800 23.541 1.00 31.26  ? 183  ILE A C   1 
ATOM   1413 O O   . ILE A 1 183 ? 46.884 -34.813 22.928 1.00 31.26  ? 183  ILE A O   1 
ATOM   1414 C CB  . ILE A 1 183 ? 44.888 -37.177 22.246 1.00 32.84  ? 183  ILE A CB  1 
ATOM   1415 C CG1 . ILE A 1 183 ? 44.703 -36.080 21.210 1.00 32.84  ? 183  ILE A CG1 1 
ATOM   1416 C CG2 . ILE A 1 183 ? 43.884 -36.997 23.359 1.00 32.84  ? 183  ILE A CG2 1 
ATOM   1417 C CD1 . ILE A 1 183 ? 43.322 -36.088 20.609 1.00 32.84  ? 183  ILE A CD1 1 
ATOM   1418 N N   . ASP A 1 184 ? 46.186 -35.760 24.841 1.00 31.37  ? 184  ASP A N   1 
ATOM   1419 C CA  . ASP A 1 184 ? 46.360 -34.523 25.592 1.00 31.37  ? 184  ASP A CA  1 
ATOM   1420 C C   . ASP A 1 184 ? 47.813 -34.390 26.015 1.00 31.37  ? 184  ASP A C   1 
ATOM   1421 O O   . ASP A 1 184 ? 48.290 -33.280 26.278 1.00 31.37  ? 184  ASP A O   1 
ATOM   1422 C CB  . ASP A 1 184 ? 45.467 -34.486 26.837 1.00 39.40  ? 184  ASP A CB  1 
ATOM   1423 C CG  . ASP A 1 184 ? 43.990 -34.390 26.499 1.00 39.40  ? 184  ASP A CG  1 
ATOM   1424 O OD1 . ASP A 1 184 ? 43.627 -33.733 25.499 1.00 39.40  ? 184  ASP A OD1 1 
ATOM   1425 O OD2 . ASP A 1 184 ? 43.181 -34.964 27.256 1.00 39.40  ? 184  ASP A OD2 1 
ATOM   1426 N N   . MET A 1 185 ? 48.519 -35.520 26.065 1.00 44.57  ? 185  MET A N   1 
ATOM   1427 C CA  . MET A 1 185 ? 49.929 -35.528 26.451 1.00 44.57  ? 185  MET A CA  1 
ATOM   1428 C C   . MET A 1 185 ? 50.807 -34.818 25.431 1.00 44.57  ? 185  MET A C   1 
ATOM   1429 O O   . MET A 1 185 ? 51.743 -34.106 25.800 1.00 44.57  ? 185  MET A O   1 
ATOM   1430 C CB  . MET A 1 185 ? 50.406 -36.958 26.644 1.00 33.93  ? 185  MET A CB  1 
ATOM   1431 C CG  . MET A 1 185 ? 49.711 -37.660 27.807 1.00 33.93  ? 185  MET A CG  1 
ATOM   1432 S SD  . MET A 1 185 ? 49.503 -36.561 29.253 1.00 33.93  ? 185  MET A SD  1 
ATOM   1433 C CE  . MET A 1 185 ? 51.220 -35.925 29.506 1.00 33.93  ? 185  MET A CE  1 
ATOM   1434 N N   . TRP A 1 186 ? 50.499 -35.009 24.147 1.00 33.87  ? 186  TRP A N   1 
ATOM   1435 C CA  . TRP A 1 186 ? 51.242 -34.360 23.077 1.00 33.87  ? 186  TRP A CA  1 
ATOM   1436 C C   . TRP A 1 186 ? 51.055 -32.853 23.187 1.00 33.87  ? 186  TRP A C   1 
ATOM   1437 O O   . TRP A 1 186 ? 52.001 -32.079 23.122 1.00 33.87  ? 186  TRP A O   1 
ATOM   1438 C CB  . TRP A 1 186 ? 50.727 -34.814 21.716 1.00 29.23  ? 186  TRP A CB  1 
ATOM   1439 C CG  . TRP A 1 186 ? 51.392 -34.117 20.600 1.00 29.23  ? 186  TRP A CG  1 
ATOM   1440 C CD1 . TRP A 1 186 ? 51.064 -32.909 20.071 1.00 29.23  ? 186  TRP A CD1 1 
ATOM   1441 C CD2 . TRP A 1 186 ? 52.556 -34.559 19.912 1.00 29.23  ? 186  TRP A CD2 1 
ATOM   1442 N NE1 . TRP A 1 186 ? 51.957 -32.564 19.085 1.00 29.23  ? 186  TRP A NE1 1 
ATOM   1443 C CE2 . TRP A 1 186 ? 52.885 -33.562 18.965 1.00 29.23  ? 186  TRP A CE2 1 
ATOM   1444 C CE3 . TRP A 1 186 ? 53.364 -35.710 20.006 1.00 29.23  ? 186  TRP A CE3 1 
ATOM   1445 C CZ2 . TRP A 1 186 ? 53.987 -33.676 18.107 1.00 29.23  ? 186  TRP A CZ2 1 
ATOM   1446 C CZ3 . TRP A 1 186 ? 54.462 -35.826 19.152 1.00 29.23  ? 186  TRP A CZ3 1 
ATOM   1447 C CH2 . TRP A 1 186 ? 54.761 -34.809 18.213 1.00 29.23  ? 186  TRP A CH2 1 
ATOM   1448 N N   . SER A 1 187 ? 49.814 -32.430 23.321 1.00 29.46  ? 187  SER A N   1 
ATOM   1449 C CA  . SER A 1 187 ? 49.558 -31.025 23.450 1.00 29.46  ? 187  SER A CA  1 
ATOM   1450 C C   . SER A 1 187 ? 50.356 -30.510 24.656 1.00 29.46  ? 187  SER A C   1 
ATOM   1451 O O   . SER A 1 187 ? 50.987 -29.446 24.591 1.00 29.46  ? 187  SER A O   1 
ATOM   1452 C CB  . SER A 1 187 ? 48.055 -30.803 23.620 1.00 30.24  ? 187  SER A CB  1 
ATOM   1453 O OG  . SER A 1 187 ? 47.354 -31.318 22.495 1.00 30.24  ? 187  SER A OG  1 
ATOM   1454 N N   . ALA A 1 188 ? 50.360 -31.281 25.742 1.00 33.22  ? 188  ALA A N   1 
ATOM   1455 C CA  . ALA A 1 188 ? 51.091 -30.889 26.941 1.00 33.22  ? 188  ALA A CA  1 
ATOM   1456 C C   . ALA A 1 188 ? 52.576 -30.652 26.602 1.00 33.22  ? 188  ALA A C   1 
ATOM   1457 O O   . ALA A 1 188 ? 53.168 -29.632 27.006 1.00 33.22  ? 188  ALA A O   1 
ATOM   1458 C CB  . ALA A 1 188 ? 50.954 -31.970 28.011 1.00 41.40  ? 188  ALA A CB  1 
ATOM   1459 N N   . GLY A 1 189 ? 53.167 -31.596 25.864 1.00 39.91  ? 189  GLY A N   1 
ATOM   1460 C CA  . GLY A 1 189 ? 54.557 -31.460 25.453 1.00 39.91  ? 189  GLY A CA  1 
ATOM   1461 C C   . GLY A 1 189 ? 54.761 -30.146 24.713 1.00 39.91  ? 189  GLY A C   1 
ATOM   1462 O O   . GLY A 1 189 ? 55.687 -29.390 25.024 1.00 39.91  ? 189  GLY A O   1 
ATOM   1463 N N   . CYS A 1 190 ? 53.900 -29.861 23.733 1.00 36.96  ? 190  CYS A N   1 
ATOM   1464 C CA  . CYS A 1 190 ? 54.007 -28.614 22.976 1.00 36.96  ? 190  CYS A CA  1 
ATOM   1465 C C   . CYS A 1 190 ? 53.989 -27.437 23.953 1.00 36.96  ? 190  CYS A C   1 
ATOM   1466 O O   . CYS A 1 190 ? 54.903 -26.599 23.955 1.00 36.96  ? 190  CYS A O   1 
ATOM   1467 C CB  . CYS A 1 190 ? 52.851 -28.471 21.966 1.00 27.19  ? 190  CYS A CB  1 
ATOM   1468 S SG  . CYS A 1 190 ? 52.886 -29.684 20.598 1.00 27.19  ? 190  CYS A SG  1 
ATOM   1469 N N   . ILE A 1 191 ? 52.947 -27.375 24.778 1.00 37.63  ? 191  ILE A N   1 
ATOM   1470 C CA  . ILE A 1 191 ? 52.836 -26.306 25.751 1.00 37.63  ? 191  ILE A CA  1 
ATOM   1471 C C   . ILE A 1 191 ? 54.133 -26.181 26.574 1.00 37.63  ? 191  ILE A C   1 
ATOM   1472 O O   . ILE A 1 191 ? 54.586 -25.074 26.880 1.00 37.63  ? 191  ILE A O   1 
ATOM   1473 C CB  . ILE A 1 191 ? 51.610 -26.543 26.650 1.00 37.91  ? 191  ILE A CB  1 
ATOM   1474 C CG1 . ILE A 1 191 ? 50.368 -26.058 25.902 1.00 37.91  ? 191  ILE A CG1 1 
ATOM   1475 C CG2 . ILE A 1 191 ? 51.766 -25.826 27.998 1.00 37.91  ? 191  ILE A CG2 1 
ATOM   1476 C CD1 . ILE A 1 191 ? 49.036 -26.558 26.450 1.00 37.91  ? 191  ILE A CD1 1 
ATOM   1477 N N   . PHE A 1 192 ? 54.735 -27.315 26.919 1.00 41.41  ? 192  PHE A N   1 
ATOM   1478 C CA  . PHE A 1 192 ? 55.993 -27.296 27.660 1.00 41.41  ? 192  PHE A CA  1 
ATOM   1479 C C   . PHE A 1 192 ? 57.041 -26.576 26.796 1.00 41.41  ? 192  PHE A C   1 
ATOM   1480 O O   . PHE A 1 192 ? 57.655 -25.610 27.239 1.00 41.41  ? 192  PHE A O   1 
ATOM   1481 C CB  . PHE A 1 192 ? 56.453 -28.727 27.976 1.00 49.73  ? 192  PHE A CB  1 
ATOM   1482 C CG  . PHE A 1 192 ? 57.673 -28.798 28.858 1.00 49.73  ? 192  PHE A CG  1 
ATOM   1483 C CD1 . PHE A 1 192 ? 58.069 -27.701 29.621 1.00 49.73  ? 192  PHE A CD1 1 
ATOM   1484 C CD2 . PHE A 1 192 ? 58.379 -29.990 28.989 1.00 49.73  ? 192  PHE A CD2 1 
ATOM   1485 C CE1 . PHE A 1 192 ? 59.146 -27.790 30.491 1.00 49.73  ? 192  PHE A CE1 1 
ATOM   1486 C CE2 . PHE A 1 192 ? 59.465 -30.089 29.863 1.00 49.73  ? 192  PHE A CE2 1 
ATOM   1487 C CZ  . PHE A 1 192 ? 59.842 -28.991 30.618 1.00 49.73  ? 192  PHE A CZ  1 
ATOM   1488 N N   . ALA A 1 193 ? 57.234 -27.034 25.562 1.00 29.84  ? 193  ALA A N   1 
ATOM   1489 C CA  . ALA A 1 193 ? 58.200 -26.382 24.682 1.00 29.84  ? 193  ALA A CA  1 
ATOM   1490 C C   . ALA A 1 193 ? 57.974 -24.870 24.686 1.00 29.84  ? 193  ALA A C   1 
ATOM   1491 O O   . ALA A 1 193 ? 58.913 -24.079 24.844 1.00 29.84  ? 193  ALA A O   1 
ATOM   1492 C CB  . ALA A 1 193 ? 58.086 -26.923 23.250 1.00 36.19  ? 193  ALA A CB  1 
ATOM   1493 N N   . GLU A 1 194 ? 56.719 -24.474 24.520 1.00 44.32  ? 194  GLU A N   1 
ATOM   1494 C CA  . GLU A 1 194 ? 56.367 -23.064 24.505 1.00 44.32  ? 194  GLU A CA  1 
ATOM   1495 C C   . GLU A 1 194 ? 56.792 -22.445 25.828 1.00 44.32  ? 194  GLU A C   1 
ATOM   1496 O O   . GLU A 1 194 ? 57.403 -21.378 25.863 1.00 44.32  ? 194  GLU A O   1 
ATOM   1497 C CB  . GLU A 1 194 ? 54.851 -22.920 24.310 1.00 45.85  ? 194  GLU A CB  1 
ATOM   1498 C CG  . GLU A 1 194 ? 54.434 -21.769 23.416 1.00 45.85  ? 194  GLU A CG  1 
ATOM   1499 C CD  . GLU A 1 194 ? 52.991 -21.889 22.941 1.00 45.85  ? 194  GLU A CD  1 
ATOM   1500 O OE1 . GLU A 1 194 ? 52.593 -23.015 22.537 1.00 45.85  ? 194  GLU A OE1 1 
ATOM   1501 O OE2 . GLU A 1 194 ? 52.271 -20.860 22.958 1.00 45.85  ? 194  GLU A OE2 1 
ATOM   1502 N N   . LEU A 1 195 ? 56.472 -23.141 26.914 1.00 42.93  ? 195  LEU A N   1 
ATOM   1503 C CA  . LEU A 1 195 ? 56.791 -22.677 28.260 1.00 42.93  ? 195  LEU A CA  1 
ATOM   1504 C C   . LEU A 1 195 ? 58.275 -22.387 28.402 1.00 42.93  ? 195  LEU A C   1 
ATOM   1505 O O   . LEU A 1 195 ? 58.666 -21.291 28.809 1.00 42.93  ? 195  LEU A O   1 
ATOM   1506 C CB  . LEU A 1 195 ? 56.363 -23.731 29.297 1.00 30.86  ? 195  LEU A CB  1 
ATOM   1507 C CG  . LEU A 1 195 ? 55.473 -23.350 30.497 1.00 30.86  ? 195  LEU A CG  1 
ATOM   1508 C CD1 . LEU A 1 195 ? 54.584 -22.151 30.206 1.00 30.86  ? 195  LEU A CD1 1 
ATOM   1509 C CD2 . LEU A 1 195 ? 54.606 -24.541 30.850 1.00 30.86  ? 195  LEU A CD2 1 
ATOM   1510 N N   . ALA A 1 196 ? 59.104 -23.356 28.033 1.00 51.22  ? 196  ALA A N   1 
ATOM   1511 C CA  . ALA A 1 196 ? 60.542 -23.212 28.163 1.00 51.22  ? 196  ALA A CA  1 
ATOM   1512 C C   . ALA A 1 196 ? 61.299 -22.492 27.050 1.00 51.22  ? 196  ALA A C   1 
ATOM   1513 O O   . ALA A 1 196 ? 62.454 -22.817 26.779 1.00 51.22  ? 196  ALA A O   1 
ATOM   1514 C CB  . ALA A 1 196 ? 61.155 -24.575 28.402 1.00 55.73  ? 196  ALA A CB  1 
ATOM   1515 N N   . ASN A 1 197 ? 60.661 -21.532 26.394 1.00 76.42  ? 197  ASN A N   1 
ATOM   1516 C CA  . ASN A 1 197 ? 61.345 -20.763 25.358 1.00 76.42  ? 197  ASN A CA  1 
ATOM   1517 C C   . ASN A 1 197 ? 60.684 -19.397 25.225 1.00 76.42  ? 197  ASN A C   1 
ATOM   1518 O O   . ASN A 1 197 ? 59.988 -18.945 26.132 1.00 76.42  ? 197  ASN A O   1 
ATOM   1519 C CB  . ASN A 1 197 ? 61.348 -21.498 24.008 1.00 84.03  ? 197  ASN A CB  1 
ATOM   1520 C CG  . ASN A 1 197 ? 62.213 -20.790 22.947 1.00 58.85  ? 197  ASN A CG  1 
ATOM   1521 O OD1 . ASN A 1 197 ? 63.415 -20.576 23.135 1.00 58.85  ? 197  ASN A OD1 1 
ATOM   1522 N ND2 . ASN A 1 197 ? 61.592 -20.426 21.829 1.00 58.85  ? 197  ASN A ND2 1 
ATOM   1523 N N   . ALA A 1 198 ? 60.896 -18.733 24.101 1.00 75.41  ? 198  ALA A N   1 
ATOM   1524 C CA  . ALA A 1 198 ? 60.334 -17.410 23.903 1.00 75.41  ? 198  ALA A CA  1 
ATOM   1525 C C   . ALA A 1 198 ? 58.818 -17.391 24.058 1.00 75.41  ? 198  ALA A C   1 
ATOM   1526 O O   . ALA A 1 198 ? 58.172 -16.376 23.781 1.00 75.41  ? 198  ALA A O   1 
ATOM   1527 C CB  . ALA A 1 198 ? 60.735 -16.885 22.526 1.00 117.60 ? 198  ALA A CB  1 
ATOM   1528 N N   . ALA A 1 199 ? 58.256 -18.511 24.503 1.00 50.03  ? 199  ALA A N   1 
ATOM   1529 C CA  . ALA A 1 199 ? 56.814 -18.631 24.686 1.00 50.03  ? 199  ALA A CA  1 
ATOM   1530 C C   . ALA A 1 199 ? 56.067 -18.663 23.333 1.00 50.03  ? 199  ALA A C   1 
ATOM   1531 O O   . ALA A 1 199 ? 54.854 -18.459 23.264 1.00 50.03  ? 199  ALA A O   1 
ATOM   1532 C CB  . ALA A 1 199 ? 56.326 -17.490 25.535 1.00 39.57  ? 199  ALA A CB  1 
ATOM   1533 N N   . ARG A 1 200 ? 56.808 -18.920 22.261 1.00 39.14  ? 200  ARG A N   1 
ATOM   1534 C CA  . ARG A 1 200 ? 56.229 -19.001 20.930 1.00 39.14  ? 200  ARG A CA  1 
ATOM   1535 C C   . ARG A 1 200 ? 55.881 -20.460 20.632 1.00 39.14  ? 200  ARG A C   1 
ATOM   1536 O O   . ARG A 1 200 ? 56.600 -21.375 21.031 1.00 39.14  ? 200  ARG A O   1 
ATOM   1537 C CB  . ARG A 1 200 ? 57.232 -18.495 19.881 1.00 55.49  ? 200  ARG A CB  1 
ATOM   1538 C CG  . ARG A 1 200 ? 57.521 -16.996 19.935 1.00 55.49  ? 200  ARG A CG  1 
ATOM   1539 C CD  . ARG A 1 200 ? 56.256 -16.191 19.691 1.00 55.49  ? 200  ARG A CD  1 
ATOM   1540 N NE  . ARG A 1 200 ? 56.405 -14.789 20.066 1.00 55.49  ? 200  ARG A NE  1 
ATOM   1541 C CZ  . ARG A 1 200 ? 55.395 -13.930 20.132 1.00 55.49  ? 200  ARG A CZ  1 
ATOM   1542 N NH1 . ARG A 1 200 ? 54.162 -14.324 19.847 1.00 55.49  ? 200  ARG A NH1 1 
ATOM   1543 N NH2 . ARG A 1 200 ? 55.616 -12.677 20.497 1.00 55.49  ? 200  ARG A NH2 1 
ATOM   1544 N N   . PRO A 1 201 ? 54.775 -20.703 19.920 1.00 39.29  ? 201  PRO A N   1 
ATOM   1545 C CA  . PRO A 1 201 ? 54.410 -22.092 19.617 1.00 39.29  ? 201  PRO A CA  1 
ATOM   1546 C C   . PRO A 1 201 ? 55.584 -22.843 19.001 1.00 39.29  ? 201  PRO A C   1 
ATOM   1547 O O   . PRO A 1 201 ? 56.354 -22.265 18.240 1.00 39.29  ? 201  PRO A O   1 
ATOM   1548 C CB  . PRO A 1 201 ? 53.249 -21.927 18.645 1.00 54.10  ? 201  PRO A CB  1 
ATOM   1549 C CG  . PRO A 1 201 ? 52.584 -20.675 19.150 1.00 48.41  ? 201  PRO A CG  1 
ATOM   1550 C CD  . PRO A 1 201 ? 53.764 -19.762 19.404 1.00 48.41  ? 201  PRO A CD  1 
ATOM   1551 N N   . LEU A 1 202 ? 55.712 -24.129 19.316 1.00 45.57  ? 202  LEU A N   1 
ATOM   1552 C CA  . LEU A 1 202 ? 56.802 -24.944 18.786 1.00 45.57  ? 202  LEU A CA  1 
ATOM   1553 C C   . LEU A 1 202 ? 56.569 -25.466 17.358 1.00 45.57  ? 202  LEU A C   1 
ATOM   1554 O O   . LEU A 1 202 ? 57.530 -25.759 16.639 1.00 45.57  ? 202  LEU A O   1 
ATOM   1555 C CB  . LEU A 1 202 ? 57.063 -26.129 19.714 1.00 26.28  ? 202  LEU A CB  1 
ATOM   1556 C CG  . LEU A 1 202 ? 58.091 -27.150 19.210 1.00 26.28  ? 202  LEU A CG  1 
ATOM   1557 C CD1 . LEU A 1 202 ? 59.440 -26.466 19.067 1.00 26.28  ? 202  LEU A CD1 1 
ATOM   1558 C CD2 . LEU A 1 202 ? 58.174 -28.330 20.157 1.00 26.28  ? 202  LEU A CD2 1 
ATOM   1559 N N   . PHE A 1 203 ? 55.304 -25.583 16.954 1.00 44.82  ? 203  PHE A N   1 
ATOM   1560 C CA  . PHE A 1 203 ? 54.949 -26.085 15.626 1.00 44.82  ? 203  PHE A CA  1 
ATOM   1561 C C   . PHE A 1 203 ? 53.768 -25.310 15.025 1.00 44.82  ? 203  PHE A C   1 
ATOM   1562 O O   . PHE A 1 203 ? 52.658 -25.847 14.915 1.00 44.82  ? 203  PHE A O   1 
ATOM   1563 C CB  . PHE A 1 203 ? 54.543 -27.547 15.729 1.00 31.87  ? 203  PHE A CB  1 
ATOM   1564 C CG  . PHE A 1 203 ? 55.605 -28.452 16.271 1.00 31.87  ? 203  PHE A CG  1 
ATOM   1565 C CD1 . PHE A 1 203 ? 56.890 -28.463 15.721 1.00 31.87  ? 203  PHE A CD1 1 
ATOM   1566 C CD2 . PHE A 1 203 ? 55.300 -29.368 17.280 1.00 31.87  ? 203  PHE A CD2 1 
ATOM   1567 C CE1 . PHE A 1 203 ? 57.851 -29.375 16.166 1.00 31.87  ? 203  PHE A CE1 1 
ATOM   1568 C CE2 . PHE A 1 203 ? 56.257 -30.290 17.736 1.00 31.87  ? 203  PHE A CE2 1 
ATOM   1569 C CZ  . PHE A 1 203 ? 57.532 -30.295 17.180 1.00 31.87  ? 203  PHE A CZ  1 
ATOM   1570 N N   . PRO A 1 204 ? 53.988 -24.056 14.596 1.00 49.48  ? 204  PRO A N   1 
ATOM   1571 C CA  . PRO A 1 204 ? 52.900 -23.243 14.018 1.00 49.48  ? 204  PRO A CA  1 
ATOM   1572 C C   . PRO A 1 204 ? 52.624 -23.378 12.501 1.00 49.48  ? 204  PRO A C   1 
ATOM   1573 O O   . PRO A 1 204 ? 52.797 -22.415 11.758 1.00 49.48  ? 204  PRO A O   1 
ATOM   1574 C CB  . PRO A 1 204 ? 53.324 -21.829 14.387 1.00 27.92  ? 204  PRO A CB  1 
ATOM   1575 C CG  . PRO A 1 204 ? 54.858 -21.908 14.126 1.00 27.92  ? 204  PRO A CG  1 
ATOM   1576 C CD  . PRO A 1 204 ? 55.241 -23.278 14.707 1.00 27.92  ? 204  PRO A CD  1 
ATOM   1577 N N   . GLY A 1 205 ? 52.174 -24.544 12.045 1.00 42.59  ? 205  GLY A N   1 
ATOM   1578 C CA  . GLY A 1 205 ? 51.903 -24.714 10.625 1.00 42.59  ? 205  GLY A CA  1 
ATOM   1579 C C   . GLY A 1 205 ? 50.732 -23.890 10.093 1.00 42.59  ? 205  GLY A C   1 
ATOM   1580 O O   . GLY A 1 205 ? 49.921 -23.364 10.875 1.00 42.59  ? 205  GLY A O   1 
ATOM   1581 N N   . ASN A 1 206 ? 50.634 -23.793 8.764  1.00 48.83  ? 206  ASN A N   1 
ATOM   1582 C CA  . ASN A 1 206 ? 49.570 -23.031 8.101  1.00 48.83  ? 206  ASN A CA  1 
ATOM   1583 C C   . ASN A 1 206 ? 48.385 -23.915 7.700  1.00 48.83  ? 206  ASN A C   1 
ATOM   1584 O O   . ASN A 1 206 ? 47.344 -23.424 7.263  1.00 48.83  ? 206  ASN A O   1 
ATOM   1585 C CB  . ASN A 1 206 ? 50.114 -22.356 6.840  1.00 76.19  ? 206  ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 206 ? 51.503 -21.791 7.033  1.00 76.19  ? 206  ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 206 ? 51.726 -20.908 7.863  1.00 76.19  ? 206  ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 206 ? 52.450 -22.300 6.261  1.00 76.19  ? 206  ASN A ND2 1 
ATOM   1589 N N   . ASP A 1 207 ? 48.560 -25.223 7.841  1.00 37.93  ? 207  ASP A N   1 
ATOM   1590 C CA  . ASP A 1 207 ? 47.535 -26.196 7.497  1.00 37.93  ? 207  ASP A CA  1 
ATOM   1591 C C   . ASP A 1 207 ? 48.048 -27.568 7.935  1.00 37.93  ? 207  ASP A C   1 
ATOM   1592 O O   . ASP A 1 207 ? 49.197 -27.696 8.357  1.00 37.93  ? 207  ASP A O   1 
ATOM   1593 C CB  . ASP A 1 207 ? 47.291 -26.175 5.992  1.00 44.34  ? 207  ASP A CB  1 
ATOM   1594 C CG  . ASP A 1 207 ? 48.519 -26.572 5.202  1.00 44.34  ? 207  ASP A CG  1 
ATOM   1595 O OD1 . ASP A 1 207 ? 48.954 -27.731 5.327  1.00 44.34  ? 207  ASP A OD1 1 
ATOM   1596 O OD2 . ASP A 1 207 ? 49.056 -25.729 4.460  1.00 44.34  ? 207  ASP A OD2 1 
ATOM   1597 N N   . VAL A 1 208 ? 47.206 -28.591 7.823  1.00 39.90  ? 208  VAL A N   1 
ATOM   1598 C CA  . VAL A 1 208 ? 47.601 -29.923 8.247  1.00 39.90  ? 208  VAL A CA  1 
ATOM   1599 C C   . VAL A 1 208 ? 48.922 -30.394 7.650  1.00 39.90  ? 208  VAL A C   1 
ATOM   1600 O O   . VAL A 1 208 ? 49.821 -30.797 8.397  1.00 39.90  ? 208  VAL A O   1 
ATOM   1601 C CB  . VAL A 1 208 ? 46.498 -30.967 7.940  1.00 32.79  ? 208  VAL A CB  1 
ATOM   1602 C CG1 . VAL A 1 208 ? 47.009 -32.375 8.254  1.00 32.79  ? 208  VAL A CG1 1 
ATOM   1603 C CG2 . VAL A 1 208 ? 45.255 -30.667 8.779  1.00 32.79  ? 208  VAL A CG2 1 
ATOM   1604 N N   . ASP A 1 209 ? 49.042 -30.355 6.319  1.00 30.38  ? 209  ASP A N   1 
ATOM   1605 C CA  . ASP A 1 209 ? 50.267 -30.774 5.652  1.00 30.38  ? 209  ASP A CA  1 
ATOM   1606 C C   . ASP A 1 209 ? 51.461 -30.030 6.247  1.00 30.38  ? 209  ASP A C   1 
ATOM   1607 O O   . ASP A 1 209 ? 52.493 -30.624 6.563  1.00 30.38  ? 209  ASP A O   1 
ATOM   1608 C CB  . ASP A 1 209 ? 50.176 -30.506 4.143  1.00 42.04  ? 209  ASP A CB  1 
ATOM   1609 C CG  . ASP A 1 209 ? 51.547 -30.538 3.447  1.00 42.04  ? 209  ASP A CG  1 
ATOM   1610 O OD1 . ASP A 1 209 ? 51.966 -29.492 2.908  1.00 42.04  ? 209  ASP A OD1 1 
ATOM   1611 O OD2 . ASP A 1 209 ? 52.213 -31.596 3.436  1.00 42.04  ? 209  ASP A OD2 1 
ATOM   1612 N N   . ASP A 1 210 ? 51.320 -28.728 6.415  1.00 41.78  ? 210  ASP A N   1 
ATOM   1613 C CA  . ASP A 1 210 ? 52.410 -27.953 6.965  1.00 41.78  ? 210  ASP A CA  1 
ATOM   1614 C C   . ASP A 1 210 ? 52.695 -28.366 8.411  1.00 41.78  ? 210  ASP A C   1 
ATOM   1615 O O   . ASP A 1 210 ? 53.854 -28.474 8.822  1.00 41.78  ? 210  ASP A O   1 
ATOM   1616 C CB  . ASP A 1 210 ? 52.077 -26.464 6.890  1.00 63.10  ? 210  ASP A CB  1 
ATOM   1617 C CG  . ASP A 1 210 ? 53.276 -25.593 7.159  1.00 63.10  ? 210  ASP A CG  1 
ATOM   1618 O OD1 . ASP A 1 210 ? 54.372 -25.963 6.689  1.00 63.10  ? 210  ASP A OD1 1 
ATOM   1619 O OD2 . ASP A 1 210 ? 53.123 -24.543 7.828  1.00 63.10  ? 210  ASP A OD2 1 
ATOM   1620 N N   . GLN A 1 211 ? 51.642 -28.618 9.179  1.00 35.01  ? 211  GLN A N   1 
ATOM   1621 C CA  . GLN A 1 211 ? 51.829 -28.998 10.570 1.00 35.01  ? 211  GLN A CA  1 
ATOM   1622 C C   . GLN A 1 211 ? 52.722 -30.223 10.638 1.00 35.01  ? 211  GLN A C   1 
ATOM   1623 O O   . GLN A 1 211 ? 53.699 -30.268 11.390 1.00 35.01  ? 211  GLN A O   1 
ATOM   1624 C CB  . GLN A 1 211 ? 50.488 -29.306 11.222 1.00 44.96  ? 211  GLN A CB  1 
ATOM   1625 C CG  . GLN A 1 211 ? 50.563 -29.486 12.728 1.00 44.96  ? 211  GLN A CG  1 
ATOM   1626 C CD  . GLN A 1 211 ? 51.049 -28.238 13.428 1.00 44.96  ? 211  GLN A CD  1 
ATOM   1627 O OE1 . GLN A 1 211 ? 50.784 -27.123 12.979 1.00 44.96  ? 211  GLN A OE1 1 
ATOM   1628 N NE2 . GLN A 1 211 ? 51.749 -28.414 14.536 1.00 44.96  ? 211  GLN A NE2 1 
ATOM   1629 N N   . LEU A 1 212 ? 52.377 -31.219 9.837  1.00 49.78  ? 212  LEU A N   1 
ATOM   1630 C CA  . LEU A 1 212 ? 53.133 -32.450 9.791  1.00 49.78  ? 212  LEU A CA  1 
ATOM   1631 C C   . LEU A 1 212 ? 54.609 -32.191 9.480  1.00 49.78  ? 212  LEU A C   1 
ATOM   1632 O O   . LEU A 1 212 ? 55.490 -32.692 10.181 1.00 49.78  ? 212  LEU A O   1 
ATOM   1633 C CB  . LEU A 1 212 ? 52.515 -33.372 8.744  1.00 39.12  ? 212  LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 212 ? 51.106 -33.868 9.086  1.00 39.12  ? 212  LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 212 ? 50.492 -34.533 7.870  1.00 39.12  ? 212  LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 212 ? 51.182 -34.841 10.264 1.00 39.12  ? 212  LEU A CD2 1 
ATOM   1637 N N   . LYS A 1 213 ? 54.879 -31.401 8.443  1.00 39.63  ? 213  LYS A N   1 
ATOM   1638 C CA  . LYS A 1 213 ? 56.257 -31.098 8.064  1.00 39.63  ? 213  LYS A CA  1 
ATOM   1639 C C   . LYS A 1 213 ? 57.106 -30.534 9.199  1.00 39.63  ? 213  LYS A C   1 
ATOM   1640 O O   . LYS A 1 213 ? 58.205 -31.032 9.464  1.00 39.63  ? 213  LYS A O   1 
ATOM   1641 C CB  . LYS A 1 213 ? 56.300 -30.102 6.911  1.00 54.12  ? 213  LYS A CB  1 
ATOM   1642 C CG  . LYS A 1 213 ? 55.817 -30.631 5.588  1.00 54.12  ? 213  LYS A CG  1 
ATOM   1643 C CD  . LYS A 1 213 ? 55.938 -29.537 4.558  1.00 54.12  ? 213  LYS A CD  1 
ATOM   1644 C CE  . LYS A 1 213 ? 55.178 -29.849 3.304  1.00 54.12  ? 213  LYS A CE  1 
ATOM   1645 N NZ  . LYS A 1 213 ? 55.294 -28.699 2.389  1.00 54.12  ? 213  LYS A NZ  1 
ATOM   1646 N N   . ARG A 1 214 ? 56.615 -29.495 9.866  1.00 39.46  ? 214  ARG A N   1 
ATOM   1647 C CA  . ARG A 1 214 ? 57.390 -28.894 10.942 1.00 39.46  ? 214  ARG A CA  1 
ATOM   1648 C C   . ARG A 1 214 ? 57.716 -29.897 12.043 1.00 39.46  ? 214  ARG A C   1 
ATOM   1649 O O   . ARG A 1 214 ? 58.801 -29.855 12.637 1.00 39.46  ? 214  ARG A O   1 
ATOM   1650 C CB  . ARG A 1 214 ? 56.641 -27.714 11.551 1.00 45.63  ? 214  ARG A CB  1 
ATOM   1651 C CG  . ARG A 1 214 ? 56.087 -26.778 10.530 1.00 45.63  ? 214  ARG A CG  1 
ATOM   1652 C CD  . ARG A 1 214 ? 56.090 -25.368 11.032 1.00 45.63  ? 214  ARG A CD  1 
ATOM   1653 N NE  . ARG A 1 214 ? 55.432 -24.495 10.071 1.00 45.63  ? 214  ARG A NE  1 
ATOM   1654 C CZ  . ARG A 1 214 ? 55.627 -23.185 10.002 1.00 45.63  ? 214  ARG A CZ  1 
ATOM   1655 N NH1 . ARG A 1 214 ? 56.470 -22.598 10.842 1.00 45.63  ? 214  ARG A NH1 1 
ATOM   1656 N NH2 . ARG A 1 214 ? 54.971 -22.466 9.098  1.00 45.63  ? 214  ARG A NH2 1 
ATOM   1657 N N   . ILE A 1 215 ? 56.765 -30.791 12.307 1.00 40.48  ? 215  ILE A N   1 
ATOM   1658 C CA  . ILE A 1 215 ? 56.920 -31.796 13.337 1.00 40.48  ? 215  ILE A CA  1 
ATOM   1659 C C   . ILE A 1 215 ? 58.002 -32.774 12.958 1.00 40.48  ? 215  ILE A C   1 
ATOM   1660 O O   . ILE A 1 215 ? 58.956 -32.969 13.707 1.00 40.48  ? 215  ILE A O   1 
ATOM   1661 C CB  . ILE A 1 215 ? 55.610 -32.590 13.570 1.00 30.27  ? 215  ILE A CB  1 
ATOM   1662 C CG1 . ILE A 1 215 ? 54.519 -31.658 14.108 1.00 30.27  ? 215  ILE A CG1 1 
ATOM   1663 C CG2 . ILE A 1 215 ? 55.853 -33.719 14.569 1.00 30.27  ? 215  ILE A CG2 1 
ATOM   1664 C CD1 . ILE A 1 215 ? 53.223 -32.364 14.463 1.00 30.27  ? 215  ILE A CD1 1 
ATOM   1665 N N   . PHE A 1 216 ? 57.859 -33.392 11.793 1.00 42.62  ? 216  PHE A N   1 
ATOM   1666 C CA  . PHE A 1 216 ? 58.842 -34.373 11.360 1.00 42.62  ? 216  PHE A CA  1 
ATOM   1667 C C   . PHE A 1 216 ? 60.177 -33.716 11.055 1.00 42.62  ? 216  PHE A C   1 
ATOM   1668 O O   . PHE A 1 216 ? 61.231 -34.318 11.269 1.00 42.62  ? 216  PHE A O   1 
ATOM   1669 C CB  . PHE A 1 216 ? 58.347 -35.138 10.136 1.00 38.60  ? 216  PHE A CB  1 
ATOM   1670 C CG  . PHE A 1 216 ? 57.032 -35.818 10.344 1.00 38.60  ? 216  PHE A CG  1 
ATOM   1671 C CD1 . PHE A 1 216 ? 56.556 -36.061 11.625 1.00 38.60  ? 216  PHE A CD1 1 
ATOM   1672 C CD2 . PHE A 1 216 ? 56.266 -36.212 9.263  1.00 38.60  ? 216  PHE A CD2 1 
ATOM   1673 C CE1 . PHE A 1 216 ? 55.337 -36.678 11.827 1.00 38.60  ? 216  PHE A CE1 1 
ATOM   1674 C CE2 . PHE A 1 216 ? 55.043 -36.832 9.455  1.00 38.60  ? 216  PHE A CE2 1 
ATOM   1675 C CZ  . PHE A 1 216 ? 54.579 -37.064 10.738 1.00 38.60  ? 216  PHE A CZ  1 
ATOM   1676 N N   . ARG A 1 217 ? 60.139 -32.478 10.579 1.00 47.38  ? 217  ARG A N   1 
ATOM   1677 C CA  . ARG A 1 217 ? 61.376 -31.797 10.269 1.00 47.38  ? 217  ARG A CA  1 
ATOM   1678 C C   . ARG A 1 217 ? 62.254 -31.709 11.512 1.00 47.38  ? 217  ARG A C   1 
ATOM   1679 O O   . ARG A 1 217 ? 63.484 -31.763 11.418 1.00 47.38  ? 217  ARG A O   1 
ATOM   1680 C CB  . ARG A 1 217 ? 61.102 -30.399 9.715  1.00 100.45 ? 217  ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 217 ? 62.316 -29.793 9.058  1.00 100.45 ? 217  ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 217 ? 62.100 -28.354 8.655  1.00 100.45 ? 217  ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 217 ? 63.343 -27.753 8.171  1.00 100.45 ? 217  ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 217 ? 63.496 -26.459 7.907  1.00 100.45 ? 217  ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 217 ? 62.481 -25.620 8.077  1.00 100.45 ? 217  ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 217 ? 64.668 -25.996 7.482  1.00 100.45 ? 217  ARG A NH2 1 
ATOM   1687 N N   . LEU A 1 218 ? 61.620 -31.596 12.677 1.00 55.64  ? 218  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 218 ? 62.343 -31.495 13.945 1.00 55.64  ? 218  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 218 ? 62.495 -32.820 14.692 1.00 55.64  ? 218  LEU A C   1 
ATOM   1690 O O   . LEU A 1 218 ? 63.568 -33.126 15.197 1.00 55.64  ? 218  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 218 ? 61.651 -30.487 14.869 1.00 35.24  ? 218  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 218 ? 62.194 -30.345 16.306 1.00 35.24  ? 218  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 218 ? 63.100 -29.114 16.425 1.00 35.24  ? 218  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 218 ? 61.028 -30.231 17.276 1.00 35.24  ? 218  LEU A CD2 1 
ATOM   1695 N N   . LEU A 1 219 ? 61.426 -33.603 14.777 1.00 45.70  ? 219  LEU A N   1 
ATOM   1696 C CA  . LEU A 1 219 ? 61.490 -34.873 15.494 1.00 45.70  ? 219  LEU A CA  1 
ATOM   1697 C C   . LEU A 1 219 ? 61.974 -36.035 14.638 1.00 45.70  ? 219  LEU A C   1 
ATOM   1698 O O   . LEU A 1 219 ? 62.366 -37.075 15.158 1.00 45.70  ? 219  LEU A O   1 
ATOM   1699 C CB  . LEU A 1 219 ? 60.114 -35.206 16.095 1.00 44.00  ? 219  LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 219 ? 59.880 -34.920 17.593 1.00 44.00  ? 219  LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 219 ? 60.684 -33.713 18.069 1.00 44.00  ? 219  LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 219 ? 58.392 -34.712 17.826 1.00 44.00  ? 219  LEU A CD2 1 
ATOM   1703 N N   . GLY A 1 220 ? 61.970 -35.849 13.325 1.00 46.31  ? 220  GLY A N   1 
ATOM   1704 C CA  . GLY A 1 220 ? 62.386 -36.915 12.438 1.00 46.31  ? 220  GLY A CA  1 
ATOM   1705 C C   . GLY A 1 220 ? 61.128 -37.665 12.059 1.00 46.31  ? 220  GLY A C   1 
ATOM   1706 O O   . GLY A 1 220 ? 60.319 -38.003 12.929 1.00 46.31  ? 220  GLY A O   1 
ATOM   1707 N N   . THR A 1 221 ? 60.955 -37.912 10.764 1.00 43.26  ? 221  THR A N   1 
ATOM   1708 C CA  . THR A 1 221 ? 59.790 -38.609 10.241 1.00 43.26  ? 221  THR A CA  1 
ATOM   1709 C C   . THR A 1 221 ? 59.683 -40.023 10.785 1.00 43.26  ? 221  THR A C   1 
ATOM   1710 O O   . THR A 1 221 ? 60.666 -40.752 10.835 1.00 43.26  ? 221  THR A O   1 
ATOM   1711 C CB  . THR A 1 221 ? 59.856 -38.677 8.727  1.00 39.74  ? 221  THR A CB  1 
ATOM   1712 O OG1 . THR A 1 221 ? 60.167 -37.378 8.211  1.00 39.74  ? 221  THR A OG1 1 
ATOM   1713 C CG2 . THR A 1 221 ? 58.530 -39.151 8.162  1.00 39.74  ? 221  THR A CG2 1 
ATOM   1714 N N   . PRO A 1 222 ? 58.480 -40.437 11.199 1.00 58.73  ? 222  PRO A N   1 
ATOM   1715 C CA  . PRO A 1 222 ? 58.260 -41.784 11.750 1.00 58.73  ? 222  PRO A CA  1 
ATOM   1716 C C   . PRO A 1 222 ? 58.515 -42.941 10.776 1.00 58.73  ? 222  PRO A C   1 
ATOM   1717 O O   . PRO A 1 222 ? 58.116 -42.880 9.616  1.00 58.73  ? 222  PRO A O   1 
ATOM   1718 C CB  . PRO A 1 222 ? 56.791 -41.746 12.180 1.00 81.74  ? 222  PRO A CB  1 
ATOM   1719 C CG  . PRO A 1 222 ? 56.513 -40.279 12.395 1.00 81.74  ? 222  PRO A CG  1 
ATOM   1720 C CD  . PRO A 1 222 ? 57.247 -39.632 11.260 1.00 81.74  ? 222  PRO A CD  1 
ATOM   1721 N N   . THR A 1 223 ? 59.173 -43.998 11.245 1.00 67.83  ? 223  THR A N   1 
ATOM   1722 C CA  . THR A 1 223 ? 59.411 -45.162 10.391 1.00 67.83  ? 223  THR A CA  1 
ATOM   1723 C C   . THR A 1 223 ? 58.469 -46.269 10.841 1.00 67.83  ? 223  THR A C   1 
ATOM   1724 O O   . THR A 1 223 ? 58.224 -46.443 12.035 1.00 67.83  ? 223  THR A O   1 
ATOM   1725 C CB  . THR A 1 223 ? 60.835 -45.701 10.503 1.00 66.05  ? 223  THR A CB  1 
ATOM   1726 O OG1 . THR A 1 223 ? 61.037 -46.211 11.826 1.00 66.05  ? 223  THR A OG1 1 
ATOM   1727 C CG2 . THR A 1 223 ? 61.849 -44.611 10.200 1.00 66.05  ? 223  THR A CG2 1 
ATOM   1728 N N   . GLU A 1 224 ? 57.951 -47.016 9.874  1.00 67.98  ? 224  GLU A N   1 
ATOM   1729 C CA  . GLU A 1 224 ? 57.023 -48.102 10.146 1.00 67.98  ? 224  GLU A CA  1 
ATOM   1730 C C   . GLU A 1 224 ? 57.486 -48.994 11.302 1.00 67.98  ? 224  GLU A C   1 
ATOM   1731 O O   . GLU A 1 224 ? 56.677 -49.660 11.943 1.00 67.98  ? 224  GLU A O   1 
ATOM   1732 C CB  . GLU A 1 224 ? 56.825 -48.922 8.868  1.00 118.32 ? 224  GLU A CB  1 
ATOM   1733 C CG  . GLU A 1 224 ? 56.687 -48.051 7.615  1.00 118.32 ? 224  GLU A CG  1 
ATOM   1734 C CD  . GLU A 1 224 ? 56.407 -48.848 6.353  1.00 118.32 ? 224  GLU A CD  1 
ATOM   1735 O OE1 . GLU A 1 224 ? 56.807 -50.030 6.292  1.00 118.32 ? 224  GLU A OE1 1 
ATOM   1736 O OE2 . GLU A 1 224 ? 55.801 -48.287 5.414  1.00 118.32 ? 224  GLU A OE2 1 
ATOM   1737 N N   . GLU A 1 225 ? 58.787 -48.997 11.572 1.00 69.74  ? 225  GLU A N   1 
ATOM   1738 C CA  . GLU A 1 225 ? 59.343 -49.802 12.654 1.00 69.74  ? 225  GLU A CA  1 
ATOM   1739 C C   . GLU A 1 225 ? 58.997 -49.213 14.007 1.00 69.74  ? 225  GLU A C   1 
ATOM   1740 O O   . GLU A 1 225 ? 58.622 -49.930 14.933 1.00 69.74  ? 225  GLU A O   1 
ATOM   1741 C CB  . GLU A 1 225 ? 60.863 -49.884 12.532 1.00 146.04 ? 225  GLU A CB  1 
ATOM   1742 C CG  . GLU A 1 225 ? 61.366 -51.130 11.837 1.00 146.04 ? 225  GLU A CG  1 
ATOM   1743 C CD  . GLU A 1 225 ? 62.881 -51.146 11.691 1.00 146.04 ? 225  GLU A CD  1 
ATOM   1744 O OE1 . GLU A 1 225 ? 63.587 -51.029 12.720 1.00 146.04 ? 225  GLU A OE1 1 
ATOM   1745 O OE2 . GLU A 1 225 ? 63.363 -51.277 10.543 1.00 146.04 ? 225  GLU A OE2 1 
ATOM   1746 N N   . GLN A 1 226 ? 59.138 -47.896 14.106 1.00 65.42  ? 226  GLN A N   1 
ATOM   1747 C CA  . GLN A 1 226 ? 58.871 -47.165 15.338 1.00 65.42  ? 226  GLN A CA  1 
ATOM   1748 C C   . GLN A 1 226 ? 57.375 -46.922 15.515 1.00 65.42  ? 226  GLN A C   1 
ATOM   1749 O O   . GLN A 1 226 ? 56.892 -46.770 16.637 1.00 65.42  ? 226  GLN A O   1 
ATOM   1750 C CB  . GLN A 1 226 ? 59.595 -45.812 15.309 1.00 104.46 ? 226  GLN A CB  1 
ATOM   1751 C CG  . GLN A 1 226 ? 60.940 -45.826 14.598 1.00 104.46 ? 226  GLN A CG  1 
ATOM   1752 C CD  . GLN A 1 226 ? 61.555 -44.442 14.468 1.00 104.46 ? 226  GLN A CD  1 
ATOM   1753 O OE1 . GLN A 1 226 ? 60.889 -43.487 14.063 1.00 104.46 ? 226  GLN A OE1 1 
ATOM   1754 N NE2 . GLN A 1 226 ? 62.835 -44.332 14.800 1.00 104.46 ? 226  GLN A NE2 1 
ATOM   1755 N N   . TRP A 1 227 ? 56.647 -46.887 14.403 1.00 55.38  ? 227  TRP A N   1 
ATOM   1756 C CA  . TRP A 1 227 ? 55.217 -46.626 14.443 1.00 55.38  ? 227  TRP A CA  1 
ATOM   1757 C C   . TRP A 1 227 ? 54.471 -47.436 13.376 1.00 55.38  ? 227  TRP A C   1 
ATOM   1758 O O   . TRP A 1 227 ? 53.888 -46.878 12.443 1.00 55.38  ? 227  TRP A O   1 
ATOM   1759 C CB  . TRP A 1 227 ? 54.987 -45.119 14.246 1.00 33.06  ? 227  TRP A CB  1 
ATOM   1760 C CG  . TRP A 1 227 ? 53.587 -44.658 14.514 1.00 33.06  ? 227  TRP A CG  1 
ATOM   1761 C CD1 . TRP A 1 227 ? 52.535 -45.416 14.960 1.00 33.06  ? 227  TRP A CD1 1 
ATOM   1762 C CD2 . TRP A 1 227 ? 53.063 -43.342 14.290 1.00 33.06  ? 227  TRP A CD2 1 
ATOM   1763 N NE1 . TRP A 1 227 ? 51.386 -44.653 15.015 1.00 33.06  ? 227  TRP A NE1 1 
ATOM   1764 C CE2 . TRP A 1 227 ? 51.682 -43.378 14.614 1.00 33.06  ? 227  TRP A CE2 1 
ATOM   1765 C CE3 . TRP A 1 227 ? 53.624 -42.137 13.851 1.00 33.06  ? 227  TRP A CE3 1 
ATOM   1766 C CZ2 . TRP A 1 227 ? 50.860 -42.261 14.499 1.00 33.06  ? 227  TRP A CZ2 1 
ATOM   1767 C CZ3 . TRP A 1 227 ? 52.804 -41.026 13.737 1.00 33.06  ? 227  TRP A CZ3 1 
ATOM   1768 C CH2 . TRP A 1 227 ? 51.436 -41.095 14.063 1.00 33.06  ? 227  TRP A CH2 1 
ATOM   1769 N N   . PRO A 1 228 ? 54.470 -48.770 13.515 1.00 56.96  ? 228  PRO A N   1 
ATOM   1770 C CA  . PRO A 1 228 ? 53.827 -49.745 12.620 1.00 56.96  ? 228  PRO A CA  1 
ATOM   1771 C C   . PRO A 1 228 ? 52.408 -49.418 12.137 1.00 56.96  ? 228  PRO A C   1 
ATOM   1772 O O   . PRO A 1 228 ? 52.131 -49.421 10.939 1.00 56.96  ? 228  PRO A O   1 
ATOM   1773 C CB  . PRO A 1 228 ? 53.855 -51.028 13.442 1.00 75.36  ? 228  PRO A CB  1 
ATOM   1774 C CG  . PRO A 1 228 ? 55.131 -50.890 14.209 1.00 75.36  ? 228  PRO A CG  1 
ATOM   1775 C CD  . PRO A 1 228 ? 55.079 -49.453 14.670 1.00 75.36  ? 228  PRO A CD  1 
ATOM   1776 N N   . SER A 1 229 ? 51.508 -49.142 13.068 1.00 40.97  ? 229  SER A N   1 
ATOM   1777 C CA  . SER A 1 229 ? 50.125 -48.847 12.701 1.00 40.97  ? 229  SER A CA  1 
ATOM   1778 C C   . SER A 1 229 ? 49.842 -47.517 11.975 1.00 40.97  ? 229  SER A C   1 
ATOM   1779 O O   . SER A 1 229 ? 48.726 -47.317 11.501 1.00 40.97  ? 229  SER A O   1 
ATOM   1780 C CB  . SER A 1 229 ? 49.241 -48.940 13.952 1.00 62.59  ? 229  SER A CB  1 
ATOM   1781 O OG  . SER A 1 229 ? 49.769 -48.167 15.019 1.00 62.59  ? 229  SER A OG  1 
ATOM   1782 N N   . MET A 1 230 ? 50.830 -46.629 11.863 1.00 53.37  ? 230  MET A N   1 
ATOM   1783 C CA  . MET A 1 230 ? 50.615 -45.330 11.210 1.00 53.37  ? 230  MET A CA  1 
ATOM   1784 C C   . MET A 1 230 ? 50.126 -45.372 9.751  1.00 53.37  ? 230  MET A C   1 
ATOM   1785 O O   . MET A 1 230 ? 49.231 -44.616 9.372  1.00 53.37  ? 230  MET A O   1 
ATOM   1786 C CB  . MET A 1 230 ? 51.887 -44.479 11.295 1.00 63.08  ? 230  MET A CB  1 
ATOM   1787 C CG  . MET A 1 230 ? 52.846 -44.640 10.128 1.00 63.08  ? 230  MET A CG  1 
ATOM   1788 S SD  . MET A 1 230 ? 54.452 -43.832 10.378 1.00 63.08  ? 230  MET A SD  1 
ATOM   1789 C CE  . MET A 1 230 ? 53.952 -42.131 10.581 1.00 63.08  ? 230  MET A CE  1 
ATOM   1790 N N   . THR A 1 231 ? 50.700 -46.250 8.935  1.00 54.48  ? 231  THR A N   1 
ATOM   1791 C CA  . THR A 1 231 ? 50.307 -46.346 7.529  1.00 54.48  ? 231  THR A CA  1 
ATOM   1792 C C   . THR A 1 231 ? 48.853 -46.756 7.298  1.00 54.48  ? 231  THR A C   1 
ATOM   1793 O O   . THR A 1 231 ? 48.295 -46.524 6.218  1.00 54.48  ? 231  THR A O   1 
ATOM   1794 C CB  . THR A 1 231 ? 51.198 -47.334 6.782  1.00 51.57  ? 231  THR A CB  1 
ATOM   1795 O OG1 . THR A 1 231 ? 51.298 -48.543 7.541  1.00 51.57  ? 231  THR A OG1 1 
ATOM   1796 C CG2 . THR A 1 231 ? 52.576 -46.749 6.580  1.00 51.57  ? 231  THR A CG2 1 
ATOM   1797 N N   . LYS A 1 232 ? 48.247 -47.362 8.314  1.00 66.99  ? 232  LYS A N   1 
ATOM   1798 C CA  . LYS A 1 232 ? 46.859 -47.811 8.228  1.00 66.99  ? 232  LYS A CA  1 
ATOM   1799 C C   . LYS A 1 232 ? 45.872 -46.699 8.565  1.00 66.99  ? 232  LYS A C   1 
ATOM   1800 O O   . LYS A 1 232 ? 44.661 -46.912 8.530  1.00 66.99  ? 232  LYS A O   1 
ATOM   1801 C CB  . LYS A 1 232 ? 46.634 -48.997 9.168  1.00 91.21  ? 232  LYS A CB  1 
ATOM   1802 C CG  . LYS A 1 232 ? 47.431 -50.225 8.783  1.00 91.21  ? 232  LYS A CG  1 
ATOM   1803 C CD  . LYS A 1 232 ? 47.115 -51.410 9.682  1.00 91.21  ? 232  LYS A CD  1 
ATOM   1804 C CE  . LYS A 1 232 ? 47.895 -52.646 9.254  1.00 91.21  ? 232  LYS A CE  1 
ATOM   1805 N NZ  . LYS A 1 232 ? 47.583 -53.809 10.126 1.00 91.21  ? 232  LYS A NZ  1 
ATOM   1806 N N   . LEU A 1 233 ? 46.391 -45.515 8.879  1.00 43.29  ? 233  LEU A N   1 
ATOM   1807 C CA  . LEU A 1 233 ? 45.545 -44.390 9.230  1.00 43.29  ? 233  LEU A CA  1 
ATOM   1808 C C   . LEU A 1 233 ? 44.900 -43.715 8.019  1.00 43.29  ? 233  LEU A C   1 
ATOM   1809 O O   . LEU A 1 233 ? 45.556 -43.462 7.000  1.00 43.29  ? 233  LEU A O   1 
ATOM   1810 C CB  . LEU A 1 233 ? 46.343 -43.370 10.056 1.00 41.92  ? 233  LEU A CB  1 
ATOM   1811 C CG  . LEU A 1 233 ? 46.715 -43.876 11.463 1.00 41.92  ? 233  LEU A CG  1 
ATOM   1812 C CD1 . LEU A 1 233 ? 47.730 -42.963 12.113 1.00 41.92  ? 233  LEU A CD1 1 
ATOM   1813 C CD2 . LEU A 1 233 ? 45.448 -43.973 12.319 1.00 41.92  ? 233  LEU A CD2 1 
ATOM   1814 N N   . PRO A 1 234 ? 43.600 -43.393 8.135  1.00 48.36  ? 234  PRO A N   1 
ATOM   1815 C CA  . PRO A 1 234 ? 42.752 -42.747 7.130  1.00 48.36  ? 234  PRO A CA  1 
ATOM   1816 C C   . PRO A 1 234 ? 43.443 -41.725 6.248  1.00 48.36  ? 234  PRO A C   1 
ATOM   1817 O O   . PRO A 1 234 ? 43.337 -41.789 5.026  1.00 48.36  ? 234  PRO A O   1 
ATOM   1818 C CB  . PRO A 1 234 ? 41.658 -42.102 7.971  1.00 48.61  ? 234  PRO A CB  1 
ATOM   1819 C CG  . PRO A 1 234 ? 41.484 -43.074 9.076  1.00 48.61  ? 234  PRO A CG  1 
ATOM   1820 C CD  . PRO A 1 234 ? 42.914 -43.432 9.440  1.00 48.61  ? 234  PRO A CD  1 
ATOM   1821 N N   . ASP A 1 235 ? 44.136 -40.773 6.864  1.00 51.08  ? 235  ASP A N   1 
ATOM   1822 C CA  . ASP A 1 235 ? 44.813 -39.723 6.115  1.00 51.08  ? 235  ASP A CA  1 
ATOM   1823 C C   . ASP A 1 235 ? 46.330 -39.734 6.181  1.00 51.08  ? 235  ASP A C   1 
ATOM   1824 O O   . ASP A 1 235 ? 46.962 -38.675 6.143  1.00 51.08  ? 235  ASP A O   1 
ATOM   1825 C CB  . ASP A 1 235 ? 44.305 -38.362 6.566  1.00 80.76  ? 235  ASP A CB  1 
ATOM   1826 C CG  . ASP A 1 235 ? 42.905 -38.084 6.082  1.00 80.76  ? 235  ASP A CG  1 
ATOM   1827 O OD1 . ASP A 1 235 ? 42.731 -37.925 4.854  1.00 80.76  ? 235  ASP A OD1 1 
ATOM   1828 O OD2 . ASP A 1 235 ? 41.980 -38.035 6.922  1.00 80.76  ? 235  ASP A OD2 1 
ATOM   1829 N N   . TYR A 1 236 ? 46.914 -40.926 6.274  1.00 40.51  ? 236  TYR A N   1 
ATOM   1830 C CA  . TYR A 1 236 ? 48.364 -41.073 6.314  1.00 40.51  ? 236  TYR A CA  1 
ATOM   1831 C C   . TYR A 1 236 ? 49.004 -40.726 4.974  1.00 40.51  ? 236  TYR A C   1 
ATOM   1832 O O   . TYR A 1 236 ? 48.445 -41.023 3.920  1.00 40.51  ? 236  TYR A O   1 
ATOM   1833 C CB  . TYR A 1 236 ? 48.747 -42.518 6.682  1.00 55.34  ? 236  TYR A CB  1 
ATOM   1834 C CG  . TYR A 1 236 ? 50.225 -42.824 6.519  1.00 55.34  ? 236  TYR A CG  1 
ATOM   1835 C CD1 . TYR A 1 236 ? 50.751 -43.258 5.296  1.00 55.34  ? 236  TYR A CD1 1 
ATOM   1836 C CD2 . TYR A 1 236 ? 51.107 -42.617 7.573  1.00 55.34  ? 236  TYR A CD2 1 
ATOM   1837 C CE1 . TYR A 1 236 ? 52.128 -43.472 5.135  1.00 55.34  ? 236  TYR A CE1 1 
ATOM   1838 C CE2 . TYR A 1 236 ? 52.472 -42.824 7.426  1.00 55.34  ? 236  TYR A CE2 1 
ATOM   1839 C CZ  . TYR A 1 236 ? 52.981 -43.250 6.213  1.00 55.34  ? 236  TYR A CZ  1 
ATOM   1840 O OH  . TYR A 1 236 ? 54.340 -43.460 6.113  1.00 55.34  ? 236  TYR A OH  1 
ATOM   1841 N N   . LYS A 1 237 ? 50.183 -40.111 5.025  1.00 49.49  ? 237  LYS A N   1 
ATOM   1842 C CA  . LYS A 1 237 ? 50.949 -39.753 3.832  1.00 49.49  ? 237  LYS A CA  1 
ATOM   1843 C C   . LYS A 1 237 ? 52.444 -39.963 4.111  1.00 49.49  ? 237  LYS A C   1 
ATOM   1844 O O   . LYS A 1 237 ? 52.954 -39.573 5.164  1.00 49.49  ? 237  LYS A O   1 
ATOM   1845 C CB  . LYS A 1 237 ? 50.688 -38.295 3.438  1.00 39.15  ? 237  LYS A CB  1 
ATOM   1846 C CG  . LYS A 1 237 ? 49.384 -38.107 2.732  1.00 39.15  ? 237  LYS A CG  1 
ATOM   1847 C CD  . LYS A 1 237 ? 48.870 -36.677 2.702  1.00 39.15  ? 237  LYS A CD  1 
ATOM   1848 C CE  . LYS A 1 237 ? 47.544 -36.708 1.937  1.00 39.15  ? 237  LYS A CE  1 
ATOM   1849 N NZ  . LYS A 1 237 ? 46.552 -35.645 2.270  1.00 39.15  ? 237  LYS A NZ  1 
ATOM   1850 N N   . PRO A 1 238 ? 53.159 -40.598 3.170  1.00 43.38  ? 238  PRO A N   1 
ATOM   1851 C CA  . PRO A 1 238 ? 54.590 -40.874 3.283  1.00 43.38  ? 238  PRO A CA  1 
ATOM   1852 C C   . PRO A 1 238 ? 55.368 -39.595 3.082  1.00 43.38  ? 238  PRO A C   1 
ATOM   1853 O O   . PRO A 1 238 ? 55.574 -39.179 1.940  1.00 43.38  ? 238  PRO A O   1 
ATOM   1854 C CB  . PRO A 1 238 ? 54.857 -41.842 2.132  1.00 48.27  ? 238  PRO A CB  1 
ATOM   1855 C CG  . PRO A 1 238 ? 53.533 -42.390 1.799  1.00 48.27  ? 238  PRO A CG  1 
ATOM   1856 C CD  . PRO A 1 238 ? 52.626 -41.211 1.947  1.00 48.27  ? 238  PRO A CD  1 
ATOM   1857 N N   . TYR A 1 239 ? 55.798 -38.959 4.165  1.00 39.84  ? 239  TYR A N   1 
ATOM   1858 C CA  . TYR A 1 239 ? 56.565 -37.734 4.007  1.00 39.84  ? 239  TYR A CA  1 
ATOM   1859 C C   . TYR A 1 239 ? 58.049 -38.069 3.870  1.00 39.84  ? 239  TYR A C   1 
ATOM   1860 O O   . TYR A 1 239 ? 58.494 -39.160 4.242  1.00 39.84  ? 239  TYR A O   1 
ATOM   1861 C CB  . TYR A 1 239 ? 56.340 -36.783 5.195  1.00 38.30  ? 239  TYR A CB  1 
ATOM   1862 C CG  . TYR A 1 239 ? 55.056 -35.975 5.128  1.00 38.30  ? 239  TYR A CG  1 
ATOM   1863 C CD1 . TYR A 1 239 ? 53.829 -36.538 5.482  1.00 38.30  ? 239  TYR A CD1 1 
ATOM   1864 C CD2 . TYR A 1 239 ? 55.068 -34.652 4.695  1.00 38.30  ? 239  TYR A CD2 1 
ATOM   1865 C CE1 . TYR A 1 239 ? 52.644 -35.803 5.402  1.00 38.30  ? 239  TYR A CE1 1 
ATOM   1866 C CE2 . TYR A 1 239 ? 53.894 -33.905 4.614  1.00 38.30  ? 239  TYR A CE2 1 
ATOM   1867 C CZ  . TYR A 1 239 ? 52.685 -34.486 4.964  1.00 38.30  ? 239  TYR A CZ  1 
ATOM   1868 O OH  . TYR A 1 239 ? 51.514 -33.760 4.846  1.00 38.30  ? 239  TYR A OH  1 
ATOM   1869 N N   . PRO A 1 240 ? 58.832 -37.142 3.301  1.00 52.57  ? 240  PRO A N   1 
ATOM   1870 C CA  . PRO A 1 240 ? 60.270 -37.376 3.135  1.00 52.57  ? 240  PRO A CA  1 
ATOM   1871 C C   . PRO A 1 240 ? 60.886 -37.676 4.501  1.00 52.57  ? 240  PRO A C   1 
ATOM   1872 O O   . PRO A 1 240 ? 60.521 -37.049 5.493  1.00 52.57  ? 240  PRO A O   1 
ATOM   1873 C CB  . PRO A 1 240 ? 60.767 -36.054 2.549  1.00 49.43  ? 240  PRO A CB  1 
ATOM   1874 C CG  . PRO A 1 240 ? 59.580 -35.572 1.765  1.00 49.43  ? 240  PRO A CG  1 
ATOM   1875 C CD  . PRO A 1 240 ? 58.438 -35.850 2.713  1.00 49.43  ? 240  PRO A CD  1 
ATOM   1876 N N   . MET A 1 241 ? 61.802 -38.636 4.557  1.00 90.32  ? 241  MET A N   1 
ATOM   1877 C CA  . MET A 1 241 ? 62.436 -38.997 5.822  1.00 90.32  ? 241  MET A CA  1 
ATOM   1878 C C   . MET A 1 241 ? 63.445 -37.944 6.282  1.00 90.32  ? 241  MET A C   1 
ATOM   1879 O O   . MET A 1 241 ? 64.655 -38.154 6.191  1.00 90.32  ? 241  MET A O   1 
ATOM   1880 C CB  . MET A 1 241 ? 63.140 -40.351 5.694  1.00 84.12  ? 241  MET A CB  1 
ATOM   1881 C CG  . MET A 1 241 ? 62.254 -41.489 5.203  1.00 84.12  ? 241  MET A CG  1 
ATOM   1882 S SD  . MET A 1 241 ? 60.884 -41.887 6.306  1.00 84.12  ? 241  MET A SD  1 
ATOM   1883 C CE  . MET A 1 241 ? 61.722 -42.768 7.578  1.00 84.12  ? 241  MET A CE  1 
ATOM   1884 N N   . TYR A 1 242 ? 62.946 -36.814 6.781  1.00 84.09  ? 242  TYR A N   1 
ATOM   1885 C CA  . TYR A 1 242 ? 63.822 -35.743 7.258  1.00 84.09  ? 242  TYR A CA  1 
ATOM   1886 C C   . TYR A 1 242 ? 64.642 -36.219 8.449  1.00 84.09  ? 242  TYR A C   1 
ATOM   1887 O O   . TYR A 1 242 ? 64.153 -36.991 9.282  1.00 84.09  ? 242  TYR A O   1 
ATOM   1888 C CB  . TYR A 1 242 ? 63.035 -34.518 7.736  1.00 60.13  ? 242  TYR A CB  1 
ATOM   1889 C CG  . TYR A 1 242 ? 61.931 -34.017 6.841  1.00 60.13  ? 242  TYR A CG  1 
ATOM   1890 C CD1 . TYR A 1 242 ? 60.642 -34.538 6.934  1.00 60.13  ? 242  TYR A CD1 1 
ATOM   1891 C CD2 . TYR A 1 242 ? 62.156 -32.975 5.948  1.00 60.13  ? 242  TYR A CD2 1 
ATOM   1892 C CE1 . TYR A 1 242 ? 59.603 -34.028 6.164  1.00 60.13  ? 242  TYR A CE1 1 
ATOM   1893 C CE2 . TYR A 1 242 ? 61.127 -32.457 5.173  1.00 60.13  ? 242  TYR A CE2 1 
ATOM   1894 C CZ  . TYR A 1 242 ? 59.851 -32.985 5.285  1.00 60.13  ? 242  TYR A CZ  1 
ATOM   1895 O OH  . TYR A 1 242 ? 58.825 -32.456 4.526  1.00 60.13  ? 242  TYR A OH  1 
ATOM   1896 N N   . PRO A 1 243 ? 65.896 -35.742 8.558  1.00 111.64 ? 243  PRO A N   1 
ATOM   1897 C CA  . PRO A 1 243 ? 66.770 -36.126 9.669  1.00 111.64 ? 243  PRO A CA  1 
ATOM   1898 C C   . PRO A 1 243 ? 66.079 -35.872 11.006 1.00 111.64 ? 243  PRO A C   1 
ATOM   1899 O O   . PRO A 1 243 ? 65.054 -35.194 11.072 1.00 111.64 ? 243  PRO A O   1 
ATOM   1900 C CB  . PRO A 1 243 ? 67.984 -35.223 9.477  1.00 64.82  ? 243  PRO A CB  1 
ATOM   1901 C CG  . PRO A 1 243 ? 68.064 -35.097 7.994  1.00 64.82  ? 243  PRO A CG  1 
ATOM   1902 C CD  . PRO A 1 243 ? 66.615 -34.876 7.604  1.00 64.82  ? 243  PRO A CD  1 
ATOM   1903 N N   . ALA A 1 244 ? 66.647 -36.423 12.069 1.00 107.66 ? 244  ALA A N   1 
ATOM   1904 C CA  . ALA A 1 244 ? 66.095 -36.246 13.398 1.00 107.66 ? 244  ALA A CA  1 
ATOM   1905 C C   . ALA A 1 244 ? 66.901 -35.200 14.154 1.00 107.66 ? 244  ALA A C   1 
ATOM   1906 O O   . ALA A 1 244 ? 67.863 -35.543 14.850 1.00 107.66 ? 244  ALA A O   1 
ATOM   1907 C CB  . ALA A 1 244 ? 66.108 -37.569 14.151 1.00 41.66  ? 244  ALA A CB  1 
ATOM   1908 N N   . THR A 1 245 ? 66.522 -33.928 14.007 1.00 152.93 ? 245  THR A N   1 
ATOM   1909 C CA  . THR A 1 245 ? 67.211 -32.834 14.702 1.00 152.93 ? 245  THR A CA  1 
ATOM   1910 C C   . THR A 1 245 ? 66.930 -32.941 16.195 1.00 152.93 ? 245  THR A C   1 
ATOM   1911 O O   . THR A 1 245 ? 66.781 -31.933 16.884 1.00 152.93 ? 245  THR A O   1 
ATOM   1912 C CB  . THR A 1 245 ? 66.734 -31.430 14.192 1.00 140.64 ? 245  THR A CB  1 
ATOM   1913 O OG1 . THR A 1 245 ? 65.303 -31.361 14.222 1.00 140.64 ? 245  THR A OG1 1 
ATOM   1914 C CG2 . THR A 1 245 ? 67.222 -31.167 12.781 1.00 140.64 ? 245  THR A CG2 1 
ATOM   1915 N N   . THR A 1 246 ? 66.868 -34.182 16.672 1.00 200.61 ? 246  THR A N   1 
ATOM   1916 C CA  . THR A 1 246 ? 66.583 -34.511 18.070 1.00 200.61 ? 246  THR A CA  1 
ATOM   1917 C C   . THR A 1 246 ? 67.425 -33.764 19.088 1.00 200.61 ? 246  THR A C   1 
ATOM   1918 O O   . THR A 1 246 ? 67.201 -33.888 20.301 1.00 200.61 ? 246  THR A O   1 
ATOM   1919 C CB  . THR A 1 246 ? 66.761 -36.017 18.328 1.00 137.41 ? 246  THR A CB  1 
ATOM   1920 O OG1 . THR A 1 246 ? 66.641 -36.302 19.729 1.00 137.41 ? 246  THR A OG1 1 
ATOM   1921 C CG2 . THR A 1 246 ? 68.112 -36.507 17.824 1.00 137.41 ? 246  THR A CG2 1 
ATOM   1922 N N   . SER A 1 247 ? 68.401 -32.989 18.625 1.00 141.84 ? 247  SER A N   1 
ATOM   1923 C CA  . SER A 1 247 ? 69.221 -32.205 19.553 1.00 141.84 ? 247  SER A CA  1 
ATOM   1924 C C   . SER A 1 247 ? 68.323 -31.019 19.921 1.00 141.84 ? 247  SER A C   1 
ATOM   1925 O O   . SER A 1 247 ? 68.672 -29.857 19.702 1.00 141.84 ? 247  SER A O   1 
ATOM   1926 C CB  . SER A 1 247 ? 70.486 -31.713 18.845 1.00 91.72  ? 247  SER A CB  1 
ATOM   1927 O OG  . SER A 1 247 ? 71.217 -32.815 18.284 1.00 91.72  ? 247  SER A OG  1 
ATOM   1928 N N   . LEU A 1 248 ? 67.163 -31.345 20.487 1.00 115.15 ? 248  LEU A N   1 
ATOM   1929 C CA  . LEU A 1 248 ? 66.175 -30.366 20.910 1.00 115.15 ? 248  LEU A CA  1 
ATOM   1930 C C   . LEU A 1 248 ? 66.758 -29.121 21.560 1.00 115.15 ? 248  LEU A C   1 
ATOM   1931 O O   . LEU A 1 248 ? 66.176 -28.041 21.478 1.00 115.15 ? 248  LEU A O   1 
ATOM   1932 C CB  . LEU A 1 248 ? 65.164 -31.012 21.868 1.00 71.09  ? 248  LEU A CB  1 
ATOM   1933 C CG  . LEU A 1 248 ? 64.011 -31.815 21.249 1.00 71.09  ? 248  LEU A CG  1 
ATOM   1934 C CD1 . LEU A 1 248 ? 64.542 -32.977 20.437 1.00 71.09  ? 248  LEU A CD1 1 
ATOM   1935 C CD2 . LEU A 1 248 ? 63.113 -32.319 22.351 1.00 71.09  ? 248  LEU A CD2 1 
ATOM   1936 N N   . VAL A 1 249 ? 67.904 -29.273 22.211 1.00 68.91  ? 249  VAL A N   1 
ATOM   1937 C CA  . VAL A 1 249 ? 68.570 -28.151 22.864 1.00 68.91  ? 249  VAL A CA  1 
ATOM   1938 C C   . VAL A 1 249 ? 68.464 -26.910 21.975 1.00 68.91  ? 249  VAL A C   1 
ATOM   1939 O O   . VAL A 1 249 ? 68.282 -25.792 22.461 1.00 68.91  ? 249  VAL A O   1 
ATOM   1940 C CB  . VAL A 1 249 ? 70.067 -28.460 23.108 1.00 88.53  ? 249  VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 249 ? 70.655 -27.450 24.082 1.00 88.53  ? 249  VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 249 ? 70.223 -29.877 23.634 1.00 88.53  ? 249  VAL A CG2 1 
ATOM   1943 N N   . ASN A 1 250 ? 68.578 -27.118 20.667 1.00 109.61 ? 250  ASN A N   1 
ATOM   1944 C CA  . ASN A 1 250 ? 68.491 -26.026 19.707 1.00 109.61 ? 250  ASN A CA  1 
ATOM   1945 C C   . ASN A 1 250 ? 67.169 -25.292 19.854 1.00 109.61 ? 250  ASN A C   1 
ATOM   1946 O O   . ASN A 1 250 ? 67.121 -24.066 19.809 1.00 109.61 ? 250  ASN A O   1 
ATOM   1947 C CB  . ASN A 1 250 ? 68.594 -26.562 18.271 1.00 102.17 ? 250  ASN A CB  1 
ATOM   1948 C CG  . ASN A 1 250 ? 69.881 -27.308 18.012 1.00 102.17 ? 250  ASN A CG  1 
ATOM   1949 O OD1 . ASN A 1 250 ? 70.971 -26.763 18.170 1.00 102.17 ? 250  ASN A OD1 1 
ATOM   1950 N ND2 . ASN A 1 250 ? 69.761 -28.565 17.599 1.00 102.17 ? 250  ASN A ND2 1 
ATOM   1951 N N   . VAL A 1 251 ? 66.101 -26.058 20.043 1.00 72.07  ? 251  VAL A N   1 
ATOM   1952 C CA  . VAL A 1 251 ? 64.762 -25.499 20.146 1.00 72.07  ? 251  VAL A CA  1 
ATOM   1953 C C   . VAL A 1 251 ? 64.232 -25.238 21.554 1.00 72.07  ? 251  VAL A C   1 
ATOM   1954 O O   . VAL A 1 251 ? 63.076 -24.844 21.711 1.00 72.07  ? 251  VAL A O   1 
ATOM   1955 C CB  . VAL A 1 251 ? 63.738 -26.403 19.415 1.00 99.74  ? 251  VAL A CB  1 
ATOM   1956 C CG1 . VAL A 1 251 ? 63.390 -27.610 20.278 1.00 99.74  ? 251  VAL A CG1 1 
ATOM   1957 C CG2 . VAL A 1 251 ? 62.498 -25.611 19.055 1.00 99.74  ? 251  VAL A CG2 1 
ATOM   1958 N N   . VAL A 1 252 ? 65.046 -25.442 22.583 1.00 61.25  ? 252  VAL A N   1 
ATOM   1959 C CA  . VAL A 1 252 ? 64.551 -25.198 23.931 1.00 61.25  ? 252  VAL A CA  1 
ATOM   1960 C C   . VAL A 1 252 ? 65.692 -25.124 24.968 1.00 61.25  ? 252  VAL A C   1 
ATOM   1961 O O   . VAL A 1 252 ? 65.873 -26.027 25.786 1.00 61.25  ? 252  VAL A O   1 
ATOM   1962 C CB  . VAL A 1 252 ? 63.461 -26.276 24.282 1.00 38.27  ? 252  VAL A CB  1 
ATOM   1963 C CG1 . VAL A 1 252 ? 64.090 -27.634 24.501 1.00 38.27  ? 252  VAL A CG1 1 
ATOM   1964 C CG2 . VAL A 1 252 ? 62.627 -25.835 25.459 1.00 38.27  ? 252  VAL A CG2 1 
ATOM   1965 N N   . PRO A 1 253 ? 66.472 -24.017 24.935 1.00 67.51  ? 253  PRO A N   1 
ATOM   1966 C CA  . PRO A 1 253 ? 67.627 -23.650 25.772 1.00 67.51  ? 253  PRO A CA  1 
ATOM   1967 C C   . PRO A 1 253 ? 67.422 -23.478 27.282 1.00 67.51  ? 253  PRO A C   1 
ATOM   1968 O O   . PRO A 1 253 ? 68.237 -23.954 28.073 1.00 67.51  ? 253  PRO A O   1 
ATOM   1969 C CB  . PRO A 1 253 ? 68.116 -22.353 25.132 1.00 83.60  ? 253  PRO A CB  1 
ATOM   1970 C CG  . PRO A 1 253 ? 67.717 -22.512 23.708 1.00 83.60  ? 253  PRO A CG  1 
ATOM   1971 C CD  . PRO A 1 253 ? 66.321 -23.037 23.846 1.00 83.60  ? 253  PRO A CD  1 
ATOM   1972 N N   . LYS A 1 254 ? 66.360 -22.781 27.679 1.00 64.12  ? 254  LYS A N   1 
ATOM   1973 C CA  . LYS A 1 254 ? 66.071 -22.547 29.098 1.00 64.12  ? 254  LYS A CA  1 
ATOM   1974 C C   . LYS A 1 254 ? 65.499 -23.810 29.728 1.00 64.12  ? 254  LYS A C   1 
ATOM   1975 O O   . LYS A 1 254 ? 64.517 -23.771 30.508 1.00 64.12  ? 254  LYS A O   1 
ATOM   1976 C CB  . LYS A 1 254 ? 65.071 -21.394 29.260 1.00 185.49 ? 254  LYS A CB  1 
ATOM   1977 C CG  . LYS A 1 254 ? 65.588 -20.044 28.767 1.00 185.49 ? 254  LYS A CG  1 
ATOM   1978 C CD  . LYS A 1 254 ? 66.842 -19.616 29.521 1.00 185.49 ? 254  LYS A CD  1 
ATOM   1979 C CE  . LYS A 1 254 ? 67.403 -18.306 28.983 1.00 185.49 ? 254  LYS A CE  1 
ATOM   1980 N NZ  . LYS A 1 254 ? 68.645 -17.889 29.697 1.00 185.49 ? 254  LYS A NZ  1 
ATOM   1981 N N   . LEU A 1 255 ? 66.139 -24.924 29.378 1.00 73.65  ? 255  LEU A N   1 
ATOM   1982 C CA  . LEU A 1 255 ? 65.754 -26.251 29.835 1.00 73.65  ? 255  LEU A CA  1 
ATOM   1983 C C   . LEU A 1 255 ? 66.989 -27.154 29.975 1.00 73.65  ? 255  LEU A C   1 
ATOM   1984 O O   . LEU A 1 255 ? 67.763 -27.326 29.027 1.00 73.65  ? 255  LEU A O   1 
ATOM   1985 C CB  . LEU A 1 255 ? 64.767 -26.859 28.825 1.00 56.77  ? 255  LEU A CB  1 
ATOM   1986 C CG  . LEU A 1 255 ? 63.790 -27.943 29.294 1.00 56.77  ? 255  LEU A CG  1 
ATOM   1987 C CD1 . LEU A 1 255 ? 63.008 -27.439 30.508 1.00 56.77  ? 255  LEU A CD1 1 
ATOM   1988 C CD2 . LEU A 1 255 ? 62.831 -28.309 28.150 1.00 56.77  ? 255  LEU A CD2 1 
ATOM   1989 N N   . ASN A 1 256 ? 67.160 -27.728 31.161 1.00 87.89  ? 256  ASN A N   1 
ATOM   1990 C CA  . ASN A 1 256 ? 68.276 -28.623 31.434 1.00 87.89  ? 256  ASN A CA  1 
ATOM   1991 C C   . ASN A 1 256 ? 68.224 -29.849 30.519 1.00 87.89  ? 256  ASN A C   1 
ATOM   1992 O O   . ASN A 1 256 ? 67.347 -29.950 29.661 1.00 87.89  ? 256  ASN A O   1 
ATOM   1993 C CB  . ASN A 1 256 ? 68.212 -29.072 32.888 1.00 73.47  ? 256  ASN A CB  1 
ATOM   1994 C CG  . ASN A 1 256 ? 66.793 -29.199 33.383 1.00 73.47  ? 256  ASN A CG  1 
ATOM   1995 O OD1 . ASN A 1 256 ? 65.900 -29.588 32.634 1.00 73.47  ? 256  ASN A OD1 1 
ATOM   1996 N ND2 . ASN A 1 256 ? 66.573 -28.870 34.653 1.00 73.47  ? 256  ASN A ND2 1 
ATOM   1997 N N   . ALA A 1 257 ? 69.158 -30.780 30.706 1.00 69.35  ? 257  ALA A N   1 
ATOM   1998 C CA  . ALA A 1 257 ? 69.191 -31.997 29.900 1.00 69.35  ? 257  ALA A CA  1 
ATOM   1999 C C   . ALA A 1 257 ? 68.110 -32.980 30.372 1.00 69.35  ? 257  ALA A C   1 
ATOM   2000 O O   . ALA A 1 257 ? 67.553 -33.754 29.583 1.00 69.35  ? 257  ALA A O   1 
ATOM   2001 C CB  . ALA A 1 257 ? 70.566 -32.641 29.989 1.00 46.13  ? 257  ALA A CB  1 
ATOM   2002 N N   . THR A 1 258 ? 67.826 -32.947 31.667 1.00 67.42  ? 258  THR A N   1 
ATOM   2003 C CA  . THR A 1 258 ? 66.812 -33.811 32.241 1.00 67.42  ? 258  THR A CA  1 
ATOM   2004 C C   . THR A 1 258 ? 65.454 -33.350 31.735 1.00 67.42  ? 258  THR A C   1 
ATOM   2005 O O   . THR A 1 258 ? 64.628 -34.160 31.311 1.00 67.42  ? 258  THR A O   1 
ATOM   2006 C CB  . THR A 1 258 ? 66.837 -33.742 33.781 1.00 60.63  ? 258  THR A CB  1 
ATOM   2007 O OG1 . THR A 1 258 ? 65.574 -34.176 34.304 1.00 60.63  ? 258  THR A OG1 1 
ATOM   2008 C CG2 . THR A 1 258 ? 67.123 -32.315 34.247 1.00 60.63  ? 258  THR A CG2 1 
ATOM   2009 N N   . GLY A 1 259 ? 65.233 -32.040 31.774 1.00 67.71  ? 259  GLY A N   1 
ATOM   2010 C CA  . GLY A 1 259 ? 63.978 -31.492 31.307 1.00 67.71  ? 259  GLY A CA  1 
ATOM   2011 C C   . GLY A 1 259 ? 63.750 -31.872 29.860 1.00 67.71  ? 259  GLY A C   1 
ATOM   2012 O O   . GLY A 1 259 ? 62.661 -32.323 29.486 1.00 67.71  ? 259  GLY A O   1 
ATOM   2013 N N   . ARG A 1 260 ? 64.782 -31.691 29.039 1.00 66.32  ? 260  ARG A N   1 
ATOM   2014 C CA  . ARG A 1 260 ? 64.686 -32.025 27.627 1.00 66.32  ? 260  ARG A CA  1 
ATOM   2015 C C   . ARG A 1 260 ? 64.289 -33.483 27.462 1.00 66.32  ? 260  ARG A C   1 
ATOM   2016 O O   . ARG A 1 260 ? 63.544 -33.822 26.545 1.00 66.32  ? 260  ARG A O   1 
ATOM   2017 C CB  . ARG A 1 260 ? 66.011 -31.763 26.915 1.00 62.67  ? 260  ARG A CB  1 
ATOM   2018 C CG  . ARG A 1 260 ? 66.385 -30.300 26.823 1.00 62.67  ? 260  ARG A CG  1 
ATOM   2019 C CD  . ARG A 1 260 ? 67.424 -30.100 25.740 1.00 62.67  ? 260  ARG A CD  1 
ATOM   2020 N NE  . ARG A 1 260 ? 68.549 -31.006 25.928 1.00 62.67  ? 260  ARG A NE  1 
ATOM   2021 C CZ  . ARG A 1 260 ? 69.580 -30.765 26.729 1.00 62.67  ? 260  ARG A CZ  1 
ATOM   2022 N NH1 . ARG A 1 260 ? 69.636 -29.630 27.416 1.00 62.67  ? 260  ARG A NH1 1 
ATOM   2023 N NH2 . ARG A 1 260 ? 70.540 -31.675 26.863 1.00 62.67  ? 260  ARG A NH2 1 
ATOM   2024 N N   . ASP A 1 261 ? 64.772 -34.347 28.351 1.00 47.99  ? 261  ASP A N   1 
ATOM   2025 C CA  . ASP A 1 261 ? 64.414 -35.761 28.261 1.00 47.99  ? 261  ASP A CA  1 
ATOM   2026 C C   . ASP A 1 261 ? 62.892 -35.954 28.386 1.00 47.99  ? 261  ASP A C   1 
ATOM   2027 O O   . ASP A 1 261 ? 62.303 -36.767 27.668 1.00 47.99  ? 261  ASP A O   1 
ATOM   2028 C CB  . ASP A 1 261 ? 65.151 -36.592 29.328 1.00 30.92  ? 261  ASP A CB  1 
ATOM   2029 C CG  . ASP A 1 261 ? 64.675 -38.043 29.368 1.00 30.92  ? 261  ASP A CG  1 
ATOM   2030 O OD1 . ASP A 1 261 ? 63.673 -38.298 30.068 1.00 30.92  ? 261  ASP A OD1 1 
ATOM   2031 O OD2 . ASP A 1 261 ? 65.275 -38.917 28.689 1.00 30.92  ? 261  ASP A OD2 1 
ATOM   2032 N N   . LEU A 1 262 ? 62.266 -35.206 29.292 1.00 53.29  ? 262  LEU A N   1 
ATOM   2033 C CA  . LEU A 1 262 ? 60.820 -35.290 29.479 1.00 53.29  ? 262  LEU A CA  1 
ATOM   2034 C C   . LEU A 1 262 ? 60.116 -34.752 28.223 1.00 53.29  ? 262  LEU A C   1 
ATOM   2035 O O   . LEU A 1 262 ? 59.208 -35.392 27.684 1.00 53.29  ? 262  LEU A O   1 
ATOM   2036 C CB  . LEU A 1 262 ? 60.383 -34.482 30.710 1.00 33.37  ? 262  LEU A CB  1 
ATOM   2037 C CG  . LEU A 1 262 ? 58.872 -34.455 30.993 1.00 33.37  ? 262  LEU A CG  1 
ATOM   2038 C CD1 . LEU A 1 262 ? 58.360 -35.881 31.088 1.00 33.37  ? 262  LEU A CD1 1 
ATOM   2039 C CD2 . LEU A 1 262 ? 58.568 -33.687 32.273 1.00 33.37  ? 262  LEU A CD2 1 
ATOM   2040 N N   . LEU A 1 263 ? 60.535 -33.579 27.754 1.00 36.38  ? 263  LEU A N   1 
ATOM   2041 C CA  . LEU A 1 263 ? 59.937 -33.010 26.557 1.00 36.38  ? 263  LEU A CA  1 
ATOM   2042 C C   . LEU A 1 263 ? 59.995 -34.032 25.418 1.00 36.38  ? 263  LEU A C   1 
ATOM   2043 O O   . LEU A 1 263 ? 59.088 -34.111 24.598 1.00 36.38  ? 263  LEU A O   1 
ATOM   2044 C CB  . LEU A 1 263 ? 60.654 -31.711 26.133 1.00 41.86  ? 263  LEU A CB  1 
ATOM   2045 C CG  . LEU A 1 263 ? 60.203 -31.114 24.787 1.00 41.86  ? 263  LEU A CG  1 
ATOM   2046 C CD1 . LEU A 1 263 ? 58.695 -31.003 24.771 1.00 41.86  ? 263  LEU A CD1 1 
ATOM   2047 C CD2 . LEU A 1 263 ? 60.833 -29.758 24.550 1.00 41.86  ? 263  LEU A CD2 1 
ATOM   2048 N N   . GLN A 1 264 ? 61.050 -34.829 25.381 1.00 55.44  ? 264  GLN A N   1 
ATOM   2049 C CA  . GLN A 1 264 ? 61.172 -35.819 24.328 1.00 55.44  ? 264  GLN A CA  1 
ATOM   2050 C C   . GLN A 1 264 ? 60.183 -36.980 24.500 1.00 55.44  ? 264  GLN A C   1 
ATOM   2051 O O   . GLN A 1 264 ? 59.682 -37.523 23.513 1.00 55.44  ? 264  GLN A O   1 
ATOM   2052 C CB  . GLN A 1 264 ? 62.609 -36.340 24.266 1.00 99.90  ? 264  GLN A CB  1 
ATOM   2053 C CG  . GLN A 1 264 ? 62.905 -37.178 23.037 1.00 99.90  ? 264  GLN A CG  1 
ATOM   2054 C CD  . GLN A 1 264 ? 62.420 -36.521 21.746 1.00 99.90  ? 264  GLN A CD  1 
ATOM   2055 O OE1 . GLN A 1 264 ? 62.696 -35.346 21.495 1.00 99.90  ? 264  GLN A OE1 1 
ATOM   2056 N NE2 . GLN A 1 264 ? 61.695 -37.280 20.920 1.00 99.90  ? 264  GLN A NE2 1 
ATOM   2057 N N   . ASN A 1 265 ? 59.886 -37.360 25.740 1.00 45.38  ? 265  ASN A N   1 
ATOM   2058 C CA  . ASN A 1 265 ? 58.951 -38.460 25.963 1.00 45.38  ? 265  ASN A CA  1 
ATOM   2059 C C   . ASN A 1 265 ? 57.509 -38.028 25.761 1.00 45.38  ? 265  ASN A C   1 
ATOM   2060 O O   . ASN A 1 265 ? 56.613 -38.862 25.614 1.00 45.38  ? 265  ASN A O   1 
ATOM   2061 C CB  . ASN A 1 265 ? 59.113 -39.040 27.367 1.00 50.39  ? 265  ASN A CB  1 
ATOM   2062 C CG  . ASN A 1 265 ? 60.306 -39.958 27.475 1.00 50.39  ? 265  ASN A CG  1 
ATOM   2063 O OD1 . ASN A 1 265 ? 60.527 -40.805 26.600 1.00 50.39  ? 265  ASN A OD1 1 
ATOM   2064 N ND2 . ASN A 1 265 ? 61.079 -39.814 28.554 1.00 50.39  ? 265  ASN A ND2 1 
ATOM   2065 N N   . LEU A 1 266 ? 57.281 -36.720 25.776 1.00 45.25  ? 266  LEU A N   1 
ATOM   2066 C CA  . LEU A 1 266 ? 55.943 -36.194 25.577 1.00 45.25  ? 266  LEU A CA  1 
ATOM   2067 C C   . LEU A 1 266 ? 55.683 -36.030 24.079 1.00 45.25  ? 266  LEU A C   1 
ATOM   2068 O O   . LEU A 1 266 ? 54.569 -36.228 23.611 1.00 45.25  ? 266  LEU A O   1 
ATOM   2069 C CB  . LEU A 1 266 ? 55.806 -34.844 26.276 1.00 37.05  ? 266  LEU A CB  1 
ATOM   2070 C CG  . LEU A 1 266 ? 55.762 -34.845 27.799 1.00 37.05  ? 266  LEU A CG  1 
ATOM   2071 C CD1 . LEU A 1 266 ? 56.045 -33.447 28.311 1.00 37.05  ? 266  LEU A CD1 1 
ATOM   2072 C CD2 . LEU A 1 266 ? 54.394 -35.329 28.279 1.00 37.05  ? 266  LEU A CD2 1 
ATOM   2073 N N   . LEU A 1 267 ? 56.727 -35.687 23.332 1.00 40.35  ? 267  LEU A N   1 
ATOM   2074 C CA  . LEU A 1 267 ? 56.592 -35.477 21.910 1.00 40.35  ? 267  LEU A CA  1 
ATOM   2075 C C   . LEU A 1 267 ? 56.889 -36.686 21.042 1.00 40.35  ? 267  LEU A C   1 
ATOM   2076 O O   . LEU A 1 267 ? 57.519 -36.560 19.982 1.00 40.35  ? 267  LEU A O   1 
ATOM   2077 C CB  . LEU A 1 267 ? 57.457 -34.297 21.464 1.00 41.50  ? 267  LEU A CB  1 
ATOM   2078 C CG  . LEU A 1 267 ? 56.929 -32.944 21.964 1.00 41.50  ? 267  LEU A CG  1 
ATOM   2079 C CD1 . LEU A 1 267 ? 57.866 -31.819 21.533 1.00 41.50  ? 267  LEU A CD1 1 
ATOM   2080 C CD2 . LEU A 1 267 ? 55.502 -32.715 21.422 1.00 41.50  ? 267  LEU A CD2 1 
ATOM   2081 N N   . LYS A 1 268 ? 56.441 -37.859 21.474 1.00 45.70  ? 268  LYS A N   1 
ATOM   2082 C CA  . LYS A 1 268 ? 56.652 -39.048 20.666 1.00 45.70  ? 268  LYS A CA  1 
ATOM   2083 C C   . LYS A 1 268 ? 55.531 -39.032 19.639 1.00 45.70  ? 268  LYS A C   1 
ATOM   2084 O O   . LYS A 1 268 ? 54.371 -38.796 19.990 1.00 45.70  ? 268  LYS A O   1 
ATOM   2085 C CB  . LYS A 1 268 ? 56.563 -40.306 21.529 1.00 69.21  ? 268  LYS A CB  1 
ATOM   2086 C CG  . LYS A 1 268 ? 57.791 -40.564 22.381 1.00 69.21  ? 268  LYS A CG  1 
ATOM   2087 C CD  . LYS A 1 268 ? 58.990 -40.893 21.512 1.00 69.21  ? 268  LYS A CD  1 
ATOM   2088 C CE  . LYS A 1 268 ? 60.213 -41.201 22.358 1.00 69.21  ? 268  LYS A CE  1 
ATOM   2089 N NZ  . LYS A 1 268 ? 61.298 -41.842 21.559 1.00 69.21  ? 268  LYS A NZ  1 
ATOM   2090 N N   . CYS A 1 269 ? 55.861 -39.256 18.370 1.00 32.45  ? 269  CYS A N   1 
ATOM   2091 C CA  . CYS A 1 269 ? 54.830 -39.254 17.342 1.00 32.45  ? 269  CYS A CA  1 
ATOM   2092 C C   . CYS A 1 269 ? 53.853 -40.419 17.538 1.00 32.45  ? 269  CYS A C   1 
ATOM   2093 O O   . CYS A 1 269 ? 52.625 -40.263 17.411 1.00 32.45  ? 269  CYS A O   1 
ATOM   2094 C CB  . CYS A 1 269 ? 55.473 -39.306 15.953 1.00 44.42  ? 269  CYS A CB  1 
ATOM   2095 S SG  . CYS A 1 269 ? 56.302 -37.763 15.481 1.00 44.42  ? 269  CYS A SG  1 
ATOM   2096 N N   . ASN A 1 270 ? 54.391 -41.589 17.855 1.00 39.29  ? 270  ASN A N   1 
ATOM   2097 C CA  . ASN A 1 270 ? 53.544 -42.742 18.061 1.00 39.29  ? 270  ASN A CA  1 
ATOM   2098 C C   . ASN A 1 270 ? 52.807 -42.561 19.372 1.00 39.29  ? 270  ASN A C   1 
ATOM   2099 O O   . ASN A 1 270 ? 53.405 -42.598 20.445 1.00 39.29  ? 270  ASN A O   1 
ATOM   2100 C CB  . ASN A 1 270 ? 54.371 -44.017 18.105 1.00 46.62  ? 270  ASN A CB  1 
ATOM   2101 C CG  . ASN A 1 270 ? 53.522 -45.253 18.317 1.00 46.62  ? 270  ASN A CG  1 
ATOM   2102 O OD1 . ASN A 1 270 ? 54.023 -46.377 18.238 1.00 46.62  ? 270  ASN A OD1 1 
ATOM   2103 N ND2 . ASN A 1 270 ? 52.228 -45.055 18.589 1.00 46.62  ? 270  ASN A ND2 1 
ATOM   2104 N N   . PRO A 1 271 ? 51.488 -42.380 19.303 1.00 37.04  ? 271  PRO A N   1 
ATOM   2105 C CA  . PRO A 1 271 ? 50.697 -42.190 20.522 1.00 37.04  ? 271  PRO A CA  1 
ATOM   2106 C C   . PRO A 1 271 ? 51.110 -43.119 21.670 1.00 37.04  ? 271  PRO A C   1 
ATOM   2107 O O   . PRO A 1 271 ? 51.414 -42.655 22.780 1.00 37.04  ? 271  PRO A O   1 
ATOM   2108 C CB  . PRO A 1 271 ? 49.257 -42.408 20.043 1.00 32.39  ? 271  PRO A CB  1 
ATOM   2109 C CG  . PRO A 1 271 ? 49.403 -43.194 18.757 1.00 32.39  ? 271  PRO A CG  1 
ATOM   2110 C CD  . PRO A 1 271 ? 50.634 -42.620 18.129 1.00 32.39  ? 271  PRO A CD  1 
ATOM   2111 N N   . VAL A 1 272 ? 51.148 -44.420 21.394 1.00 37.42  ? 272  VAL A N   1 
ATOM   2112 C CA  . VAL A 1 272 ? 51.533 -45.427 22.392 1.00 37.42  ? 272  VAL A CA  1 
ATOM   2113 C C   . VAL A 1 272 ? 52.866 -45.166 23.127 1.00 37.42  ? 272  VAL A C   1 
ATOM   2114 O O   . VAL A 1 272 ? 53.038 -45.601 24.264 1.00 37.42  ? 272  VAL A O   1 
ATOM   2115 C CB  . VAL A 1 272 ? 51.633 -46.826 21.743 1.00 71.73  ? 272  VAL A CB  1 
ATOM   2116 C CG1 . VAL A 1 272 ? 51.828 -47.883 22.812 1.00 71.73  ? 272  VAL A CG1 1 
ATOM   2117 C CG2 . VAL A 1 272 ? 50.389 -47.106 20.921 1.00 71.73  ? 272  VAL A CG2 1 
ATOM   2118 N N   . GLN A 1 273 ? 53.803 -44.475 22.480 1.00 51.39  ? 273  GLN A N   1 
ATOM   2119 C CA  . GLN A 1 273 ? 55.108 -44.186 23.092 1.00 51.39  ? 273  GLN A CA  1 
ATOM   2120 C C   . GLN A 1 273 ? 55.100 -42.941 23.986 1.00 51.39  ? 273  GLN A C   1 
ATOM   2121 O O   . GLN A 1 273 ? 56.126 -42.583 24.566 1.00 51.39  ? 273  GLN A O   1 
ATOM   2122 C CB  . GLN A 1 273 ? 56.186 -44.008 22.007 1.00 76.31  ? 273  GLN A CB  1 
ATOM   2123 C CG  . GLN A 1 273 ? 56.495 -45.251 21.178 1.00 76.31  ? 273  GLN A CG  1 
ATOM   2124 C CD  . GLN A 1 273 ? 57.401 -44.968 19.972 1.00 76.31  ? 273  GLN A CD  1 
ATOM   2125 O OE1 . GLN A 1 273 ? 57.610 -43.812 19.579 1.00 76.31  ? 273  GLN A OE1 1 
ATOM   2126 N NE2 . GLN A 1 273 ? 57.924 -46.032 19.367 1.00 76.31  ? 273  GLN A NE2 1 
ATOM   2127 N N   . ARG A 1 274 ? 53.954 -42.275 24.089 1.00 45.73  ? 274  ARG A N   1 
ATOM   2128 C CA  . ARG A 1 274 ? 53.842 -41.069 24.908 1.00 45.73  ? 274  ARG A CA  1 
ATOM   2129 C C   . ARG A 1 274 ? 53.722 -41.395 26.392 1.00 45.73  ? 274  ARG A C   1 
ATOM   2130 O O   . ARG A 1 274 ? 52.915 -42.236 26.801 1.00 45.73  ? 274  ARG A O   1 
ATOM   2131 C CB  . ARG A 1 274 ? 52.618 -40.246 24.484 1.00 40.76  ? 274  ARG A CB  1 
ATOM   2132 C CG  . ARG A 1 274 ? 52.742 -39.608 23.125 1.00 40.76  ? 274  ARG A CG  1 
ATOM   2133 C CD  . ARG A 1 274 ? 51.428 -39.014 22.624 1.00 40.76  ? 274  ARG A CD  1 
ATOM   2134 N NE  . ARG A 1 274 ? 51.466 -38.887 21.162 1.00 40.76  ? 274  ARG A NE  1 
ATOM   2135 C CZ  . ARG A 1 274 ? 50.402 -38.817 20.367 1.00 40.76  ? 274  ARG A CZ  1 
ATOM   2136 N NH1 . ARG A 1 274 ? 49.173 -38.845 20.865 1.00 40.76  ? 274  ARG A NH1 1 
ATOM   2137 N NH2 . ARG A 1 274 ? 50.575 -38.772 19.054 1.00 40.76  ? 274  ARG A NH2 1 
ATOM   2138 N N   . ILE A 1 275 ? 54.533 -40.736 27.205 1.00 34.42  ? 275  ILE A N   1 
ATOM   2139 C CA  . ILE A 1 275 ? 54.465 -40.947 28.640 1.00 34.42  ? 275  ILE A CA  1 
ATOM   2140 C C   . ILE A 1 275 ? 53.103 -40.439 29.100 1.00 34.42  ? 275  ILE A C   1 
ATOM   2141 O O   . ILE A 1 275 ? 52.497 -39.593 28.445 1.00 34.42  ? 275  ILE A O   1 
ATOM   2142 C CB  . ILE A 1 275 ? 55.534 -40.134 29.366 1.00 61.08  ? 275  ILE A CB  1 
ATOM   2143 C CG1 . ILE A 1 275 ? 55.392 -38.662 28.984 1.00 61.08  ? 275  ILE A CG1 1 
ATOM   2144 C CG2 . ILE A 1 275 ? 56.901 -40.640 28.988 1.00 61.08  ? 275  ILE A CG2 1 
ATOM   2145 C CD1 . ILE A 1 275 ? 56.041 -37.727 29.938 1.00 61.08  ? 275  ILE A CD1 1 
ATOM   2146 N N   . SER A 1 276 ? 52.632 -40.947 30.230 1.00 44.27  ? 276  SER A N   1 
ATOM   2147 C CA  . SER A 1 276 ? 51.356 -40.511 30.772 1.00 44.27  ? 276  SER A CA  1 
ATOM   2148 C C   . SER A 1 276 ? 51.630 -39.413 31.783 1.00 44.27  ? 276  SER A C   1 
ATOM   2149 O O   . SER A 1 276 ? 52.795 -39.132 32.115 1.00 44.27  ? 276  SER A O   1 
ATOM   2150 C CB  . SER A 1 276 ? 50.626 -41.673 31.455 1.00 38.68  ? 276  SER A CB  1 
ATOM   2151 O OG  . SER A 1 276 ? 51.273 -42.054 32.654 1.00 38.68  ? 276  SER A OG  1 
ATOM   2152 N N   . ALA A 1 277 ? 50.559 -38.799 32.272 1.00 36.16  ? 277  ALA A N   1 
ATOM   2153 C CA  . ALA A 1 277 ? 50.687 -37.736 33.253 1.00 36.16  ? 277  ALA A CA  1 
ATOM   2154 C C   . ALA A 1 277 ? 51.342 -38.261 34.531 1.00 36.16  ? 277  ALA A C   1 
ATOM   2155 O O   . ALA A 1 277 ? 52.214 -37.612 35.105 1.00 36.16  ? 277  ALA A O   1 
ATOM   2156 C CB  . ALA A 1 277 ? 49.317 -37.152 33.566 1.00 55.65  ? 277  ALA A CB  1 
ATOM   2157 N N   . GLU A 1 278 ? 50.918 -39.433 34.989 1.00 55.82  ? 278  GLU A N   1 
ATOM   2158 C CA  . GLU A 1 278 ? 51.507 -39.995 36.200 1.00 55.82  ? 278  GLU A CA  1 
ATOM   2159 C C   . GLU A 1 278 ? 53.026 -40.035 36.045 1.00 55.82  ? 278  GLU A C   1 
ATOM   2160 O O   . GLU A 1 278 ? 53.766 -39.414 36.818 1.00 55.82  ? 278  GLU A O   1 
ATOM   2161 C CB  . GLU A 1 278 ? 50.965 -41.403 36.456 1.00 84.64  ? 278  GLU A CB  1 
ATOM   2162 C CG  . GLU A 1 278 ? 49.700 -41.433 37.298 1.00 84.64  ? 278  GLU A CG  1 
ATOM   2163 C CD  . GLU A 1 278 ? 49.079 -42.818 37.381 1.00 84.64  ? 278  GLU A CD  1 
ATOM   2164 O OE1 . GLU A 1 278 ? 49.794 -43.783 37.730 1.00 84.64  ? 278  GLU A OE1 1 
ATOM   2165 O OE2 . GLU A 1 278 ? 47.869 -42.940 37.099 1.00 84.64  ? 278  GLU A OE2 1 
ATOM   2166 N N   . GLU A 1 279 ? 53.471 -40.762 35.027 1.00 39.82  ? 279  GLU A N   1 
ATOM   2167 C CA  . GLU A 1 279 ? 54.885 -40.911 34.717 1.00 39.82  ? 279  GLU A CA  1 
ATOM   2168 C C   . GLU A 1 279 ? 55.551 -39.554 34.614 1.00 39.82  ? 279  GLU A C   1 
ATOM   2169 O O   . GLU A 1 279 ? 56.565 -39.296 35.260 1.00 39.82  ? 279  GLU A O   1 
ATOM   2170 C CB  . GLU A 1 279 ? 55.055 -41.662 33.391 1.00 54.26  ? 279  GLU A CB  1 
ATOM   2171 C CG  . GLU A 1 279 ? 54.398 -43.025 33.365 1.00 54.26  ? 279  GLU A CG  1 
ATOM   2172 C CD  . GLU A 1 279 ? 54.384 -43.661 31.980 1.00 54.26  ? 279  GLU A CD  1 
ATOM   2173 O OE1 . GLU A 1 279 ? 54.810 -43.011 31.001 1.00 54.26  ? 279  GLU A OE1 1 
ATOM   2174 O OE2 . GLU A 1 279 ? 53.934 -44.823 31.868 1.00 54.26  ? 279  GLU A OE2 1 
ATOM   2175 N N   . ALA A 1 280 ? 54.981 -38.689 33.787 1.00 66.54  ? 280  ALA A N   1 
ATOM   2176 C CA  . ALA A 1 280 ? 55.543 -37.361 33.608 1.00 66.54  ? 280  ALA A CA  1 
ATOM   2177 C C   . ALA A 1 280 ? 55.817 -36.710 34.964 1.00 66.54  ? 280  ALA A C   1 
ATOM   2178 O O   . ALA A 1 280 ? 56.897 -36.161 35.190 1.00 66.54  ? 280  ALA A O   1 
ATOM   2179 C CB  . ALA A 1 280 ? 54.590 -36.494 32.782 1.00 39.68  ? 280  ALA A CB  1 
ATOM   2180 N N   . LEU A 1 281 ? 54.842 -36.784 35.868 1.00 45.03  ? 281  LEU A N   1 
ATOM   2181 C CA  . LEU A 1 281 ? 54.988 -36.194 37.192 1.00 45.03  ? 281  LEU A CA  1 
ATOM   2182 C C   . LEU A 1 281 ? 56.053 -36.877 38.048 1.00 45.03  ? 281  LEU A C   1 
ATOM   2183 O O   . LEU A 1 281 ? 56.661 -36.244 38.912 1.00 45.03  ? 281  LEU A O   1 
ATOM   2184 C CB  . LEU A 1 281 ? 53.652 -36.214 37.932 1.00 34.84  ? 281  LEU A CB  1 
ATOM   2185 C CG  . LEU A 1 281 ? 52.719 -35.034 37.661 1.00 34.84  ? 281  LEU A CG  1 
ATOM   2186 C CD1 . LEU A 1 281 ? 51.420 -35.237 38.426 1.00 34.84  ? 281  LEU A CD1 1 
ATOM   2187 C CD2 . LEU A 1 281 ? 53.404 -33.724 38.054 1.00 34.84  ? 281  LEU A CD2 1 
ATOM   2188 N N   . GLN A 1 282 ? 56.274 -38.166 37.803 1.00 55.06  ? 282  GLN A N   1 
ATOM   2189 C CA  . GLN A 1 282 ? 57.276 -38.927 38.541 1.00 55.06  ? 282  GLN A CA  1 
ATOM   2190 C C   . GLN A 1 282 ? 58.621 -38.866 37.815 1.00 55.06  ? 282  GLN A C   1 
ATOM   2191 O O   . GLN A 1 282 ? 59.535 -39.651 38.084 1.00 55.06  ? 282  GLN A O   1 
ATOM   2192 C CB  . GLN A 1 282 ? 56.830 -40.388 38.680 1.00 100.99 ? 282  GLN A CB  1 
ATOM   2193 C CG  . GLN A 1 282 ? 55.591 -40.589 39.550 1.00 100.99 ? 282  GLN A CG  1 
ATOM   2194 C CD  . GLN A 1 282 ? 55.835 -40.248 41.014 1.00 100.99 ? 282  GLN A CD  1 
ATOM   2195 O OE1 . GLN A 1 282 ? 54.919 -40.301 41.838 1.00 100.99 ? 282  GLN A OE1 1 
ATOM   2196 N NE2 . GLN A 1 282 ? 57.078 -39.904 41.345 1.00 100.99 ? 282  GLN A NE2 1 
ATOM   2197 N N   . HIS A 1 283 ? 58.737 -37.925 36.889 1.00 59.95  ? 283  HIS A N   1 
ATOM   2198 C CA  . HIS A 1 283 ? 59.954 -37.790 36.109 1.00 59.95  ? 283  HIS A CA  1 
ATOM   2199 C C   . HIS A 1 283 ? 61.036 -37.020 36.854 1.00 59.95  ? 283  HIS A C   1 
ATOM   2200 O O   . HIS A 1 283 ? 60.752 -36.061 37.580 1.00 59.95  ? 283  HIS A O   1 
ATOM   2201 C CB  . HIS A 1 283 ? 59.647 -37.108 34.774 1.00 39.44  ? 283  HIS A CB  1 
ATOM   2202 C CG  . HIS A 1 283 ? 60.772 -37.186 33.796 1.00 39.44  ? 283  HIS A CG  1 
ATOM   2203 N ND1 . HIS A 1 283 ? 61.810 -36.278 33.782 1.00 39.44  ? 283  HIS A ND1 1 
ATOM   2204 C CD2 . HIS A 1 283 ? 61.066 -38.110 32.850 1.00 39.44  ? 283  HIS A CD2 1 
ATOM   2205 C CE1 . HIS A 1 283 ? 62.696 -36.639 32.869 1.00 39.44  ? 283  HIS A CE1 1 
ATOM   2206 N NE2 . HIS A 1 283 ? 62.269 -37.748 32.290 1.00 39.44  ? 283  HIS A NE2 1 
ATOM   2207 N N   . PRO A 1 284 ? 62.301 -37.445 36.700 1.00 62.63  ? 284  PRO A N   1 
ATOM   2208 C CA  . PRO A 1 284 ? 63.416 -36.772 37.373 1.00 62.63  ? 284  PRO A CA  1 
ATOM   2209 C C   . PRO A 1 284 ? 63.351 -35.244 37.316 1.00 62.63  ? 284  PRO A C   1 
ATOM   2210 O O   . PRO A 1 284 ? 63.568 -34.564 38.324 1.00 62.63  ? 284  PRO A O   1 
ATOM   2211 C CB  . PRO A 1 284 ? 64.661 -37.358 36.682 1.00 49.80  ? 284  PRO A CB  1 
ATOM   2212 C CG  . PRO A 1 284 ? 64.126 -38.165 35.495 1.00 49.80  ? 284  PRO A CG  1 
ATOM   2213 C CD  . PRO A 1 284 ? 62.773 -38.612 35.938 1.00 49.80  ? 284  PRO A CD  1 
ATOM   2214 N N   . TYR A 1 285 ? 63.035 -34.707 36.144 1.00 52.81  ? 285  TYR A N   1 
ATOM   2215 C CA  . TYR A 1 285 ? 62.923 -33.259 35.966 1.00 52.81  ? 285  TYR A CA  1 
ATOM   2216 C C   . TYR A 1 285 ? 62.211 -32.581 37.150 1.00 52.81  ? 285  TYR A C   1 
ATOM   2217 O O   . TYR A 1 285 ? 62.440 -31.403 37.417 1.00 52.81  ? 285  TYR A O   1 
ATOM   2218 C CB  . TYR A 1 285 ? 62.169 -32.965 34.657 1.00 41.45  ? 285  TYR A CB  1 
ATOM   2219 C CG  . TYR A 1 285 ? 61.679 -31.535 34.510 1.00 41.45  ? 285  TYR A CG  1 
ATOM   2220 C CD1 . TYR A 1 285 ? 62.517 -30.531 34.012 1.00 41.45  ? 285  TYR A CD1 1 
ATOM   2221 C CD2 . TYR A 1 285 ? 60.382 -31.183 34.897 1.00 41.45  ? 285  TYR A CD2 1 
ATOM   2222 C CE1 . TYR A 1 285 ? 62.071 -29.218 33.903 1.00 41.45  ? 285  TYR A CE1 1 
ATOM   2223 C CE2 . TYR A 1 285 ? 59.934 -29.873 34.793 1.00 41.45  ? 285  TYR A CE2 1 
ATOM   2224 C CZ  . TYR A 1 285 ? 60.779 -28.897 34.295 1.00 41.45  ? 285  TYR A CZ  1 
ATOM   2225 O OH  . TYR A 1 285 ? 60.333 -27.600 34.181 1.00 41.45  ? 285  TYR A OH  1 
ATOM   2226 N N   . PHE A 1 286 ? 61.364 -33.339 37.852 1.00 68.47  ? 286  PHE A N   1 
ATOM   2227 C CA  . PHE A 1 286 ? 60.601 -32.838 39.000 1.00 68.47  ? 286  PHE A CA  1 
ATOM   2228 C C   . PHE A 1 286 ? 61.195 -33.230 40.351 1.00 68.47  ? 286  PHE A C   1 
ATOM   2229 O O   . PHE A 1 286 ? 61.134 -34.396 40.751 1.00 68.47  ? 286  PHE A O   1 
ATOM   2230 C CB  . PHE A 1 286 ? 59.166 -33.350 38.950 1.00 60.90  ? 286  PHE A CB  1 
ATOM   2231 C CG  . PHE A 1 286 ? 58.342 -32.737 37.863 1.00 60.90  ? 286  PHE A CG  1 
ATOM   2232 C CD1 . PHE A 1 286 ? 58.105 -31.363 37.835 1.00 60.90  ? 286  PHE A CD1 1 
ATOM   2233 C CD2 . PHE A 1 286 ? 57.786 -33.532 36.869 1.00 60.90  ? 286  PHE A CD2 1 
ATOM   2234 C CE1 . PHE A 1 286 ? 57.324 -30.792 36.834 1.00 60.90  ? 286  PHE A CE1 1 
ATOM   2235 C CE2 . PHE A 1 286 ? 57.004 -32.969 35.865 1.00 60.90  ? 286  PHE A CE2 1 
ATOM   2236 C CZ  . PHE A 1 286 ? 56.774 -31.595 35.851 1.00 60.90  ? 286  PHE A CZ  1 
ATOM   2237 N N   . SER A 1 287 ? 61.756 -32.256 41.063 1.00 193.02 ? 287  SER A N   1 
ATOM   2238 C CA  . SER A 1 287 ? 62.345 -32.518 42.376 1.00 193.02 ? 287  SER A CA  1 
ATOM   2239 C C   . SER A 1 287 ? 62.201 -31.326 43.319 1.00 193.02 ? 287  SER A C   1 
ATOM   2240 O O   . SER A 1 287 ? 61.724 -30.262 42.869 1.00 193.02 ? 287  SER A O   1 
ATOM   2241 C CB  . SER A 1 287 ? 63.824 -32.881 42.222 1.00 66.71  ? 287  SER A CB  1 
ATOM   2242 O OG  . SER A 1 287 ? 63.978 -34.080 41.482 1.00 66.71  ? 287  SER A OG  1 
ATOM   2243 N N   . GLN B 1 2   ? 22.670 -14.782 1.388  1.00 92.94  ? 2    GLN B N   1 
ATOM   2244 C CA  . GLN B 1 2   ? 22.461 -16.229 1.090  1.00 92.94  ? 2    GLN B CA  1 
ATOM   2245 C C   . GLN B 1 2   ? 23.233 -16.692 -0.144 1.00 92.94  ? 2    GLN B C   1 
ATOM   2246 O O   . GLN B 1 2   ? 23.189 -17.871 -0.507 1.00 92.94  ? 2    GLN B O   1 
ATOM   2247 C CB  . GLN B 1 2   ? 20.970 -16.519 0.901  1.00 126.76 ? 2    GLN B CB  1 
ATOM   2248 C CG  . GLN B 1 2   ? 20.309 -15.720 -0.205 1.00 170.04 ? 2    GLN B CG  1 
ATOM   2249 C CD  . GLN B 1 2   ? 18.831 -16.024 -0.326 1.00 170.04 ? 2    GLN B CD  1 
ATOM   2250 O OE1 . GLN B 1 2   ? 18.070 -15.854 0.627  1.00 170.04 ? 2    GLN B OE1 1 
ATOM   2251 N NE2 . GLN B 1 2   ? 18.414 -16.478 -1.503 1.00 170.04 ? 2    GLN B NE2 1 
ATOM   2252 N N   . LYS B 1 3   ? 23.926 -15.761 -0.795 1.00 74.09  ? 3    LYS B N   1 
ATOM   2253 C CA  . LYS B 1 3   ? 24.731 -16.089 -1.966 1.00 74.09  ? 3    LYS B CA  1 
ATOM   2254 C C   . LYS B 1 3   ? 26.141 -16.454 -1.499 1.00 74.09  ? 3    LYS B C   1 
ATOM   2255 O O   . LYS B 1 3   ? 27.092 -16.422 -2.284 1.00 74.09  ? 3    LYS B O   1 
ATOM   2256 C CB  . LYS B 1 3   ? 24.809 -14.897 -2.926 1.00 146.20 ? 3    LYS B CB  1 
ATOM   2257 C CG  . LYS B 1 3   ? 23.517 -14.589 -3.671 1.00 146.20 ? 3    LYS B CG  1 
ATOM   2258 C CD  . LYS B 1 3   ? 23.740 -13.508 -4.725 1.00 146.20 ? 3    LYS B CD  1 
ATOM   2259 C CE  . LYS B 1 3   ? 22.499 -13.277 -5.576 1.00 146.20 ? 3    LYS B CE  1 
ATOM   2260 N NZ  . LYS B 1 3   ? 21.350 -12.781 -4.772 1.00 146.20 ? 3    LYS B NZ  1 
ATOM   2261 N N   . TYR B 1 4   ? 26.262 -16.803 -0.219 1.00 86.41  ? 4    TYR B N   1 
ATOM   2262 C CA  . TYR B 1 4   ? 27.548 -17.158 0.378  1.00 86.41  ? 4    TYR B CA  1 
ATOM   2263 C C   . TYR B 1 4   ? 27.561 -18.583 0.936  1.00 86.41  ? 4    TYR B C   1 
ATOM   2264 O O   . TYR B 1 4   ? 26.523 -19.124 1.304  1.00 86.41  ? 4    TYR B O   1 
ATOM   2265 C CB  . TYR B 1 4   ? 27.893 -16.151 1.483  1.00 46.42  ? 4    TYR B CB  1 
ATOM   2266 C CG  . TYR B 1 4   ? 28.117 -14.735 0.964  1.00 46.42  ? 4    TYR B CG  1 
ATOM   2267 C CD1 . TYR B 1 4   ? 29.365 -14.338 0.467  1.00 46.42  ? 4    TYR B CD1 1 
ATOM   2268 C CD2 . TYR B 1 4   ? 27.074 -13.802 0.945  1.00 46.42  ? 4    TYR B CD2 1 
ATOM   2269 C CE1 . TYR B 1 4   ? 29.568 -13.045 -0.035 1.00 46.42  ? 4    TYR B CE1 1 
ATOM   2270 C CE2 . TYR B 1 4   ? 27.268 -12.514 0.444  1.00 46.42  ? 4    TYR B CE2 1 
ATOM   2271 C CZ  . TYR B 1 4   ? 28.516 -12.142 -0.042 1.00 46.42  ? 4    TYR B CZ  1 
ATOM   2272 O OH  . TYR B 1 4   ? 28.710 -10.869 -0.536 1.00 46.42  ? 4    TYR B OH  1 
ATOM   2273 N N   . GLU B 1 5   ? 28.747 -19.179 0.995  1.00 56.61  ? 5    GLU B N   1 
ATOM   2274 C CA  . GLU B 1 5   ? 28.921 -20.539 1.487  1.00 56.61  ? 5    GLU B CA  1 
ATOM   2275 C C   . GLU B 1 5   ? 29.894 -20.561 2.665  1.00 56.61  ? 5    GLU B C   1 
ATOM   2276 O O   . GLU B 1 5   ? 31.101 -20.711 2.475  1.00 56.61  ? 5    GLU B O   1 
ATOM   2277 C CB  . GLU B 1 5   ? 29.455 -21.414 0.346  1.00 112.96 ? 5    GLU B CB  1 
ATOM   2278 C CG  . GLU B 1 5   ? 29.848 -22.840 0.717  1.00 112.96 ? 5    GLU B CG  1 
ATOM   2279 C CD  . GLU B 1 5   ? 30.459 -23.596 -0.462 1.00 112.96 ? 5    GLU B CD  1 
ATOM   2280 O OE1 . GLU B 1 5   ? 30.794 -24.789 -0.303 1.00 112.96 ? 5    GLU B OE1 1 
ATOM   2281 O OE2 . GLU B 1 5   ? 30.607 -22.994 -1.549 1.00 112.96 ? 5    GLU B OE2 1 
ATOM   2282 N N   . LYS B 1 6   ? 29.371 -20.404 3.880  1.00 67.08  ? 6    LYS B N   1 
ATOM   2283 C CA  . LYS B 1 6   ? 30.210 -20.421 5.079  1.00 67.08  ? 6    LYS B CA  1 
ATOM   2284 C C   . LYS B 1 6   ? 31.209 -21.574 5.079  1.00 67.08  ? 6    LYS B C   1 
ATOM   2285 O O   . LYS B 1 6   ? 31.016 -22.588 4.411  1.00 67.08  ? 6    LYS B O   1 
ATOM   2286 C CB  . LYS B 1 6   ? 29.355 -20.520 6.344  1.00 119.35 ? 6    LYS B CB  1 
ATOM   2287 C CG  . LYS B 1 6   ? 28.790 -19.204 6.831  1.00 119.35 ? 6    LYS B CG  1 
ATOM   2288 C CD  . LYS B 1 6   ? 28.115 -19.372 8.188  1.00 119.35 ? 6    LYS B CD  1 
ATOM   2289 C CE  . LYS B 1 6   ? 27.640 -18.034 8.742  1.00 119.35 ? 6    LYS B CE  1 
ATOM   2290 N NZ  . LYS B 1 6   ? 27.028 -18.164 10.095 1.00 119.35 ? 6    LYS B NZ  1 
ATOM   2291 N N   . LEU B 1 7   ? 32.278 -21.410 5.846  1.00 81.98  ? 7    LEU B N   1 
ATOM   2292 C CA  . LEU B 1 7   ? 33.316 -22.423 5.953  1.00 81.97  ? 7    LEU B CA  1 
ATOM   2293 C C   . LEU B 1 7   ? 33.856 -22.363 7.372  1.00 90.94  ? 7    LEU B C   1 
ATOM   2294 O O   . LEU B 1 7   ? 33.105 -22.122 8.319  1.00 95.11  ? 7    LEU B O   1 
ATOM   2295 C CB  . LEU B 1 7   ? 34.436 -22.130 4.957  1.00 115.02 ? 7    LEU B CB  1 
ATOM   2296 C CG  . LEU B 1 7   ? 33.986 -21.985 3.502  1.00 105.27 ? 7    LEU B CG  1 
ATOM   2297 C CD1 . LEU B 1 7   ? 35.170 -21.591 2.639  1.00 105.27 ? 7    LEU B CD1 1 
ATOM   2298 C CD2 . LEU B 1 7   ? 33.375 -23.294 3.019  1.00 105.27 ? 7    LEU B CD2 1 
ATOM   2299 N N   . GLU B 1 8   ? 35.155 -22.589 7.521  1.00 113.91 ? 8    GLU B N   1 
ATOM   2300 C CA  . GLU B 1 8   ? 35.766 -22.524 8.839  1.00 114.94 ? 8    GLU B CA  1 
ATOM   2301 C C   . GLU B 1 8   ? 35.474 -21.128 9.373  1.00 114.16 ? 8    GLU B C   1 
ATOM   2302 O O   . GLU B 1 8   ? 35.681 -20.144 8.665  1.00 113.70 ? 8    GLU B O   1 
ATOM   2303 C CB  . GLU B 1 8   ? 37.281 -22.742 8.735  1.00 92.63  ? 8    GLU B CB  1 
ATOM   2304 C CG  . GLU B 1 8   ? 37.935 -22.013 7.567  1.00 98.60  ? 8    GLU B CG  1 
ATOM   2305 C CD  . GLU B 1 8   ? 39.393 -21.696 7.823  1.00 107.83 ? 8    GLU B CD  1 
ATOM   2306 O OE1 . GLU B 1 8   ? 40.090 -21.271 6.876  1.00 107.79 ? 8    GLU B OE1 1 
ATOM   2307 O OE2 . GLU B 1 8   ? 39.840 -21.862 8.978  1.00 113.44 ? 8    GLU B OE2 1 
ATOM   2308 N N   . LYS B 1 9   ? 34.971 -21.029 10.600 1.00 72.01  ? 9    LYS B N   1 
ATOM   2309 C CA  . LYS B 1 9   ? 34.690 -19.708 11.156 1.00 74.89  ? 9    LYS B CA  1 
ATOM   2310 C C   . LYS B 1 9   ? 35.824 -19.249 12.071 1.00 72.27  ? 9    LYS B C   1 
ATOM   2311 O O   . LYS B 1 9   ? 36.303 -20.004 12.912 1.00 73.68  ? 9    LYS B O   1 
ATOM   2312 C CB  . LYS B 1 9   ? 33.358 -19.698 11.919 1.00 67.91  ? 9    LYS B CB  1 
ATOM   2313 C CG  . LYS B 1 9   ? 33.373 -20.357 13.286 1.00 77.42  ? 9    LYS B CG  1 
ATOM   2314 C CD  . LYS B 1 9   ? 32.057 -20.099 14.010 1.00 84.08  ? 9    LYS B CD  1 
ATOM   2315 C CE  . LYS B 1 9   ? 32.070 -20.661 15.421 1.00 88.24  ? 9    LYS B CE  1 
ATOM   2316 N NZ  . LYS B 1 9   ? 30.804 -20.377 16.146 1.00 88.24  ? 9    LYS B NZ  1 
ATOM   2317 N N   . ILE B 1 10  ? 36.254 -18.007 11.886 1.00 65.59  ? 10   ILE B N   1 
ATOM   2318 C CA  . ILE B 1 10  ? 37.328 -17.422 12.682 1.00 69.21  ? 10   ILE B CA  1 
ATOM   2319 C C   . ILE B 1 10  ? 36.741 -16.566 13.799 1.00 75.59  ? 10   ILE B C   1 
ATOM   2320 O O   . ILE B 1 10  ? 37.474 -15.997 14.602 1.00 76.22  ? 10   ILE B O   1 
ATOM   2321 C CB  . ILE B 1 10  ? 38.226 -16.526 11.824 1.00 66.94  ? 10   ILE B CB  1 
ATOM   2322 C CG1 . ILE B 1 10  ? 38.622 -17.264 10.547 1.00 66.11  ? 10   ILE B CG1 1 
ATOM   2323 C CG2 . ILE B 1 10  ? 39.464 -16.136 12.609 1.00 69.12  ? 10   ILE B CG2 1 
ATOM   2324 C CD1 . ILE B 1 10  ? 39.364 -16.396 9.557  1.00 62.25  ? 10   ILE B CD1 1 
ATOM   2325 N N   . TYR B 1 15  ? 32.483 -7.592  17.027 1.00 104.59 ? 15   TYR B N   1 
ATOM   2326 C CA  . TYR B 1 15  ? 31.105 -7.963  17.320 1.00 105.86 ? 15   TYR B CA  1 
ATOM   2327 C C   . TYR B 1 15  ? 31.013 -9.467  17.330 1.00 105.86 ? 15   TYR B C   1 
ATOM   2328 O O   . TYR B 1 15  ? 31.922 -10.141 17.807 1.00 105.86 ? 15   TYR B O   1 
ATOM   2329 C CB  . TYR B 1 15  ? 30.161 -7.411  16.260 1.00 176.88 ? 15   TYR B CB  1 
ATOM   2330 C CG  . TYR B 1 15  ? 30.439 -5.977  15.939 1.00 102.29 ? 15   TYR B CG  1 
ATOM   2331 C CD1 . TYR B 1 15  ? 31.472 -5.631  15.069 1.00 102.29 ? 15   TYR B CD1 1 
ATOM   2332 C CD2 . TYR B 1 15  ? 29.725 -4.958  16.560 1.00 102.29 ? 15   TYR B CD2 1 
ATOM   2333 C CE1 . TYR B 1 15  ? 31.796 -4.306  14.830 1.00 102.29 ? 15   TYR B CE1 1 
ATOM   2334 C CE2 . TYR B 1 15  ? 30.037 -3.624  16.332 1.00 102.29 ? 15   TYR B CE2 1 
ATOM   2335 C CZ  . TYR B 1 15  ? 31.077 -3.303  15.466 1.00 102.29 ? 15   TYR B CZ  1 
ATOM   2336 O OH  . TYR B 1 15  ? 31.411 -1.984  15.247 1.00 102.29 ? 15   TYR B OH  1 
ATOM   2337 N N   . GLY B 1 16  ? 29.915 -9.987  16.792 1.00 81.51  ? 16   GLY B N   1 
ATOM   2338 C CA  . GLY B 1 16  ? 29.720 -11.423 16.748 1.00 81.87  ? 16   GLY B CA  1 
ATOM   2339 C C   . GLY B 1 16  ? 30.896 -12.189 16.168 1.00 82.10  ? 16   GLY B C   1 
ATOM   2340 O O   . GLY B 1 16  ? 32.043 -11.739 16.216 1.00 82.95  ? 16   GLY B O   1 
ATOM   2341 N N   . THR B 1 17  ? 30.611 -13.357 15.608 1.00 70.26  ? 17   THR B N   1 
ATOM   2342 C CA  . THR B 1 17  ? 31.659 -14.185 15.030 1.00 66.13  ? 17   THR B CA  1 
ATOM   2343 C C   . THR B 1 17  ? 32.019 -13.790 13.595 1.00 59.76  ? 17   THR B C   1 
ATOM   2344 O O   . THR B 1 17  ? 31.196 -13.239 12.858 1.00 59.39  ? 17   THR B O   1 
ATOM   2345 C CB  . THR B 1 17  ? 31.256 -15.678 15.076 1.00 183.48 ? 17   THR B CB  1 
ATOM   2346 O OG1 . THR B 1 17  ? 31.912 -16.394 14.021 1.00 128.64 ? 17   THR B OG1 1 
ATOM   2347 C CG2 . THR B 1 17  ? 29.745 -15.823 14.963 1.00 186.52 ? 17   THR B CG2 1 
ATOM   2348 N N   . VAL B 1 18  ? 33.267 -14.061 13.225 1.00 91.13  ? 18   VAL B N   1 
ATOM   2349 C CA  . VAL B 1 18  ? 33.771 -13.774 11.890 1.00 84.95  ? 18   VAL B CA  1 
ATOM   2350 C C   . VAL B 1 18  ? 34.023 -15.127 11.234 1.00 83.89  ? 18   VAL B C   1 
ATOM   2351 O O   . VAL B 1 18  ? 34.819 -15.919 11.749 1.00 85.34  ? 18   VAL B O   1 
ATOM   2352 C CB  . VAL B 1 18  ? 35.100 -12.995 11.948 1.00 77.52  ? 18   VAL B CB  1 
ATOM   2353 C CG1 . VAL B 1 18  ? 35.537 -12.607 10.544 1.00 73.11  ? 18   VAL B CG1 1 
ATOM   2354 C CG2 . VAL B 1 18  ? 34.941 -11.763 12.819 1.00 80.38  ? 18   VAL B CG2 1 
ATOM   2355 N N   . PHE B 1 19  ? 33.339 -15.391 10.116 1.00 61.73  ? 19   PHE B N   1 
ATOM   2356 C CA  . PHE B 1 19  ? 33.482 -16.659 9.399  1.00 58.14  ? 19   PHE B CA  1 
ATOM   2357 C C   . PHE B 1 19  ? 34.140 -16.470 8.049  1.00 55.18  ? 19   PHE B C   1 
ATOM   2358 O O   . PHE B 1 19  ? 34.011 -15.419 7.428  1.00 55.69  ? 19   PHE B O   1 
ATOM   2359 C CB  . PHE B 1 19  ? 32.131 -17.312 9.112  1.00 57.72  ? 19   PHE B CB  1 
ATOM   2360 C CG  . PHE B 1 19  ? 31.141 -17.217 10.225 1.00 67.98  ? 19   PHE B CG  1 
ATOM   2361 C CD1 . PHE B 1 19  ? 30.545 -16.003 10.547 1.00 73.56  ? 19   PHE B CD1 1 
ATOM   2362 C CD2 . PHE B 1 19  ? 30.734 -18.359 10.898 1.00 70.51  ? 19   PHE B CD2 1 
ATOM   2363 C CE1 . PHE B 1 19  ? 29.548 -15.935 11.515 1.00 76.39  ? 19   PHE B CE1 1 
ATOM   2364 C CE2 . PHE B 1 19  ? 29.741 -18.304 11.867 1.00 75.37  ? 19   PHE B CE2 1 
ATOM   2365 C CZ  . PHE B 1 19  ? 29.145 -17.091 12.176 1.00 80.97  ? 19   PHE B CZ  1 
ATOM   2366 N N   . LYS B 1 20  ? 34.832 -17.507 7.589  1.00 67.20  ? 20   LYS B N   1 
ATOM   2367 C CA  . LYS B 1 20  ? 35.463 -17.483 6.274  1.00 64.26  ? 20   LYS B CA  1 
ATOM   2368 C C   . LYS B 1 20  ? 34.332 -17.927 5.351  1.00 65.99  ? 20   LYS B C   1 
ATOM   2369 O O   . LYS B 1 20  ? 33.406 -18.599 5.797  1.00 63.93  ? 20   LYS B O   1 
ATOM   2370 C CB  . LYS B 1 20  ? 36.619 -18.492 6.214  1.00 72.42  ? 20   LYS B CB  1 
ATOM   2371 C CG  . LYS B 1 20  ? 37.357 -18.569 4.870  1.00 76.52  ? 20   LYS B CG  1 
ATOM   2372 C CD  . LYS B 1 20  ? 38.490 -19.590 4.940  1.00 82.41  ? 20   LYS B CD  1 
ATOM   2373 C CE  . LYS B 1 20  ? 39.396 -19.514 3.725  1.00 85.63  ? 20   LYS B CE  1 
ATOM   2374 N NZ  . LYS B 1 20  ? 40.619 -20.336 3.921  1.00 85.50  ? 20   LYS B NZ  1 
ATOM   2375 N N   . ALA B 1 21  ? 34.385 -17.547 4.081  1.00 48.72  ? 21   ALA B N   1 
ATOM   2376 C CA  . ALA B 1 21  ? 33.335 -17.947 3.157  1.00 47.18  ? 21   ALA B CA  1 
ATOM   2377 C C   . ALA B 1 21  ? 33.708 -17.765 1.702  1.00 51.46  ? 21   ALA B C   1 
ATOM   2378 O O   . ALA B 1 21  ? 34.649 -17.044 1.369  1.00 50.25  ? 21   ALA B O   1 
ATOM   2379 C CB  . ALA B 1 21  ? 32.063 -17.193 3.458  1.00 44.39  ? 21   ALA B CB  1 
ATOM   2380 N N   . LYS B 1 22  ? 32.939 -18.428 0.846  1.00 70.86  ? 22   LYS B N   1 
ATOM   2381 C CA  . LYS B 1 22  ? 33.130 -18.411 -0.598 1.00 71.63  ? 22   LYS B CA  1 
ATOM   2382 C C   . LYS B 1 22  ? 31.879 -17.789 -1.214 1.00 66.21  ? 22   LYS B C   1 
ATOM   2383 O O   . LYS B 1 22  ? 30.780 -17.964 -0.691 1.00 63.63  ? 22   LYS B O   1 
ATOM   2384 C CB  . LYS B 1 22  ? 33.316 -19.852 -1.068 1.00 134.04 ? 22   LYS B CB  1 
ATOM   2385 C CG  . LYS B 1 22  ? 33.614 -20.074 -2.536 1.00 141.18 ? 22   LYS B CG  1 
ATOM   2386 C CD  . LYS B 1 22  ? 33.894 -21.559 -2.731 1.00 151.44 ? 22   LYS B CD  1 
ATOM   2387 C CE  . LYS B 1 22  ? 34.105 -21.948 -4.176 1.00 104.13 ? 22   LYS B CE  1 
ATOM   2388 N NZ  . LYS B 1 22  ? 34.442 -23.403 -4.234 1.00 104.13 ? 22   LYS B NZ  1 
ATOM   2389 N N   . ASN B 1 23  ? 32.045 -17.058 -2.310 1.00 108.08 ? 23   ASN B N   1 
ATOM   2390 C CA  . ASN B 1 23  ? 30.912 -16.415 -2.956 1.00 106.91 ? 23   ASN B CA  1 
ATOM   2391 C C   . ASN B 1 23  ? 30.093 -17.401 -3.784 1.00 108.94 ? 23   ASN B C   1 
ATOM   2392 O O   . ASN B 1 23  ? 28.948 -17.117 -4.143 1.00 109.33 ? 23   ASN B O   1 
ATOM   2393 C CB  . ASN B 1 23  ? 31.388 -15.278 -3.857 1.00 111.12 ? 23   ASN B CB  1 
ATOM   2394 C CG  . ASN B 1 23  ? 30.246 -14.396 -4.322 1.00 117.69 ? 23   ASN B CG  1 
ATOM   2395 O OD1 . ASN B 1 23  ? 29.661 -13.656 -3.533 1.00 119.91 ? 23   ASN B OD1 1 
ATOM   2396 N ND2 . ASN B 1 23  ? 29.912 -14.481 -5.602 1.00 121.59 ? 23   ASN B ND2 1 
ATOM   2397 N N   . ARG B 1 24  ? 30.685 -18.558 -4.072 1.00 127.93 ? 24   ARG B N   1 
ATOM   2398 C CA  . ARG B 1 24  ? 30.067 -19.623 -4.871 1.00 128.78 ? 24   ARG B CA  1 
ATOM   2399 C C   . ARG B 1 24  ? 29.465 -19.190 -6.207 1.00 132.90 ? 24   ARG B C   1 
ATOM   2400 O O   . ARG B 1 24  ? 29.427 -19.981 -7.147 1.00 137.43 ? 24   ARG B O   1 
ATOM   2401 C CB  . ARG B 1 24  ? 29.011 -20.405 -4.061 1.00 82.65  ? 24   ARG B CB  1 
ATOM   2402 C CG  . ARG B 1 24  ? 27.744 -19.652 -3.680 1.00 85.33  ? 24   ARG B CG  1 
ATOM   2403 C CD  . ARG B 1 24  ? 26.558 -20.618 -3.568 1.00 85.68  ? 24   ARG B CD  1 
ATOM   2404 N NE  . ARG B 1 24  ? 26.735 -21.708 -2.600 1.00 71.35  ? 24   ARG B NE  1 
ATOM   2405 C CZ  . ARG B 1 24  ? 26.269 -21.689 -1.353 1.00 71.35  ? 24   ARG B CZ  1 
ATOM   2406 N NH1 . ARG B 1 24  ? 25.599 -20.633 -0.908 1.00 71.35  ? 24   ARG B NH1 1 
ATOM   2407 N NH2 . ARG B 1 24  ? 26.449 -22.733 -0.556 1.00 71.35  ? 24   ARG B NH2 1 
ATOM   2408 N N   . GLU B 1 25  ? 28.994 -17.950 -6.299 1.00 155.86 ? 25   GLU B N   1 
ATOM   2409 C CA  . GLU B 1 25  ? 28.419 -17.454 -7.545 1.00 156.28 ? 25   GLU B CA  1 
ATOM   2410 C C   . GLU B 1 25  ? 29.534 -16.792 -8.347 1.00 159.71 ? 25   GLU B C   1 
ATOM   2411 O O   . GLU B 1 25  ? 29.416 -16.592 -9.556 1.00 163.73 ? 25   GLU B O   1 
ATOM   2412 C CB  . GLU B 1 25  ? 27.305 -16.442 -7.266 1.00 140.95 ? 25   GLU B CB  1 
ATOM   2413 C CG  . GLU B 1 25  ? 26.409 -16.168 -8.468 1.00 141.79 ? 25   GLU B CG  1 
ATOM   2414 C CD  . GLU B 1 25  ? 25.388 -15.080 -8.201 1.00 121.53 ? 25   GLU B CD  1 
ATOM   2415 O OE1 . GLU B 1 25  ? 25.792 -13.906 -8.070 1.00 121.53 ? 25   GLU B OE1 1 
ATOM   2416 O OE2 . GLU B 1 25  ? 24.183 -15.404 -8.116 1.00 121.53 ? 25   GLU B OE2 1 
ATOM   2417 N N   . THR B 1 26  ? 30.613 -16.449 -7.650 1.00 76.27  ? 26   THR B N   1 
ATOM   2418 C CA  . THR B 1 26  ? 31.791 -15.831 -8.256 1.00 73.92  ? 26   THR B CA  1 
ATOM   2419 C C   . THR B 1 26  ? 32.967 -16.472 -7.539 1.00 71.52  ? 26   THR B C   1 
ATOM   2420 O O   . THR B 1 26  ? 34.128 -16.126 -7.759 1.00 71.80  ? 26   THR B O   1 
ATOM   2421 C CB  . THR B 1 26  ? 31.846 -14.308 -8.013 1.00 104.60 ? 26   THR B CB  1 
ATOM   2422 O OG1 . THR B 1 26  ? 32.153 -14.049 -6.635 1.00 104.73 ? 26   THR B OG1 1 
ATOM   2423 C CG2 . THR B 1 26  ? 30.512 -13.667 -8.370 1.00 101.87 ? 26   THR B CG2 1 
ATOM   2424 N N   . HIS B 1 27  ? 32.628 -17.416 -6.670 1.00 87.50  ? 27   HIS B N   1 
ATOM   2425 C CA  . HIS B 1 27  ? 33.586 -18.164 -5.871 1.00 87.50  ? 27   HIS B CA  1 
ATOM   2426 C C   . HIS B 1 27  ? 34.746 -17.377 -5.263 1.00 87.50  ? 27   HIS B C   1 
ATOM   2427 O O   . HIS B 1 27  ? 35.828 -17.932 -5.065 1.00 87.50  ? 27   HIS B O   1 
ATOM   2428 C CB  . HIS B 1 27  ? 34.140 -19.348 -6.675 1.00 160.78 ? 27   HIS B CB  1 
ATOM   2429 C CG  . HIS B 1 27  ? 34.908 -18.952 -7.895 1.00 160.78 ? 27   HIS B CG  1 
ATOM   2430 N ND1 . HIS B 1 27  ? 34.310 -18.402 -9.010 1.00 160.78 ? 27   HIS B ND1 1 
ATOM   2431 C CD2 . HIS B 1 27  ? 36.229 -19.031 -8.181 1.00 160.78 ? 27   HIS B CD2 1 
ATOM   2432 C CE1 . HIS B 1 27  ? 35.228 -18.162 -9.927 1.00 160.78 ? 27   HIS B CE1 1 
ATOM   2433 N NE2 . HIS B 1 27  ? 36.402 -18.535 -9.449 1.00 160.78 ? 27   HIS B NE2 1 
ATOM   2434 N N   . GLU B 1 28  ? 34.531 -16.096 -4.961 1.00 84.95  ? 28   GLU B N   1 
ATOM   2435 C CA  . GLU B 1 28  ? 35.583 -15.292 -4.342 1.00 84.95  ? 28   GLU B CA  1 
ATOM   2436 C C   . GLU B 1 28  ? 35.519 -15.559 -2.841 1.00 84.95  ? 28   GLU B C   1 
ATOM   2437 O O   . GLU B 1 28  ? 34.453 -15.885 -2.316 1.00 84.95  ? 28   GLU B O   1 
ATOM   2438 C CB  . GLU B 1 28  ? 35.371 -13.794 -4.593 1.00 80.63  ? 28   GLU B CB  1 
ATOM   2439 C CG  . GLU B 1 28  ? 36.524 -12.934 -4.061 1.00 80.63  ? 28   GLU B CG  1 
ATOM   2440 C CD  . GLU B 1 28  ? 36.264 -11.434 -4.138 1.00 80.63  ? 28   GLU B CD  1 
ATOM   2441 O OE1 . GLU B 1 28  ? 37.242 -10.661 -4.029 1.00 80.63  ? 28   GLU B OE1 1 
ATOM   2442 O OE2 . GLU B 1 28  ? 35.091 -11.023 -4.293 1.00 80.63  ? 28   GLU B OE2 1 
ATOM   2443 N N   . ILE B 1 29  ? 36.650 -15.438 -2.150 1.00 58.44  ? 29   ILE B N   1 
ATOM   2444 C CA  . ILE B 1 29  ? 36.656 -15.669 -0.713 1.00 58.44  ? 29   ILE B CA  1 
ATOM   2445 C C   . ILE B 1 29  ? 36.522 -14.363 0.061  1.00 58.44  ? 29   ILE B C   1 
ATOM   2446 O O   . ILE B 1 29  ? 37.220 -13.378 -0.194 1.00 58.44  ? 29   ILE B O   1 
ATOM   2447 C CB  . ILE B 1 29  ? 37.915 -16.401 -0.260 1.00 56.40  ? 29   ILE B CB  1 
ATOM   2448 C CG1 . ILE B 1 29  ? 38.013 -17.737 -0.992 1.00 56.40  ? 29   ILE B CG1 1 
ATOM   2449 C CG2 . ILE B 1 29  ? 37.853 -16.648 1.239  1.00 56.40  ? 29   ILE B CG2 1 
ATOM   2450 C CD1 . ILE B 1 29  ? 39.167 -18.596 -0.529 1.00 56.40  ? 29   ILE B CD1 1 
ATOM   2451 N N   . VAL B 1 30  ? 35.605 -14.379 1.017  1.00 56.24  ? 30   VAL B N   1 
ATOM   2452 C CA  . VAL B 1 30  ? 35.312 -13.222 1.830  1.00 56.24  ? 30   VAL B CA  1 
ATOM   2453 C C   . VAL B 1 30  ? 35.338 -13.599 3.296  1.00 56.24  ? 30   VAL B C   1 
ATOM   2454 O O   . VAL B 1 30  ? 35.623 -14.735 3.658  1.00 56.24  ? 30   VAL B O   1 
ATOM   2455 C CB  . VAL B 1 30  ? 33.915 -12.703 1.510  1.00 50.33  ? 30   VAL B CB  1 
ATOM   2456 C CG1 . VAL B 1 30  ? 33.788 -12.450 0.011  1.00 50.33  ? 30   VAL B CG1 1 
ATOM   2457 C CG2 . VAL B 1 30  ? 32.874 -13.723 1.973  1.00 50.33  ? 30   VAL B CG2 1 
ATOM   2458 N N   . ALA B 1 31  ? 35.031 -12.625 4.135  1.00 50.38  ? 31   ALA B N   1 
ATOM   2459 C CA  . ALA B 1 31  ? 34.981 -12.843 5.563  1.00 50.38  ? 31   ALA B CA  1 
ATOM   2460 C C   . ALA B 1 31  ? 33.676 -12.203 6.015  1.00 50.38  ? 31   ALA B C   1 
ATOM   2461 O O   . ALA B 1 31  ? 33.388 -11.056 5.667  1.00 50.38  ? 31   ALA B O   1 
ATOM   2462 C CB  . ALA B 1 31  ? 36.177 -12.187 6.247  1.00 38.59  ? 31   ALA B CB  1 
ATOM   2463 N N   . LEU B 1 32  ? 32.875 -12.961 6.759  1.00 45.54  ? 32   LEU B N   1 
ATOM   2464 C CA  . LEU B 1 32  ? 31.584 -12.489 7.260  1.00 45.54  ? 32   LEU B CA  1 
ATOM   2465 C C   . LEU B 1 32  ? 31.648 -12.123 8.742  1.00 45.54  ? 32   LEU B C   1 
ATOM   2466 O O   . LEU B 1 32  ? 32.274 -12.832 9.534  1.00 45.54  ? 32   LEU B O   1 
ATOM   2467 C CB  . LEU B 1 32  ? 30.523 -13.571 7.056  1.00 45.47  ? 32   LEU B CB  1 
ATOM   2468 C CG  . LEU B 1 32  ? 29.641 -13.532 5.814  1.00 45.47  ? 32   LEU B CG  1 
ATOM   2469 C CD1 . LEU B 1 32  ? 30.417 -13.063 4.595  1.00 45.47  ? 32   LEU B CD1 1 
ATOM   2470 C CD2 . LEU B 1 32  ? 29.082 -14.922 5.598  1.00 45.47  ? 32   LEU B CD2 1 
ATOM   2471 N N   . LYS B 1 33  ? 31.003 -11.017 9.101  1.00 45.26  ? 33   LYS B N   1 
ATOM   2472 C CA  . LYS B 1 33  ? 30.955 -10.532 10.479 1.00 45.26  ? 33   LYS B CA  1 
ATOM   2473 C C   . LYS B 1 33  ? 29.456 -10.433 10.728 1.00 45.26  ? 33   LYS B C   1 
ATOM   2474 O O   . LYS B 1 33  ? 28.815 -9.460  10.328 1.00 45.26  ? 33   LYS B O   1 
ATOM   2475 C CB  . LYS B 1 33  ? 31.588 -9.143  10.571 1.00 70.97  ? 33   LYS B CB  1 
ATOM   2476 C CG  . LYS B 1 33  ? 32.096 -8.735  11.955 1.00 70.97  ? 33   LYS B CG  1 
ATOM   2477 C CD  . LYS B 1 33  ? 32.524 -7.260  11.938 1.00 70.97  ? 33   LYS B CD  1 
ATOM   2478 C CE  . LYS B 1 33  ? 33.604 -6.929  12.965 1.00 70.97  ? 33   LYS B CE  1 
ATOM   2479 N NZ  . LYS B 1 33  ? 34.198 -5.574  12.717 1.00 70.97  ? 33   LYS B NZ  1 
ATOM   2480 N N   . ARG B 1 34  ? 28.887 -11.439 11.374 1.00 54.52  ? 34   ARG B N   1 
ATOM   2481 C CA  . ARG B 1 34  ? 27.458 -11.427 11.600 1.00 54.52  ? 34   ARG B CA  1 
ATOM   2482 C C   . ARG B 1 34  ? 27.069 -10.859 12.956 1.00 54.52  ? 34   ARG B C   1 
ATOM   2483 O O   . ARG B 1 34  ? 27.130 -11.540 13.972 1.00 54.52  ? 34   ARG B O   1 
ATOM   2484 C CB  . ARG B 1 34  ? 26.911 -12.839 11.373 1.00 53.33  ? 34   ARG B CB  1 
ATOM   2485 C CG  . ARG B 1 34  ? 27.491 -13.487 10.104 1.00 53.33  ? 34   ARG B CG  1 
ATOM   2486 C CD  . ARG B 1 34  ? 26.589 -14.531 9.545  1.00 53.33  ? 34   ARG B CD  1 
ATOM   2487 N NE  . ARG B 1 34  ? 25.305 -13.913 9.323  1.00 53.33  ? 34   ARG B NE  1 
ATOM   2488 C CZ  . ARG B 1 34  ? 24.191 -14.574 9.049  1.00 53.33  ? 34   ARG B CZ  1 
ATOM   2489 N NH1 . ARG B 1 34  ? 24.207 -15.900 8.960  1.00 53.33  ? 34   ARG B NH1 1 
ATOM   2490 N NH2 . ARG B 1 34  ? 23.054 -13.907 8.882  1.00 53.33  ? 34   ARG B NH2 1 
ATOM   2491 N N   . VAL B 1 35  ? 26.670 -9.588  12.936 1.00 43.98  ? 35   VAL B N   1 
ATOM   2492 C CA  . VAL B 1 35  ? 26.276 -8.844  14.128 1.00 43.98  ? 35   VAL B CA  1 
ATOM   2493 C C   . VAL B 1 35  ? 24.814 -9.063  14.445 1.00 43.98  ? 35   VAL B C   1 
ATOM   2494 O O   . VAL B 1 35  ? 23.972 -8.990  13.553 1.00 43.98  ? 35   VAL B O   1 
ATOM   2495 C CB  . VAL B 1 35  ? 26.482 -7.320  13.934 1.00 47.09  ? 35   VAL B CB  1 
ATOM   2496 C CG1 . VAL B 1 35  ? 26.075 -6.573  15.189 1.00 47.09  ? 35   VAL B CG1 1 
ATOM   2497 C CG2 . VAL B 1 35  ? 27.931 -7.011  13.587 1.00 47.09  ? 35   VAL B CG2 1 
ATOM   2498 N N   . ARG B 1 36  ? 24.526 -9.314  15.723 1.00 56.61  ? 36   ARG B N   1 
ATOM   2499 C CA  . ARG B 1 36  ? 23.163 -9.546  16.212 1.00 56.61  ? 36   ARG B CA  1 
ATOM   2500 C C   . ARG B 1 36  ? 22.467 -8.220  16.487 1.00 56.61  ? 36   ARG B C   1 
ATOM   2501 O O   . ARG B 1 36  ? 23.078 -7.282  16.995 1.00 56.61  ? 36   ARG B O   1 
ATOM   2502 C CB  . ARG B 1 36  ? 23.186 -10.347 17.517 1.00 167.91 ? 36   ARG B CB  1 
ATOM   2503 C CG  . ARG B 1 36  ? 23.835 -11.717 17.440 1.00 167.91 ? 36   ARG B CG  1 
ATOM   2504 C CD  . ARG B 1 36  ? 22.983 -12.702 16.669 1.00 167.91 ? 36   ARG B CD  1 
ATOM   2505 N NE  . ARG B 1 36  ? 23.522 -14.054 16.768 1.00 167.91 ? 36   ARG B NE  1 
ATOM   2506 C CZ  . ARG B 1 36  ? 23.030 -15.106 16.123 1.00 167.91 ? 36   ARG B CZ  1 
ATOM   2507 N NH1 . ARG B 1 36  ? 21.982 -14.965 15.322 1.00 167.91 ? 36   ARG B NH1 1 
ATOM   2508 N NH2 . ARG B 1 36  ? 23.586 -16.301 16.279 1.00 167.91 ? 36   ARG B NH2 1 
ATOM   2509 N N   . LEU B 1 37  ? 21.178 -8.157  16.177 1.00 57.11  ? 37   LEU B N   1 
ATOM   2510 C CA  . LEU B 1 37  ? 20.393 -6.942  16.389 1.00 57.11  ? 37   LEU B CA  1 
ATOM   2511 C C   . LEU B 1 37  ? 19.505 -7.070  17.618 1.00 57.11  ? 37   LEU B C   1 
ATOM   2512 O O   . LEU B 1 37  ? 18.511 -6.352  17.744 1.00 57.11  ? 37   LEU B O   1 
ATOM   2513 C CB  . LEU B 1 37  ? 19.525 -6.666  15.160 1.00 50.23  ? 37   LEU B CB  1 
ATOM   2514 C CG  . LEU B 1 37  ? 20.305 -6.620  13.840 1.00 50.23  ? 37   LEU B CG  1 
ATOM   2515 C CD1 . LEU B 1 37  ? 19.355 -6.516  12.664 1.00 50.23  ? 37   LEU B CD1 1 
ATOM   2516 C CD2 . LEU B 1 37  ? 21.275 -5.445  13.878 1.00 50.23  ? 37   LEU B CD2 1 
ATOM   2517 N N   . ASP B 1 38  ? 19.863 -7.983  18.520 1.00 92.19  ? 38   ASP B N   1 
ATOM   2518 C CA  . ASP B 1 38  ? 19.088 -8.203  19.741 1.00 92.19  ? 38   ASP B CA  1 
ATOM   2519 C C   . ASP B 1 38  ? 19.884 -9.004  20.777 1.00 92.19  ? 38   ASP B C   1 
ATOM   2520 O O   . ASP B 1 38  ? 20.678 -8.452  21.544 1.00 92.19  ? 38   ASP B O   1 
ATOM   2521 C CB  . ASP B 1 38  ? 17.781 -8.938  19.406 1.00 118.00 ? 38   ASP B CB  1 
ATOM   2522 C CG  . ASP B 1 38  ? 18.014 -10.364 18.918 1.00 118.00 ? 38   ASP B CG  1 
ATOM   2523 O OD1 . ASP B 1 38  ? 18.916 -10.578 18.079 1.00 118.00 ? 38   ASP B OD1 1 
ATOM   2524 O OD2 . ASP B 1 38  ? 17.286 -11.274 19.367 1.00 118.00 ? 38   ASP B OD2 1 
ATOM   2525 N N   . GLY B 1 43  ? 24.237 -1.617  22.260 1.00 92.13  ? 43   GLY B N   1 
ATOM   2526 C CA  . GLY B 1 43  ? 25.190 -0.703  21.651 1.00 92.13  ? 43   GLY B CA  1 
ATOM   2527 C C   . GLY B 1 43  ? 26.047 -1.345  20.569 1.00 92.13  ? 43   GLY B C   1 
ATOM   2528 O O   . GLY B 1 43  ? 26.827 -0.669  19.890 1.00 92.13  ? 43   GLY B O   1 
ATOM   2529 N N   . VAL B 1 44  ? 25.907 -2.658  20.414 1.00 56.29  ? 44   VAL B N   1 
ATOM   2530 C CA  . VAL B 1 44  ? 26.663 -3.401  19.415 1.00 56.29  ? 44   VAL B CA  1 
ATOM   2531 C C   . VAL B 1 44  ? 26.300 -2.885  18.025 1.00 56.29  ? 44   VAL B C   1 
ATOM   2532 O O   . VAL B 1 44  ? 27.181 -2.528  17.237 1.00 56.29  ? 44   VAL B O   1 
ATOM   2533 C CB  . VAL B 1 44  ? 26.348 -4.923  19.508 1.00 46.18  ? 44   VAL B CB  1 
ATOM   2534 C CG1 . VAL B 1 44  ? 27.006 -5.680  18.381 1.00 46.18  ? 44   VAL B CG1 1 
ATOM   2535 C CG2 . VAL B 1 44  ? 26.813 -5.456  20.845 1.00 46.18  ? 44   VAL B CG2 1 
ATOM   2536 N N   . PRO B 1 45  ? 24.990 -2.812  17.722 1.00 54.11  ? 45   PRO B N   1 
ATOM   2537 C CA  . PRO B 1 45  ? 24.517 -2.338  16.417 1.00 54.11  ? 45   PRO B CA  1 
ATOM   2538 C C   . PRO B 1 45  ? 24.989 -0.925  16.050 1.00 54.11  ? 45   PRO B C   1 
ATOM   2539 O O   . PRO B 1 45  ? 25.457 -0.679  14.930 1.00 54.11  ? 45   PRO B O   1 
ATOM   2540 C CB  . PRO B 1 45  ? 22.991 -2.428  16.549 1.00 26.70  ? 45   PRO B CB  1 
ATOM   2541 C CG  . PRO B 1 45  ? 22.796 -3.527  17.592 1.00 26.70  ? 45   PRO B CG  1 
ATOM   2542 C CD  . PRO B 1 45  ? 23.850 -3.156  18.593 1.00 26.70  ? 45   PRO B CD  1 
ATOM   2543 N N   . SER B 1 46  ? 24.877 0.004   16.991 1.00 42.18  ? 46   SER B N   1 
ATOM   2544 C CA  . SER B 1 46  ? 25.284 1.369   16.708 1.00 42.18  ? 46   SER B CA  1 
ATOM   2545 C C   . SER B 1 46  ? 26.755 1.437   16.348 1.00 42.18  ? 46   SER B C   1 
ATOM   2546 O O   . SER B 1 46  ? 27.149 2.250   15.520 1.00 42.18  ? 46   SER B O   1 
ATOM   2547 C CB  . SER B 1 46  ? 25.001 2.295   17.894 1.00 47.40  ? 46   SER B CB  1 
ATOM   2548 O OG  . SER B 1 46  ? 25.908 2.058   18.952 1.00 47.40  ? 46   SER B OG  1 
ATOM   2549 N N   . SER B 1 47  ? 27.580 0.603   16.963 1.00 35.82  ? 47   SER B N   1 
ATOM   2550 C CA  . SER B 1 47  ? 28.988 0.641   16.630 1.00 35.82  ? 47   SER B CA  1 
ATOM   2551 C C   . SER B 1 47  ? 29.149 0.010   15.254 1.00 35.82  ? 47   SER B C   1 
ATOM   2552 O O   . SER B 1 47  ? 29.940 0.474   14.432 1.00 35.82  ? 47   SER B O   1 
ATOM   2553 C CB  . SER B 1 47  ? 29.814 -0.121  17.661 1.00 40.29  ? 47   SER B CB  1 
ATOM   2554 O OG  . SER B 1 47  ? 31.174 -0.175  17.261 1.00 40.29  ? 47   SER B OG  1 
ATOM   2555 N N   . ALA B 1 48  ? 28.386 -1.046  14.997 1.00 34.34  ? 48   ALA B N   1 
ATOM   2556 C CA  . ALA B 1 48  ? 28.465 -1.712  13.709 1.00 34.34  ? 48   ALA B CA  1 
ATOM   2557 C C   . ALA B 1 48  ? 28.075 -0.740  12.603 1.00 34.34  ? 48   ALA B C   1 
ATOM   2558 O O   . ALA B 1 48  ? 28.740 -0.693  11.557 1.00 34.34  ? 48   ALA B O   1 
ATOM   2559 C CB  . ALA B 1 48  ? 27.549 -2.901  13.679 1.00 11.54  ? 48   ALA B CB  1 
ATOM   2560 N N   . LEU B 1 49  ? 27.001 0.027   12.834 1.00 35.31  ? 49   LEU B N   1 
ATOM   2561 C CA  . LEU B 1 49  ? 26.528 0.986   11.845 1.00 35.31  ? 49   LEU B CA  1 
ATOM   2562 C C   . LEU B 1 49  ? 27.550 2.070   11.581 1.00 35.31  ? 49   LEU B C   1 
ATOM   2563 O O   . LEU B 1 49  ? 27.754 2.468   10.435 1.00 35.31  ? 49   LEU B O   1 
ATOM   2564 C CB  . LEU B 1 49  ? 25.194 1.596   12.279 1.00 36.47  ? 49   LEU B CB  1 
ATOM   2565 C CG  . LEU B 1 49  ? 24.013 0.618   12.189 1.00 36.47  ? 49   LEU B CG  1 
ATOM   2566 C CD1 . LEU B 1 49  ? 22.733 1.300   12.618 1.00 36.47  ? 49   LEU B CD1 1 
ATOM   2567 C CD2 . LEU B 1 49  ? 23.872 0.117   10.769 1.00 36.47  ? 49   LEU B CD2 1 
ATOM   2568 N N   . ARG B 1 50  ? 28.204 2.541   12.638 1.00 36.92  ? 50   ARG B N   1 
ATOM   2569 C CA  . ARG B 1 50  ? 29.236 3.569   12.485 1.00 36.92  ? 50   ARG B CA  1 
ATOM   2570 C C   . ARG B 1 50  ? 30.391 2.979   11.661 1.00 36.92  ? 50   ARG B C   1 
ATOM   2571 O O   . ARG B 1 50  ? 30.944 3.635   10.770 1.00 36.92  ? 50   ARG B O   1 
ATOM   2572 C CB  . ARG B 1 50  ? 29.753 4.041   13.851 1.00 47.23  ? 50   ARG B CB  1 
ATOM   2573 C CG  . ARG B 1 50  ? 30.780 5.155   13.751 1.00 47.23  ? 50   ARG B CG  1 
ATOM   2574 C CD  . ARG B 1 50  ? 31.061 5.854   15.075 1.00 47.23  ? 50   ARG B CD  1 
ATOM   2575 N NE  . ARG B 1 50  ? 31.787 4.992   15.997 1.00 47.23  ? 50   ARG B NE  1 
ATOM   2576 C CZ  . ARG B 1 50  ? 31.221 4.330   17.000 1.00 47.23  ? 50   ARG B CZ  1 
ATOM   2577 N NH1 . ARG B 1 50  ? 29.915 4.437   17.219 1.00 47.23  ? 50   ARG B NH1 1 
ATOM   2578 N NH2 . ARG B 1 50  ? 31.955 3.544   17.774 1.00 47.23  ? 50   ARG B NH2 1 
ATOM   2579 N N   . GLU B 1 51  ? 30.752 1.735   11.949 1.00 34.92  ? 51   GLU B N   1 
ATOM   2580 C CA  . GLU B 1 51  ? 31.819 1.113   11.195 1.00 34.92  ? 51   GLU B CA  1 
ATOM   2581 C C   . GLU B 1 51  ? 31.471 1.075   9.705  1.00 34.92  ? 51   GLU B C   1 
ATOM   2582 O O   . GLU B 1 51  ? 32.277 1.467   8.859  1.00 34.92  ? 51   GLU B O   1 
ATOM   2583 C CB  . GLU B 1 51  ? 32.083 -0.295  11.704 1.00 46.65  ? 51   GLU B CB  1 
ATOM   2584 C CG  . GLU B 1 51  ? 33.249 -0.937  11.003 1.00 46.65  ? 51   GLU B CG  1 
ATOM   2585 C CD  . GLU B 1 51  ? 33.534 -2.326  11.510 1.00 46.65  ? 51   GLU B CD  1 
ATOM   2586 O OE1 . GLU B 1 51  ? 34.499 -2.943  11.001 1.00 46.65  ? 51   GLU B OE1 1 
ATOM   2587 O OE2 . GLU B 1 51  ? 32.801 -2.795  12.415 1.00 46.65  ? 51   GLU B OE2 1 
ATOM   2588 N N   . ILE B 1 52  ? 30.279 0.594   9.377  1.00 45.58  ? 52   ILE B N   1 
ATOM   2589 C CA  . ILE B 1 52  ? 29.864 0.543   7.985  1.00 45.58  ? 52   ILE B CA  1 
ATOM   2590 C C   . ILE B 1 52  ? 30.049 1.928   7.349  1.00 45.58  ? 52   ILE B C   1 
ATOM   2591 O O   . ILE B 1 52  ? 30.781 2.060   6.367  1.00 45.58  ? 52   ILE B O   1 
ATOM   2592 C CB  . ILE B 1 52  ? 28.397 0.077   7.878  1.00 36.30  ? 52   ILE B CB  1 
ATOM   2593 C CG1 . ILE B 1 52  ? 28.317 -1.404  8.274  1.00 36.30  ? 52   ILE B CG1 1 
ATOM   2594 C CG2 . ILE B 1 52  ? 27.850 0.335   6.462  1.00 36.30  ? 52   ILE B CG2 1 
ATOM   2595 C CD1 . ILE B 1 52  ? 26.912 -1.959  8.291  1.00 36.30  ? 52   ILE B CD1 1 
ATOM   2596 N N   . CYS B 1 53  ? 29.406 2.950   7.926  1.00 41.03  ? 53   CYS B N   1 
ATOM   2597 C CA  . CYS B 1 53  ? 29.501 4.340   7.442  1.00 41.03  ? 53   CYS B CA  1 
ATOM   2598 C C   . CYS B 1 53  ? 30.918 4.772   7.124  1.00 41.03  ? 53   CYS B C   1 
ATOM   2599 O O   . CYS B 1 53  ? 31.205 5.242   6.013  1.00 41.03  ? 53   CYS B O   1 
ATOM   2600 C CB  . CYS B 1 53  ? 28.978 5.327   8.479  1.00 39.99  ? 53   CYS B CB  1 
ATOM   2601 S SG  . CYS B 1 53  ? 27.231 5.525   8.512  1.00 39.99  ? 53   CYS B SG  1 
ATOM   2602 N N   . LEU B 1 54  ? 31.791 4.647   8.120  1.00 33.33  ? 54   LEU B N   1 
ATOM   2603 C CA  . LEU B 1 54  ? 33.184 5.034   7.958  1.00 33.33  ? 54   LEU B CA  1 
ATOM   2604 C C   . LEU B 1 54  ? 33.864 4.221   6.855  1.00 33.33  ? 54   LEU B C   1 
ATOM   2605 O O   . LEU B 1 54  ? 34.497 4.786   5.964  1.00 33.33  ? 54   LEU B O   1 
ATOM   2606 C CB  . LEU B 1 54  ? 33.926 4.891   9.288  1.00 22.74  ? 54   LEU B CB  1 
ATOM   2607 C CG  . LEU B 1 54  ? 33.386 5.808   10.392 1.00 22.74  ? 54   LEU B CG  1 
ATOM   2608 C CD1 . LEU B 1 54  ? 34.138 5.561   11.690 1.00 22.74  ? 54   LEU B CD1 1 
ATOM   2609 C CD2 . LEU B 1 54  ? 33.547 7.254   9.983  1.00 22.74  ? 54   LEU B CD2 1 
ATOM   2610 N N   . LEU B 1 55  ? 33.716 2.905   6.883  1.00 39.16  ? 55   LEU B N   1 
ATOM   2611 C CA  . LEU B 1 55  ? 34.348 2.092   5.854  1.00 39.16  ? 55   LEU B CA  1 
ATOM   2612 C C   . LEU B 1 55  ? 33.864 2.425   4.440  1.00 39.16  ? 55   LEU B C   1 
ATOM   2613 O O   . LEU B 1 55  ? 34.672 2.416   3.515  1.00 39.16  ? 55   LEU B O   1 
ATOM   2614 C CB  . LEU B 1 55  ? 34.158 0.597   6.161  1.00 41.01  ? 55   LEU B CB  1 
ATOM   2615 C CG  . LEU B 1 55  ? 35.434 -0.214  6.466  1.00 41.01  ? 55   LEU B CG  1 
ATOM   2616 C CD1 . LEU B 1 55  ? 36.583 0.715   6.850  1.00 41.01  ? 55   LEU B CD1 1 
ATOM   2617 C CD2 . LEU B 1 55  ? 35.163 -1.232  7.580  1.00 41.01  ? 55   LEU B CD2 1 
ATOM   2618 N N   . LYS B 1 56  ? 32.578 2.742   4.251  1.00 41.94  ? 56   LYS B N   1 
ATOM   2619 C CA  . LYS B 1 56  ? 32.107 3.062   2.891  1.00 41.94  ? 56   LYS B CA  1 
ATOM   2620 C C   . LYS B 1 56  ? 32.921 4.208   2.284  1.00 41.94  ? 56   LYS B C   1 
ATOM   2621 O O   . LYS B 1 56  ? 33.118 4.256   1.076  1.00 41.94  ? 56   LYS B O   1 
ATOM   2622 C CB  . LYS B 1 56  ? 30.614 3.454   2.847  1.00 32.04  ? 56   LYS B CB  1 
ATOM   2623 C CG  . LYS B 1 56  ? 29.616 2.420   3.416  1.00 32.04  ? 56   LYS B CG  1 
ATOM   2624 C CD  . LYS B 1 56  ? 28.186 2.662   2.913  1.00 32.04  ? 56   LYS B CD  1 
ATOM   2625 C CE  . LYS B 1 56  ? 27.940 1.843   1.650  1.00 32.04  ? 56   LYS B CE  1 
ATOM   2626 N NZ  . LYS B 1 56  ? 26.826 2.338   0.775  1.00 32.04  ? 56   LYS B NZ  1 
ATOM   2627 N N   . GLU B 1 57  ? 33.398 5.119   3.127  1.00 33.16  ? 57   GLU B N   1 
ATOM   2628 C CA  . GLU B 1 57  ? 34.167 6.274   2.680  1.00 33.16  ? 57   GLU B CA  1 
ATOM   2629 C C   . GLU B 1 57  ? 35.679 6.139   2.817  1.00 33.16  ? 57   GLU B C   1 
ATOM   2630 O O   . GLU B 1 57  ? 36.393 7.125   2.680  1.00 33.16  ? 57   GLU B O   1 
ATOM   2631 C CB  . GLU B 1 57  ? 33.716 7.499   3.460  1.00 47.97  ? 57   GLU B CB  1 
ATOM   2632 C CG  . GLU B 1 57  ? 32.245 7.762   3.321  1.00 47.97  ? 57   GLU B CG  1 
ATOM   2633 C CD  . GLU B 1 57  ? 31.825 7.781   1.874  1.00 47.97  ? 57   GLU B CD  1 
ATOM   2634 O OE1 . GLU B 1 57  ? 32.431 8.556   1.094  1.00 47.97  ? 57   GLU B OE1 1 
ATOM   2635 O OE2 . GLU B 1 57  ? 30.901 7.020   1.516  1.00 47.97  ? 57   GLU B OE2 1 
ATOM   2636 N N   . LEU B 1 58  ? 36.175 4.934   3.074  1.00 48.01  ? 58   LEU B N   1 
ATOM   2637 C CA  . LEU B 1 58  ? 37.613 4.744   3.233  1.00 48.01  ? 58   LEU B CA  1 
ATOM   2638 C C   . LEU B 1 58  ? 38.196 3.679   2.295  1.00 48.01  ? 58   LEU B C   1 
ATOM   2639 O O   . LEU B 1 58  ? 38.459 2.557   2.706  1.00 48.01  ? 58   LEU B O   1 
ATOM   2640 C CB  . LEU B 1 58  ? 37.920 4.371   4.687  1.00 55.83  ? 58   LEU B CB  1 
ATOM   2641 C CG  . LEU B 1 58  ? 37.549 5.372   5.784  1.00 55.83  ? 58   LEU B CG  1 
ATOM   2642 C CD1 . LEU B 1 58  ? 37.716 4.738   7.156  1.00 55.83  ? 58   LEU B CD1 1 
ATOM   2643 C CD2 . LEU B 1 58  ? 38.424 6.601   5.655  1.00 55.83  ? 58   LEU B CD2 1 
ATOM   2644 N N   . LYS B 1 59  ? 38.411 4.027   1.037  1.00 43.69  ? 59   LYS B N   1 
ATOM   2645 C CA  . LYS B 1 59  ? 38.966 3.062   0.096  1.00 43.69  ? 59   LYS B CA  1 
ATOM   2646 C C   . LYS B 1 59  ? 40.463 3.277   -0.086 1.00 43.69  ? 59   LYS B C   1 
ATOM   2647 O O   . LYS B 1 59  ? 40.899 4.309   -0.600 1.00 43.69  ? 59   LYS B O   1 
ATOM   2648 C CB  . LYS B 1 59  ? 38.276 3.186   -1.259 1.00 56.60  ? 59   LYS B CB  1 
ATOM   2649 C CG  . LYS B 1 59  ? 36.760 3.135   -1.190 1.00 56.60  ? 59   LYS B CG  1 
ATOM   2650 C CD  . LYS B 1 59  ? 36.275 1.814   -0.650 1.00 56.60  ? 59   LYS B CD  1 
ATOM   2651 C CE  . LYS B 1 59  ? 34.772 1.733   -0.696 1.00 56.60  ? 59   LYS B CE  1 
ATOM   2652 N NZ  . LYS B 1 59  ? 34.346 0.440   -0.108 1.00 56.60  ? 59   LYS B NZ  1 
ATOM   2653 N N   . HIS B 1 60  ? 41.249 2.299   0.337  1.00 34.31  ? 60   HIS B N   1 
ATOM   2654 C CA  . HIS B 1 60  ? 42.701 2.380   0.222  1.00 34.31  ? 60   HIS B CA  1 
ATOM   2655 C C   . HIS B 1 60  ? 43.216 0.947   0.283  1.00 34.31  ? 60   HIS B C   1 
ATOM   2656 O O   . HIS B 1 60  ? 42.560 0.065   0.849  1.00 34.31  ? 60   HIS B O   1 
ATOM   2657 C CB  . HIS B 1 60  ? 43.270 3.234   1.373  1.00 37.68  ? 60   HIS B CB  1 
ATOM   2658 C CG  . HIS B 1 60  ? 44.743 3.511   1.275  1.00 37.68  ? 60   HIS B CG  1 
ATOM   2659 N ND1 . HIS B 1 60  ? 45.705 2.614   1.696  1.00 37.68  ? 60   HIS B ND1 1 
ATOM   2660 C CD2 . HIS B 1 60  ? 45.416 4.610   0.855  1.00 37.68  ? 60   HIS B CD2 1 
ATOM   2661 C CE1 . HIS B 1 60  ? 46.903 3.151   1.545  1.00 37.68  ? 60   HIS B CE1 1 
ATOM   2662 N NE2 . HIS B 1 60  ? 46.755 4.362   1.036  1.00 37.68  ? 60   HIS B NE2 1 
ATOM   2663 N N   . LYS B 1 61  ? 44.385 0.720   -0.304 1.00 51.16  ? 61   LYS B N   1 
ATOM   2664 C CA  . LYS B 1 61  ? 44.976 -0.607  -0.343 1.00 51.16  ? 61   LYS B CA  1 
ATOM   2665 C C   . LYS B 1 61  ? 45.416 -1.113  1.018  1.00 51.16  ? 61   LYS B C   1 
ATOM   2666 O O   . LYS B 1 61  ? 45.581 -2.315  1.212  1.00 51.16  ? 61   LYS B O   1 
ATOM   2667 C CB  . LYS B 1 61  ? 46.150 -0.618  -1.331 1.00 114.79 ? 61   LYS B CB  1 
ATOM   2668 C CG  . LYS B 1 61  ? 45.737 -0.144  -2.724 1.00 114.79 ? 61   LYS B CG  1 
ATOM   2669 C CD  . LYS B 1 61  ? 46.613 -0.703  -3.836 1.00 114.79 ? 61   LYS B CD  1 
ATOM   2670 C CE  . LYS B 1 61  ? 46.028 -0.369  -5.209 1.00 114.79 ? 61   LYS B CE  1 
ATOM   2671 N NZ  . LYS B 1 61  ? 46.783 -1.006  -6.336 1.00 114.79 ? 61   LYS B NZ  1 
ATOM   2672 N N   . ASN B 1 62  ? 45.578 -0.203  1.970  1.00 37.81  ? 62   ASN B N   1 
ATOM   2673 C CA  . ASN B 1 62  ? 46.010 -0.593  3.311  1.00 37.81  ? 62   ASN B CA  1 
ATOM   2674 C C   . ASN B 1 62  ? 44.925 -0.523  4.394  1.00 37.81  ? 62   ASN B C   1 
ATOM   2675 O O   . ASN B 1 62  ? 45.205 -0.557  5.596  1.00 37.81  ? 62   ASN B O   1 
ATOM   2676 C CB  . ASN B 1 62  ? 47.236 0.232   3.700  1.00 37.08  ? 62   ASN B CB  1 
ATOM   2677 C CG  . ASN B 1 62  ? 48.427 -0.086  2.823  1.00 37.08  ? 62   ASN B CG  1 
ATOM   2678 O OD1 . ASN B 1 62  ? 48.879 -1.230  2.779  1.00 37.08  ? 62   ASN B OD1 1 
ATOM   2679 N ND2 . ASN B 1 62  ? 48.934 0.914   2.112  1.00 37.08  ? 62   ASN B ND2 1 
ATOM   2680 N N   . ILE B 1 63  ? 43.678 -0.433  3.949  1.00 44.98  ? 63   ILE B N   1 
ATOM   2681 C CA  . ILE B 1 63  ? 42.533 -0.401  4.850  1.00 44.98  ? 63   ILE B CA  1 
ATOM   2682 C C   . ILE B 1 63  ? 41.637 -1.492  4.289  1.00 44.98  ? 63   ILE B C   1 
ATOM   2683 O O   . ILE B 1 63  ? 41.346 -1.501  3.092  1.00 44.98  ? 63   ILE B O   1 
ATOM   2684 C CB  . ILE B 1 63  ? 41.829 0.981   4.811  1.00 25.87  ? 63   ILE B CB  1 
ATOM   2685 C CG1 . ILE B 1 63  ? 42.729 2.040   5.469  1.00 25.87  ? 63   ILE B CG1 1 
ATOM   2686 C CG2 . ILE B 1 63  ? 40.476 0.910   5.503  1.00 25.87  ? 63   ILE B CG2 1 
ATOM   2687 C CD1 . ILE B 1 63  ? 42.180 3.457   5.367  1.00 25.87  ? 63   ILE B CD1 1 
ATOM   2688 N N   . VAL B 1 64  ? 41.233 -2.431  5.139  1.00 33.60  ? 64   VAL B N   1 
ATOM   2689 C CA  . VAL B 1 64  ? 40.396 -3.552  4.708  1.00 33.60  ? 64   VAL B CA  1 
ATOM   2690 C C   . VAL B 1 64  ? 39.129 -3.106  3.984  1.00 33.60  ? 64   VAL B C   1 
ATOM   2691 O O   . VAL B 1 64  ? 38.501 -2.121  4.358  1.00 33.60  ? 64   VAL B O   1 
ATOM   2692 C CB  . VAL B 1 64  ? 39.995 -4.446  5.906  1.00 45.49  ? 64   VAL B CB  1 
ATOM   2693 C CG1 . VAL B 1 64  ? 39.148 -3.661  6.896  1.00 45.49  ? 64   VAL B CG1 1 
ATOM   2694 C CG2 . VAL B 1 64  ? 39.255 -5.673  5.409  1.00 45.49  ? 64   VAL B CG2 1 
ATOM   2695 N N   . ARG B 1 65  ? 38.760 -3.835  2.937  1.00 34.96  ? 65   ARG B N   1 
ATOM   2696 C CA  . ARG B 1 65  ? 37.573 -3.503  2.164  1.00 34.96  ? 65   ARG B CA  1 
ATOM   2697 C C   . ARG B 1 65  ? 36.288 -4.120  2.703  1.00 34.96  ? 65   ARG B C   1 
ATOM   2698 O O   . ARG B 1 65  ? 36.280 -5.254  3.183  1.00 34.96  ? 65   ARG B O   1 
ATOM   2699 C CB  . ARG B 1 65  ? 37.760 -3.940  0.708  1.00 131.87 ? 65   ARG B CB  1 
ATOM   2700 C CG  . ARG B 1 65  ? 38.782 -3.131  -0.070 1.00 84.91  ? 65   ARG B CG  1 
ATOM   2701 C CD  . ARG B 1 65  ? 39.043 -3.752  -1.432 1.00 84.91  ? 65   ARG B CD  1 
ATOM   2702 N NE  . ARG B 1 65  ? 39.809 -4.990  -1.323 1.00 84.91  ? 65   ARG B NE  1 
ATOM   2703 C CZ  . ARG B 1 65  ? 40.110 -5.777  -2.350 1.00 84.91  ? 65   ARG B CZ  1 
ATOM   2704 N NH1 . ARG B 1 65  ? 39.706 -5.458  -3.571 1.00 84.91  ? 65   ARG B NH1 1 
ATOM   2705 N NH2 . ARG B 1 65  ? 40.819 -6.881  -2.158 1.00 84.91  ? 65   ARG B NH2 1 
ATOM   2706 N N   . LEU B 1 66  ? 35.210 -3.347  2.627  1.00 43.35  ? 66   LEU B N   1 
ATOM   2707 C CA  . LEU B 1 66  ? 33.881 -3.787  3.035  1.00 43.35  ? 66   LEU B CA  1 
ATOM   2708 C C   . LEU B 1 66  ? 33.141 -3.940  1.715  1.00 43.35  ? 66   LEU B C   1 
ATOM   2709 O O   . LEU B 1 66  ? 32.740 -2.950  1.113  1.00 43.35  ? 66   LEU B O   1 
ATOM   2710 C CB  . LEU B 1 66  ? 33.172 -2.717  3.872  1.00 35.80  ? 66   LEU B CB  1 
ATOM   2711 C CG  . LEU B 1 66  ? 31.658 -2.930  4.058  1.00 35.80  ? 66   LEU B CG  1 
ATOM   2712 C CD1 . LEU B 1 66  ? 31.419 -4.166  4.930  1.00 35.80  ? 66   LEU B CD1 1 
ATOM   2713 C CD2 . LEU B 1 66  ? 31.015 -1.702  4.710  1.00 35.80  ? 66   LEU B CD2 1 
ATOM   2714 N N   . HIS B 1 67  ? 32.960 -5.173  1.262  1.00 50.89  ? 67   HIS B N   1 
ATOM   2715 C CA  . HIS B 1 67  ? 32.281 -5.411  -0.005 1.00 50.89  ? 67   HIS B CA  1 
ATOM   2716 C C   . HIS B 1 67  ? 30.777 -5.189  -0.009 1.00 50.89  ? 67   HIS B C   1 
ATOM   2717 O O   . HIS B 1 67  ? 30.254 -4.588  -0.943 1.00 50.89  ? 67   HIS B O   1 
ATOM   2718 C CB  . HIS B 1 67  ? 32.573 -6.824  -0.499 1.00 47.44  ? 67   HIS B CB  1 
ATOM   2719 C CG  . HIS B 1 67  ? 34.009 -7.059  -0.837 1.00 47.44  ? 67   HIS B CG  1 
ATOM   2720 N ND1 . HIS B 1 67  ? 34.686 -8.199  -0.452 1.00 47.44  ? 67   HIS B ND1 1 
ATOM   2721 C CD2 . HIS B 1 67  ? 34.901 -6.306  -1.525 1.00 47.44  ? 67   HIS B CD2 1 
ATOM   2722 C CE1 . HIS B 1 67  ? 35.932 -8.136  -0.888 1.00 47.44  ? 67   HIS B CE1 1 
ATOM   2723 N NE2 . HIS B 1 67  ? 36.089 -6.997  -1.543 1.00 47.44  ? 67   HIS B NE2 1 
ATOM   2724 N N   . ASP B 1 68  ? 30.075 -5.648  1.024  1.00 47.00  ? 68   ASP B N   1 
ATOM   2725 C CA  . ASP B 1 68  ? 28.616 -5.505  1.044  1.00 47.00  ? 68   ASP B CA  1 
ATOM   2726 C C   . ASP B 1 68  ? 28.047 -5.590  2.458  1.00 47.00  ? 68   ASP B C   1 
ATOM   2727 O O   . ASP B 1 68  ? 28.785 -5.799  3.416  1.00 47.00  ? 68   ASP B O   1 
ATOM   2728 C CB  . ASP B 1 68  ? 28.011 -6.622  0.174  1.00 58.58  ? 68   ASP B CB  1 
ATOM   2729 C CG  . ASP B 1 68  ? 26.550 -6.381  -0.198 1.00 58.58  ? 68   ASP B CG  1 
ATOM   2730 O OD1 . ASP B 1 68  ? 25.973 -7.274  -0.855 1.00 58.58  ? 68   ASP B OD1 1 
ATOM   2731 O OD2 . ASP B 1 68  ? 25.983 -5.321  0.148  1.00 58.58  ? 68   ASP B OD2 1 
ATOM   2732 N N   . VAL B 1 69  ? 26.736 -5.402  2.584  1.00 46.93  ? 69   VAL B N   1 
ATOM   2733 C CA  . VAL B 1 69  ? 26.065 -5.516  3.875  1.00 46.93  ? 69   VAL B CA  1 
ATOM   2734 C C   . VAL B 1 69  ? 24.696 -6.131  3.674  1.00 46.93  ? 69   VAL B C   1 
ATOM   2735 O O   . VAL B 1 69  ? 23.938 -5.703  2.806  1.00 46.93  ? 69   VAL B O   1 
ATOM   2736 C CB  . VAL B 1 69  ? 25.874 -4.168  4.573  1.00 37.19  ? 69   VAL B CB  1 
ATOM   2737 C CG1 . VAL B 1 69  ? 25.310 -4.406  5.979  1.00 37.19  ? 69   VAL B CG1 1 
ATOM   2738 C CG2 . VAL B 1 69  ? 27.193 -3.434  4.663  1.00 37.19  ? 69   VAL B CG2 1 
ATOM   2739 N N   . LEU B 1 70  ? 24.376 -7.133  4.485  1.00 56.96  ? 70   LEU B N   1 
ATOM   2740 C CA  . LEU B 1 70  ? 23.098 -7.819  4.369  1.00 56.96  ? 70   LEU B CA  1 
ATOM   2741 C C   . LEU B 1 70  ? 22.312 -7.767  5.677  1.00 56.96  ? 70   LEU B C   1 
ATOM   2742 O O   . LEU B 1 70  ? 22.894 -7.796  6.758  1.00 56.96  ? 70   LEU B O   1 
ATOM   2743 C CB  . LEU B 1 70  ? 23.350 -9.279  3.975  1.00 56.19  ? 70   LEU B CB  1 
ATOM   2744 C CG  . LEU B 1 70  ? 24.540 -9.563  3.044  1.00 56.19  ? 70   LEU B CG  1 
ATOM   2745 C CD1 . LEU B 1 70  ? 24.693 -11.062 2.836  1.00 56.19  ? 70   LEU B CD1 1 
ATOM   2746 C CD2 . LEU B 1 70  ? 24.337 -8.866  1.712  1.00 56.19  ? 70   LEU B CD2 1 
ATOM   2747 N N   . HIS B 1 71  ? 20.991 -7.682  5.574  1.00 48.08  ? 71   HIS B N   1 
ATOM   2748 C CA  . HIS B 1 71  ? 20.121 -7.661  6.746  1.00 48.08  ? 71   HIS B CA  1 
ATOM   2749 C C   . HIS B 1 71  ? 19.139 -8.820  6.604  1.00 48.08  ? 71   HIS B C   1 
ATOM   2750 O O   . HIS B 1 71  ? 18.082 -8.686  5.978  1.00 48.08  ? 71   HIS B O   1 
ATOM   2751 C CB  . HIS B 1 71  ? 19.343 -6.346  6.827  1.00 51.66  ? 71   HIS B CB  1 
ATOM   2752 C CG  . HIS B 1 71  ? 18.238 -6.352  7.843  1.00 51.66  ? 71   HIS B CG  1 
ATOM   2753 N ND1 . HIS B 1 71  ? 17.132 -5.529  7.748  1.00 51.66  ? 71   HIS B ND1 1 
ATOM   2754 C CD2 . HIS B 1 71  ? 18.068 -7.071  8.979  1.00 51.66  ? 71   HIS B CD2 1 
ATOM   2755 C CE1 . HIS B 1 71  ? 16.333 -5.745  8.775  1.00 51.66  ? 71   HIS B CE1 1 
ATOM   2756 N NE2 . HIS B 1 71  ? 16.877 -6.675  9.540  1.00 51.66  ? 71   HIS B NE2 1 
ATOM   2757 N N   . SER B 1 72  ? 19.489 -9.960  7.184  1.00 63.19  ? 72   SER B N   1 
ATOM   2758 C CA  . SER B 1 72  ? 18.629 -11.132 7.106  1.00 63.19  ? 72   SER B CA  1 
ATOM   2759 C C   . SER B 1 72  ? 18.671 -11.927 8.401  1.00 63.19  ? 72   SER B C   1 
ATOM   2760 O O   . SER B 1 72  ? 19.740 -12.116 8.987  1.00 63.19  ? 72   SER B O   1 
ATOM   2761 C CB  . SER B 1 72  ? 19.076 -12.031 5.953  1.00 67.98  ? 72   SER B CB  1 
ATOM   2762 O OG  . SER B 1 72  ? 20.336 -12.624 6.236  1.00 67.98  ? 72   SER B OG  1 
ATOM   2763 N N   . ASP B 1 73  ? 17.503 -12.391 8.839  1.00 79.12  ? 73   ASP B N   1 
ATOM   2764 C CA  . ASP B 1 73  ? 17.382 -13.191 10.055 1.00 79.12  ? 73   ASP B CA  1 
ATOM   2765 C C   . ASP B 1 73  ? 17.690 -12.399 11.320 1.00 79.12  ? 73   ASP B C   1 
ATOM   2766 O O   . ASP B 1 73  ? 18.316 -12.916 12.239 1.00 79.12  ? 73   ASP B O   1 
ATOM   2767 C CB  . ASP B 1 73  ? 18.317 -14.404 9.984  1.00 96.23  ? 73   ASP B CB  1 
ATOM   2768 C CG  . ASP B 1 73  ? 17.986 -15.339 8.835  1.00 96.23  ? 73   ASP B CG  1 
ATOM   2769 O OD1 . ASP B 1 73  ? 18.730 -16.327 8.649  1.00 96.23  ? 73   ASP B OD1 1 
ATOM   2770 O OD2 . ASP B 1 73  ? 16.988 -15.095 8.122  1.00 96.23  ? 73   ASP B OD2 1 
ATOM   2771 N N   . LYS B 1 74  ? 17.244 -11.151 11.374 1.00 53.74  ? 74   LYS B N   1 
ATOM   2772 C CA  . LYS B 1 74  ? 17.495 -10.294 12.534 1.00 53.74  ? 74   LYS B CA  1 
ATOM   2773 C C   . LYS B 1 74  ? 19.003 -10.176 12.749 1.00 53.74  ? 74   LYS B C   1 
ATOM   2774 O O   . LYS B 1 74  ? 19.473 -10.101 13.886 1.00 53.74  ? 74   LYS B O   1 
ATOM   2775 C CB  . LYS B 1 74  ? 16.880 -10.896 13.799 1.00 69.25  ? 74   LYS B CB  1 
ATOM   2776 C CG  . LYS B 1 74  ? 15.521 -11.529 13.628 1.00 69.25  ? 74   LYS B CG  1 
ATOM   2777 C CD  . LYS B 1 74  ? 15.089 -12.152 14.954 1.00 69.25  ? 74   LYS B CD  1 
ATOM   2778 C CE  . LYS B 1 74  ? 13.898 -13.113 14.790 1.00 69.25  ? 74   LYS B CE  1 
ATOM   2779 N NZ  . LYS B 1 74  ? 13.629 -13.860 16.075 1.00 69.25  ? 74   LYS B NZ  1 
ATOM   2780 N N   . LYS B 1 75  ? 19.764 -10.155 11.661 1.00 81.23  ? 75   LYS B N   1 
ATOM   2781 C CA  . LYS B 1 75  ? 21.210 -10.076 11.793 1.00 81.23  ? 75   LYS B CA  1 
ATOM   2782 C C   . LYS B 1 75  ? 21.878 -9.307  10.653 1.00 81.23  ? 75   LYS B C   1 
ATOM   2783 O O   . LYS B 1 75  ? 21.536 -9.486  9.486  1.00 81.23  ? 75   LYS B O   1 
ATOM   2784 C CB  . LYS B 1 75  ? 21.773 -11.501 11.867 1.00 114.36 ? 75   LYS B CB  1 
ATOM   2785 C CG  . LYS B 1 75  ? 22.901 -11.704 12.870 1.00 114.36 ? 75   LYS B CG  1 
ATOM   2786 C CD  . LYS B 1 75  ? 23.296 -13.182 12.978 1.00 114.36 ? 75   LYS B CD  1 
ATOM   2787 C CE  . LYS B 1 75  ? 24.539 -13.372 13.858 1.00 114.36 ? 75   LYS B CE  1 
ATOM   2788 N NZ  . LYS B 1 75  ? 25.036 -14.785 13.895 1.00 114.36 ? 75   LYS B NZ  1 
ATOM   2789 N N   . LEU B 1 76  ? 22.813 -8.429  10.995 1.00 51.99  ? 76   LEU B N   1 
ATOM   2790 C CA  . LEU B 1 76  ? 23.548 -7.695  9.975  1.00 51.99  ? 76   LEU B CA  1 
ATOM   2791 C C   . LEU B 1 76  ? 24.820 -8.486  9.707  1.00 51.99  ? 76   LEU B C   1 
ATOM   2792 O O   . LEU B 1 76  ? 25.455 -8.995  10.634 1.00 51.99  ? 76   LEU B O   1 
ATOM   2793 C CB  . LEU B 1 76  ? 23.926 -6.290  10.441 1.00 38.28  ? 76   LEU B CB  1 
ATOM   2794 C CG  . LEU B 1 76  ? 22.838 -5.234  10.525 1.00 38.28  ? 76   LEU B CG  1 
ATOM   2795 C CD1 . LEU B 1 76  ? 23.510 -3.904  10.715 1.00 38.28  ? 76   LEU B CD1 1 
ATOM   2796 C CD2 . LEU B 1 76  ? 22.000 -5.207  9.260  1.00 38.28  ? 76   LEU B CD2 1 
ATOM   2797 N N   . THR B 1 77  ? 25.187 -8.594  8.438  1.00 40.33  ? 77   THR B N   1 
ATOM   2798 C CA  . THR B 1 77  ? 26.373 -9.332  8.070  1.00 40.33  ? 77   THR B CA  1 
ATOM   2799 C C   . THR B 1 77  ? 27.247 -8.439  7.229  1.00 40.33  ? 77   THR B C   1 
ATOM   2800 O O   . THR B 1 77  ? 26.863 -8.020  6.145  1.00 40.33  ? 77   THR B O   1 
ATOM   2801 C CB  . THR B 1 77  ? 26.026 -10.597 7.270  1.00 46.78  ? 77   THR B CB  1 
ATOM   2802 O OG1 . THR B 1 77  ? 25.333 -11.526 8.118  1.00 46.78  ? 77   THR B OG1 1 
ATOM   2803 C CG2 . THR B 1 77  ? 27.297 -11.250 6.732  1.00 46.78  ? 77   THR B CG2 1 
ATOM   2804 N N   . LEU B 1 78  ? 28.429 -8.147  7.753  1.00 34.87  ? 78   LEU B N   1 
ATOM   2805 C CA  . LEU B 1 78  ? 29.387 -7.301  7.081  1.00 34.87  ? 78   LEU B CA  1 
ATOM   2806 C C   . LEU B 1 78  ? 30.204 -8.234  6.211  1.00 34.87  ? 78   LEU B C   1 
ATOM   2807 O O   . LEU B 1 78  ? 30.775 -9.199  6.717  1.00 34.87  ? 78   LEU B O   1 
ATOM   2808 C CB  . LEU B 1 78  ? 30.284 -6.623  8.114  1.00 42.34  ? 78   LEU B CB  1 
ATOM   2809 C CG  . LEU B 1 78  ? 29.673 -5.673  9.163  1.00 42.34  ? 78   LEU B CG  1 
ATOM   2810 C CD1 . LEU B 1 78  ? 29.928 -4.238  8.734  1.00 42.34  ? 78   LEU B CD1 1 
ATOM   2811 C CD2 . LEU B 1 78  ? 28.170 -5.937  9.371  1.00 42.34  ? 78   LEU B CD2 1 
ATOM   2812 N N   . VAL B 1 79  ? 30.246 -7.974  4.906  1.00 42.92  ? 79   VAL B N   1 
ATOM   2813 C CA  . VAL B 1 79  ? 31.011 -8.825  4.014  1.00 42.92  ? 79   VAL B CA  1 
ATOM   2814 C C   . VAL B 1 79  ? 32.361 -8.181  3.755  1.00 42.92  ? 79   VAL B C   1 
ATOM   2815 O O   . VAL B 1 79  ? 32.464 -7.244  2.960  1.00 42.92  ? 79   VAL B O   1 
ATOM   2816 C CB  . VAL B 1 79  ? 30.280 -9.037  2.681  1.00 48.92  ? 79   VAL B CB  1 
ATOM   2817 C CG1 . VAL B 1 79  ? 31.035 -10.048 1.826  1.00 48.92  ? 79   VAL B CG1 1 
ATOM   2818 C CG2 . VAL B 1 79  ? 28.862 -9.545  2.940  1.00 48.92  ? 79   VAL B CG2 1 
ATOM   2819 N N   . PHE B 1 80  ? 33.391 -8.687  4.432  1.00 49.93  ? 80   PHE B N   1 
ATOM   2820 C CA  . PHE B 1 80  ? 34.745 -8.156  4.305  1.00 49.93  ? 80   PHE B CA  1 
ATOM   2821 C C   . PHE B 1 80  ? 35.629 -8.927  3.333  1.00 49.93  ? 80   PHE B C   1 
ATOM   2822 O O   . PHE B 1 80  ? 35.319 -10.059 2.974  1.00 49.93  ? 80   PHE B O   1 
ATOM   2823 C CB  . PHE B 1 80  ? 35.439 -8.148  5.670  1.00 38.22  ? 80   PHE B CB  1 
ATOM   2824 C CG  . PHE B 1 80  ? 34.998 -7.035  6.575  1.00 38.22  ? 80   PHE B CG  1 
ATOM   2825 C CD1 . PHE B 1 80  ? 34.133 -7.281  7.637  1.00 38.22  ? 80   PHE B CD1 1 
ATOM   2826 C CD2 . PHE B 1 80  ? 35.461 -5.738  6.377  1.00 38.22  ? 80   PHE B CD2 1 
ATOM   2827 C CE1 . PHE B 1 80  ? 33.734 -6.248  8.497  1.00 38.22  ? 80   PHE B CE1 1 
ATOM   2828 C CE2 . PHE B 1 80  ? 35.071 -4.709  7.225  1.00 38.22  ? 80   PHE B CE2 1 
ATOM   2829 C CZ  . PHE B 1 80  ? 34.202 -4.967  8.291  1.00 38.22  ? 80   PHE B CZ  1 
ATOM   2830 N N   . GLU B 1 81  ? 36.728 -8.311  2.901  1.00 51.10  ? 81   GLU B N   1 
ATOM   2831 C CA  . GLU B 1 81  ? 37.664 -8.993  2.013  1.00 51.10  ? 81   GLU B CA  1 
ATOM   2832 C C   . GLU B 1 81  ? 38.325 -9.931  2.985  1.00 51.10  ? 81   GLU B C   1 
ATOM   2833 O O   . GLU B 1 81  ? 38.266 -9.700  4.195  1.00 51.10  ? 81   GLU B O   1 
ATOM   2834 C CB  . GLU B 1 81  ? 38.721 -8.040  1.445  1.00 62.84  ? 81   GLU B CB  1 
ATOM   2835 C CG  . GLU B 1 81  ? 39.730 -7.544  2.465  1.00 62.84  ? 81   GLU B CG  1 
ATOM   2836 C CD  . GLU B 1 81  ? 40.791 -6.627  1.865  1.00 62.84  ? 81   GLU B CD  1 
ATOM   2837 O OE1 . GLU B 1 81  ? 41.567 -7.087  1.003  1.00 62.84  ? 81   GLU B OE1 1 
ATOM   2838 O OE2 . GLU B 1 81  ? 40.852 -5.440  2.256  1.00 62.84  ? 81   GLU B OE2 1 
ATOM   2839 N N   . PHE B 1 82  ? 38.957 -10.980 2.476  1.00 44.51  ? 82   PHE B N   1 
ATOM   2840 C CA  . PHE B 1 82  ? 39.609 -11.942 3.344  1.00 44.51  ? 82   PHE B CA  1 
ATOM   2841 C C   . PHE B 1 82  ? 41.086 -11.664 3.468  1.00 44.51  ? 82   PHE B C   1 
ATOM   2842 O O   . PHE B 1 82  ? 41.730 -11.217 2.528  1.00 44.51  ? 82   PHE B O   1 
ATOM   2843 C CB  . PHE B 1 82  ? 39.403 -13.370 2.821  1.00 52.59  ? 82   PHE B CB  1 
ATOM   2844 C CG  . PHE B 1 82  ? 39.943 -14.433 3.742  1.00 52.59  ? 82   PHE B CG  1 
ATOM   2845 C CD1 . PHE B 1 82  ? 41.197 -14.991 3.528  1.00 52.59  ? 82   PHE B CD1 1 
ATOM   2846 C CD2 . PHE B 1 82  ? 39.207 -14.845 4.854  1.00 52.59  ? 82   PHE B CD2 1 
ATOM   2847 C CE1 . PHE B 1 82  ? 41.719 -15.946 4.407  1.00 52.59  ? 82   PHE B CE1 1 
ATOM   2848 C CE2 . PHE B 1 82  ? 39.715 -15.798 5.744  1.00 52.59  ? 82   PHE B CE2 1 
ATOM   2849 C CZ  . PHE B 1 82  ? 40.977 -16.351 5.519  1.00 52.59  ? 82   PHE B CZ  1 
ATOM   2850 N N   . CYS B 1 83  ? 41.614 -11.929 4.653  1.00 46.18  ? 83   CYS B N   1 
ATOM   2851 C CA  . CYS B 1 83  ? 43.029 -11.762 4.932  1.00 46.18  ? 83   CYS B CA  1 
ATOM   2852 C C   . CYS B 1 83  ? 43.509 -13.018 5.631  1.00 46.18  ? 83   CYS B C   1 
ATOM   2853 O O   . CYS B 1 83  ? 42.881 -13.531 6.559  1.00 46.18  ? 83   CYS B O   1 
ATOM   2854 C CB  . CYS B 1 83  ? 43.271 -10.526 5.793  1.00 49.83  ? 83   CYS B CB  1 
ATOM   2855 S SG  . CYS B 1 83  ? 42.985 -9.014  4.860  1.00 49.83  ? 83   CYS B SG  1 
ATOM   2856 N N   . ASP B 1 84  ? 44.628 -13.522 5.154  1.00 47.23  ? 84   ASP B N   1 
ATOM   2857 C CA  . ASP B 1 84  ? 45.187 -14.737 5.686  1.00 47.23  ? 84   ASP B CA  1 
ATOM   2858 C C   . ASP B 1 84  ? 45.225 -14.730 7.208  1.00 47.23  ? 84   ASP B C   1 
ATOM   2859 O O   . ASP B 1 84  ? 44.790 -15.693 7.829  1.00 47.23  ? 84   ASP B O   1 
ATOM   2860 C CB  . ASP B 1 84  ? 46.558 -14.946 5.045  1.00 55.84  ? 84   ASP B CB  1 
ATOM   2861 C CG  . ASP B 1 84  ? 46.488 -14.856 3.521  1.00 55.84  ? 84   ASP B CG  1 
ATOM   2862 O OD1 . ASP B 1 84  ? 45.647 -15.570 2.930  1.00 55.84  ? 84   ASP B OD1 1 
ATOM   2863 O OD2 . ASP B 1 84  ? 47.247 -14.069 2.916  1.00 55.84  ? 84   ASP B OD2 1 
ATOM   2864 N N   . GLN B 1 85  ? 45.698 -13.643 7.814  1.00 58.16  ? 85   GLN B N   1 
ATOM   2865 C CA  . GLN B 1 85  ? 45.744 -13.570 9.273  1.00 58.16  ? 85   GLN B CA  1 
ATOM   2866 C C   . GLN B 1 85  ? 46.071 -12.171 9.802  1.00 58.16  ? 85   GLN B C   1 
ATOM   2867 O O   . GLN B 1 85  ? 46.487 -11.292 9.047  1.00 58.16  ? 85   GLN B O   1 
ATOM   2868 C CB  . GLN B 1 85  ? 46.767 -14.579 9.816  1.00 63.11  ? 85   GLN B CB  1 
ATOM   2869 C CG  . GLN B 1 85  ? 48.229 -14.190 9.585  1.00 63.11  ? 85   GLN B CG  1 
ATOM   2870 C CD  . GLN B 1 85  ? 49.203 -15.346 9.811  1.00 63.11  ? 85   GLN B CD  1 
ATOM   2871 O OE1 . GLN B 1 85  ? 49.110 -16.078 10.801 1.00 63.11  ? 85   GLN B OE1 1 
ATOM   2872 N NE2 . GLN B 1 85  ? 50.153 -15.501 8.894  1.00 63.11  ? 85   GLN B NE2 1 
ATOM   2873 N N   . ASP B 1 86  ? 45.888 -11.982 11.109 1.00 40.61  ? 86   ASP B N   1 
ATOM   2874 C CA  . ASP B 1 86  ? 46.161 -10.704 11.769 1.00 40.61  ? 86   ASP B CA  1 
ATOM   2875 C C   . ASP B 1 86  ? 47.615 -10.655 12.271 1.00 40.61  ? 86   ASP B C   1 
ATOM   2876 O O   . ASP B 1 86  ? 48.211 -11.695 12.567 1.00 40.61  ? 86   ASP B O   1 
ATOM   2877 C CB  . ASP B 1 86  ? 45.191 -10.525 12.936 1.00 53.44  ? 86   ASP B CB  1 
ATOM   2878 C CG  . ASP B 1 86  ? 45.362 -11.592 13.987 1.00 53.44  ? 86   ASP B CG  1 
ATOM   2879 O OD1 . ASP B 1 86  ? 46.186 -11.421 14.903 1.00 53.44  ? 86   ASP B OD1 1 
ATOM   2880 O OD2 . ASP B 1 86  ? 44.689 -12.629 13.887 1.00 53.44  ? 86   ASP B OD2 1 
ATOM   2881 N N   . LEU B 1 87  ? 48.181 -9.454  12.379 1.00 35.78  ? 87   LEU B N   1 
ATOM   2882 C CA  . LEU B 1 87  ? 49.566 -9.324  12.824 1.00 35.78  ? 87   LEU B CA  1 
ATOM   2883 C C   . LEU B 1 87  ? 49.875 -10.093 14.109 1.00 35.78  ? 87   LEU B C   1 
ATOM   2884 O O   . LEU B 1 87  ? 50.962 -10.663 14.260 1.00 35.78  ? 87   LEU B O   1 
ATOM   2885 C CB  . LEU B 1 87  ? 49.959 -7.849  13.007 1.00 36.50  ? 87   LEU B CB  1 
ATOM   2886 C CG  . LEU B 1 87  ? 51.394 -7.676  13.544 1.00 36.50  ? 87   LEU B CG  1 
ATOM   2887 C CD1 . LEU B 1 87  ? 52.352 -8.493  12.666 1.00 36.50  ? 87   LEU B CD1 1 
ATOM   2888 C CD2 . LEU B 1 87  ? 51.798 -6.173  13.577 1.00 36.50  ? 87   LEU B CD2 1 
ATOM   2889 N N   . LYS B 1 88  ? 48.926 -10.100 15.034 1.00 40.99  ? 88   LYS B N   1 
ATOM   2890 C CA  . LYS B 1 88  ? 49.126 -10.801 16.289 1.00 40.99  ? 88   LYS B CA  1 
ATOM   2891 C C   . LYS B 1 88  ? 49.458 -12.266 16.005 1.00 40.99  ? 88   LYS B C   1 
ATOM   2892 O O   . LYS B 1 88  ? 50.441 -12.802 16.528 1.00 40.99  ? 88   LYS B O   1 
ATOM   2893 C CB  . LYS B 1 88  ? 47.869 -10.717 17.137 1.00 54.77  ? 88   LYS B CB  1 
ATOM   2894 C CG  . LYS B 1 88  ? 48.051 -11.166 18.565 1.00 54.77  ? 88   LYS B CG  1 
ATOM   2895 C CD  . LYS B 1 88  ? 48.780 -10.128 19.370 1.00 54.77  ? 88   LYS B CD  1 
ATOM   2896 C CE  . LYS B 1 88  ? 48.622 -10.424 20.836 1.00 54.77  ? 88   LYS B CE  1 
ATOM   2897 N NZ  . LYS B 1 88  ? 49.350 -9.426  21.657 1.00 54.77  ? 88   LYS B NZ  1 
ATOM   2898 N N   . LYS B 1 89  ? 48.650 -12.921 15.175 1.00 42.44  ? 89   LYS B N   1 
ATOM   2899 C CA  . LYS B 1 89  ? 48.917 -14.317 14.854 1.00 42.44  ? 89   LYS B CA  1 
ATOM   2900 C C   . LYS B 1 89  ? 50.206 -14.442 14.039 1.00 42.44  ? 89   LYS B C   1 
ATOM   2901 O O   . LYS B 1 89  ? 50.898 -15.457 14.110 1.00 42.44  ? 89   LYS B O   1 
ATOM   2902 C CB  . LYS B 1 89  ? 47.753 -14.938 14.083 1.00 50.90  ? 89   LYS B CB  1 
ATOM   2903 C CG  . LYS B 1 89  ? 47.942 -16.427 13.811 1.00 50.90  ? 89   LYS B CG  1 
ATOM   2904 C CD  . LYS B 1 89  ? 46.750 -17.008 13.077 1.00 50.90  ? 89   LYS B CD  1 
ATOM   2905 C CE  . LYS B 1 89  ? 46.832 -18.525 12.977 1.00 50.90  ? 89   LYS B CE  1 
ATOM   2906 N NZ  . LYS B 1 89  ? 45.553 -19.103 12.451 1.00 50.90  ? 89   LYS B NZ  1 
ATOM   2907 N N   . TYR B 1 90  ? 50.525 -13.408 13.267 1.00 36.78  ? 90   TYR B N   1 
ATOM   2908 C CA  . TYR B 1 90  ? 51.736 -13.411 12.461 1.00 36.78  ? 90   TYR B CA  1 
ATOM   2909 C C   . TYR B 1 90  ? 52.928 -13.597 13.384 1.00 36.78  ? 90   TYR B C   1 
ATOM   2910 O O   . TYR B 1 90  ? 53.837 -14.368 13.096 1.00 36.78  ? 90   TYR B O   1 
ATOM   2911 C CB  . TYR B 1 90  ? 51.899 -12.087 11.735 1.00 45.18  ? 90   TYR B CB  1 
ATOM   2912 C CG  . TYR B 1 90  ? 53.134 -12.040 10.874 1.00 45.18  ? 90   TYR B CG  1 
ATOM   2913 C CD1 . TYR B 1 90  ? 53.105 -12.504 9.566  1.00 45.18  ? 90   TYR B CD1 1 
ATOM   2914 C CD2 . TYR B 1 90  ? 54.337 -11.549 11.374 1.00 45.18  ? 90   TYR B CD2 1 
ATOM   2915 C CE1 . TYR B 1 90  ? 54.239 -12.479 8.777  1.00 45.18  ? 90   TYR B CE1 1 
ATOM   2916 C CE2 . TYR B 1 90  ? 55.476 -11.521 10.595 1.00 45.18  ? 90   TYR B CE2 1 
ATOM   2917 C CZ  . TYR B 1 90  ? 55.421 -11.987 9.294  1.00 45.18  ? 90   TYR B CZ  1 
ATOM   2918 O OH  . TYR B 1 90  ? 56.545 -11.957 8.496  1.00 45.18  ? 90   TYR B OH  1 
ATOM   2919 N N   . PHE B 1 91  ? 52.920 -12.865 14.492 1.00 43.80  ? 91   PHE B N   1 
ATOM   2920 C CA  . PHE B 1 91  ? 53.980 -12.942 15.477 1.00 43.80  ? 91   PHE B CA  1 
ATOM   2921 C C   . PHE B 1 91  ? 54.160 -14.372 15.978 1.00 43.80  ? 91   PHE B C   1 
ATOM   2922 O O   . PHE B 1 91  ? 55.253 -14.764 16.385 1.00 43.80  ? 91   PHE B O   1 
ATOM   2923 C CB  . PHE B 1 91  ? 53.655 -12.020 16.655 1.00 38.05  ? 91   PHE B CB  1 
ATOM   2924 C CG  . PHE B 1 91  ? 53.899 -10.566 16.380 1.00 38.05  ? 91   PHE B CG  1 
ATOM   2925 C CD1 . PHE B 1 91  ? 53.279 -9.592  17.150 1.00 38.05  ? 91   PHE B CD1 1 
ATOM   2926 C CD2 . PHE B 1 91  ? 54.806 -10.163 15.396 1.00 38.05  ? 91   PHE B CD2 1 
ATOM   2927 C CE1 . PHE B 1 91  ? 53.555 -8.232  16.951 1.00 38.05  ? 91   PHE B CE1 1 
ATOM   2928 C CE2 . PHE B 1 91  ? 55.091 -8.801  15.189 1.00 38.05  ? 91   PHE B CE2 1 
ATOM   2929 C CZ  . PHE B 1 91  ? 54.464 -7.837  15.971 1.00 38.05  ? 91   PHE B CZ  1 
ATOM   2930 N N   . ASP B 1 92  ? 53.087 -15.155 15.959 1.00 62.67  ? 92   ASP B N   1 
ATOM   2931 C CA  . ASP B 1 92  ? 53.173 -16.539 16.425 1.00 62.67  ? 92   ASP B CA  1 
ATOM   2932 C C   . ASP B 1 92  ? 53.696 -17.497 15.350 1.00 62.67  ? 92   ASP B C   1 
ATOM   2933 O O   . ASP B 1 92  ? 54.444 -18.429 15.659 1.00 62.67  ? 92   ASP B O   1 
ATOM   2934 C CB  . ASP B 1 92  ? 51.808 -17.000 16.935 1.00 69.94  ? 92   ASP B CB  1 
ATOM   2935 C CG  . ASP B 1 92  ? 51.622 -16.737 18.414 1.00 69.94  ? 92   ASP B CG  1 
ATOM   2936 O OD1 . ASP B 1 92  ? 50.485 -16.880 18.904 1.00 69.94  ? 92   ASP B OD1 1 
ATOM   2937 O OD2 . ASP B 1 92  ? 52.612 -16.394 19.090 1.00 69.94  ? 92   ASP B OD2 1 
ATOM   2938 N N   . SER B 1 93  ? 53.297 -17.260 14.098 1.00 64.14  ? 93   SER B N   1 
ATOM   2939 C CA  . SER B 1 93  ? 53.732 -18.075 12.965 1.00 64.14  ? 93   SER B CA  1 
ATOM   2940 C C   . SER B 1 93  ? 55.247 -18.033 12.981 1.00 64.14  ? 93   SER B C   1 
ATOM   2941 O O   . SER B 1 93  ? 55.890 -18.947 13.481 1.00 64.14  ? 93   SER B O   1 
ATOM   2942 C CB  . SER B 1 93  ? 53.202 -17.488 11.662 1.00 70.03  ? 93   SER B CB  1 
ATOM   2943 O OG  . SER B 1 93  ? 51.804 -17.284 11.739 1.00 70.03  ? 93   SER B OG  1 
ATOM   2944 N N   . CYS B 1 94  ? 55.830 -16.980 12.426 1.00 65.57  ? 94   CYS B N   1 
ATOM   2945 C CA  . CYS B 1 94  ? 57.275 -16.849 12.499 1.00 65.57  ? 94   CYS B CA  1 
ATOM   2946 C C   . CYS B 1 94  ? 57.343 -16.749 14.022 1.00 65.57  ? 94   CYS B C   1 
ATOM   2947 O O   . CYS B 1 94  ? 56.336 -16.386 14.638 1.00 65.57  ? 94   CYS B O   1 
ATOM   2948 C CB  . CYS B 1 94  ? 57.731 -15.536 11.879 1.00 89.41  ? 94   CYS B CB  1 
ATOM   2949 S SG  . CYS B 1 94  ? 57.503 -14.149 12.997 1.00 89.41  ? 94   CYS B SG  1 
ATOM   2950 N N   . ASN B 1 95  ? 58.486 -17.041 14.640 1.00 68.81  ? 95   ASN B N   1 
ATOM   2951 C CA  . ASN B 1 95  ? 58.542 -17.006 16.101 1.00 68.81  ? 95   ASN B CA  1 
ATOM   2952 C C   . ASN B 1 95  ? 58.895 -15.679 16.762 1.00 68.81  ? 95   ASN B C   1 
ATOM   2953 O O   . ASN B 1 95  ? 59.715 -15.630 17.675 1.00 68.81  ? 95   ASN B O   1 
ATOM   2954 C CB  . ASN B 1 95  ? 59.472 -18.110 16.622 1.00 113.94 ? 95   ASN B CB  1 
ATOM   2955 C CG  . ASN B 1 95  ? 60.908 -17.916 16.197 1.00 113.94 ? 95   ASN B CG  1 
ATOM   2956 O OD1 . ASN B 1 95  ? 61.200 -17.736 15.016 1.00 113.94 ? 95   ASN B OD1 1 
ATOM   2957 N ND2 . ASN B 1 95  ? 61.819 -17.960 17.162 1.00 113.94 ? 95   ASN B ND2 1 
ATOM   2958 N N   . GLY B 1 96  ? 58.272 -14.597 16.314 1.00 102.17 ? 96   GLY B N   1 
ATOM   2959 C CA  . GLY B 1 96  ? 58.550 -13.313 16.926 1.00 102.17 ? 96   GLY B CA  1 
ATOM   2960 C C   . GLY B 1 96  ? 59.502 -12.410 16.176 1.00 102.17 ? 96   GLY B C   1 
ATOM   2961 O O   . GLY B 1 96  ? 59.132 -11.296 15.829 1.00 102.17 ? 96   GLY B O   1 
ATOM   2962 N N   . ASP B 1 97  ? 60.723 -12.863 15.919 1.00 83.13  ? 97   ASP B N   1 
ATOM   2963 C CA  . ASP B 1 97  ? 61.659 -12.000 15.212 1.00 83.13  ? 97   ASP B CA  1 
ATOM   2964 C C   . ASP B 1 97  ? 61.396 -11.971 13.717 1.00 83.13  ? 97   ASP B C   1 
ATOM   2965 O O   . ASP B 1 97  ? 61.370 -13.005 13.041 1.00 83.13  ? 97   ASP B O   1 
ATOM   2966 C CB  . ASP B 1 97  ? 63.114 -12.401 15.480 1.00 130.21 ? 97   ASP B CB  1 
ATOM   2967 C CG  . ASP B 1 97  ? 64.076 -11.224 15.326 1.00 130.21 ? 97   ASP B CG  1 
ATOM   2968 O OD1 . ASP B 1 97  ? 65.288 -11.389 15.582 1.00 130.21 ? 97   ASP B OD1 1 
ATOM   2969 O OD2 . ASP B 1 97  ? 63.612 -10.127 14.948 1.00 130.21 ? 97   ASP B OD2 1 
ATOM   2970 N N   . LEU B 1 98  ? 61.187 -10.758 13.220 1.00 56.05  ? 98   LEU B N   1 
ATOM   2971 C CA  . LEU B 1 98  ? 60.912 -10.523 11.819 1.00 56.05  ? 98   LEU B CA  1 
ATOM   2972 C C   . LEU B 1 98  ? 62.152 -9.930  11.207 1.00 56.05  ? 98   LEU B C   1 
ATOM   2973 O O   . LEU B 1 98  ? 62.943 -9.280  11.890 1.00 56.05  ? 98   LEU B O   1 
ATOM   2974 C CB  . LEU B 1 98  ? 59.769 -9.515  11.644 1.00 50.66  ? 98   LEU B CB  1 
ATOM   2975 C CG  . LEU B 1 98  ? 58.471 -9.682  12.424 1.00 50.66  ? 98   LEU B CG  1 
ATOM   2976 C CD1 . LEU B 1 98  ? 58.748 -9.389  13.876 1.00 50.66  ? 98   LEU B CD1 1 
ATOM   2977 C CD2 . LEU B 1 98  ? 57.417 -8.734  11.898 1.00 50.66  ? 98   LEU B CD2 1 
ATOM   2978 N N   . ASP B 1 99  ? 62.304 -10.156 9.909  1.00 55.71  ? 99   ASP B N   1 
ATOM   2979 C CA  . ASP B 1 99  ? 63.425 -9.627  9.144  1.00 55.71  ? 99   ASP B CA  1 
ATOM   2980 C C   . ASP B 1 99  ? 63.288 -8.090  9.109  1.00 55.71  ? 99   ASP B C   1 
ATOM   2981 O O   . ASP B 1 99  ? 62.230 -7.562  8.769  1.00 55.71  ? 99   ASP B O   1 
ATOM   2982 C CB  . ASP B 1 99  ? 63.369 -10.224 7.730  1.00 113.33 ? 99   ASP B CB  1 
ATOM   2983 C CG  . ASP B 1 99  ? 64.404 -9.640  6.790  1.00 113.33 ? 99   ASP B CG  1 
ATOM   2984 O OD1 . ASP B 1 99  ? 64.493 -10.137 5.648  1.00 113.33 ? 99   ASP B OD1 1 
ATOM   2985 O OD2 . ASP B 1 99  ? 65.121 -8.694  7.176  1.00 113.33 ? 99   ASP B OD2 1 
ATOM   2986 N N   . PRO B 1 100 ? 64.355 -7.361  9.482  1.00 64.82  ? 100  PRO B N   1 
ATOM   2987 C CA  . PRO B 1 100 ? 64.361 -5.895  9.495  1.00 64.82  ? 100  PRO B CA  1 
ATOM   2988 C C   . PRO B 1 100 ? 63.656 -5.233  8.307  1.00 64.82  ? 100  PRO B C   1 
ATOM   2989 O O   . PRO B 1 100 ? 63.112 -4.134  8.433  1.00 64.82  ? 100  PRO B O   1 
ATOM   2990 C CB  . PRO B 1 100 ? 65.846 -5.577  9.542  1.00 47.77  ? 100  PRO B CB  1 
ATOM   2991 C CG  . PRO B 1 100 ? 66.338 -6.630  10.490 1.00 47.77  ? 100  PRO B CG  1 
ATOM   2992 C CD  . PRO B 1 100 ? 65.646 -7.885  9.967  1.00 47.77  ? 100  PRO B CD  1 
ATOM   2993 N N   . GLU B 1 101 ? 63.671 -5.906  7.160  1.00 56.63  ? 101  GLU B N   1 
ATOM   2994 C CA  . GLU B 1 101 ? 63.041 -5.380  5.961  1.00 56.63  ? 101  GLU B CA  1 
ATOM   2995 C C   . GLU B 1 101 ? 61.532 -5.531  6.098  1.00 56.63  ? 101  GLU B C   1 
ATOM   2996 O O   . GLU B 1 101 ? 60.758 -4.749  5.537  1.00 56.63  ? 101  GLU B O   1 
ATOM   2997 C CB  . GLU B 1 101 ? 63.529 -6.148  4.735  1.00 75.28  ? 101  GLU B CB  1 
ATOM   2998 C CG  . GLU B 1 101 ? 63.838 -5.272  3.542  1.00 75.28  ? 101  GLU B CG  1 
ATOM   2999 C CD  . GLU B 1 101 ? 64.924 -4.258  3.844  1.00 75.28  ? 101  GLU B CD  1 
ATOM   3000 O OE1 . GLU B 1 101 ? 64.623 -3.200  4.438  1.00 75.28  ? 101  GLU B OE1 1 
ATOM   3001 O OE2 . GLU B 1 101 ? 66.091 -4.528  3.496  1.00 75.28  ? 101  GLU B OE2 1 
ATOM   3002 N N   . ILE B 1 102 ? 61.119 -6.549  6.845  1.00 39.80  ? 102  ILE B N   1 
ATOM   3003 C CA  . ILE B 1 102 ? 59.710 -6.799  7.067  1.00 39.80  ? 102  ILE B CA  1 
ATOM   3004 C C   . ILE B 1 102 ? 59.200 -5.752  8.047  1.00 39.80  ? 102  ILE B C   1 
ATOM   3005 O O   . ILE B 1 102 ? 58.123 -5.186  7.851  1.00 39.80  ? 102  ILE B O   1 
ATOM   3006 C CB  . ILE B 1 102 ? 59.499 -8.250  7.578  1.00 56.69  ? 102  ILE B CB  1 
ATOM   3007 C CG1 . ILE B 1 102 ? 59.532 -9.205  6.381  1.00 56.69  ? 102  ILE B CG1 1 
ATOM   3008 C CG2 . ILE B 1 102 ? 58.188 -8.385  8.332  1.00 56.69  ? 102  ILE B CG2 1 
ATOM   3009 C CD1 . ILE B 1 102 ? 59.324 -10.666 6.738  1.00 56.69  ? 102  ILE B CD1 1 
ATOM   3010 N N   . VAL B 1 103 ? 59.988 -5.474  9.082  1.00 39.04  ? 103  VAL B N   1 
ATOM   3011 C CA  . VAL B 1 103 ? 59.621 -4.467  10.068 1.00 39.04  ? 103  VAL B CA  1 
ATOM   3012 C C   . VAL B 1 103 ? 59.248 -3.191  9.321  1.00 39.04  ? 103  VAL B C   1 
ATOM   3013 O O   . VAL B 1 103 ? 58.168 -2.620  9.520  1.00 39.04  ? 103  VAL B O   1 
ATOM   3014 C CB  . VAL B 1 103 ? 60.803 -4.111  10.997 1.00 25.07  ? 103  VAL B CB  1 
ATOM   3015 C CG1 . VAL B 1 103 ? 60.419 -2.959  11.896 1.00 25.07  ? 103  VAL B CG1 1 
ATOM   3016 C CG2 . VAL B 1 103 ? 61.235 -5.327  11.832 1.00 25.07  ? 103  VAL B CG2 1 
ATOM   3017 N N   . LYS B 1 104 ? 60.153 -2.759  8.449  1.00 35.59  ? 104  LYS B N   1 
ATOM   3018 C CA  . LYS B 1 104 ? 59.967 -1.542  7.662  1.00 35.59  ? 104  LYS B CA  1 
ATOM   3019 C C   . LYS B 1 104 ? 58.720 -1.541  6.777  1.00 35.59  ? 104  LYS B C   1 
ATOM   3020 O O   . LYS B 1 104 ? 57.996 -0.548  6.712  1.00 35.59  ? 104  LYS B O   1 
ATOM   3021 C CB  . LYS B 1 104 ? 61.208 -1.294  6.799  1.00 55.35  ? 104  LYS B CB  1 
ATOM   3022 C CG  . LYS B 1 104 ? 61.167 -0.015  5.981  1.00 55.35  ? 104  LYS B CG  1 
ATOM   3023 C CD  . LYS B 1 104 ? 62.464 0.187   5.206  1.00 55.35  ? 104  LYS B CD  1 
ATOM   3024 C CE  . LYS B 1 104 ? 63.671 0.311   6.139  1.00 55.35  ? 104  LYS B CE  1 
ATOM   3025 N NZ  . LYS B 1 104 ? 64.968 0.535   5.415  1.00 55.35  ? 104  LYS B NZ  1 
ATOM   3026 N N   . SER B 1 105 ? 58.479 -2.648  6.089  1.00 36.45  ? 105  SER B N   1 
ATOM   3027 C CA  . SER B 1 105 ? 57.329 -2.727  5.211  1.00 36.45  ? 105  SER B CA  1 
ATOM   3028 C C   . SER B 1 105 ? 56.002 -2.646  5.987  1.00 36.45  ? 105  SER B C   1 
ATOM   3029 O O   . SER B 1 105 ? 55.093 -1.896  5.608  1.00 36.45  ? 105  SER B O   1 
ATOM   3030 C CB  . SER B 1 105 ? 57.390 -4.009  4.384  1.00 38.21  ? 105  SER B CB  1 
ATOM   3031 O OG  . SER B 1 105 ? 56.242 -4.123  3.564  1.00 38.21  ? 105  SER B OG  1 
ATOM   3032 N N   . PHE B 1 106 ? 55.882 -3.410  7.068  1.00 36.96  ? 106  PHE B N   1 
ATOM   3033 C CA  . PHE B 1 106 ? 54.657 -3.368  7.850  1.00 36.96  ? 106  PHE B CA  1 
ATOM   3034 C C   . PHE B 1 106 ? 54.457 -1.967  8.440  1.00 36.96  ? 106  PHE B C   1 
ATOM   3035 O O   . PHE B 1 106 ? 53.330 -1.488  8.549  1.00 36.96  ? 106  PHE B O   1 
ATOM   3036 C CB  . PHE B 1 106 ? 54.691 -4.411  8.980  1.00 35.98  ? 106  PHE B CB  1 
ATOM   3037 C CG  . PHE B 1 106 ? 54.527 -5.836  8.514  1.00 35.98  ? 106  PHE B CG  1 
ATOM   3038 C CD1 . PHE B 1 106 ? 54.224 -6.130  7.185  1.00 35.98  ? 106  PHE B CD1 1 
ATOM   3039 C CD2 . PHE B 1 106 ? 54.638 -6.887  9.418  1.00 35.98  ? 106  PHE B CD2 1 
ATOM   3040 C CE1 . PHE B 1 106 ? 54.031 -7.461  6.766  1.00 35.98  ? 106  PHE B CE1 1 
ATOM   3041 C CE2 . PHE B 1 106 ? 54.446 -8.203  9.011  1.00 35.98  ? 106  PHE B CE2 1 
ATOM   3042 C CZ  . PHE B 1 106 ? 54.141 -8.488  7.680  1.00 35.98  ? 106  PHE B CZ  1 
ATOM   3043 N N   . LEU B 1 107 ? 55.542 -1.305  8.818  1.00 42.49  ? 107  LEU B N   1 
ATOM   3044 C CA  . LEU B 1 107 ? 55.398 0.020   9.387  1.00 42.49  ? 107  LEU B CA  1 
ATOM   3045 C C   . LEU B 1 107 ? 55.099 1.018   8.295  1.00 42.49  ? 107  LEU B C   1 
ATOM   3046 O O   . LEU B 1 107 ? 54.480 2.052   8.545  1.00 42.49  ? 107  LEU B O   1 
ATOM   3047 C CB  . LEU B 1 107 ? 56.653 0.455   10.141 1.00 40.96  ? 107  LEU B CB  1 
ATOM   3048 C CG  . LEU B 1 107 ? 56.533 1.868   10.733 1.00 40.96  ? 107  LEU B CG  1 
ATOM   3049 C CD1 . LEU B 1 107 ? 55.254 1.961   11.546 1.00 40.96  ? 107  LEU B CD1 1 
ATOM   3050 C CD2 . LEU B 1 107 ? 57.750 2.202   11.597 1.00 40.96  ? 107  LEU B CD2 1 
ATOM   3051 N N   . PHE B 1 108 ? 55.534 0.718   7.080  1.00 44.87  ? 108  PHE B N   1 
ATOM   3052 C CA  . PHE B 1 108 ? 55.278 1.623   5.977  1.00 44.87  ? 108  PHE B CA  1 
ATOM   3053 C C   . PHE B 1 108 ? 53.794 1.570   5.629  1.00 44.87  ? 108  PHE B C   1 
ATOM   3054 O O   . PHE B 1 108 ? 53.123 2.602   5.536  1.00 44.87  ? 108  PHE B O   1 
ATOM   3055 C CB  . PHE B 1 108 ? 56.120 1.234   4.746  1.00 29.60  ? 108  PHE B CB  1 
ATOM   3056 C CG  . PHE B 1 108 ? 55.917 2.139   3.553  1.00 29.60  ? 108  PHE B CG  1 
ATOM   3057 C CD1 . PHE B 1 108 ? 56.418 3.439   3.548  1.00 29.60  ? 108  PHE B CD1 1 
ATOM   3058 C CD2 . PHE B 1 108 ? 55.204 1.698   2.435  1.00 29.60  ? 108  PHE B CD2 1 
ATOM   3059 C CE1 . PHE B 1 108 ? 56.203 4.291   2.430  1.00 29.60  ? 108  PHE B CE1 1 
ATOM   3060 C CE2 . PHE B 1 108 ? 54.997 2.543   1.335  1.00 29.60  ? 108  PHE B CE2 1 
ATOM   3061 C CZ  . PHE B 1 108 ? 55.498 3.836   1.340  1.00 29.60  ? 108  PHE B CZ  1 
ATOM   3062 N N   . GLN B 1 109 ? 53.272 0.364   5.457  1.00 44.85  ? 109  GLN B N   1 
ATOM   3063 C CA  . GLN B 1 109 ? 51.876 0.225   5.077  1.00 44.85  ? 109  GLN B CA  1 
ATOM   3064 C C   . GLN B 1 109 ? 50.940 0.684   6.185  1.00 44.85  ? 109  GLN B C   1 
ATOM   3065 O O   . GLN B 1 109 ? 49.870 1.238   5.908  1.00 44.85  ? 109  GLN B O   1 
ATOM   3066 C CB  . GLN B 1 109 ? 51.576 -1.223  4.677  1.00 33.72  ? 109  GLN B CB  1 
ATOM   3067 C CG  . GLN B 1 109 ? 52.437 -1.755  3.517  1.00 33.72  ? 109  GLN B CG  1 
ATOM   3068 C CD  . GLN B 1 109 ? 52.072 -3.178  3.132  1.00 33.72  ? 109  GLN B CD  1 
ATOM   3069 O OE1 . GLN B 1 109 ? 51.000 -3.431  2.575  1.00 33.72  ? 109  GLN B OE1 1 
ATOM   3070 N NE2 . GLN B 1 109 ? 52.954 -4.119  3.441  1.00 33.72  ? 109  GLN B NE2 1 
ATOM   3071 N N   . LEU B 1 110 ? 51.342 0.467   7.438  1.00 46.12  ? 110  LEU B N   1 
ATOM   3072 C CA  . LEU B 1 110 ? 50.511 0.895   8.552  1.00 46.12  ? 110  LEU B CA  1 
ATOM   3073 C C   . LEU B 1 110 ? 50.382 2.400   8.481  1.00 46.12  ? 110  LEU B C   1 
ATOM   3074 O O   . LEU B 1 110 ? 49.277 2.934   8.394  1.00 46.12  ? 110  LEU B O   1 
ATOM   3075 C CB  . LEU B 1 110 ? 51.127 0.505   9.895  1.00 40.63  ? 110  LEU B CB  1 
ATOM   3076 C CG  . LEU B 1 110 ? 50.420 1.138   11.102 1.00 40.63  ? 110  LEU B CG  1 
ATOM   3077 C CD1 . LEU B 1 110 ? 48.917 0.953   11.003 1.00 40.63  ? 110  LEU B CD1 1 
ATOM   3078 C CD2 . LEU B 1 110 ? 50.948 0.519   12.371 1.00 40.63  ? 110  LEU B CD2 1 
ATOM   3079 N N   . LEU B 1 111 ? 51.524 3.081   8.514  1.00 40.94  ? 111  LEU B N   1 
ATOM   3080 C CA  . LEU B 1 111 ? 51.548 4.541   8.442  1.00 40.94  ? 111  LEU B CA  1 
ATOM   3081 C C   . LEU B 1 111 ? 50.822 5.032   7.188  1.00 40.94  ? 111  LEU B C   1 
ATOM   3082 O O   . LEU B 1 111 ? 50.220 6.104   7.189  1.00 40.94  ? 111  LEU B O   1 
ATOM   3083 C CB  . LEU B 1 111 ? 52.993 5.045   8.422  1.00 27.75  ? 111  LEU B CB  1 
ATOM   3084 C CG  . LEU B 1 111 ? 53.789 4.796   9.690  1.00 27.75  ? 111  LEU B CG  1 
ATOM   3085 C CD1 . LEU B 1 111 ? 55.246 5.190   9.466  1.00 27.75  ? 111  LEU B CD1 1 
ATOM   3086 C CD2 . LEU B 1 111 ? 53.180 5.600   10.830 1.00 27.75  ? 111  LEU B CD2 1 
ATOM   3087 N N   . LYS B 1 112 ? 50.884 4.248   6.116  1.00 45.57  ? 112  LYS B N   1 
ATOM   3088 C CA  . LYS B 1 112 ? 50.219 4.639   4.887  1.00 45.57  ? 112  LYS B CA  1 
ATOM   3089 C C   . LYS B 1 112 ? 48.701 4.503   5.051  1.00 45.57  ? 112  LYS B C   1 
ATOM   3090 O O   . LYS B 1 112 ? 47.939 5.351   4.589  1.00 45.57  ? 112  LYS B O   1 
ATOM   3091 C CB  . LYS B 1 112 ? 50.727 3.787   3.722  1.00 75.24  ? 112  LYS B CB  1 
ATOM   3092 C CG  . LYS B 1 112 ? 50.430 4.372   2.353  1.00 75.24  ? 112  LYS B CG  1 
ATOM   3093 C CD  . LYS B 1 112 ? 51.100 3.557   1.257  1.00 75.24  ? 112  LYS B CD  1 
ATOM   3094 C CE  . LYS B 1 112 ? 50.595 3.956   -0.124 1.00 75.24  ? 112  LYS B CE  1 
ATOM   3095 N NZ  . LYS B 1 112 ? 51.184 3.106   -1.188 1.00 75.24  ? 112  LYS B NZ  1 
ATOM   3096 N N   . GLY B 1 113 ? 48.255 3.452   5.729  1.00 44.19  ? 113  GLY B N   1 
ATOM   3097 C CA  . GLY B 1 113 ? 46.825 3.277   5.925  1.00 44.19  ? 113  GLY B CA  1 
ATOM   3098 C C   . GLY B 1 113 ? 46.258 4.277   6.919  1.00 44.19  ? 113  GLY B C   1 
ATOM   3099 O O   . GLY B 1 113 ? 45.232 4.921   6.673  1.00 44.19  ? 113  GLY B O   1 
ATOM   3100 N N   . LEU B 1 114 ? 46.931 4.398   8.055  1.00 44.73  ? 114  LEU B N   1 
ATOM   3101 C CA  . LEU B 1 114 ? 46.516 5.319   9.097  1.00 44.73  ? 114  LEU B CA  1 
ATOM   3102 C C   . LEU B 1 114 ? 46.605 6.723   8.525  1.00 44.73  ? 114  LEU B C   1 
ATOM   3103 O O   . LEU B 1 114 ? 45.697 7.546   8.714  1.00 44.73  ? 114  LEU B O   1 
ATOM   3104 C CB  . LEU B 1 114 ? 47.456 5.186   10.286 1.00 42.19  ? 114  LEU B CB  1 
ATOM   3105 C CG  . LEU B 1 114 ? 47.169 5.901   11.598 1.00 42.19  ? 114  LEU B CG  1 
ATOM   3106 C CD1 . LEU B 1 114 ? 45.832 5.449   12.175 1.00 42.19  ? 114  LEU B CD1 1 
ATOM   3107 C CD2 . LEU B 1 114 ? 48.321 5.591   12.554 1.00 42.19  ? 114  LEU B CD2 1 
ATOM   3108 N N   . GLY B 1 115 ? 47.705 6.987   7.819  1.00 35.51  ? 115  GLY B N   1 
ATOM   3109 C CA  . GLY B 1 115 ? 47.908 8.293   7.212  1.00 35.51  ? 115  GLY B CA  1 
ATOM   3110 C C   . GLY B 1 115 ? 46.718 8.662   6.351  1.00 35.51  ? 115  GLY B C   1 
ATOM   3111 O O   . GLY B 1 115 ? 46.272 9.810   6.355  1.00 35.51  ? 115  GLY B O   1 
ATOM   3112 N N   . PHE B 1 116 ? 46.181 7.686   5.629  1.00 43.63  ? 116  PHE B N   1 
ATOM   3113 C CA  . PHE B 1 116 ? 45.026 7.935   4.777  1.00 43.63  ? 116  PHE B CA  1 
ATOM   3114 C C   . PHE B 1 116 ? 43.786 8.243   5.619  1.00 43.63  ? 116  PHE B C   1 
ATOM   3115 O O   . PHE B 1 116 ? 43.029 9.163   5.292  1.00 43.63  ? 116  PHE B O   1 
ATOM   3116 C CB  . PHE B 1 116 ? 44.746 6.727   3.876  1.00 34.41  ? 116  PHE B CB  1 
ATOM   3117 C CG  . PHE B 1 116 ? 43.595 6.929   2.949  1.00 34.41  ? 116  PHE B CG  1 
ATOM   3118 C CD1 . PHE B 1 116 ? 43.750 7.661   1.779  1.00 34.41  ? 116  PHE B CD1 1 
ATOM   3119 C CD2 . PHE B 1 116 ? 42.333 6.434   3.269  1.00 34.41  ? 116  PHE B CD2 1 
ATOM   3120 C CE1 . PHE B 1 116 ? 42.652 7.904   0.925  1.00 34.41  ? 116  PHE B CE1 1 
ATOM   3121 C CE2 . PHE B 1 116 ? 41.228 6.671   2.422  1.00 34.41  ? 116  PHE B CE2 1 
ATOM   3122 C CZ  . PHE B 1 116 ? 41.393 7.409   1.250  1.00 34.41  ? 116  PHE B CZ  1 
ATOM   3123 N N   . CYS B 1 117 ? 43.576 7.480   6.694  1.00 34.20  ? 117  CYS B N   1 
ATOM   3124 C CA  . CYS B 1 117 ? 42.415 7.702   7.570  1.00 34.20  ? 117  CYS B CA  1 
ATOM   3125 C C   . CYS B 1 117 ? 42.433 9.105   8.160  1.00 34.20  ? 117  CYS B C   1 
ATOM   3126 O O   . CYS B 1 117 ? 41.402 9.774   8.254  1.00 34.20  ? 117  CYS B O   1 
ATOM   3127 C CB  . CYS B 1 117 ? 42.378 6.682   8.715  1.00 46.26  ? 117  CYS B CB  1 
ATOM   3128 S SG  . CYS B 1 117 ? 41.855 5.025   8.226  1.00 46.26  ? 117  CYS B SG  1 
ATOM   3129 N N   . HIS B 1 118 ? 43.609 9.558   8.556  1.00 31.85  ? 118  HIS B N   1 
ATOM   3130 C CA  . HIS B 1 118 ? 43.696 10.889  9.124  1.00 31.85  ? 118  HIS B CA  1 
ATOM   3131 C C   . HIS B 1 118 ? 43.343 11.923  8.064  1.00 31.85  ? 118  HIS B C   1 
ATOM   3132 O O   . HIS B 1 118 ? 42.589 12.858  8.334  1.00 31.85  ? 118  HIS B O   1 
ATOM   3133 C CB  . HIS B 1 118 ? 45.098 11.159  9.688  1.00 41.82  ? 118  HIS B CB  1 
ATOM   3134 C CG  . HIS B 1 118 ? 45.447 10.312  10.871 1.00 41.82  ? 118  HIS B CG  1 
ATOM   3135 N ND1 . HIS B 1 118 ? 44.491 9.715   11.667 1.00 41.82  ? 118  HIS B ND1 1 
ATOM   3136 C CD2 . HIS B 1 118 ? 46.643 9.976   11.409 1.00 41.82  ? 118  HIS B CD2 1 
ATOM   3137 C CE1 . HIS B 1 118 ? 45.082 9.048   12.643 1.00 41.82  ? 118  HIS B CE1 1 
ATOM   3138 N NE2 . HIS B 1 118 ? 46.388 9.191   12.510 1.00 41.82  ? 118  HIS B NE2 1 
ATOM   3139 N N   . SER B 1 119 ? 43.851 11.755  6.849  1.00 39.40  ? 119  SER B N   1 
ATOM   3140 C CA  . SER B 1 119 ? 43.544 12.750  5.832  1.00 39.40  ? 119  SER B CA  1 
ATOM   3141 C C   . SER B 1 119 ? 42.043 12.817  5.558  1.00 39.40  ? 119  SER B C   1 
ATOM   3142 O O   . SER B 1 119 ? 41.525 13.865  5.187  1.00 39.40  ? 119  SER B O   1 
ATOM   3143 C CB  . SER B 1 119 ? 44.319 12.474  4.534  1.00 41.75  ? 119  SER B CB  1 
ATOM   3144 O OG  . SER B 1 119 ? 43.723 11.452  3.757  1.00 41.75  ? 119  SER B OG  1 
ATOM   3145 N N   . ARG B 1 120 ? 41.344 11.707  5.772  1.00 45.47  ? 120  ARG B N   1 
ATOM   3146 C CA  . ARG B 1 120 ? 39.906 11.648  5.528  1.00 45.47  ? 120  ARG B CA  1 
ATOM   3147 C C   . ARG B 1 120 ? 39.092 12.047  6.753  1.00 45.47  ? 120  ARG B C   1 
ATOM   3148 O O   . ARG B 1 120 ? 37.861 12.034  6.727  1.00 45.47  ? 120  ARG B O   1 
ATOM   3149 C CB  . ARG B 1 120 ? 39.518 10.242  5.062  1.00 59.63  ? 120  ARG B CB  1 
ATOM   3150 C CG  . ARG B 1 120 ? 40.070 9.875   3.683  1.00 59.63  ? 120  ARG B CG  1 
ATOM   3151 C CD  . ARG B 1 120 ? 39.223 10.478  2.575  1.00 59.63  ? 120  ARG B CD  1 
ATOM   3152 N NE  . ARG B 1 120 ? 37.897 9.849   2.514  1.00 59.63  ? 120  ARG B NE  1 
ATOM   3153 C CZ  . ARG B 1 120 ? 36.876 10.291  1.781  1.00 59.63  ? 120  ARG B CZ  1 
ATOM   3154 N NH1 . ARG B 1 120 ? 37.017 11.378  1.032  1.00 59.63  ? 120  ARG B NH1 1 
ATOM   3155 N NH2 . ARG B 1 120 ? 35.711 9.650   1.801  1.00 59.63  ? 120  ARG B NH2 1 
ATOM   3156 N N   . ASN B 1 121 ? 39.783 12.407  7.828  1.00 30.39  ? 121  ASN B N   1 
ATOM   3157 C CA  . ASN B 1 121 ? 39.110 12.829  9.053  1.00 30.39  ? 121  ASN B CA  1 
ATOM   3158 C C   . ASN B 1 121 ? 38.490 11.707  9.877  1.00 30.39  ? 121  ASN B C   1 
ATOM   3159 O O   . ASN B 1 121 ? 37.370 11.818  10.360 1.00 30.39  ? 121  ASN B O   1 
ATOM   3160 C CB  . ASN B 1 121 ? 38.059 13.889  8.718  1.00 44.73  ? 121  ASN B CB  1 
ATOM   3161 C CG  . ASN B 1 121 ? 38.671 15.271  8.541  1.00 44.73  ? 121  ASN B CG  1 
ATOM   3162 O OD1 . ASN B 1 121 ? 38.865 16.009  9.512  1.00 44.73  ? 121  ASN B OD1 1 
ATOM   3163 N ND2 . ASN B 1 121 ? 39.008 15.613  7.305  1.00 44.73  ? 121  ASN B ND2 1 
ATOM   3164 N N   . VAL B 1 122 ? 39.233 10.622  10.046 1.00 39.09  ? 122  VAL B N   1 
ATOM   3165 C CA  . VAL B 1 122 ? 38.754 9.517   10.842 1.00 39.09  ? 122  VAL B CA  1 
ATOM   3166 C C   . VAL B 1 122 ? 39.845 8.989   11.750 1.00 39.09  ? 122  VAL B C   1 
ATOM   3167 O O   . VAL B 1 122 ? 40.938 8.691   11.291 1.00 39.09  ? 122  VAL B O   1 
ATOM   3168 C CB  . VAL B 1 122 ? 38.263 8.380   9.961  1.00 35.99  ? 122  VAL B CB  1 
ATOM   3169 C CG1 . VAL B 1 122 ? 38.060 7.126   10.794 1.00 35.99  ? 122  VAL B CG1 1 
ATOM   3170 C CG2 . VAL B 1 122 ? 36.956 8.775   9.305  1.00 35.99  ? 122  VAL B CG2 1 
ATOM   3171 N N   . LEU B 1 123 ? 39.562 8.897   13.045 1.00 39.62  ? 123  LEU B N   1 
ATOM   3172 C CA  . LEU B 1 123 ? 40.528 8.357   13.996 1.00 39.62  ? 123  LEU B CA  1 
ATOM   3173 C C   . LEU B 1 123 ? 40.120 6.901   14.139 1.00 39.62  ? 123  LEU B C   1 
ATOM   3174 O O   . LEU B 1 123 ? 38.935 6.590   14.168 1.00 39.62  ? 123  LEU B O   1 
ATOM   3175 C CB  . LEU B 1 123 ? 40.398 9.034   15.361 1.00 34.31  ? 123  LEU B CB  1 
ATOM   3176 C CG  . LEU B 1 123 ? 40.439 10.558  15.390 1.00 34.31  ? 123  LEU B CG  1 
ATOM   3177 C CD1 . LEU B 1 123 ? 39.974 11.034  16.742 1.00 34.31  ? 123  LEU B CD1 1 
ATOM   3178 C CD2 . LEU B 1 123 ? 41.840 11.062  15.074 1.00 34.31  ? 123  LEU B CD2 1 
ATOM   3179 N N   . HIS B 1 124 ? 41.086 6.004   14.216 1.00 40.60  ? 124  HIS B N   1 
ATOM   3180 C CA  . HIS B 1 124 ? 40.782 4.587   14.359 1.00 40.60  ? 124  HIS B CA  1 
ATOM   3181 C C   . HIS B 1 124 ? 40.567 4.269   15.837 1.00 40.60  ? 124  HIS B C   1 
ATOM   3182 O O   . HIS B 1 124 ? 39.638 3.555   16.210 1.00 40.60  ? 124  HIS B O   1 
ATOM   3183 C CB  . HIS B 1 124 ? 41.933 3.765   13.784 1.00 27.65  ? 124  HIS B CB  1 
ATOM   3184 C CG  . HIS B 1 124 ? 41.712 2.290   13.854 1.00 27.65  ? 124  HIS B CG  1 
ATOM   3185 N ND1 . HIS B 1 124 ? 41.877 1.569   15.015 1.00 27.65  ? 124  HIS B ND1 1 
ATOM   3186 C CD2 . HIS B 1 124 ? 41.356 1.397   12.899 1.00 27.65  ? 124  HIS B CD2 1 
ATOM   3187 C CE1 . HIS B 1 124 ? 41.636 0.291   14.772 1.00 27.65  ? 124  HIS B CE1 1 
ATOM   3188 N NE2 . HIS B 1 124 ? 41.318 0.160   13.495 1.00 27.65  ? 124  HIS B NE2 1 
ATOM   3189 N N   . ARG B 1 125 ? 41.448 4.809   16.668 1.00 26.16  ? 125  ARG B N   1 
ATOM   3190 C CA  . ARG B 1 125 ? 41.374 4.650   18.109 1.00 26.16  ? 125  ARG B CA  1 
ATOM   3191 C C   . ARG B 1 125 ? 41.423 3.233   18.638 1.00 26.16  ? 125  ARG B C   1 
ATOM   3192 O O   . ARG B 1 125 ? 41.145 3.023   19.818 1.00 26.16  ? 125  ARG B O   1 
ATOM   3193 C CB  . ARG B 1 125 ? 40.128 5.346   18.651 1.00 40.59  ? 125  ARG B CB  1 
ATOM   3194 C CG  . ARG B 1 125 ? 40.047 6.812   18.290 1.00 40.59  ? 125  ARG B CG  1 
ATOM   3195 C CD  . ARG B 1 125 ? 38.917 7.479   19.028 1.00 40.59  ? 125  ARG B CD  1 
ATOM   3196 N NE  . ARG B 1 125 ? 37.643 6.834   18.746 1.00 40.59  ? 125  ARG B NE  1 
ATOM   3197 C CZ  . ARG B 1 125 ? 36.477 7.249   19.226 1.00 40.59  ? 125  ARG B CZ  1 
ATOM   3198 N NH1 . ARG B 1 125 ? 36.427 8.310   20.019 1.00 40.59  ? 125  ARG B NH1 1 
ATOM   3199 N NH2 . ARG B 1 125 ? 35.359 6.617   18.900 1.00 40.59  ? 125  ARG B NH2 1 
ATOM   3200 N N   . ASP B 1 126 ? 41.736 2.260   17.781 1.00 29.42  ? 126  ASP B N   1 
ATOM   3201 C CA  . ASP B 1 126 ? 41.876 0.881   18.238 1.00 29.42  ? 126  ASP B CA  1 
ATOM   3202 C C   . ASP B 1 126 ? 43.026 0.197   17.507 1.00 29.42  ? 126  ASP B C   1 
ATOM   3203 O O   . ASP B 1 126 ? 42.942 -0.982  17.119 1.00 29.42  ? 126  ASP B O   1 
ATOM   3204 C CB  . ASP B 1 126 ? 40.603 0.053   18.053 1.00 39.74  ? 126  ASP B CB  1 
ATOM   3205 C CG  . ASP B 1 126 ? 40.619 -1.229  18.908 1.00 39.74  ? 126  ASP B CG  1 
ATOM   3206 O OD1 . ASP B 1 126 ? 40.016 -2.247  18.492 1.00 39.74  ? 126  ASP B OD1 1 
ATOM   3207 O OD2 . ASP B 1 126 ? 41.231 -1.217  20.003 1.00 39.74  ? 126  ASP B OD2 1 
ATOM   3208 N N   . LEU B 1 127 ? 44.108 0.945   17.322 1.00 42.24  ? 127  LEU B N   1 
ATOM   3209 C CA  . LEU B 1 127 ? 45.271 0.411   16.654 1.00 42.24  ? 127  LEU B CA  1 
ATOM   3210 C C   . LEU B 1 127 ? 46.000 -0.570  17.572 1.00 42.24  ? 127  LEU B C   1 
ATOM   3211 O O   . LEU B 1 127 ? 46.517 -0.197  18.628 1.00 42.24  ? 127  LEU B O   1 
ATOM   3212 C CB  . LEU B 1 127 ? 46.208 1.540   16.266 1.00 61.38  ? 127  LEU B CB  1 
ATOM   3213 C CG  . LEU B 1 127 ? 46.933 1.282   14.954 1.00 61.38  ? 127  LEU B CG  1 
ATOM   3214 C CD1 . LEU B 1 127 ? 45.909 1.168   13.819 1.00 61.38  ? 127  LEU B CD1 1 
ATOM   3215 C CD2 . LEU B 1 127 ? 47.902 2.413   14.694 1.00 61.38  ? 127  LEU B CD2 1 
ATOM   3216 N N   . LYS B 1 128 ? 46.014 -1.834  17.172 1.00 40.91  ? 128  LYS B N   1 
ATOM   3217 C CA  . LYS B 1 128 ? 46.693 -2.876  17.925 1.00 40.91  ? 128  LYS B CA  1 
ATOM   3218 C C   . LYS B 1 128 ? 46.885 -4.060  16.978 1.00 40.91  ? 128  LYS B C   1 
ATOM   3219 O O   . LYS B 1 128 ? 46.104 -4.250  16.050 1.00 40.91  ? 128  LYS B O   1 
ATOM   3220 C CB  . LYS B 1 128 ? 45.882 -3.269  19.159 1.00 30.86  ? 128  LYS B CB  1 
ATOM   3221 C CG  . LYS B 1 128 ? 44.574 -3.968  18.891 1.00 30.86  ? 128  LYS B CG  1 
ATOM   3222 C CD  . LYS B 1 128 ? 43.902 -4.353  20.220 1.00 30.86  ? 128  LYS B CD  1 
ATOM   3223 C CE  . LYS B 1 128 ? 42.499 -4.920  19.989 1.00 30.86  ? 128  LYS B CE  1 
ATOM   3224 N NZ  . LYS B 1 128 ? 41.865 -5.461  21.205 1.00 30.86  ? 128  LYS B NZ  1 
ATOM   3225 N N   . PRO B 1 129 ? 47.921 -4.875  17.203 1.00 33.41  ? 129  PRO B N   1 
ATOM   3226 C CA  . PRO B 1 129 ? 48.231 -6.038  16.360 1.00 33.41  ? 129  PRO B CA  1 
ATOM   3227 C C   . PRO B 1 129 ? 47.036 -6.824  15.813 1.00 33.41  ? 129  PRO B C   1 
ATOM   3228 O O   . PRO B 1 129 ? 46.931 -7.045  14.602 1.00 33.41  ? 129  PRO B O   1 
ATOM   3229 C CB  . PRO B 1 129 ? 49.125 -6.883  17.255 1.00 35.78  ? 129  PRO B CB  1 
ATOM   3230 C CG  . PRO B 1 129 ? 49.849 -5.857  18.060 1.00 35.78  ? 129  PRO B CG  1 
ATOM   3231 C CD  . PRO B 1 129 ? 48.723 -4.900  18.436 1.00 35.78  ? 129  PRO B CD  1 
ATOM   3232 N N   . GLN B 1 130 ? 46.143 -7.247  16.697 1.00 33.05  ? 130  GLN B N   1 
ATOM   3233 C CA  . GLN B 1 130 ? 44.971 -7.999  16.283 1.00 33.05  ? 130  GLN B CA  1 
ATOM   3234 C C   . GLN B 1 130 ? 44.097 -7.263  15.249 1.00 33.05  ? 130  GLN B C   1 
ATOM   3235 O O   . GLN B 1 130 ? 43.453 -7.896  14.419 1.00 33.05  ? 130  GLN B O   1 
ATOM   3236 C CB  . GLN B 1 130 ? 44.144 -8.410  17.514 1.00 54.36  ? 130  GLN B CB  1 
ATOM   3237 C CG  . GLN B 1 130 ? 44.270 -7.499  18.748 1.00 54.36  ? 130  GLN B CG  1 
ATOM   3238 C CD  . GLN B 1 130 ? 45.584 -7.675  19.536 1.00 54.36  ? 130  GLN B CD  1 
ATOM   3239 O OE1 . GLN B 1 130 ? 46.654 -7.270  19.087 1.00 54.36  ? 130  GLN B OE1 1 
ATOM   3240 N NE2 . GLN B 1 130 ? 45.492 -8.281  20.718 1.00 54.36  ? 130  GLN B NE2 1 
ATOM   3241 N N   . ASN B 1 131 ? 44.079 -5.934  15.268 1.00 43.09  ? 131  ASN B N   1 
ATOM   3242 C CA  . ASN B 1 131 ? 43.287 -5.198  14.284 1.00 43.09  ? 131  ASN B CA  1 
ATOM   3243 C C   . ASN B 1 131 ? 44.081 -4.915  13.014 1.00 43.09  ? 131  ASN B C   1 
ATOM   3244 O O   . ASN B 1 131 ? 43.624 -4.178  12.132 1.00 43.09  ? 131  ASN B O   1 
ATOM   3245 C CB  . ASN B 1 131 ? 42.775 -3.885  14.866 1.00 44.18  ? 131  ASN B CB  1 
ATOM   3246 C CG  . ASN B 1 131 ? 41.675 -4.096  15.871 1.00 44.18  ? 131  ASN B CG  1 
ATOM   3247 O OD1 . ASN B 1 131 ? 41.300 -3.177  16.609 1.00 44.18  ? 131  ASN B OD1 1 
ATOM   3248 N ND2 . ASN B 1 131 ? 41.145 -5.312  15.913 1.00 44.18  ? 131  ASN B ND2 1 
ATOM   3249 N N   . LEU B 1 132 ? 45.280 -5.476  12.926 1.00 38.36  ? 132  LEU B N   1 
ATOM   3250 C CA  . LEU B 1 132 ? 46.086 -5.300  11.732 1.00 38.36  ? 132  LEU B CA  1 
ATOM   3251 C C   . LEU B 1 132 ? 46.134 -6.629  10.984 1.00 38.36  ? 132  LEU B C   1 
ATOM   3252 O O   . LEU B 1 132 ? 46.590 -7.646  11.527 1.00 38.36  ? 132  LEU B O   1 
ATOM   3253 C CB  . LEU B 1 132 ? 47.489 -4.817  12.102 1.00 33.97  ? 132  LEU B CB  1 
ATOM   3254 C CG  . LEU B 1 132 ? 47.634 -3.305  11.916 1.00 33.97  ? 132  LEU B CG  1 
ATOM   3255 C CD1 . LEU B 1 132 ? 46.500 -2.614  12.630 1.00 33.97  ? 132  LEU B CD1 1 
ATOM   3256 C CD2 . LEU B 1 132 ? 48.966 -2.824  12.435 1.00 33.97  ? 132  LEU B CD2 1 
ATOM   3257 N N   . LEU B 1 133 ? 45.641 -6.615  9.746  1.00 34.63  ? 133  LEU B N   1 
ATOM   3258 C CA  . LEU B 1 133 ? 45.572 -7.815  8.904  1.00 34.63  ? 133  LEU B CA  1 
ATOM   3259 C C   . LEU B 1 133 ? 46.751 -7.953  7.943  1.00 34.63  ? 133  LEU B C   1 
ATOM   3260 O O   . LEU B 1 133 ? 47.254 -6.956  7.409  1.00 34.63  ? 133  LEU B O   1 
ATOM   3261 C CB  . LEU B 1 133 ? 44.260 -7.806  8.113  1.00 49.05  ? 133  LEU B CB  1 
ATOM   3262 C CG  . LEU B 1 133 ? 43.018 -7.677  9.003  1.00 49.05  ? 133  LEU B CG  1 
ATOM   3263 C CD1 . LEU B 1 133 ? 41.749 -7.779  8.174  1.00 49.05  ? 133  LEU B CD1 1 
ATOM   3264 C CD2 . LEU B 1 133 ? 43.044 -8.771  10.056 1.00 49.05  ? 133  LEU B CD2 1 
ATOM   3265 N N   . ILE B 1 134 ? 47.179 -9.195  7.719  1.00 49.84  ? 134  ILE B N   1 
ATOM   3266 C CA  . ILE B 1 134 ? 48.306 -9.473  6.834  1.00 49.84  ? 134  ILE B CA  1 
ATOM   3267 C C   . ILE B 1 134 ? 48.122 -10.656 5.880  1.00 49.84  ? 134  ILE B C   1 
ATOM   3268 O O   . ILE B 1 134 ? 47.835 -11.780 6.320  1.00 49.84  ? 134  ILE B O   1 
ATOM   3269 C CB  . ILE B 1 134 ? 49.568 -9.746  7.643  1.00 55.09  ? 134  ILE B CB  1 
ATOM   3270 C CG1 . ILE B 1 134 ? 49.812 -8.600  8.623  1.00 55.09  ? 134  ILE B CG1 1 
ATOM   3271 C CG2 . ILE B 1 134 ? 50.741 -9.933  6.697  1.00 55.09  ? 134  ILE B CG2 1 
ATOM   3272 C CD1 . ILE B 1 134 ? 51.015 -8.798  9.503  1.00 55.09  ? 134  ILE B CD1 1 
ATOM   3273 N N   . ASN B 1 135 ? 48.304 -10.391 4.582  1.00 49.43  ? 135  ASN B N   1 
ATOM   3274 C CA  . ASN B 1 135 ? 48.202 -11.403 3.518  1.00 49.43  ? 135  ASN B CA  1 
ATOM   3275 C C   . ASN B 1 135 ? 49.571 -12.045 3.334  1.00 49.43  ? 135  ASN B C   1 
ATOM   3276 O O   . ASN B 1 135 ? 50.572 -11.494 3.786  1.00 49.43  ? 135  ASN B O   1 
ATOM   3277 C CB  . ASN B 1 135 ? 47.825 -10.742 2.197  1.00 38.15  ? 135  ASN B CB  1 
ATOM   3278 C CG  . ASN B 1 135 ? 46.367 -10.366 2.121  1.00 38.15  ? 135  ASN B CG  1 
ATOM   3279 O OD1 . ASN B 1 135 ? 45.973 -9.507  1.317  1.00 38.15  ? 135  ASN B OD1 1 
ATOM   3280 N ND2 . ASN B 1 135 ? 45.545 -11.011 2.946  1.00 38.15  ? 135  ASN B ND2 1 
ATOM   3281 N N   . ARG B 1 136 ? 49.648 -13.189 2.661  1.00 65.71  ? 136  ARG B N   1 
ATOM   3282 C CA  . ARG B 1 136 ? 50.964 -13.785 2.463  1.00 65.71  ? 136  ARG B CA  1 
ATOM   3283 C C   . ARG B 1 136 ? 51.799 -12.915 1.523  1.00 65.71  ? 136  ARG B C   1 
ATOM   3284 O O   . ARG B 1 136 ? 53.033 -12.956 1.558  1.00 65.71  ? 136  ARG B O   1 
ATOM   3285 C CB  . ARG B 1 136 ? 50.868 -15.231 1.949  1.00 89.47  ? 136  ARG B CB  1 
ATOM   3286 C CG  . ARG B 1 136 ? 49.664 -15.569 1.089  1.00 89.47  ? 136  ARG B CG  1 
ATOM   3287 C CD  . ARG B 1 136 ? 49.572 -17.088 0.894  1.00 89.47  ? 136  ARG B CD  1 
ATOM   3288 N NE  . ARG B 1 136 ? 50.704 -17.623 0.137  1.00 89.47  ? 136  ARG B NE  1 
ATOM   3289 C CZ  . ARG B 1 136 ? 51.046 -18.908 0.101  1.00 89.47  ? 136  ARG B CZ  1 
ATOM   3290 N NH1 . ARG B 1 136 ? 50.345 -19.805 0.786  1.00 89.47  ? 136  ARG B NH1 1 
ATOM   3291 N NH2 . ARG B 1 136 ? 52.088 -19.298 -0.623 1.00 89.47  ? 136  ARG B NH2 1 
ATOM   3292 N N   . ASN B 1 137 ? 51.126 -12.107 0.704  1.00 74.02  ? 137  ASN B N   1 
ATOM   3293 C CA  . ASN B 1 137 ? 51.820 -11.206 -0.221 1.00 74.02  ? 137  ASN B CA  1 
ATOM   3294 C C   . ASN B 1 137 ? 52.743 -10.325 0.610  1.00 74.02  ? 137  ASN B C   1 
ATOM   3295 O O   . ASN B 1 137 ? 53.781 -9.872  0.139  1.00 74.02  ? 137  ASN B O   1 
ATOM   3296 C CB  . ASN B 1 137 ? 50.833 -10.285 -0.937 1.00 84.49  ? 137  ASN B CB  1 
ATOM   3297 C CG  . ASN B 1 137 ? 49.564 -10.988 -1.339 1.00 84.49  ? 137  ASN B CG  1 
ATOM   3298 O OD1 . ASN B 1 137 ? 48.876 -11.579 -0.504 1.00 84.49  ? 137  ASN B OD1 1 
ATOM   3299 N ND2 . ASN B 1 137 ? 49.232 -10.919 -2.622 1.00 84.49  ? 137  ASN B ND2 1 
ATOM   3300 N N   . GLY B 1 138 ? 52.344 -10.078 1.855  1.00 49.64  ? 138  GLY B N   1 
ATOM   3301 C CA  . GLY B 1 138 ? 53.130 -9.230  2.723  1.00 49.64  ? 138  GLY B CA  1 
ATOM   3302 C C   . GLY B 1 138 ? 52.456 -7.885  2.880  1.00 49.64  ? 138  GLY B C   1 
ATOM   3303 O O   . GLY B 1 138 ? 53.061 -6.952  3.406  1.00 49.64  ? 138  GLY B O   1 
ATOM   3304 N N   . GLU B 1 139 ? 51.212 -7.760  2.417  1.00 48.35  ? 139  GLU B N   1 
ATOM   3305 C CA  . GLU B 1 139 ? 50.511 -6.485  2.563  1.00 48.35  ? 139  GLU B CA  1 
ATOM   3306 C C   . GLU B 1 139 ? 49.750 -6.460  3.884  1.00 48.35  ? 139  GLU B C   1 
ATOM   3307 O O   . GLU B 1 139 ? 49.160 -7.464  4.303  1.00 48.35  ? 139  GLU B O   1 
ATOM   3308 C CB  . GLU B 1 139 ? 49.540 -6.230  1.411  1.00 89.53  ? 139  GLU B CB  1 
ATOM   3309 C CG  . GLU B 1 139 ? 49.491 -7.300  0.359  1.00 89.53  ? 139  GLU B CG  1 
ATOM   3310 C CD  . GLU B 1 139 ? 48.605 -6.901  -0.807 1.00 89.53  ? 139  GLU B CD  1 
ATOM   3311 O OE1 . GLU B 1 139 ? 48.965 -5.945  -1.528 1.00 89.53  ? 139  GLU B OE1 1 
ATOM   3312 O OE2 . GLU B 1 139 ? 47.543 -7.533  -0.995 1.00 89.53  ? 139  GLU B OE2 1 
ATOM   3313 N N   . LEU B 1 140 ? 49.790 -5.302  4.537  1.00 49.12  ? 140  LEU B N   1 
ATOM   3314 C CA  . LEU B 1 140 ? 49.135 -5.092  5.821  1.00 49.12  ? 140  LEU B CA  1 
ATOM   3315 C C   . LEU B 1 140 ? 47.917 -4.194  5.636  1.00 49.12  ? 140  LEU B C   1 
ATOM   3316 O O   . LEU B 1 140 ? 47.908 -3.306  4.773  1.00 49.12  ? 140  LEU B O   1 
ATOM   3317 C CB  . LEU B 1 140 ? 50.141 -4.478  6.801  1.00 31.18  ? 140  LEU B CB  1 
ATOM   3318 C CG  . LEU B 1 140 ? 49.740 -3.941  8.180  1.00 31.18  ? 140  LEU B CG  1 
ATOM   3319 C CD1 . LEU B 1 140 ? 50.929 -4.033  9.145  1.00 31.18  ? 140  LEU B CD1 1 
ATOM   3320 C CD2 . LEU B 1 140 ? 49.281 -2.489  8.044  1.00 31.18  ? 140  LEU B CD2 1 
ATOM   3321 N N   . LYS B 1 141 ? 46.878 -4.440  6.432  1.00 38.86  ? 141  LYS B N   1 
ATOM   3322 C CA  . LYS B 1 141 ? 45.650 -3.650  6.339  1.00 38.86  ? 141  LYS B CA  1 
ATOM   3323 C C   . LYS B 1 141 ? 45.005 -3.354  7.686  1.00 38.86  ? 141  LYS B C   1 
ATOM   3324 O O   . LYS B 1 141 ? 44.893 -4.234  8.541  1.00 38.86  ? 141  LYS B O   1 
ATOM   3325 C CB  . LYS B 1 141 ? 44.642 -4.363  5.429  1.00 48.01  ? 141  LYS B CB  1 
ATOM   3326 C CG  . LYS B 1 141 ? 45.137 -4.476  4.013  1.00 48.01  ? 141  LYS B CG  1 
ATOM   3327 C CD  . LYS B 1 141 ? 44.200 -5.221  3.111  1.00 48.01  ? 141  LYS B CD  1 
ATOM   3328 C CE  . LYS B 1 141 ? 44.823 -5.274  1.726  1.00 48.01  ? 141  LYS B CE  1 
ATOM   3329 N NZ  . LYS B 1 141 ? 43.906 -5.886  0.749  1.00 48.01  ? 141  LYS B NZ  1 
ATOM   3330 N N   . LEU B 1 142 ? 44.600 -2.100  7.871  1.00 38.94  ? 142  LEU B N   1 
ATOM   3331 C CA  . LEU B 1 142 ? 43.942 -1.694  9.103  1.00 38.94  ? 142  LEU B CA  1 
ATOM   3332 C C   . LEU B 1 142 ? 42.525 -2.249  9.070  1.00 38.94  ? 142  LEU B C   1 
ATOM   3333 O O   . LEU B 1 142 ? 41.878 -2.267  8.024  1.00 38.94  ? 142  LEU B O   1 
ATOM   3334 C CB  . LEU B 1 142 ? 43.910 -0.163  9.242  1.00 41.88  ? 142  LEU B CB  1 
ATOM   3335 C CG  . LEU B 1 142 ? 45.219 0.464   9.748  1.00 41.88  ? 142  LEU B CG  1 
ATOM   3336 C CD1 . LEU B 1 142 ? 46.260 0.466   8.629  1.00 41.88  ? 142  LEU B CD1 1 
ATOM   3337 C CD2 . LEU B 1 142 ? 44.966 1.883   10.249 1.00 41.88  ? 142  LEU B CD2 1 
ATOM   3338 N N   . ALA B 1 143 ? 42.048 -2.718  10.215 1.00 42.65  ? 143  ALA B N   1 
ATOM   3339 C CA  . ALA B 1 143 ? 40.715 -3.284  10.272 1.00 42.65  ? 143  ALA B CA  1 
ATOM   3340 C C   . ALA B 1 143 ? 40.034 -2.942  11.578 1.00 42.65  ? 143  ALA B C   1 
ATOM   3341 O O   . ALA B 1 143 ? 40.597 -2.243  12.424 1.00 42.65  ? 143  ALA B O   1 
ATOM   3342 C CB  . ALA B 1 143 ? 40.786 -4.808  10.103 1.00 50.25  ? 143  ALA B CB  1 
ATOM   3343 N N   . ASP B 1 144 ? 38.811 -3.441  11.716 1.00 32.36  ? 144  ASP B N   1 
ATOM   3344 C CA  . ASP B 1 144 ? 38.007 -3.250  12.908 1.00 32.36  ? 144  ASP B CA  1 
ATOM   3345 C C   . ASP B 1 144 ? 37.863 -1.789  13.324 1.00 32.36  ? 144  ASP B C   1 
ATOM   3346 O O   . ASP B 1 144 ? 38.472 -1.339  14.308 1.00 32.36  ? 144  ASP B O   1 
ATOM   3347 C CB  . ASP B 1 144 ? 38.601 -4.097  14.036 1.00 41.99  ? 144  ASP B CB  1 
ATOM   3348 C CG  . ASP B 1 144 ? 38.745 -5.558  13.634 1.00 41.99  ? 144  ASP B CG  1 
ATOM   3349 O OD1 . ASP B 1 144 ? 37.719 -6.172  13.261 1.00 41.99  ? 144  ASP B OD1 1 
ATOM   3350 O OD2 . ASP B 1 144 ? 39.873 -6.095  13.675 1.00 41.99  ? 144  ASP B OD2 1 
ATOM   3351 N N   . PHE B 1 145 ? 37.059 -1.052  12.560 1.00 37.28  ? 145  PHE B N   1 
ATOM   3352 C CA  . PHE B 1 145 ? 36.814 0.351   12.840 1.00 37.28  ? 145  PHE B CA  1 
ATOM   3353 C C   . PHE B 1 145 ? 35.661 0.524   13.813 1.00 37.28  ? 145  PHE B C   1 
ATOM   3354 O O   . PHE B 1 145 ? 35.029 1.568   13.845 1.00 37.28  ? 145  PHE B O   1 
ATOM   3355 C CB  . PHE B 1 145 ? 36.501 1.093   11.544 1.00 33.26  ? 145  PHE B CB  1 
ATOM   3356 C CG  . PHE B 1 145 ? 37.709 1.367   10.704 1.00 33.26  ? 145  PHE B CG  1 
ATOM   3357 C CD1 . PHE B 1 145 ? 38.456 0.325   10.173 1.00 33.26  ? 145  PHE B CD1 1 
ATOM   3358 C CD2 . PHE B 1 145 ? 38.146 2.674   10.499 1.00 33.26  ? 145  PHE B CD2 1 
ATOM   3359 C CE1 . PHE B 1 145 ? 39.631 0.579   9.458  1.00 33.26  ? 145  PHE B CE1 1 
ATOM   3360 C CE2 . PHE B 1 145 ? 39.322 2.930   9.785  1.00 33.26  ? 145  PHE B CE2 1 
ATOM   3361 C CZ  . PHE B 1 145 ? 40.062 1.877   9.267  1.00 33.26  ? 145  PHE B CZ  1 
ATOM   3362 N N   . GLY B 1 146 ? 35.392 -0.503  14.609 1.00 36.73  ? 146  GLY B N   1 
ATOM   3363 C CA  . GLY B 1 146 ? 34.290 -0.451  15.554 1.00 36.73  ? 146  GLY B CA  1 
ATOM   3364 C C   . GLY B 1 146 ? 34.363 0.682   16.548 1.00 36.73  ? 146  GLY B C   1 
ATOM   3365 O O   . GLY B 1 146 ? 33.339 1.119   17.075 1.00 36.73  ? 146  GLY B O   1 
ATOM   3366 N N   . LEU B 1 147 ? 35.570 1.175   16.800 1.00 32.30  ? 147  LEU B N   1 
ATOM   3367 C CA  . LEU B 1 147 ? 35.755 2.259   17.756 1.00 32.30  ? 147  LEU B CA  1 
ATOM   3368 C C   . LEU B 1 147 ? 36.117 3.574   17.073 1.00 32.30  ? 147  LEU B C   1 
ATOM   3369 O O   . LEU B 1 147 ? 36.345 4.582   17.740 1.00 32.30  ? 147  LEU B O   1 
ATOM   3370 C CB  . LEU B 1 147 ? 36.857 1.890   18.744 1.00 56.15  ? 147  LEU B CB  1 
ATOM   3371 C CG  . LEU B 1 147 ? 36.641 0.559   19.461 1.00 56.15  ? 147  LEU B CG  1 
ATOM   3372 C CD1 . LEU B 1 147 ? 37.771 0.316   20.453 1.00 56.15  ? 147  LEU B CD1 1 
ATOM   3373 C CD2 . LEU B 1 147 ? 35.309 0.585   20.185 1.00 56.15  ? 147  LEU B CD2 1 
ATOM   3374 N N   . ALA B 1 148 ? 36.171 3.565   15.748 1.00 29.10  ? 148  ALA B N   1 
ATOM   3375 C CA  . ALA B 1 148 ? 36.539 4.767   15.018 1.00 29.10  ? 148  ALA B CA  1 
ATOM   3376 C C   . ALA B 1 148 ? 35.445 5.820   15.018 1.00 29.10  ? 148  ALA B C   1 
ATOM   3377 O O   . ALA B 1 148 ? 34.307 5.567   15.418 1.00 29.10  ? 148  ALA B O   1 
ATOM   3378 C CB  . ALA B 1 148 ? 36.914 4.405   13.564 1.00 10.63  ? 148  ALA B CB  1 
ATOM   3379 N N   . ARG B 1 149 ? 35.803 7.011   14.565 1.00 34.14  ? 149  ARG B N   1 
ATOM   3380 C CA  . ARG B 1 149 ? 34.842 8.088   14.461 1.00 34.14  ? 149  ARG B CA  1 
ATOM   3381 C C   . ARG B 1 149 ? 35.391 9.168   13.558 1.00 34.14  ? 149  ARG B C   1 
ATOM   3382 O O   . ARG B 1 149 ? 36.573 9.203   13.270 1.00 34.14  ? 149  ARG B O   1 
ATOM   3383 C CB  . ARG B 1 149 ? 34.506 8.673   15.836 1.00 61.97  ? 149  ARG B CB  1 
ATOM   3384 C CG  . ARG B 1 149 ? 35.413 9.787   16.318 1.00 61.97  ? 149  ARG B CG  1 
ATOM   3385 C CD  . ARG B 1 149 ? 34.724 10.551  17.436 1.00 61.97  ? 149  ARG B CD  1 
ATOM   3386 N NE  . ARG B 1 149 ? 33.569 11.302  16.944 1.00 61.97  ? 149  ARG B NE  1 
ATOM   3387 C CZ  . ARG B 1 149 ? 32.669 11.896  17.726 1.00 61.97  ? 149  ARG B CZ  1 
ATOM   3388 N NH1 . ARG B 1 149 ? 32.789 11.823  19.045 1.00 61.97  ? 149  ARG B NH1 1 
ATOM   3389 N NH2 . ARG B 1 149 ? 31.655 12.570  17.192 1.00 61.97  ? 149  ARG B NH2 1 
ATOM   3390 N N   . ALA B 1 150 ? 34.517 10.039  13.089 1.00 34.72  ? 150  ALA B N   1 
ATOM   3391 C CA  . ALA B 1 150 ? 34.942 11.125  12.232 1.00 34.72  ? 150  ALA B CA  1 
ATOM   3392 C C   . ALA B 1 150 ? 35.206 12.252  13.186 1.00 34.72  ? 150  ALA B C   1 
ATOM   3393 O O   . ALA B 1 150 ? 34.643 12.279  14.276 1.00 34.72  ? 150  ALA B O   1 
ATOM   3394 C CB  . ALA B 1 150 ? 33.837 11.506  11.279 1.00 25.17  ? 150  ALA B CB  1 
ATOM   3395 N N   . PHE B 1 151 ? 36.084 13.165  12.794 1.00 47.36  ? 151  PHE B N   1 
ATOM   3396 C CA  . PHE B 1 151 ? 36.388 14.315  13.630 1.00 47.36  ? 151  PHE B CA  1 
ATOM   3397 C C   . PHE B 1 151 ? 36.483 15.495  12.691 1.00 47.36  ? 151  PHE B C   1 
ATOM   3398 O O   . PHE B 1 151 ? 36.912 15.355  11.547 1.00 47.36  ? 151  PHE B O   1 
ATOM   3399 C CB  . PHE B 1 151 ? 37.704 14.133  14.407 1.00 42.54  ? 151  PHE B CB  1 
ATOM   3400 C CG  . PHE B 1 151 ? 38.915 14.165  13.549 1.00 42.54  ? 151  PHE B CG  1 
ATOM   3401 C CD1 . PHE B 1 151 ? 39.359 13.025  12.913 1.00 42.54  ? 151  PHE B CD1 1 
ATOM   3402 C CD2 . PHE B 1 151 ? 39.577 15.366  13.312 1.00 42.54  ? 151  PHE B CD2 1 
ATOM   3403 C CE1 . PHE B 1 151 ? 40.449 13.084  12.041 1.00 42.54  ? 151  PHE B CE1 1 
ATOM   3404 C CE2 . PHE B 1 151 ? 40.666 15.430  12.442 1.00 42.54  ? 151  PHE B CE2 1 
ATOM   3405 C CZ  . PHE B 1 151 ? 41.100 14.291  11.808 1.00 42.54  ? 151  PHE B CZ  1 
ATOM   3406 N N   . GLY B 1 152 ? 36.063 16.654  13.179 1.00 46.04  ? 152  GLY B N   1 
ATOM   3407 C CA  . GLY B 1 152 ? 36.087 17.853  12.369 1.00 46.04  ? 152  GLY B CA  1 
ATOM   3408 C C   . GLY B 1 152 ? 35.171 18.905  12.945 1.00 46.04  ? 152  GLY B C   1 
ATOM   3409 O O   . GLY B 1 152 ? 35.527 20.073  12.977 1.00 46.04  ? 152  GLY B O   1 
ATOM   3410 N N   . ILE B 1 153 ? 33.992 18.495  13.393 1.00 60.20  ? 153  ILE B N   1 
ATOM   3411 C CA  . ILE B 1 153 ? 33.033 19.421  13.977 1.00 60.20  ? 153  ILE B CA  1 
ATOM   3412 C C   . ILE B 1 153 ? 33.413 19.722  15.427 1.00 60.20  ? 153  ILE B C   1 
ATOM   3413 O O   . ILE B 1 153 ? 33.709 18.810  16.207 1.00 60.20  ? 153  ILE B O   1 
ATOM   3414 C CB  . ILE B 1 153 ? 31.602 18.840  13.951 1.00 50.14  ? 153  ILE B CB  1 
ATOM   3415 C CG1 . ILE B 1 153 ? 31.152 18.672  12.502 1.00 50.14  ? 153  ILE B CG1 1 
ATOM   3416 C CG2 . ILE B 1 153 ? 30.646 19.754  14.717 1.00 50.14  ? 153  ILE B CG2 1 
ATOM   3417 C CD1 . ILE B 1 153 ? 29.809 18.046  12.362 1.00 50.14  ? 153  ILE B CD1 1 
ATOM   3418 N N   . PRO B 1 154 ? 33.408 21.009  15.805 1.00 112.41 ? 154  PRO B N   1 
ATOM   3419 C CA  . PRO B 1 154 ? 33.751 21.436  17.162 1.00 112.41 ? 154  PRO B CA  1 
ATOM   3420 C C   . PRO B 1 154 ? 33.001 20.626  18.212 1.00 112.41 ? 154  PRO B C   1 
ATOM   3421 O O   . PRO B 1 154 ? 31.834 20.886  18.493 1.00 112.41 ? 154  PRO B O   1 
ATOM   3422 C CB  . PRO B 1 154 ? 33.350 22.907  17.166 1.00 137.65 ? 154  PRO B CB  1 
ATOM   3423 C CG  . PRO B 1 154 ? 33.615 23.316  15.760 1.00 137.65 ? 154  PRO B CG  1 
ATOM   3424 C CD  . PRO B 1 154 ? 33.029 22.167  14.977 1.00 137.65 ? 154  PRO B CD  1 
ATOM   3425 N N   . VAL B 1 155 ? 33.679 19.638  18.779 1.00 77.51  ? 155  VAL B N   1 
ATOM   3426 C CA  . VAL B 1 155 ? 33.080 18.794  19.801 1.00 77.51  ? 155  VAL B CA  1 
ATOM   3427 C C   . VAL B 1 155 ? 33.569 19.215  21.172 1.00 77.51  ? 155  VAL B C   1 
ATOM   3428 O O   . VAL B 1 155 ? 34.714 19.644  21.334 1.00 77.51  ? 155  VAL B O   1 
ATOM   3429 C CB  . VAL B 1 155 ? 33.443 17.297  19.597 1.00 81.06  ? 155  VAL B CB  1 
ATOM   3430 C CG1 . VAL B 1 155 ? 33.079 16.485  20.841 1.00 81.06  ? 155  VAL B CG1 1 
ATOM   3431 C CG2 . VAL B 1 155 ? 32.709 16.741  18.382 1.00 81.06  ? 155  VAL B CG2 1 
ATOM   3432 N N   . ARG B 1 156 ? 32.690 19.093  22.158 1.00 87.27  ? 156  ARG B N   1 
ATOM   3433 C CA  . ARG B 1 156 ? 33.032 19.432  23.528 1.00 87.27  ? 156  ARG B CA  1 
ATOM   3434 C C   . ARG B 1 156 ? 34.099 18.452  24.023 1.00 87.27  ? 156  ARG B C   1 
ATOM   3435 O O   . ARG B 1 156 ? 35.064 18.857  24.673 1.00 87.27  ? 156  ARG B O   1 
ATOM   3436 C CB  . ARG B 1 156 ? 31.778 19.354  24.404 1.00 139.15 ? 156  ARG B CB  1 
ATOM   3437 C CG  . ARG B 1 156 ? 30.655 20.276  23.939 1.00 139.15 ? 156  ARG B CG  1 
ATOM   3438 C CD  . ARG B 1 156 ? 29.414 20.165  24.814 1.00 139.15 ? 156  ARG B CD  1 
ATOM   3439 N NE  . ARG B 1 156 ? 28.383 21.121  24.411 1.00 139.15 ? 156  ARG B NE  1 
ATOM   3440 C CZ  . ARG B 1 156 ? 27.193 21.234  24.994 1.00 139.15 ? 156  ARG B CZ  1 
ATOM   3441 N NH1 . ARG B 1 156 ? 26.874 20.448  26.013 1.00 139.15 ? 156  ARG B NH1 1 
ATOM   3442 N NH2 . ARG B 1 156 ? 26.321 22.136  24.561 1.00 139.15 ? 156  ARG B NH2 1 
ATOM   3443 N N   . CYS B 1 157 ? 33.925 17.170  23.684 1.00 90.50  ? 157  CYS B N   1 
ATOM   3444 C CA  . CYS B 1 157 ? 34.853 16.105  24.093 1.00 90.50  ? 157  CYS B CA  1 
ATOM   3445 C C   . CYS B 1 157 ? 34.429 14.740  23.529 1.00 90.50  ? 157  CYS B C   1 
ATOM   3446 O O   . CYS B 1 157 ? 33.243 14.503  23.302 1.00 90.50  ? 157  CYS B O   1 
ATOM   3447 C CB  . CYS B 1 157 ? 34.886 16.007  25.622 1.00 68.38  ? 157  CYS B CB  1 
ATOM   3448 S SG  . CYS B 1 157 ? 33.314 15.425  26.343 1.00 68.38  ? 157  CYS B SG  1 
ATOM   3449 N N   . TYR B 1 158 ? 35.390 13.842  23.314 1.00 76.22  ? 158  TYR B N   1 
ATOM   3450 C CA  . TYR B 1 158 ? 35.063 12.503  22.799 1.00 76.22  ? 158  TYR B CA  1 
ATOM   3451 C C   . TYR B 1 158 ? 34.882 11.592  24.009 1.00 76.22  ? 158  TYR B C   1 
ATOM   3452 O O   . TYR B 1 158 ? 34.165 11.935  24.943 1.00 76.22  ? 158  TYR B O   1 
ATOM   3453 C CB  . TYR B 1 158 ? 36.181 11.942  21.893 1.00 58.12  ? 158  TYR B CB  1 
ATOM   3454 C CG  . TYR B 1 158 ? 36.544 12.824  20.721 1.00 58.12  ? 158  TYR B CG  1 
ATOM   3455 C CD1 . TYR B 1 158 ? 37.841 13.304  20.572 1.00 58.12  ? 158  TYR B CD1 1 
ATOM   3456 C CD2 . TYR B 1 158 ? 35.581 13.231  19.799 1.00 58.12  ? 158  TYR B CD2 1 
ATOM   3457 C CE1 . TYR B 1 158 ? 38.178 14.183  19.541 1.00 58.12  ? 158  TYR B CE1 1 
ATOM   3458 C CE2 . TYR B 1 158 ? 35.903 14.109  18.754 1.00 58.12  ? 158  TYR B CE2 1 
ATOM   3459 C CZ  . TYR B 1 158 ? 37.207 14.586  18.639 1.00 58.12  ? 158  TYR B CZ  1 
ATOM   3460 O OH  . TYR B 1 158 ? 37.537 15.499  17.658 1.00 58.12  ? 158  TYR B OH  1 
ATOM   3461 N N   . SER B 1 159 ? 35.538 10.441  23.995 1.00 60.23  ? 159  SER B N   1 
ATOM   3462 C CA  . SER B 1 159 ? 35.451 9.498   25.100 1.00 60.23  ? 159  SER B CA  1 
ATOM   3463 C C   . SER B 1 159 ? 36.850 8.951   25.359 1.00 60.23  ? 159  SER B C   1 
ATOM   3464 O O   . SER B 1 159 ? 37.630 8.777   24.419 1.00 60.23  ? 159  SER B O   1 
ATOM   3465 C CB  . SER B 1 159 ? 34.499 8.356   24.739 1.00 50.14  ? 159  SER B CB  1 
ATOM   3466 O OG  . SER B 1 159 ? 34.525 7.344   25.728 1.00 50.14  ? 159  SER B OG  1 
ATOM   3467 N N   . ALA B 1 160 ? 37.175 8.684   26.621 1.00 66.85  ? 160  ALA B N   1 
ATOM   3468 C CA  . ALA B 1 160 ? 38.496 8.161   26.951 1.00 66.85  ? 160  ALA B CA  1 
ATOM   3469 C C   . ALA B 1 160 ? 38.533 6.638   26.919 1.00 66.85  ? 160  ALA B C   1 
ATOM   3470 O O   . ALA B 1 160 ? 39.587 6.035   27.116 1.00 66.85  ? 160  ALA B O   1 
ATOM   3471 C CB  . ALA B 1 160 ? 38.940 8.671   28.324 1.00 51.80  ? 160  ALA B CB  1 
ATOM   3472 N N   . GLU B 1 161 ? 37.388 6.011   26.664 1.00 54.00  ? 161  GLU B N   1 
ATOM   3473 C CA  . GLU B 1 161 ? 37.340 4.555   26.627 1.00 54.00  ? 161  GLU B CA  1 
ATOM   3474 C C   . GLU B 1 161 ? 37.613 4.020   25.238 1.00 54.00  ? 161  GLU B C   1 
ATOM   3475 O O   . GLU B 1 161 ? 36.826 3.259   24.662 1.00 54.00  ? 161  GLU B O   1 
ATOM   3476 C CB  . GLU B 1 161 ? 35.998 4.057   27.165 1.00 116.88 ? 161  GLU B CB  1 
ATOM   3477 C CG  . GLU B 1 161 ? 35.874 4.281   28.666 1.00 116.88 ? 161  GLU B CG  1 
ATOM   3478 C CD  . GLU B 1 161 ? 37.177 3.959   29.405 1.00 116.88 ? 161  GLU B CD  1 
ATOM   3479 O OE1 . GLU B 1 161 ? 37.692 2.829   29.243 1.00 116.88 ? 161  GLU B OE1 1 
ATOM   3480 O OE2 . GLU B 1 161 ? 37.690 4.832   30.145 1.00 116.88 ? 161  GLU B OE2 1 
ATOM   3481 N N   . VAL B 1 162 ? 38.762 4.431   24.718 1.00 61.59  ? 162  VAL B N   1 
ATOM   3482 C CA  . VAL B 1 162 ? 39.201 4.043   23.393 1.00 61.59  ? 162  VAL B CA  1 
ATOM   3483 C C   . VAL B 1 162 ? 40.625 3.470   23.450 1.00 61.59  ? 162  VAL B C   1 
ATOM   3484 O O   . VAL B 1 162 ? 41.461 3.937   24.233 1.00 61.59  ? 162  VAL B O   1 
ATOM   3485 C CB  . VAL B 1 162 ? 39.173 5.265   22.427 1.00 55.44  ? 162  VAL B CB  1 
ATOM   3486 C CG1 . VAL B 1 162 ? 37.739 5.762   22.264 1.00 55.44  ? 162  VAL B CG1 1 
ATOM   3487 C CG2 . VAL B 1 162 ? 40.053 6.390   22.952 1.00 55.44  ? 162  VAL B CG2 1 
ATOM   3488 N N   . VAL B 1 163 ? 40.885 2.459   22.614 1.00 38.21  ? 163  VAL B N   1 
ATOM   3489 C CA  . VAL B 1 163 ? 42.181 1.779   22.514 1.00 38.21  ? 163  VAL B CA  1 
ATOM   3490 C C   . VAL B 1 163 ? 42.446 0.891   23.714 1.00 38.21  ? 163  VAL B C   1 
ATOM   3491 O O   . VAL B 1 163 ? 42.252 1.306   24.844 1.00 38.21  ? 163  VAL B O   1 
ATOM   3492 C CB  . VAL B 1 163 ? 43.369 2.766   22.417 1.00 35.63  ? 163  VAL B CB  1 
ATOM   3493 C CG1 . VAL B 1 163 ? 44.531 2.085   21.734 1.00 35.63  ? 163  VAL B CG1 1 
ATOM   3494 C CG2 . VAL B 1 163 ? 42.977 4.032   21.670 1.00 35.63  ? 163  VAL B CG2 1 
ATOM   3495 N N   . THR B 1 164 ? 42.897 -0.332  23.460 1.00 35.27  ? 164  THR B N   1 
ATOM   3496 C CA  . THR B 1 164 ? 43.226 -1.283  24.522 1.00 35.27  ? 164  THR B CA  1 
ATOM   3497 C C   . THR B 1 164 ? 44.354 -0.722  25.395 1.00 35.27  ? 164  THR B C   1 
ATOM   3498 O O   . THR B 1 164 ? 45.291 -0.074  24.889 1.00 35.27  ? 164  THR B O   1 
ATOM   3499 C CB  . THR B 1 164 ? 43.729 -2.617  23.951 1.00 54.09  ? 164  THR B CB  1 
ATOM   3500 O OG1 . THR B 1 164 ? 42.814 -3.090  22.952 1.00 54.09  ? 164  THR B OG1 1 
ATOM   3501 C CG2 . THR B 1 164 ? 43.863 -3.645  25.066 1.00 54.09  ? 164  THR B CG2 1 
ATOM   3502 N N   . LEU B 1 165 ? 44.259 -1.007  26.694 1.00 27.14  ? 165  LEU B N   1 
ATOM   3503 C CA  . LEU B 1 165 ? 45.218 -0.547  27.672 1.00 27.14  ? 165  LEU B CA  1 
ATOM   3504 C C   . LEU B 1 165 ? 46.679 -0.467  27.218 1.00 27.14  ? 165  LEU B C   1 
ATOM   3505 O O   . LEU B 1 165 ? 47.290 0.603   27.282 1.00 27.14  ? 165  LEU B O   1 
ATOM   3506 C CB  . LEU B 1 165 ? 45.147 -1.415  28.930 1.00 38.27  ? 165  LEU B CB  1 
ATOM   3507 C CG  . LEU B 1 165 ? 46.094 -0.941  30.041 1.00 38.27  ? 165  LEU B CG  1 
ATOM   3508 C CD1 . LEU B 1 165 ? 45.705 0.474   30.435 1.00 38.27  ? 165  LEU B CD1 1 
ATOM   3509 C CD2 . LEU B 1 165 ? 46.042 -1.873  31.242 1.00 38.27  ? 165  LEU B CD2 1 
ATOM   3510 N N   . TRP B 1 166 ? 47.244 -1.580  26.764 1.00 34.27  ? 166  TRP B N   1 
ATOM   3511 C CA  . TRP B 1 166 ? 48.648 -1.575  26.359 1.00 34.27  ? 166  TRP B CA  1 
ATOM   3512 C C   . TRP B 1 166 ? 49.002 -0.638  25.216 1.00 34.27  ? 166  TRP B C   1 
ATOM   3513 O O   . TRP B 1 166 ? 50.174 -0.472  24.889 1.00 34.27  ? 166  TRP B O   1 
ATOM   3514 C CB  . TRP B 1 166 ? 49.121 -2.978  25.986 1.00 33.51  ? 166  TRP B CB  1 
ATOM   3515 C CG  . TRP B 1 166 ? 48.965 -4.045  27.046 1.00 33.51  ? 166  TRP B CG  1 
ATOM   3516 C CD1 . TRP B 1 166 ? 48.726 -3.875  28.391 1.00 33.51  ? 166  TRP B CD1 1 
ATOM   3517 C CD2 . TRP B 1 166 ? 49.077 -5.459  26.836 1.00 33.51  ? 166  TRP B CD2 1 
ATOM   3518 N NE1 . TRP B 1 166 ? 48.687 -5.103  29.025 1.00 33.51  ? 166  TRP B NE1 1 
ATOM   3519 C CE2 . TRP B 1 166 ? 48.900 -6.088  28.095 1.00 33.51  ? 166  TRP B CE2 1 
ATOM   3520 C CE3 . TRP B 1 166 ? 49.315 -6.255  25.701 1.00 33.51  ? 166  TRP B CE3 1 
ATOM   3521 C CZ2 . TRP B 1 166 ? 48.952 -7.474  28.249 1.00 33.51  ? 166  TRP B CZ2 1 
ATOM   3522 C CZ3 . TRP B 1 166 ? 49.367 -7.635  25.852 1.00 33.51  ? 166  TRP B CZ3 1 
ATOM   3523 C CH2 . TRP B 1 166 ? 49.186 -8.232  27.120 1.00 33.51  ? 166  TRP B CH2 1 
ATOM   3524 N N   . TYR B 1 167 ? 48.019 -0.015  24.595 1.00 37.68  ? 167  TYR B N   1 
ATOM   3525 C CA  . TYR B 1 167 ? 48.349 0.879   23.492 1.00 37.68  ? 167  TYR B CA  1 
ATOM   3526 C C   . TYR B 1 167 ? 47.769 2.252   23.761 1.00 37.68  ? 167  TYR B C   1 
ATOM   3527 O O   . TYR B 1 167 ? 47.837 3.139   22.912 1.00 37.68  ? 167  TYR B O   1 
ATOM   3528 C CB  . TYR B 1 167 ? 47.815 0.315   22.161 1.00 30.05  ? 167  TYR B CB  1 
ATOM   3529 C CG  . TYR B 1 167 ? 48.360 -1.059  21.845 1.00 30.05  ? 167  TYR B CG  1 
ATOM   3530 C CD1 . TYR B 1 167 ? 49.603 -1.218  21.227 1.00 30.05  ? 167  TYR B CD1 1 
ATOM   3531 C CD2 . TYR B 1 167 ? 47.687 -2.201  22.265 1.00 30.05  ? 167  TYR B CD2 1 
ATOM   3532 C CE1 . TYR B 1 167 ? 50.167 -2.486  21.048 1.00 30.05  ? 167  TYR B CE1 1 
ATOM   3533 C CE2 . TYR B 1 167 ? 48.233 -3.466  22.095 1.00 30.05  ? 167  TYR B CE2 1 
ATOM   3534 C CZ  . TYR B 1 167 ? 49.479 -3.611  21.488 1.00 30.05  ? 167  TYR B CZ  1 
ATOM   3535 O OH  . TYR B 1 167 ? 50.026 -4.886  21.333 1.00 30.05  ? 167  TYR B OH  1 
ATOM   3536 N N   . ARG B 1 168 ? 47.221 2.433   24.957 1.00 33.73  ? 168  ARG B N   1 
ATOM   3537 C CA  . ARG B 1 168 ? 46.620 3.710   25.321 1.00 33.73  ? 168  ARG B CA  1 
ATOM   3538 C C   . ARG B 1 168 ? 47.678 4.796   25.609 1.00 33.73  ? 168  ARG B C   1 
ATOM   3539 O O   . ARG B 1 168 ? 48.562 4.607   26.448 1.00 33.73  ? 168  ARG B O   1 
ATOM   3540 C CB  . ARG B 1 168 ? 45.712 3.510   26.540 1.00 46.64  ? 168  ARG B CB  1 
ATOM   3541 C CG  . ARG B 1 168 ? 44.557 4.499   26.652 1.00 46.64  ? 168  ARG B CG  1 
ATOM   3542 C CD  . ARG B 1 168 ? 43.223 3.769   26.847 1.00 46.64  ? 168  ARG B CD  1 
ATOM   3543 N NE  . ARG B 1 168 ? 43.066 3.209   28.186 1.00 46.64  ? 168  ARG B NE  1 
ATOM   3544 C CZ  . ARG B 1 168 ? 42.360 2.111   28.456 1.00 46.64  ? 168  ARG B CZ  1 
ATOM   3545 N NH1 . ARG B 1 168 ? 41.755 1.457   27.481 1.00 46.64  ? 168  ARG B NH1 1 
ATOM   3546 N NH2 . ARG B 1 168 ? 42.256 1.666   29.705 1.00 46.64  ? 168  ARG B NH2 1 
ATOM   3547 N N   . PRO B 1 169 ? 47.621 5.935   24.892 1.00 41.02  ? 169  PRO B N   1 
ATOM   3548 C CA  . PRO B 1 169 ? 48.611 6.981   25.156 1.00 41.02  ? 169  PRO B CA  1 
ATOM   3549 C C   . PRO B 1 169 ? 48.447 7.541   26.574 1.00 41.02  ? 169  PRO B C   1 
ATOM   3550 O O   . PRO B 1 169 ? 47.346 7.561   27.131 1.00 41.02  ? 169  PRO B O   1 
ATOM   3551 C CB  . PRO B 1 169 ? 48.340 8.005   24.052 1.00 31.21  ? 169  PRO B CB  1 
ATOM   3552 C CG  . PRO B 1 169 ? 46.913 7.802   23.723 1.00 31.21  ? 169  PRO B CG  1 
ATOM   3553 C CD  . PRO B 1 169 ? 46.761 6.299   23.757 1.00 31.21  ? 169  PRO B CD  1 
ATOM   3554 N N   . PRO B 1 170 ? 49.546 8.002   27.184 1.00 68.43  ? 170  PRO B N   1 
ATOM   3555 C CA  . PRO B 1 170 ? 49.397 8.527   28.545 1.00 68.43  ? 170  PRO B CA  1 
ATOM   3556 C C   . PRO B 1 170 ? 48.393 9.663   28.753 1.00 68.43  ? 170  PRO B C   1 
ATOM   3557 O O   . PRO B 1 170 ? 47.763 9.724   29.806 1.00 68.43  ? 170  PRO B O   1 
ATOM   3558 C CB  . PRO B 1 170 ? 50.839 8.892   28.945 1.00 38.34  ? 170  PRO B CB  1 
ATOM   3559 C CG  . PRO B 1 170 ? 51.473 9.247   27.645 1.00 38.34  ? 170  PRO B CG  1 
ATOM   3560 C CD  . PRO B 1 170 ? 50.923 8.181   26.687 1.00 38.34  ? 170  PRO B CD  1 
ATOM   3561 N N   . ASP B 1 171 ? 48.222 10.563  27.787 1.00 43.86  ? 171  ASP B N   1 
ATOM   3562 C CA  . ASP B 1 171 ? 47.243 11.634  28.005 1.00 43.86  ? 171  ASP B CA  1 
ATOM   3563 C C   . ASP B 1 171 ? 45.871 11.002  28.244 1.00 43.86  ? 171  ASP B C   1 
ATOM   3564 O O   . ASP B 1 171 ? 45.084 11.480  29.069 1.00 43.86  ? 171  ASP B O   1 
ATOM   3565 C CB  . ASP B 1 171 ? 47.172 12.601  26.818 1.00 58.17  ? 171  ASP B CB  1 
ATOM   3566 C CG  . ASP B 1 171 ? 46.984 11.891  25.500 1.00 58.17  ? 171  ASP B CG  1 
ATOM   3567 O OD1 . ASP B 1 171 ? 46.119 12.310  24.691 1.00 58.17  ? 171  ASP B OD1 1 
ATOM   3568 O OD2 . ASP B 1 171 ? 47.722 10.911  25.278 1.00 58.17  ? 171  ASP B OD2 1 
ATOM   3569 N N   . VAL B 1 172 ? 45.600 9.908   27.539 1.00 44.32  ? 172  VAL B N   1 
ATOM   3570 C CA  . VAL B 1 172 ? 44.333 9.214   27.691 1.00 44.32  ? 172  VAL B CA  1 
ATOM   3571 C C   . VAL B 1 172 ? 44.301 8.446   29.020 1.00 44.32  ? 172  VAL B C   1 
ATOM   3572 O O   . VAL B 1 172 ? 43.253 8.300   29.641 1.00 44.32  ? 172  VAL B O   1 
ATOM   3573 C CB  . VAL B 1 172 ? 44.090 8.269   26.494 1.00 31.81  ? 172  VAL B CB  1 
ATOM   3574 C CG1 . VAL B 1 172 ? 42.805 7.482   26.695 1.00 31.81  ? 172  VAL B CG1 1 
ATOM   3575 C CG2 . VAL B 1 172 ? 44.012 9.087   25.209 1.00 31.81  ? 172  VAL B CG2 1 
ATOM   3576 N N   . LEU B 1 173 ? 45.452 7.958   29.456 1.00 40.11  ? 173  LEU B N   1 
ATOM   3577 C CA  . LEU B 1 173 ? 45.542 7.248   30.730 1.00 40.11  ? 173  LEU B CA  1 
ATOM   3578 C C   . LEU B 1 173 ? 45.326 8.242   31.879 1.00 40.11  ? 173  LEU B C   1 
ATOM   3579 O O   . LEU B 1 173 ? 44.985 7.847   32.985 1.00 40.11  ? 173  LEU B O   1 
ATOM   3580 C CB  . LEU B 1 173 ? 46.919 6.565   30.861 1.00 40.07  ? 173  LEU B CB  1 
ATOM   3581 C CG  . LEU B 1 173 ? 47.108 5.096   30.404 1.00 40.07  ? 173  LEU B CG  1 
ATOM   3582 C CD1 . LEU B 1 173 ? 46.014 4.693   29.446 1.00 40.07  ? 173  LEU B CD1 1 
ATOM   3583 C CD2 . LEU B 1 173 ? 48.481 4.910   29.760 1.00 40.07  ? 173  LEU B CD2 1 
ATOM   3584 N N   . PHE B 1 174 ? 45.521 9.531   31.600 1.00 36.86  ? 174  PHE B N   1 
ATOM   3585 C CA  . PHE B 1 174 ? 45.339 10.591  32.595 1.00 36.86  ? 174  PHE B CA  1 
ATOM   3586 C C   . PHE B 1 174 ? 43.934 11.197  32.527 1.00 36.86  ? 174  PHE B C   1 
ATOM   3587 O O   . PHE B 1 174 ? 43.711 12.319  33.003 1.00 36.86  ? 174  PHE B O   1 
ATOM   3588 C CB  . PHE B 1 174 ? 46.361 11.723  32.372 1.00 42.61  ? 174  PHE B CB  1 
ATOM   3589 C CG  . PHE B 1 174 ? 47.745 11.427  32.895 1.00 42.61  ? 174  PHE B CG  1 
ATOM   3590 C CD1 . PHE B 1 174 ? 48.856 12.005  32.290 1.00 42.61  ? 174  PHE B CD1 1 
ATOM   3591 C CD2 . PHE B 1 174 ? 47.938 10.579  33.985 1.00 42.61  ? 174  PHE B CD2 1 
ATOM   3592 C CE1 . PHE B 1 174 ? 50.154 11.739  32.761 1.00 42.61  ? 174  PHE B CE1 1 
ATOM   3593 C CE2 . PHE B 1 174 ? 49.212 10.307  34.462 1.00 42.61  ? 174  PHE B CE2 1 
ATOM   3594 C CZ  . PHE B 1 174 ? 50.331 10.889  33.849 1.00 42.61  ? 174  PHE B CZ  1 
ATOM   3595 N N   . GLY B 1 175 ? 43.000 10.480  31.905 1.00 49.21  ? 175  GLY B N   1 
ATOM   3596 C CA  . GLY B 1 175 ? 41.633 10.972  31.792 1.00 49.21  ? 175  GLY B CA  1 
ATOM   3597 C C   . GLY B 1 175 ? 41.295 11.894  30.622 1.00 49.21  ? 175  GLY B C   1 
ATOM   3598 O O   . GLY B 1 175 ? 40.153 12.345  30.490 1.00 49.21  ? 175  GLY B O   1 
ATOM   3599 N N   . ALA B 1 176 ? 42.268 12.177  29.766 1.00 47.61  ? 176  ALA B N   1 
ATOM   3600 C CA  . ALA B 1 176 ? 42.026 13.064  28.636 1.00 47.61  ? 176  ALA B CA  1 
ATOM   3601 C C   . ALA B 1 176 ? 40.845 12.584  27.792 1.00 47.61  ? 176  ALA B C   1 
ATOM   3602 O O   . ALA B 1 176 ? 40.849 11.457  27.288 1.00 47.61  ? 176  ALA B O   1 
ATOM   3603 C CB  . ALA B 1 176 ? 43.283 13.163  27.783 1.00 28.71  ? 176  ALA B CB  1 
ATOM   3604 N N   . LYS B 1 177 ? 39.831 13.438  27.647 1.00 55.85  ? 177  LYS B N   1 
ATOM   3605 C CA  . LYS B 1 177 ? 38.646 13.097  26.863 1.00 55.85  ? 177  LYS B CA  1 
ATOM   3606 C C   . LYS B 1 177 ? 38.671 13.737  25.491 1.00 55.85  ? 177  LYS B C   1 
ATOM   3607 O O   . LYS B 1 177 ? 37.832 13.453  24.641 1.00 55.85  ? 177  LYS B O   1 
ATOM   3608 C CB  . LYS B 1 177 ? 37.372 13.495  27.614 1.00 91.85  ? 177  LYS B CB  1 
ATOM   3609 C CG  . LYS B 1 177 ? 37.055 12.555  28.764 1.00 91.85  ? 177  LYS B CG  1 
ATOM   3610 C CD  . LYS B 1 177 ? 35.745 12.878  29.461 1.00 91.85  ? 177  LYS B CD  1 
ATOM   3611 C CE  . LYS B 1 177 ? 35.516 11.900  30.610 1.00 91.85  ? 177  LYS B CE  1 
ATOM   3612 N NZ  . LYS B 1 177 ? 34.282 12.178  31.392 1.00 91.85  ? 177  LYS B NZ  1 
ATOM   3613 N N   . LEU B 1 178 ? 39.643 14.605  25.270 1.00 44.41  ? 178  LEU B N   1 
ATOM   3614 C CA  . LEU B 1 178 ? 39.782 15.253  23.982 1.00 44.41  ? 178  LEU B CA  1 
ATOM   3615 C C   . LEU B 1 178 ? 41.156 14.867  23.463 1.00 44.41  ? 178  LEU B C   1 
ATOM   3616 O O   . LEU B 1 178 ? 42.116 14.794  24.228 1.00 44.41  ? 178  LEU B O   1 
ATOM   3617 C CB  . LEU B 1 178 ? 39.686 16.771  24.129 1.00 107.70 ? 178  LEU B CB  1 
ATOM   3618 C CG  . LEU B 1 178 ? 39.484 17.586  22.845 1.00 107.70 ? 178  LEU B CG  1 
ATOM   3619 C CD1 . LEU B 1 178 ? 39.256 19.043  23.220 1.00 107.70 ? 178  LEU B CD1 1 
ATOM   3620 C CD2 . LEU B 1 178 ? 40.684 17.451  21.915 1.00 107.70 ? 178  LEU B CD2 1 
ATOM   3621 N N   . TYR B 1 179 ? 41.250 14.607  22.166 1.00 37.94  ? 179  TYR B N   1 
ATOM   3622 C CA  . TYR B 1 179 ? 42.520 14.231  21.554 1.00 37.94  ? 179  TYR B CA  1 
ATOM   3623 C C   . TYR B 1 179 ? 42.413 14.286  20.037 1.00 37.94  ? 179  TYR B C   1 
ATOM   3624 O O   . TYR B 1 179 ? 41.324 14.296  19.469 1.00 37.94  ? 179  TYR B O   1 
ATOM   3625 C CB  . TYR B 1 179 ? 42.926 12.821  21.995 1.00 39.34  ? 179  TYR B CB  1 
ATOM   3626 C CG  . TYR B 1 179 ? 41.796 11.835  21.911 1.00 39.34  ? 179  TYR B CG  1 
ATOM   3627 C CD1 . TYR B 1 179 ? 41.256 11.464  20.679 1.00 39.34  ? 179  TYR B CD1 1 
ATOM   3628 C CD2 . TYR B 1 179 ? 41.193 11.347  23.064 1.00 39.34  ? 179  TYR B CD2 1 
ATOM   3629 C CE1 . TYR B 1 179 ? 40.140 10.646  20.600 1.00 39.34  ? 179  TYR B CE1 1 
ATOM   3630 C CE2 . TYR B 1 179 ? 40.071 10.524  22.993 1.00 39.34  ? 179  TYR B CE2 1 
ATOM   3631 C CZ  . TYR B 1 179 ? 39.554 10.183  21.760 1.00 39.34  ? 179  TYR B CZ  1 
ATOM   3632 O OH  . TYR B 1 179 ? 38.442 9.387   21.690 1.00 39.34  ? 179  TYR B OH  1 
ATOM   3633 N N   . SER B 1 180 ? 43.561 14.300  19.383 1.00 37.77  ? 180  SER B N   1 
ATOM   3634 C CA  . SER B 1 180 ? 43.598 14.354  17.941 1.00 37.77  ? 180  SER B CA  1 
ATOM   3635 C C   . SER B 1 180 ? 44.123 13.049  17.371 1.00 37.77  ? 180  SER B C   1 
ATOM   3636 O O   . SER B 1 180 ? 44.128 12.008  18.044 1.00 37.77  ? 180  SER B O   1 
ATOM   3637 C CB  . SER B 1 180 ? 44.497 15.499  17.512 1.00 74.32  ? 180  SER B CB  1 
ATOM   3638 O OG  . SER B 1 180 ? 43.996 16.711  18.045 1.00 74.32  ? 180  SER B OG  1 
ATOM   3639 N N   . THR B 1 181 ? 44.568 13.137  16.119 1.00 33.95  ? 181  THR B N   1 
ATOM   3640 C CA  . THR B 1 181 ? 45.132 12.014  15.397 1.00 33.95  ? 181  THR B CA  1 
ATOM   3641 C C   . THR B 1 181 ? 46.298 11.421  16.190 1.00 33.95  ? 181  THR B C   1 
ATOM   3642 O O   . THR B 1 181 ? 46.606 10.229  16.087 1.00 33.95  ? 181  THR B O   1 
ATOM   3643 C CB  . THR B 1 181 ? 45.621 12.472  14.037 1.00 32.11  ? 181  THR B CB  1 
ATOM   3644 O OG1 . THR B 1 181 ? 46.390 13.660  14.207 1.00 32.11  ? 181  THR B OG1 1 
ATOM   3645 C CG2 . THR B 1 181 ? 44.453 12.767  13.117 1.00 32.11  ? 181  THR B CG2 1 
ATOM   3646 N N   . SER B 1 182 ? 46.930 12.265  16.995 1.00 34.95  ? 182  SER B N   1 
ATOM   3647 C CA  . SER B 1 182 ? 48.052 11.857  17.823 1.00 34.95  ? 182  SER B CA  1 
ATOM   3648 C C   . SER B 1 182 ? 47.768 10.564  18.578 1.00 34.95  ? 182  SER B C   1 
ATOM   3649 O O   . SER B 1 182 ? 48.677 9.759   18.810 1.00 34.95  ? 182  SER B O   1 
ATOM   3650 C CB  . SER B 1 182 ? 48.377 12.956  18.833 1.00 62.83  ? 182  SER B CB  1 
ATOM   3651 O OG  . SER B 1 182 ? 47.301 13.141  19.744 1.00 62.83  ? 182  SER B OG  1 
ATOM   3652 N N   . ILE B 1 183 ? 46.509 10.364  18.963 1.00 40.11  ? 183  ILE B N   1 
ATOM   3653 C CA  . ILE B 1 183 ? 46.134 9.173   19.714 1.00 40.11  ? 183  ILE B CA  1 
ATOM   3654 C C   . ILE B 1 183 ? 46.489 7.915   18.939 1.00 40.11  ? 183  ILE B C   1 
ATOM   3655 O O   . ILE B 1 183 ? 47.019 6.972   19.528 1.00 40.11  ? 183  ILE B O   1 
ATOM   3656 C CB  . ILE B 1 183 ? 44.635 9.185   20.077 1.00 35.47  ? 183  ILE B CB  1 
ATOM   3657 C CG1 . ILE B 1 183 ? 44.324 8.044   21.040 1.00 35.47  ? 183  ILE B CG1 1 
ATOM   3658 C CG2 . ILE B 1 183 ? 43.786 9.077   18.839 1.00 35.47  ? 183  ILE B CG2 1 
ATOM   3659 C CD1 . ILE B 1 183 ? 42.869 8.058   21.537 1.00 35.47  ? 183  ILE B CD1 1 
ATOM   3660 N N   . ASP B 1 184 ? 46.233 7.902   17.626 1.00 40.54  ? 184  ASP B N   1 
ATOM   3661 C CA  . ASP B 1 184 ? 46.568 6.739   16.806 1.00 40.54  ? 184  ASP B CA  1 
ATOM   3662 C C   . ASP B 1 184 ? 48.078 6.659   16.618 1.00 40.54  ? 184  ASP B C   1 
ATOM   3663 O O   . ASP B 1 184 ? 48.647 5.560   16.542 1.00 40.54  ? 184  ASP B O   1 
ATOM   3664 C CB  . ASP B 1 184 ? 45.923 6.804   15.418 1.00 31.76  ? 184  ASP B CB  1 
ATOM   3665 C CG  . ASP B 1 184 ? 44.427 6.586   15.450 1.00 31.76  ? 184  ASP B CG  1 
ATOM   3666 O OD1 . ASP B 1 184 ? 43.935 5.921   16.384 1.00 31.76  ? 184  ASP B OD1 1 
ATOM   3667 O OD2 . ASP B 1 184 ? 43.744 7.078   14.525 1.00 31.76  ? 184  ASP B OD2 1 
ATOM   3668 N N   . MET B 1 185 ? 48.725 7.821   16.533 1.00 30.46  ? 185  MET B N   1 
ATOM   3669 C CA  . MET B 1 185 ? 50.170 7.873   16.338 1.00 30.46  ? 185  MET B CA  1 
ATOM   3670 C C   . MET B 1 185 ? 50.939 7.169   17.436 1.00 30.46  ? 185  MET B C   1 
ATOM   3671 O O   . MET B 1 185 ? 51.878 6.430   17.168 1.00 30.46  ? 185  MET B O   1 
ATOM   3672 C CB  . MET B 1 185 ? 50.618 9.312   16.205 1.00 39.49  ? 185  MET B CB  1 
ATOM   3673 C CG  . MET B 1 185 ? 50.198 9.892   14.883 1.00 39.49  ? 185  MET B CG  1 
ATOM   3674 S SD  . MET B 1 185 ? 50.328 8.643   13.562 1.00 39.49  ? 185  MET B SD  1 
ATOM   3675 C CE  . MET B 1 185 ? 52.075 8.167   13.677 1.00 39.49  ? 185  MET B CE  1 
ATOM   3676 N N   . TRP B 1 186 ? 50.527 7.382   18.677 1.00 39.79  ? 186  TRP B N   1 
ATOM   3677 C CA  . TRP B 1 186 ? 51.175 6.713   19.788 1.00 39.79  ? 186  TRP B CA  1 
ATOM   3678 C C   . TRP B 1 186 ? 51.044 5.190   19.671 1.00 39.79  ? 186  TRP B C   1 
ATOM   3679 O O   . TRP B 1 186 ? 51.983 4.460   19.974 1.00 39.79  ? 186  TRP B O   1 
ATOM   3680 C CB  . TRP B 1 186 ? 50.561 7.180   21.109 1.00 30.16  ? 186  TRP B CB  1 
ATOM   3681 C CG  . TRP B 1 186 ? 51.047 6.408   22.287 1.00 30.16  ? 186  TRP B CG  1 
ATOM   3682 C CD1 . TRP B 1 186 ? 50.584 5.205   22.734 1.00 30.16  ? 186  TRP B CD1 1 
ATOM   3683 C CD2 . TRP B 1 186 ? 52.128 6.765   23.141 1.00 30.16  ? 186  TRP B CD2 1 
ATOM   3684 N NE1 . TRP B 1 186 ? 51.314 4.793   23.821 1.00 30.16  ? 186  TRP B NE1 1 
ATOM   3685 C CE2 . TRP B 1 186 ? 52.265 5.738   24.093 1.00 30.16  ? 186  TRP B CE2 1 
ATOM   3686 C CE3 . TRP B 1 186 ? 52.993 7.866   23.201 1.00 30.16  ? 186  TRP B CE3 1 
ATOM   3687 C CZ2 . TRP B 1 186 ? 53.240 5.774   25.094 1.00 30.16  ? 186  TRP B CZ2 1 
ATOM   3688 C CZ3 . TRP B 1 186 ? 53.960 7.903   24.196 1.00 30.16  ? 186  TRP B CZ3 1 
ATOM   3689 C CH2 . TRP B 1 186 ? 54.073 6.866   25.131 1.00 30.16  ? 186  TRP B CH2 1 
ATOM   3690 N N   . SER B 1 187 ? 49.879 4.709   19.246 1.00 36.22  ? 187  SER B N   1 
ATOM   3691 C CA  . SER B 1 187 ? 49.665 3.275   19.121 1.00 36.22  ? 187  SER B CA  1 
ATOM   3692 C C   . SER B 1 187 ? 50.546 2.700   18.041 1.00 36.22  ? 187  SER B C   1 
ATOM   3693 O O   . SER B 1 187 ? 51.065 1.594   18.178 1.00 36.22  ? 187  SER B O   1 
ATOM   3694 C CB  . SER B 1 187 ? 48.203 2.970   18.793 1.00 42.80  ? 187  SER B CB  1 
ATOM   3695 O OG  . SER B 1 187 ? 47.356 3.455   19.819 1.00 42.80  ? 187  SER B OG  1 
ATOM   3696 N N   . ALA B 1 188 ? 50.713 3.449   16.959 1.00 34.38  ? 188  ALA B N   1 
ATOM   3697 C CA  . ALA B 1 188 ? 51.542 2.996   15.853 1.00 34.38  ? 188  ALA B CA  1 
ATOM   3698 C C   . ALA B 1 188 ? 52.965 2.704   16.388 1.00 34.38  ? 188  ALA B C   1 
ATOM   3699 O O   . ALA B 1 188 ? 53.555 1.636   16.128 1.00 34.38  ? 188  ALA B O   1 
ATOM   3700 C CB  . ALA B 1 188 ? 51.576 4.074   14.773 1.00 36.35  ? 188  ALA B CB  1 
ATOM   3701 N N   . GLY B 1 189 ? 53.500 3.656   17.150 1.00 46.15  ? 189  GLY B N   1 
ATOM   3702 C CA  . GLY B 1 189 ? 54.820 3.487   17.725 1.00 46.15  ? 189  GLY B CA  1 
ATOM   3703 C C   . GLY B 1 189 ? 54.895 2.209   18.541 1.00 46.15  ? 189  GLY B C   1 
ATOM   3704 O O   . GLY B 1 189 ? 55.802 1.393   18.327 1.00 46.15  ? 189  GLY B O   1 
ATOM   3705 N N   . CYS B 1 190 ? 53.964 2.031   19.483 1.00 36.68  ? 190  CYS B N   1 
ATOM   3706 C CA  . CYS B 1 190 ? 53.959 0.813   20.295 1.00 36.68  ? 190  CYS B CA  1 
ATOM   3707 C C   . CYS B 1 190 ? 54.072 -0.378  19.331 1.00 36.68  ? 190  CYS B C   1 
ATOM   3708 O O   . CYS B 1 190 ? 54.928 -1.248  19.482 1.00 36.68  ? 190  CYS B O   1 
ATOM   3709 C CB  . CYS B 1 190 ? 52.658 0.683   21.095 1.00 36.56  ? 190  CYS B CB  1 
ATOM   3710 S SG  . CYS B 1 190 ? 52.458 1.848   22.466 1.00 36.56  ? 190  CYS B SG  1 
ATOM   3711 N N   . ILE B 1 191 ? 53.204 -0.407  18.327 1.00 34.01  ? 191  ILE B N   1 
ATOM   3712 C CA  . ILE B 1 191 ? 53.239 -1.491  17.379 1.00 34.01  ? 191  ILE B CA  1 
ATOM   3713 C C   . ILE B 1 191 ? 54.630 -1.584  16.733 1.00 34.01  ? 191  ILE B C   1 
ATOM   3714 O O   . ILE B 1 191 ? 55.166 -2.681  16.571 1.00 34.01  ? 191  ILE B O   1 
ATOM   3715 C CB  . ILE B 1 191 ? 52.120 -1.304  16.345 1.00 39.32  ? 191  ILE B CB  1 
ATOM   3716 C CG1 . ILE B 1 191 ? 50.783 -1.585  17.035 1.00 39.32  ? 191  ILE B CG1 1 
ATOM   3717 C CG2 . ILE B 1 191 ? 52.324 -2.221  15.150 1.00 39.32  ? 191  ILE B CG2 1 
ATOM   3718 C CD1 . ILE B 1 191 ? 49.571 -1.146  16.251 1.00 39.32  ? 191  ILE B CD1 1 
ATOM   3719 N N   . PHE B 1 192 ? 55.221 -0.445  16.387 1.00 32.03  ? 192  PHE B N   1 
ATOM   3720 C CA  . PHE B 1 192 ? 56.555 -0.446  15.784 1.00 32.03  ? 192  PHE B CA  1 
ATOM   3721 C C   . PHE B 1 192 ? 57.561 -1.120  16.738 1.00 32.03  ? 192  PHE B C   1 
ATOM   3722 O O   . PHE B 1 192 ? 58.371 -1.946  16.313 1.00 32.03  ? 192  PHE B O   1 
ATOM   3723 C CB  . PHE B 1 192 ? 56.996 0.992   15.471 1.00 45.40  ? 192  PHE B CB  1 
ATOM   3724 C CG  . PHE B 1 192 ? 58.322 1.091   14.748 1.00 45.40  ? 192  PHE B CG  1 
ATOM   3725 C CD1 . PHE B 1 192 ? 58.753 0.074   13.896 1.00 45.40  ? 192  PHE B CD1 1 
ATOM   3726 C CD2 . PHE B 1 192 ? 59.095 2.254   14.845 1.00 45.40  ? 192  PHE B CD2 1 
ATOM   3727 C CE1 . PHE B 1 192 ? 59.919 0.217   13.148 1.00 45.40  ? 192  PHE B CE1 1 
ATOM   3728 C CE2 . PHE B 1 192 ? 60.260 2.402   14.101 1.00 45.40  ? 192  PHE B CE2 1 
ATOM   3729 C CZ  . PHE B 1 192 ? 60.669 1.382   13.250 1.00 45.40  ? 192  PHE B CZ  1 
ATOM   3730 N N   . ALA B 1 193 ? 57.506 -0.764  18.020 1.00 36.51  ? 193  ALA B N   1 
ATOM   3731 C CA  . ALA B 1 193 ? 58.389 -1.380  18.999 1.00 36.51  ? 193  ALA B CA  1 
ATOM   3732 C C   . ALA B 1 193 ? 58.109 -2.886  19.033 1.00 36.51  ? 193  ALA B C   1 
ATOM   3733 O O   . ALA B 1 193 ? 59.024 -3.702  19.115 1.00 36.51  ? 193  ALA B O   1 
ATOM   3734 C CB  . ALA B 1 193 ? 58.163 -0.773  20.394 1.00 29.73  ? 193  ALA B CB  1 
ATOM   3735 N N   . GLU B 1 194 ? 56.838 -3.255  18.973 1.00 54.29  ? 194  GLU B N   1 
ATOM   3736 C CA  . GLU B 1 194 ? 56.466 -4.658  19.001 1.00 54.29  ? 194  GLU B CA  1 
ATOM   3737 C C   . GLU B 1 194 ? 57.048 -5.331  17.754 1.00 54.29  ? 194  GLU B C   1 
ATOM   3738 O O   . GLU B 1 194 ? 57.576 -6.444  17.813 1.00 54.29  ? 194  GLU B O   1 
ATOM   3739 C CB  . GLU B 1 194 ? 54.938 -4.784  19.023 1.00 47.48  ? 194  GLU B CB  1 
ATOM   3740 C CG  . GLU B 1 194 ? 54.429 -6.044  19.706 1.00 47.48  ? 194  GLU B CG  1 
ATOM   3741 C CD  . GLU B 1 194 ? 52.944 -5.986  20.034 1.00 47.48  ? 194  GLU B CD  1 
ATOM   3742 O OE1 . GLU B 1 194 ? 52.508 -4.989  20.659 1.00 47.48  ? 194  GLU B OE1 1 
ATOM   3743 O OE2 . GLU B 1 194 ? 52.223 -6.946  19.676 1.00 47.48  ? 194  GLU B OE2 1 
ATOM   3744 N N   . LEU B 1 195 ? 56.963 -4.631  16.631 1.00 47.05  ? 195  LEU B N   1 
ATOM   3745 C CA  . LEU B 1 195 ? 57.462 -5.137  15.370 1.00 47.05  ? 195  LEU B CA  1 
ATOM   3746 C C   . LEU B 1 195 ? 58.958 -5.423  15.405 1.00 47.05  ? 195  LEU B C   1 
ATOM   3747 O O   . LEU B 1 195 ? 59.384 -6.524  15.066 1.00 47.05  ? 195  LEU B O   1 
ATOM   3748 C CB  . LEU B 1 195 ? 57.165 -4.127  14.259 1.00 33.82  ? 195  LEU B CB  1 
ATOM   3749 C CG  . LEU B 1 195 ? 56.352 -4.523  13.010 1.00 33.82  ? 195  LEU B CG  1 
ATOM   3750 C CD1 . LEU B 1 195 ? 55.499 -5.757  13.239 1.00 33.82  ? 195  LEU B CD1 1 
ATOM   3751 C CD2 . LEU B 1 195 ? 55.472 -3.347  12.634 1.00 33.82  ? 195  LEU B CD2 1 
ATOM   3752 N N   . ALA B 1 196 ? 59.753 -4.446  15.835 1.00 60.38  ? 196  ALA B N   1 
ATOM   3753 C CA  . ALA B 1 196 ? 61.206 -4.591  15.850 1.00 60.38  ? 196  ALA B CA  1 
ATOM   3754 C C   . ALA B 1 196 ? 61.854 -5.480  16.905 1.00 60.38  ? 196  ALA B C   1 
ATOM   3755 O O   . ALA B 1 196 ? 62.793 -6.207  16.590 1.00 60.38  ? 196  ALA B O   1 
ATOM   3756 C CB  . ALA B 1 196 ? 61.849 -3.219  15.881 1.00 50.01  ? 196  ALA B CB  1 
ATOM   3757 N N   . ASN B 1 197 ? 61.402 -5.425  18.153 1.00 65.83  ? 197  ASN B N   1 
ATOM   3758 C CA  . ASN B 1 197 ? 62.020 -6.280  19.156 1.00 65.83  ? 197  ASN B CA  1 
ATOM   3759 C C   . ASN B 1 197 ? 61.653 -7.717  18.827 1.00 65.83  ? 197  ASN B C   1 
ATOM   3760 O O   . ASN B 1 197 ? 62.179 -8.274  17.865 1.00 65.83  ? 197  ASN B O   1 
ATOM   3761 C CB  . ASN B 1 197 ? 61.568 -5.910  20.570 1.00 79.56  ? 197  ASN B CB  1 
ATOM   3762 C CG  . ASN B 1 197 ? 62.207 -6.792  21.641 1.00 54.38  ? 197  ASN B CG  1 
ATOM   3763 O OD1 . ASN B 1 197 ? 63.418 -7.026  21.650 1.00 54.38  ? 197  ASN B OD1 1 
ATOM   3764 N ND2 . ASN B 1 197 ? 61.387 -7.281  22.554 1.00 54.38  ? 197  ASN B ND2 1 
ATOM   3765 N N   . ALA B 1 198 ? 60.749 -8.323  19.586 1.00 63.08  ? 198  ALA B N   1 
ATOM   3766 C CA  . ALA B 1 198 ? 60.394 -9.706  19.302 1.00 63.08  ? 198  ALA B CA  1 
ATOM   3767 C C   . ALA B 1 198 ? 58.901 -9.980  19.300 1.00 63.08  ? 198  ALA B C   1 
ATOM   3768 O O   . ALA B 1 198 ? 58.447 -11.015 19.795 1.00 63.08  ? 198  ALA B O   1 
ATOM   3769 C CB  . ALA B 1 198 ? 61.095 -10.642 20.293 1.00 34.73  ? 198  ALA B CB  1 
ATOM   3770 N N   . ALA B 1 199 ? 58.131 -9.050  18.755 1.00 47.00  ? 199  ALA B N   1 
ATOM   3771 C CA  . ALA B 1 199 ? 56.697 -9.252  18.677 1.00 47.00  ? 199  ALA B CA  1 
ATOM   3772 C C   . ALA B 1 199 ? 55.995 -9.228  20.026 1.00 47.00  ? 199  ALA B C   1 
ATOM   3773 O O   . ALA B 1 199 ? 54.831 -9.613  20.120 1.00 47.00  ? 199  ALA B O   1 
ATOM   3774 C CB  . ALA B 1 199 ? 56.425 -10.567 17.994 1.00 114.79 ? 199  ALA B CB  1 
ATOM   3775 N N   . ARG B 1 200 ? 56.693 -8.807  21.075 1.00 44.40  ? 200  ARG B N   1 
ATOM   3776 C CA  . ARG B 1 200 ? 56.077 -8.745  22.390 1.00 44.40  ? 200  ARG B CA  1 
ATOM   3777 C C   . ARG B 1 200 ? 55.737 -7.300  22.733 1.00 44.40  ? 200  ARG B C   1 
ATOM   3778 O O   . ARG B 1 200 ? 56.497 -6.378  22.444 1.00 44.40  ? 200  ARG B O   1 
ATOM   3779 C CB  . ARG B 1 200 ? 57.009 -9.361  23.431 1.00 49.89  ? 200  ARG B CB  1 
ATOM   3780 C CG  . ARG B 1 200 ? 57.155 -10.894 23.299 1.00 49.89  ? 200  ARG B CG  1 
ATOM   3781 C CD  . ARG B 1 200 ? 55.868 -11.656 23.669 1.00 49.89  ? 200  ARG B CD  1 
ATOM   3782 N NE  . ARG B 1 200 ? 55.950 -13.072 23.299 1.00 49.89  ? 200  ARG B NE  1 
ATOM   3783 C CZ  . ARG B 1 200 ? 54.949 -13.952 23.383 1.00 49.89  ? 200  ARG B CZ  1 
ATOM   3784 N NH1 . ARG B 1 200 ? 53.756 -13.589 23.834 1.00 49.89  ? 200  ARG B NH1 1 
ATOM   3785 N NH2 . ARG B 1 200 ? 55.138 -15.204 22.991 1.00 49.89  ? 200  ARG B NH2 1 
ATOM   3786 N N   . PRO B 1 201 ? 54.566 -7.075  23.335 1.00 36.88  ? 201  PRO B N   1 
ATOM   3787 C CA  . PRO B 1 201 ? 54.147 -5.721  23.703 1.00 36.88  ? 201  PRO B CA  1 
ATOM   3788 C C   . PRO B 1 201 ? 55.207 -4.920  24.461 1.00 36.88  ? 201  PRO B C   1 
ATOM   3789 O O   . PRO B 1 201 ? 55.861 -5.447  25.359 1.00 36.88  ? 201  PRO B O   1 
ATOM   3790 C CB  . PRO B 1 201 ? 52.902 -5.972  24.549 1.00 60.26  ? 201  PRO B CB  1 
ATOM   3791 C CG  . PRO B 1 201 ? 52.318 -7.184  23.909 1.00 54.57  ? 201  PRO B CG  1 
ATOM   3792 C CD  . PRO B 1 201 ? 53.526 -8.061  23.680 1.00 54.57  ? 201  PRO B CD  1 
ATOM   3793 N N   . LEU B 1 202 ? 55.353 -3.643  24.104 1.00 38.16  ? 202  LEU B N   1 
ATOM   3794 C CA  . LEU B 1 202 ? 56.308 -2.762  24.757 1.00 38.16  ? 202  LEU B CA  1 
ATOM   3795 C C   . LEU B 1 202 ? 55.844 -2.332  26.133 1.00 38.16  ? 202  LEU B C   1 
ATOM   3796 O O   . LEU B 1 202 ? 56.657 -2.158  27.014 1.00 38.16  ? 202  LEU B O   1 
ATOM   3797 C CB  . LEU B 1 202 ? 56.565 -1.497  23.926 1.00 26.33  ? 202  LEU B CB  1 
ATOM   3798 C CG  . LEU B 1 202 ? 57.561 -0.493  24.557 1.00 26.33  ? 202  LEU B CG  1 
ATOM   3799 C CD1 . LEU B 1 202 ? 58.822 -1.237  24.982 1.00 26.33  ? 202  LEU B CD1 1 
ATOM   3800 C CD2 . LEU B 1 202 ? 57.925 0.597   23.577 1.00 26.33  ? 202  LEU B CD2 1 
ATOM   3801 N N   . PHE B 1 203 ? 54.542 -2.154  26.324 1.00 46.42  ? 203  PHE B N   1 
ATOM   3802 C CA  . PHE B 1 203 ? 54.017 -1.709  27.620 1.00 46.42  ? 203  PHE B CA  1 
ATOM   3803 C C   . PHE B 1 203 ? 52.796 -2.520  28.058 1.00 46.42  ? 203  PHE B C   1 
ATOM   3804 O O   . PHE B 1 203 ? 51.666 -2.059  27.929 1.00 46.42  ? 203  PHE B O   1 
ATOM   3805 C CB  . PHE B 1 203 ? 53.620 -0.234  27.529 1.00 39.84  ? 203  PHE B CB  1 
ATOM   3806 C CG  . PHE B 1 203 ? 54.749 0.690   27.148 1.00 39.84  ? 203  PHE B CG  1 
ATOM   3807 C CD1 . PHE B 1 203 ? 55.907 0.767   27.928 1.00 39.84  ? 203  PHE B CD1 1 
ATOM   3808 C CD2 . PHE B 1 203 ? 54.628 1.542   26.054 1.00 39.84  ? 203  PHE B CD2 1 
ATOM   3809 C CE1 . PHE B 1 203 ? 56.922 1.686   27.625 1.00 39.84  ? 203  PHE B CE1 1 
ATOM   3810 C CE2 . PHE B 1 203 ? 55.639 2.465   25.746 1.00 39.84  ? 203  PHE B CE2 1 
ATOM   3811 C CZ  . PHE B 1 203 ? 56.786 2.536   26.536 1.00 39.84  ? 203  PHE B CZ  1 
ATOM   3812 N N   . PRO B 1 204 ? 53.008 -3.723  28.606 1.00 32.71  ? 204  PRO B N   1 
ATOM   3813 C CA  . PRO B 1 204 ? 51.913 -4.602  29.056 1.00 32.71  ? 204  PRO B CA  1 
ATOM   3814 C C   . PRO B 1 204 ? 51.419 -4.446  30.506 1.00 32.71  ? 204  PRO B C   1 
ATOM   3815 O O   . PRO B 1 204 ? 51.421 -5.411  31.286 1.00 32.71  ? 204  PRO B O   1 
ATOM   3816 C CB  . PRO B 1 204 ? 52.490 -5.994  28.800 1.00 43.72  ? 204  PRO B CB  1 
ATOM   3817 C CG  . PRO B 1 204 ? 53.945 -5.801  29.234 1.00 43.72  ? 204  PRO B CG  1 
ATOM   3818 C CD  . PRO B 1 204 ? 54.304 -4.436  28.619 1.00 43.72  ? 204  PRO B CD  1 
ATOM   3819 N N   . GLY B 1 205 ? 50.965 -3.252  30.858 1.00 39.12  ? 205  GLY B N   1 
ATOM   3820 C CA  . GLY B 1 205 ? 50.506 -3.018  32.215 1.00 39.12  ? 205  GLY B CA  1 
ATOM   3821 C C   . GLY B 1 205 ? 49.362 -3.882  32.731 1.00 39.12  ? 205  GLY B C   1 
ATOM   3822 O O   . GLY B 1 205 ? 48.589 -4.458  31.955 1.00 39.12  ? 205  GLY B O   1 
ATOM   3823 N N   . ASN B 1 206 ? 49.249 -3.952  34.057 1.00 46.66  ? 206  ASN B N   1 
ATOM   3824 C CA  . ASN B 1 206 ? 48.209 -4.731  34.719 1.00 46.66  ? 206  ASN B CA  1 
ATOM   3825 C C   . ASN B 1 206 ? 46.957 -3.865  34.890 1.00 46.66  ? 206  ASN B C   1 
ATOM   3826 O O   . ASN B 1 206 ? 45.850 -4.372  35.104 1.00 46.66  ? 206  ASN B O   1 
ATOM   3827 C CB  . ASN B 1 206 ? 48.711 -5.206  36.081 1.00 91.16  ? 206  ASN B CB  1 
ATOM   3828 C CG  . ASN B 1 206 ? 50.057 -5.914  35.995 1.00 91.16  ? 206  ASN B CG  1 
ATOM   3829 O OD1 . ASN B 1 206 ? 50.594 -6.364  37.004 1.00 91.16  ? 206  ASN B OD1 1 
ATOM   3830 N ND2 . ASN B 1 206 ? 50.606 -6.012  34.789 1.00 91.16  ? 206  ASN B ND2 1 
ATOM   3831 N N   . ASP B 1 207 ? 47.151 -2.552  34.782 1.00 45.74  ? 207  ASP B N   1 
ATOM   3832 C CA  . ASP B 1 207 ? 46.073 -1.579  34.902 1.00 45.74  ? 207  ASP B CA  1 
ATOM   3833 C C   . ASP B 1 207 ? 46.563 -0.190  34.483 1.00 45.74  ? 207  ASP B C   1 
ATOM   3834 O O   . ASP B 1 207 ? 47.742 -0.020  34.148 1.00 45.74  ? 207  ASP B O   1 
ATOM   3835 C CB  . ASP B 1 207 ? 45.541 -1.549  36.341 1.00 54.50  ? 207  ASP B CB  1 
ATOM   3836 C CG  . ASP B 1 207 ? 46.626 -1.290  37.368 1.00 54.50  ? 207  ASP B CG  1 
ATOM   3837 O OD1 . ASP B 1 207 ? 47.296 -0.234  37.302 1.00 54.50  ? 207  ASP B OD1 1 
ATOM   3838 O OD2 . ASP B 1 207 ? 46.802 -2.150  38.250 1.00 54.50  ? 207  ASP B OD2 1 
ATOM   3839 N N   . VAL B 1 208 ? 45.662 0.793   34.503 1.00 42.32  ? 208  VAL B N   1 
ATOM   3840 C CA  . VAL B 1 208 ? 45.990 2.159   34.107 1.00 42.32  ? 208  VAL B CA  1 
ATOM   3841 C C   . VAL B 1 208 ? 47.201 2.710   34.844 1.00 42.32  ? 208  VAL B C   1 
ATOM   3842 O O   . VAL B 1 208 ? 48.063 3.360   34.242 1.00 42.32  ? 208  VAL B O   1 
ATOM   3843 C CB  . VAL B 1 208 ? 44.798 3.109   34.349 1.00 29.46  ? 208  VAL B CB  1 
ATOM   3844 C CG1 . VAL B 1 208 ? 45.244 4.570   34.196 1.00 29.46  ? 208  VAL B CG1 1 
ATOM   3845 C CG2 . VAL B 1 208 ? 43.664 2.774   33.362 1.00 29.46  ? 208  VAL B CG2 1 
ATOM   3846 N N   . ASP B 1 209 ? 47.245 2.461   36.152 1.00 35.17  ? 209  ASP B N   1 
ATOM   3847 C CA  . ASP B 1 209 ? 48.344 2.907   37.004 1.00 35.17  ? 209  ASP B CA  1 
ATOM   3848 C C   . ASP B 1 209 ? 49.619 2.177   36.562 1.00 35.17  ? 209  ASP B C   1 
ATOM   3849 O O   . ASP B 1 209 ? 50.617 2.808   36.197 1.00 35.17  ? 209  ASP B O   1 
ATOM   3850 C CB  . ASP B 1 209 ? 48.013 2.593   38.472 1.00 48.04  ? 209  ASP B CB  1 
ATOM   3851 C CG  . ASP B 1 209 ? 49.200 2.789   39.407 1.00 48.04  ? 209  ASP B CG  1 
ATOM   3852 O OD1 . ASP B 1 209 ? 49.514 1.846   40.167 1.00 48.04  ? 209  ASP B OD1 1 
ATOM   3853 O OD2 . ASP B 1 209 ? 49.820 3.876   39.402 1.00 48.04  ? 209  ASP B OD2 1 
ATOM   3854 N N   . ASP B 1 210 ? 49.581 0.849   36.564 1.00 47.91  ? 210  ASP B N   1 
ATOM   3855 C CA  . ASP B 1 210 ? 50.748 0.074   36.155 1.00 47.91  ? 210  ASP B CA  1 
ATOM   3856 C C   . ASP B 1 210 ? 51.176 0.435   34.735 1.00 47.91  ? 210  ASP B C   1 
ATOM   3857 O O   . ASP B 1 210 ? 52.357 0.427   34.405 1.00 47.91  ? 210  ASP B O   1 
ATOM   3858 C CB  . ASP B 1 210 ? 50.451 -1.417  36.227 1.00 55.38  ? 210  ASP B CB  1 
ATOM   3859 C CG  . ASP B 1 210 ? 51.667 -2.253  35.929 1.00 55.38  ? 210  ASP B CG  1 
ATOM   3860 O OD1 . ASP B 1 210 ? 52.712 -1.997  36.567 1.00 55.38  ? 210  ASP B OD1 1 
ATOM   3861 O OD2 . ASP B 1 210 ? 51.580 -3.159  35.062 1.00 55.38  ? 210  ASP B OD2 1 
ATOM   3862 N N   . GLN B 1 211 ? 50.197 0.755   33.901 1.00 40.90  ? 211  GLN B N   1 
ATOM   3863 C CA  . GLN B 1 211 ? 50.459 1.118   32.523 1.00 40.90  ? 211  GLN B CA  1 
ATOM   3864 C C   . GLN B 1 211 ? 51.312 2.389   32.483 1.00 40.90  ? 211  GLN B C   1 
ATOM   3865 O O   . GLN B 1 211 ? 52.355 2.444   31.823 1.00 40.90  ? 211  GLN B O   1 
ATOM   3866 C CB  . GLN B 1 211 ? 49.127 1.344   31.801 1.00 43.57  ? 211  GLN B CB  1 
ATOM   3867 C CG  . GLN B 1 211 ? 49.232 1.462   30.293 1.00 43.57  ? 211  GLN B CG  1 
ATOM   3868 C CD  . GLN B 1 211 ? 49.867 0.238   29.665 1.00 43.57  ? 211  GLN B CD  1 
ATOM   3869 O OE1 . GLN B 1 211 ? 49.606 -0.892  30.092 1.00 43.57  ? 211  GLN B OE1 1 
ATOM   3870 N NE2 . GLN B 1 211 ? 50.697 0.451   28.639 1.00 43.57  ? 211  GLN B NE2 1 
ATOM   3871 N N   . LEU B 1 212 ? 50.872 3.414   33.194 1.00 51.51  ? 212  LEU B N   1 
ATOM   3872 C CA  . LEU B 1 212 ? 51.615 4.656   33.208 1.00 51.51  ? 212  LEU B CA  1 
ATOM   3873 C C   . LEU B 1 212 ? 53.048 4.462   33.722 1.00 51.51  ? 212  LEU B C   1 
ATOM   3874 O O   . LEU B 1 212 ? 53.992 5.043   33.181 1.00 51.51  ? 212  LEU B O   1 
ATOM   3875 C CB  . LEU B 1 212 ? 50.864 5.695   34.046 1.00 36.78  ? 212  LEU B CB  1 
ATOM   3876 C CG  . LEU B 1 212 ? 49.664 6.343   33.333 1.00 36.78  ? 212  LEU B CG  1 
ATOM   3877 C CD1 . LEU B 1 212 ? 48.763 7.047   34.341 1.00 36.78  ? 212  LEU B CD1 1 
ATOM   3878 C CD2 . LEU B 1 212 ? 50.170 7.326   32.293 1.00 36.78  ? 212  LEU B CD2 1 
ATOM   3879 N N   . LYS B 1 213 ? 53.217 3.635   34.748 1.00 49.29  ? 213  LYS B N   1 
ATOM   3880 C CA  . LYS B 1 213 ? 54.548 3.404   35.290 1.00 49.29  ? 213  LYS B CA  1 
ATOM   3881 C C   . LYS B 1 213 ? 55.477 2.802   34.252 1.00 49.29  ? 213  LYS B C   1 
ATOM   3882 O O   . LYS B 1 213 ? 56.566 3.331   33.993 1.00 49.29  ? 213  LYS B O   1 
ATOM   3883 C CB  . LYS B 1 213 ? 54.492 2.474   36.502 1.00 55.92  ? 213  LYS B CB  1 
ATOM   3884 C CG  . LYS B 1 213 ? 53.939 3.117   37.757 1.00 55.92  ? 213  LYS B CG  1 
ATOM   3885 C CD  . LYS B 1 213 ? 53.911 2.116   38.883 1.00 55.92  ? 213  LYS B CD  1 
ATOM   3886 C CE  . LYS B 1 213 ? 52.886 2.489   39.932 1.00 55.92  ? 213  LYS B CE  1 
ATOM   3887 N NZ  . LYS B 1 213 ? 52.420 1.244   40.599 1.00 55.92  ? 213  LYS B NZ  1 
ATOM   3888 N N   . ARG B 1 214 ? 55.044 1.695   33.659 1.00 45.54  ? 214  ARG B N   1 
ATOM   3889 C CA  . ARG B 1 214 ? 55.853 1.019   32.665 1.00 45.54  ? 214  ARG B CA  1 
ATOM   3890 C C   . ARG B 1 214 ? 56.305 2.008   31.603 1.00 45.54  ? 214  ARG B C   1 
ATOM   3891 O O   . ARG B 1 214 ? 57.474 2.017   31.211 1.00 45.54  ? 214  ARG B O   1 
ATOM   3892 C CB  . ARG B 1 214 ? 55.059 -0.119  32.033 1.00 65.31  ? 214  ARG B CB  1 
ATOM   3893 C CG  . ARG B 1 214 ? 54.457 -1.044  33.064 1.00 65.31  ? 214  ARG B CG  1 
ATOM   3894 C CD  . ARG B 1 214 ? 53.772 -2.230  32.422 1.00 65.31  ? 214  ARG B CD  1 
ATOM   3895 N NE  . ARG B 1 214 ? 54.665 -3.378  32.292 1.00 65.31  ? 214  ARG B NE  1 
ATOM   3896 C CZ  . ARG B 1 214 ? 54.582 -4.469  33.047 1.00 65.31  ? 214  ARG B CZ  1 
ATOM   3897 N NH1 . ARG B 1 214 ? 53.649 -4.557  33.986 1.00 65.31  ? 214  ARG B NH1 1 
ATOM   3898 N NH2 . ARG B 1 214 ? 55.421 -5.475  32.849 1.00 65.31  ? 214  ARG B NH2 1 
ATOM   3899 N N   . ILE B 1 215 ? 55.379 2.851   31.159 1.00 46.26  ? 215  ILE B N   1 
ATOM   3900 C CA  . ILE B 1 215 ? 55.672 3.852   30.141 1.00 46.26  ? 215  ILE B CA  1 
ATOM   3901 C C   . ILE B 1 215 ? 56.750 4.820   30.619 1.00 46.26  ? 215  ILE B C   1 
ATOM   3902 O O   . ILE B 1 215 ? 57.764 5.018   29.944 1.00 46.26  ? 215  ILE B O   1 
ATOM   3903 C CB  . ILE B 1 215 ? 54.407 4.671   29.783 1.00 40.75  ? 215  ILE B CB  1 
ATOM   3904 C CG1 . ILE B 1 215 ? 53.360 3.760   29.130 1.00 40.75  ? 215  ILE B CG1 1 
ATOM   3905 C CG2 . ILE B 1 215 ? 54.761 5.810   28.833 1.00 40.75  ? 215  ILE B CG2 1 
ATOM   3906 C CD1 . ILE B 1 215 ? 52.071 4.476   28.748 1.00 40.75  ? 215  ILE B CD1 1 
ATOM   3907 N N   . PHE B 1 216 ? 56.521 5.415   31.786 1.00 47.18  ? 216  PHE B N   1 
ATOM   3908 C CA  . PHE B 1 216 ? 57.450 6.388   32.342 1.00 47.18  ? 216  PHE B CA  1 
ATOM   3909 C C   . PHE B 1 216 ? 58.775 5.796   32.803 1.00 47.18  ? 216  PHE B C   1 
ATOM   3910 O O   . PHE B 1 216 ? 59.789 6.481   32.776 1.00 47.18  ? 216  PHE B O   1 
ATOM   3911 C CB  . PHE B 1 216 ? 56.808 7.149   33.507 1.00 50.93  ? 216  PHE B CB  1 
ATOM   3912 C CG  . PHE B 1 216 ? 55.577 7.932   33.130 1.00 50.93  ? 216  PHE B CG  1 
ATOM   3913 C CD1 . PHE B 1 216 ? 55.281 8.206   31.799 1.00 50.93  ? 216  PHE B CD1 1 
ATOM   3914 C CD2 . PHE B 1 216 ? 54.727 8.426   34.120 1.00 50.93  ? 216  PHE B CD2 1 
ATOM   3915 C CE1 . PHE B 1 216 ? 54.160 8.961   31.454 1.00 50.93  ? 216  PHE B CE1 1 
ATOM   3916 C CE2 . PHE B 1 216 ? 53.602 9.184   33.782 1.00 50.93  ? 216  PHE B CE2 1 
ATOM   3917 C CZ  . PHE B 1 216 ? 53.322 9.450   32.448 1.00 50.93  ? 216  PHE B CZ  1 
ATOM   3918 N N   . ARG B 1 217 ? 58.775 4.536   33.221 1.00 58.37  ? 217  ARG B N   1 
ATOM   3919 C CA  . ARG B 1 217 ? 60.008 3.907   33.671 1.00 58.37  ? 217  ARG B CA  1 
ATOM   3920 C C   . ARG B 1 217 ? 60.991 3.758   32.521 1.00 58.37  ? 217  ARG B C   1 
ATOM   3921 O O   . ARG B 1 217 ? 62.201 3.670   32.733 1.00 58.37  ? 217  ARG B O   1 
ATOM   3922 C CB  . ARG B 1 217 ? 59.722 2.539   34.288 1.00 86.51  ? 217  ARG B CB  1 
ATOM   3923 C CG  . ARG B 1 217 ? 59.038 2.615   35.635 1.00 86.51  ? 217  ARG B CG  1 
ATOM   3924 C CD  . ARG B 1 217 ? 58.693 1.243   36.173 1.00 86.51  ? 217  ARG B CD  1 
ATOM   3925 N NE  . ARG B 1 217 ? 57.933 1.338   37.415 1.00 86.51  ? 217  ARG B NE  1 
ATOM   3926 C CZ  . ARG B 1 217 ? 57.312 0.312   37.990 1.00 86.51  ? 217  ARG B CZ  1 
ATOM   3927 N NH1 . ARG B 1 217 ? 57.362 -0.890  37.430 1.00 86.51  ? 217  ARG B NH1 1 
ATOM   3928 N NH2 . ARG B 1 217 ? 56.638 0.485   39.122 1.00 86.51  ? 217  ARG B NH2 1 
ATOM   3929 N N   . LEU B 1 218 ? 60.477 3.740   31.300 1.00 54.35  ? 218  LEU B N   1 
ATOM   3930 C CA  . LEU B 1 218 ? 61.329 3.597   30.126 1.00 54.35  ? 218  LEU B CA  1 
ATOM   3931 C C   . LEU B 1 218 ? 61.585 4.918   29.424 1.00 54.35  ? 218  LEU B C   1 
ATOM   3932 O O   . LEU B 1 218 ? 62.715 5.211   29.040 1.00 54.35  ? 218  LEU B O   1 
ATOM   3933 C CB  . LEU B 1 218 ? 60.696 2.639   29.120 1.00 62.78  ? 218  LEU B CB  1 
ATOM   3934 C CG  . LEU B 1 218 ? 61.374 2.616   27.745 1.00 62.78  ? 218  LEU B CG  1 
ATOM   3935 C CD1 . LEU B 1 218 ? 62.619 1.749   27.818 1.00 62.78  ? 218  LEU B CD1 1 
ATOM   3936 C CD2 . LEU B 1 218 ? 60.414 2.077   26.689 1.00 62.78  ? 218  LEU B CD2 1 
ATOM   3937 N N   . LEU B 1 219 ? 60.526 5.702   29.238 1.00 47.12  ? 219  LEU B N   1 
ATOM   3938 C CA  . LEU B 1 219 ? 60.637 6.983   28.550 1.00 47.12  ? 219  LEU B CA  1 
ATOM   3939 C C   . LEU B 1 219 ? 60.916 8.145   29.473 1.00 47.12  ? 219  LEU B C   1 
ATOM   3940 O O   . LEU B 1 219 ? 61.198 9.244   29.012 1.00 47.12  ? 219  LEU B O   1 
ATOM   3941 C CB  . LEU B 1 219 ? 59.359 7.284   27.753 1.00 55.83  ? 219  LEU B CB  1 
ATOM   3942 C CG  . LEU B 1 219 ? 59.118 6.699   26.356 1.00 55.83  ? 219  LEU B CG  1 
ATOM   3943 C CD1 . LEU B 1 219 ? 59.254 5.189   26.359 1.00 55.83  ? 219  LEU B CD1 1 
ATOM   3944 C CD2 . LEU B 1 219 ? 57.719 7.099   25.909 1.00 55.83  ? 219  LEU B CD2 1 
ATOM   3945 N N   . GLY B 1 220 ? 60.830 7.911   30.774 1.00 49.88  ? 220  GLY B N   1 
ATOM   3946 C CA  . GLY B 1 220 ? 61.074 8.978   31.727 1.00 49.88  ? 220  GLY B CA  1 
ATOM   3947 C C   . GLY B 1 220 ? 59.831 9.804   31.979 1.00 49.88  ? 220  GLY B C   1 
ATOM   3948 O O   . GLY B 1 220 ? 59.167 10.243  31.038 1.00 49.88  ? 220  GLY B O   1 
ATOM   3949 N N   . THR B 1 221 ? 59.521 10.022  33.252 1.00 49.61  ? 221  THR B N   1 
ATOM   3950 C CA  . THR B 1 221 ? 58.347 10.789  33.649 1.00 49.61  ? 221  THR B CA  1 
ATOM   3951 C C   . THR B 1 221 ? 58.389 12.221  33.131 1.00 49.61  ? 221  THR B C   1 
ATOM   3952 O O   . THR B 1 221 ? 59.316 12.959  33.427 1.00 49.61  ? 221  THR B O   1 
ATOM   3953 C CB  . THR B 1 221 ? 58.220 10.824  35.168 1.00 42.70  ? 221  THR B CB  1 
ATOM   3954 O OG1 . THR B 1 221 ? 58.230 9.481   35.676 1.00 42.70  ? 221  THR B OG1 1 
ATOM   3955 C CG2 . THR B 1 221 ? 56.919 11.515  35.573 1.00 42.70  ? 221  THR B CG2 1 
ATOM   3956 N N   . PRO B 1 222 ? 57.362 12.636  32.371 1.00 51.14  ? 222  PRO B N   1 
ATOM   3957 C CA  . PRO B 1 222 ? 57.220 13.971  31.771 1.00 51.14  ? 222  PRO B CA  1 
ATOM   3958 C C   . PRO B 1 222 ? 57.262 15.142  32.752 1.00 51.14  ? 222  PRO B C   1 
ATOM   3959 O O   . PRO B 1 222 ? 56.715 15.063  33.854 1.00 51.14  ? 222  PRO B O   1 
ATOM   3960 C CB  . PRO B 1 222 ? 55.861 13.899  31.070 1.00 86.31  ? 222  PRO B CB  1 
ATOM   3961 C CG  . PRO B 1 222 ? 55.639 12.437  30.851 1.00 86.31  ? 222  PRO B CG  1 
ATOM   3962 C CD  . PRO B 1 222 ? 56.150 11.834  32.126 1.00 86.31  ? 222  PRO B CD  1 
ATOM   3963 N N   . THR B 1 223 ? 57.899 16.235  32.345 1.00 72.97  ? 223  THR B N   1 
ATOM   3964 C CA  . THR B 1 223 ? 57.954 17.412  33.204 1.00 72.97  ? 223  THR B CA  1 
ATOM   3965 C C   . THR B 1 223 ? 56.899 18.395  32.726 1.00 72.97  ? 223  THR B C   1 
ATOM   3966 O O   . THR B 1 223 ? 56.550 18.429  31.542 1.00 72.97  ? 223  THR B O   1 
ATOM   3967 C CB  . THR B 1 223 ? 59.337 18.119  33.176 1.00 63.20  ? 223  THR B CB  1 
ATOM   3968 O OG1 . THR B 1 223 ? 59.613 18.598  31.853 1.00 63.20  ? 223  THR B OG1 1 
ATOM   3969 C CG2 . THR B 1 223 ? 60.438 17.161  33.617 1.00 63.20  ? 223  THR B CG2 1 
ATOM   3970 N N   . GLU B 1 224 ? 56.391 19.193  33.654 1.00 83.37  ? 224  GLU B N   1 
ATOM   3971 C CA  . GLU B 1 224 ? 55.370 20.174  33.337 1.00 83.37  ? 224  GLU B CA  1 
ATOM   3972 C C   . GLU B 1 224 ? 55.854 21.158  32.271 1.00 83.37  ? 224  GLU B C   1 
ATOM   3973 O O   . GLU B 1 224 ? 55.059 21.895  31.684 1.00 83.37  ? 224  GLU B O   1 
ATOM   3974 C CB  . GLU B 1 224 ? 54.965 20.904  34.618 1.00 150.88 ? 224  GLU B CB  1 
ATOM   3975 C CG  . GLU B 1 224 ? 54.267 19.996  35.628 1.00 150.88 ? 224  GLU B CG  1 
ATOM   3976 C CD  . GLU B 1 224 ? 54.148 20.626  37.000 1.00 150.88 ? 224  GLU B CD  1 
ATOM   3977 O OE1 . GLU B 1 224 ? 54.048 21.869  37.070 1.00 150.88 ? 224  GLU B OE1 1 
ATOM   3978 O OE2 . GLU B 1 224 ? 54.142 19.879  38.004 1.00 150.88 ? 224  GLU B OE2 1 
ATOM   3979 N N   . GLU B 1 225 ? 57.160 21.152  32.017 1.00 65.19  ? 225  GLU B N   1 
ATOM   3980 C CA  . GLU B 1 225 ? 57.751 22.034  31.015 1.00 65.19  ? 225  GLU B CA  1 
ATOM   3981 C C   . GLU B 1 225 ? 57.662 21.426  29.618 1.00 65.19  ? 225  GLU B C   1 
ATOM   3982 O O   . GLU B 1 225 ? 57.363 22.122  28.649 1.00 65.19  ? 225  GLU B O   1 
ATOM   3983 C CB  . GLU B 1 225 ? 59.212 22.327  31.366 1.00 167.46 ? 225  GLU B CB  1 
ATOM   3984 C CG  . GLU B 1 225 ? 59.380 23.394  32.435 1.00 167.46 ? 225  GLU B CG  1 
ATOM   3985 C CD  . GLU B 1 225 ? 60.776 23.418  33.030 1.00 167.46 ? 225  GLU B CD  1 
ATOM   3986 O OE1 . GLU B 1 225 ? 61.752 23.578  32.264 1.00 167.46 ? 225  GLU B OE1 1 
ATOM   3987 O OE2 . GLU B 1 225 ? 60.892 23.277  34.269 1.00 167.46 ? 225  GLU B OE2 1 
ATOM   3988 N N   . GLN B 1 226 ? 57.919 20.124  29.527 1.00 71.24  ? 226  GLN B N   1 
ATOM   3989 C CA  . GLN B 1 226 ? 57.868 19.398  28.259 1.00 71.24  ? 226  GLN B CA  1 
ATOM   3990 C C   . GLN B 1 226 ? 56.411 19.066  27.912 1.00 71.24  ? 226  GLN B C   1 
ATOM   3991 O O   . GLN B 1 226 ? 56.092 18.703  26.775 1.00 71.24  ? 226  GLN B O   1 
ATOM   3992 C CB  . GLN B 1 226 ? 58.672 18.102  28.380 1.00 99.83  ? 226  GLN B CB  1 
ATOM   3993 C CG  . GLN B 1 226 ? 60.021 18.289  29.050 1.00 99.83  ? 226  GLN B CG  1 
ATOM   3994 C CD  . GLN B 1 226 ? 60.558 17.009  29.664 1.00 99.83  ? 226  GLN B CD  1 
ATOM   3995 O OE1 . GLN B 1 226 ? 61.543 17.029  30.407 1.00 99.83  ? 226  GLN B OE1 1 
ATOM   3996 N NE2 . GLN B 1 226 ? 59.912 15.887  29.359 1.00 99.83  ? 226  GLN B NE2 1 
ATOM   3997 N N   . TRP B 1 227 ? 55.534 19.202  28.902 1.00 41.10  ? 227  TRP B N   1 
ATOM   3998 C CA  . TRP B 1 227 ? 54.125 18.906  28.725 1.00 41.10  ? 227  TRP B CA  1 
ATOM   3999 C C   . TRP B 1 227 ? 53.337 19.700  29.766 1.00 41.10  ? 227  TRP B C   1 
ATOM   4000 O O   . TRP B 1 227 ? 52.814 19.145  30.730 1.00 41.10  ? 227  TRP B O   1 
ATOM   4001 C CB  . TRP B 1 227 ? 53.912 17.399  28.897 1.00 39.12  ? 227  TRP B CB  1 
ATOM   4002 C CG  . TRP B 1 227 ? 52.522 16.934  28.659 1.00 39.12  ? 227  TRP B CG  1 
ATOM   4003 C CD1 . TRP B 1 227 ? 51.491 17.661  28.156 1.00 39.12  ? 227  TRP B CD1 1 
ATOM   4004 C CD2 . TRP B 1 227 ? 52.006 15.618  28.897 1.00 39.12  ? 227  TRP B CD2 1 
ATOM   4005 N NE1 . TRP B 1 227 ? 50.362 16.885  28.072 1.00 39.12  ? 227  TRP B NE1 1 
ATOM   4006 C CE2 . TRP B 1 227 ? 50.651 15.628  28.524 1.00 39.12  ? 227  TRP B CE2 1 
ATOM   4007 C CE3 . TRP B 1 227 ? 52.556 14.436  29.408 1.00 39.12  ? 227  TRP B CE3 1 
ATOM   4008 C CZ2 . TRP B 1 227 ? 49.843 14.501  28.623 1.00 39.12  ? 227  TRP B CZ2 1 
ATOM   4009 C CZ3 . TRP B 1 227 ? 51.751 13.315  29.511 1.00 39.12  ? 227  TRP B CZ3 1 
ATOM   4010 C CH2 . TRP B 1 227 ? 50.408 13.356  29.126 1.00 39.12  ? 227  TRP B CH2 1 
ATOM   4011 N N   . PRO B 1 228 ? 53.256 21.026  29.575 1.00 75.06  ? 228  PRO B N   1 
ATOM   4012 C CA  . PRO B 1 228 ? 52.575 22.031  30.406 1.00 75.06  ? 228  PRO B CA  1 
ATOM   4013 C C   . PRO B 1 228 ? 51.149 21.753  30.907 1.00 75.06  ? 228  PRO B C   1 
ATOM   4014 O O   . PRO B 1 228 ? 50.873 21.891  32.097 1.00 75.06  ? 228  PRO B O   1 
ATOM   4015 C CB  . PRO B 1 228 ? 52.633 23.282  29.532 1.00 62.96  ? 228  PRO B CB  1 
ATOM   4016 C CG  . PRO B 1 228 ? 53.938 23.129  28.839 1.00 62.96  ? 228  PRO B CG  1 
ATOM   4017 C CD  . PRO B 1 228 ? 53.919 21.673  28.427 1.00 62.96  ? 228  PRO B CD  1 
ATOM   4018 N N   . SER B 1 229 ? 50.243 21.373  30.013 1.00 54.37  ? 229  SER B N   1 
ATOM   4019 C CA  . SER B 1 229 ? 48.857 21.129  30.416 1.00 54.37  ? 229  SER B CA  1 
ATOM   4020 C C   . SER B 1 229 ? 48.470 19.715  30.857 1.00 54.37  ? 229  SER B C   1 
ATOM   4021 O O   . SER B 1 229 ? 47.305 19.341  30.741 1.00 54.37  ? 229  SER B O   1 
ATOM   4022 C CB  . SER B 1 229 ? 47.912 21.555  29.293 1.00 52.62  ? 229  SER B CB  1 
ATOM   4023 O OG  . SER B 1 229 ? 48.142 20.790  28.123 1.00 52.62  ? 229  SER B OG  1 
ATOM   4024 N N   . MET B 1 230 ? 49.418 18.937  31.376 1.00 59.19  ? 230  MET B N   1 
ATOM   4025 C CA  . MET B 1 230 ? 49.113 17.573  31.816 1.00 59.19  ? 230  MET B CA  1 
ATOM   4026 C C   . MET B 1 230 ? 48.454 17.494  33.202 1.00 59.19  ? 230  MET B C   1 
ATOM   4027 O O   . MET B 1 230 ? 47.546 16.689  33.422 1.00 59.19  ? 230  MET B O   1 
ATOM   4028 C CB  . MET B 1 230 ? 50.380 16.712  31.809 1.00 72.90  ? 230  MET B CB  1 
ATOM   4029 C CG  . MET B 1 230 ? 51.403 17.087  32.863 1.00 72.90  ? 230  MET B CG  1 
ATOM   4030 S SD  . MET B 1 230 ? 52.709 15.842  33.020 1.00 72.90  ? 230  MET B SD  1 
ATOM   4031 C CE  . MET B 1 230 ? 54.018 16.595  32.063 1.00 72.90  ? 230  MET B CE  1 
ATOM   4032 N N   . THR B 1 231 ? 48.922 18.319  34.136 1.00 58.02  ? 231  THR B N   1 
ATOM   4033 C CA  . THR B 1 231 ? 48.369 18.340  35.491 1.00 58.02  ? 231  THR B CA  1 
ATOM   4034 C C   . THR B 1 231 ? 46.920 18.823  35.491 1.00 58.02  ? 231  THR B C   1 
ATOM   4035 O O   . THR B 1 231 ? 46.192 18.609  36.456 1.00 58.02  ? 231  THR B O   1 
ATOM   4036 C CB  . THR B 1 231 ? 49.188 19.263  36.407 1.00 53.67  ? 231  THR B CB  1 
ATOM   4037 O OG1 . THR B 1 231 ? 49.416 20.507  35.737 1.00 53.67  ? 231  THR B OG1 1 
ATOM   4038 C CG2 . THR B 1 231 ? 50.528 18.635  36.754 1.00 53.67  ? 231  THR B CG2 1 
ATOM   4039 N N   . LYS B 1 232 ? 46.514 19.478  34.406 1.00 54.79  ? 232  LYS B N   1 
ATOM   4040 C CA  . LYS B 1 232 ? 45.152 19.988  34.266 1.00 54.79  ? 232  LYS B CA  1 
ATOM   4041 C C   . LYS B 1 232 ? 44.206 18.911  33.758 1.00 54.79  ? 232  LYS B C   1 
ATOM   4042 O O   . LYS B 1 232 ? 43.020 19.173  33.551 1.00 54.79  ? 232  LYS B O   1 
ATOM   4043 C CB  . LYS B 1 232 ? 45.119 21.172  33.298 1.00 79.40  ? 232  LYS B CB  1 
ATOM   4044 C CG  . LYS B 1 232 ? 45.834 22.406  33.806 1.00 79.40  ? 232  LYS B CG  1 
ATOM   4045 C CD  . LYS B 1 232 ? 45.522 23.610  32.937 1.00 79.40  ? 232  LYS B CD  1 
ATOM   4046 C CE  . LYS B 1 232 ? 46.107 24.880  33.527 1.00 79.40  ? 232  LYS B CE  1 
ATOM   4047 N NZ  . LYS B 1 232 ? 45.717 26.076  32.736 1.00 79.40  ? 232  LYS B NZ  1 
ATOM   4048 N N   . LEU B 1 233 ? 44.735 17.703  33.563 1.00 59.14  ? 233  LEU B N   1 
ATOM   4049 C CA  . LEU B 1 233 ? 43.954 16.574  33.065 1.00 59.14  ? 233  LEU B CA  1 
ATOM   4050 C C   . LEU B 1 233 ? 43.229 15.799  34.168 1.00 59.14  ? 233  LEU B C   1 
ATOM   4051 O O   . LEU B 1 233 ? 43.824 15.441  35.181 1.00 59.14  ? 233  LEU B O   1 
ATOM   4052 C CB  . LEU B 1 233 ? 44.858 15.620  32.279 1.00 37.35  ? 233  LEU B CB  1 
ATOM   4053 C CG  . LEU B 1 233 ? 45.418 16.114  30.940 1.00 37.35  ? 233  LEU B CG  1 
ATOM   4054 C CD1 . LEU B 1 233 ? 46.221 15.011  30.305 1.00 37.35  ? 233  LEU B CD1 1 
ATOM   4055 C CD2 . LEU B 1 233 ? 44.293 16.530  30.011 1.00 37.35  ? 233  LEU B CD2 1 
ATOM   4056 N N   . PRO B 1 234 ? 41.941 15.495  33.955 1.00 58.65  ? 234  PRO B N   1 
ATOM   4057 C CA  . PRO B 1 234 ? 41.022 14.772  34.843 1.00 58.65  ? 234  PRO B CA  1 
ATOM   4058 C C   . PRO B 1 234 ? 41.587 13.710  35.787 1.00 58.65  ? 234  PRO B C   1 
ATOM   4059 O O   . PRO B 1 234 ? 41.174 13.635  36.943 1.00 58.65  ? 234  PRO B O   1 
ATOM   4060 C CB  . PRO B 1 234 ? 40.017 14.171  33.869 1.00 61.71  ? 234  PRO B CB  1 
ATOM   4061 C CG  . PRO B 1 234 ? 39.902 15.225  32.839 1.00 61.71  ? 234  PRO B CG  1 
ATOM   4062 C CD  . PRO B 1 234 ? 41.352 15.624  32.610 1.00 61.71  ? 234  PRO B CD  1 
ATOM   4063 N N   . ASP B 1 235 ? 42.507 12.883  35.304 1.00 51.04  ? 235  ASP B N   1 
ATOM   4064 C CA  . ASP B 1 235 ? 43.074 11.821  36.133 1.00 51.04  ? 235  ASP B CA  1 
ATOM   4065 C C   . ASP B 1 235 ? 44.582 11.882  36.360 1.00 51.04  ? 235  ASP B C   1 
ATOM   4066 O O   . ASP B 1 235 ? 45.197 10.889  36.773 1.00 51.04  ? 235  ASP B O   1 
ATOM   4067 C CB  . ASP B 1 235 ? 42.713 10.464  35.544 1.00 70.79  ? 235  ASP B CB  1 
ATOM   4068 C CG  . ASP B 1 235 ? 41.296 10.072  35.850 1.00 70.79  ? 235  ASP B CG  1 
ATOM   4069 O OD1 . ASP B 1 235 ? 41.006 9.824   37.039 1.00 70.79  ? 235  ASP B OD1 1 
ATOM   4070 O OD2 . ASP B 1 235 ? 40.467 10.022  34.915 1.00 70.79  ? 235  ASP B OD2 1 
ATOM   4071 N N   . TYR B 1 236 ? 45.178 13.041  36.103 1.00 34.65  ? 236  TYR B N   1 
ATOM   4072 C CA  . TYR B 1 236 ? 46.611 13.213  36.300 1.00 34.65  ? 236  TYR B CA  1 
ATOM   4073 C C   . TYR B 1 236 ? 47.059 12.869  37.714 1.00 34.65  ? 236  TYR B C   1 
ATOM   4074 O O   . TYR B 1 236 ? 46.354 13.113  38.691 1.00 34.65  ? 236  TYR B O   1 
ATOM   4075 C CB  . TYR B 1 236 ? 47.030 14.660  35.980 1.00 70.27  ? 236  TYR B CB  1 
ATOM   4076 C CG  . TYR B 1 236 ? 48.479 14.972  36.314 1.00 70.27  ? 236  TYR B CG  1 
ATOM   4077 C CD1 . TYR B 1 236 ? 48.899 15.124  37.645 1.00 70.27  ? 236  TYR B CD1 1 
ATOM   4078 C CD2 . TYR B 1 236 ? 49.441 15.079  35.306 1.00 70.27  ? 236  TYR B CD2 1 
ATOM   4079 C CE1 . TYR B 1 236 ? 50.245 15.372  37.962 1.00 70.27  ? 236  TYR B CE1 1 
ATOM   4080 C CE2 . TYR B 1 236 ? 50.786 15.329  35.611 1.00 70.27  ? 236  TYR B CE2 1 
ATOM   4081 C CZ  . TYR B 1 236 ? 51.181 15.474  36.937 1.00 70.27  ? 236  TYR B CZ  1 
ATOM   4082 O OH  . TYR B 1 236 ? 52.502 15.731  37.232 1.00 70.27  ? 236  TYR B OH  1 
ATOM   4083 N N   . LYS B 1 237 ? 48.247 12.298  37.811 1.00 47.14  ? 237  LYS B N   1 
ATOM   4084 C CA  . LYS B 1 237 ? 48.828 11.963  39.090 1.00 47.14  ? 237  LYS B CA  1 
ATOM   4085 C C   . LYS B 1 237 ? 50.326 12.114  38.958 1.00 47.14  ? 237  LYS B C   1 
ATOM   4086 O O   . LYS B 1 237 ? 50.919 11.722  37.946 1.00 47.14  ? 237  LYS B O   1 
ATOM   4087 C CB  . LYS B 1 237 ? 48.471 10.535  39.507 1.00 45.88  ? 237  LYS B CB  1 
ATOM   4088 C CG  . LYS B 1 237 ? 47.032 10.409  39.916 1.00 45.88  ? 237  LYS B CG  1 
ATOM   4089 C CD  . LYS B 1 237 ? 46.583 8.973   40.113 1.00 45.88  ? 237  LYS B CD  1 
ATOM   4090 C CE  . LYS B 1 237 ? 45.082 9.000   40.377 1.00 45.88  ? 237  LYS B CE  1 
ATOM   4091 N NZ  . LYS B 1 237 ? 44.480 7.660   40.373 1.00 45.88  ? 237  LYS B NZ  1 
ATOM   4092 N N   . PRO B 1 238 ? 50.955 12.732  39.965 1.00 60.94  ? 238  PRO B N   1 
ATOM   4093 C CA  . PRO B 1 238 ? 52.400 12.954  39.996 1.00 60.94  ? 238  PRO B CA  1 
ATOM   4094 C C   . PRO B 1 238 ? 53.098 11.657  40.345 1.00 60.94  ? 238  PRO B C   1 
ATOM   4095 O O   . PRO B 1 238 ? 53.076 11.231  41.501 1.00 60.94  ? 238  PRO B O   1 
ATOM   4096 C CB  . PRO B 1 238 ? 52.570 13.992  41.102 1.00 69.84  ? 238  PRO B CB  1 
ATOM   4097 C CG  . PRO B 1 238 ? 51.255 14.699  41.118 1.00 69.84  ? 238  PRO B CG  1 
ATOM   4098 C CD  . PRO B 1 238 ? 50.290 13.555  40.987 1.00 69.84  ? 238  PRO B CD  1 
ATOM   4099 N N   . TYR B 1 239 ? 53.686 11.015  39.344 1.00 44.32  ? 239  TYR B N   1 
ATOM   4100 C CA  . TYR B 1 239 ? 54.413 9.771   39.568 1.00 44.32  ? 239  TYR B CA  1 
ATOM   4101 C C   . TYR B 1 239 ? 55.872 10.107  39.883 1.00 44.32  ? 239  TYR B C   1 
ATOM   4102 O O   . TYR B 1 239 ? 56.345 11.210  39.586 1.00 44.32  ? 239  TYR B O   1 
ATOM   4103 C CB  . TYR B 1 239 ? 54.328 8.889   38.314 1.00 43.40  ? 239  TYR B CB  1 
ATOM   4104 C CG  . TYR B 1 239 ? 53.044 8.095   38.225 1.00 43.40  ? 239  TYR B CG  1 
ATOM   4105 C CD1 . TYR B 1 239 ? 52.979 6.792   38.720 1.00 43.40  ? 239  TYR B CD1 1 
ATOM   4106 C CD2 . TYR B 1 239 ? 51.881 8.658   37.680 1.00 43.40  ? 239  TYR B CD2 1 
ATOM   4107 C CE1 . TYR B 1 239 ? 51.795 6.068   38.678 1.00 43.40  ? 239  TYR B CE1 1 
ATOM   4108 C CE2 . TYR B 1 239 ? 50.688 7.940   37.640 1.00 43.40  ? 239  TYR B CE2 1 
ATOM   4109 C CZ  . TYR B 1 239 ? 50.655 6.647   38.140 1.00 43.40  ? 239  TYR B CZ  1 
ATOM   4110 O OH  . TYR B 1 239 ? 49.479 5.928   38.110 1.00 43.40  ? 239  TYR B OH  1 
ATOM   4111 N N   . PRO B 1 240 ? 56.596 9.180   40.520 1.00 49.33  ? 240  PRO B N   1 
ATOM   4112 C CA  . PRO B 1 240 ? 57.999 9.482   40.814 1.00 49.33  ? 240  PRO B CA  1 
ATOM   4113 C C   . PRO B 1 240 ? 58.675 9.818   39.488 1.00 49.33  ? 240  PRO B C   1 
ATOM   4114 O O   . PRO B 1 240 ? 58.343 9.225   38.465 1.00 49.33  ? 240  PRO B O   1 
ATOM   4115 C CB  . PRO B 1 240 ? 58.512 8.176   41.412 1.00 75.65  ? 240  PRO B CB  1 
ATOM   4116 C CG  . PRO B 1 240 ? 57.321 7.656   42.141 1.00 75.65  ? 240  PRO B CG  1 
ATOM   4117 C CD  . PRO B 1 240 ? 56.188 7.908   41.143 1.00 75.65  ? 240  PRO B CD  1 
ATOM   4118 N N   . MET B 1 241 ? 59.610 10.762  39.506 1.00 90.87  ? 241  MET B N   1 
ATOM   4119 C CA  . MET B 1 241 ? 60.310 11.175  38.293 1.00 90.87  ? 241  MET B CA  1 
ATOM   4120 C C   . MET B 1 241 ? 61.449 10.245  37.872 1.00 90.87  ? 241  MET B C   1 
ATOM   4121 O O   . MET B 1 241 ? 62.618 10.631  37.921 1.00 90.87  ? 241  MET B O   1 
ATOM   4122 C CB  . MET B 1 241 ? 60.858 12.596  38.466 1.00 85.24  ? 241  MET B CB  1 
ATOM   4123 C CG  . MET B 1 241 ? 59.794 13.678  38.595 1.00 85.24  ? 241  MET B CG  1 
ATOM   4124 S SD  . MET B 1 241 ? 58.946 14.039  37.042 1.00 85.24  ? 241  MET B SD  1 
ATOM   4125 C CE  . MET B 1 241 ? 59.983 15.316  36.364 1.00 85.24  ? 241  MET B CE  1 
ATOM   4126 N N   . TYR B 1 242 ? 61.110 9.027   37.453 1.00 111.91 ? 242  TYR B N   1 
ATOM   4127 C CA  . TYR B 1 242 ? 62.117 8.061   37.010 1.00 111.91 ? 242  TYR B CA  1 
ATOM   4128 C C   . TYR B 1 242 ? 62.961 8.709   35.910 1.00 111.91 ? 242  TYR B C   1 
ATOM   4129 O O   . TYR B 1 242 ? 62.535 9.675   35.267 1.00 111.91 ? 242  TYR B O   1 
ATOM   4130 C CB  . TYR B 1 242 ? 61.474 6.791   36.410 1.00 68.65  ? 242  TYR B CB  1 
ATOM   4131 C CG  . TYR B 1 242 ? 60.310 6.193   37.171 1.00 68.65  ? 242  TYR B CG  1 
ATOM   4132 C CD1 . TYR B 1 242 ? 59.067 6.819   37.186 1.00 68.65  ? 242  TYR B CD1 1 
ATOM   4133 C CD2 . TYR B 1 242 ? 60.440 4.980   37.843 1.00 68.65  ? 242  TYR B CD2 1 
ATOM   4134 C CE1 . TYR B 1 242 ? 57.977 6.250   37.854 1.00 68.65  ? 242  TYR B CE1 1 
ATOM   4135 C CE2 . TYR B 1 242 ? 59.356 4.399   38.512 1.00 68.65  ? 242  TYR B CE2 1 
ATOM   4136 C CZ  . TYR B 1 242 ? 58.130 5.039   38.513 1.00 68.65  ? 242  TYR B CZ  1 
ATOM   4137 O OH  . TYR B 1 242 ? 57.060 4.478   39.174 1.00 68.65  ? 242  TYR B OH  1 
ATOM   4138 N N   . PRO B 1 243 ? 64.174 8.184   35.681 1.00 137.02 ? 243  PRO B N   1 
ATOM   4139 C CA  . PRO B 1 243 ? 65.036 8.745   34.637 1.00 137.02 ? 243  PRO B CA  1 
ATOM   4140 C C   . PRO B 1 243 ? 64.517 8.374   33.252 1.00 137.02 ? 243  PRO B C   1 
ATOM   4141 O O   . PRO B 1 243 ? 63.920 7.313   33.062 1.00 137.02 ? 243  PRO B O   1 
ATOM   4142 C CB  . PRO B 1 243 ? 66.396 8.099   34.916 1.00 90.72  ? 243  PRO B CB  1 
ATOM   4143 C CG  . PRO B 1 243 ? 66.337 7.766   36.367 1.00 90.72  ? 243  PRO B CG  1 
ATOM   4144 C CD  . PRO B 1 243 ? 64.932 7.245   36.525 1.00 90.72  ? 243  PRO B CD  1 
ATOM   4145 N N   . ALA B 1 244 ? 64.751 9.259   32.291 1.00 115.20 ? 244  ALA B N   1 
ATOM   4146 C CA  . ALA B 1 244 ? 64.344 9.018   30.917 1.00 115.20 ? 244  ALA B CA  1 
ATOM   4147 C C   . ALA B 1 244 ? 65.389 8.105   30.274 1.00 115.20 ? 244  ALA B C   1 
ATOM   4148 O O   . ALA B 1 244 ? 66.120 8.531   29.378 1.00 115.20 ? 244  ALA B O   1 
ATOM   4149 C CB  . ALA B 1 244 ? 64.270 10.337  30.162 1.00 68.67  ? 244  ALA B CB  1 
ATOM   4150 N N   . THR B 1 245 ? 65.480 6.860   30.730 1.00 121.85 ? 245  THR B N   1 
ATOM   4151 C CA  . THR B 1 245 ? 66.464 5.939   30.165 1.00 121.85 ? 245  THR B CA  1 
ATOM   4152 C C   . THR B 1 245 ? 66.123 5.645   28.700 1.00 121.85 ? 245  THR B C   1 
ATOM   4153 O O   . THR B 1 245 ? 66.472 4.590   28.166 1.00 121.85 ? 245  THR B O   1 
ATOM   4154 C CB  . THR B 1 245 ? 66.512 4.608   30.960 1.00 139.11 ? 245  THR B CB  1 
ATOM   4155 O OG1 . THR B 1 245 ? 65.284 3.893   30.784 1.00 139.11 ? 245  THR B OG1 1 
ATOM   4156 C CG2 . THR B 1 245 ? 66.716 4.880   32.449 1.00 139.11 ? 245  THR B CG2 1 
ATOM   4157 N N   . THR B 1 246 ? 65.456 6.611   28.066 1.00 189.15 ? 246  THR B N   1 
ATOM   4158 C CA  . THR B 1 246 ? 65.003 6.543   26.672 1.00 189.15 ? 246  THR B CA  1 
ATOM   4159 C C   . THR B 1 246 ? 66.066 6.273   25.613 1.00 189.15 ? 246  THR B C   1 
ATOM   4160 O O   . THR B 1 246 ? 65.870 6.604   24.441 1.00 189.15 ? 246  THR B O   1 
ATOM   4161 C CB  . THR B 1 246 ? 64.271 7.845   26.252 1.00 143.14 ? 246  THR B CB  1 
ATOM   4162 O OG1 . THR B 1 246 ? 65.234 8.841   25.877 1.00 143.14 ? 246  THR B OG1 1 
ATOM   4163 C CG2 . THR B 1 246 ? 63.434 8.375   27.399 1.00 143.14 ? 246  THR B CG2 1 
ATOM   4164 N N   . SER B 1 247 ? 67.191 5.694   26.015 1.00 117.75 ? 247  SER B N   1 
ATOM   4165 C CA  . SER B 1 247 ? 68.245 5.363   25.065 1.00 117.75 ? 247  SER B CA  1 
ATOM   4166 C C   . SER B 1 247 ? 67.761 4.028   24.501 1.00 117.75 ? 247  SER B C   1 
ATOM   4167 O O   . SER B 1 247 ? 68.471 3.023   24.487 1.00 117.75 ? 247  SER B O   1 
ATOM   4168 C CB  . SER B 1 247 ? 69.579 5.209   25.795 1.00 121.59 ? 247  SER B CB  1 
ATOM   4169 O OG  . SER B 1 247 ? 70.640 5.749   25.028 1.00 121.59 ? 247  SER B OG  1 
ATOM   4170 N N   . LEU B 1 248 ? 66.507 4.075   24.061 1.00 85.87  ? 248  LEU B N   1 
ATOM   4171 C CA  . LEU B 1 248 ? 65.728 2.977   23.503 1.00 85.87  ? 248  LEU B CA  1 
ATOM   4172 C C   . LEU B 1 248 ? 66.358 1.742   22.868 1.00 85.87  ? 248  LEU B C   1 
ATOM   4173 O O   . LEU B 1 248 ? 65.662 0.748   22.667 1.00 85.87  ? 248  LEU B O   1 
ATOM   4174 C CB  . LEU B 1 248 ? 64.690 3.556   22.533 1.00 74.62  ? 248  LEU B CB  1 
ATOM   4175 C CG  . LEU B 1 248 ? 63.296 3.891   23.092 1.00 74.62  ? 248  LEU B CG  1 
ATOM   4176 C CD1 . LEU B 1 248 ? 63.380 4.876   24.235 1.00 74.62  ? 248  LEU B CD1 1 
ATOM   4177 C CD2 . LEU B 1 248 ? 62.448 4.462   21.978 1.00 74.62  ? 248  LEU B CD2 1 
ATOM   4178 N N   . VAL B 1 249 ? 67.645 1.771   22.545 1.00 78.78  ? 249  VAL B N   1 
ATOM   4179 C CA  . VAL B 1 249 ? 68.262 0.593   21.931 1.00 78.78  ? 249  VAL B CA  1 
ATOM   4180 C C   . VAL B 1 249 ? 68.132 -0.618  22.856 1.00 78.78  ? 249  VAL B C   1 
ATOM   4181 O O   . VAL B 1 249 ? 68.080 -1.766  22.401 1.00 78.78  ? 249  VAL B O   1 
ATOM   4182 C CB  . VAL B 1 249 ? 69.763 0.804   21.632 1.00 86.99  ? 249  VAL B CB  1 
ATOM   4183 C CG1 . VAL B 1 249 ? 70.299 -0.378  20.835 1.00 86.99  ? 249  VAL B CG1 1 
ATOM   4184 C CG2 . VAL B 1 249 ? 69.975 2.096   20.872 1.00 86.99  ? 249  VAL B CG2 1 
ATOM   4185 N N   . ASN B 1 250 ? 68.078 -0.348  24.157 1.00 87.73  ? 250  ASN B N   1 
ATOM   4186 C CA  . ASN B 1 250 ? 67.961 -1.395  25.163 1.00 87.73  ? 250  ASN B CA  1 
ATOM   4187 C C   . ASN B 1 250 ? 66.654 -2.162  25.020 1.00 87.73  ? 250  ASN B C   1 
ATOM   4188 O O   . ASN B 1 250 ? 66.510 -3.264  25.552 1.00 87.73  ? 250  ASN B O   1 
ATOM   4189 C CB  . ASN B 1 250 ? 68.034 -0.785  26.565 1.00 119.58 ? 250  ASN B CB  1 
ATOM   4190 C CG  . ASN B 1 250 ? 69.364 -0.115  26.842 1.00 119.58 ? 250  ASN B CG  1 
ATOM   4191 O OD1 . ASN B 1 250 ? 70.400 -0.775  26.930 1.00 119.58 ? 250  ASN B OD1 1 
ATOM   4192 N ND2 . ASN B 1 250 ? 69.343 1.207   26.978 1.00 119.58 ? 250  ASN B ND2 1 
ATOM   4193 N N   . VAL B 1 251 ? 65.705 -1.583  24.291 1.00 72.30  ? 251  VAL B N   1 
ATOM   4194 C CA  . VAL B 1 251 ? 64.409 -2.219  24.117 1.00 72.30  ? 251  VAL B CA  1 
ATOM   4195 C C   . VAL B 1 251 ? 64.056 -2.540  22.663 1.00 72.30  ? 251  VAL B C   1 
ATOM   4196 O O   . VAL B 1 251 ? 63.030 -3.163  22.396 1.00 72.30  ? 251  VAL B O   1 
ATOM   4197 C CB  . VAL B 1 251 ? 63.285 -1.340  24.741 1.00 76.50  ? 251  VAL B CB  1 
ATOM   4198 C CG1 . VAL B 1 251 ? 62.886 -0.232  23.782 1.00 76.50  ? 251  VAL B CG1 1 
ATOM   4199 C CG2 . VAL B 1 251 ? 62.095 -2.199  25.119 1.00 76.50  ? 251  VAL B CG2 1 
ATOM   4200 N N   . VAL B 1 252 ? 64.895 -2.139  21.716 1.00 69.03  ? 252  VAL B N   1 
ATOM   4201 C CA  . VAL B 1 252 ? 64.578 -2.426  20.323 1.00 69.03  ? 252  VAL B CA  1 
ATOM   4202 C C   . VAL B 1 252 ? 65.823 -2.487  19.421 1.00 69.03  ? 252  VAL B C   1 
ATOM   4203 O O   . VAL B 1 252 ? 65.981 -1.685  18.494 1.00 69.03  ? 252  VAL B O   1 
ATOM   4204 C CB  . VAL B 1 252 ? 63.543 -1.381  19.789 1.00 63.30  ? 252  VAL B CB  1 
ATOM   4205 C CG1 . VAL B 1 252 ? 64.168 0.002   19.683 1.00 63.30  ? 252  VAL B CG1 1 
ATOM   4206 C CG2 . VAL B 1 252 ? 62.984 -1.834  18.466 1.00 63.30  ? 252  VAL B CG2 1 
ATOM   4207 N N   . PRO B 1 253 ? 66.717 -3.464  19.680 1.00 90.10  ? 253  PRO B N   1 
ATOM   4208 C CA  . PRO B 1 253 ? 67.980 -3.736  18.976 1.00 90.10  ? 253  PRO B CA  1 
ATOM   4209 C C   . PRO B 1 253 ? 67.897 -3.961  17.466 1.00 90.10  ? 253  PRO B C   1 
ATOM   4210 O O   . PRO B 1 253 ? 68.639 -3.342  16.703 1.00 90.10  ? 253  PRO B O   1 
ATOM   4211 C CB  . PRO B 1 253 ? 68.518 -4.965  19.703 1.00 158.34 ? 253  PRO B CB  1 
ATOM   4212 C CG  . PRO B 1 253 ? 68.002 -4.779  21.088 1.00 158.34 ? 253  PRO B CG  1 
ATOM   4213 C CD  . PRO B 1 253 ? 66.574 -4.375  20.829 1.00 158.34 ? 253  PRO B CD  1 
ATOM   4214 N N   . LYS B 1 254 ? 67.014 -4.860  17.040 1.00 90.33  ? 254  LYS B N   1 
ATOM   4215 C CA  . LYS B 1 254 ? 66.841 -5.154  15.617 1.00 90.33  ? 254  LYS B CA  1 
ATOM   4216 C C   . LYS B 1 254 ? 66.306 -3.916  14.899 1.00 90.33  ? 254  LYS B C   1 
ATOM   4217 O O   . LYS B 1 254 ? 65.516 -4.014  13.944 1.00 90.33  ? 254  LYS B O   1 
ATOM   4218 C CB  . LYS B 1 254 ? 65.861 -6.318  15.428 1.00 153.51 ? 254  LYS B CB  1 
ATOM   4219 C CG  . LYS B 1 254 ? 66.321 -7.646  16.024 1.00 153.51 ? 254  LYS B CG  1 
ATOM   4220 C CD  . LYS B 1 254 ? 67.541 -8.203  15.300 1.00 153.51 ? 254  LYS B CD  1 
ATOM   4221 C CE  . LYS B 1 254 ? 67.931 -9.572  15.843 1.00 153.51 ? 254  LYS B CE  1 
ATOM   4222 N NZ  . LYS B 1 254 ? 69.083 -10.157 15.104 1.00 153.51 ? 254  LYS B NZ  1 
ATOM   4223 N N   . LEU B 1 255 ? 66.743 -2.755  15.379 1.00 64.95  ? 255  LEU B N   1 
ATOM   4224 C CA  . LEU B 1 255 ? 66.339 -1.474  14.825 1.00 64.95  ? 255  LEU B CA  1 
ATOM   4225 C C   . LEU B 1 255 ? 67.540 -0.529  14.831 1.00 64.95  ? 255  LEU B C   1 
ATOM   4226 O O   . LEU B 1 255 ? 68.226 -0.399  15.850 1.00 64.95  ? 255  LEU B O   1 
ATOM   4227 C CB  . LEU B 1 255 ? 65.200 -0.885  15.656 1.00 50.09  ? 255  LEU B CB  1 
ATOM   4228 C CG  . LEU B 1 255 ? 64.401 0.194   14.928 1.00 50.09  ? 255  LEU B CG  1 
ATOM   4229 C CD1 . LEU B 1 255 ? 63.840 -0.380  13.627 1.00 50.09  ? 255  LEU B CD1 1 
ATOM   4230 C CD2 . LEU B 1 255 ? 63.288 0.698   15.830 1.00 50.09  ? 255  LEU B CD2 1 
ATOM   4231 N N   . ASN B 1 256 ? 67.779 0.124   13.692 1.00 64.95  ? 256  ASN B N   1 
ATOM   4232 C CA  . ASN B 1 256 ? 68.901 1.047   13.525 1.00 64.95  ? 256  ASN B CA  1 
ATOM   4233 C C   . ASN B 1 256 ? 68.709 2.432   14.133 1.00 64.95  ? 256  ASN B C   1 
ATOM   4234 O O   . ASN B 1 256 ? 67.612 2.797   14.542 1.00 64.95  ? 256  ASN B O   1 
ATOM   4235 C CB  . ASN B 1 256 ? 69.217 1.207   12.044 1.00 66.18  ? 256  ASN B CB  1 
ATOM   4236 C CG  . ASN B 1 256 ? 67.971 1.306   11.199 1.00 66.18  ? 256  ASN B CG  1 
ATOM   4237 O OD1 . ASN B 1 256 ? 66.943 1.808   11.649 1.00 66.18  ? 256  ASN B OD1 1 
ATOM   4238 N ND2 . ASN B 1 256 ? 68.055 0.833   9.962  1.00 66.18  ? 256  ASN B ND2 1 
ATOM   4239 N N   . ALA B 1 257 ? 69.796 3.199   14.169 1.00 58.23  ? 257  ALA B N   1 
ATOM   4240 C CA  . ALA B 1 257 ? 69.810 4.553   14.722 1.00 58.23  ? 257  ALA B CA  1 
ATOM   4241 C C   . ALA B 1 257 ? 68.748 5.461   14.118 1.00 58.23  ? 257  ALA B C   1 
ATOM   4242 O O   . ALA B 1 257 ? 68.159 6.291   14.810 1.00 58.23  ? 257  ALA B O   1 
ATOM   4243 C CB  . ALA B 1 257 ? 71.191 5.177   14.525 1.00 47.65  ? 257  ALA B CB  1 
ATOM   4244 N N   . THR B 1 258 ? 68.516 5.312   12.822 1.00 50.60  ? 258  THR B N   1 
ATOM   4245 C CA  . THR B 1 258 ? 67.525 6.118   12.134 1.00 50.60  ? 258  THR B CA  1 
ATOM   4246 C C   . THR B 1 258 ? 66.106 5.713   12.534 1.00 50.60  ? 258  THR B C   1 
ATOM   4247 O O   . THR B 1 258 ? 65.284 6.548   12.926 1.00 50.60  ? 258  THR B O   1 
ATOM   4248 C CB  . THR B 1 258 ? 67.670 5.969   10.625 1.00 64.22  ? 258  THR B CB  1 
ATOM   4249 O OG1 . THR B 1 258 ? 66.481 6.446   9.992  1.00 64.22  ? 258  THR B OG1 1 
ATOM   4250 C CG2 . THR B 1 258 ? 67.888 4.508   10.251 1.00 64.22  ? 258  THR B CG2 1 
ATOM   4251 N N   . GLY B 1 259 ? 65.823 4.422   12.434 1.00 51.85  ? 259  GLY B N   1 
ATOM   4252 C CA  . GLY B 1 259 ? 64.507 3.938   12.793 1.00 51.85  ? 259  GLY B CA  1 
ATOM   4253 C C   . GLY B 1 259 ? 64.190 4.212   14.246 1.00 51.85  ? 259  GLY B C   1 
ATOM   4254 O O   . GLY B 1 259 ? 63.039 4.471   14.593 1.00 51.85  ? 259  GLY B O   1 
ATOM   4255 N N   . ARG B 1 260 ? 65.209 4.160   15.099 1.00 54.62  ? 260  ARG B N   1 
ATOM   4256 C CA  . ARG B 1 260 ? 65.007 4.406   16.521 1.00 54.62  ? 260  ARG B CA  1 
ATOM   4257 C C   . ARG B 1 260 ? 64.610 5.854   16.772 1.00 54.62  ? 260  ARG B C   1 
ATOM   4258 O O   . ARG B 1 260 ? 63.851 6.147   17.695 1.00 54.62  ? 260  ARG B O   1 
ATOM   4259 C CB  . ARG B 1 260 ? 66.271 4.076   17.321 1.00 60.77  ? 260  ARG B CB  1 
ATOM   4260 C CG  . ARG B 1 260 ? 66.727 2.626   17.236 1.00 60.77  ? 260  ARG B CG  1 
ATOM   4261 C CD  . ARG B 1 260 ? 67.561 2.269   18.449 1.00 60.77  ? 260  ARG B CD  1 
ATOM   4262 N NE  . ARG B 1 260 ? 68.646 3.222   18.676 1.00 60.77  ? 260  ARG B NE  1 
ATOM   4263 C CZ  . ARG B 1 260 ? 69.763 3.274   17.957 1.00 60.77  ? 260  ARG B CZ  1 
ATOM   4264 N NH1 . ARG B 1 260 ? 69.953 2.423   16.957 1.00 60.77  ? 260  ARG B NH1 1 
ATOM   4265 N NH2 . ARG B 1 260 ? 70.689 4.183   18.239 1.00 60.77  ? 260  ARG B NH2 1 
ATOM   4266 N N   . ASP B 1 261 ? 65.127 6.761   15.955 1.00 55.20  ? 261  ASP B N   1 
ATOM   4267 C CA  . ASP B 1 261 ? 64.792 8.166   16.111 1.00 55.20  ? 261  ASP B CA  1 
ATOM   4268 C C   . ASP B 1 261 ? 63.291 8.311   15.868 1.00 55.20  ? 261  ASP B C   1 
ATOM   4269 O O   . ASP B 1 261 ? 62.574 8.935   16.659 1.00 55.20  ? 261  ASP B O   1 
ATOM   4270 C CB  . ASP B 1 261 ? 65.591 9.015   15.114 1.00 47.58  ? 261  ASP B CB  1 
ATOM   4271 C CG  . ASP B 1 261 ? 65.092 10.451  15.036 1.00 47.58  ? 261  ASP B CG  1 
ATOM   4272 O OD1 . ASP B 1 261 ? 64.244 10.736  14.155 1.00 47.58  ? 261  ASP B OD1 1 
ATOM   4273 O OD2 . ASP B 1 261 ? 65.535 11.288  15.864 1.00 47.58  ? 261  ASP B OD2 1 
ATOM   4274 N N   . LEU B 1 262 ? 62.824 7.718   14.771 1.00 53.17  ? 262  LEU B N   1 
ATOM   4275 C CA  . LEU B 1 262 ? 61.419 7.763   14.428 1.00 53.17  ? 262  LEU B CA  1 
ATOM   4276 C C   . LEU B 1 262 ? 60.608 7.238   15.605 1.00 53.17  ? 262  LEU B C   1 
ATOM   4277 O O   . LEU B 1 262 ? 59.683 7.898   16.077 1.00 53.17  ? 262  LEU B O   1 
ATOM   4278 C CB  . LEU B 1 262 ? 61.145 6.902   13.201 1.00 28.20  ? 262  LEU B CB  1 
ATOM   4279 C CG  . LEU B 1 262 ? 59.654 6.796   12.879 1.00 28.20  ? 262  LEU B CG  1 
ATOM   4280 C CD1 . LEU B 1 262 ? 59.090 8.195   12.803 1.00 28.20  ? 262  LEU B CD1 1 
ATOM   4281 C CD2 . LEU B 1 262 ? 59.418 6.038   11.569 1.00 28.20  ? 262  LEU B CD2 1 
ATOM   4282 N N   . LEU B 1 263 ? 60.961 6.049   16.083 1.00 41.55  ? 263  LEU B N   1 
ATOM   4283 C CA  . LEU B 1 263 ? 60.251 5.462   17.207 1.00 41.55  ? 263  LEU B CA  1 
ATOM   4284 C C   . LEU B 1 263 ? 60.162 6.446   18.370 1.00 41.55  ? 263  LEU B C   1 
ATOM   4285 O O   . LEU B 1 263 ? 59.178 6.462   19.107 1.00 41.55  ? 263  LEU B O   1 
ATOM   4286 C CB  . LEU B 1 263 ? 60.944 4.190   17.691 1.00 38.61  ? 263  LEU B CB  1 
ATOM   4287 C CG  . LEU B 1 263 ? 60.302 3.605   18.955 1.00 38.61  ? 263  LEU B CG  1 
ATOM   4288 C CD1 . LEU B 1 263 ? 58.904 3.123   18.638 1.00 38.61  ? 263  LEU B CD1 1 
ATOM   4289 C CD2 . LEU B 1 263 ? 61.139 2.466   19.488 1.00 38.61  ? 263  LEU B CD2 1 
ATOM   4290 N N   . GLN B 1 264 ? 61.187 7.267   18.546 1.00 56.84  ? 264  GLN B N   1 
ATOM   4291 C CA  . GLN B 1 264 ? 61.156 8.222   19.638 1.00 56.84  ? 264  GLN B CA  1 
ATOM   4292 C C   . GLN B 1 264 ? 60.158 9.331   19.338 1.00 56.84  ? 264  GLN B C   1 
ATOM   4293 O O   . GLN B 1 264 ? 59.545 9.881   20.250 1.00 56.84  ? 264  GLN B O   1 
ATOM   4294 C CB  . GLN B 1 264 ? 62.547 8.809   19.885 1.00 99.52  ? 264  GLN B CB  1 
ATOM   4295 C CG  . GLN B 1 264 ? 63.622 7.760   20.120 1.00 99.52  ? 264  GLN B CG  1 
ATOM   4296 C CD  . GLN B 1 264 ? 64.848 8.334   20.800 1.00 99.52  ? 264  GLN B CD  1 
ATOM   4297 O OE1 . GLN B 1 264 ? 65.164 9.511   20.632 1.00 99.52  ? 264  GLN B OE1 1 
ATOM   4298 N NE2 . GLN B 1 264 ? 65.553 7.502   21.564 1.00 99.52  ? 264  GLN B NE2 1 
ATOM   4299 N N   . ASN B 1 265 ? 59.984 9.661   18.063 1.00 39.09  ? 265  ASN B N   1 
ATOM   4300 C CA  . ASN B 1 265 ? 59.035 10.711  17.710 1.00 39.09  ? 265  ASN B CA  1 
ATOM   4301 C C   . ASN B 1 265 ? 57.581 10.249  17.751 1.00 39.09  ? 265  ASN B C   1 
ATOM   4302 O O   . ASN B 1 265 ? 56.666 11.077  17.743 1.00 39.09  ? 265  ASN B O   1 
ATOM   4303 C CB  . ASN B 1 265 ? 59.358 11.294  16.341 1.00 68.46  ? 265  ASN B CB  1 
ATOM   4304 C CG  . ASN B 1 265 ? 60.238 12.513  16.442 1.00 68.46  ? 265  ASN B CG  1 
ATOM   4305 O OD1 . ASN B 1 265 ? 59.854 13.516  17.048 1.00 68.46  ? 265  ASN B OD1 1 
ATOM   4306 N ND2 . ASN B 1 265 ? 61.432 12.436  15.864 1.00 68.46  ? 265  ASN B ND2 1 
ATOM   4307 N N   . LEU B 1 266 ? 57.381 8.930   17.792 1.00 51.39  ? 266  LEU B N   1 
ATOM   4308 C CA  . LEU B 1 266 ? 56.042 8.350   17.856 1.00 51.39  ? 266  LEU B CA  1 
ATOM   4309 C C   . LEU B 1 266 ? 55.659 8.207   19.323 1.00 51.39  ? 266  LEU B C   1 
ATOM   4310 O O   . LEU B 1 266 ? 54.504 8.425   19.696 1.00 51.39  ? 266  LEU B O   1 
ATOM   4311 C CB  . LEU B 1 266 ? 56.002 6.961   17.197 1.00 42.74  ? 266  LEU B CB  1 
ATOM   4312 C CG  . LEU B 1 266 ? 56.167 6.814   15.678 1.00 42.74  ? 266  LEU B CG  1 
ATOM   4313 C CD1 . LEU B 1 266 ? 56.368 5.346   15.335 1.00 42.74  ? 266  LEU B CD1 1 
ATOM   4314 C CD2 . LEU B 1 266 ? 54.957 7.364   14.943 1.00 42.74  ? 266  LEU B CD2 1 
ATOM   4315 N N   . LEU B 1 267 ? 56.642 7.859   20.152 1.00 38.29  ? 267  LEU B N   1 
ATOM   4316 C CA  . LEU B 1 267 ? 56.392 7.657   21.573 1.00 38.29  ? 267  LEU B CA  1 
ATOM   4317 C C   . LEU B 1 267 ? 56.579 8.846   22.500 1.00 38.29  ? 267  LEU B C   1 
ATOM   4318 O O   . LEU B 1 267 ? 56.995 8.663   23.638 1.00 38.29  ? 267  LEU B O   1 
ATOM   4319 C CB  . LEU B 1 267 ? 57.224 6.481   22.108 1.00 38.26  ? 267  LEU B CB  1 
ATOM   4320 C CG  . LEU B 1 267 ? 56.874 5.089   21.560 1.00 38.26  ? 267  LEU B CG  1 
ATOM   4321 C CD1 . LEU B 1 267 ? 57.623 4.032   22.351 1.00 38.26  ? 267  LEU B CD1 1 
ATOM   4322 C CD2 . LEU B 1 267 ? 55.367 4.835   21.664 1.00 38.26  ? 267  LEU B CD2 1 
ATOM   4323 N N   . LYS B 1 268 ? 56.269 10.050  22.031 1.00 43.41  ? 268  LYS B N   1 
ATOM   4324 C CA  . LYS B 1 268 ? 56.380 11.239  22.872 1.00 43.41  ? 268  LYS B CA  1 
ATOM   4325 C C   . LYS B 1 268 ? 55.133 11.286  23.751 1.00 43.41  ? 268  LYS B C   1 
ATOM   4326 O O   . LYS B 1 268 ? 54.016 11.112  23.256 1.00 43.41  ? 268  LYS B O   1 
ATOM   4327 C CB  . LYS B 1 268 ? 56.443 12.503  22.011 1.00 62.55  ? 268  LYS B CB  1 
ATOM   4328 C CG  . LYS B 1 268 ? 57.759 12.705  21.274 1.00 62.55  ? 268  LYS B CG  1 
ATOM   4329 C CD  . LYS B 1 268 ? 58.881 13.061  22.226 1.00 62.55  ? 268  LYS B CD  1 
ATOM   4330 C CE  . LYS B 1 268 ? 60.104 13.535  21.463 1.00 62.55  ? 268  LYS B CE  1 
ATOM   4331 N NZ  . LYS B 1 268 ? 61.049 14.298  22.331 1.00 62.55  ? 268  LYS B NZ  1 
ATOM   4332 N N   . CYS B 1 269 ? 55.306 11.513  25.050 1.00 45.87  ? 269  CYS B N   1 
ATOM   4333 C CA  . CYS B 1 269 ? 54.157 11.552  25.951 1.00 45.87  ? 269  CYS B CA  1 
ATOM   4334 C C   . CYS B 1 269 ? 53.202 12.709  25.665 1.00 45.87  ? 269  CYS B C   1 
ATOM   4335 O O   . CYS B 1 269 ? 51.969 12.550  25.702 1.00 45.87  ? 269  CYS B O   1 
ATOM   4336 C CB  . CYS B 1 269 ? 54.631 11.616  27.397 1.00 40.95  ? 269  CYS B CB  1 
ATOM   4337 S SG  . CYS B 1 269 ? 55.552 10.154  27.842 1.00 40.95  ? 269  CYS B SG  1 
ATOM   4338 N N   . ASN B 1 270 ? 53.765 13.878  25.384 1.00 52.52  ? 270  ASN B N   1 
ATOM   4339 C CA  . ASN B 1 270 ? 52.933 15.027  25.091 1.00 52.52  ? 270  ASN B CA  1 
ATOM   4340 C C   . ASN B 1 270 ? 52.338 14.807  23.719 1.00 52.52  ? 270  ASN B C   1 
ATOM   4341 O O   . ASN B 1 270 ? 53.044 14.812  22.715 1.00 52.52  ? 270  ASN B O   1 
ATOM   4342 C CB  . ASN B 1 270 ? 53.751 16.308  25.104 1.00 62.80  ? 270  ASN B CB  1 
ATOM   4343 C CG  . ASN B 1 270 ? 52.902 17.530  24.863 1.00 62.80  ? 270  ASN B CG  1 
ATOM   4344 O OD1 . ASN B 1 270 ? 53.386 18.660  24.942 1.00 62.80  ? 270  ASN B OD1 1 
ATOM   4345 N ND2 . ASN B 1 270 ? 51.623 17.314  24.565 1.00 62.80  ? 270  ASN B ND2 1 
ATOM   4346 N N   . PRO B 1 271 ? 51.019 14.603  23.663 1.00 51.01  ? 271  PRO B N   1 
ATOM   4347 C CA  . PRO B 1 271 ? 50.324 14.373  22.393 1.00 51.01  ? 271  PRO B CA  1 
ATOM   4348 C C   . PRO B 1 271 ? 50.739 15.333  21.283 1.00 51.01  ? 271  PRO B C   1 
ATOM   4349 O O   . PRO B 1 271 ? 50.871 14.926  20.125 1.00 51.01  ? 271  PRO B O   1 
ATOM   4350 C CB  . PRO B 1 271 ? 48.840 14.508  22.771 1.00 31.39  ? 271  PRO B CB  1 
ATOM   4351 C CG  . PRO B 1 271 ? 48.851 15.326  24.036 1.00 31.39  ? 271  PRO B CG  1 
ATOM   4352 C CD  . PRO B 1 271 ? 50.061 14.794  24.767 1.00 31.39  ? 271  PRO B CD  1 
ATOM   4353 N N   . VAL B 1 272 ? 50.960 16.597  21.640 1.00 42.65  ? 272  VAL B N   1 
ATOM   4354 C CA  . VAL B 1 272 ? 51.341 17.626  20.667 1.00 42.65  ? 272  VAL B CA  1 
ATOM   4355 C C   . VAL B 1 272 ? 52.727 17.389  20.058 1.00 42.65  ? 272  VAL B C   1 
ATOM   4356 O O   . VAL B 1 272 ? 53.017 17.839  18.952 1.00 42.65  ? 272  VAL B O   1 
ATOM   4357 C CB  . VAL B 1 272 ? 51.349 19.031  21.317 1.00 57.47  ? 272  VAL B CB  1 
ATOM   4358 C CG1 . VAL B 1 272 ? 51.200 20.101  20.248 1.00 57.47  ? 272  VAL B CG1 1 
ATOM   4359 C CG2 . VAL B 1 272 ? 50.247 19.138  22.360 1.00 57.47  ? 272  VAL B CG2 1 
ATOM   4360 N N   . GLN B 1 273 ? 53.576 16.675  20.788 1.00 64.61  ? 273  GLN B N   1 
ATOM   4361 C CA  . GLN B 1 273 ? 54.936 16.393  20.350 1.00 64.61  ? 273  GLN B CA  1 
ATOM   4362 C C   . GLN B 1 273 ? 55.075 15.130  19.484 1.00 64.61  ? 273  GLN B C   1 
ATOM   4363 O O   . GLN B 1 273 ? 56.184 14.788  19.061 1.00 64.61  ? 273  GLN B O   1 
ATOM   4364 C CB  . GLN B 1 273 ? 55.836 16.303  21.600 1.00 135.78 ? 273  GLN B CB  1 
ATOM   4365 C CG  . GLN B 1 273 ? 57.324 16.063  21.347 1.00 135.78 ? 273  GLN B CG  1 
ATOM   4366 C CD  . GLN B 1 273 ? 58.176 16.171  22.617 1.00 135.78 ? 273  GLN B CD  1 
ATOM   4367 O OE1 . GLN B 1 273 ? 57.909 15.511  23.633 1.00 135.78 ? 273  GLN B OE1 1 
ATOM   4368 N NE2 . GLN B 1 273 ? 59.206 17.011  22.560 1.00 135.78 ? 273  GLN B NE2 1 
ATOM   4369 N N   . ARG B 1 274 ? 53.962 14.445  19.211 1.00 38.94  ? 274  ARG B N   1 
ATOM   4370 C CA  . ARG B 1 274 ? 54.003 13.215  18.415 1.00 38.94  ? 274  ARG B CA  1 
ATOM   4371 C C   . ARG B 1 274 ? 54.107 13.519  16.935 1.00 38.94  ? 274  ARG B C   1 
ATOM   4372 O O   . ARG B 1 274 ? 53.403 14.385  16.421 1.00 38.94  ? 274  ARG B O   1 
ATOM   4373 C CB  . ARG B 1 274 ? 52.758 12.352  18.672 1.00 45.03  ? 274  ARG B CB  1 
ATOM   4374 C CG  . ARG B 1 274 ? 52.768 11.619  20.010 1.00 45.03  ? 274  ARG B CG  1 
ATOM   4375 C CD  . ARG B 1 274 ? 51.373 11.127  20.425 1.00 45.03  ? 274  ARG B CD  1 
ATOM   4376 N NE  . ARG B 1 274 ? 51.225 11.198  21.885 1.00 45.03  ? 274  ARG B NE  1 
ATOM   4377 C CZ  . ARG B 1 274 ? 50.091 11.020  22.560 1.00 45.03  ? 274  ARG B CZ  1 
ATOM   4378 N NH1 . ARG B 1 274 ? 48.956 10.742  21.932 1.00 45.03  ? 274  ARG B NH1 1 
ATOM   4379 N NH2 . ARG B 1 274 ? 50.089 11.156  23.877 1.00 45.03  ? 274  ARG B NH2 1 
ATOM   4380 N N   . ILE B 1 275 ? 55.005 12.823  16.248 1.00 47.69  ? 275  ILE B N   1 
ATOM   4381 C CA  . ILE B 1 275 ? 55.176 13.023  14.810 1.00 47.69  ? 275  ILE B CA  1 
ATOM   4382 C C   . ILE B 1 275 ? 53.874 12.540  14.167 1.00 47.69  ? 275  ILE B C   1 
ATOM   4383 O O   . ILE B 1 275 ? 53.126 11.791  14.788 1.00 47.69  ? 275  ILE B O   1 
ATOM   4384 C CB  . ILE B 1 275 ? 56.376 12.201  14.277 1.00 34.69  ? 275  ILE B CB  1 
ATOM   4385 C CG1 . ILE B 1 275 ? 56.547 12.431  12.777 1.00 34.69  ? 275  ILE B CG1 1 
ATOM   4386 C CG2 . ILE B 1 275 ? 56.164 10.738  14.581 1.00 34.69  ? 275  ILE B CG2 1 
ATOM   4387 C CD1 . ILE B 1 275 ? 57.810 11.835  12.188 1.00 34.69  ? 275  ILE B CD1 1 
ATOM   4388 N N   . SER B 1 276 ? 53.593 12.963  12.939 1.00 53.31  ? 276  SER B N   1 
ATOM   4389 C CA  . SER B 1 276 ? 52.358 12.552  12.273 1.00 53.31  ? 276  SER B CA  1 
ATOM   4390 C C   . SER B 1 276 ? 52.591 11.475  11.221 1.00 53.31  ? 276  SER B C   1 
ATOM   4391 O O   . SER B 1 276 ? 53.734 11.171  10.870 1.00 53.31  ? 276  SER B O   1 
ATOM   4392 C CB  . SER B 1 276 ? 51.700 13.746  11.596 1.00 41.10  ? 276  SER B CB  1 
ATOM   4393 O OG  . SER B 1 276 ? 52.254 13.909  10.304 1.00 41.10  ? 276  SER B OG  1 
ATOM   4394 N N   . ALA B 1 277 ? 51.495 10.911  10.714 1.00 48.47  ? 277  ALA B N   1 
ATOM   4395 C CA  . ALA B 1 277 ? 51.563 9.871   9.693  1.00 48.47  ? 277  ALA B CA  1 
ATOM   4396 C C   . ALA B 1 277 ? 52.369 10.362  8.497  1.00 48.47  ? 277  ALA B C   1 
ATOM   4397 O O   . ALA B 1 277 ? 53.328 9.720   8.084  1.00 48.47  ? 277  ALA B O   1 
ATOM   4398 C CB  . ALA B 1 277 ? 50.157 9.468   9.251  1.00 21.70  ? 277  ALA B CB  1 
ATOM   4399 N N   . GLU B 1 278 ? 51.982 11.502  7.938  1.00 55.76  ? 278  GLU B N   1 
ATOM   4400 C CA  . GLU B 1 278 ? 52.708 12.055  6.800  1.00 55.76  ? 278  GLU B CA  1 
ATOM   4401 C C   . GLU B 1 278 ? 54.193 12.167  7.159  1.00 55.76  ? 278  GLU B C   1 
ATOM   4402 O O   . GLU B 1 278 ? 55.044 11.508  6.559  1.00 55.76  ? 278  GLU B O   1 
ATOM   4403 C CB  . GLU B 1 278 ? 52.169 13.439  6.443  1.00 86.85  ? 278  GLU B CB  1 
ATOM   4404 C CG  . GLU B 1 278 ? 50.743 13.462  5.935  1.00 86.85  ? 278  GLU B CG  1 
ATOM   4405 C CD  . GLU B 1 278 ? 50.288 14.872  5.598  1.00 86.85  ? 278  GLU B CD  1 
ATOM   4406 O OE1 . GLU B 1 278 ? 50.977 15.537  4.793  1.00 86.85  ? 278  GLU B OE1 1 
ATOM   4407 O OE2 . GLU B 1 278 ? 49.247 15.318  6.136  1.00 86.85  ? 278  GLU B OE2 1 
ATOM   4408 N N   . GLU B 1 279 ? 54.489 13.005  8.147  1.00 51.95  ? 279  GLU B N   1 
ATOM   4409 C CA  . GLU B 1 279 ? 55.859 13.224  8.610  1.00 51.95  ? 279  GLU B CA  1 
ATOM   4410 C C   . GLU B 1 279 ? 56.618 11.909  8.800  1.00 51.95  ? 279  GLU B C   1 
ATOM   4411 O O   . GLU B 1 279 ? 57.782 11.777  8.407  1.00 51.95  ? 279  GLU B O   1 
ATOM   4412 C CB  . GLU B 1 279 ? 55.847 13.999  9.934  1.00 58.18  ? 279  GLU B CB  1 
ATOM   4413 C CG  . GLU B 1 279 ? 55.313 15.424  9.837  1.00 58.18  ? 279  GLU B CG  1 
ATOM   4414 C CD  . GLU B 1 279 ? 55.051 16.053  11.208 1.00 58.18  ? 279  GLU B CD  1 
ATOM   4415 O OE1 . GLU B 1 279 ? 55.066 17.300  11.308 1.00 58.18  ? 279  GLU B OE1 1 
ATOM   4416 O OE2 . GLU B 1 279 ? 54.817 15.307  12.185 1.00 58.18  ? 279  GLU B OE2 1 
ATOM   4417 N N   . ALA B 1 280 ? 55.958 10.937  9.416  1.00 63.99  ? 280  ALA B N   1 
ATOM   4418 C CA  . ALA B 1 280 ? 56.588 9.656   9.646  1.00 63.99  ? 280  ALA B CA  1 
ATOM   4419 C C   . ALA B 1 280 ? 57.045 9.077   8.309  1.00 63.99  ? 280  ALA B C   1 
ATOM   4420 O O   . ALA B 1 280 ? 58.206 8.712   8.142  1.00 63.99  ? 280  ALA B O   1 
ATOM   4421 C CB  . ALA B 1 280 ? 55.610 8.720   10.324 1.00 78.22  ? 280  ALA B CB  1 
ATOM   4422 N N   . LEU B 1 281 ? 56.124 9.011   7.356  1.00 47.54  ? 281  LEU B N   1 
ATOM   4423 C CA  . LEU B 1 281 ? 56.407 8.477   6.029  1.00 47.54  ? 281  LEU B CA  1 
ATOM   4424 C C   . LEU B 1 281 ? 57.539 9.221   5.315  1.00 47.54  ? 281  LEU B C   1 
ATOM   4425 O O   . LEU B 1 281 ? 58.169 8.685   4.401  1.00 47.54  ? 281  LEU B O   1 
ATOM   4426 C CB  . LEU B 1 281 ? 55.147 8.555   5.166  1.00 44.29  ? 281  LEU B CB  1 
ATOM   4427 C CG  . LEU B 1 281 ? 53.929 7.732   5.591  1.00 44.29  ? 281  LEU B CG  1 
ATOM   4428 C CD1 . LEU B 1 281 ? 52.686 8.284   4.910  1.00 44.29  ? 281  LEU B CD1 1 
ATOM   4429 C CD2 . LEU B 1 281 ? 54.145 6.251   5.241  1.00 44.29  ? 281  LEU B CD2 1 
ATOM   4430 N N   . GLN B 1 282 ? 57.782 10.462  5.719  1.00 66.87  ? 282  GLN B N   1 
ATOM   4431 C CA  . GLN B 1 282 ? 58.822 11.270  5.099  1.00 66.87  ? 282  GLN B CA  1 
ATOM   4432 C C   . GLN B 1 282 ? 60.091 11.252  5.925  1.00 66.87  ? 282  GLN B C   1 
ATOM   4433 O O   . GLN B 1 282 ? 61.019 12.011  5.669  1.00 66.87  ? 282  GLN B O   1 
ATOM   4434 C CB  . GLN B 1 282 ? 58.335 12.712  4.935  1.00 115.74 ? 282  GLN B CB  1 
ATOM   4435 C CG  . GLN B 1 282 ? 57.230 12.877  3.907  1.00 115.74 ? 282  GLN B CG  1 
ATOM   4436 C CD  . GLN B 1 282 ? 57.708 12.607  2.490  1.00 115.74 ? 282  GLN B CD  1 
ATOM   4437 O OE1 . GLN B 1 282 ? 56.910 12.545  1.553  1.00 115.74 ? 282  GLN B OE1 1 
ATOM   4438 N NE2 . GLN B 1 282 ? 59.019 12.453  2.326  1.00 115.74 ? 282  GLN B NE2 1 
ATOM   4439 N N   . HIS B 1 283 ? 60.129 10.375  6.916  1.00 71.39  ? 283  HIS B N   1 
ATOM   4440 C CA  . HIS B 1 283 ? 61.276 10.275  7.803  1.00 71.39  ? 283  HIS B CA  1 
ATOM   4441 C C   . HIS B 1 283 ? 62.394 9.415   7.199  1.00 71.39  ? 283  HIS B C   1 
ATOM   4442 O O   . HIS B 1 283 ? 62.130 8.407   6.540  1.00 71.39  ? 283  HIS B O   1 
ATOM   4443 C CB  . HIS B 1 283 ? 60.803 9.712   9.138  1.00 46.17  ? 283  HIS B CB  1 
ATOM   4444 C CG  . HIS B 1 283 ? 61.847 9.725   10.204 1.00 46.17  ? 283  HIS B CG  1 
ATOM   4445 N ND1 . HIS B 1 283 ? 62.888 8.823   10.236 1.00 46.17  ? 283  HIS B ND1 1 
ATOM   4446 C CD2 . HIS B 1 283 ? 62.010 10.530  11.280 1.00 46.17  ? 283  HIS B CD2 1 
ATOM   4447 C CE1 . HIS B 1 283 ? 63.646 9.068   11.291 1.00 46.17  ? 283  HIS B CE1 1 
ATOM   4448 N NE2 . HIS B 1 283 ? 63.135 10.099  11.942 1.00 46.17  ? 283  HIS B NE2 1 
ATOM   4449 N N   . PRO B 1 284 ? 63.662 9.803   7.421  1.00 84.97  ? 284  PRO B N   1 
ATOM   4450 C CA  . PRO B 1 284 ? 64.793 9.040   6.874  1.00 84.97  ? 284  PRO B CA  1 
ATOM   4451 C C   . PRO B 1 284 ? 64.654 7.515   6.886  1.00 84.97  ? 284  PRO B C   1 
ATOM   4452 O O   . PRO B 1 284 ? 64.951 6.857   5.888  1.00 84.97  ? 284  PRO B O   1 
ATOM   4453 C CB  . PRO B 1 284 ? 65.994 9.534   7.699  1.00 62.36  ? 284  PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 284 ? 65.378 10.200  8.911  1.00 62.36  ? 284  PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 284 ? 64.136 10.842  8.350  1.00 62.36  ? 284  PRO B CD  1 
ATOM   4456 N N   . TYR B 1 285 ? 64.197 6.966   8.008  1.00 59.95  ? 285  TYR B N   1 
ATOM   4457 C CA  . TYR B 1 285 ? 64.020 5.522   8.165  1.00 59.95  ? 285  TYR B CA  1 
ATOM   4458 C C   . TYR B 1 285 ? 63.499 4.846   6.913  1.00 59.95  ? 285  TYR B C   1 
ATOM   4459 O O   . TYR B 1 285 ? 63.871 3.717   6.612  1.00 59.95  ? 285  TYR B O   1 
ATOM   4460 C CB  . TYR B 1 285 ? 63.054 5.237   9.311  1.00 53.14  ? 285  TYR B CB  1 
ATOM   4461 C CG  . TYR B 1 285 ? 62.636 3.783   9.449  1.00 53.14  ? 285  TYR B CG  1 
ATOM   4462 C CD1 . TYR B 1 285 ? 63.524 2.823   9.948  1.00 53.14  ? 285  TYR B CD1 1 
ATOM   4463 C CD2 . TYR B 1 285 ? 61.330 3.376   9.137  1.00 53.14  ? 285  TYR B CD2 1 
ATOM   4464 C CE1 . TYR B 1 285 ? 63.115 1.498   10.148 1.00 53.14  ? 285  TYR B CE1 1 
ATOM   4465 C CE2 . TYR B 1 285 ? 60.914 2.055   9.330  1.00 53.14  ? 285  TYR B CE2 1 
ATOM   4466 C CZ  . TYR B 1 285 ? 61.807 1.126   9.841  1.00 53.14  ? 285  TYR B CZ  1 
ATOM   4467 O OH  . TYR B 1 285 ? 61.395 -0.161  10.094 1.00 53.14  ? 285  TYR B OH  1 
ATOM   4468 N N   . PHE B 1 286 ? 62.621 5.527   6.191  1.00 51.01  ? 286  PHE B N   1 
ATOM   4469 C CA  . PHE B 1 286 ? 62.058 4.959   4.975  1.00 51.01  ? 286  PHE B CA  1 
ATOM   4470 C C   . PHE B 1 286 ? 62.845 5.327   3.710  1.00 51.01  ? 286  PHE B C   1 
ATOM   4471 O O   . PHE B 1 286 ? 63.547 6.344   3.667  1.00 51.01  ? 286  PHE B O   1 
ATOM   4472 C CB  . PHE B 1 286 ? 60.588 5.381   4.834  1.00 72.88  ? 286  PHE B CB  1 
ATOM   4473 C CG  . PHE B 1 286 ? 59.669 4.736   5.841  1.00 72.88  ? 286  PHE B CG  1 
ATOM   4474 C CD1 . PHE B 1 286 ? 59.441 3.361   5.815  1.00 72.88  ? 286  PHE B CD1 1 
ATOM   4475 C CD2 . PHE B 1 286 ? 59.040 5.499   6.824  1.00 72.88  ? 286  PHE B CD2 1 
ATOM   4476 C CE1 . PHE B 1 286 ? 58.595 2.754   6.753  1.00 72.88  ? 286  PHE B CE1 1 
ATOM   4477 C CE2 . PHE B 1 286 ? 58.197 4.904   7.762  1.00 72.88  ? 286  PHE B CE2 1 
ATOM   4478 C CZ  . PHE B 1 286 ? 57.974 3.528   7.728  1.00 72.88  ? 286  PHE B CZ  1 
ATOM   4479 N N   . SER B 1 287 ? 62.721 4.471   2.698  1.00 113.38 ? 287  SER B N   1 
ATOM   4480 C CA  . SER B 1 287 ? 63.381 4.633   1.406  1.00 113.38 ? 287  SER B CA  1 
ATOM   4481 C C   . SER B 1 287 ? 63.187 3.364   0.582  1.00 113.38 ? 287  SER B C   1 
ATOM   4482 O O   . SER B 1 287 ? 62.569 2.414   1.111  1.00 113.38 ? 287  SER B O   1 
ATOM   4483 C CB  . SER B 1 287 ? 64.879 4.901   1.582  1.00 71.52  ? 287  SER B CB  1 
ATOM   4484 O OG  . SER B 1 287 ? 65.120 6.248   1.951  1.00 71.52  ? 287  SER B OG  1 
ATOM   4485 N N   . SER C 2 1   ? 22.859 -56.531 19.970 1.00 54.06  ? 147  SER D N   1 
ATOM   4486 C CA  . SER C 2 1   ? 22.536 -55.756 18.738 1.00 54.06  ? 147  SER D CA  1 
ATOM   4487 C C   . SER C 2 1   ? 21.563 -54.629 19.052 1.00 54.06  ? 147  SER D C   1 
ATOM   4488 O O   . SER C 2 1   ? 20.713 -54.756 19.920 1.00 54.06  ? 147  SER D O   1 
ATOM   4489 C CB  . SER C 2 1   ? 21.947 -56.677 17.674 1.00 115.19 ? 147  SER D CB  1 
ATOM   4490 N N   . THR C 2 2   ? 21.711 -53.519 18.343 1.00 66.59  ? 148  THR D N   1 
ATOM   4491 C CA  . THR C 2 2   ? 20.863 -52.356 18.530 1.00 66.59  ? 148  THR D CA  1 
ATOM   4492 C C   . THR C 2 2   ? 19.407 -52.777 18.724 1.00 66.59  ? 148  THR D C   1 
ATOM   4493 O O   . THR C 2 2   ? 18.973 -53.045 19.846 1.00 66.59  ? 148  THR D O   1 
ATOM   4494 C CB  . THR C 2 2   ? 20.978 -51.412 17.313 1.00 78.23  ? 148  THR D CB  1 
ATOM   4495 O OG1 . THR C 2 2   ? 22.353 -51.062 17.117 1.00 78.23  ? 148  THR D OG1 1 
ATOM   4496 C CG2 . THR C 2 2   ? 20.175 -50.143 17.532 1.00 78.23  ? 148  THR D CG2 1 
ATOM   4497 N N   . SER C 2 3   ? 18.667 -52.835 17.622 1.00 97.44  ? 149  SER D N   1 
ATOM   4498 C CA  . SER C 2 3   ? 17.259 -53.213 17.635 1.00 97.44  ? 149  SER D CA  1 
ATOM   4499 C C   . SER C 2 3   ? 16.783 -53.871 18.930 1.00 97.44  ? 149  SER D C   1 
ATOM   4500 O O   . SER C 2 3   ? 15.994 -53.291 19.666 1.00 97.44  ? 149  SER D O   1 
ATOM   4501 C CB  . SER C 2 3   ? 16.962 -54.133 16.451 1.00 143.02 ? 149  SER D CB  1 
ATOM   4502 O OG  . SER C 2 3   ? 15.591 -54.472 16.427 1.00 143.02 ? 149  SER D OG  1 
ATOM   4503 N N   . GLU C 2 4   ? 17.265 -55.081 19.199 1.00 62.31  ? 150  GLU D N   1 
ATOM   4504 C CA  . GLU C 2 4   ? 16.896 -55.838 20.403 1.00 62.31  ? 150  GLU D CA  1 
ATOM   4505 C C   . GLU C 2 4   ? 16.842 -54.974 21.674 1.00 62.31  ? 150  GLU D C   1 
ATOM   4506 O O   . GLU C 2 4   ? 15.818 -54.932 22.351 1.00 62.31  ? 150  GLU D O   1 
ATOM   4507 C CB  . GLU C 2 4   ? 17.873 -57.009 20.580 1.00 200.61 ? 150  GLU D CB  1 
ATOM   4508 C CG  . GLU C 2 4   ? 19.157 -56.833 19.778 1.00 200.61 ? 150  GLU D CG  1 
ATOM   4509 C CD  . GLU C 2 4   ? 20.282 -57.752 20.225 1.00 200.61 ? 150  GLU D CD  1 
ATOM   4510 O OE1 . GLU C 2 4   ? 20.638 -57.725 21.420 1.00 200.61 ? 150  GLU D OE1 1 
ATOM   4511 O OE2 . GLU C 2 4   ? 20.816 -58.487 19.364 1.00 200.61 ? 150  GLU D OE2 1 
ATOM   4512 N N   . LEU C 2 5   ? 17.937 -54.284 21.991 1.00 56.52  ? 151  LEU D N   1 
ATOM   4513 C CA  . LEU C 2 5   ? 17.982 -53.420 23.169 1.00 56.52  ? 151  LEU D CA  1 
ATOM   4514 C C   . LEU C 2 5   ? 16.912 -52.330 23.066 1.00 56.52  ? 151  LEU D C   1 
ATOM   4515 O O   . LEU C 2 5   ? 16.337 -51.916 24.071 1.00 56.52  ? 151  LEU D O   1 
ATOM   4516 C CB  . LEU C 2 5   ? 19.379 -52.798 23.320 1.00 35.00  ? 151  LEU D CB  1 
ATOM   4517 C CG  . LEU C 2 5   ? 20.504 -53.776 23.697 1.00 35.00  ? 151  LEU D CG  1 
ATOM   4518 C CD1 . LEU C 2 5   ? 21.860 -53.092 23.607 1.00 35.00  ? 151  LEU D CD1 1 
ATOM   4519 C CD2 . LEU C 2 5   ? 20.277 -54.306 25.102 1.00 35.00  ? 151  LEU D CD2 1 
ATOM   4520 N N   . LEU C 2 6   ? 16.638 -51.880 21.843 1.00 65.45  ? 152  LEU D N   1 
ATOM   4521 C CA  . LEU C 2 6   ? 15.626 -50.848 21.605 1.00 65.45  ? 152  LEU D CA  1 
ATOM   4522 C C   . LEU C 2 6   ? 14.258 -51.297 22.119 1.00 65.45  ? 152  LEU D C   1 
ATOM   4523 O O   . LEU C 2 6   ? 13.633 -50.580 22.902 1.00 65.45  ? 152  LEU D O   1 
ATOM   4524 C CB  . LEU C 2 6   ? 15.551 -50.522 20.114 1.00 48.60  ? 152  LEU D CB  1 
ATOM   4525 C CG  . LEU C 2 6   ? 16.796 -49.817 19.577 1.00 48.60  ? 152  LEU D CG  1 
ATOM   4526 C CD1 . LEU C 2 6   ? 16.768 -49.788 18.060 1.00 48.60  ? 152  LEU D CD1 1 
ATOM   4527 C CD2 . LEU C 2 6   ? 16.844 -48.397 20.149 1.00 48.60  ? 152  LEU D CD2 1 
ATOM   4528 N N   . ARG C 2 7   ? 13.806 -52.479 21.686 1.00 55.90  ? 153  ARG D N   1 
ATOM   4529 C CA  . ARG C 2 7   ? 12.521 -53.032 22.135 1.00 55.90  ? 153  ARG D CA  1 
ATOM   4530 C C   . ARG C 2 7   ? 12.495 -53.060 23.654 1.00 55.90  ? 153  ARG D C   1 
ATOM   4531 O O   . ARG C 2 7   ? 11.470 -52.761 24.274 1.00 55.90  ? 153  ARG D O   1 
ATOM   4532 C CB  . ARG C 2 7   ? 12.312 -54.463 21.629 1.00 118.29 ? 153  ARG D CB  1 
ATOM   4533 C CG  . ARG C 2 7   ? 12.068 -54.591 20.141 1.00 118.29 ? 153  ARG D CG  1 
ATOM   4534 C CD  . ARG C 2 7   ? 12.009 -56.059 19.739 1.00 118.29 ? 153  ARG D CD  1 
ATOM   4535 N NE  . ARG C 2 7   ? 11.904 -56.225 18.292 1.00 118.29 ? 153  ARG D NE  1 
ATOM   4536 C CZ  . ARG C 2 7   ? 11.809 -57.400 17.678 1.00 118.29 ? 153  ARG D CZ  1 
ATOM   4537 N NH1 . ARG C 2 7   ? 11.807 -58.524 18.386 1.00 118.29 ? 153  ARG D NH1 1 
ATOM   4538 N NH2 . ARG C 2 7   ? 11.710 -57.452 16.355 1.00 118.29 ? 153  ARG D NH2 1 
ATOM   4539 N N   . CYS C 2 8   ? 13.620 -53.432 24.256 1.00 53.62  ? 154  CYS D N   1 
ATOM   4540 C CA  . CYS C 2 8   ? 13.690 -53.477 25.706 1.00 53.62  ? 154  CYS D CA  1 
ATOM   4541 C C   . CYS C 2 8   ? 13.440 -52.073 26.224 1.00 53.62  ? 154  CYS D C   1 
ATOM   4542 O O   . CYS C 2 8   ? 12.721 -51.892 27.212 1.00 53.62  ? 154  CYS D O   1 
ATOM   4543 C CB  . CYS C 2 8   ? 15.054 -53.988 26.171 1.00 52.80  ? 154  CYS D CB  1 
ATOM   4544 S SG  . CYS C 2 8   ? 15.401 -55.681 25.624 1.00 52.80  ? 154  CYS D SG  1 
ATOM   4545 N N   . LEU C 2 9   ? 14.020 -51.083 25.545 1.00 50.64  ? 155  LEU D N   1 
ATOM   4546 C CA  . LEU C 2 9   ? 13.830 -49.689 25.938 1.00 50.64  ? 155  LEU D CA  1 
ATOM   4547 C C   . LEU C 2 9   ? 12.319 -49.405 25.851 1.00 50.64  ? 155  LEU D C   1 
ATOM   4548 O O   . LEU C 2 9   ? 11.709 -48.944 26.819 1.00 50.64  ? 155  LEU D O   1 
ATOM   4549 C CB  . LEU C 2 9   ? 14.578 -48.750 24.985 1.00 36.31  ? 155  LEU D CB  1 
ATOM   4550 C CG  . LEU C 2 9   ? 15.254 -47.498 25.559 1.00 36.31  ? 155  LEU D CG  1 
ATOM   4551 C CD1 . LEU C 2 9   ? 15.423 -46.519 24.412 1.00 36.31  ? 155  LEU D CD1 1 
ATOM   4552 C CD2 . LEU C 2 9   ? 14.458 -46.855 26.686 1.00 36.31  ? 155  LEU D CD2 1 
ATOM   4553 N N   . GLY C 2 10  ? 11.728 -49.688 24.689 1.00 57.21  ? 156  GLY D N   1 
ATOM   4554 C CA  . GLY C 2 10  ? 10.303 -49.477 24.520 1.00 57.21  ? 156  GLY D CA  1 
ATOM   4555 C C   . GLY C 2 10  ? 9.580  -50.236 25.618 1.00 57.21  ? 156  GLY D C   1 
ATOM   4556 O O   . GLY C 2 10  ? 8.791  -49.667 26.381 1.00 57.21  ? 156  GLY D O   1 
ATOM   4557 N N   . GLU C 2 11  ? 9.870  -51.531 25.704 1.00 59.55  ? 157  GLU D N   1 
ATOM   4558 C CA  . GLU C 2 11  ? 9.271  -52.380 26.715 1.00 59.55  ? 157  GLU D CA  1 
ATOM   4559 C C   . GLU C 2 11  ? 9.257  -51.586 28.020 1.00 59.55  ? 157  GLU D C   1 
ATOM   4560 O O   . GLU C 2 11  ? 8.197  -51.269 28.568 1.00 59.55  ? 157  GLU D O   1 
ATOM   4561 C CB  . GLU C 2 11  ? 10.106 -53.654 26.886 1.00 86.61  ? 157  GLU D CB  1 
ATOM   4562 C CG  . GLU C 2 11  ? 9.290  -54.942 26.979 1.00 86.61  ? 157  GLU D CG  1 
ATOM   4563 C CD  . GLU C 2 11  ? 8.660  -55.345 25.649 1.00 86.61  ? 157  GLU D CD  1 
ATOM   4564 O OE1 . GLU C 2 11  ? 9.409  -55.675 24.703 1.00 86.61  ? 157  GLU D OE1 1 
ATOM   4565 O OE2 . GLU C 2 11  ? 7.414  -55.331 25.549 1.00 86.61  ? 157  GLU D OE2 1 
ATOM   4566 N N   . PHE C 2 12  ? 10.447 -51.241 28.497 1.00 54.90  ? 158  PHE D N   1 
ATOM   4567 C CA  . PHE C 2 12  ? 10.581 -50.488 29.730 1.00 54.90  ? 158  PHE D CA  1 
ATOM   4568 C C   . PHE C 2 12  ? 9.747  -49.215 29.785 1.00 54.90  ? 158  PHE D C   1 
ATOM   4569 O O   . PHE C 2 12  ? 9.109  -48.929 30.792 1.00 54.90  ? 158  PHE D O   1 
ATOM   4570 C CB  . PHE C 2 12  ? 12.031 -50.093 29.966 1.00 35.74  ? 158  PHE D CB  1 
ATOM   4571 C CG  . PHE C 2 12  ? 12.180 -49.010 30.995 1.00 35.74  ? 158  PHE D CG  1 
ATOM   4572 C CD1 . PHE C 2 12  ? 12.019 -49.295 32.347 1.00 35.74  ? 158  PHE D CD1 1 
ATOM   4573 C CD2 . PHE C 2 12  ? 12.394 -47.692 30.603 1.00 35.74  ? 158  PHE D CD2 1 
ATOM   4574 C CE1 . PHE C 2 12  ? 12.056 -48.276 33.298 1.00 35.74  ? 158  PHE D CE1 1 
ATOM   4575 C CE2 . PHE C 2 12  ? 12.434 -46.678 31.528 1.00 35.74  ? 158  PHE D CE2 1 
ATOM   4576 C CZ  . PHE C 2 12  ? 12.267 -46.961 32.881 1.00 35.74  ? 158  PHE D CZ  1 
ATOM   4577 N N   . LEU C 2 13  ? 9.780  -48.438 28.711 1.00 69.86  ? 159  LEU D N   1 
ATOM   4578 C CA  . LEU C 2 13  ? 9.046  -47.183 28.674 1.00 69.86  ? 159  LEU D CA  1 
ATOM   4579 C C   . LEU C 2 13  ? 7.538  -47.365 28.835 1.00 69.86  ? 159  LEU D C   1 
ATOM   4580 O O   . LEU C 2 13  ? 6.841  -46.440 29.241 1.00 69.86  ? 159  LEU D O   1 
ATOM   4581 C CB  . LEU C 2 13  ? 9.382  -46.412 27.388 1.00 82.35  ? 159  LEU D CB  1 
ATOM   4582 C CG  . LEU C 2 13  ? 10.833 -45.902 27.321 1.00 82.35  ? 159  LEU D CG  1 
ATOM   4583 C CD1 . LEU C 2 13  ? 11.095 -45.233 25.991 1.00 82.35  ? 159  LEU D CD1 1 
ATOM   4584 C CD2 . LEU C 2 13  ? 11.100 -44.925 28.455 1.00 82.35  ? 159  LEU D CD2 1 
ATOM   4585 N N   . CYS C 2 14  ? 7.034  -48.557 28.538 1.00 87.36  ? 160  CYS D N   1 
ATOM   4586 C CA  . CYS C 2 14  ? 5.609  -48.811 28.695 1.00 87.36  ? 160  CYS D CA  1 
ATOM   4587 C C   . CYS C 2 14  ? 5.323  -49.250 30.127 1.00 87.36  ? 160  CYS D C   1 
ATOM   4588 O O   . CYS C 2 14  ? 4.297  -48.890 30.707 1.00 87.36  ? 160  CYS D O   1 
ATOM   4589 C CB  . CYS C 2 14  ? 5.143  -49.886 27.720 1.00 61.06  ? 160  CYS D CB  1 
ATOM   4590 S SG  . CYS C 2 14  ? 5.162  -49.367 25.994 1.00 61.06  ? 160  CYS D SG  1 
ATOM   4591 N N   . ARG C 2 15  ? 6.239  -50.023 30.700 1.00 80.00  ? 161  ARG D N   1 
ATOM   4592 C CA  . ARG C 2 15  ? 6.073  -50.498 32.068 1.00 80.00  ? 161  ARG D CA  1 
ATOM   4593 C C   . ARG C 2 15  ? 6.245  -49.334 33.046 1.00 80.00  ? 161  ARG D C   1 
ATOM   4594 O O   . ARG C 2 15  ? 5.858  -49.426 34.212 1.00 80.00  ? 161  ARG D O   1 
ATOM   4595 C CB  . ARG C 2 15  ? 7.093  -51.597 32.373 1.00 138.59 ? 161  ARG D CB  1 
ATOM   4596 C CG  . ARG C 2 15  ? 6.913  -52.257 33.727 1.00 138.59 ? 161  ARG D CG  1 
ATOM   4597 C CD  . ARG C 2 15  ? 7.994  -53.297 33.986 1.00 138.59 ? 161  ARG D CD  1 
ATOM   4598 N NE  . ARG C 2 15  ? 7.840  -53.913 35.301 1.00 138.59 ? 161  ARG D NE  1 
ATOM   4599 C CZ  . ARG C 2 15  ? 8.694  -54.785 35.831 1.00 138.59 ? 161  ARG D CZ  1 
ATOM   4600 N NH1 . ARG C 2 15  ? 9.776  -55.154 35.158 1.00 138.59 ? 161  ARG D NH1 1 
ATOM   4601 N NH2 . ARG C 2 15  ? 8.464  -55.287 37.039 1.00 138.59 ? 161  ARG D NH2 1 
ATOM   4602 N N   . ARG C 2 16  ? 6.822  -48.237 32.558 1.00 77.05  ? 162  ARG D N   1 
ATOM   4603 C CA  . ARG C 2 16  ? 7.045  -47.050 33.382 1.00 77.05  ? 162  ARG D CA  1 
ATOM   4604 C C   . ARG C 2 16  ? 5.874  -46.074 33.283 1.00 77.05  ? 162  ARG D C   1 
ATOM   4605 O O   . ARG C 2 16  ? 5.379  -45.578 34.297 1.00 77.05  ? 162  ARG D O   1 
ATOM   4606 C CB  . ARG C 2 16  ? 8.343  -46.345 32.960 1.00 57.55  ? 162  ARG D CB  1 
ATOM   4607 C CG  . ARG C 2 16  ? 8.570  -44.991 33.626 1.00 57.55  ? 162  ARG D CG  1 
ATOM   4608 C CD  . ARG C 2 16  ? 8.582  -45.109 35.150 1.00 57.55  ? 162  ARG D CD  1 
ATOM   4609 N NE  . ARG C 2 16  ? 9.641  -46.000 35.626 1.00 57.55  ? 162  ARG D NE  1 
ATOM   4610 C CZ  . ARG C 2 16  ? 10.924 -45.662 35.720 1.00 57.55  ? 162  ARG D CZ  1 
ATOM   4611 N NH1 . ARG C 2 16  ? 11.322 -44.439 35.378 1.00 57.55  ? 162  ARG D NH1 1 
ATOM   4612 N NH2 . ARG C 2 16  ? 11.812 -46.561 36.133 1.00 57.55  ? 162  ARG D NH2 1 
ATOM   4613 N N   . CYS C 2 17  ? 5.439  -45.812 32.052 1.00 69.84  ? 163  CYS D N   1 
ATOM   4614 C CA  . CYS C 2 17  ? 4.337  -44.894 31.782 1.00 69.84  ? 163  CYS D CA  1 
ATOM   4615 C C   . CYS C 2 17  ? 3.008  -45.647 31.671 1.00 69.84  ? 163  CYS D C   1 
ATOM   4616 O O   . CYS C 2 17  ? 2.202  -45.391 30.774 1.00 69.84  ? 163  CYS D O   1 
ATOM   4617 C CB  . CYS C 2 17  ? 4.615  -44.129 30.482 1.00 79.85  ? 163  CYS D CB  1 
ATOM   4618 S SG  . CYS C 2 17  ? 6.209  -43.262 30.447 1.00 79.85  ? 163  CYS D SG  1 
ATOM   4619 N N   . TYR C 2 18  ? 2.797  -46.573 32.600 1.00 82.95  ? 164  TYR D N   1 
ATOM   4620 C CA  . TYR C 2 18  ? 1.593  -47.395 32.654 1.00 82.95  ? 164  TYR D CA  1 
ATOM   4621 C C   . TYR C 2 18  ? 0.316  -46.614 32.343 1.00 82.95  ? 164  TYR D C   1 
ATOM   4622 O O   . TYR C 2 18  ? -0.646 -47.161 31.800 1.00 82.95  ? 164  TYR D O   1 
ATOM   4623 C CB  . TYR C 2 18  ? 1.470  -48.025 34.049 1.00 92.38  ? 164  TYR D CB  1 
ATOM   4624 C CG  . TYR C 2 18  ? 0.997  -47.064 35.125 1.00 92.38  ? 164  TYR D CG  1 
ATOM   4625 C CD1 . TYR C 2 18  ? -0.350 -46.711 35.230 1.00 92.38  ? 164  TYR D CD1 1 
ATOM   4626 C CD2 . TYR C 2 18  ? 1.899  -46.470 36.004 1.00 92.38  ? 164  TYR D CD2 1 
ATOM   4627 C CE1 . TYR C 2 18  ? -0.787 -45.791 36.175 1.00 92.38  ? 164  TYR D CE1 1 
ATOM   4628 C CE2 . TYR C 2 18  ? 1.471  -45.543 36.960 1.00 92.38  ? 164  TYR D CE2 1 
ATOM   4629 C CZ  . TYR C 2 18  ? 0.125  -45.207 37.035 1.00 92.38  ? 164  TYR D CZ  1 
ATOM   4630 O OH  . TYR C 2 18  ? -0.308 -44.275 37.954 1.00 92.38  ? 164  TYR D OH  1 
ATOM   4631 N N   . ARG C 2 19  ? 0.317  -45.334 32.697 1.00 82.43  ? 165  ARG D N   1 
ATOM   4632 C CA  . ARG C 2 19  ? -0.841 -44.474 32.503 1.00 82.43  ? 165  ARG D CA  1 
ATOM   4633 C C   . ARG C 2 19  ? -1.259 -44.276 31.041 1.00 82.43  ? 165  ARG D C   1 
ATOM   4634 O O   . ARG C 2 19  ? -2.152 -43.480 30.742 1.00 82.43  ? 165  ARG D O   1 
ATOM   4635 C CB  . ARG C 2 19  ? -0.579 -43.123 33.169 1.00 100.16 ? 165  ARG D CB  1 
ATOM   4636 C CG  . ARG C 2 19  ? -1.816 -42.275 33.348 1.00 100.16 ? 165  ARG D CG  1 
ATOM   4637 C CD  . ARG C 2 19  ? -1.454 -40.929 33.928 1.00 100.16 ? 165  ARG D CD  1 
ATOM   4638 N NE  . ARG C 2 19  ? -2.602 -40.034 33.984 1.00 100.16 ? 165  ARG D NE  1 
ATOM   4639 C CZ  . ARG C 2 19  ? -2.514 -38.732 34.227 1.00 100.16 ? 165  ARG D CZ  1 
ATOM   4640 N NH1 . ARG C 2 19  ? -1.329 -38.175 34.437 1.00 100.16 ? 165  ARG D NH1 1 
ATOM   4641 N NH2 . ARG C 2 19  ? -3.609 -37.987 34.253 1.00 100.16 ? 165  ARG D NH2 1 
ATOM   4642 N N   . LEU C 2 20  ? -0.617 -45.000 30.131 1.00 96.77  ? 166  LEU D N   1 
ATOM   4643 C CA  . LEU C 2 20  ? -0.951 -44.905 28.712 1.00 96.77  ? 166  LEU D CA  1 
ATOM   4644 C C   . LEU C 2 20  ? -0.961 -46.285 28.074 1.00 96.77  ? 166  LEU D C   1 
ATOM   4645 O O   . LEU C 2 20  ? -0.069 -46.639 27.297 1.00 96.77  ? 166  LEU D O   1 
ATOM   4646 C CB  . LEU C 2 20  ? 0.043  -43.999 27.980 1.00 167.86 ? 166  LEU D CB  1 
ATOM   4647 C CG  . LEU C 2 20  ? -0.052 -42.511 28.328 1.00 167.86 ? 166  LEU D CG  1 
ATOM   4648 C CD1 . LEU C 2 20  ? 0.893  -41.723 27.435 1.00 167.86 ? 166  LEU D CD1 1 
ATOM   4649 C CD2 . LEU C 2 20  ? -1.487 -42.027 28.142 1.00 167.86 ? 166  LEU D CD2 1 
ATOM   4650 N N   . LYS C 2 21  ? -1.993 -47.053 28.411 1.00 97.28  ? 167  LYS D N   1 
ATOM   4651 C CA  . LYS C 2 21  ? -2.157 -48.408 27.911 1.00 97.28  ? 167  LYS D CA  1 
ATOM   4652 C C   . LYS C 2 21  ? -2.554 -48.430 26.444 1.00 97.28  ? 167  LYS D C   1 
ATOM   4653 O O   . LYS C 2 21  ? -3.284 -49.310 25.989 1.00 97.28  ? 167  LYS D O   1 
ATOM   4654 C CB  . LYS C 2 21  ? -3.191 -49.138 28.765 1.00 92.14  ? 167  LYS D CB  1 
ATOM   4655 C CG  . LYS C 2 21  ? -2.842 -49.080 30.238 1.00 92.14  ? 167  LYS D CG  1 
ATOM   4656 C CD  . LYS C 2 21  ? -3.771 -49.902 31.100 1.00 92.14  ? 167  LYS D CD  1 
ATOM   4657 C CE  . LYS C 2 21  ? -3.384 -49.746 32.565 1.00 92.14  ? 167  LYS D CE  1 
ATOM   4658 N NZ  . LYS C 2 21  ? -4.141 -50.654 33.469 1.00 92.14  ? 167  LYS D NZ  1 
ATOM   4659 N N   . HIS C 2 22  ? -2.061 -47.451 25.701 1.00 97.89  ? 168  HIS D N   1 
ATOM   4660 C CA  . HIS C 2 22  ? -2.344 -47.365 24.282 1.00 97.89  ? 168  HIS D CA  1 
ATOM   4661 C C   . HIS C 2 22  ? -0.990 -47.430 23.601 1.00 97.89  ? 168  HIS D C   1 
ATOM   4662 O O   . HIS C 2 22  ? -0.890 -47.369 22.376 1.00 97.89  ? 168  HIS D O   1 
ATOM   4663 C CB  . HIS C 2 22  ? -3.018 -46.031 23.960 1.00 142.12 ? 168  HIS D CB  1 
ATOM   4664 C CG  . HIS C 2 22  ? -2.059 -44.893 23.790 1.00 142.12 ? 168  HIS D CG  1 
ATOM   4665 N ND1 . HIS C 2 22  ? -1.227 -44.781 22.697 1.00 142.12 ? 168  HIS D ND1 1 
ATOM   4666 C CD2 . HIS C 2 22  ? -1.789 -43.825 24.578 1.00 142.12 ? 168  HIS D CD2 1 
ATOM   4667 C CE1 . HIS C 2 22  ? -0.488 -43.694 22.817 1.00 142.12 ? 168  HIS D CE1 1 
ATOM   4668 N NE2 . HIS C 2 22  ? -0.809 -43.095 23.950 1.00 142.12 ? 168  HIS D NE2 1 
ATOM   4669 N N   . LEU C 2 23  ? 0.053  -47.566 24.414 1.00 85.39  ? 169  LEU D N   1 
ATOM   4670 C CA  . LEU C 2 23  ? 1.410  -47.585 23.894 1.00 85.39  ? 169  LEU D CA  1 
ATOM   4671 C C   . LEU C 2 23  ? 2.027  -48.950 23.625 1.00 85.39  ? 169  LEU D C   1 
ATOM   4672 O O   . LEU C 2 23  ? 1.801  -49.919 24.349 1.00 85.39  ? 169  LEU D O   1 
ATOM   4673 C CB  . LEU C 2 23  ? 2.321  -46.773 24.822 1.00 105.91 ? 169  LEU D CB  1 
ATOM   4674 C CG  . LEU C 2 23  ? 3.357  -45.897 24.111 1.00 105.91 ? 169  LEU D CG  1 
ATOM   4675 C CD1 . LEU C 2 23  ? 3.812  -44.774 25.026 1.00 105.91 ? 169  LEU D CD1 1 
ATOM   4676 C CD2 . LEU C 2 23  ? 4.525  -46.753 23.669 1.00 105.91 ? 169  LEU D CD2 1 
ATOM   4677 N N   . SER C 2 24  ? 2.809  -48.992 22.553 1.00 124.89 ? 170  SER D N   1 
ATOM   4678 C CA  . SER C 2 24  ? 3.518  -50.183 22.112 1.00 124.89 ? 170  SER D CA  1 
ATOM   4679 C C   . SER C 2 24  ? 5.016  -49.889 22.174 1.00 124.89 ? 170  SER D C   1 
ATOM   4680 O O   . SER C 2 24  ? 5.451  -48.772 21.899 1.00 124.89 ? 170  SER D O   1 
ATOM   4681 C CB  . SER C 2 24  ? 3.115  -50.527 20.676 1.00 65.15  ? 170  SER D CB  1 
ATOM   4682 O OG  . SER C 2 24  ? 3.948  -51.543 20.145 1.00 65.15  ? 170  SER D OG  1 
ATOM   4683 N N   . PRO C 2 25  ? 5.826  -50.892 22.535 1.00 111.39 ? 171  PRO D N   1 
ATOM   4684 C CA  . PRO C 2 25  ? 7.274  -50.693 22.622 1.00 111.39 ? 171  PRO D CA  1 
ATOM   4685 C C   . PRO C 2 25  ? 7.868  -50.189 21.310 1.00 111.39 ? 171  PRO D C   1 
ATOM   4686 O O   . PRO C 2 25  ? 8.965  -49.635 21.283 1.00 111.39 ? 171  PRO D O   1 
ATOM   4687 C CB  . PRO C 2 25  ? 7.787  -52.083 22.995 1.00 86.33  ? 171  PRO D CB  1 
ATOM   4688 C CG  . PRO C 2 25  ? 6.640  -52.673 23.756 1.00 86.33  ? 171  PRO D CG  1 
ATOM   4689 C CD  . PRO C 2 25  ? 5.469  -52.271 22.903 1.00 86.33  ? 171  PRO D CD  1 
ATOM   4690 N N   . THR C 2 26  ? 7.124  -50.374 20.226 1.00 57.15  ? 172  THR D N   1 
ATOM   4691 C CA  . THR C 2 26  ? 7.568  -49.965 18.900 1.00 57.15  ? 172  THR D CA  1 
ATOM   4692 C C   . THR C 2 26  ? 7.579  -48.446 18.677 1.00 57.15  ? 172  THR D C   1 
ATOM   4693 O O   . THR C 2 26  ? 8.426  -47.924 17.951 1.00 57.15  ? 172  THR D O   1 
ATOM   4694 C CB  . THR C 2 26  ? 6.682  -50.627 17.820 1.00 59.21  ? 172  THR D CB  1 
ATOM   4695 O OG1 . THR C 2 26  ? 6.392  -51.973 18.215 1.00 59.21  ? 172  THR D OG1 1 
ATOM   4696 C CG2 . THR C 2 26  ? 7.396  -50.651 16.473 1.00 59.21  ? 172  THR D CG2 1 
ATOM   4697 N N   . ASP C 2 27  ? 6.642  -47.734 19.294 1.00 73.93  ? 173  ASP D N   1 
ATOM   4698 C CA  . ASP C 2 27  ? 6.579  -46.290 19.115 1.00 73.93  ? 173  ASP D CA  1 
ATOM   4699 C C   . ASP C 2 27  ? 7.854  -45.580 19.571 1.00 73.93  ? 173  ASP D C   1 
ATOM   4700 O O   . ASP C 2 27  ? 8.543  -44.947 18.766 1.00 73.93  ? 173  ASP D O   1 
ATOM   4701 C CB  . ASP C 2 27  ? 5.368  -45.705 19.852 1.00 103.67 ? 173  ASP D CB  1 
ATOM   4702 C CG  . ASP C 2 27  ? 4.050  -46.132 19.239 1.00 103.67 ? 173  ASP D CG  1 
ATOM   4703 O OD1 . ASP C 2 27  ? 3.891  -45.991 18.008 1.00 103.67 ? 173  ASP D OD1 1 
ATOM   4704 O OD2 . ASP C 2 27  ? 3.168  -46.602 19.990 1.00 103.67 ? 173  ASP D OD2 1 
ATOM   4705 N N   . PRO C 2 28  ? 8.190  -45.685 20.867 1.00 67.57  ? 174  PRO D N   1 
ATOM   4706 C CA  . PRO C 2 28  ? 9.392  -45.032 21.390 1.00 67.57  ? 174  PRO D CA  1 
ATOM   4707 C C   . PRO C 2 28  ? 10.602 -45.292 20.503 1.00 67.57  ? 174  PRO D C   1 
ATOM   4708 O O   . PRO C 2 28  ? 11.437 -44.408 20.306 1.00 67.57  ? 174  PRO D O   1 
ATOM   4709 C CB  . PRO C 2 28  ? 9.552  -45.657 22.768 1.00 59.84  ? 174  PRO D CB  1 
ATOM   4710 C CG  . PRO C 2 28  ? 8.159  -45.989 23.151 1.00 59.84  ? 174  PRO D CG  1 
ATOM   4711 C CD  . PRO C 2 28  ? 7.598  -46.566 21.883 1.00 59.84  ? 174  PRO D CD  1 
ATOM   4712 N N   . VAL C 2 29  ? 10.689 -46.509 19.969 1.00 63.62  ? 175  VAL D N   1 
ATOM   4713 C CA  . VAL C 2 29  ? 11.801 -46.889 19.100 1.00 63.62  ? 175  VAL D CA  1 
ATOM   4714 C C   . VAL C 2 29  ? 11.701 -46.167 17.769 1.00 63.62  ? 175  VAL D C   1 
ATOM   4715 O O   . VAL C 2 29  ? 12.715 -45.798 17.169 1.00 63.62  ? 175  VAL D O   1 
ATOM   4716 C CB  . VAL C 2 29  ? 11.817 -48.402 18.808 1.00 52.27  ? 175  VAL D CB  1 
ATOM   4717 C CG1 . VAL C 2 29  ? 12.959 -48.724 17.837 1.00 52.27  ? 175  VAL D CG1 1 
ATOM   4718 C CG2 . VAL C 2 29  ? 11.974 -49.194 20.109 1.00 52.27  ? 175  VAL D CG2 1 
ATOM   4719 N N   . LEU C 2 30  ? 10.473 -45.976 17.303 1.00 51.98  ? 176  LEU D N   1 
ATOM   4720 C CA  . LEU C 2 30  ? 10.261 -45.294 16.038 1.00 51.98  ? 176  LEU D CA  1 
ATOM   4721 C C   . LEU C 2 30  ? 10.720 -43.853 16.198 1.00 51.98  ? 176  LEU D C   1 
ATOM   4722 O O   . LEU C 2 30  ? 11.283 -43.267 15.268 1.00 51.98  ? 176  LEU D O   1 
ATOM   4723 C CB  . LEU C 2 30  ? 8.783  -45.331 15.642 1.00 93.66  ? 176  LEU D CB  1 
ATOM   4724 C CG  . LEU C 2 30  ? 8.462  -44.761 14.257 1.00 93.66  ? 176  LEU D CG  1 
ATOM   4725 C CD1 . LEU C 2 30  ? 9.160  -45.590 13.184 1.00 93.66  ? 176  LEU D CD1 1 
ATOM   4726 C CD2 . LEU C 2 30  ? 6.958  -44.763 14.037 1.00 93.66  ? 176  LEU D CD2 1 
ATOM   4727 N N   . TRP C 2 31  ? 10.486 -43.291 17.385 1.00 51.84  ? 177  TRP D N   1 
ATOM   4728 C CA  . TRP C 2 31  ? 10.882 -41.918 17.662 1.00 51.84  ? 177  TRP D CA  1 
ATOM   4729 C C   . TRP C 2 31  ? 12.402 -41.804 17.698 1.00 51.84  ? 177  TRP D C   1 
ATOM   4730 O O   . TRP C 2 31  ? 12.968 -40.861 17.145 1.00 51.84  ? 177  TRP D O   1 
ATOM   4731 C CB  . TRP C 2 31  ? 10.293 -41.432 18.991 1.00 69.18  ? 177  TRP D CB  1 
ATOM   4732 C CG  . TRP C 2 31  ? 8.792  -41.467 19.047 1.00 69.18  ? 177  TRP D CG  1 
ATOM   4733 C CD1 . TRP C 2 31  ? 7.928  -41.347 17.994 1.00 69.18  ? 177  TRP D CD1 1 
ATOM   4734 C CD2 . TRP C 2 31  ? 7.976  -41.622 20.219 1.00 69.18  ? 177  TRP D CD2 1 
ATOM   4735 N NE1 . TRP C 2 31  ? 6.628  -41.423 18.437 1.00 69.18  ? 177  TRP D NE1 1 
ATOM   4736 C CE2 . TRP C 2 31  ? 6.628  -41.593 19.797 1.00 69.18  ? 177  TRP D CE2 1 
ATOM   4737 C CE3 . TRP C 2 31  ? 8.254  -41.787 21.585 1.00 69.18  ? 177  TRP D CE3 1 
ATOM   4738 C CZ2 . TRP C 2 31  ? 5.558  -41.720 20.693 1.00 69.18  ? 177  TRP D CZ2 1 
ATOM   4739 C CZ3 . TRP C 2 31  ? 7.186  -41.913 22.478 1.00 69.18  ? 177  TRP D CZ3 1 
ATOM   4740 C CH2 . TRP C 2 31  ? 5.856  -41.880 22.023 1.00 69.18  ? 177  TRP D CH2 1 
ATOM   4741 N N   . LEU C 2 32  ? 13.061 -42.764 18.344 1.00 69.90  ? 178  LEU D N   1 
ATOM   4742 C CA  . LEU C 2 32  ? 14.518 -42.749 18.425 1.00 69.90  ? 178  LEU D CA  1 
ATOM   4743 C C   . LEU C 2 32  ? 15.112 -42.991 17.042 1.00 69.90  ? 178  LEU D C   1 
ATOM   4744 O O   . LEU C 2 32  ? 16.080 -42.341 16.652 1.00 69.90  ? 178  LEU D O   1 
ATOM   4745 C CB  . LEU C 2 32  ? 15.022 -43.817 19.403 1.00 40.64  ? 178  LEU D CB  1 
ATOM   4746 C CG  . LEU C 2 32  ? 14.566 -43.655 20.854 1.00 40.64  ? 178  LEU D CG  1 
ATOM   4747 C CD1 . LEU C 2 32  ? 15.160 -44.757 21.728 1.00 40.64  ? 178  LEU D CD1 1 
ATOM   4748 C CD2 . LEU C 2 32  ? 14.987 -42.280 21.363 1.00 40.64  ? 178  LEU D CD2 1 
ATOM   4749 N N   . ARG C 2 33  ? 14.528 -43.923 16.299 1.00 62.80  ? 179  ARG D N   1 
ATOM   4750 C CA  . ARG C 2 33  ? 15.011 -44.227 14.958 1.00 62.80  ? 179  ARG D CA  1 
ATOM   4751 C C   . ARG C 2 33  ? 14.875 -43.034 14.014 1.00 62.80  ? 179  ARG D C   1 
ATOM   4752 O O   . ARG C 2 33  ? 15.707 -42.829 13.130 1.00 62.80  ? 179  ARG D O   1 
ATOM   4753 C CB  . ARG C 2 33  ? 14.250 -45.420 14.380 1.00 64.02  ? 179  ARG D CB  1 
ATOM   4754 C CG  . ARG C 2 33  ? 14.701 -46.758 14.921 1.00 64.02  ? 179  ARG D CG  1 
ATOM   4755 C CD  . ARG C 2 33  ? 16.138 -47.028 14.513 1.00 64.02  ? 179  ARG D CD  1 
ATOM   4756 N NE  . ARG C 2 33  ? 16.593 -48.355 14.907 1.00 64.02  ? 179  ARG D NE  1 
ATOM   4757 C CZ  . ARG C 2 33  ? 17.817 -48.814 14.678 1.00 64.02  ? 179  ARG D CZ  1 
ATOM   4758 N NH1 . ARG C 2 33  ? 18.715 -48.055 14.057 1.00 64.02  ? 179  ARG D NH1 1 
ATOM   4759 N NH2 . ARG C 2 33  ? 18.143 -50.035 15.069 1.00 64.02  ? 179  ARG D NH2 1 
ATOM   4760 N N   . SER C 2 34  ? 13.832 -42.238 14.213 1.00 62.20  ? 180  SER D N   1 
ATOM   4761 C CA  . SER C 2 34  ? 13.593 -41.090 13.356 1.00 62.20  ? 180  SER D CA  1 
ATOM   4762 C C   . SER C 2 34  ? 14.678 -40.020 13.374 1.00 62.20  ? 180  SER D C   1 
ATOM   4763 O O   . SER C 2 34  ? 15.282 -39.730 12.338 1.00 62.20  ? 180  SER D O   1 
ATOM   4764 C CB  . SER C 2 34  ? 12.249 -40.454 13.698 1.00 61.17  ? 180  SER D CB  1 
ATOM   4765 O OG  . SER C 2 34  ? 11.204 -41.380 13.486 1.00 61.17  ? 180  SER D OG  1 
ATOM   4766 N N   . VAL C 2 35  ? 14.932 -39.425 14.534 1.00 48.39  ? 181  VAL D N   1 
ATOM   4767 C CA  . VAL C 2 35  ? 15.935 -38.380 14.577 1.00 48.39  ? 181  VAL D CA  1 
ATOM   4768 C C   . VAL C 2 35  ? 17.287 -38.924 14.123 1.00 48.39  ? 181  VAL D C   1 
ATOM   4769 O O   . VAL C 2 35  ? 17.933 -38.335 13.251 1.00 48.39  ? 181  VAL D O   1 
ATOM   4770 C CB  . VAL C 2 35  ? 16.022 -37.715 15.991 1.00 38.91  ? 181  VAL D CB  1 
ATOM   4771 C CG1 . VAL C 2 35  ? 14.835 -38.144 16.829 1.00 38.91  ? 181  VAL D CG1 1 
ATOM   4772 C CG2 . VAL C 2 35  ? 17.357 -38.032 16.675 1.00 38.91  ? 181  VAL D CG2 1 
ATOM   4773 N N   . ASP C 2 36  ? 17.706 -40.060 14.674 1.00 62.27  ? 182  ASP D N   1 
ATOM   4774 C CA  . ASP C 2 36  ? 18.990 -40.610 14.271 1.00 62.27  ? 182  ASP D CA  1 
ATOM   4775 C C   . ASP C 2 36  ? 18.987 -40.869 12.775 1.00 62.27  ? 182  ASP D C   1 
ATOM   4776 O O   . ASP C 2 36  ? 20.036 -41.073 12.178 1.00 62.27  ? 182  ASP D O   1 
ATOM   4777 C CB  . ASP C 2 36  ? 19.298 -41.910 14.997 1.00 52.73  ? 182  ASP D CB  1 
ATOM   4778 C CG  . ASP C 2 36  ? 20.744 -42.351 14.801 1.00 52.73  ? 182  ASP D CG  1 
ATOM   4779 O OD1 . ASP C 2 36  ? 21.017 -43.568 14.869 1.00 52.73  ? 182  ASP D OD1 1 
ATOM   4780 O OD2 . ASP C 2 36  ? 21.616 -41.481 14.586 1.00 52.73  ? 182  ASP D OD2 1 
ATOM   4781 N N   . ARG C 2 37  ? 17.806 -40.871 12.169 1.00 71.28  ? 183  ARG D N   1 
ATOM   4782 C CA  . ARG C 2 37  ? 17.712 -41.099 10.733 1.00 71.28  ? 183  ARG D CA  1 
ATOM   4783 C C   . ARG C 2 37  ? 17.920 -39.783 9.995  1.00 71.28  ? 183  ARG D C   1 
ATOM   4784 O O   . ARG C 2 37  ? 18.838 -39.658 9.184  1.00 71.28  ? 183  ARG D O   1 
ATOM   4785 C CB  . ARG C 2 37  ? 16.346 -41.684 10.355 1.00 113.73 ? 183  ARG D CB  1 
ATOM   4786 C CG  . ARG C 2 37  ? 16.208 -42.006 8.871  1.00 113.73 ? 183  ARG D CG  1 
ATOM   4787 C CD  . ARG C 2 37  ? 14.791 -42.407 8.485  1.00 113.73 ? 183  ARG D CD  1 
ATOM   4788 N NE  . ARG C 2 37  ? 14.689 -42.665 7.049  1.00 113.73 ? 183  ARG D NE  1 
ATOM   4789 C CZ  . ARG C 2 37  ? 13.555 -42.926 6.406  1.00 113.73 ? 183  ARG D CZ  1 
ATOM   4790 N NH1 . ARG C 2 37  ? 12.408 -42.967 7.070  1.00 113.73 ? 183  ARG D NH1 1 
ATOM   4791 N NH2 . ARG C 2 37  ? 13.567 -43.146 5.097  1.00 113.73 ? 183  ARG D NH2 1 
ATOM   4792 N N   . SER C 2 38  ? 17.069 -38.803 10.285 1.00 79.08  ? 184  SER D N   1 
ATOM   4793 C CA  . SER C 2 38  ? 17.171 -37.504 9.634  1.00 79.08  ? 184  SER D CA  1 
ATOM   4794 C C   . SER C 2 38  ? 18.492 -36.831 9.965  1.00 79.08  ? 184  SER D C   1 
ATOM   4795 O O   . SER C 2 38  ? 19.045 -36.101 9.143  1.00 79.08  ? 184  SER D O   1 
ATOM   4796 C CB  . SER C 2 38  ? 15.999 -36.594 10.036 1.00 68.23  ? 184  SER D CB  1 
ATOM   4797 O OG  . SER C 2 38  ? 16.066 -36.226 11.395 1.00 68.23  ? 184  SER D OG  1 
ATOM   4798 N N   . LEU C 2 39  ? 19.003 -37.084 11.165 1.00 64.90  ? 185  LEU D N   1 
ATOM   4799 C CA  . LEU C 2 39  ? 20.272 -36.492 11.569 1.00 64.90  ? 185  LEU D CA  1 
ATOM   4800 C C   . LEU C 2 39  ? 21.271 -36.819 10.463 1.00 64.90  ? 185  LEU D C   1 
ATOM   4801 O O   . LEU C 2 39  ? 22.298 -36.157 10.309 1.00 64.90  ? 185  LEU D O   1 
ATOM   4802 C CB  . LEU C 2 39  ? 20.733 -37.067 12.916 1.00 43.76  ? 185  LEU D CB  1 
ATOM   4803 C CG  . LEU C 2 39  ? 21.333 -36.061 13.909 1.00 43.76  ? 185  LEU D CG  1 
ATOM   4804 C CD1 . LEU C 2 39  ? 20.599 -34.724 13.877 1.00 43.76  ? 185  LEU D CD1 1 
ATOM   4805 C CD2 . LEU C 2 39  ? 21.255 -36.655 15.298 1.00 43.76  ? 185  LEU D CD2 1 
ATOM   4806 N N   . LEU C 2 40  ? 20.964 -37.846 9.682  1.00 81.00  ? 186  LEU D N   1 
ATOM   4807 C CA  . LEU C 2 40  ? 21.835 -38.177 8.577  1.00 81.00  ? 186  LEU D CA  1 
ATOM   4808 C C   . LEU C 2 40  ? 21.527 -37.227 7.417  1.00 81.00  ? 186  LEU D C   1 
ATOM   4809 O O   . LEU C 2 40  ? 21.359 -37.635 6.266  1.00 81.00  ? 186  LEU D O   1 
ATOM   4810 C CB  . LEU C 2 40  ? 21.683 -39.648 8.167  1.00 57.06  ? 186  LEU D CB  1 
ATOM   4811 C CG  . LEU C 2 40  ? 22.311 -40.590 9.196  1.00 57.06  ? 186  LEU D CG  1 
ATOM   4812 C CD1 . LEU C 2 40  ? 22.465 -41.986 8.633  1.00 57.06  ? 186  LEU D CD1 1 
ATOM   4813 C CD2 . LEU C 2 40  ? 23.672 -40.053 9.567  1.00 57.06  ? 186  LEU D CD2 1 
ATOM   4814 N N   . LEU C 2 41  ? 21.404 -35.949 7.771  1.00 56.39  ? 187  LEU D N   1 
ATOM   4815 C CA  . LEU C 2 41  ? 21.205 -34.861 6.816  1.00 56.39  ? 187  LEU D CA  1 
ATOM   4816 C C   . LEU C 2 41  ? 22.660 -34.460 6.661  1.00 56.39  ? 187  LEU D C   1 
ATOM   4817 O O   . LEU C 2 41  ? 23.003 -33.279 6.639  1.00 56.39  ? 187  LEU D O   1 
ATOM   4818 C CB  . LEU C 2 41  ? 20.407 -33.709 7.439  1.00 97.01  ? 187  LEU D CB  1 
ATOM   4819 C CG  . LEU C 2 41  ? 18.904 -33.733 7.165  1.00 97.01  ? 187  LEU D CG  1 
ATOM   4820 C CD1 . LEU C 2 41  ? 18.182 -32.722 8.046  1.00 97.01  ? 187  LEU D CD1 1 
ATOM   4821 C CD2 . LEU C 2 41  ? 18.675 -33.440 5.685  1.00 97.01  ? 187  LEU D CD2 1 
ATOM   4822 N N   . GLN C 2 42  ? 23.485 -35.505 6.608  1.00 200.61 ? 188  GLN D N   1 
ATOM   4823 C CA  . GLN C 2 42  ? 24.933 -35.453 6.483  1.00 200.61 ? 188  GLN D CA  1 
ATOM   4824 C C   . GLN C 2 42  ? 25.646 -34.150 6.773  1.00 200.61 ? 188  GLN D C   1 
ATOM   4825 O O   . GLN C 2 42  ? 25.135 -33.058 6.528  1.00 200.61 ? 188  GLN D O   1 
ATOM   4826 C CB  . GLN C 2 42  ? 25.368 -35.987 5.115  1.00 154.83 ? 188  GLN D CB  1 
ATOM   4827 C CG  . GLN C 2 42  ? 25.101 -37.472 4.922  1.00 154.83 ? 188  GLN D CG  1 
ATOM   4828 C CD  . GLN C 2 42  ? 25.216 -38.268 6.212  1.00 154.83 ? 188  GLN D CD  1 
ATOM   4829 O OE1 . GLN C 2 42  ? 26.195 -38.140 6.954  1.00 154.83 ? 188  GLN D OE1 1 
ATOM   4830 N NE2 . GLN C 2 42  ? 24.212 -39.103 6.483  1.00 154.83 ? 188  GLN D NE2 1 
ATOM   4831 N N   . GLY C 2 43  ? 26.866 -34.285 7.275  1.00 170.93 ? 189  GLY D N   1 
ATOM   4832 C CA  . GLY C 2 43  ? 27.641 -33.119 7.637  1.00 170.93 ? 189  GLY D CA  1 
ATOM   4833 C C   . GLY C 2 43  ? 27.329 -32.966 9.109  1.00 170.93 ? 189  GLY D C   1 
ATOM   4834 O O   . GLY C 2 43  ? 27.995 -32.203 9.826  1.00 170.93 ? 189  GLY D O   1 
ATOM   4835 N N   . TRP C 2 44  ? 26.291 -33.701 9.538  1.00 100.78 ? 190  TRP D N   1 
ATOM   4836 C CA  . TRP C 2 44  ? 25.839 -33.726 10.929 1.00 100.78 ? 190  TRP D CA  1 
ATOM   4837 C C   . TRP C 2 44  ? 26.473 -34.936 11.600 1.00 100.78 ? 190  TRP D C   1 
ATOM   4838 O O   . TRP C 2 44  ? 26.944 -34.851 12.729 1.00 100.78 ? 190  TRP D O   1 
ATOM   4839 C CB  . TRP C 2 44  ? 24.313 -33.810 11.008 1.00 118.20 ? 190  TRP D CB  1 
ATOM   4840 C CG  . TRP C 2 44  ? 23.623 -32.491 10.776 1.00 118.20 ? 190  TRP D CG  1 
ATOM   4841 C CD1 . TRP C 2 44  ? 24.214 -31.281 10.539 1.00 118.20 ? 190  TRP D CD1 1 
ATOM   4842 C CD2 . TRP C 2 44  ? 22.210 -32.251 10.772 1.00 118.20 ? 190  TRP D CD2 1 
ATOM   4843 N NE1 . TRP C 2 44  ? 23.258 -30.306 10.389 1.00 118.20 ? 190  TRP D NE1 1 
ATOM   4844 C CE2 . TRP C 2 44  ? 22.019 -30.874 10.528 1.00 118.20 ? 190  TRP D CE2 1 
ATOM   4845 C CE3 . TRP C 2 44  ? 21.085 -33.068 10.955 1.00 118.20 ? 190  TRP D CE3 1 
ATOM   4846 C CZ2 . TRP C 2 44  ? 20.745 -30.294 10.459 1.00 118.20 ? 190  TRP D CZ2 1 
ATOM   4847 C CZ3 . TRP C 2 44  ? 19.816 -32.492 10.887 1.00 118.20 ? 190  TRP D CZ3 1 
ATOM   4848 C CH2 . TRP C 2 44  ? 19.659 -31.118 10.642 1.00 118.20 ? 190  TRP D CH2 1 
ATOM   4849 N N   . GLN C 2 45  ? 26.487 -36.064 10.900 1.00 71.23  ? 191  GLN D N   1 
ATOM   4850 C CA  . GLN C 2 45  ? 27.114 -37.276 11.421 1.00 71.23  ? 191  GLN D CA  1 
ATOM   4851 C C   . GLN C 2 45  ? 27.274 -38.291 10.305 1.00 71.23  ? 191  GLN D C   1 
ATOM   4852 O O   . GLN C 2 45  ? 26.321 -38.613 9.603  1.00 71.23  ? 191  GLN D O   1 
ATOM   4853 C CB  . GLN C 2 45  ? 26.315 -37.882 12.588 1.00 69.72  ? 191  GLN D CB  1 
ATOM   4854 C CG  . GLN C 2 45  ? 24.883 -38.284 12.292 1.00 69.72  ? 191  GLN D CG  1 
ATOM   4855 C CD  . GLN C 2 45  ? 24.281 -39.155 13.388 1.00 69.72  ? 191  GLN D CD  1 
ATOM   4856 O OE1 . GLN C 2 45  ? 24.764 -39.178 14.528 1.00 69.72  ? 191  GLN D OE1 1 
ATOM   4857 N NE2 . GLN C 2 45  ? 23.210 -39.868 13.050 1.00 69.72  ? 191  GLN D NE2 1 
ATOM   4858 N N   . ASP C 2 46  ? 28.497 -38.780 10.141 1.00 85.87  ? 192  ASP D N   1 
ATOM   4859 C CA  . ASP C 2 46  ? 28.807 -39.746 9.099  1.00 85.87  ? 192  ASP D CA  1 
ATOM   4860 C C   . ASP C 2 46  ? 28.447 -41.169 9.526  1.00 85.87  ? 192  ASP D C   1 
ATOM   4861 O O   . ASP C 2 46  ? 28.427 -42.083 8.704  1.00 85.87  ? 192  ASP D O   1 
ATOM   4862 C CB  . ASP C 2 46  ? 30.300 -39.658 8.754  1.00 157.45 ? 192  ASP D CB  1 
ATOM   4863 C CG  . ASP C 2 46  ? 30.569 -39.832 7.277  1.00 157.45 ? 192  ASP D CG  1 
ATOM   4864 O OD1 . ASP C 2 46  ? 30.327 -40.937 6.749  1.00 157.45 ? 192  ASP D OD1 1 
ATOM   4865 O OD2 . ASP C 2 46  ? 31.017 -38.856 6.632  1.00 157.45 ? 192  ASP D OD2 1 
ATOM   4866 N N   . GLN C 2 47  ? 28.153 -41.354 10.809 1.00 73.26  ? 193  GLN D N   1 
ATOM   4867 C CA  . GLN C 2 47  ? 27.800 -42.673 11.321 1.00 73.26  ? 193  GLN D CA  1 
ATOM   4868 C C   . GLN C 2 47  ? 26.595 -42.577 12.252 1.00 73.26  ? 193  GLN D C   1 
ATOM   4869 O O   . GLN C 2 47  ? 26.398 -41.559 12.924 1.00 73.26  ? 193  GLN D O   1 
ATOM   4870 C CB  . GLN C 2 47  ? 28.988 -43.277 12.076 1.00 111.33 ? 193  GLN D CB  1 
ATOM   4871 C CG  . GLN C 2 47  ? 28.994 -44.796 12.102 1.00 111.33 ? 193  GLN D CG  1 
ATOM   4872 C CD  . GLN C 2 47  ? 30.208 -45.373 12.806 1.00 111.33 ? 193  GLN D CD  1 
ATOM   4873 O OE1 . GLN C 2 47  ? 31.342 -44.962 12.552 1.00 111.33 ? 193  GLN D OE1 1 
ATOM   4874 N NE2 . GLN C 2 47  ? 29.976 -46.341 13.687 1.00 111.33 ? 193  GLN D NE2 1 
ATOM   4875 N N   . GLY C 2 48  ? 25.789 -43.635 12.284 1.00 48.09  ? 194  GLY D N   1 
ATOM   4876 C CA  . GLY C 2 48  ? 24.616 -43.652 13.142 1.00 48.09  ? 194  GLY D CA  1 
ATOM   4877 C C   . GLY C 2 48  ? 24.980 -43.702 14.615 1.00 48.09  ? 194  GLY D C   1 
ATOM   4878 O O   . GLY C 2 48  ? 25.876 -44.439 15.021 1.00 48.09  ? 194  GLY D O   1 
ATOM   4879 N N   . PHE C 2 49  ? 24.273 -42.918 15.416 1.00 42.67  ? 195  PHE D N   1 
ATOM   4880 C CA  . PHE C 2 49  ? 24.524 -42.856 16.844 1.00 42.67  ? 195  PHE D CA  1 
ATOM   4881 C C   . PHE C 2 49  ? 24.011 -44.082 17.587 1.00 42.67  ? 195  PHE D C   1 
ATOM   4882 O O   . PHE C 2 49  ? 24.776 -44.763 18.254 1.00 42.67  ? 195  PHE D O   1 
ATOM   4883 C CB  . PHE C 2 49  ? 23.881 -41.595 17.423 1.00 51.28  ? 195  PHE D CB  1 
ATOM   4884 C CG  . PHE C 2 49  ? 24.116 -41.416 18.890 1.00 51.28  ? 195  PHE D CG  1 
ATOM   4885 C CD1 . PHE C 2 49  ? 25.392 -41.161 19.377 1.00 51.28  ? 195  PHE D CD1 1 
ATOM   4886 C CD2 . PHE C 2 49  ? 23.069 -41.523 19.790 1.00 51.28  ? 195  PHE D CD2 1 
ATOM   4887 C CE1 . PHE C 2 49  ? 25.618 -41.019 20.746 1.00 51.28  ? 195  PHE D CE1 1 
ATOM   4888 C CE2 . PHE C 2 49  ? 23.287 -41.382 21.158 1.00 51.28  ? 195  PHE D CE2 1 
ATOM   4889 C CZ  . PHE C 2 49  ? 24.559 -41.130 21.634 1.00 51.28  ? 195  PHE D CZ  1 
ATOM   4890 N N   . ILE C 2 50  ? 22.718 -44.360 17.469 1.00 63.82  ? 196  ILE D N   1 
ATOM   4891 C CA  . ILE C 2 50  ? 22.109 -45.493 18.155 1.00 63.82  ? 196  ILE D CA  1 
ATOM   4892 C C   . ILE C 2 50  ? 22.874 -46.791 17.993 1.00 63.82  ? 196  ILE D C   1 
ATOM   4893 O O   . ILE C 2 50  ? 22.863 -47.404 16.931 1.00 63.82  ? 196  ILE D O   1 
ATOM   4894 C CB  . ILE C 2 50  ? 20.667 -45.714 17.691 1.00 43.50  ? 196  ILE D CB  1 
ATOM   4895 C CG1 . ILE C 2 50  ? 19.812 -44.516 18.096 1.00 43.50  ? 196  ILE D CG1 1 
ATOM   4896 C CG2 . ILE C 2 50  ? 20.096 -46.949 18.325 1.00 43.50  ? 196  ILE D CG2 1 
ATOM   4897 C CD1 . ILE C 2 50  ? 18.410 -44.560 17.554 1.00 43.50  ? 196  ILE D CD1 1 
ATOM   4898 N N   . THR C 2 51  ? 23.530 -47.201 19.073 1.00 40.88  ? 197  THR D N   1 
ATOM   4899 C CA  . THR C 2 51  ? 24.321 -48.420 19.104 1.00 40.88  ? 197  THR D CA  1 
ATOM   4900 C C   . THR C 2 51  ? 23.992 -49.120 20.416 1.00 40.88  ? 197  THR D C   1 
ATOM   4901 O O   . THR C 2 51  ? 23.340 -48.551 21.287 1.00 40.88  ? 197  THR D O   1 
ATOM   4902 C CB  . THR C 2 51  ? 25.827 -48.102 19.086 1.00 54.91  ? 197  THR D CB  1 
ATOM   4903 O OG1 . THR C 2 51  ? 26.159 -47.377 20.273 1.00 35.05  ? 197  THR D OG1 1 
ATOM   4904 C CG2 . THR C 2 51  ? 26.191 -47.250 17.887 1.00 54.91  ? 197  THR D CG2 1 
ATOM   4905 N N   . PRO C 2 52  ? 24.439 -50.366 20.579 1.00 44.57  ? 198  PRO D N   1 
ATOM   4906 C CA  . PRO C 2 52  ? 24.135 -51.057 21.830 1.00 44.57  ? 198  PRO D CA  1 
ATOM   4907 C C   . PRO C 2 52  ? 24.434 -50.172 23.023 1.00 44.57  ? 198  PRO D C   1 
ATOM   4908 O O   . PRO C 2 52  ? 23.527 -49.768 23.755 1.00 44.57  ? 198  PRO D O   1 
ATOM   4909 C CB  . PRO C 2 52  ? 25.047 -52.275 21.780 1.00 48.81  ? 198  PRO D CB  1 
ATOM   4910 C CG  . PRO C 2 52  ? 25.092 -52.585 20.310 1.00 48.81  ? 198  PRO D CG  1 
ATOM   4911 C CD  . PRO C 2 52  ? 25.250 -51.208 19.682 1.00 48.81  ? 198  PRO D CD  1 
ATOM   4912 N N   . ALA C 2 53  ? 25.717 -49.866 23.195 1.00 48.69  ? 199  ALA D N   1 
ATOM   4913 C CA  . ALA C 2 53  ? 26.205 -49.039 24.298 1.00 48.69  ? 199  ALA D CA  1 
ATOM   4914 C C   . ALA C 2 53  ? 25.390 -47.766 24.487 1.00 48.69  ? 199  ALA D C   1 
ATOM   4915 O O   . ALA C 2 53  ? 24.970 -47.439 25.598 1.00 48.69  ? 199  ALA D O   1 
ATOM   4916 C CB  . ALA C 2 53  ? 27.673 -48.685 24.064 1.00 24.60  ? 199  ALA D CB  1 
ATOM   4917 N N   . ASN C 2 54  ? 25.161 -47.053 23.394 1.00 52.28  ? 200  ASN D N   1 
ATOM   4918 C CA  . ASN C 2 54  ? 24.408 -45.823 23.475 1.00 52.28  ? 200  ASN D CA  1 
ATOM   4919 C C   . ASN C 2 54  ? 22.969 -46.033 23.916 1.00 52.28  ? 200  ASN D C   1 
ATOM   4920 O O   . ASN C 2 54  ? 22.458 -45.252 24.727 1.00 52.28  ? 200  ASN D O   1 
ATOM   4921 C CB  . ASN C 2 54  ? 24.482 -45.094 22.146 1.00 50.02  ? 200  ASN D CB  1 
ATOM   4922 C CG  . ASN C 2 54  ? 25.853 -44.498 21.903 1.00 50.02  ? 200  ASN D CG  1 
ATOM   4923 O OD1 . ASN C 2 54  ? 26.303 -44.377 20.758 1.00 50.02  ? 200  ASN D OD1 1 
ATOM   4924 N ND2 . ASN C 2 54  ? 26.527 -44.113 22.981 1.00 50.02  ? 200  ASN D ND2 1 
ATOM   4925 N N   . VAL C 2 55  ? 22.307 -47.077 23.419 1.00 41.27  ? 201  VAL D N   1 
ATOM   4926 C CA  . VAL C 2 55  ? 20.931 -47.293 23.848 1.00 41.27  ? 201  VAL D CA  1 
ATOM   4927 C C   . VAL C 2 55  ? 21.005 -47.471 25.353 1.00 41.27  ? 201  VAL D C   1 
ATOM   4928 O O   . VAL C 2 55  ? 20.243 -46.869 26.100 1.00 41.27  ? 201  VAL D O   1 
ATOM   4929 C CB  . VAL C 2 55  ? 20.292 -48.562 23.238 1.00 45.50  ? 201  VAL D CB  1 
ATOM   4930 C CG1 . VAL C 2 55  ? 18.849 -48.670 23.694 1.00 45.50  ? 201  VAL D CG1 1 
ATOM   4931 C CG2 . VAL C 2 55  ? 20.348 -48.505 21.725 1.00 45.50  ? 201  VAL D CG2 1 
ATOM   4932 N N   . VAL C 2 56  ? 21.954 -48.286 25.794 1.00 40.69  ? 202  VAL D N   1 
ATOM   4933 C CA  . VAL C 2 56  ? 22.121 -48.541 27.214 1.00 40.69  ? 202  VAL D CA  1 
ATOM   4934 C C   . VAL C 2 56  ? 22.338 -47.226 27.952 1.00 40.69  ? 202  VAL D C   1 
ATOM   4935 O O   . VAL C 2 56  ? 21.666 -46.942 28.946 1.00 40.69  ? 202  VAL D O   1 
ATOM   4936 C CB  . VAL C 2 56  ? 23.310 -49.482 27.464 1.00 38.55  ? 202  VAL D CB  1 
ATOM   4937 C CG1 . VAL C 2 56  ? 23.476 -49.719 28.960 1.00 38.55  ? 202  VAL D CG1 1 
ATOM   4938 C CG2 . VAL C 2 56  ? 23.087 -50.794 26.732 1.00 38.55  ? 202  VAL D CG2 1 
ATOM   4939 N N   . PHE C 2 57  ? 23.281 -46.423 27.475 1.00 32.46  ? 203  PHE D N   1 
ATOM   4940 C CA  . PHE C 2 57  ? 23.531 -45.122 28.102 1.00 32.46  ? 203  PHE D CA  1 
ATOM   4941 C C   . PHE C 2 57  ? 22.191 -44.385 28.188 1.00 32.46  ? 203  PHE D C   1 
ATOM   4942 O O   . PHE C 2 57  ? 21.872 -43.760 29.185 1.00 32.46  ? 203  PHE D O   1 
ATOM   4943 C CB  . PHE C 2 57  ? 24.484 -44.286 27.244 1.00 31.47  ? 203  PHE D CB  1 
ATOM   4944 C CG  . PHE C 2 57  ? 24.849 -42.980 27.852 1.00 31.47  ? 203  PHE D CG  1 
ATOM   4945 C CD1 . PHE C 2 57  ? 25.977 -42.866 28.654 1.00 31.47  ? 203  PHE D CD1 1 
ATOM   4946 C CD2 . PHE C 2 57  ? 24.050 -41.869 27.652 1.00 31.47  ? 203  PHE D CD2 1 
ATOM   4947 C CE1 . PHE C 2 57  ? 26.305 -41.654 29.254 1.00 31.47  ? 203  PHE D CE1 1 
ATOM   4948 C CE2 . PHE C 2 57  ? 24.356 -40.655 28.239 1.00 31.47  ? 203  PHE D CE2 1 
ATOM   4949 C CZ  . PHE C 2 57  ? 25.492 -40.541 29.049 1.00 31.47  ? 203  PHE D CZ  1 
ATOM   4950 N N   . LEU C 2 58  ? 21.406 -44.478 27.126 1.00 35.17  ? 204  LEU D N   1 
ATOM   4951 C CA  . LEU C 2 58  ? 20.128 -43.802 27.082 1.00 35.17  ? 204  LEU D CA  1 
ATOM   4952 C C   . LEU C 2 58  ? 19.121 -44.404 28.050 1.00 35.17  ? 204  LEU D C   1 
ATOM   4953 O O   . LEU C 2 58  ? 18.358 -43.676 28.690 1.00 35.17  ? 204  LEU D O   1 
ATOM   4954 C CB  . LEU C 2 58  ? 19.562 -43.838 25.657 1.00 37.40  ? 204  LEU D CB  1 
ATOM   4955 C CG  . LEU C 2 58  ? 18.192 -43.189 25.478 1.00 37.40  ? 204  LEU D CG  1 
ATOM   4956 C CD1 . LEU C 2 58  ? 18.278 -41.677 25.699 1.00 37.40  ? 204  LEU D CD1 1 
ATOM   4957 C CD2 . LEU C 2 58  ? 17.698 -43.487 24.087 1.00 37.40  ? 204  LEU D CD2 1 
ATOM   4958 N N   . TYR C 2 59  ? 19.101 -45.728 28.149 1.00 44.25  ? 205  TYR D N   1 
ATOM   4959 C CA  . TYR C 2 59  ? 18.165 -46.378 29.049 1.00 44.25  ? 205  TYR D CA  1 
ATOM   4960 C C   . TYR C 2 59  ? 18.516 -45.906 30.443 1.00 44.25  ? 205  TYR D C   1 
ATOM   4961 O O   . TYR C 2 59  ? 17.648 -45.732 31.302 1.00 44.25  ? 205  TYR D O   1 
ATOM   4962 C CB  . TYR C 2 59  ? 18.300 -47.890 28.940 1.00 48.58  ? 205  TYR D CB  1 
ATOM   4963 C CG  . TYR C 2 59  ? 17.723 -48.655 30.104 1.00 48.58  ? 205  TYR D CG  1 
ATOM   4964 C CD1 . TYR C 2 59  ? 16.347 -48.718 30.323 1.00 48.58  ? 205  TYR D CD1 1 
ATOM   4965 C CD2 . TYR C 2 59  ? 18.564 -49.318 30.998 1.00 48.58  ? 205  TYR D CD2 1 
ATOM   4966 C CE1 . TYR C 2 59  ? 15.831 -49.427 31.405 1.00 48.58  ? 205  TYR D CE1 1 
ATOM   4967 C CE2 . TYR C 2 59  ? 18.062 -50.023 32.077 1.00 48.58  ? 205  TYR D CE2 1 
ATOM   4968 C CZ  . TYR C 2 59  ? 16.701 -50.077 32.281 1.00 48.58  ? 205  TYR D CZ  1 
ATOM   4969 O OH  . TYR C 2 59  ? 16.230 -50.769 33.379 1.00 48.58  ? 205  TYR D OH  1 
ATOM   4970 N N   . MET C 2 60  ? 19.803 -45.669 30.652 1.00 56.54  ? 206  MET D N   1 
ATOM   4971 C CA  . MET C 2 60  ? 20.271 -45.214 31.941 1.00 56.54  ? 206  MET D CA  1 
ATOM   4972 C C   . MET C 2 60  ? 19.576 -43.905 32.349 1.00 56.54  ? 206  MET D C   1 
ATOM   4973 O O   . MET C 2 60  ? 19.045 -43.804 33.466 1.00 56.54  ? 206  MET D O   1 
ATOM   4974 C CB  . MET C 2 60  ? 21.780 -45.041 31.899 1.00 54.00  ? 206  MET D CB  1 
ATOM   4975 C CG  . MET C 2 60  ? 22.406 -44.837 33.247 1.00 54.00  ? 206  MET D CG  1 
ATOM   4976 S SD  . MET C 2 60  ? 23.375 -43.341 33.242 1.00 54.00  ? 206  MET D SD  1 
ATOM   4977 C CE  . MET C 2 60  ? 22.137 -42.194 33.713 1.00 54.00  ? 206  MET D CE  1 
ATOM   4978 N N   . LEU C 2 61  ? 19.560 -42.908 31.459 1.00 44.93  ? 207  LEU D N   1 
ATOM   4979 C CA  . LEU C 2 61  ? 18.901 -41.635 31.783 1.00 44.93  ? 207  LEU D CA  1 
ATOM   4980 C C   . LEU C 2 61  ? 17.401 -41.848 31.989 1.00 44.93  ? 207  LEU D C   1 
ATOM   4981 O O   . LEU C 2 61  ? 16.883 -41.557 33.066 1.00 44.93  ? 207  LEU D O   1 
ATOM   4982 C CB  . LEU C 2 61  ? 19.121 -40.585 30.685 1.00 40.22  ? 207  LEU D CB  1 
ATOM   4983 C CG  . LEU C 2 61  ? 20.555 -40.113 30.397 1.00 40.22  ? 207  LEU D CG  1 
ATOM   4984 C CD1 . LEU C 2 61  ? 20.581 -39.119 29.208 1.00 40.22  ? 207  LEU D CD1 1 
ATOM   4985 C CD2 . LEU C 2 61  ? 21.126 -39.472 31.654 1.00 40.22  ? 207  LEU D CD2 1 
ATOM   4986 N N   . CYS C 2 62  ? 16.714 -42.357 30.965 1.00 51.04  ? 208  CYS D N   1 
ATOM   4987 C CA  . CYS C 2 62  ? 15.271 -42.616 31.040 1.00 51.04  ? 208  CYS D CA  1 
ATOM   4988 C C   . CYS C 2 62  ? 14.905 -43.246 32.376 1.00 51.04  ? 208  CYS D C   1 
ATOM   4989 O O   . CYS C 2 62  ? 13.949 -42.849 33.046 1.00 51.04  ? 208  CYS D O   1 
ATOM   4990 C CB  . CYS C 2 62  ? 14.831 -43.580 29.939 1.00 46.61  ? 208  CYS D CB  1 
ATOM   4991 S SG  . CYS C 2 62  ? 15.059 -42.988 28.277 1.00 46.61  ? 208  CYS D SG  1 
ATOM   4992 N N   . ARG C 2 63  ? 15.687 -44.253 32.731 1.00 57.32  ? 209  ARG D N   1 
ATOM   4993 C CA  . ARG C 2 63  ? 15.531 -45.005 33.953 1.00 57.32  ? 209  ARG D CA  1 
ATOM   4994 C C   . ARG C 2 63  ? 15.136 -44.111 35.126 1.00 57.32  ? 209  ARG D C   1 
ATOM   4995 O O   . ARG C 2 63  ? 14.053 -44.245 35.696 1.00 57.32  ? 209  ARG D O   1 
ATOM   4996 C CB  . ARG C 2 63  ? 16.859 -45.694 34.244 1.00 60.15  ? 209  ARG D CB  1 
ATOM   4997 C CG  . ARG C 2 63  ? 16.795 -46.888 35.142 1.00 60.15  ? 209  ARG D CG  1 
ATOM   4998 C CD  . ARG C 2 63  ? 18.208 -47.247 35.524 1.00 60.15  ? 209  ARG D CD  1 
ATOM   4999 N NE  . ARG C 2 63  ? 18.365 -48.646 35.889 1.00 60.15  ? 209  ARG D NE  1 
ATOM   5000 C CZ  . ARG C 2 63  ? 19.526 -49.186 36.239 1.00 60.15  ? 209  ARG D CZ  1 
ATOM   5001 N NH1 . ARG C 2 63  ? 20.624 -48.435 36.274 1.00 60.15  ? 209  ARG D NH1 1 
ATOM   5002 N NH2 . ARG C 2 63  ? 19.596 -50.478 36.534 1.00 60.15  ? 209  ARG D NH2 1 
ATOM   5003 N N   . ASP C 2 64  ? 16.019 -43.184 35.474 1.00 67.34  ? 210  ASP D N   1 
ATOM   5004 C CA  . ASP C 2 64  ? 15.793 -42.292 36.607 1.00 67.34  ? 210  ASP D CA  1 
ATOM   5005 C C   . ASP C 2 64  ? 15.162 -40.955 36.247 1.00 67.34  ? 210  ASP D C   1 
ATOM   5006 O O   . ASP C 2 64  ? 15.104 -40.059 37.088 1.00 67.34  ? 210  ASP D O   1 
ATOM   5007 C CB  . ASP C 2 64  ? 17.123 -42.028 37.316 1.00 76.77  ? 210  ASP D CB  1 
ATOM   5008 C CG  . ASP C 2 64  ? 17.711 -43.274 37.925 1.00 76.77  ? 210  ASP D CG  1 
ATOM   5009 O OD1 . ASP C 2 64  ? 18.955 -43.405 37.934 1.00 76.77  ? 210  ASP D OD1 1 
ATOM   5010 O OD2 . ASP C 2 64  ? 16.930 -44.121 38.414 1.00 76.77  ? 210  ASP D OD2 1 
ATOM   5011 N N   . VAL C 2 65  ? 14.676 -40.805 35.020 1.00 48.87  ? 211  VAL D N   1 
ATOM   5012 C CA  . VAL C 2 65  ? 14.108 -39.524 34.631 1.00 48.87  ? 211  VAL D CA  1 
ATOM   5013 C C   . VAL C 2 65  ? 12.640 -39.525 34.228 1.00 48.87  ? 211  VAL D C   1 
ATOM   5014 O O   . VAL C 2 65  ? 11.876 -38.670 34.672 1.00 48.87  ? 211  VAL D O   1 
ATOM   5015 C CB  . VAL C 2 65  ? 14.965 -38.885 33.506 1.00 44.19  ? 211  VAL D CB  1 
ATOM   5016 C CG1 . VAL C 2 65  ? 14.263 -37.664 32.934 1.00 44.19  ? 211  VAL D CG1 1 
ATOM   5017 C CG2 . VAL C 2 65  ? 16.319 -38.492 34.058 1.00 44.19  ? 211  VAL D CG2 1 
ATOM   5018 N N   . ILE C 2 66  ? 12.252 -40.480 33.394 1.00 54.97  ? 212  ILE D N   1 
ATOM   5019 C CA  . ILE C 2 66  ? 10.870 -40.574 32.935 1.00 54.97  ? 212  ILE D CA  1 
ATOM   5020 C C   . ILE C 2 66  ? 9.902  -40.805 34.095 1.00 54.97  ? 212  ILE D C   1 
ATOM   5021 O O   . ILE C 2 66  ? 9.890  -41.872 34.701 1.00 54.97  ? 212  ILE D O   1 
ATOM   5022 C CB  . ILE C 2 66  ? 10.687 -41.736 31.948 1.00 74.43  ? 212  ILE D CB  1 
ATOM   5023 C CG1 . ILE C 2 66  ? 11.761 -41.671 30.848 1.00 74.43  ? 212  ILE D CG1 1 
ATOM   5024 C CG2 . ILE C 2 66  ? 9.303  -41.680 31.351 1.00 74.43  ? 212  ILE D CG2 1 
ATOM   5025 C CD1 . ILE C 2 66  ? 11.677 -40.460 29.968 1.00 74.43  ? 212  ILE D CD1 1 
ATOM   5026 N N   . SER C 2 67  ? 9.090  -39.805 34.411 1.00 62.40  ? 213  SER D N   1 
ATOM   5027 C CA  . SER C 2 67  ? 8.122  -39.948 35.491 1.00 62.40  ? 213  SER D CA  1 
ATOM   5028 C C   . SER C 2 67  ? 7.189  -41.100 35.162 1.00 62.40  ? 213  SER D C   1 
ATOM   5029 O O   . SER C 2 67  ? 6.950  -41.404 33.994 1.00 62.40  ? 213  SER D O   1 
ATOM   5030 C CB  . SER C 2 67  ? 7.297  -38.672 35.657 1.00 89.62  ? 213  SER D CB  1 
ATOM   5031 O OG  . SER C 2 67  ? 6.335  -38.833 36.674 1.00 89.62  ? 213  SER D OG  1 
ATOM   5032 N N   . SER C 2 68  ? 6.660  -41.737 36.199 1.00 75.06  ? 214  SER D N   1 
ATOM   5033 C CA  . SER C 2 68  ? 5.751  -42.860 36.020 1.00 75.06  ? 214  SER D CA  1 
ATOM   5034 C C   . SER C 2 68  ? 4.329  -42.390 35.744 1.00 75.06  ? 214  SER D C   1 
ATOM   5035 O O   . SER C 2 68  ? 3.503  -43.147 35.237 1.00 75.06  ? 214  SER D O   1 
ATOM   5036 C CB  . SER C 2 68  ? 5.778  -43.743 37.269 1.00 83.68  ? 214  SER D CB  1 
ATOM   5037 O OG  . SER C 2 68  ? 5.586  -42.970 38.440 1.00 83.68  ? 214  SER D OG  1 
ATOM   5038 N N   . GLU C 2 69  ? 4.054  -41.131 36.068 1.00 82.12  ? 215  GLU D N   1 
ATOM   5039 C CA  . GLU C 2 69  ? 2.725  -40.564 35.872 1.00 82.12  ? 215  GLU D CA  1 
ATOM   5040 C C   . GLU C 2 69  ? 2.596  -39.735 34.600 1.00 82.12  ? 215  GLU D C   1 
ATOM   5041 O O   . GLU C 2 69  ? 1.653  -38.963 34.442 1.00 82.12  ? 215  GLU D O   1 
ATOM   5042 C CB  . GLU C 2 69  ? 2.338  -39.716 37.084 1.00 143.18 ? 215  GLU D CB  1 
ATOM   5043 C CG  . GLU C 2 69  ? 2.422  -40.482 38.388 1.00 143.18 ? 215  GLU D CG  1 
ATOM   5044 C CD  . GLU C 2 69  ? 1.781  -39.750 39.543 1.00 143.18 ? 215  GLU D CD  1 
ATOM   5045 O OE1 . GLU C 2 69  ? 2.134  -38.576 39.782 1.00 143.18 ? 215  GLU D OE1 1 
ATOM   5046 O OE2 . GLU C 2 69  ? 0.925  -40.357 40.218 1.00 143.18 ? 215  GLU D OE2 1 
ATOM   5047 N N   . VAL C 2 70  ? 3.549  -39.898 33.693 1.00 84.62  ? 216  VAL D N   1 
ATOM   5048 C CA  . VAL C 2 70  ? 3.523  -39.175 32.431 1.00 84.62  ? 216  VAL D CA  1 
ATOM   5049 C C   . VAL C 2 70  ? 2.119  -39.168 31.843 1.00 84.62  ? 216  VAL D C   1 
ATOM   5050 O O   . VAL C 2 70  ? 1.524  -40.226 31.648 1.00 84.62  ? 216  VAL D O   1 
ATOM   5051 C CB  . VAL C 2 70  ? 4.461  -39.833 31.410 1.00 63.55  ? 216  VAL D CB  1 
ATOM   5052 C CG1 . VAL C 2 70  ? 4.257  -39.212 30.036 1.00 63.55  ? 216  VAL D CG1 1 
ATOM   5053 C CG2 . VAL C 2 70  ? 5.901  -39.680 31.870 1.00 63.55  ? 216  VAL D CG2 1 
ATOM   5054 N N   . GLY C 2 71  ? 1.596  -37.976 31.567 1.00 104.15 ? 217  GLY D N   1 
ATOM   5055 C CA  . GLY C 2 71  ? 0.268  -37.859 30.987 1.00 104.15 ? 217  GLY D CA  1 
ATOM   5056 C C   . GLY C 2 71  ? 0.325  -37.441 29.525 1.00 104.15 ? 217  GLY D C   1 
ATOM   5057 O O   . GLY C 2 71  ? 0.513  -36.264 29.221 1.00 104.15 ? 217  GLY D O   1 
ATOM   5058 N N   . SER C 2 72  ? 0.162  -38.416 28.632 1.00 62.09  ? 218  SER D N   1 
ATOM   5059 C CA  . SER C 2 72  ? 0.185  -38.237 27.172 1.00 62.09  ? 218  SER D CA  1 
ATOM   5060 C C   . SER C 2 72  ? 1.557  -38.591 26.599 1.00 62.09  ? 218  SER D C   1 
ATOM   5061 O O   . SER C 2 72  ? 2.584  -38.198 27.144 1.00 62.09  ? 218  SER D O   1 
ATOM   5062 C CB  . SER C 2 72  ? -0.175 -36.803 26.761 1.00 96.85  ? 218  SER D CB  1 
ATOM   5063 O OG  . SER C 2 72  ? 0.952  -35.945 26.833 1.00 96.85  ? 218  SER D OG  1 
ATOM   5064 N N   . ASP C 2 73  ? 1.561  -39.336 25.497 1.00 99.56  ? 219  ASP D N   1 
ATOM   5065 C CA  . ASP C 2 73  ? 2.804  -39.752 24.858 1.00 99.56  ? 219  ASP D CA  1 
ATOM   5066 C C   . ASP C 2 73  ? 3.655  -38.559 24.446 1.00 99.56  ? 219  ASP D C   1 
ATOM   5067 O O   . ASP C 2 73  ? 4.884  -38.611 24.510 1.00 99.56  ? 219  ASP D O   1 
ATOM   5068 C CB  . ASP C 2 73  ? 2.514  -40.622 23.636 1.00 105.30 ? 219  ASP D CB  1 
ATOM   5069 C CG  . ASP C 2 73  ? 1.564  -39.965 22.666 1.00 73.77  ? 219  ASP D CG  1 
ATOM   5070 O OD1 . ASP C 2 73  ? 1.424  -38.726 22.703 1.00 73.77  ? 219  ASP D OD1 1 
ATOM   5071 O OD2 . ASP C 2 73  ? 0.966  -40.686 21.844 1.00 73.77  ? 219  ASP D OD2 1 
ATOM   5072 N N   . HIS C 2 74  ? 2.997  -37.489 24.015 1.00 53.38  ? 220  HIS D N   1 
ATOM   5073 C CA  . HIS C 2 74  ? 3.686  -36.271 23.609 1.00 53.38  ? 220  HIS D CA  1 
ATOM   5074 C C   . HIS C 2 74  ? 4.664  -35.843 24.713 1.00 53.38  ? 220  HIS D C   1 
ATOM   5075 O O   . HIS C 2 74  ? 5.788  -35.433 24.431 1.00 53.38  ? 220  HIS D O   1 
ATOM   5076 C CB  . HIS C 2 74  ? 2.657  -35.168 23.337 1.00 168.78 ? 220  HIS D CB  1 
ATOM   5077 C CG  . HIS C 2 74  ? 3.241  -33.923 22.748 1.00 168.78 ? 220  HIS D CG  1 
ATOM   5078 N ND1 . HIS C 2 74  ? 3.712  -32.882 23.517 1.00 112.92 ? 220  HIS D ND1 1 
ATOM   5079 C CD2 . HIS C 2 74  ? 3.435  -33.557 21.458 1.00 112.92 ? 220  HIS D CD2 1 
ATOM   5080 C CE1 . HIS C 2 74  ? 4.170  -31.925 22.727 1.00 112.92 ? 220  HIS D CE1 1 
ATOM   5081 N NE2 . HIS C 2 74  ? 4.013  -32.311 21.474 1.00 112.92 ? 220  HIS D NE2 1 
ATOM   5082 N N   . GLU C 2 75  ? 4.235  -35.950 25.968 1.00 97.66  ? 221  GLU D N   1 
ATOM   5083 C CA  . GLU C 2 75  ? 5.096  -35.589 27.090 1.00 97.66  ? 221  GLU D CA  1 
ATOM   5084 C C   . GLU C 2 75  ? 6.256  -36.578 27.188 1.00 97.66  ? 221  GLU D C   1 
ATOM   5085 O O   . GLU C 2 75  ? 7.379  -36.206 27.530 1.00 97.66  ? 221  GLU D O   1 
ATOM   5086 C CB  . GLU C 2 75  ? 4.308  -35.592 28.403 1.00 173.41 ? 221  GLU D CB  1 
ATOM   5087 C CG  . GLU C 2 75  ? 5.184  -35.477 29.645 1.00 173.41 ? 221  GLU D CG  1 
ATOM   5088 C CD  . GLU C 2 75  ? 4.381  -35.362 30.928 1.00 92.92  ? 221  GLU D CD  1 
ATOM   5089 O OE1 . GLU C 2 75  ? 4.990  -35.440 32.021 1.00 92.92  ? 221  GLU D OE1 1 
ATOM   5090 O OE2 . GLU C 2 75  ? 3.143  -35.189 30.844 1.00 92.92  ? 221  GLU D OE2 1 
ATOM   5091 N N   . LEU C 2 76  ? 5.976  -37.840 26.883 1.00 73.44  ? 222  LEU D N   1 
ATOM   5092 C CA  . LEU C 2 76  ? 7.000  -38.871 26.930 1.00 73.44  ? 222  LEU D CA  1 
ATOM   5093 C C   . LEU C 2 76  ? 8.058  -38.590 25.861 1.00 73.44  ? 222  LEU D C   1 
ATOM   5094 O O   . LEU C 2 76  ? 9.246  -38.461 26.166 1.00 73.44  ? 222  LEU D O   1 
ATOM   5095 C CB  . LEU C 2 76  ? 6.369  -40.255 26.707 1.00 39.14  ? 222  LEU D CB  1 
ATOM   5096 C CG  . LEU C 2 76  ? 7.317  -41.446 26.909 1.00 39.14  ? 222  LEU D CG  1 
ATOM   5097 C CD1 . LEU C 2 76  ? 8.023  -41.265 28.232 1.00 39.14  ? 222  LEU D CD1 1 
ATOM   5098 C CD2 . LEU C 2 76  ? 6.564  -42.776 26.892 1.00 39.14  ? 222  LEU D CD2 1 
ATOM   5099 N N   . GLN C 2 77  ? 7.609  -38.487 24.612 1.00 52.23  ? 223  GLN D N   1 
ATOM   5100 C CA  . GLN C 2 77  ? 8.484  -38.221 23.484 1.00 52.23  ? 223  GLN D CA  1 
ATOM   5101 C C   . GLN C 2 77  ? 9.386  -37.005 23.728 1.00 52.23  ? 223  GLN D C   1 
ATOM   5102 O O   . GLN C 2 77  ? 10.531 -36.971 23.276 1.00 52.23  ? 223  GLN D O   1 
ATOM   5103 C CB  . GLN C 2 77  ? 7.644  -38.000 22.230 1.00 45.99  ? 223  GLN D CB  1 
ATOM   5104 C CG  . GLN C 2 77  ? 8.471  -37.845 20.975 1.00 45.99  ? 223  GLN D CG  1 
ATOM   5105 C CD  . GLN C 2 77  ? 7.633  -37.564 19.751 1.00 45.99  ? 223  GLN D CD  1 
ATOM   5106 O OE1 . GLN C 2 77  ? 8.158  -37.430 18.643 1.00 45.99  ? 223  GLN D OE1 1 
ATOM   5107 N NE2 . GLN C 2 77  ? 6.321  -37.473 19.939 1.00 45.99  ? 223  GLN D NE2 1 
ATOM   5108 N N   . ALA C 2 78  ? 8.866  -36.008 24.437 1.00 46.71  ? 224  ALA D N   1 
ATOM   5109 C CA  . ALA C 2 78  ? 9.633  -34.810 24.741 1.00 46.71  ? 224  ALA D CA  1 
ATOM   5110 C C   . ALA C 2 78  ? 10.777 -35.129 25.705 1.00 46.71  ? 224  ALA D C   1 
ATOM   5111 O O   . ALA C 2 78  ? 11.944 -34.873 25.414 1.00 46.71  ? 224  ALA D O   1 
ATOM   5112 C CB  . ALA C 2 78  ? 8.723  -33.747 25.358 1.00 25.65  ? 224  ALA D CB  1 
ATOM   5113 N N   . VAL C 2 79  ? 10.433 -35.683 26.862 1.00 60.23  ? 225  VAL D N   1 
ATOM   5114 C CA  . VAL C 2 79  ? 11.434 -36.014 27.859 1.00 60.23  ? 225  VAL D CA  1 
ATOM   5115 C C   . VAL C 2 79  ? 12.363 -37.092 27.314 1.00 60.23  ? 225  VAL D C   1 
ATOM   5116 O O   . VAL C 2 79  ? 13.564 -37.077 27.590 1.00 60.23  ? 225  VAL D O   1 
ATOM   5117 C CB  . VAL C 2 79  ? 10.778 -36.503 29.166 1.00 33.52  ? 225  VAL D CB  1 
ATOM   5118 C CG1 . VAL C 2 79  ? 10.190 -37.874 28.970 1.00 33.52  ? 225  VAL D CG1 1 
ATOM   5119 C CG2 . VAL C 2 79  ? 11.801 -36.527 30.281 1.00 33.52  ? 225  VAL D CG2 1 
ATOM   5120 N N   . LEU C 2 80  ? 11.812 -38.021 26.534 1.00 46.69  ? 226  LEU D N   1 
ATOM   5121 C CA  . LEU C 2 80  ? 12.636 -39.075 25.966 1.00 46.69  ? 226  LEU D CA  1 
ATOM   5122 C C   . LEU C 2 80  ? 13.648 -38.425 25.026 1.00 46.69  ? 226  LEU D C   1 
ATOM   5123 O O   . LEU C 2 80  ? 14.830 -38.782 25.017 1.00 46.69  ? 226  LEU D O   1 
ATOM   5124 C CB  . LEU C 2 80  ? 11.797 -40.086 25.187 1.00 32.68  ? 226  LEU D CB  1 
ATOM   5125 C CG  . LEU C 2 80  ? 12.676 -41.160 24.538 1.00 32.68  ? 226  LEU D CG  1 
ATOM   5126 C CD1 . LEU C 2 80  ? 13.243 -42.058 25.619 1.00 32.68  ? 226  LEU D CD1 1 
ATOM   5127 C CD2 . LEU C 2 80  ? 11.879 -41.981 23.547 1.00 32.68  ? 226  LEU D CD2 1 
ATOM   5128 N N   . LEU C 2 81  ? 13.181 -37.458 24.244 1.00 50.80  ? 227  LEU D N   1 
ATOM   5129 C CA  . LEU C 2 81  ? 14.059 -36.770 23.310 1.00 50.80  ? 227  LEU D CA  1 
ATOM   5130 C C   . LEU C 2 81  ? 15.052 -35.863 24.020 1.00 50.80  ? 227  LEU D C   1 
ATOM   5131 O O   . LEU C 2 81  ? 16.135 -35.588 23.497 1.00 50.80  ? 227  LEU D O   1 
ATOM   5132 C CB  . LEU C 2 81  ? 13.236 -35.994 22.275 1.00 47.14  ? 227  LEU D CB  1 
ATOM   5133 C CG  . LEU C 2 81  ? 13.116 -36.754 20.945 1.00 47.14  ? 227  LEU D CG  1 
ATOM   5134 C CD1 . LEU C 2 81  ? 12.975 -38.235 21.211 1.00 47.14  ? 227  LEU D CD1 1 
ATOM   5135 C CD2 . LEU C 2 81  ? 11.927 -36.241 20.145 1.00 47.14  ? 227  LEU D CD2 1 
ATOM   5136 N N   . THR C 2 82  ? 14.699 -35.394 25.210 1.00 40.95  ? 228  THR D N   1 
ATOM   5137 C CA  . THR C 2 82  ? 15.636 -34.565 25.943 1.00 40.95  ? 228  THR D CA  1 
ATOM   5138 C C   . THR C 2 82  ? 16.775 -35.514 26.310 1.00 40.95  ? 228  THR D C   1 
ATOM   5139 O O   . THR C 2 82  ? 17.954 -35.219 26.099 1.00 40.95  ? 228  THR D O   1 
ATOM   5140 C CB  . THR C 2 82  ? 14.988 -33.966 27.206 1.00 46.74  ? 228  THR D CB  1 
ATOM   5141 O OG1 . THR C 2 82  ? 14.022 -32.984 26.818 1.00 46.74  ? 228  THR D OG1 1 
ATOM   5142 C CG2 . THR C 2 82  ? 16.027 -33.296 28.082 1.00 46.74  ? 228  THR D CG2 1 
ATOM   5143 N N   . CYS C 2 83  ? 16.408 -36.680 26.828 1.00 42.91  ? 229  CYS D N   1 
ATOM   5144 C CA  . CYS C 2 83  ? 17.393 -37.677 27.199 1.00 42.91  ? 229  CYS D CA  1 
ATOM   5145 C C   . CYS C 2 83  ? 18.263 -38.008 26.006 1.00 42.91  ? 229  CYS D C   1 
ATOM   5146 O O   . CYS C 2 83  ? 19.495 -38.022 26.103 1.00 42.91  ? 229  CYS D O   1 
ATOM   5147 C CB  . CYS C 2 83  ? 16.700 -38.942 27.697 1.00 43.34  ? 229  CYS D CB  1 
ATOM   5148 S SG  . CYS C 2 83  ? 15.974 -38.745 29.334 1.00 43.34  ? 229  CYS D SG  1 
ATOM   5149 N N   . LEU C 2 84  ? 17.626 -38.257 24.869 1.00 39.09  ? 230  LEU D N   1 
ATOM   5150 C CA  . LEU C 2 84  ? 18.387 -38.601 23.683 1.00 39.09  ? 230  LEU D CA  1 
ATOM   5151 C C   . LEU C 2 84  ? 19.351 -37.482 23.337 1.00 39.09  ? 230  LEU D C   1 
ATOM   5152 O O   . LEU C 2 84  ? 20.502 -37.727 22.984 1.00 39.09  ? 230  LEU D O   1 
ATOM   5153 C CB  . LEU C 2 84  ? 17.475 -38.858 22.490 1.00 48.22  ? 230  LEU D CB  1 
ATOM   5154 C CG  . LEU C 2 84  ? 18.308 -39.350 21.300 1.00 48.22  ? 230  LEU D CG  1 
ATOM   5155 C CD1 . LEU C 2 84  ? 18.849 -40.745 21.618 1.00 48.22  ? 230  LEU D CD1 1 
ATOM   5156 C CD2 . LEU C 2 84  ? 17.475 -39.369 20.032 1.00 48.22  ? 230  LEU D CD2 1 
ATOM   5157 N N   . TYR C 2 85  ? 18.879 -36.249 23.444 1.00 41.42  ? 231  TYR D N   1 
ATOM   5158 C CA  . TYR C 2 85  ? 19.709 -35.104 23.135 1.00 41.42  ? 231  TYR D CA  1 
ATOM   5159 C C   . TYR C 2 85  ? 20.995 -35.134 23.985 1.00 41.42  ? 231  TYR D C   1 
ATOM   5160 O O   . TYR C 2 85  ? 22.102 -34.991 23.453 1.00 41.42  ? 231  TYR D O   1 
ATOM   5161 C CB  . TYR C 2 85  ? 18.904 -33.831 23.384 1.00 43.39  ? 231  TYR D CB  1 
ATOM   5162 C CG  . TYR C 2 85  ? 19.611 -32.551 23.018 1.00 43.39  ? 231  TYR D CG  1 
ATOM   5163 C CD1 . TYR C 2 85  ? 20.141 -32.358 21.743 1.00 43.39  ? 231  TYR D CD1 1 
ATOM   5164 C CD2 . TYR C 2 85  ? 19.756 -31.536 23.952 1.00 43.39  ? 231  TYR D CD2 1 
ATOM   5165 C CE1 . TYR C 2 85  ? 20.814 -31.175 21.412 1.00 43.39  ? 231  TYR D CE1 1 
ATOM   5166 C CE2 . TYR C 2 85  ? 20.415 -30.359 23.640 1.00 43.39  ? 231  TYR D CE2 1 
ATOM   5167 C CZ  . TYR C 2 85  ? 20.950 -30.179 22.372 1.00 43.39  ? 231  TYR D CZ  1 
ATOM   5168 O OH  . TYR C 2 85  ? 21.653 -29.019 22.097 1.00 43.39  ? 231  TYR D OH  1 
ATOM   5169 N N   . LEU C 2 86  ? 20.846 -35.338 25.297 1.00 39.55  ? 232  LEU D N   1 
ATOM   5170 C CA  . LEU C 2 86  ? 21.990 -35.395 26.214 1.00 39.55  ? 232  LEU D CA  1 
ATOM   5171 C C   . LEU C 2 86  ? 22.936 -36.529 25.888 1.00 39.55  ? 232  LEU D C   1 
ATOM   5172 O O   . LEU C 2 86  ? 24.152 -36.376 26.015 1.00 39.55  ? 232  LEU D O   1 
ATOM   5173 C CB  . LEU C 2 86  ? 21.520 -35.588 27.640 1.00 40.56  ? 232  LEU D CB  1 
ATOM   5174 C CG  . LEU C 2 86  ? 20.634 -34.485 28.180 1.00 40.56  ? 232  LEU D CG  1 
ATOM   5175 C CD1 . LEU C 2 86  ? 20.288 -34.821 29.628 1.00 40.56  ? 232  LEU D CD1 1 
ATOM   5176 C CD2 . LEU C 2 86  ? 21.369 -33.142 28.067 1.00 40.56  ? 232  LEU D CD2 1 
ATOM   5177 N N   . SER C 2 87  ? 22.372 -37.673 25.500 1.00 38.03  ? 233  SER D N   1 
ATOM   5178 C CA  . SER C 2 87  ? 23.176 -38.836 25.148 1.00 38.03  ? 233  SER D CA  1 
ATOM   5179 C C   . SER C 2 87  ? 24.049 -38.483 23.952 1.00 38.03  ? 233  SER D C   1 
ATOM   5180 O O   . SER C 2 87  ? 25.220 -38.869 23.879 1.00 38.03  ? 233  SER D O   1 
ATOM   5181 C CB  . SER C 2 87  ? 22.284 -40.024 24.794 1.00 69.44  ? 233  SER D CB  1 
ATOM   5182 O OG  . SER C 2 87  ? 21.537 -40.449 25.917 1.00 69.44  ? 233  SER D OG  1 
ATOM   5183 N N   . TYR C 2 88  ? 23.467 -37.750 23.012 1.00 35.48  ? 234  TYR D N   1 
ATOM   5184 C CA  . TYR C 2 88  ? 24.206 -37.338 21.837 1.00 35.48  ? 234  TYR D CA  1 
ATOM   5185 C C   . TYR C 2 88  ? 25.279 -36.337 22.270 1.00 35.48  ? 234  TYR D C   1 
ATOM   5186 O O   . TYR C 2 88  ? 26.456 -36.451 21.907 1.00 35.48  ? 234  TYR D O   1 
ATOM   5187 C CB  . TYR C 2 88  ? 23.280 -36.666 20.827 1.00 49.37  ? 234  TYR D CB  1 
ATOM   5188 C CG  . TYR C 2 88  ? 22.626 -37.581 19.810 1.00 49.37  ? 234  TYR D CG  1 
ATOM   5189 C CD1 . TYR C 2 88  ? 21.348 -38.096 20.019 1.00 49.37  ? 234  TYR D CD1 1 
ATOM   5190 C CD2 . TYR C 2 88  ? 23.257 -37.861 18.596 1.00 49.37  ? 234  TYR D CD2 1 
ATOM   5191 C CE1 . TYR C 2 88  ? 20.707 -38.859 19.038 1.00 49.37  ? 234  TYR D CE1 1 
ATOM   5192 C CE2 . TYR C 2 88  ? 22.628 -38.619 17.613 1.00 49.37  ? 234  TYR D CE2 1 
ATOM   5193 C CZ  . TYR C 2 88  ? 21.351 -39.111 17.837 1.00 49.37  ? 234  TYR D CZ  1 
ATOM   5194 O OH  . TYR C 2 88  ? 20.709 -39.822 16.849 1.00 49.37  ? 234  TYR D OH  1 
ATOM   5195 N N   . SER C 2 89  ? 24.865 -35.354 23.057 1.00 34.61  ? 235  SER D N   1 
ATOM   5196 C CA  . SER C 2 89  ? 25.785 -34.340 23.521 1.00 34.61  ? 235  SER D CA  1 
ATOM   5197 C C   . SER C 2 89  ? 26.989 -34.951 24.224 1.00 34.61  ? 235  SER D C   1 
ATOM   5198 O O   . SER C 2 89  ? 28.136 -34.646 23.908 1.00 34.61  ? 235  SER D O   1 
ATOM   5199 C CB  . SER C 2 89  ? 25.060 -33.401 24.472 1.00 39.69  ? 235  SER D CB  1 
ATOM   5200 O OG  . SER C 2 89  ? 23.839 -32.980 23.897 1.00 39.69  ? 235  SER D OG  1 
ATOM   5201 N N   . TYR C 2 90  ? 26.708 -35.849 25.155 1.00 38.22  ? 236  TYR D N   1 
ATOM   5202 C CA  . TYR C 2 90  ? 27.731 -36.483 25.967 1.00 38.22  ? 236  TYR D CA  1 
ATOM   5203 C C   . TYR C 2 90  ? 28.463 -37.673 25.341 1.00 38.22  ? 236  TYR D C   1 
ATOM   5204 O O   . TYR C 2 90  ? 29.664 -37.803 25.511 1.00 38.22  ? 236  TYR D O   1 
ATOM   5205 C CB  . TYR C 2 90  ? 27.081 -36.878 27.294 1.00 39.82  ? 236  TYR D CB  1 
ATOM   5206 C CG  . TYR C 2 90  ? 28.022 -37.237 28.410 1.00 39.82  ? 236  TYR D CG  1 
ATOM   5207 C CD1 . TYR C 2 90  ? 28.458 -38.543 28.584 1.00 39.82  ? 236  TYR D CD1 1 
ATOM   5208 C CD2 . TYR C 2 90  ? 28.432 -36.278 29.333 1.00 39.82  ? 236  TYR D CD2 1 
ATOM   5209 C CE1 . TYR C 2 90  ? 29.271 -38.890 29.653 1.00 39.82  ? 236  TYR D CE1 1 
ATOM   5210 C CE2 . TYR C 2 90  ? 29.245 -36.611 30.405 1.00 39.82  ? 236  TYR D CE2 1 
ATOM   5211 C CZ  . TYR C 2 90  ? 29.659 -37.919 30.561 1.00 39.82  ? 236  TYR D CZ  1 
ATOM   5212 O OH  . TYR C 2 90  ? 30.460 -38.267 31.630 1.00 39.82  ? 236  TYR D OH  1 
ATOM   5213 N N   . MET C 2 91  ? 27.752 -38.539 24.626 1.00 38.20  ? 237  MET D N   1 
ATOM   5214 C CA  . MET C 2 91  ? 28.375 -39.717 24.017 1.00 38.20  ? 237  MET D CA  1 
ATOM   5215 C C   . MET C 2 91  ? 28.566 -39.544 22.528 1.00 38.20  ? 237  MET D C   1 
ATOM   5216 O O   . MET C 2 91  ? 29.181 -40.383 21.881 1.00 38.20  ? 237  MET D O   1 
ATOM   5217 C CB  . MET C 2 91  ? 27.519 -40.968 24.235 1.00 43.04  ? 237  MET D CB  1 
ATOM   5218 C CG  . MET C 2 91  ? 27.358 -41.387 25.673 1.00 43.04  ? 237  MET D CG  1 
ATOM   5219 S SD  . MET C 2 91  ? 28.939 -41.799 26.382 1.00 43.04  ? 237  MET D SD  1 
ATOM   5220 C CE  . MET C 2 91  ? 28.985 -43.523 26.074 1.00 43.04  ? 237  MET D CE  1 
ATOM   5221 N N   . GLY C 2 92  ? 28.031 -38.457 21.988 1.00 44.35  ? 238  GLY D N   1 
ATOM   5222 C CA  . GLY C 2 92  ? 28.136 -38.223 20.566 1.00 44.35  ? 238  GLY D CA  1 
ATOM   5223 C C   . GLY C 2 92  ? 29.538 -38.340 20.000 1.00 44.35  ? 238  GLY D C   1 
ATOM   5224 O O   . GLY C 2 92  ? 30.505 -37.833 20.577 1.00 44.35  ? 238  GLY D O   1 
ATOM   5225 N N   . ASN C 2 93  ? 29.631 -39.006 18.853 1.00 84.23  ? 239  ASN D N   1 
ATOM   5226 C CA  . ASN C 2 93  ? 30.895 -39.198 18.160 1.00 84.23  ? 239  ASN D CA  1 
ATOM   5227 C C   . ASN C 2 93  ? 31.329 -37.877 17.530 1.00 84.23  ? 239  ASN D C   1 
ATOM   5228 O O   . ASN C 2 93  ? 32.520 -37.631 17.367 1.00 84.23  ? 239  ASN D O   1 
ATOM   5229 C CB  . ASN C 2 93  ? 30.743 -40.296 17.111 1.00 80.59  ? 239  ASN D CB  1 
ATOM   5230 C CG  . ASN C 2 93  ? 30.336 -41.621 17.728 1.00 80.59  ? 239  ASN D CG  1 
ATOM   5231 O OD1 . ASN C 2 93  ? 31.096 -42.227 18.488 1.00 80.59  ? 239  ASN D OD1 1 
ATOM   5232 N ND2 . ASN C 2 93  ? 29.127 -42.071 17.418 1.00 80.59  ? 239  ASN D ND2 1 
ATOM   5233 N N   . GLU C 2 94  ? 30.364 -37.030 17.175 1.00 50.21  ? 240  GLU D N   1 
ATOM   5234 C CA  . GLU C 2 94  ? 30.675 -35.714 16.616 1.00 50.21  ? 240  GLU D CA  1 
ATOM   5235 C C   . GLU C 2 94  ? 30.978 -34.814 17.818 1.00 50.21  ? 240  GLU D C   1 
ATOM   5236 O O   . GLU C 2 94  ? 30.688 -35.189 18.960 1.00 50.21  ? 240  GLU D O   1 
ATOM   5237 C CB  . GLU C 2 94  ? 29.476 -35.141 15.858 1.00 50.38  ? 240  GLU D CB  1 
ATOM   5238 C CG  . GLU C 2 94  ? 28.945 -36.029 14.735 1.00 50.38  ? 240  GLU D CG  1 
ATOM   5239 C CD  . GLU C 2 94  ? 30.011 -36.436 13.732 1.00 50.38  ? 240  GLU D CD  1 
ATOM   5240 O OE1 . GLU C 2 94  ? 30.872 -35.603 13.386 1.00 50.38  ? 240  GLU D OE1 1 
ATOM   5241 O OE2 . GLU C 2 94  ? 29.982 -37.590 13.270 1.00 50.38  ? 240  GLU D OE2 1 
ATOM   5242 N N   . ILE C 2 95  ? 31.556 -33.640 17.595 1.00 83.00  ? 241  ILE D N   1 
ATOM   5243 C CA  . ILE C 2 95  ? 31.832 -32.770 18.728 1.00 83.00  ? 241  ILE D CA  1 
ATOM   5244 C C   . ILE C 2 95  ? 30.566 -31.994 19.095 1.00 83.00  ? 241  ILE D C   1 
ATOM   5245 O O   . ILE C 2 95  ? 30.561 -31.241 20.067 1.00 83.00  ? 241  ILE D O   1 
ATOM   5246 C CB  . ILE C 2 95  ? 33.000 -31.781 18.448 1.00 55.76  ? 241  ILE D CB  1 
ATOM   5247 C CG1 . ILE C 2 95  ? 32.620 -30.809 17.331 1.00 55.76  ? 241  ILE D CG1 1 
ATOM   5248 C CG2 . ILE C 2 95  ? 34.264 -32.557 18.073 1.00 55.76  ? 241  ILE D CG2 1 
ATOM   5249 C CD1 . ILE C 2 95  ? 33.550 -29.638 17.229 1.00 55.76  ? 241  ILE D CD1 1 
ATOM   5250 N N   . SER C 2 96  ? 29.495 -32.194 18.320 1.00 69.25  ? 242  SER D N   1 
ATOM   5251 C CA  . SER C 2 96  ? 28.213 -31.527 18.572 1.00 69.25  ? 242  SER D CA  1 
ATOM   5252 C C   . SER C 2 96  ? 27.080 -31.982 17.638 1.00 69.25  ? 242  SER D C   1 
ATOM   5253 O O   . SER C 2 96  ? 27.323 -32.689 16.657 1.00 69.25  ? 242  SER D O   1 
ATOM   5254 C CB  . SER C 2 96  ? 28.379 -30.012 18.461 1.00 51.32  ? 242  SER D CB  1 
ATOM   5255 O OG  . SER C 2 96  ? 28.856 -29.644 17.178 1.00 51.32  ? 242  SER D OG  1 
ATOM   5256 N N   . TYR C 2 97  ? 25.847 -31.575 17.968 1.00 56.83  ? 243  TYR D N   1 
ATOM   5257 C CA  . TYR C 2 97  ? 24.639 -31.897 17.188 1.00 56.83  ? 243  TYR D CA  1 
ATOM   5258 C C   . TYR C 2 97  ? 23.592 -30.797 17.245 1.00 56.83  ? 243  TYR D C   1 
ATOM   5259 O O   . TYR C 2 97  ? 23.568 -29.983 18.163 1.00 56.83  ? 243  TYR D O   1 
ATOM   5260 C CB  . TYR C 2 97  ? 23.969 -33.192 17.669 1.00 38.40  ? 243  TYR D CB  1 
ATOM   5261 C CG  . TYR C 2 97  ? 24.840 -34.416 17.566 1.00 38.40  ? 243  TYR D CG  1 
ATOM   5262 C CD1 . TYR C 2 97  ? 25.657 -34.786 18.612 1.00 38.40  ? 243  TYR D CD1 1 
ATOM   5263 C CD2 . TYR C 2 97  ? 24.905 -35.150 16.387 1.00 38.40  ? 243  TYR D CD2 1 
ATOM   5264 C CE1 . TYR C 2 97  ? 26.530 -35.859 18.497 1.00 38.40  ? 243  TYR D CE1 1 
ATOM   5265 C CE2 . TYR C 2 97  ? 25.771 -36.217 16.253 1.00 38.40  ? 243  TYR D CE2 1 
ATOM   5266 C CZ  . TYR C 2 97  ? 26.584 -36.566 17.317 1.00 38.40  ? 243  TYR D CZ  1 
ATOM   5267 O OH  . TYR C 2 97  ? 27.455 -37.619 17.207 1.00 38.40  ? 243  TYR D OH  1 
ATOM   5268 N N   . PRO C 2 98  ? 22.707 -30.767 16.246 1.00 55.97  ? 244  PRO D N   1 
ATOM   5269 C CA  . PRO C 2 98  ? 21.628 -29.785 16.135 1.00 55.97  ? 244  PRO D CA  1 
ATOM   5270 C C   . PRO C 2 98  ? 20.512 -30.115 17.109 1.00 55.97  ? 244  PRO D C   1 
ATOM   5271 O O   . PRO C 2 98  ? 20.448 -31.224 17.635 1.00 55.97  ? 244  PRO D O   1 
ATOM   5272 C CB  . PRO C 2 98  ? 21.158 -29.943 14.690 1.00 98.33  ? 244  PRO D CB  1 
ATOM   5273 C CG  . PRO C 2 98  ? 22.355 -30.518 13.986 1.00 98.33  ? 244  PRO D CG  1 
ATOM   5274 C CD  . PRO C 2 98  ? 22.852 -31.516 14.989 1.00 98.33  ? 244  PRO D CD  1 
ATOM   5275 N N   . LEU C 2 99  ? 19.624 -29.149 17.312 1.00 47.19  ? 245  LEU D N   1 
ATOM   5276 C CA  . LEU C 2 99  ? 18.483 -29.279 18.206 1.00 47.19  ? 245  LEU D CA  1 
ATOM   5277 C C   . LEU C 2 99  ? 17.162 -29.448 17.440 1.00 47.19  ? 245  LEU D C   1 
ATOM   5278 O O   . LEU C 2 99  ? 16.112 -29.685 18.035 1.00 47.19  ? 245  LEU D O   1 
ATOM   5279 C CB  . LEU C 2 99  ? 18.392 -28.025 19.075 1.00 76.80  ? 245  LEU D CB  1 
ATOM   5280 C CG  . LEU C 2 99  ? 17.174 -27.887 19.984 1.00 76.80  ? 245  LEU D CG  1 
ATOM   5281 C CD1 . LEU C 2 99  ? 17.239 -28.959 21.053 1.00 76.80  ? 245  LEU D CD1 1 
ATOM   5282 C CD2 . LEU C 2 99  ? 17.140 -26.505 20.607 1.00 76.80  ? 245  LEU D CD2 1 
ATOM   5283 N N   . LYS C 2 100 ? 17.204 -29.330 16.121 1.00 64.59  ? 246  LYS D N   1 
ATOM   5284 C CA  . LYS C 2 100 ? 15.983 -29.427 15.336 1.00 64.59  ? 246  LYS D CA  1 
ATOM   5285 C C   . LYS C 2 100 ? 15.160 -30.687 15.584 1.00 64.59  ? 246  LYS D C   1 
ATOM   5286 O O   . LYS C 2 100 ? 14.000 -30.600 15.992 1.00 64.59  ? 246  LYS D O   1 
ATOM   5287 C CB  . LYS C 2 100 ? 16.310 -29.278 13.838 1.00 96.03  ? 246  LYS D CB  1 
ATOM   5288 C CG  . LYS C 2 100 ? 17.159 -28.025 13.546 1.00 96.03  ? 246  LYS D CG  1 
ATOM   5289 C CD  . LYS C 2 100 ? 17.391 -27.734 12.046 1.00 96.03  ? 246  LYS D CD  1 
ATOM   5290 C CE  . LYS C 2 100 ? 18.238 -26.446 11.896 1.00 96.03  ? 246  LYS D CE  1 
ATOM   5291 N NZ  . LYS C 2 100 ? 18.463 -25.979 10.488 1.00 96.03  ? 246  LYS D NZ  1 
ATOM   5292 N N   . PRO C 2 101 ? 15.752 -31.877 15.374 1.00 52.80  ? 247  PRO D N   1 
ATOM   5293 C CA  . PRO C 2 101 ? 15.010 -33.123 15.582 1.00 52.80  ? 247  PRO D CA  1 
ATOM   5294 C C   . PRO C 2 101 ? 14.708 -33.520 17.029 1.00 52.80  ? 247  PRO D C   1 
ATOM   5295 O O   . PRO C 2 101 ? 14.042 -34.528 17.267 1.00 52.80  ? 247  PRO D O   1 
ATOM   5296 C CB  . PRO C 2 101 ? 15.885 -34.152 14.877 1.00 69.30  ? 247  PRO D CB  1 
ATOM   5297 C CG  . PRO C 2 101 ? 17.256 -33.657 15.180 1.00 69.30  ? 247  PRO D CG  1 
ATOM   5298 C CD  . PRO C 2 101 ? 17.136 -32.161 14.953 1.00 69.30  ? 247  PRO D CD  1 
ATOM   5299 N N   . PHE C 2 102 ? 15.173 -32.733 17.994 1.00 64.06  ? 248  PHE D N   1 
ATOM   5300 C CA  . PHE C 2 102 ? 14.941 -33.078 19.388 1.00 64.06  ? 248  PHE D CA  1 
ATOM   5301 C C   . PHE C 2 102 ? 13.833 -32.282 20.050 1.00 64.06  ? 248  PHE D C   1 
ATOM   5302 O O   . PHE C 2 102 ? 13.131 -32.797 20.923 1.00 64.06  ? 248  PHE D O   1 
ATOM   5303 C CB  . PHE C 2 102 ? 16.230 -32.911 20.196 1.00 58.01  ? 248  PHE D CB  1 
ATOM   5304 C CG  . PHE C 2 102 ? 17.376 -33.717 19.672 1.00 58.01  ? 248  PHE D CG  1 
ATOM   5305 C CD1 . PHE C 2 102 ? 18.144 -33.250 18.610 1.00 58.01  ? 248  PHE D CD1 1 
ATOM   5306 C CD2 . PHE C 2 102 ? 17.679 -34.957 20.227 1.00 58.01  ? 248  PHE D CD2 1 
ATOM   5307 C CE1 . PHE C 2 102 ? 19.199 -34.008 18.106 1.00 58.01  ? 248  PHE D CE1 1 
ATOM   5308 C CE2 . PHE C 2 102 ? 18.733 -35.730 19.730 1.00 58.01  ? 248  PHE D CE2 1 
ATOM   5309 C CZ  . PHE C 2 102 ? 19.497 -35.254 18.668 1.00 58.01  ? 248  PHE D CZ  1 
ATOM   5310 N N   . LEU C 2 103 ? 13.680 -31.029 19.646 1.00 68.00  ? 249  LEU D N   1 
ATOM   5311 C CA  . LEU C 2 103 ? 12.656 -30.177 20.234 1.00 68.00  ? 249  LEU D CA  1 
ATOM   5312 C C   . LEU C 2 103 ? 11.287 -30.380 19.584 1.00 68.00  ? 249  LEU D C   1 
ATOM   5313 O O   . LEU C 2 103 ? 10.986 -29.782 18.551 1.00 68.00  ? 249  LEU D O   1 
ATOM   5314 C CB  . LEU C 2 103 ? 13.072 -28.711 20.117 1.00 80.50  ? 249  LEU D CB  1 
ATOM   5315 C CG  . LEU C 2 103 ? 12.150 -27.703 20.802 1.00 80.50  ? 249  LEU D CG  1 
ATOM   5316 C CD1 . LEU C 2 103 ? 12.133 -27.957 22.300 1.00 80.50  ? 249  LEU D CD1 1 
ATOM   5317 C CD2 . LEU C 2 103 ? 12.635 -26.296 20.507 1.00 80.50  ? 249  LEU D CD2 1 
ATOM   5318 N N   . VAL C 2 104 ? 10.470 -31.235 20.197 1.00 92.98  ? 250  VAL D N   1 
ATOM   5319 C CA  . VAL C 2 104 ? 9.125  -31.522 19.713 1.00 92.98  ? 250  VAL D CA  1 
ATOM   5320 C C   . VAL C 2 104 ? 8.135  -30.806 20.617 1.00 92.98  ? 250  VAL D C   1 
ATOM   5321 O O   . VAL C 2 104 ? 6.950  -30.693 20.307 1.00 92.98  ? 250  VAL D O   1 
ATOM   5322 C CB  . VAL C 2 104 ? 8.826  -33.044 19.738 1.00 108.58 ? 250  VAL D CB  1 
ATOM   5323 C CG1 . VAL C 2 104 ? 7.368  -33.306 19.365 1.00 108.58 ? 250  VAL D CG1 1 
ATOM   5324 C CG2 . VAL C 2 104 ? 9.748  -33.768 18.771 1.00 108.58 ? 250  VAL D CG2 1 
ATOM   5325 N N   . GLU C 2 105 ? 8.644  -30.319 21.741 1.00 69.23  ? 251  GLU D N   1 
ATOM   5326 C CA  . GLU C 2 105 ? 7.834  -29.597 22.712 1.00 69.23  ? 251  GLU D CA  1 
ATOM   5327 C C   . GLU C 2 105 ? 7.599  -28.172 22.201 1.00 69.23  ? 251  GLU D C   1 
ATOM   5328 O O   . GLU C 2 105 ? 8.334  -27.691 21.344 1.00 69.23  ? 251  GLU D O   1 
ATOM   5329 C CB  . GLU C 2 105 ? 8.567  -29.571 24.046 1.00 78.21  ? 251  GLU D CB  1 
ATOM   5330 C CG  . GLU C 2 105 ? 7.787  -28.960 25.167 1.00 78.21  ? 251  GLU D CG  1 
ATOM   5331 C CD  . GLU C 2 105 ? 8.557  -28.977 26.465 1.00 78.21  ? 251  GLU D CD  1 
ATOM   5332 O OE1 . GLU C 2 105 ? 8.723  -30.060 27.068 1.00 78.21  ? 251  GLU D OE1 1 
ATOM   5333 O OE2 . GLU C 2 105 ? 9.012  -27.898 26.880 1.00 78.21  ? 251  GLU D OE2 1 
ATOM   5334 N N   . SER C 2 106 ? 6.572  -27.507 22.717 1.00 82.85  ? 252  SER D N   1 
ATOM   5335 C CA  . SER C 2 106 ? 6.252  -26.151 22.288 1.00 82.85  ? 252  SER D CA  1 
ATOM   5336 C C   . SER C 2 106 ? 7.065  -25.080 23.022 1.00 82.85  ? 252  SER D C   1 
ATOM   5337 O O   . SER C 2 106 ? 7.771  -24.270 22.403 1.00 82.85  ? 252  SER D O   1 
ATOM   5338 C CB  . SER C 2 106 ? 4.758  -25.879 22.500 1.00 65.39  ? 252  SER D CB  1 
ATOM   5339 O OG  . SER C 2 106 ? 4.430  -24.512 22.235 1.00 65.39  ? 252  SER D OG  1 
ATOM   5340 N N   . CYS C 2 107 ? 6.949  -25.090 24.347 1.00 70.42  ? 253  CYS D N   1 
ATOM   5341 C CA  . CYS C 2 107 ? 7.633  -24.149 25.223 1.00 70.42  ? 253  CYS D CA  1 
ATOM   5342 C C   . CYS C 2 107 ? 9.142  -24.429 25.253 1.00 70.42  ? 253  CYS D C   1 
ATOM   5343 O O   . CYS C 2 107 ? 9.622  -25.161 26.121 1.00 70.42  ? 253  CYS D O   1 
ATOM   5344 C CB  . CYS C 2 107 ? 7.032  -24.272 26.634 1.00 77.42  ? 253  CYS D CB  1 
ATOM   5345 S SG  . CYS C 2 107 ? 7.710  -23.184 27.914 1.00 77.42  ? 253  CYS D SG  1 
ATOM   5346 N N   . LYS C 2 108 ? 9.879  -23.855 24.304 1.00 70.59  ? 254  LYS D N   1 
ATOM   5347 C CA  . LYS C 2 108 ? 11.325 -24.034 24.265 1.00 70.59  ? 254  LYS D CA  1 
ATOM   5348 C C   . LYS C 2 108 ? 11.939 -23.917 25.658 1.00 70.59  ? 254  LYS D C   1 
ATOM   5349 O O   . LYS C 2 108 ? 12.845 -24.662 26.017 1.00 70.59  ? 254  LYS D O   1 
ATOM   5350 C CB  . LYS C 2 108 ? 11.991 -22.995 23.361 1.00 80.52  ? 254  LYS D CB  1 
ATOM   5351 C CG  . LYS C 2 108 ? 12.056 -23.345 21.893 1.00 80.52  ? 254  LYS D CG  1 
ATOM   5352 C CD  . LYS C 2 108 ? 12.982 -22.365 21.177 1.00 80.52  ? 254  LYS D CD  1 
ATOM   5353 C CE  . LYS C 2 108 ? 13.139 -22.694 19.703 1.00 80.52  ? 254  LYS D CE  1 
ATOM   5354 N NZ  . LYS C 2 108 ? 14.190 -21.852 19.060 1.00 80.52  ? 254  LYS D NZ  1 
ATOM   5355 N N   . GLU C 2 109 ? 11.443 -22.966 26.437 1.00 82.41  ? 255  GLU D N   1 
ATOM   5356 C CA  . GLU C 2 109 ? 11.937 -22.747 27.789 1.00 82.41  ? 255  GLU D CA  1 
ATOM   5357 C C   . GLU C 2 109 ? 11.959 -24.027 28.629 1.00 82.41  ? 255  GLU D C   1 
ATOM   5358 O O   . GLU C 2 109 ? 12.860 -24.228 29.443 1.00 82.41  ? 255  GLU D O   1 
ATOM   5359 C CB  . GLU C 2 109 ? 11.083 -21.686 28.495 1.00 104.55 ? 255  GLU D CB  1 
ATOM   5360 C CG  . GLU C 2 109 ? 11.324 -21.598 29.994 1.00 104.55 ? 255  GLU D CG  1 
ATOM   5361 C CD  . GLU C 2 109 ? 10.503 -20.511 30.654 1.00 104.55 ? 255  GLU D CD  1 
ATOM   5362 O OE1 . GLU C 2 109 ? 9.256  -20.570 30.558 1.00 104.55 ? 255  GLU D OE1 1 
ATOM   5363 O OE2 . GLU C 2 109 ? 11.106 -19.605 31.272 1.00 104.55 ? 255  GLU D OE2 1 
ATOM   5364 N N   . ALA C 2 110 ? 10.971 -24.894 28.434 1.00 53.97  ? 256  ALA D N   1 
ATOM   5365 C CA  . ALA C 2 110 ? 10.903 -26.139 29.198 1.00 53.97  ? 256  ALA D CA  1 
ATOM   5366 C C   . ALA C 2 110 ? 11.909 -27.193 28.730 1.00 53.97  ? 256  ALA D C   1 
ATOM   5367 O O   . ALA C 2 110 ? 12.453 -27.929 29.544 1.00 53.97  ? 256  ALA D O   1 
ATOM   5368 C CB  . ALA C 2 110 ? 9.491  -26.699 29.154 1.00 42.38  ? 256  ALA D CB  1 
ATOM   5369 N N   . PHE C 2 111 ? 12.154 -27.263 27.426 1.00 46.32  ? 257  PHE D N   1 
ATOM   5370 C CA  . PHE C 2 111 ? 13.114 -28.221 26.900 1.00 46.32  ? 257  PHE D CA  1 
ATOM   5371 C C   . PHE C 2 111 ? 14.468 -28.048 27.585 1.00 46.32  ? 257  PHE D C   1 
ATOM   5372 O O   . PHE C 2 111 ? 15.074 -29.022 28.042 1.00 46.32  ? 257  PHE D O   1 
ATOM   5373 C CB  . PHE C 2 111 ? 13.311 -28.036 25.395 1.00 52.76  ? 257  PHE D CB  1 
ATOM   5374 C CG  . PHE C 2 111 ? 14.398 -28.914 24.818 1.00 52.76  ? 257  PHE D CG  1 
ATOM   5375 C CD1 . PHE C 2 111 ? 14.130 -30.229 24.450 1.00 52.76  ? 257  PHE D CD1 1 
ATOM   5376 C CD2 . PHE C 2 111 ? 15.703 -28.436 24.686 1.00 52.76  ? 257  PHE D CD2 1 
ATOM   5377 C CE1 . PHE C 2 111 ? 15.149 -31.060 23.957 1.00 52.76  ? 257  PHE D CE1 1 
ATOM   5378 C CE2 . PHE C 2 111 ? 16.735 -29.257 24.196 1.00 52.76  ? 257  PHE D CE2 1 
ATOM   5379 C CZ  . PHE C 2 111 ? 16.458 -30.569 23.832 1.00 52.76  ? 257  PHE D CZ  1 
ATOM   5380 N N   . TRP C 2 112 ? 14.943 -26.806 27.633 1.00 45.40  ? 258  TRP D N   1 
ATOM   5381 C CA  . TRP C 2 112 ? 16.223 -26.486 28.256 1.00 45.40  ? 258  TRP D CA  1 
ATOM   5382 C C   . TRP C 2 112 ? 16.167 -26.689 29.755 1.00 45.40  ? 258  TRP D C   1 
ATOM   5383 O O   . TRP C 2 112 ? 17.184 -26.912 30.401 1.00 45.40  ? 258  TRP D O   1 
ATOM   5384 C CB  . TRP C 2 112 ? 16.620 -25.035 27.963 1.00 47.86  ? 258  TRP D CB  1 
ATOM   5385 C CG  . TRP C 2 112 ? 16.949 -24.791 26.528 1.00 47.86  ? 258  TRP D CG  1 
ATOM   5386 C CD1 . TRP C 2 112 ? 16.345 -23.904 25.690 1.00 47.86  ? 258  TRP D CD1 1 
ATOM   5387 C CD2 . TRP C 2 112 ? 17.953 -25.452 25.758 1.00 47.86  ? 258  TRP D CD2 1 
ATOM   5388 N NE1 . TRP C 2 112 ? 16.909 -23.971 24.441 1.00 47.86  ? 258  TRP D NE1 1 
ATOM   5389 C CE2 . TRP C 2 112 ? 17.900 -24.914 24.454 1.00 47.86  ? 258  TRP D CE2 1 
ATOM   5390 C CE3 . TRP C 2 112 ? 18.894 -26.449 26.041 1.00 47.86  ? 258  TRP D CE3 1 
ATOM   5391 C CZ2 . TRP C 2 112 ? 18.751 -25.337 23.436 1.00 47.86  ? 258  TRP D CZ2 1 
ATOM   5392 C CZ3 . TRP C 2 112 ? 19.740 -26.873 25.033 1.00 47.86  ? 258  TRP D CZ3 1 
ATOM   5393 C CH2 . TRP C 2 112 ? 19.664 -26.316 23.744 1.00 47.86  ? 258  TRP D CH2 1 
ATOM   5394 N N   . ASP C 2 113 ? 14.973 -26.607 30.315 1.00 68.30  ? 259  ASP D N   1 
ATOM   5395 C CA  . ASP C 2 113 ? 14.842 -26.788 31.742 1.00 68.30  ? 259  ASP D CA  1 
ATOM   5396 C C   . ASP C 2 113 ? 15.155 -28.236 32.097 1.00 68.30  ? 259  ASP D C   1 
ATOM   5397 O O   . ASP C 2 113 ? 15.933 -28.500 33.020 1.00 68.30  ? 259  ASP D O   1 
ATOM   5398 C CB  . ASP C 2 113 ? 13.437 -26.421 32.191 1.00 132.99 ? 259  ASP D CB  1 
ATOM   5399 C CG  . ASP C 2 113 ? 13.415 -25.898 33.599 1.00 132.99 ? 259  ASP D CG  1 
ATOM   5400 O OD1 . ASP C 2 113 ? 13.704 -26.680 34.535 1.00 132.99 ? 259  ASP D OD1 1 
ATOM   5401 O OD2 . ASP C 2 113 ? 13.126 -24.695 33.766 1.00 132.99 ? 259  ASP D OD2 1 
ATOM   5402 N N   . ARG C 2 114 ? 14.547 -29.172 31.367 1.00 64.54  ? 260  ARG D N   1 
ATOM   5403 C CA  . ARG C 2 114 ? 14.805 -30.590 31.604 1.00 64.54  ? 260  ARG D CA  1 
ATOM   5404 C C   . ARG C 2 114 ? 16.303 -30.840 31.445 1.00 64.54  ? 260  ARG D C   1 
ATOM   5405 O O   . ARG C 2 114 ? 16.917 -31.503 32.282 1.00 64.54  ? 260  ARG D O   1 
ATOM   5406 C CB  . ARG C 2 114 ? 14.036 -31.466 30.612 1.00 60.08  ? 260  ARG D CB  1 
ATOM   5407 C CG  . ARG C 2 114 ? 12.647 -31.851 31.053 1.00 60.08  ? 260  ARG D CG  1 
ATOM   5408 C CD  . ARG C 2 114 ? 12.065 -32.860 30.086 1.00 60.08  ? 260  ARG D CD  1 
ATOM   5409 N NE  . ARG C 2 114 ? 11.954 -32.304 28.741 1.00 60.08  ? 260  ARG D NE  1 
ATOM   5410 C CZ  . ARG C 2 114 ? 11.036 -31.415 28.368 1.00 60.08  ? 260  ARG D CZ  1 
ATOM   5411 N NH1 . ARG C 2 114 ? 10.130 -30.977 29.238 1.00 60.08  ? 260  ARG D NH1 1 
ATOM   5412 N NH2 . ARG C 2 114 ? 11.032 -30.954 27.124 1.00 60.08  ? 260  ARG D NH2 1 
ATOM   5413 N N   . CYS C 2 115 ? 16.878 -30.304 30.365 1.00 48.54  ? 261  CYS D N   1 
ATOM   5414 C CA  . CYS C 2 115 ? 18.304 -30.442 30.100 1.00 48.54  ? 261  CYS D CA  1 
ATOM   5415 C C   . CYS C 2 115 ? 19.102 -30.116 31.370 1.00 48.54  ? 261  CYS D C   1 
ATOM   5416 O O   . CYS C 2 115 ? 20.045 -30.836 31.711 1.00 48.54  ? 261  CYS D O   1 
ATOM   5417 C CB  . CYS C 2 115 ? 18.721 -29.529 28.938 1.00 42.11  ? 261  CYS D CB  1 
ATOM   5418 S SG  . CYS C 2 115 ? 18.156 -30.084 27.291 1.00 42.11  ? 261  CYS D SG  1 
ATOM   5419 N N   . LEU C 2 116 ? 18.727 -29.052 32.078 1.00 44.65  ? 262  LEU D N   1 
ATOM   5420 C CA  . LEU C 2 116 ? 19.425 -28.720 33.320 1.00 44.65  ? 262  LEU D CA  1 
ATOM   5421 C C   . LEU C 2 116 ? 19.032 -29.675 34.462 1.00 44.65  ? 262  LEU D C   1 
ATOM   5422 O O   . LEU C 2 116 ? 19.902 -30.163 35.206 1.00 44.65  ? 262  LEU D O   1 
ATOM   5423 C CB  . LEU C 2 116 ? 19.163 -27.273 33.747 1.00 40.34  ? 262  LEU D CB  1 
ATOM   5424 C CG  . LEU C 2 116 ? 20.032 -26.226 33.050 1.00 40.34  ? 262  LEU D CG  1 
ATOM   5425 C CD1 . LEU C 2 116 ? 19.831 -24.863 33.703 1.00 40.34  ? 262  LEU D CD1 1 
ATOM   5426 C CD2 . LEU C 2 116 ? 21.506 -26.645 33.170 1.00 40.34  ? 262  LEU D CD2 1 
ATOM   5427 N N   . SER C 2 117 ? 17.736 -29.958 34.595 1.00 55.18  ? 263  SER D N   1 
ATOM   5428 C CA  . SER C 2 117 ? 17.272 -30.870 35.644 1.00 55.18  ? 263  SER D CA  1 
ATOM   5429 C C   . SER C 2 117 ? 17.996 -32.221 35.539 1.00 55.18  ? 263  SER D C   1 
ATOM   5430 O O   . SER C 2 117 ? 18.556 -32.720 36.521 1.00 55.18  ? 263  SER D O   1 
ATOM   5431 C CB  . SER C 2 117 ? 15.759 -31.101 35.528 1.00 64.38  ? 263  SER D CB  1 
ATOM   5432 O OG  . SER C 2 117 ? 15.045 -29.875 35.509 1.00 64.38  ? 263  SER D OG  1 
ATOM   5433 N N   . VAL C 2 118 ? 17.987 -32.803 34.342 1.00 40.97  ? 264  VAL D N   1 
ATOM   5434 C CA  . VAL C 2 118 ? 18.626 -34.090 34.133 1.00 40.97  ? 264  VAL D CA  1 
ATOM   5435 C C   . VAL C 2 118 ? 20.116 -34.023 34.395 1.00 40.97  ? 264  VAL D C   1 
ATOM   5436 O O   . VAL C 2 118 ? 20.677 -34.877 35.087 1.00 40.97  ? 264  VAL D O   1 
ATOM   5437 C CB  . VAL C 2 118 ? 18.429 -34.611 32.711 1.00 41.02  ? 264  VAL D CB  1 
ATOM   5438 C CG1 . VAL C 2 118 ? 19.164 -35.930 32.557 1.00 41.02  ? 264  VAL D CG1 1 
ATOM   5439 C CG2 . VAL C 2 118 ? 16.945 -34.797 32.415 1.00 41.02  ? 264  VAL D CG2 1 
ATOM   5440 N N   . ILE C 2 119 ? 20.764 -33.010 33.838 1.00 34.89  ? 265  ILE D N   1 
ATOM   5441 C CA  . ILE C 2 119 ? 22.195 -32.876 34.039 1.00 34.89  ? 265  ILE D CA  1 
ATOM   5442 C C   . ILE C 2 119 ? 22.533 -32.798 35.527 1.00 34.89  ? 265  ILE D C   1 
ATOM   5443 O O   . ILE C 2 119 ? 23.502 -33.388 35.982 1.00 34.89  ? 265  ILE D O   1 
ATOM   5444 C CB  . ILE C 2 119 ? 22.739 -31.636 33.296 1.00 39.07  ? 265  ILE D CB  1 
ATOM   5445 C CG1 . ILE C 2 119 ? 22.939 -31.976 31.816 1.00 39.07  ? 265  ILE D CG1 1 
ATOM   5446 C CG2 . ILE C 2 119 ? 24.037 -31.166 33.927 1.00 39.07  ? 265  ILE D CG2 1 
ATOM   5447 C CD1 . ILE C 2 119 ? 23.359 -30.761 30.973 1.00 39.07  ? 265  ILE D CD1 1 
ATOM   5448 N N   . ASN C 2 120 ? 21.719 -32.092 36.294 1.00 47.86  ? 266  ASN D N   1 
ATOM   5449 C CA  . ASN C 2 120 ? 22.007 -31.964 37.710 1.00 47.86  ? 266  ASN D CA  1 
ATOM   5450 C C   . ASN C 2 120 ? 21.782 -33.224 38.528 1.00 47.86  ? 266  ASN D C   1 
ATOM   5451 O O   . ASN C 2 120 ? 22.388 -33.395 39.582 1.00 47.86  ? 266  ASN D O   1 
ATOM   5452 C CB  . ASN C 2 120 ? 21.202 -30.813 38.300 1.00 69.21  ? 266  ASN D CB  1 
ATOM   5453 C CG  . ASN C 2 120 ? 21.708 -29.470 37.837 1.00 69.21  ? 266  ASN D CG  1 
ATOM   5454 O OD1 . ASN C 2 120 ? 22.915 -29.223 37.831 1.00 69.21  ? 266  ASN D OD1 1 
ATOM   5455 N ND2 . ASN C 2 120 ? 20.792 -28.588 37.454 1.00 69.21  ? 266  ASN D ND2 1 
ATOM   5456 N N   . LEU C 2 121 ? 20.929 -34.112 38.030 1.00 35.71  ? 267  LEU D N   1 
ATOM   5457 C CA  . LEU C 2 121 ? 20.597 -35.348 38.731 1.00 35.71  ? 267  LEU D CA  1 
ATOM   5458 C C   . LEU C 2 121 ? 21.360 -36.554 38.173 1.00 35.71  ? 267  LEU D C   1 
ATOM   5459 O O   . LEU C 2 121 ? 21.578 -37.524 38.896 1.00 35.71  ? 267  LEU D O   1 
ATOM   5460 C CB  . LEU C 2 121 ? 19.072 -35.576 38.641 1.00 41.97  ? 267  LEU D CB  1 
ATOM   5461 C CG  . LEU C 2 121 ? 18.287 -36.694 39.360 1.00 41.97  ? 267  LEU D CG  1 
ATOM   5462 C CD1 . LEU C 2 121 ? 18.428 -38.009 38.620 1.00 41.97  ? 267  LEU D CD1 1 
ATOM   5463 C CD2 . LEU C 2 121 ? 18.751 -36.819 40.796 1.00 41.97  ? 267  LEU D CD2 1 
ATOM   5464 N N   . MET C 2 122 ? 21.783 -36.489 36.906 1.00 34.32  ? 268  MET D N   1 
ATOM   5465 C CA  . MET C 2 122 ? 22.500 -37.607 36.285 1.00 34.32  ? 268  MET D CA  1 
ATOM   5466 C C   . MET C 2 122 ? 23.979 -37.411 35.946 1.00 34.32  ? 268  MET D C   1 
ATOM   5467 O O   . MET C 2 122 ? 24.633 -38.362 35.518 1.00 34.32  ? 268  MET D O   1 
ATOM   5468 C CB  . MET C 2 122 ? 21.791 -38.050 35.007 1.00 42.40  ? 268  MET D CB  1 
ATOM   5469 C CG  . MET C 2 122 ? 20.342 -38.396 35.185 1.00 42.40  ? 268  MET D CG  1 
ATOM   5470 S SD  . MET C 2 122 ? 20.128 -39.484 36.594 1.00 42.40  ? 268  MET D SD  1 
ATOM   5471 C CE  . MET C 2 122 ? 20.274 -41.073 35.834 1.00 42.40  ? 268  MET D CE  1 
ATOM   5472 N N   . SER C 2 123 ? 24.520 -36.211 36.143 1.00 38.53  ? 269  SER D N   1 
ATOM   5473 C CA  . SER C 2 123 ? 25.920 -35.975 35.789 1.00 38.53  ? 269  SER D CA  1 
ATOM   5474 C C   . SER C 2 123 ? 26.891 -37.025 36.312 1.00 38.53  ? 269  SER D C   1 
ATOM   5475 O O   . SER C 2 123 ? 27.777 -37.448 35.582 1.00 38.53  ? 269  SER D O   1 
ATOM   5476 C CB  . SER C 2 123 ? 26.383 -34.601 36.255 1.00 40.98  ? 269  SER D CB  1 
ATOM   5477 O OG  . SER C 2 123 ? 26.886 -34.667 37.569 1.00 40.98  ? 269  SER D OG  1 
ATOM   5478 N N   . SER C 2 124 ? 26.744 -37.450 37.563 1.00 48.15  ? 270  SER D N   1 
ATOM   5479 C CA  . SER C 2 124 ? 27.648 -38.467 38.116 1.00 48.15  ? 270  SER D CA  1 
ATOM   5480 C C   . SER C 2 124 ? 27.517 -39.827 37.416 1.00 48.15  ? 270  SER D C   1 
ATOM   5481 O O   . SER C 2 124 ? 28.518 -40.442 37.038 1.00 48.15  ? 270  SER D O   1 
ATOM   5482 C CB  . SER C 2 124 ? 27.397 -38.631 39.610 1.00 48.53  ? 270  SER D CB  1 
ATOM   5483 O OG  . SER C 2 124 ? 27.586 -37.388 40.254 1.00 48.53  ? 270  SER D OG  1 
ATOM   5484 N N   . LYS C 2 125 ? 26.283 -40.293 37.244 1.00 35.19  ? 271  LYS D N   1 
ATOM   5485 C CA  . LYS C 2 125 ? 26.035 -41.565 36.580 1.00 35.19  ? 271  LYS D CA  1 
ATOM   5486 C C   . LYS C 2 125 ? 26.458 -41.554 35.110 1.00 35.19  ? 271  LYS D C   1 
ATOM   5487 O O   . LYS C 2 125 ? 26.859 -42.590 34.567 1.00 35.19  ? 271  LYS D O   1 
ATOM   5488 C CB  . LYS C 2 125 ? 24.550 -41.928 36.682 1.00 38.96  ? 271  LYS D CB  1 
ATOM   5489 C CG  . LYS C 2 125 ? 24.089 -42.200 38.104 1.00 38.96  ? 271  LYS D CG  1 
ATOM   5490 C CD  . LYS C 2 125 ? 22.587 -42.293 38.164 1.00 38.96  ? 271  LYS D CD  1 
ATOM   5491 C CE  . LYS C 2 125 ? 22.132 -42.631 39.557 1.00 38.96  ? 271  LYS D CE  1 
ATOM   5492 N NZ  . LYS C 2 125 ? 20.659 -42.721 39.577 1.00 38.96  ? 271  LYS D NZ  1 
ATOM   5493 N N   . MET C 2 126 ? 26.363 -40.392 34.470 1.00 45.56  ? 272  MET D N   1 
ATOM   5494 C CA  . MET C 2 126 ? 26.750 -40.271 33.075 1.00 45.56  ? 272  MET D CA  1 
ATOM   5495 C C   . MET C 2 126 ? 28.244 -40.536 32.923 1.00 45.56  ? 272  MET D C   1 
ATOM   5496 O O   . MET C 2 126 ? 28.677 -41.151 31.940 1.00 45.56  ? 272  MET D O   1 
ATOM   5497 C CB  . MET C 2 126 ? 26.402 -38.881 32.553 1.00 45.12  ? 272  MET D CB  1 
ATOM   5498 C CG  . MET C 2 126 ? 24.907 -38.657 32.405 1.00 45.12  ? 272  MET D CG  1 
ATOM   5499 S SD  . MET C 2 126 ? 24.455 -36.913 32.246 1.00 45.12  ? 272  MET D SD  1 
ATOM   5500 C CE  . MET C 2 126 ? 24.697 -36.645 30.432 1.00 45.12  ? 272  MET D CE  1 
ATOM   5501 N N   . LEU C 2 127 ? 29.029 -40.089 33.904 1.00 37.63  ? 273  LEU D N   1 
ATOM   5502 C CA  . LEU C 2 127 ? 30.477 -40.300 33.879 1.00 37.63  ? 273  LEU D CA  1 
ATOM   5503 C C   . LEU C 2 127 ? 30.846 -41.689 34.399 1.00 37.63  ? 273  LEU D C   1 
ATOM   5504 O O   . LEU C 2 127 ? 31.761 -42.331 33.874 1.00 37.63  ? 273  LEU D O   1 
ATOM   5505 C CB  . LEU C 2 127 ? 31.203 -39.250 34.731 1.00 37.06  ? 273  LEU D CB  1 
ATOM   5506 C CG  . LEU C 2 127 ? 32.740 -39.386 34.746 1.00 37.06  ? 273  LEU D CG  1 
ATOM   5507 C CD1 . LEU C 2 127 ? 33.282 -39.289 33.322 1.00 37.06  ? 273  LEU D CD1 1 
ATOM   5508 C CD2 . LEU C 2 127 ? 33.366 -38.291 35.614 1.00 37.06  ? 273  LEU D CD2 1 
ATOM   5509 N N   . GLN C 2 128 ? 30.126 -42.157 35.421 1.00 44.87  ? 274  GLN D N   1 
ATOM   5510 C CA  . GLN C 2 128 ? 30.425 -43.461 36.003 1.00 44.87  ? 274  GLN D CA  1 
ATOM   5511 C C   . GLN C 2 128 ? 30.288 -44.613 35.012 1.00 44.87  ? 274  GLN D C   1 
ATOM   5512 O O   . GLN C 2 128 ? 31.203 -45.432 34.879 1.00 44.87  ? 274  GLN D O   1 
ATOM   5513 C CB  . GLN C 2 128 ? 29.534 -43.747 37.218 1.00 65.58  ? 274  GLN D CB  1 
ATOM   5514 C CG  . GLN C 2 128 ? 30.133 -44.809 38.151 1.00 65.58  ? 274  GLN D CG  1 
ATOM   5515 C CD  . GLN C 2 128 ? 29.115 -45.491 39.054 1.00 65.58  ? 274  GLN D CD  1 
ATOM   5516 O OE1 . GLN C 2 128 ? 28.156 -44.869 39.518 1.00 65.58  ? 274  GLN D OE1 1 
ATOM   5517 N NE2 . GLN C 2 128 ? 29.336 -46.777 39.324 1.00 65.58  ? 274  GLN D NE2 1 
ATOM   5518 N N   . ILE C 2 129 ? 29.149 -44.668 34.318 1.00 37.68  ? 275  ILE D N   1 
ATOM   5519 C CA  . ILE C 2 129 ? 28.886 -45.738 33.362 1.00 37.68  ? 275  ILE D CA  1 
ATOM   5520 C C   . ILE C 2 129 ? 29.968 -45.821 32.314 1.00 37.68  ? 275  ILE D C   1 
ATOM   5521 O O   . ILE C 2 129 ? 30.068 -46.803 31.576 1.00 37.68  ? 275  ILE D O   1 
ATOM   5522 C CB  . ILE C 2 129 ? 27.537 -45.564 32.650 1.00 34.68  ? 275  ILE D CB  1 
ATOM   5523 C CG1 . ILE C 2 129 ? 27.202 -46.860 31.899 1.00 34.68  ? 275  ILE D CG1 1 
ATOM   5524 C CG2 . ILE C 2 129 ? 27.592 -44.365 31.718 1.00 34.68  ? 275  ILE D CG2 1 
ATOM   5525 C CD1 . ILE C 2 129 ? 25.712 -47.088 31.639 1.00 34.68  ? 275  ILE D CD1 1 
ATOM   5526 N N   . ASN C 2 130 ? 30.779 -44.778 32.254 1.00 45.38  ? 276  ASN D N   1 
ATOM   5527 C CA  . ASN C 2 130 ? 31.863 -44.746 31.307 1.00 45.38  ? 276  ASN D CA  1 
ATOM   5528 C C   . ASN C 2 130 ? 33.133 -45.204 32.004 1.00 45.38  ? 276  ASN D C   1 
ATOM   5529 O O   . ASN C 2 130 ? 33.884 -46.013 31.470 1.00 45.38  ? 276  ASN D O   1 
ATOM   5530 C CB  . ASN C 2 130 ? 32.033 -43.330 30.738 1.00 36.48  ? 276  ASN D CB  1 
ATOM   5531 C CG  . ASN C 2 130 ? 31.162 -43.083 29.511 1.00 36.48  ? 276  ASN D CG  1 
ATOM   5532 O OD1 . ASN C 2 130 ? 31.437 -43.599 28.431 1.00 36.48  ? 276  ASN D OD1 1 
ATOM   5533 N ND2 . ASN C 2 130 ? 30.109 -42.289 29.676 1.00 36.48  ? 276  ASN D ND2 1 
ATOM   5534 N N   . ALA C 2 131 ? 33.345 -44.718 33.216 1.00 37.22  ? 277  ALA D N   1 
ATOM   5535 C CA  . ALA C 2 131 ? 34.546 -45.052 33.964 1.00 37.22  ? 277  ALA D CA  1 
ATOM   5536 C C   . ALA C 2 131 ? 34.497 -46.350 34.762 1.00 37.22  ? 277  ALA D C   1 
ATOM   5537 O O   . ALA C 2 131 ? 35.541 -46.860 35.191 1.00 37.22  ? 277  ALA D O   1 
ATOM   5538 C CB  . ALA C 2 131 ? 34.883 -43.920 34.900 1.00 16.79  ? 277  ALA D CB  1 
ATOM   5539 N N   . ASP C 2 132 ? 33.300 -46.892 34.961 1.00 59.66  ? 278  ASP D N   1 
ATOM   5540 C CA  . ASP C 2 132 ? 33.153 -48.104 35.757 1.00 59.66  ? 278  ASP D CA  1 
ATOM   5541 C C   . ASP C 2 132 ? 32.500 -49.239 34.978 1.00 59.66  ? 278  ASP D C   1 
ATOM   5542 O O   . ASP C 2 132 ? 31.274 -49.380 34.974 1.00 59.66  ? 278  ASP D O   1 
ATOM   5543 C CB  . ASP C 2 132 ? 32.327 -47.764 36.994 1.00 62.87  ? 278  ASP D CB  1 
ATOM   5544 C CG  . ASP C 2 132 ? 32.175 -48.924 37.931 1.00 62.87  ? 278  ASP D CG  1 
ATOM   5545 O OD1 . ASP C 2 132 ? 31.448 -48.758 38.933 1.00 62.87  ? 278  ASP D OD1 1 
ATOM   5546 O OD2 . ASP C 2 132 ? 32.771 -49.988 37.671 1.00 62.87  ? 278  ASP D OD2 1 
ATOM   5547 N N   . PRO C 2 133 ? 33.312 -50.075 34.313 1.00 54.62  ? 279  PRO D N   1 
ATOM   5548 C CA  . PRO C 2 133 ? 32.793 -51.203 33.526 1.00 54.62  ? 279  PRO D CA  1 
ATOM   5549 C C   . PRO C 2 133 ? 31.745 -52.060 34.237 1.00 54.62  ? 279  PRO D C   1 
ATOM   5550 O O   . PRO C 2 133 ? 30.790 -52.511 33.611 1.00 54.62  ? 279  PRO D O   1 
ATOM   5551 C CB  . PRO C 2 133 ? 34.053 -51.991 33.180 1.00 51.49  ? 279  PRO D CB  1 
ATOM   5552 C CG  . PRO C 2 133 ? 35.077 -50.894 33.023 1.00 51.49  ? 279  PRO D CG  1 
ATOM   5553 C CD  . PRO C 2 133 ? 34.782 -50.002 34.220 1.00 51.49  ? 279  PRO D CD  1 
ATOM   5554 N N   . HIS C 2 134 ? 31.914 -52.285 35.537 1.00 50.05  ? 280  HIS D N   1 
ATOM   5555 C CA  . HIS C 2 134 ? 30.952 -53.095 36.273 1.00 50.05  ? 280  HIS D CA  1 
ATOM   5556 C C   . HIS C 2 134 ? 29.610 -52.398 36.313 1.00 50.05  ? 280  HIS D C   1 
ATOM   5557 O O   . HIS C 2 134 ? 28.558 -53.034 36.256 1.00 50.05  ? 280  HIS D O   1 
ATOM   5558 C CB  . HIS C 2 134 ? 31.454 -53.380 37.689 1.00 116.03 ? 280  HIS D CB  1 
ATOM   5559 C CG  . HIS C 2 134 ? 32.602 -54.334 37.727 1.00 116.03 ? 280  HIS D CG  1 
ATOM   5560 N ND1 . HIS C 2 134 ? 33.831 -54.039 37.173 1.00 116.03 ? 280  HIS D ND1 1 
ATOM   5561 C CD2 . HIS C 2 134 ? 32.696 -55.601 38.196 1.00 116.03 ? 280  HIS D CD2 1 
ATOM   5562 C CE1 . HIS C 2 134 ? 34.628 -55.083 37.297 1.00 116.03 ? 280  HIS D CE1 1 
ATOM   5563 N NE2 . HIS C 2 134 ? 33.964 -56.045 37.914 1.00 116.03 ? 280  HIS D NE2 1 
ATOM   5564 N N   . TYR C 2 135 ? 29.640 -51.080 36.400 1.00 49.19  ? 281  TYR D N   1 
ATOM   5565 C CA  . TYR C 2 135 ? 28.397 -50.346 36.423 1.00 49.19  ? 281  TYR D CA  1 
ATOM   5566 C C   . TYR C 2 135 ? 27.751 -50.429 35.041 1.00 49.19  ? 281  TYR D C   1 
ATOM   5567 O O   . TYR C 2 135 ? 26.524 -50.480 34.921 1.00 49.19  ? 281  TYR D O   1 
ATOM   5568 C CB  . TYR C 2 135 ? 28.650 -48.893 36.825 1.00 45.35  ? 281  TYR D CB  1 
ATOM   5569 C CG  . TYR C 2 135 ? 27.402 -48.055 36.827 1.00 45.35  ? 281  TYR D CG  1 
ATOM   5570 C CD1 . TYR C 2 135 ? 26.205 -48.561 37.332 1.00 45.35  ? 281  TYR D CD1 1 
ATOM   5571 C CD2 . TYR C 2 135 ? 27.404 -46.771 36.285 1.00 45.35  ? 281  TYR D CD2 1 
ATOM   5572 C CE1 . TYR C 2 135 ? 25.035 -47.817 37.289 1.00 45.35  ? 281  TYR D CE1 1 
ATOM   5573 C CE2 . TYR C 2 135 ? 26.245 -46.016 36.239 1.00 45.35  ? 281  TYR D CE2 1 
ATOM   5574 C CZ  . TYR C 2 135 ? 25.055 -46.548 36.741 1.00 45.35  ? 281  TYR D CZ  1 
ATOM   5575 O OH  . TYR C 2 135 ? 23.889 -45.809 36.669 1.00 45.35  ? 281  TYR D OH  1 
ATOM   5576 N N   . PHE C 2 136 ? 28.578 -50.465 33.997 1.00 38.43  ? 282  PHE D N   1 
ATOM   5577 C CA  . PHE C 2 136 ? 28.072 -50.543 32.629 1.00 38.43  ? 282  PHE D CA  1 
ATOM   5578 C C   . PHE C 2 136 ? 27.334 -51.855 32.440 1.00 38.43  ? 282  PHE D C   1 
ATOM   5579 O O   . PHE C 2 136 ? 26.292 -51.906 31.791 1.00 38.43  ? 282  PHE D O   1 
ATOM   5580 C CB  . PHE C 2 136 ? 29.224 -50.464 31.620 1.00 43.32  ? 282  PHE D CB  1 
ATOM   5581 C CG  . PHE C 2 136 ? 28.784 -50.596 30.181 1.00 43.32  ? 282  PHE D CG  1 
ATOM   5582 C CD1 . PHE C 2 136 ? 27.903 -49.680 29.622 1.00 43.32  ? 282  PHE D CD1 1 
ATOM   5583 C CD2 . PHE C 2 136 ? 29.234 -51.650 29.396 1.00 43.32  ? 282  PHE D CD2 1 
ATOM   5584 C CE1 . PHE C 2 136 ? 27.474 -49.814 28.309 1.00 43.32  ? 282  PHE D CE1 1 
ATOM   5585 C CE2 . PHE C 2 136 ? 28.812 -51.799 28.079 1.00 43.32  ? 282  PHE D CE2 1 
ATOM   5586 C CZ  . PHE C 2 136 ? 27.930 -50.876 27.534 1.00 43.32  ? 282  PHE D CZ  1 
ATOM   5587 N N   . THR C 2 137 ? 27.893 -52.915 33.017 1.00 55.48  ? 283  THR D N   1 
ATOM   5588 C CA  . THR C 2 137 ? 27.313 -54.242 32.922 1.00 55.48  ? 283  THR D CA  1 
ATOM   5589 C C   . THR C 2 137 ? 25.975 -54.333 33.636 1.00 55.48  ? 283  THR D C   1 
ATOM   5590 O O   . THR C 2 137 ? 25.043 -54.952 33.134 1.00 55.48  ? 283  THR D O   1 
ATOM   5591 C CB  . THR C 2 137 ? 28.265 -55.306 33.498 1.00 55.27  ? 283  THR D CB  1 
ATOM   5592 O OG1 . THR C 2 137 ? 29.405 -55.441 32.639 1.00 55.27  ? 283  THR D OG1 1 
ATOM   5593 C CG2 . THR C 2 137 ? 27.553 -56.643 33.617 1.00 55.27  ? 283  THR D CG2 1 
ATOM   5594 N N   . GLN C 2 138 ? 25.875 -53.717 34.806 1.00 53.27  ? 284  GLN D N   1 
ATOM   5595 C CA  . GLN C 2 138 ? 24.623 -53.750 35.560 1.00 53.27  ? 284  GLN D CA  1 
ATOM   5596 C C   . GLN C 2 138 ? 23.513 -53.048 34.791 1.00 53.27  ? 284  GLN D C   1 
ATOM   5597 O O   . GLN C 2 138 ? 22.402 -53.561 34.691 1.00 53.27  ? 284  GLN D O   1 
ATOM   5598 C CB  . GLN C 2 138 ? 24.807 -53.109 36.934 1.00 97.64  ? 284  GLN D CB  1 
ATOM   5599 C CG  . GLN C 2 138 ? 25.464 -54.035 37.938 1.00 97.64  ? 284  GLN D CG  1 
ATOM   5600 C CD  . GLN C 2 138 ? 25.882 -53.321 39.201 1.00 97.64  ? 284  GLN D CD  1 
ATOM   5601 O OE1 . GLN C 2 138 ? 25.094 -52.594 39.809 1.00 97.64  ? 284  GLN D OE1 1 
ATOM   5602 N NE2 . GLN C 2 138 ? 27.131 -53.527 39.610 1.00 97.64  ? 284  GLN D NE2 1 
ATOM   5603 N N   . VAL C 2 139 ? 23.805 -51.877 34.238 1.00 45.60  ? 285  VAL D N   1 
ATOM   5604 C CA  . VAL C 2 139 ? 22.790 -51.183 33.468 1.00 45.60  ? 285  VAL D CA  1 
ATOM   5605 C C   . VAL C 2 139 ? 22.476 -52.029 32.233 1.00 45.60  ? 285  VAL D C   1 
ATOM   5606 O O   . VAL C 2 139 ? 21.307 -52.317 31.943 1.00 45.60  ? 285  VAL D O   1 
ATOM   5607 C CB  . VAL C 2 139 ? 23.266 -49.804 33.022 1.00 47.61  ? 285  VAL D CB  1 
ATOM   5608 C CG1 . VAL C 2 139 ? 22.137 -49.092 32.289 1.00 47.61  ? 285  VAL D CG1 1 
ATOM   5609 C CG2 . VAL C 2 139 ? 23.723 -48.998 34.234 1.00 47.61  ? 285  VAL D CG2 1 
ATOM   5610 N N   . PHE C 2 140 ? 23.514 -52.431 31.505 1.00 48.45  ? 286  PHE D N   1 
ATOM   5611 C CA  . PHE C 2 140 ? 23.314 -53.259 30.318 1.00 48.45  ? 286  PHE D CA  1 
ATOM   5612 C C   . PHE C 2 140 ? 22.437 -54.462 30.671 1.00 48.45  ? 286  PHE D C   1 
ATOM   5613 O O   . PHE C 2 140 ? 21.462 -54.767 29.981 1.00 48.45  ? 286  PHE D O   1 
ATOM   5614 C CB  . PHE C 2 140 ? 24.648 -53.769 29.777 1.00 51.37  ? 286  PHE D CB  1 
ATOM   5615 C CG  . PHE C 2 140 ? 24.499 -54.755 28.664 1.00 51.37  ? 286  PHE D CG  1 
ATOM   5616 C CD1 . PHE C 2 140 ? 24.187 -54.332 27.376 1.00 51.37  ? 286  PHE D CD1 1 
ATOM   5617 C CD2 . PHE C 2 140 ? 24.627 -56.118 28.908 1.00 51.37  ? 286  PHE D CD2 1 
ATOM   5618 C CE1 . PHE C 2 140 ? 23.999 -55.257 26.343 1.00 51.37  ? 286  PHE D CE1 1 
ATOM   5619 C CE2 . PHE C 2 140 ? 24.441 -57.053 27.885 1.00 51.37  ? 286  PHE D CE2 1 
ATOM   5620 C CZ  . PHE C 2 140 ? 24.128 -56.620 26.600 1.00 51.37  ? 286  PHE D CZ  1 
ATOM   5621 N N   . SER C 2 141 ? 22.800 -55.149 31.746 1.00 64.57  ? 287  SER D N   1 
ATOM   5622 C CA  . SER C 2 141 ? 22.049 -56.311 32.188 1.00 64.57  ? 287  SER D CA  1 
ATOM   5623 C C   . SER C 2 141 ? 20.599 -55.930 32.499 1.00 64.57  ? 287  SER D C   1 
ATOM   5624 O O   . SER C 2 141 ? 19.681 -56.482 31.898 1.00 64.57  ? 287  SER D O   1 
ATOM   5625 C CB  . SER C 2 141 ? 22.714 -56.921 33.421 1.00 55.78  ? 287  SER D CB  1 
ATOM   5626 O OG  . SER C 2 141 ? 21.978 -58.021 33.906 1.00 55.78  ? 287  SER D OG  1 
ATOM   5627 N N   . ASP C 2 142 ? 20.390 -54.990 33.423 1.00 55.77  ? 288  ASP D N   1 
ATOM   5628 C CA  . ASP C 2 142 ? 19.038 -54.556 33.776 1.00 55.77  ? 288  ASP D CA  1 
ATOM   5629 C C   . ASP C 2 142 ? 18.225 -54.299 32.515 1.00 55.77  ? 288  ASP D C   1 
ATOM   5630 O O   . ASP C 2 142 ? 17.089 -54.756 32.402 1.00 55.77  ? 288  ASP D O   1 
ATOM   5631 C CB  . ASP C 2 142 ? 19.056 -53.265 34.614 1.00 62.08  ? 288  ASP D CB  1 
ATOM   5632 C CG  . ASP C 2 142 ? 19.710 -53.441 35.976 1.00 62.08  ? 288  ASP D CG  1 
ATOM   5633 O OD1 . ASP C 2 142 ? 19.362 -54.399 36.699 1.00 62.08  ? 288  ASP D OD1 1 
ATOM   5634 O OD2 . ASP C 2 142 ? 20.565 -52.599 36.328 1.00 62.08  ? 288  ASP D OD2 1 
ATOM   5635 N N   . LEU C 2 143 ? 18.807 -53.568 31.568 1.00 50.15  ? 289  LEU D N   1 
ATOM   5636 C CA  . LEU C 2 143 ? 18.110 -53.253 30.322 1.00 50.15  ? 289  LEU D CA  1 
ATOM   5637 C C   . LEU C 2 143 ? 17.729 -54.513 29.557 1.00 50.15  ? 289  LEU D C   1 
ATOM   5638 O O   . LEU C 2 143 ? 16.608 -54.642 29.055 1.00 50.15  ? 289  LEU D O   1 
ATOM   5639 C CB  . LEU C 2 143 ? 18.975 -52.374 29.416 1.00 46.76  ? 289  LEU D CB  1 
ATOM   5640 C CG  . LEU C 2 143 ? 18.317 -52.049 28.070 1.00 46.76  ? 289  LEU D CG  1 
ATOM   5641 C CD1 . LEU C 2 143 ? 16.999 -51.335 28.312 1.00 46.76  ? 289  LEU D CD1 1 
ATOM   5642 C CD2 . LEU C 2 143 ? 19.235 -51.196 27.214 1.00 46.76  ? 289  LEU D CD2 1 
ATOM   5643 N N   . LYS C 2 144 ? 18.680 -55.434 29.474 1.00 78.85  ? 290  LYS D N   1 
ATOM   5644 C CA  . LYS C 2 144 ? 18.500 -56.699 28.777 1.00 78.85  ? 290  LYS D CA  1 
ATOM   5645 C C   . LYS C 2 144 ? 17.334 -57.511 29.341 1.00 78.85  ? 290  LYS D C   1 
ATOM   5646 O O   . LYS C 2 144 ? 16.614 -58.169 28.588 1.00 78.85  ? 290  LYS D O   1 
ATOM   5647 C CB  . LYS C 2 144 ? 19.802 -57.506 28.862 1.00 117.65 ? 290  LYS D CB  1 
ATOM   5648 C CG  . LYS C 2 144 ? 19.781 -58.850 28.156 1.00 117.65 ? 290  LYS D CG  1 
ATOM   5649 C CD  . LYS C 2 144 ? 21.077 -59.622 28.418 1.00 117.65 ? 290  LYS D CD  1 
ATOM   5650 C CE  . LYS C 2 144 ? 20.976 -61.072 27.941 1.00 117.65 ? 290  LYS D CE  1 
ATOM   5651 N NZ  . LYS C 2 144 ? 22.124 -61.908 28.402 1.00 117.65 ? 290  LYS D NZ  1 
ATOM   5652 N N   . ASN C 2 145 ? 17.151 -57.450 30.662 1.00 62.45  ? 291  ASN D N   1 
ATOM   5653 C CA  . ASN C 2 145 ? 16.085 -58.190 31.344 1.00 62.45  ? 291  ASN D CA  1 
ATOM   5654 C C   . ASN C 2 145 ? 14.829 -57.369 31.599 1.00 62.45  ? 291  ASN D C   1 
ATOM   5655 O O   . ASN C 2 145 ? 13.978 -57.752 32.404 1.00 62.45  ? 291  ASN D O   1 
ATOM   5656 C CB  . ASN C 2 145 ? 16.590 -58.759 32.678 1.00 84.20  ? 291  ASN D CB  1 
ATOM   5657 C CG  . ASN C 2 145 ? 17.688 -59.790 32.495 1.00 84.20  ? 291  ASN D CG  1 
ATOM   5658 O OD1 . ASN C 2 145 ? 17.551 -60.731 31.712 1.00 84.20  ? 291  ASN D OD1 1 
ATOM   5659 N ND2 . ASN C 2 145 ? 18.782 -59.622 33.226 1.00 84.20  ? 291  ASN D ND2 1 
ATOM   5660 N N   . GLU C 2 146 ? 14.725 -56.235 30.919 1.00 63.36  ? 292  GLU D N   1 
ATOM   5661 C CA  . GLU C 2 146 ? 13.569 -55.365 31.058 1.00 63.36  ? 292  GLU D CA  1 
ATOM   5662 C C   . GLU C 2 146 ? 12.533 -55.889 30.073 1.00 63.36  ? 292  GLU D C   1 
ATOM   5663 O O   . GLU C 2 146 ? 11.365 -55.504 30.106 1.00 63.36  ? 292  GLU D O   1 
ATOM   5664 C CB  . GLU C 2 146 ? 13.952 -53.931 30.701 1.00 68.69  ? 292  GLU D CB  1 
ATOM   5665 C CG  . GLU C 2 146 ? 12.979 -52.869 31.188 1.00 68.69  ? 292  GLU D CG  1 
ATOM   5666 C CD  . GLU C 2 146 ? 13.065 -52.605 32.686 1.00 68.69  ? 292  GLU D CD  1 
ATOM   5667 O OE1 . GLU C 2 146 ? 14.179 -52.335 33.196 1.00 68.69  ? 292  GLU D OE1 1 
ATOM   5668 O OE2 . GLU C 2 146 ? 12.007 -52.653 33.349 1.00 68.69  ? 292  GLU D OE2 1 
ATOM   5669 N N   . SER C 2 147 ? 12.984 -56.780 29.198 1.00 82.45  ? 293  SER D N   1 
ATOM   5670 C CA  . SER C 2 147 ? 12.129 -57.385 28.186 1.00 82.45  ? 293  SER D CA  1 
ATOM   5671 C C   . SER C 2 147 ? 10.978 -58.148 28.832 1.00 82.45  ? 293  SER D C   1 
ATOM   5672 O O   . SER C 2 147 ? 9.813  -57.918 28.438 1.00 82.45  ? 293  SER D O   1 
ATOM   5673 C CB  . SER C 2 147 ? 12.953 -58.334 27.309 1.00 94.10  ? 293  SER D CB  1 
ATOM   5674 O OG  . SER C 2 147 ? 12.141 -58.964 26.336 1.00 94.10  ? 293  SER D OG  1 
ATOM   5675 O OXT . SER C 2 147 ? 11.265 -58.977 29.722 1.00 94.10  ? 293  SER D OXT 1 
ATOM   5676 N N   . SER D 2 1   ? 22.661 28.022  19.418 1.00 51.49  ? 147  SER E N   1 
ATOM   5677 C CA  . SER D 2 1   ? 21.799 27.701  20.600 1.00 51.49  ? 147  SER E CA  1 
ATOM   5678 C C   . SER D 2 1   ? 20.868 26.546  20.245 1.00 51.49  ? 147  SER E C   1 
ATOM   5679 O O   . SER D 2 1   ? 20.086 26.646  19.305 1.00 51.49  ? 147  SER E O   1 
ATOM   5680 C CB  . SER D 2 1   ? 20.987 28.924  20.994 1.00 102.25 ? 147  SER E CB  1 
ATOM   5681 N N   . THR D 2 2   ? 20.951 25.451  20.993 1.00 59.21  ? 148  THR E N   1 
ATOM   5682 C CA  . THR D 2 2   ? 20.121 24.280  20.718 1.00 59.21  ? 148  THR E CA  1 
ATOM   5683 C C   . THR D 2 2   ? 18.643 24.636  20.559 1.00 59.21  ? 148  THR E C   1 
ATOM   5684 O O   . THR D 2 2   ? 18.022 24.314  19.548 1.00 59.21  ? 148  THR E O   1 
ATOM   5685 C CB  . THR D 2 2   ? 20.272 23.203  21.839 1.00 85.49  ? 148  THR E CB  1 
ATOM   5686 O OG1 . THR D 2 2   ? 21.641 22.781  21.922 1.00 85.49  ? 148  THR E OG1 1 
ATOM   5687 C CG2 . THR D 2 2   ? 19.392 21.981  21.552 1.00 85.49  ? 148  THR E CG2 1 
ATOM   5688 N N   . SER D 2 3   ? 18.091 25.316  21.551 1.00 65.38  ? 149  SER E N   1 
ATOM   5689 C CA  . SER D 2 3   ? 16.691 25.700  21.530 1.00 65.38  ? 149  SER E CA  1 
ATOM   5690 C C   . SER D 2 3   ? 16.161 26.067  20.152 1.00 65.38  ? 149  SER E C   1 
ATOM   5691 O O   . SER D 2 3   ? 15.315 25.370  19.588 1.00 65.38  ? 149  SER E O   1 
ATOM   5692 C CB  . SER D 2 3   ? 16.469 26.872  22.495 1.00 87.82  ? 149  SER E CB  1 
ATOM   5693 O OG  . SER D 2 3   ? 16.863 26.537  23.812 1.00 87.82  ? 149  SER E OG  1 
ATOM   5694 N N   . GLU D 2 4   ? 16.667 27.172  19.621 1.00 62.19  ? 150  GLU E N   1 
ATOM   5695 C CA  . GLU D 2 4   ? 16.236 27.676  18.325 1.00 62.19  ? 150  GLU E CA  1 
ATOM   5696 C C   . GLU D 2 4   ? 16.614 26.869  17.088 1.00 62.19  ? 150  GLU E C   1 
ATOM   5697 O O   . GLU D 2 4   ? 15.869 26.873  16.107 1.00 62.19  ? 150  GLU E O   1 
ATOM   5698 C CB  . GLU D 2 4   ? 16.671 29.139  18.162 1.00 134.02 ? 150  GLU E CB  1 
ATOM   5699 C CG  . GLU D 2 4   ? 17.995 29.485  18.782 1.00 134.02 ? 150  GLU E CG  1 
ATOM   5700 C CD  . GLU D 2 4   ? 18.921 30.132  17.774 1.00 134.02 ? 150  GLU E CD  1 
ATOM   5701 O OE1 . GLU D 2 4   ? 18.480 31.087  17.092 1.00 134.02 ? 150  GLU E OE1 1 
ATOM   5702 O OE2 . GLU D 2 4   ? 20.085 29.677  17.658 1.00 134.02 ? 150  GLU E OE2 1 
ATOM   5703 N N   . LEU D 2 5   ? 17.753 26.183  17.107 1.00 47.36  ? 151  LEU E N   1 
ATOM   5704 C CA  . LEU D 2 5   ? 18.109 25.380  15.938 1.00 47.36  ? 151  LEU E CA  1 
ATOM   5705 C C   . LEU D 2 5   ? 17.080 24.257  15.877 1.00 47.36  ? 151  LEU E C   1 
ATOM   5706 O O   . LEU D 2 5   ? 16.683 23.818  14.791 1.00 47.36  ? 151  LEU E O   1 
ATOM   5707 C CB  . LEU D 2 5   ? 19.533 24.801  16.043 1.00 38.44  ? 151  LEU E CB  1 
ATOM   5708 C CG  . LEU D 2 5   ? 20.701 25.781  15.799 1.00 38.44  ? 151  LEU E CG  1 
ATOM   5709 C CD1 . LEU D 2 5   ? 22.033 25.203  16.270 1.00 38.44  ? 151  LEU E CD1 1 
ATOM   5710 C CD2 . LEU D 2 5   ? 20.767 26.115  14.322 1.00 38.44  ? 151  LEU E CD2 1 
ATOM   5711 N N   . LEU D 2 6   ? 16.629 23.823  17.054 1.00 48.97  ? 152  LEU E N   1 
ATOM   5712 C CA  . LEU D 2 6   ? 15.634 22.762  17.162 1.00 48.97  ? 152  LEU E CA  1 
ATOM   5713 C C   . LEU D 2 6   ? 14.296 23.146  16.562 1.00 48.97  ? 152  LEU E C   1 
ATOM   5714 O O   . LEU D 2 6   ? 13.661 22.340  15.873 1.00 48.97  ? 152  LEU E O   1 
ATOM   5715 C CB  . LEU D 2 6   ? 15.430 22.371  18.621 1.00 49.96  ? 152  LEU E CB  1 
ATOM   5716 C CG  . LEU D 2 6   ? 16.273 21.192  19.094 1.00 49.96  ? 152  LEU E CG  1 
ATOM   5717 C CD1 . LEU D 2 6   ? 16.092 21.029  20.590 1.00 49.96  ? 152  LEU E CD1 1 
ATOM   5718 C CD2 . LEU D 2 6   ? 15.858 19.916  18.356 1.00 49.96  ? 152  LEU E CD2 1 
ATOM   5719 N N   . ARG D 2 7   ? 13.853 24.367  16.849 1.00 53.91  ? 153  ARG E N   1 
ATOM   5720 C CA  . ARG D 2 7   ? 12.581 24.864  16.320 1.00 53.91  ? 153  ARG E CA  1 
ATOM   5721 C C   . ARG D 2 7   ? 12.725 24.978  14.808 1.00 53.91  ? 153  ARG E C   1 
ATOM   5722 O O   . ARG D 2 7   ? 11.752 24.861  14.062 1.00 53.91  ? 153  ARG E O   1 
ATOM   5723 C CB  . ARG D 2 7   ? 12.266 26.248  16.876 1.00 110.20 ? 153  ARG E CB  1 
ATOM   5724 C CG  . ARG D 2 7   ? 12.116 26.310  18.370 1.00 110.20 ? 153  ARG E CG  1 
ATOM   5725 C CD  . ARG D 2 7   ? 11.789 27.729  18.786 1.00 110.20 ? 153  ARG E CD  1 
ATOM   5726 N NE  . ARG D 2 7   ? 11.464 27.823  20.204 1.00 110.20 ? 153  ARG E NE  1 
ATOM   5727 C CZ  . ARG D 2 7   ? 10.802 28.841  20.744 1.00 110.20 ? 153  ARG E CZ  1 
ATOM   5728 N NH1 . ARG D 2 7   ? 10.398 29.850  19.980 1.00 110.20 ? 153  ARG E NH1 1 
ATOM   5729 N NH2 . ARG D 2 7   ? 10.527 28.844  22.043 1.00 110.20 ? 153  ARG E NH2 1 
ATOM   5730 N N   . CYS D 2 8   ? 13.950 25.230  14.363 1.00 52.14  ? 154  CYS E N   1 
ATOM   5731 C CA  . CYS D 2 8   ? 14.199 25.347  12.948 1.00 52.14  ? 154  CYS E CA  1 
ATOM   5732 C C   . CYS D 2 8   ? 13.939 23.997  12.286 1.00 52.14  ? 154  CYS E C   1 
ATOM   5733 O O   . CYS D 2 8   ? 13.332 23.933  11.207 1.00 52.14  ? 154  CYS E O   1 
ATOM   5734 C CB  . CYS D 2 8   ? 15.633 25.822  12.709 1.00 48.55  ? 154  CYS E CB  1 
ATOM   5735 S SG  . CYS D 2 8   ? 15.834 27.603  13.016 1.00 48.55  ? 154  CYS E SG  1 
ATOM   5736 N N   . LEU D 2 9   ? 14.390 22.928  12.946 1.00 42.07  ? 155  LEU E N   1 
ATOM   5737 C CA  . LEU D 2 9   ? 14.204 21.575  12.448 1.00 42.07  ? 155  LEU E CA  1 
ATOM   5738 C C   . LEU D 2 9   ? 12.699 21.324  12.376 1.00 42.07  ? 155  LEU E C   1 
ATOM   5739 O O   . LEU D 2 9   ? 12.193 20.796  11.385 1.00 42.07  ? 155  LEU E O   1 
ATOM   5740 C CB  . LEU D 2 9   ? 14.846 20.562  13.404 1.00 37.27  ? 155  LEU E CB  1 
ATOM   5741 C CG  . LEU D 2 9   ? 15.693 19.415  12.836 1.00 37.27  ? 155  LEU E CG  1 
ATOM   5742 C CD1 . LEU D 2 9   ? 15.934 18.375  13.934 1.00 37.27  ? 155  LEU E CD1 1 
ATOM   5743 C CD2 . LEU D 2 9   ? 15.001 18.774  11.653 1.00 37.27  ? 155  LEU E CD2 1 
ATOM   5744 N N   . GLY D 2 10  ? 11.989 21.699  13.437 1.00 49.92  ? 156  GLY E N   1 
ATOM   5745 C CA  . GLY D 2 10  ? 10.547 21.509  13.458 1.00 49.92  ? 156  GLY E CA  1 
ATOM   5746 C C   . GLY D 2 10  ? 9.882  22.259  12.317 1.00 49.92  ? 156  GLY E C   1 
ATOM   5747 O O   . GLY D 2 10  ? 9.101  21.694  11.544 1.00 49.92  ? 156  GLY E O   1 
ATOM   5748 N N   . GLU D 2 11  ? 10.191 23.547  12.223 1.00 48.35  ? 157  GLU E N   1 
ATOM   5749 C CA  . GLU D 2 11  ? 9.662  24.391  11.166 1.00 48.35  ? 157  GLU E CA  1 
ATOM   5750 C C   . GLU D 2 11  ? 9.858  23.623  9.850  1.00 48.35  ? 157  GLU E C   1 
ATOM   5751 O O   . GLU D 2 11  ? 8.918  23.429  9.074  1.00 48.35  ? 157  GLU E O   1 
ATOM   5752 C CB  . GLU D 2 11  ? 10.450 25.703  11.126 1.00 72.93  ? 157  GLU E CB  1 
ATOM   5753 C CG  . GLU D 2 11  ? 9.622  26.933  10.829 1.00 72.93  ? 157  GLU E CG  1 
ATOM   5754 C CD  . GLU D 2 11  ? 8.680  27.284  11.967 1.00 72.93  ? 157  GLU E CD  1 
ATOM   5755 O OE1 . GLU D 2 11  ? 9.175  27.592  13.077 1.00 72.93  ? 157  GLU E OE1 1 
ATOM   5756 O OE2 . GLU D 2 11  ? 7.444  27.250  11.753 1.00 72.93  ? 157  GLU E OE2 1 
ATOM   5757 N N   . PHE D 2 12  ? 11.092 23.177  9.622  1.00 59.69  ? 158  PHE E N   1 
ATOM   5758 C CA  . PHE D 2 12  ? 11.448 22.428  8.423  1.00 59.69  ? 158  PHE E CA  1 
ATOM   5759 C C   . PHE D 2 12  ? 10.625 21.164  8.205  1.00 59.69  ? 158  PHE E C   1 
ATOM   5760 O O   . PHE D 2 12  ? 10.030 20.982  7.150  1.00 59.69  ? 158  PHE E O   1 
ATOM   5761 C CB  . PHE D 2 12  ? 12.911 22.026  8.457  1.00 31.12  ? 158  PHE E CB  1 
ATOM   5762 C CG  . PHE D 2 12  ? 13.264 21.020  7.425  1.00 31.12  ? 158  PHE E CG  1 
ATOM   5763 C CD1 . PHE D 2 12  ? 13.409 21.393  6.094  1.00 31.12  ? 158  PHE E CD1 1 
ATOM   5764 C CD2 . PHE D 2 12  ? 13.402 19.685  7.772  1.00 31.12  ? 158  PHE E CD2 1 
ATOM   5765 C CE1 . PHE D 2 12  ? 13.686 20.439  5.112  1.00 31.12  ? 158  PHE E CE1 1 
ATOM   5766 C CE2 . PHE D 2 12  ? 13.678 18.723  6.819  1.00 31.12  ? 158  PHE E CE2 1 
ATOM   5767 C CZ  . PHE D 2 12  ? 13.821 19.093  5.482  1.00 31.12  ? 158  PHE E CZ  1 
ATOM   5768 N N   . LEU D 2 13  ? 10.626 20.273  9.189  1.00 55.90  ? 159  LEU E N   1 
ATOM   5769 C CA  . LEU D 2 13  ? 9.869  19.041  9.066  1.00 55.90  ? 159  LEU E CA  1 
ATOM   5770 C C   . LEU D 2 13  ? 8.427  19.389  8.688  1.00 55.90  ? 159  LEU E C   1 
ATOM   5771 O O   . LEU D 2 13  ? 7.841  18.752  7.810  1.00 55.90  ? 159  LEU E O   1 
ATOM   5772 C CB  . LEU D 2 13  ? 9.941  18.240  10.376 1.00 41.49  ? 159  LEU E CB  1 
ATOM   5773 C CG  . LEU D 2 13  ? 11.321 17.652  10.715 1.00 41.49  ? 159  LEU E CG  1 
ATOM   5774 C CD1 . LEU D 2 13  ? 11.317 16.988  12.067 1.00 41.49  ? 159  LEU E CD1 1 
ATOM   5775 C CD2 . LEU D 2 13  ? 11.705 16.647  9.648  1.00 41.49  ? 159  LEU E CD2 1 
ATOM   5776 N N   . CYS D 2 14  ? 7.862  20.417  9.318  1.00 45.37  ? 160  CYS E N   1 
ATOM   5777 C CA  . CYS D 2 14  ? 6.500  20.825  8.985  1.00 45.37  ? 160  CYS E CA  1 
ATOM   5778 C C   . CYS D 2 14  ? 6.408  21.286  7.528  1.00 45.37  ? 160  CYS E C   1 
ATOM   5779 O O   . CYS D 2 14  ? 5.478  20.920  6.808  1.00 45.37  ? 160  CYS E O   1 
ATOM   5780 C CB  . CYS D 2 14  ? 6.019  21.949  9.905  1.00 58.17  ? 160  CYS E CB  1 
ATOM   5781 S SG  . CYS D 2 14  ? 5.672  21.435  11.610 1.00 58.17  ? 160  CYS E SG  1 
ATOM   5782 N N   . ARG D 2 15  ? 7.371  22.078  7.080  1.00 59.76  ? 161  ARG E N   1 
ATOM   5783 C CA  . ARG D 2 15  ? 7.329  22.544  5.705  1.00 59.76  ? 161  ARG E CA  1 
ATOM   5784 C C   . ARG D 2 15  ? 7.451  21.373  4.720  1.00 59.76  ? 161  ARG E C   1 
ATOM   5785 O O   . ARG D 2 15  ? 6.773  21.342  3.694  1.00 59.76  ? 161  ARG E O   1 
ATOM   5786 C CB  . ARG D 2 15  ? 8.447  23.562  5.452  1.00 116.94 ? 161  ARG E CB  1 
ATOM   5787 C CG  . ARG D 2 15  ? 8.352  24.245  4.099  1.00 116.94 ? 161  ARG E CG  1 
ATOM   5788 C CD  . ARG D 2 15  ? 9.447  25.281  3.883  1.00 116.94 ? 161  ARG E CD  1 
ATOM   5789 N NE  . ARG D 2 15  ? 9.235  26.001  2.628  1.00 116.94 ? 161  ARG E NE  1 
ATOM   5790 C CZ  . ARG D 2 15  ? 10.034 26.951  2.150  1.00 116.94 ? 161  ARG E CZ  1 
ATOM   5791 N NH1 . ARG D 2 15  ? 11.121 27.310  2.821  1.00 116.94 ? 161  ARG E NH1 1 
ATOM   5792 N NH2 . ARG D 2 15  ? 9.742  27.545  0.998  1.00 116.94 ? 161  ARG E NH2 1 
ATOM   5793 N N   . ARG D 2 16  ? 8.306  20.406  5.048  1.00 43.45  ? 162  ARG E N   1 
ATOM   5794 C CA  . ARG D 2 16  ? 8.560  19.235  4.202  1.00 43.45  ? 162  ARG E CA  1 
ATOM   5795 C C   . ARG D 2 16  ? 7.391  18.261  4.154  1.00 43.45  ? 162  ARG E C   1 
ATOM   5796 O O   . ARG D 2 16  ? 7.107  17.684  3.106  1.00 43.45  ? 162  ARG E O   1 
ATOM   5797 C CB  . ARG D 2 16  ? 9.833  18.510  4.687  1.00 42.67  ? 162  ARG E CB  1 
ATOM   5798 C CG  . ARG D 2 16  ? 10.041 17.085  4.154  1.00 42.67  ? 162  ARG E CG  1 
ATOM   5799 C CD  . ARG D 2 16  ? 10.150 17.053  2.642  1.00 42.67  ? 162  ARG E CD  1 
ATOM   5800 N NE  . ARG D 2 16  ? 11.261 17.868  2.158  1.00 42.67  ? 162  ARG E NE  1 
ATOM   5801 C CZ  . ARG D 2 16  ? 12.543 17.528  2.254  1.00 42.67  ? 162  ARG E CZ  1 
ATOM   5802 N NH1 . ARG D 2 16  ? 12.892 16.373  2.815  1.00 42.67  ? 162  ARG E NH1 1 
ATOM   5803 N NH2 . ARG D 2 16  ? 13.476 18.351  1.797  1.00 42.67  ? 162  ARG E NH2 1 
ATOM   5804 N N   . CYS D 2 17  ? 6.730  18.076  5.292  1.00 52.28  ? 163  CYS E N   1 
ATOM   5805 C CA  . CYS D 2 17  ? 5.587  17.173  5.380  1.00 52.28  ? 163  CYS E CA  1 
ATOM   5806 C C   . CYS D 2 17  ? 4.262  17.926  5.302  1.00 52.28  ? 163  CYS E C   1 
ATOM   5807 O O   . CYS D 2 17  ? 3.510  17.974  6.276  1.00 52.28  ? 163  CYS E O   1 
ATOM   5808 C CB  . CYS D 2 17  ? 5.640  16.374  6.681  1.00 60.27  ? 163  CYS E CB  1 
ATOM   5809 S SG  . CYS D 2 17  ? 7.067  15.294  6.796  1.00 60.27  ? 163  CYS E SG  1 
ATOM   5810 N N   . TYR D 2 18  ? 3.991  18.500  4.131  1.00 67.19  ? 164  TYR E N   1 
ATOM   5811 C CA  . TYR D 2 18  ? 2.773  19.265  3.873  1.00 67.19  ? 164  TYR E CA  1 
ATOM   5812 C C   . TYR D 2 18  ? 1.526  18.376  3.939  1.00 67.19  ? 164  TYR E C   1 
ATOM   5813 O O   . TYR D 2 18  ? 0.396  18.859  3.827  1.00 67.19  ? 164  TYR E O   1 
ATOM   5814 C CB  . TYR D 2 18  ? 2.868  19.912  2.488  1.00 71.12  ? 164  TYR E CB  1 
ATOM   5815 C CG  . TYR D 2 18  ? 2.823  18.913  1.351  1.00 71.12  ? 164  TYR E CG  1 
ATOM   5816 C CD1 . TYR D 2 18  ? 1.619  18.329  0.960  1.00 71.12  ? 164  TYR E CD1 1 
ATOM   5817 C CD2 . TYR D 2 18  ? 3.986  18.518  0.697  1.00 71.12  ? 164  TYR E CD2 1 
ATOM   5818 C CE1 . TYR D 2 18  ? 1.574  17.373  -0.051 1.00 71.12  ? 164  TYR E CE1 1 
ATOM   5819 C CE2 . TYR D 2 18  ? 3.954  17.562  -0.316 1.00 71.12  ? 164  TYR E CE2 1 
ATOM   5820 C CZ  . TYR D 2 18  ? 2.745  16.992  -0.684 1.00 71.12  ? 164  TYR E CZ  1 
ATOM   5821 O OH  . TYR D 2 18  ? 2.710  16.032  -1.673 1.00 71.12  ? 164  TYR E OH  1 
ATOM   5822 N N   . ARG D 2 19  ? 1.748  17.074  4.108  1.00 65.49  ? 165  ARG E N   1 
ATOM   5823 C CA  . ARG D 2 19  ? 0.669  16.095  4.185  1.00 65.49  ? 165  ARG E CA  1 
ATOM   5824 C C   . ARG D 2 19  ? 0.070  16.062  5.597  1.00 65.49  ? 165  ARG E C   1 
ATOM   5825 O O   . ARG D 2 19  ? -0.970 15.440  5.827  1.00 65.49  ? 165  ARG E O   1 
ATOM   5826 C CB  . ARG D 2 19  ? 1.209  14.710  3.806  1.00 148.42 ? 165  ARG E CB  1 
ATOM   5827 C CG  . ARG D 2 19  ? 0.149  13.651  3.505  1.00 148.42 ? 165  ARG E CG  1 
ATOM   5828 C CD  . ARG D 2 19  ? -0.673 14.017  2.279  1.00 148.42 ? 165  ARG E CD  1 
ATOM   5829 N NE  . ARG D 2 19  ? -0.884 12.874  1.389  1.00 148.42 ? 165  ARG E NE  1 
ATOM   5830 C CZ  . ARG D 2 19  ? -1.518 12.946  0.220  1.00 148.42 ? 165  ARG E CZ  1 
ATOM   5831 N NH1 . ARG D 2 19  ? -2.013 14.104  -0.205 1.00 148.42 ? 165  ARG E NH1 1 
ATOM   5832 N NH2 . ARG D 2 19  ? -1.641 11.868  -0.539 1.00 148.42 ? 165  ARG E NH2 1 
ATOM   5833 N N   . LEU D 2 20  ? 0.726  16.739  6.536  1.00 72.57  ? 166  LEU E N   1 
ATOM   5834 C CA  . LEU D 2 20  ? 0.251  16.780  7.914  1.00 72.57  ? 166  LEU E CA  1 
ATOM   5835 C C   . LEU D 2 20  ? 0.043  18.205  8.419  1.00 72.57  ? 166  LEU E C   1 
ATOM   5836 O O   . LEU D 2 20  ? 0.913  18.770  9.080  1.00 72.57  ? 166  LEU E O   1 
ATOM   5837 C CB  . LEU D 2 20  ? 1.243  16.056  8.822  1.00 80.54  ? 166  LEU E CB  1 
ATOM   5838 C CG  . LEU D 2 20  ? 1.452  14.592  8.453  1.00 80.54  ? 166  LEU E CG  1 
ATOM   5839 C CD1 . LEU D 2 20  ? 2.405  13.951  9.434  1.00 80.54  ? 166  LEU E CD1 1 
ATOM   5840 C CD2 . LEU D 2 20  ? 0.114  13.875  8.462  1.00 80.54  ? 166  LEU E CD2 1 
ATOM   5841 N N   . LYS D 2 21  ? -1.118 18.775  8.114  1.00 78.06  ? 167  LYS E N   1 
ATOM   5842 C CA  . LYS D 2 21  ? -1.437 20.126  8.536  1.00 78.06  ? 167  LYS E CA  1 
ATOM   5843 C C   . LYS D 2 21  ? -1.781 20.224  10.016 1.00 78.06  ? 167  LYS E C   1 
ATOM   5844 O O   . LYS D 2 21  ? -1.954 21.319  10.553 1.00 78.06  ? 167  LYS E O   1 
ATOM   5845 C CB  . LYS D 2 21  ? -2.577 20.693  7.687  1.00 102.20 ? 167  LYS E CB  1 
ATOM   5846 C CG  . LYS D 2 21  ? -2.175 20.996  6.254  1.00 102.20 ? 167  LYS E CG  1 
ATOM   5847 C CD  . LYS D 2 21  ? -3.169 21.935  5.589  1.00 102.20 ? 167  LYS E CD  1 
ATOM   5848 C CE  . LYS D 2 21  ? -2.717 22.331  4.192  1.00 102.20 ? 167  LYS E CE  1 
ATOM   5849 N NZ  . LYS D 2 21  ? -3.621 23.346  3.579  1.00 102.20 ? 167  LYS E NZ  1 
ATOM   5850 N N   . HIS D 2 22  ? -1.888 19.079  10.678 1.00 125.92 ? 168  HIS E N   1 
ATOM   5851 C CA  . HIS D 2 22  ? -2.183 19.066  12.105 1.00 125.92 ? 168  HIS E CA  1 
ATOM   5852 C C   . HIS D 2 22  ? -0.877 18.960  12.883 1.00 125.92 ? 168  HIS E C   1 
ATOM   5853 O O   . HIS D 2 22  ? -0.886 18.710  14.084 1.00 125.92 ? 168  HIS E O   1 
ATOM   5854 C CB  . HIS D 2 22  ? -3.078 17.877  12.472 1.00 159.19 ? 168  HIS E CB  1 
ATOM   5855 C CG  . HIS D 2 22  ? -4.482 17.987  11.967 1.00 159.19 ? 168  HIS E CG  1 
ATOM   5856 N ND1 . HIS D 2 22  ? -5.257 19.113  12.157 1.00 159.19 ? 168  HIS E ND1 1 
ATOM   5857 C CD2 . HIS D 2 22  ? -5.265 17.102  11.306 1.00 159.19 ? 168  HIS E CD2 1 
ATOM   5858 C CE1 . HIS D 2 22  ? -6.453 18.915  11.637 1.00 159.19 ? 168  HIS E CE1 1 
ATOM   5859 N NE2 . HIS D 2 22  ? -6.485 17.701  11.114 1.00 159.19 ? 168  HIS E NE2 1 
ATOM   5860 N N   . LEU D 2 23  ? 0.243  19.157  12.192 1.00 76.51  ? 169  LEU E N   1 
ATOM   5861 C CA  . LEU D 2 23  ? 1.556  19.059  12.814 1.00 76.51  ? 169  LEU E CA  1 
ATOM   5862 C C   . LEU D 2 23  ? 2.157  20.417  13.170 1.00 76.51  ? 169  LEU E C   1 
ATOM   5863 O O   . LEU D 2 23  ? 2.092  21.361  12.387 1.00 76.51  ? 169  LEU E O   1 
ATOM   5864 C CB  . LEU D 2 23  ? 2.514  18.311  11.883 1.00 65.38  ? 169  LEU E CB  1 
ATOM   5865 C CG  . LEU D 2 23  ? 3.901  17.990  12.445 1.00 65.38  ? 169  LEU E CG  1 
ATOM   5866 C CD1 . LEU D 2 23  ? 3.744  17.043  13.624 1.00 65.38  ? 169  LEU E CD1 1 
ATOM   5867 C CD2 . LEU D 2 23  ? 4.772  17.373  11.362 1.00 65.38  ? 169  LEU E CD2 1 
ATOM   5868 N N   . SER D 2 24  ? 2.746  20.513  14.356 1.00 66.48  ? 170  SER E N   1 
ATOM   5869 C CA  . SER D 2 24  ? 3.365  21.760  14.769 1.00 66.48  ? 170  SER E CA  1 
ATOM   5870 C C   . SER D 2 24  ? 4.852  21.501  14.972 1.00 66.48  ? 170  SER E C   1 
ATOM   5871 O O   . SER D 2 24  ? 5.252  20.422  15.410 1.00 66.48  ? 170  SER E O   1 
ATOM   5872 C CB  . SER D 2 24  ? 2.744  22.274  16.067 1.00 56.08  ? 170  SER E CB  1 
ATOM   5873 O OG  . SER D 2 24  ? 3.505  21.869  17.188 1.00 56.08  ? 170  SER E OG  1 
ATOM   5874 N N   . PRO D 2 25  ? 5.691  22.498  14.662 1.00 71.46  ? 171  PRO E N   1 
ATOM   5875 C CA  . PRO D 2 25  ? 7.139  22.370  14.808 1.00 71.46  ? 171  PRO E CA  1 
ATOM   5876 C C   . PRO D 2 25  ? 7.552  21.838  16.176 1.00 71.46  ? 171  PRO E C   1 
ATOM   5877 O O   . PRO D 2 25  ? 8.610  21.220  16.319 1.00 71.46  ? 171  PRO E O   1 
ATOM   5878 C CB  . PRO D 2 25  ? 7.629  23.796  14.577 1.00 68.03  ? 171  PRO E CB  1 
ATOM   5879 C CG  . PRO D 2 25  ? 6.621  24.347  13.625 1.00 68.03  ? 171  PRO E CG  1 
ATOM   5880 C CD  . PRO D 2 25  ? 5.331  23.857  14.222 1.00 68.03  ? 171  PRO E CD  1 
ATOM   5881 N N   . THR D 2 26  ? 6.711  22.076  17.177 1.00 60.85  ? 172  THR E N   1 
ATOM   5882 C CA  . THR D 2 26  ? 7.008  21.652  18.538 1.00 60.85  ? 172  THR E CA  1 
ATOM   5883 C C   . THR D 2 26  ? 6.943  20.144  18.805 1.00 60.85  ? 172  THR E C   1 
ATOM   5884 O O   . THR D 2 26  ? 7.655  19.640  19.676 1.00 60.85  ? 172  THR E O   1 
ATOM   5885 C CB  . THR D 2 26  ? 6.084  22.377  19.529 1.00 66.65  ? 172  THR E CB  1 
ATOM   5886 O OG1 . THR D 2 26  ? 6.046  23.773  19.216 1.00 66.65  ? 172  THR E OG1 1 
ATOM   5887 C CG2 . THR D 2 26  ? 6.602  22.229  20.946 1.00 66.65  ? 172  THR E CG2 1 
ATOM   5888 N N   . ASP D 2 27  ? 6.111  19.423  18.060 1.00 58.14  ? 173  ASP E N   1 
ATOM   5889 C CA  . ASP D 2 27  ? 5.995  17.979  18.266 1.00 58.14  ? 173  ASP E CA  1 
ATOM   5890 C C   . ASP D 2 27  ? 7.310  17.192  18.054 1.00 58.14  ? 173  ASP E C   1 
ATOM   5891 O O   . ASP D 2 27  ? 7.721  16.410  18.920 1.00 58.14  ? 173  ASP E O   1 
ATOM   5892 C CB  . ASP D 2 27  ? 4.864  17.410  17.391 1.00 62.63  ? 173  ASP E CB  1 
ATOM   5893 C CG  . ASP D 2 27  ? 3.505  18.036  17.708 1.00 62.63  ? 173  ASP E CG  1 
ATOM   5894 O OD1 . ASP D 2 27  ? 3.090  18.038  18.889 1.00 62.63  ? 173  ASP E OD1 1 
ATOM   5895 O OD2 . ASP D 2 27  ? 2.840  18.519  16.767 1.00 62.63  ? 173  ASP E OD2 1 
ATOM   5896 N N   . PRO D 2 28  ? 7.991  17.394  16.905 1.00 57.02  ? 174  PRO E N   1 
ATOM   5897 C CA  . PRO D 2 28  ? 9.254  16.693  16.615 1.00 57.02  ? 174  PRO E CA  1 
ATOM   5898 C C   . PRO D 2 28  ? 10.312 17.022  17.675 1.00 57.02  ? 174  PRO E C   1 
ATOM   5899 O O   . PRO D 2 28  ? 11.059 16.144  18.121 1.00 57.02  ? 174  PRO E O   1 
ATOM   5900 C CB  . PRO D 2 28  ? 9.644  17.228  15.231 1.00 65.09  ? 174  PRO E CB  1 
ATOM   5901 C CG  . PRO D 2 28  ? 8.324  17.624  14.631 1.00 65.09  ? 174  PRO E CG  1 
ATOM   5902 C CD  . PRO D 2 28  ? 7.612  18.272  15.784 1.00 65.09  ? 174  PRO E CD  1 
ATOM   5903 N N   . VAL D 2 29  ? 10.366 18.293  18.071 1.00 48.91  ? 175  VAL E N   1 
ATOM   5904 C CA  . VAL D 2 29  ? 11.314 18.726  19.085 1.00 48.91  ? 175  VAL E CA  1 
ATOM   5905 C C   . VAL D 2 29  ? 11.070 17.885  20.336 1.00 48.91  ? 175  VAL E C   1 
ATOM   5906 O O   . VAL D 2 29  ? 12.014 17.456  21.009 1.00 48.91  ? 175  VAL E O   1 
ATOM   5907 C CB  . VAL D 2 29  ? 11.138 20.213  19.440 1.00 48.04  ? 175  VAL E CB  1 
ATOM   5908 C CG1 . VAL D 2 29  ? 12.024 20.571  20.640 1.00 48.04  ? 175  VAL E CG1 1 
ATOM   5909 C CG2 . VAL D 2 29  ? 11.512 21.084  18.234 1.00 48.04  ? 175  VAL E CG2 1 
ATOM   5910 N N   . LEU D 2 30  ? 9.801  17.641  20.646 1.00 67.89  ? 176  LEU E N   1 
ATOM   5911 C CA  . LEU D 2 30  ? 9.475  16.834  21.812 1.00 67.89  ? 176  LEU E CA  1 
ATOM   5912 C C   . LEU D 2 30  ? 9.923  15.379  21.644 1.00 67.89  ? 176  LEU E C   1 
ATOM   5913 O O   . LEU D 2 30  ? 10.475 14.790  22.578 1.00 67.89  ? 176  LEU E O   1 
ATOM   5914 C CB  . LEU D 2 30  ? 7.971  16.904  22.105 1.00 110.79 ? 176  LEU E CB  1 
ATOM   5915 C CG  . LEU D 2 30  ? 7.570  17.951  23.153 1.00 110.79 ? 176  LEU E CG  1 
ATOM   5916 C CD1 . LEU D 2 30  ? 6.061  18.121  23.172 1.00 110.79 ? 176  LEU E CD1 1 
ATOM   5917 C CD2 . LEU D 2 30  ? 8.082  17.520  24.522 1.00 110.79 ? 176  LEU E CD2 1 
ATOM   5918 N N   . TRP D 2 31  ? 9.696  14.800  20.465 1.00 62.31  ? 177  TRP E N   1 
ATOM   5919 C CA  . TRP D 2 31  ? 10.086 13.410  20.230 1.00 62.31  ? 177  TRP E CA  1 
ATOM   5920 C C   . TRP D 2 31  ? 11.586 13.290  20.380 1.00 62.31  ? 177  TRP E C   1 
ATOM   5921 O O   . TRP D 2 31  ? 12.081 12.278  20.874 1.00 62.31  ? 177  TRP E O   1 
ATOM   5922 C CB  . TRP D 2 31  ? 9.695  12.940  18.828 1.00 59.75  ? 177  TRP E CB  1 
ATOM   5923 C CG  . TRP D 2 31  ? 8.250  13.061  18.531 1.00 59.75  ? 177  TRP E CG  1 
ATOM   5924 C CD1 . TRP D 2 31  ? 7.228  13.045  19.429 1.00 59.75  ? 177  TRP E CD1 1 
ATOM   5925 C CD2 . TRP D 2 31  ? 7.652  13.208  17.240 1.00 59.75  ? 177  TRP E CD2 1 
ATOM   5926 N NE1 . TRP D 2 31  ? 6.027  13.178  18.781 1.00 59.75  ? 177  TRP E NE1 1 
ATOM   5927 C CE2 . TRP D 2 31  ? 6.258  13.278  17.433 1.00 59.75  ? 177  TRP E CE2 1 
ATOM   5928 C CE3 . TRP D 2 31  ? 8.159  13.283  15.937 1.00 59.75  ? 177  TRP E CE3 1 
ATOM   5929 C CZ2 . TRP D 2 31  ? 5.361  13.428  16.370 1.00 59.75  ? 177  TRP E CZ2 1 
ATOM   5930 C CZ3 . TRP D 2 31  ? 7.271  13.431  14.882 1.00 59.75  ? 177  TRP E CZ3 1 
ATOM   5931 C CH2 . TRP D 2 31  ? 5.887  13.500  15.105 1.00 59.75  ? 177  TRP E CH2 1 
ATOM   5932 N N   . LEU D 2 32  ? 12.299 14.326  19.944 1.00 55.60  ? 178  LEU E N   1 
ATOM   5933 C CA  . LEU D 2 32  ? 13.746 14.346  20.040 1.00 55.60  ? 178  LEU E CA  1 
ATOM   5934 C C   . LEU D 2 32  ? 14.169 14.555  21.488 1.00 55.60  ? 178  LEU E C   1 
ATOM   5935 O O   . LEU D 2 32  ? 14.824 13.692  22.070 1.00 55.60  ? 178  LEU E O   1 
ATOM   5936 C CB  . LEU D 2 32  ? 14.324 15.450  19.139 1.00 47.53  ? 178  LEU E CB  1 
ATOM   5937 C CG  . LEU D 2 32  ? 14.131 15.279  17.616 1.00 47.53  ? 178  LEU E CG  1 
ATOM   5938 C CD1 . LEU D 2 32  ? 14.715 16.478  16.864 1.00 47.53  ? 178  LEU E CD1 1 
ATOM   5939 C CD2 . LEU D 2 32  ? 14.802 13.988  17.166 1.00 47.53  ? 178  LEU E CD2 1 
ATOM   5940 N N   . ARG D 2 33  ? 13.788 15.680  22.086 1.00 52.92  ? 179  ARG E N   1 
ATOM   5941 C CA  . ARG D 2 33  ? 14.178 15.945  23.473 1.00 52.92  ? 179  ARG E CA  1 
ATOM   5942 C C   . ARG D 2 33  ? 13.840 14.844  24.476 1.00 52.92  ? 179  ARG E C   1 
ATOM   5943 O O   . ARG D 2 33  ? 14.518 14.704  25.492 1.00 52.92  ? 179  ARG E O   1 
ATOM   5944 C CB  . ARG D 2 33  ? 13.603 17.279  23.959 1.00 52.45  ? 179  ARG E CB  1 
ATOM   5945 C CG  . ARG D 2 33  ? 14.415 18.458  23.459 1.00 52.45  ? 179  ARG E CG  1 
ATOM   5946 C CD  . ARG D 2 33  ? 14.074 19.748  24.166 1.00 52.45  ? 179  ARG E CD  1 
ATOM   5947 N NE  . ARG D 2 33  ? 15.104 20.767  23.952 1.00 52.45  ? 179  ARG E NE  1 
ATOM   5948 C CZ  . ARG D 2 33  ? 16.404 20.582  24.189 1.00 52.45  ? 179  ARG E CZ  1 
ATOM   5949 N NH1 . ARG D 2 33  ? 16.849 19.410  24.641 1.00 52.45  ? 179  ARG E NH1 1 
ATOM   5950 N NH2 . ARG D 2 33  ? 17.260 21.578  24.003 1.00 52.45  ? 179  ARG E NH2 1 
ATOM   5951 N N   . SER D 2 34  ? 12.809 14.057  24.193 1.00 43.16  ? 180  SER E N   1 
ATOM   5952 C CA  . SER D 2 34  ? 12.425 12.980  25.093 1.00 43.16  ? 180  SER E CA  1 
ATOM   5953 C C   . SER D 2 34  ? 13.437 11.833  25.112 1.00 43.16  ? 180  SER E C   1 
ATOM   5954 O O   . SER D 2 34  ? 13.915 11.448  26.183 1.00 43.16  ? 180  SER E O   1 
ATOM   5955 C CB  . SER D 2 34  ? 11.036 12.435  24.730 1.00 72.67  ? 180  SER E CB  1 
ATOM   5956 O OG  . SER D 2 34  ? 10.018 13.386  25.009 1.00 72.67  ? 180  SER E OG  1 
ATOM   5957 N N   . VAL D 2 35  ? 13.764 11.277  23.947 1.00 57.86  ? 181  VAL E N   1 
ATOM   5958 C CA  . VAL D 2 35  ? 14.717 10.173  23.917 1.00 57.86  ? 181  VAL E CA  1 
ATOM   5959 C C   . VAL D 2 35  ? 16.040 10.601  24.559 1.00 57.86  ? 181  VAL E C   1 
ATOM   5960 O O   . VAL D 2 35  ? 16.662 9.824   25.282 1.00 57.86  ? 181  VAL E O   1 
ATOM   5961 C CB  . VAL D 2 35  ? 14.995 9.642   22.460 1.00 44.44  ? 181  VAL E CB  1 
ATOM   5962 C CG1 . VAL D 2 35  ? 13.746 9.749   21.611 1.00 44.44  ? 181  VAL E CG1 1 
ATOM   5963 C CG2 . VAL D 2 35  ? 16.173 10.375  21.832 1.00 44.44  ? 181  VAL E CG2 1 
ATOM   5964 N N   . ASP D 2 36  ? 16.468 11.835  24.313 1.00 60.34  ? 182  ASP E N   1 
ATOM   5965 C CA  . ASP D 2 36  ? 17.720 12.290  24.905 1.00 60.34  ? 182  ASP E CA  1 
ATOM   5966 C C   . ASP D 2 36  ? 17.517 12.417  26.412 1.00 60.34  ? 182  ASP E C   1 
ATOM   5967 O O   . ASP D 2 36  ? 18.471 12.365  27.191 1.00 60.34  ? 182  ASP E O   1 
ATOM   5968 C CB  . ASP D 2 36  ? 18.147 13.641  24.331 1.00 50.36  ? 182  ASP E CB  1 
ATOM   5969 C CG  . ASP D 2 36  ? 19.601 13.952  24.611 1.00 50.36  ? 182  ASP E CG  1 
ATOM   5970 O OD1 . ASP D 2 36  ? 19.999 15.131  24.503 1.00 50.36  ? 182  ASP E OD1 1 
ATOM   5971 O OD2 . ASP D 2 36  ? 20.355 13.013  24.938 1.00 50.36  ? 182  ASP E OD2 1 
ATOM   5972 N N   . ARG D 2 37  ? 16.263 12.581  26.818 1.00 67.26  ? 183  ARG E N   1 
ATOM   5973 C CA  . ARG D 2 37  ? 15.942 12.705  28.228 1.00 67.26  ? 183  ARG E CA  1 
ATOM   5974 C C   . ARG D 2 37  ? 16.129 11.343  28.883 1.00 67.26  ? 183  ARG E C   1 
ATOM   5975 O O   . ARG D 2 37  ? 16.863 11.224  29.868 1.00 67.26  ? 183  ARG E O   1 
ATOM   5976 C CB  . ARG D 2 37  ? 14.505 13.182  28.401 1.00 105.31 ? 183  ARG E CB  1 
ATOM   5977 C CG  . ARG D 2 37  ? 14.145 13.545  29.818 1.00 105.31 ? 183  ARG E CG  1 
ATOM   5978 C CD  . ARG D 2 37  ? 12.677 13.895  29.926 1.00 105.31 ? 183  ARG E CD  1 
ATOM   5979 N NE  . ARG D 2 37  ? 12.308 14.202  31.302 1.00 105.31 ? 183  ARG E NE  1 
ATOM   5980 C CZ  . ARG D 2 37  ? 11.059 14.371  31.722 1.00 105.31 ? 183  ARG E CZ  1 
ATOM   5981 N NH1 . ARG D 2 37  ? 10.049 14.259  30.867 1.00 105.31 ? 183  ARG E NH1 1 
ATOM   5982 N NH2 . ARG D 2 37  ? 10.822 14.651  32.998 1.00 105.31 ? 183  ARG E NH2 1 
ATOM   5983 N N   . SER D 2 38  ? 15.471 10.323  28.325 1.00 66.90  ? 184  SER E N   1 
ATOM   5984 C CA  . SER D 2 38  ? 15.571 8.955   28.839 1.00 66.90  ? 184  SER E CA  1 
ATOM   5985 C C   . SER D 2 38  ? 17.038 8.577   29.026 1.00 66.90  ? 184  SER E C   1 
ATOM   5986 O O   . SER D 2 38  ? 17.479 8.286   30.136 1.00 66.90  ? 184  SER E O   1 
ATOM   5987 C CB  . SER D 2 38  ? 14.920 7.961   27.869 1.00 59.48  ? 184  SER E CB  1 
ATOM   5988 O OG  . SER D 2 38  ? 13.554 8.256   27.651 1.00 59.48  ? 184  SER E OG  1 
ATOM   5989 N N   . LEU D 2 39  ? 17.787 8.588   27.927 1.00 52.93  ? 185  LEU E N   1 
ATOM   5990 C CA  . LEU D 2 39  ? 19.202 8.262   27.945 1.00 52.93  ? 185  LEU E CA  1 
ATOM   5991 C C   . LEU D 2 39  ? 19.995 8.988   29.036 1.00 52.93  ? 185  LEU E C   1 
ATOM   5992 O O   . LEU D 2 39  ? 20.967 8.441   29.564 1.00 52.93  ? 185  LEU E O   1 
ATOM   5993 C CB  . LEU D 2 39  ? 19.817 8.562   26.582 1.00 48.96  ? 185  LEU E CB  1 
ATOM   5994 C CG  . LEU D 2 39  ? 19.304 7.668   25.458 1.00 48.96  ? 185  LEU E CG  1 
ATOM   5995 C CD1 . LEU D 2 39  ? 19.873 8.128   24.136 1.00 48.96  ? 185  LEU E CD1 1 
ATOM   5996 C CD2 . LEU D 2 39  ? 19.707 6.231   25.731 1.00 48.96  ? 185  LEU E CD2 1 
ATOM   5997 N N   . LEU D 2 40  ? 19.618 10.214  29.380 1.00 75.29  ? 186  LEU E N   1 
ATOM   5998 C CA  . LEU D 2 40  ? 20.368 10.886  30.430 1.00 75.29  ? 186  LEU E CA  1 
ATOM   5999 C C   . LEU D 2 40  ? 19.984 10.268  31.760 1.00 75.29  ? 186  LEU E C   1 
ATOM   6000 O O   . LEU D 2 40  ? 20.778 10.256  32.697 1.00 75.29  ? 186  LEU E O   1 
ATOM   6001 C CB  . LEU D 2 40  ? 20.107 12.384  30.448 1.00 55.41  ? 186  LEU E CB  1 
ATOM   6002 C CG  . LEU D 2 40  ? 21.428 13.146  30.326 1.00 55.41  ? 186  LEU E CG  1 
ATOM   6003 C CD1 . LEU D 2 40  ? 21.153 14.638  30.374 1.00 55.41  ? 186  LEU E CD1 1 
ATOM   6004 C CD2 . LEU D 2 40  ? 22.390 12.727  31.439 1.00 55.41  ? 186  LEU E CD2 1 
ATOM   6005 N N   . LEU D 2 41  ? 18.756 9.768   31.853 1.00 82.39  ? 187  LEU E N   1 
ATOM   6006 C CA  . LEU D 2 41  ? 18.340 9.085   33.066 1.00 82.39  ? 187  LEU E CA  1 
ATOM   6007 C C   . LEU D 2 41  ? 19.076 7.754   32.885 1.00 82.39  ? 187  LEU E C   1 
ATOM   6008 O O   . LEU D 2 41  ? 18.510 6.653   32.912 1.00 82.39  ? 187  LEU E O   1 
ATOM   6009 C CB  . LEU D 2 41  ? 16.819 8.921   33.101 1.00 74.82  ? 187  LEU E CB  1 
ATOM   6010 C CG  . LEU D 2 41  ? 16.088 10.269  32.984 1.00 74.82  ? 187  LEU E CG  1 
ATOM   6011 C CD1 . LEU D 2 41  ? 14.617 10.076  33.322 1.00 74.82  ? 187  LEU E CD1 1 
ATOM   6012 C CD2 . LEU D 2 41  ? 16.716 11.306  33.914 1.00 74.82  ? 187  LEU E CD2 1 
ATOM   6013 N N   . GLN D 2 42  ? 20.369 7.935   32.655 1.00 135.54 ? 188  GLN E N   1 
ATOM   6014 C CA  . GLN D 2 42  ? 21.371 6.917   32.426 1.00 135.54 ? 188  GLN E CA  1 
ATOM   6015 C C   . GLN D 2 42  ? 21.069 5.653   31.639 1.00 135.54 ? 188  GLN E C   1 
ATOM   6016 O O   . GLN D 2 42  ? 21.138 4.540   32.161 1.00 135.54 ? 188  GLN E O   1 
ATOM   6017 C CB  . GLN D 2 42  ? 22.058 6.559   33.746 1.00 187.51 ? 188  GLN E CB  1 
ATOM   6018 C CG  . GLN D 2 42  ? 22.746 7.755   34.436 1.00 187.51 ? 188  GLN E CG  1 
ATOM   6019 C CD  . GLN D 2 42  ? 23.330 8.773   33.457 1.00 187.51 ? 188  GLN E CD  1 
ATOM   6020 O OE1 . GLN D 2 42  ? 23.785 8.420   32.366 1.00 187.51 ? 188  GLN E OE1 1 
ATOM   6021 N NE2 . GLN D 2 42  ? 23.329 10.044  33.855 1.00 187.51 ? 188  GLN E NE2 1 
ATOM   6022 N N   . GLY D 2 43  ? 20.726 5.848   30.370 1.00 134.15 ? 189  GLY E N   1 
ATOM   6023 C CA  . GLY D 2 43  ? 20.535 4.732   29.461 1.00 134.15 ? 189  GLY E CA  1 
ATOM   6024 C C   . GLY D 2 43  ? 21.983 4.727   29.009 1.00 134.15 ? 189  GLY E C   1 
ATOM   6025 O O   . GLY D 2 43  ? 22.411 4.019   28.094 1.00 134.15 ? 189  GLY E O   1 
ATOM   6026 N N   . TRP D 2 44  ? 22.705 5.593   29.721 1.00 93.51  ? 190  TRP E N   1 
ATOM   6027 C CA  . TRP D 2 44  ? 24.123 5.898   29.635 1.00 93.51  ? 190  TRP E CA  1 
ATOM   6028 C C   . TRP D 2 44  ? 24.526 6.989   28.672 1.00 93.51  ? 190  TRP E C   1 
ATOM   6029 O O   . TRP D 2 44  ? 24.593 6.803   27.457 1.00 93.51  ? 190  TRP E O   1 
ATOM   6030 C CB  . TRP D 2 44  ? 24.974 4.644   29.420 1.00 153.85 ? 190  TRP E CB  1 
ATOM   6031 C CG  . TRP D 2 44  ? 25.913 4.447   30.593 1.00 153.85 ? 190  TRP E CG  1 
ATOM   6032 C CD1 . TRP D 2 44  ? 25.569 4.055   31.862 1.00 153.85 ? 190  TRP E CD1 1 
ATOM   6033 C CD2 . TRP D 2 44  ? 27.313 4.765   30.640 1.00 153.85 ? 190  TRP E CD2 1 
ATOM   6034 N NE1 . TRP D 2 44  ? 26.659 4.118   32.687 1.00 153.85 ? 190  TRP E NE1 1 
ATOM   6035 C CE2 . TRP D 2 44  ? 27.744 4.548   31.969 1.00 153.85 ? 190  TRP E CE2 1 
ATOM   6036 C CE3 . TRP D 2 44  ? 28.243 5.213   29.690 1.00 153.85 ? 190  TRP E CE3 1 
ATOM   6037 C CZ2 . TRP D 2 44  ? 29.067 4.769   32.378 1.00 153.85 ? 190  TRP E CZ2 1 
ATOM   6038 C CZ3 . TRP D 2 44  ? 29.555 5.432   30.093 1.00 153.85 ? 190  TRP E CZ3 1 
ATOM   6039 C CH2 . TRP D 2 44  ? 29.955 5.208   31.430 1.00 153.85 ? 190  TRP E CH2 1 
ATOM   6040 N N   . GLN D 2 45  ? 24.806 8.142   29.269 1.00 95.33  ? 191  GLN E N   1 
ATOM   6041 C CA  . GLN D 2 45  ? 25.217 9.337   28.558 1.00 95.33  ? 191  GLN E CA  1 
ATOM   6042 C C   . GLN D 2 45  ? 25.366 10.431  29.615 1.00 95.33  ? 191  GLN E C   1 
ATOM   6043 O O   . GLN D 2 45  ? 24.422 11.182  29.868 1.00 95.33  ? 191  GLN E O   1 
ATOM   6044 C CB  . GLN D 2 45  ? 24.143 9.735   27.555 1.00 108.54 ? 191  GLN E CB  1 
ATOM   6045 C CG  . GLN D 2 45  ? 24.634 10.689  26.502 1.00 108.54 ? 191  GLN E CG  1 
ATOM   6046 C CD  . GLN D 2 45  ? 23.502 11.313  25.718 1.00 108.54 ? 191  GLN E CD  1 
ATOM   6047 O OE1 . GLN D 2 45  ? 23.728 11.912  24.667 1.00 108.54 ? 191  GLN E OE1 1 
ATOM   6048 N NE2 . GLN D 2 45  ? 22.276 11.187  26.230 1.00 108.54 ? 191  GLN E NE2 1 
ATOM   6049 N N   . ASP D 2 46  ? 26.549 10.514  30.227 1.00 103.62 ? 192  ASP E N   1 
ATOM   6050 C CA  . ASP D 2 46  ? 26.808 11.497  31.275 1.00 103.62 ? 192  ASP E CA  1 
ATOM   6051 C C   . ASP D 2 46  ? 26.284 12.888  30.935 1.00 103.62 ? 192  ASP E C   1 
ATOM   6052 O O   . ASP D 2 46  ? 25.751 13.569  31.805 1.00 103.62 ? 192  ASP E O   1 
ATOM   6053 C CB  . ASP D 2 46  ? 28.309 11.560  31.618 1.00 154.31 ? 192  ASP E CB  1 
ATOM   6054 C CG  . ASP D 2 46  ? 29.144 12.239  30.543 1.00 154.31 ? 192  ASP E CG  1 
ATOM   6055 O OD1 . ASP D 2 46  ? 28.943 13.446  30.293 1.00 154.31 ? 192  ASP E OD1 1 
ATOM   6056 O OD2 . ASP D 2 46  ? 30.016 11.563  29.954 1.00 154.31 ? 192  ASP E OD2 1 
ATOM   6057 N N   . GLN D 2 47  ? 26.423 13.313  29.682 1.00 68.19  ? 193  GLN E N   1 
ATOM   6058 C CA  . GLN D 2 47  ? 25.926 14.630  29.278 1.00 68.19  ? 193  GLN E CA  1 
ATOM   6059 C C   . GLN D 2 47  ? 24.971 14.488  28.091 1.00 68.19  ? 193  GLN E C   1 
ATOM   6060 O O   . GLN D 2 47  ? 24.919 13.431  27.456 1.00 68.19  ? 193  GLN E O   1 
ATOM   6061 C CB  . GLN D 2 47  ? 27.092 15.551  28.912 1.00 109.34 ? 193  GLN E CB  1 
ATOM   6062 C CG  . GLN D 2 47  ? 27.595 15.401  27.486 1.00 109.34 ? 193  GLN E CG  1 
ATOM   6063 C CD  . GLN D 2 47  ? 29.078 15.106  27.414 1.00 109.34 ? 193  GLN E CD  1 
ATOM   6064 O OE1 . GLN D 2 47  ? 29.514 13.981  27.667 1.00 109.34 ? 193  GLN E OE1 1 
ATOM   6065 N NE2 . GLN D 2 47  ? 29.864 16.120  27.072 1.00 109.34 ? 193  GLN E NE2 1 
ATOM   6066 N N   . GLY D 2 48  ? 24.218 15.546  27.794 1.00 63.42  ? 194  GLY E N   1 
ATOM   6067 C CA  . GLY D 2 48  ? 23.262 15.508  26.686 1.00 63.42  ? 194  GLY E CA  1 
ATOM   6068 C C   . GLY D 2 48  ? 23.839 15.457  25.276 1.00 63.42  ? 194  GLY E C   1 
ATOM   6069 O O   . GLY D 2 48  ? 24.876 16.055  24.999 1.00 63.42  ? 194  GLY E O   1 
ATOM   6070 N N   . PHE D 2 49  ? 23.151 14.759  24.375 1.00 48.89  ? 195  PHE E N   1 
ATOM   6071 C CA  . PHE D 2 49  ? 23.616 14.609  22.994 1.00 48.89  ? 195  PHE E CA  1 
ATOM   6072 C C   . PHE D 2 49  ? 23.226 15.750  22.083 1.00 48.89  ? 195  PHE E C   1 
ATOM   6073 O O   . PHE D 2 49  ? 23.981 16.119  21.187 1.00 48.89  ? 195  PHE E O   1 
ATOM   6074 C CB  . PHE D 2 49  ? 23.077 13.314  22.369 1.00 47.27  ? 195  PHE E CB  1 
ATOM   6075 C CG  . PHE D 2 49  ? 23.466 13.129  20.917 1.00 47.27  ? 195  PHE E CG  1 
ATOM   6076 C CD1 . PHE D 2 49  ? 24.777 12.811  20.567 1.00 47.27  ? 195  PHE E CD1 1 
ATOM   6077 C CD2 . PHE D 2 49  ? 22.529 13.284  19.903 1.00 47.27  ? 195  PHE E CD2 1 
ATOM   6078 C CE1 . PHE D 2 49  ? 25.148 12.650  19.222 1.00 47.27  ? 195  PHE E CE1 1 
ATOM   6079 C CE2 . PHE D 2 49  ? 22.888 13.126  18.568 1.00 47.27  ? 195  PHE E CE2 1 
ATOM   6080 C CZ  . PHE D 2 49  ? 24.199 12.808  18.228 1.00 47.27  ? 195  PHE E CZ  1 
ATOM   6081 N N   . ILE D 2 50  ? 22.036 16.289  22.303 1.00 50.03  ? 196  ILE E N   1 
ATOM   6082 C CA  . ILE D 2 50  ? 21.521 17.363  21.477 1.00 50.03  ? 196  ILE E CA  1 
ATOM   6083 C C   . ILE D 2 50  ? 22.273 18.659  21.698 1.00 50.03  ? 196  ILE E C   1 
ATOM   6084 O O   . ILE D 2 50  ? 22.100 19.324  22.709 1.00 50.03  ? 196  ILE E O   1 
ATOM   6085 C CB  . ILE D 2 50  ? 20.017 17.553  21.734 1.00 40.65  ? 196  ILE E CB  1 
ATOM   6086 C CG1 . ILE D 2 50  ? 19.301 16.224  21.470 1.00 40.65  ? 196  ILE E CG1 1 
ATOM   6087 C CG2 . ILE D 2 50  ? 19.450 18.634  20.830 1.00 40.65  ? 196  ILE E CG2 1 
ATOM   6088 C CD1 . ILE D 2 50  ? 17.810 16.255  21.744 1.00 40.65  ? 196  ILE E CD1 1 
ATOM   6089 N N   . THR D 2 51  ? 23.120 18.995  20.731 1.00 46.26  ? 197  THR E N   1 
ATOM   6090 C CA  . THR D 2 51  ? 23.926 20.208  20.765 1.00 46.26  ? 197  THR E CA  1 
ATOM   6091 C C   . THR D 2 51  ? 23.722 20.902  19.432 1.00 46.26  ? 197  THR E C   1 
ATOM   6092 O O   . THR D 2 51  ? 23.234 20.299  18.477 1.00 46.26  ? 197  THR E O   1 
ATOM   6093 C CB  . THR D 2 51  ? 25.438 19.893  20.895 1.00 61.17  ? 197  THR E CB  1 
ATOM   6094 O OG1 . THR D 2 51  ? 25.916 19.294  19.678 1.00 41.31  ? 197  THR E OG1 1 
ATOM   6095 C CG2 . THR D 2 51  ? 25.687 18.954  22.061 1.00 61.17  ? 197  THR E CG2 1 
ATOM   6096 N N   . PRO D 2 52  ? 24.103 22.176  19.340 1.00 48.03  ? 198  PRO E N   1 
ATOM   6097 C CA  . PRO D 2 52  ? 23.925 22.880  18.073 1.00 48.03  ? 198  PRO E CA  1 
ATOM   6098 C C   . PRO D 2 52  ? 24.455 22.112  16.877 1.00 48.03  ? 198  PRO E C   1 
ATOM   6099 O O   . PRO D 2 52  ? 23.737 21.948  15.886 1.00 48.03  ? 198  PRO E O   1 
ATOM   6100 C CB  . PRO D 2 52  ? 24.659 24.187  18.308 1.00 38.61  ? 198  PRO E CB  1 
ATOM   6101 C CG  . PRO D 2 52  ? 24.324 24.445  19.763 1.00 38.61  ? 198  PRO E CG  1 
ATOM   6102 C CD  . PRO D 2 52  ? 24.561 23.091  20.397 1.00 38.61  ? 198  PRO E CD  1 
ATOM   6103 N N   . ALA D 2 53  ? 25.693 21.627  16.971 1.00 43.18  ? 199  ALA E N   1 
ATOM   6104 C CA  . ALA D 2 53  ? 26.316 20.890  15.866 1.00 43.18  ? 199  ALA E CA  1 
ATOM   6105 C C   . ALA D 2 53  ? 25.575 19.598  15.524 1.00 43.18  ? 199  ALA E C   1 
ATOM   6106 O O   . ALA D 2 53  ? 25.316 19.312  14.348 1.00 43.18  ? 199  ALA E O   1 
ATOM   6107 C CB  . ALA D 2 53  ? 27.783 20.577  16.193 1.00 34.12  ? 199  ALA E CB  1 
ATOM   6108 N N   . ASN D 2 54  ? 25.240 18.827  16.555 1.00 53.01  ? 200  ASN E N   1 
ATOM   6109 C CA  . ASN D 2 54  ? 24.518 17.580  16.358 1.00 53.01  ? 200  ASN E CA  1 
ATOM   6110 C C   . ASN D 2 54  ? 23.113 17.803  15.778 1.00 53.01  ? 200  ASN E C   1 
ATOM   6111 O O   . ASN D 2 54  ? 22.621 16.989  14.997 1.00 53.01  ? 200  ASN E O   1 
ATOM   6112 C CB  . ASN D 2 54  ? 24.453 16.798  17.670 1.00 35.71  ? 200  ASN E CB  1 
ATOM   6113 C CG  . ASN D 2 54  ? 25.737 16.023  17.947 1.00 35.71  ? 200  ASN E CG  1 
ATOM   6114 O OD1 . ASN D 2 54  ? 25.922 15.455  19.024 1.00 35.71  ? 200  ASN E OD1 1 
ATOM   6115 N ND2 . ASN D 2 54  ? 26.621 15.992  16.972 1.00 35.71  ? 200  ASN E ND2 1 
ATOM   6116 N N   . VAL D 2 55  ? 22.464 18.904  16.142 1.00 34.72  ? 201  VAL E N   1 
ATOM   6117 C CA  . VAL D 2 55  ? 21.150 19.169  15.591 1.00 34.72  ? 201  VAL E CA  1 
ATOM   6118 C C   . VAL D 2 55  ? 21.399 19.351  14.106 1.00 34.72  ? 201  VAL E C   1 
ATOM   6119 O O   . VAL D 2 55  ? 20.738 18.720  13.281 1.00 34.72  ? 201  VAL E O   1 
ATOM   6120 C CB  . VAL D 2 55  ? 20.518 20.454  16.180 1.00 34.96  ? 201  VAL E CB  1 
ATOM   6121 C CG1 . VAL D 2 55  ? 19.177 20.730  15.521 1.00 34.96  ? 201  VAL E CG1 1 
ATOM   6122 C CG2 . VAL D 2 55  ? 20.300 20.277  17.670 1.00 34.96  ? 201  VAL E CG2 1 
ATOM   6123 N N   . VAL D 2 56  ? 22.374 20.191  13.764 1.00 41.00  ? 202  VAL E N   1 
ATOM   6124 C CA  . VAL D 2 56  ? 22.692 20.434  12.359 1.00 41.00  ? 202  VAL E CA  1 
ATOM   6125 C C   . VAL D 2 56  ? 22.948 19.115  11.625 1.00 41.00  ? 202  VAL E C   1 
ATOM   6126 O O   . VAL D 2 56  ? 22.408 18.880  10.540 1.00 41.00  ? 202  VAL E O   1 
ATOM   6127 C CB  . VAL D 2 56  ? 23.931 21.333  12.199 1.00 40.01  ? 202  VAL E CB  1 
ATOM   6128 C CG1 . VAL D 2 56  ? 24.164 21.633  10.714 1.00 40.01  ? 202  VAL E CG1 1 
ATOM   6129 C CG2 . VAL D 2 56  ? 23.741 22.620  12.965 1.00 40.01  ? 202  VAL E CG2 1 
ATOM   6130 N N   . PHE D 2 57  ? 23.777 18.259  12.219 1.00 37.81  ? 203  PHE E N   1 
ATOM   6131 C CA  . PHE D 2 57  ? 24.074 16.956  11.617 1.00 37.81  ? 203  PHE E CA  1 
ATOM   6132 C C   . PHE D 2 57  ? 22.752 16.226  11.368 1.00 37.81  ? 203  PHE E C   1 
ATOM   6133 O O   . PHE D 2 57  ? 22.551 15.602  10.323 1.00 37.81  ? 203  PHE E O   1 
ATOM   6134 C CB  . PHE D 2 57  ? 24.952 16.128  12.559 1.00 33.14  ? 203  PHE E CB  1 
ATOM   6135 C CG  . PHE D 2 57  ? 25.356 14.787  12.002 1.00 33.14  ? 203  PHE E CG  1 
ATOM   6136 C CD1 . PHE D 2 57  ? 26.635 14.587  11.494 1.00 33.14  ? 203  PHE E CD1 1 
ATOM   6137 C CD2 . PHE D 2 57  ? 24.465 13.721  12.005 1.00 33.14  ? 203  PHE E CD2 1 
ATOM   6138 C CE1 . PHE D 2 57  ? 27.017 13.336  10.997 1.00 33.14  ? 203  PHE E CE1 1 
ATOM   6139 C CE2 . PHE D 2 57  ? 24.832 12.479  11.515 1.00 33.14  ? 203  PHE E CE2 1 
ATOM   6140 C CZ  . PHE D 2 57  ? 26.112 12.282  11.008 1.00 33.14  ? 203  PHE E CZ  1 
ATOM   6141 N N   . LEU D 2 58  ? 21.848 16.334  12.335 1.00 34.17  ? 204  LEU E N   1 
ATOM   6142 C CA  . LEU D 2 58  ? 20.551 15.684  12.238 1.00 34.17  ? 204  LEU E CA  1 
ATOM   6143 C C   . LEU D 2 58  ? 19.761 16.282  11.089 1.00 34.17  ? 204  LEU E C   1 
ATOM   6144 O O   . LEU D 2 58  ? 19.155 15.566  10.304 1.00 34.17  ? 204  LEU E O   1 
ATOM   6145 C CB  . LEU D 2 58  ? 19.765 15.872  13.530 1.00 25.80  ? 204  LEU E CB  1 
ATOM   6146 C CG  . LEU D 2 58  ? 18.805 14.770  13.962 1.00 25.80  ? 204  LEU E CG  1 
ATOM   6147 C CD1 . LEU D 2 58  ? 17.660 15.423  14.718 1.00 25.80  ? 204  LEU E CD1 1 
ATOM   6148 C CD2 . LEU D 2 58  ? 18.257 14.007  12.774 1.00 25.80  ? 204  LEU E CD2 1 
ATOM   6149 N N   . TYR D 2 59  ? 19.765 17.604  10.997 1.00 51.45  ? 205  TYR E N   1 
ATOM   6150 C CA  . TYR D 2 59  ? 19.031 18.281  9.942  1.00 51.45  ? 205  TYR E CA  1 
ATOM   6151 C C   . TYR D 2 59  ? 19.561 17.805  8.615  1.00 51.45  ? 205  TYR E C   1 
ATOM   6152 O O   . TYR D 2 59  ? 18.813 17.682  7.649  1.00 51.45  ? 205  TYR E O   1 
ATOM   6153 C CB  . TYR D 2 59  ? 19.209 19.790  10.069 1.00 45.22  ? 205  TYR E CB  1 
ATOM   6154 C CG  . TYR D 2 59  ? 18.810 20.591  8.853  1.00 45.22  ? 205  TYR E CG  1 
ATOM   6155 C CD1 . TYR D 2 59  ? 17.478 20.710  8.480  1.00 45.22  ? 205  TYR E CD1 1 
ATOM   6156 C CD2 . TYR D 2 59  ? 19.772 21.253  8.090  1.00 45.22  ? 205  TYR E CD2 1 
ATOM   6157 C CE1 . TYR D 2 59  ? 17.110 21.479  7.373  1.00 45.22  ? 205  TYR E CE1 1 
ATOM   6158 C CE2 . TYR D 2 59  ? 19.421 22.021  6.990  1.00 45.22  ? 205  TYR E CE2 1 
ATOM   6159 C CZ  . TYR D 2 59  ? 18.091 22.131  6.636  1.00 45.22  ? 205  TYR E CZ  1 
ATOM   6160 O OH  . TYR D 2 59  ? 17.739 22.886  5.545  1.00 45.22  ? 205  TYR E OH  1 
ATOM   6161 N N   . MET D 2 60  ? 20.857 17.518  8.575  1.00 34.23  ? 206  MET E N   1 
ATOM   6162 C CA  . MET D 2 60  ? 21.484 17.070  7.347  1.00 34.23  ? 206  MET E CA  1 
ATOM   6163 C C   . MET D 2 60  ? 20.901 15.754  6.855  1.00 34.23  ? 206  MET E C   1 
ATOM   6164 O O   . MET D 2 60  ? 20.664 15.585  5.660  1.00 34.23  ? 206  MET E O   1 
ATOM   6165 C CB  . MET D 2 60  ? 22.976 16.943  7.563  1.00 50.45  ? 206  MET E CB  1 
ATOM   6166 C CG  . MET D 2 60  ? 23.746 16.751  6.297  1.00 50.45  ? 206  MET E CG  1 
ATOM   6167 S SD  . MET D 2 60  ? 24.611 15.191  6.357  1.00 50.45  ? 206  MET E SD  1 
ATOM   6168 C CE  . MET D 2 60  ? 23.312 14.121  5.924  1.00 50.45  ? 206  MET E CE  1 
ATOM   6169 N N   . LEU D 2 61  ? 20.667 14.809  7.761  1.00 37.04  ? 207  LEU E N   1 
ATOM   6170 C CA  . LEU D 2 61  ? 20.087 13.539  7.346  1.00 37.04  ? 207  LEU E CA  1 
ATOM   6171 C C   . LEU D 2 61  ? 18.640 13.780  6.906  1.00 37.04  ? 207  LEU E C   1 
ATOM   6172 O O   . LEU D 2 61  ? 18.300 13.564  5.743  1.00 37.04  ? 207  LEU E O   1 
ATOM   6173 C CB  . LEU D 2 61  ? 20.127 12.513  8.485  1.00 29.69  ? 207  LEU E CB  1 
ATOM   6174 C CG  . LEU D 2 61  ? 21.497 12.028  8.987  1.00 29.69  ? 207  LEU E CG  1 
ATOM   6175 C CD1 . LEU D 2 61  ? 21.335 10.988  10.106 1.00 29.69  ? 207  LEU E CD1 1 
ATOM   6176 C CD2 . LEU D 2 61  ? 22.262 11.442  7.834  1.00 29.69  ? 207  LEU E CD2 1 
ATOM   6177 N N   . CYS D 2 62  ? 17.801 14.243  7.835  1.00 34.73  ? 208  CYS E N   1 
ATOM   6178 C CA  . CYS D 2 62  ? 16.377 14.521  7.572  1.00 34.73  ? 208  CYS E CA  1 
ATOM   6179 C C   . CYS D 2 62  ? 16.123 15.166  6.219  1.00 34.73  ? 208  CYS E C   1 
ATOM   6180 O O   . CYS D 2 62  ? 15.204 14.791  5.502  1.00 34.73  ? 208  CYS E O   1 
ATOM   6181 C CB  . CYS D 2 62  ? 15.802 15.450  8.645  1.00 37.67  ? 208  CYS E CB  1 
ATOM   6182 S SG  . CYS D 2 62  ? 15.871 14.791  10.294 1.00 37.67  ? 208  CYS E SG  1 
ATOM   6183 N N   . ARG D 2 63  ? 16.952 16.143  5.888  1.00 41.98  ? 209  ARG E N   1 
ATOM   6184 C CA  . ARG D 2 63  ? 16.831 16.878  4.646  1.00 41.98  ? 209  ARG E CA  1 
ATOM   6185 C C   . ARG D 2 63  ? 16.775 15.996  3.401  1.00 41.98  ? 209  ARG E C   1 
ATOM   6186 O O   . ARG D 2 63  ? 15.993 16.257  2.498  1.00 41.98  ? 209  ARG E O   1 
ATOM   6187 C CB  . ARG D 2 63  ? 17.991 17.858  4.538  1.00 47.93  ? 209  ARG E CB  1 
ATOM   6188 C CG  . ARG D 2 63  ? 17.838 18.859  3.451  1.00 47.93  ? 209  ARG E CG  1 
ATOM   6189 C CD  . ARG D 2 63  ? 18.780 20.013  3.679  1.00 47.93  ? 209  ARG E CD  1 
ATOM   6190 N NE  . ARG D 2 63  ? 20.172 19.655  3.455  1.00 47.93  ? 209  ARG E NE  1 
ATOM   6191 C CZ  . ARG D 2 63  ? 21.155 20.544  3.412  1.00 47.93  ? 209  ARG E CZ  1 
ATOM   6192 N NH1 . ARG D 2 63  ? 20.883 21.828  3.581  1.00 47.93  ? 209  ARG E NH1 1 
ATOM   6193 N NH2 . ARG D 2 63  ? 22.405 20.154  3.195  1.00 47.93  ? 209  ARG E NH2 1 
ATOM   6194 N N   . ASP D 2 64  ? 17.595 14.951  3.352  1.00 46.72  ? 210  ASP E N   1 
ATOM   6195 C CA  . ASP D 2 64  ? 17.614 14.064  2.193  1.00 46.72  ? 210  ASP E CA  1 
ATOM   6196 C C   . ASP D 2 64  ? 16.966 12.713  2.483  1.00 46.72  ? 210  ASP E C   1 
ATOM   6197 O O   . ASP D 2 64  ? 17.040 11.799  1.662  1.00 46.72  ? 210  ASP E O   1 
ATOM   6198 C CB  . ASP D 2 64  ? 19.059 13.824  1.738  1.00 43.07  ? 210  ASP E CB  1 
ATOM   6199 C CG  . ASP D 2 64  ? 19.756 15.097  1.268  1.00 43.07  ? 210  ASP E CG  1 
ATOM   6200 O OD1 . ASP D 2 64  ? 20.998 15.187  1.422  1.00 43.07  ? 210  ASP E OD1 1 
ATOM   6201 O OD2 . ASP D 2 64  ? 19.070 16.001  0.735  1.00 43.07  ? 210  ASP E OD2 1 
ATOM   6202 N N   . VAL D 2 65  ? 16.321 12.576  3.636  1.00 41.83  ? 211  VAL E N   1 
ATOM   6203 C CA  . VAL D 2 65  ? 15.729 11.291  3.979  1.00 41.83  ? 211  VAL E CA  1 
ATOM   6204 C C   . VAL D 2 65  ? 14.247 11.298  4.264  1.00 41.83  ? 211  VAL E C   1 
ATOM   6205 O O   . VAL D 2 65  ? 13.545 10.367  3.862  1.00 41.83  ? 211  VAL E O   1 
ATOM   6206 C CB  . VAL D 2 65  ? 16.467 10.657  5.169  1.00 41.30  ? 211  VAL E CB  1 
ATOM   6207 C CG1 . VAL D 2 65  ? 15.570 9.650   5.869  1.00 41.30  ? 211  VAL E CG1 1 
ATOM   6208 C CG2 . VAL D 2 65  ? 17.720 9.969   4.673  1.00 41.30  ? 211  VAL E CG2 1 
ATOM   6209 N N   . ILE D 2 66  ? 13.772 12.314  4.977  1.00 45.50  ? 212  ILE E N   1 
ATOM   6210 C CA  . ILE D 2 66  ? 12.344 12.406  5.267  1.00 45.50  ? 212  ILE E CA  1 
ATOM   6211 C C   . ILE D 2 66  ? 11.672 12.674  3.926  1.00 45.50  ? 212  ILE E C   1 
ATOM   6212 O O   . ILE D 2 66  ? 12.061 13.586  3.190  1.00 45.50  ? 212  ILE E O   1 
ATOM   6213 C CB  . ILE D 2 66  ? 12.004 13.581  6.207  1.00 67.14  ? 212  ILE E CB  1 
ATOM   6214 C CG1 . ILE D 2 66  ? 12.913 13.565  7.445  1.00 67.14  ? 212  ILE E CG1 1 
ATOM   6215 C CG2 . ILE D 2 66  ? 10.534 13.513  6.599  1.00 67.14  ? 212  ILE E CG2 1 
ATOM   6216 C CD1 . ILE D 2 66  ? 12.770 12.344  8.330  1.00 67.14  ? 212  ILE E CD1 1 
ATOM   6217 N N   . SER D 2 67  ? 10.678 11.871  3.590  1.00 45.36  ? 213  SER E N   1 
ATOM   6218 C CA  . SER D 2 67  ? 9.989  12.063  2.331  1.00 45.36  ? 213  SER E CA  1 
ATOM   6219 C C   . SER D 2 67  ? 8.874  13.078  2.473  1.00 45.36  ? 213  SER E C   1 
ATOM   6220 O O   . SER D 2 67  ? 8.158  13.088  3.467  1.00 45.36  ? 213  SER E O   1 
ATOM   6221 C CB  . SER D 2 67  ? 9.399  10.747  1.839  1.00 44.63  ? 213  SER E CB  1 
ATOM   6222 O OG  . SER D 2 67  ? 8.519  10.996  0.760  1.00 44.63  ? 213  SER E OG  1 
ATOM   6223 N N   . SER D 2 68  ? 8.723  13.924  1.463  1.00 70.28  ? 214  SER E N   1 
ATOM   6224 C CA  . SER D 2 68  ? 7.680  14.938  1.468  1.00 70.28  ? 214  SER E CA  1 
ATOM   6225 C C   . SER D 2 68  ? 6.325  14.252  1.300  1.00 70.28  ? 214  SER E C   1 
ATOM   6226 O O   . SER D 2 68  ? 5.278  14.894  1.337  1.00 70.28  ? 214  SER E O   1 
ATOM   6227 C CB  . SER D 2 68  ? 7.921  15.933  0.332  1.00 82.93  ? 214  SER E CB  1 
ATOM   6228 O OG  . SER D 2 68  ? 8.213  15.257  -0.880 1.00 82.93  ? 214  SER E OG  1 
ATOM   6229 N N   . GLU D 2 69  ? 6.361  12.935  1.134  1.00 48.50  ? 215  GLU E N   1 
ATOM   6230 C CA  . GLU D 2 69  ? 5.147  12.146  0.964  1.00 48.50  ? 215  GLU E CA  1 
ATOM   6231 C C   . GLU D 2 69  ? 4.741  11.436  2.255  1.00 48.50  ? 215  GLU E C   1 
ATOM   6232 O O   . GLU D 2 69  ? 3.713  10.765  2.308  1.00 48.50  ? 215  GLU E O   1 
ATOM   6233 C CB  . GLU D 2 69  ? 5.347  11.117  -0.148 1.00 94.08  ? 215  GLU E CB  1 
ATOM   6234 C CG  . GLU D 2 69  ? 5.748  11.722  -1.475 1.00 94.08  ? 215  GLU E CG  1 
ATOM   6235 C CD  . GLU D 2 69  ? 4.768  12.783  -1.946 1.00 94.08  ? 215  GLU E CD  1 
ATOM   6236 O OE1 . GLU D 2 69  ? 4.641  13.823  -1.272 1.00 94.08  ? 215  GLU E OE1 1 
ATOM   6237 O OE2 . GLU D 2 69  ? 4.123  12.579  -2.993 1.00 94.08  ? 215  GLU E OE2 1 
ATOM   6238 N N   . VAL D 2 70  ? 5.562  11.581  3.288  1.00 44.61  ? 216  VAL E N   1 
ATOM   6239 C CA  . VAL D 2 70  ? 5.292  10.963  4.580  1.00 44.61  ? 216  VAL E CA  1 
ATOM   6240 C C   . VAL D 2 70  ? 3.821  11.051  4.960  1.00 44.61  ? 216  VAL E C   1 
ATOM   6241 O O   . VAL D 2 70  ? 3.238  12.127  4.976  1.00 44.61  ? 216  VAL E O   1 
ATOM   6242 C CB  . VAL D 2 70  ? 6.149  11.622  5.674  1.00 57.07  ? 216  VAL E CB  1 
ATOM   6243 C CG1 . VAL D 2 70  ? 5.620  11.269  7.054  1.00 57.07  ? 216  VAL E CG1 1 
ATOM   6244 C CG2 . VAL D 2 70  ? 7.584  11.155  5.532  1.00 57.07  ? 216  VAL E CG2 1 
ATOM   6245 N N   . GLY D 2 71  ? 3.234  9.904   5.267  1.00 77.60  ? 217  GLY E N   1 
ATOM   6246 C CA  . GLY D 2 71  ? 1.834  9.869   5.629  1.00 77.60  ? 217  GLY E CA  1 
ATOM   6247 C C   . GLY D 2 71  ? 1.476  10.476  6.972  1.00 77.60  ? 217  GLY E C   1 
ATOM   6248 O O   . GLY D 2 71  ? 1.154  11.659  7.059  1.00 77.60  ? 217  GLY E O   1 
ATOM   6249 N N   . SER D 2 72  ? 1.545  9.665   8.023  1.00 47.96  ? 218  SER E N   1 
ATOM   6250 C CA  . SER D 2 72  ? 1.182  10.084  9.375  1.00 47.96  ? 218  SER E CA  1 
ATOM   6251 C C   . SER D 2 72  ? 2.295  10.629  10.269 1.00 47.96  ? 218  SER E C   1 
ATOM   6252 O O   . SER D 2 72  ? 3.459  10.708  9.880  1.00 47.96  ? 218  SER E O   1 
ATOM   6253 C CB  . SER D 2 72  ? 0.542  8.902   10.086 1.00 45.79  ? 218  SER E CB  1 
ATOM   6254 O OG  . SER D 2 72  ? 1.381  7.762   9.965  1.00 45.79  ? 218  SER E OG  1 
ATOM   6255 N N   . ASP D 2 73  ? 1.909  10.994  11.486 1.00 69.79  ? 219  ASP E N   1 
ATOM   6256 C CA  . ASP D 2 73  ? 2.845  11.498  12.476 1.00 69.79  ? 219  ASP E CA  1 
ATOM   6257 C C   . ASP D 2 73  ? 3.690  10.305  12.906 1.00 69.79  ? 219  ASP E C   1 
ATOM   6258 O O   . ASP D 2 73  ? 4.866  10.436  13.262 1.00 69.79  ? 219  ASP E O   1 
ATOM   6259 C CB  . ASP D 2 73  ? 2.087  12.063  13.682 1.00 108.57 ? 219  ASP E CB  1 
ATOM   6260 C CG  . ASP D 2 73  ? 1.521  13.448  13.425 1.00 77.04  ? 219  ASP E CG  1 
ATOM   6261 O OD1 . ASP D 2 73  ? 0.954  13.685  12.336 1.00 77.04  ? 219  ASP E OD1 1 
ATOM   6262 O OD2 . ASP D 2 73  ? 1.637  14.305  14.325 1.00 77.04  ? 219  ASP E OD2 1 
ATOM   6263 N N   . HIS D 2 74  ? 3.074  9.130   12.853 1.00 64.58  ? 220  HIS E N   1 
ATOM   6264 C CA  . HIS D 2 74  ? 3.754  7.903   13.226 1.00 64.58  ? 220  HIS E CA  1 
ATOM   6265 C C   . HIS D 2 74  ? 4.920  7.670   12.273 1.00 64.58  ? 220  HIS E C   1 
ATOM   6266 O O   . HIS D 2 74  ? 6.036  7.353   12.702 1.00 64.58  ? 220  HIS E O   1 
ATOM   6267 C CB  . HIS D 2 74  ? 2.795  6.716   13.158 1.00 124.81 ? 220  HIS E CB  1 
ATOM   6268 C CG  . HIS D 2 74  ? 3.358  5.462   13.744 1.00 124.81 ? 220  HIS E CG  1 
ATOM   6269 N ND1 . HIS D 2 74  ? 3.509  5.281   15.103 1.00 68.95  ? 220  HIS E ND1 1 
ATOM   6270 C CD2 . HIS D 2 74  ? 3.852  4.347   13.158 1.00 68.95  ? 220  HIS E CD2 1 
ATOM   6271 C CE1 . HIS D 2 74  ? 4.073  4.108   15.328 1.00 68.95  ? 220  HIS E CE1 1 
ATOM   6272 N NE2 . HIS D 2 74  ? 4.292  3.521   14.164 1.00 68.95  ? 220  HIS E NE2 1 
ATOM   6273 N N   . GLU D 2 75  ? 4.664  7.834   10.979 1.00 64.59  ? 221  GLU E N   1 
ATOM   6274 C CA  . GLU D 2 75  ? 5.714  7.630   9.994  1.00 64.59  ? 221  GLU E CA  1 
ATOM   6275 C C   . GLU D 2 75  ? 6.856  8.624   10.180 1.00 64.59  ? 221  GLU E C   1 
ATOM   6276 O O   . GLU D 2 75  ? 8.024  8.238   10.206 1.00 64.59  ? 221  GLU E O   1 
ATOM   6277 C CB  . GLU D 2 75  ? 5.164  7.746   8.575  1.00 163.60 ? 221  GLU E CB  1 
ATOM   6278 C CG  . GLU D 2 75  ? 6.229  7.524   7.514  1.00 163.60 ? 221  GLU E CG  1 
ATOM   6279 C CD  . GLU D 2 75  ? 5.653  7.355   6.129  1.00 83.11  ? 221  GLU E CD  1 
ATOM   6280 O OE1 . GLU D 2 75  ? 6.440  7.200   5.168  1.00 83.11  ? 221  GLU E OE1 1 
ATOM   6281 O OE2 . GLU D 2 75  ? 4.409  7.374   6.001  1.00 83.11  ? 221  GLU E OE2 1 
ATOM   6282 N N   . LEU D 2 76  ? 6.520  9.902   10.317 1.00 53.37  ? 222  LEU E N   1 
ATOM   6283 C CA  . LEU D 2 76  ? 7.549  10.911  10.490 1.00 53.37  ? 222  LEU E CA  1 
ATOM   6284 C C   . LEU D 2 76  ? 8.447  10.583  11.674 1.00 53.37  ? 222  LEU E C   1 
ATOM   6285 O O   . LEU D 2 76  ? 9.656  10.409  11.518 1.00 53.37  ? 222  LEU E O   1 
ATOM   6286 C CB  . LEU D 2 76  ? 6.917  12.283  10.683 1.00 46.40  ? 222  LEU E CB  1 
ATOM   6287 C CG  . LEU D 2 76  ? 7.894  13.437  10.881 1.00 46.40  ? 222  LEU E CG  1 
ATOM   6288 C CD1 . LEU D 2 76  ? 9.065  13.339  9.891  1.00 46.40  ? 222  LEU E CD1 1 
ATOM   6289 C CD2 . LEU D 2 76  ? 7.116  14.746  10.697 1.00 46.40  ? 222  LEU E CD2 1 
ATOM   6290 N N   . GLN D 2 77  ? 7.850  10.486  12.856 1.00 59.41  ? 223  GLN E N   1 
ATOM   6291 C CA  . GLN D 2 77  ? 8.604  10.174  14.058 1.00 59.41  ? 223  GLN E CA  1 
ATOM   6292 C C   . GLN D 2 77  ? 9.550  8.989   13.853 1.00 59.41  ? 223  GLN E C   1 
ATOM   6293 O O   . GLN D 2 77  ? 10.711 9.046   14.261 1.00 59.41  ? 223  GLN E O   1 
ATOM   6294 C CB  . GLN D 2 77  ? 7.648  9.879   15.207 1.00 53.07  ? 223  GLN E CB  1 
ATOM   6295 C CG  . GLN D 2 77  ? 8.336  9.616   16.520 1.00 53.07  ? 223  GLN E CG  1 
ATOM   6296 C CD  . GLN D 2 77  ? 7.367  9.235   17.628 1.00 53.07  ? 223  GLN E CD  1 
ATOM   6297 O OE1 . GLN D 2 77  ? 7.781  8.898   18.737 1.00 53.07  ? 223  GLN E OE1 1 
ATOM   6298 N NE2 . GLN D 2 77  ? 6.071  9.293   17.336 1.00 53.07  ? 223  GLN E NE2 1 
ATOM   6299 N N   . ALA D 2 78  ? 9.064  7.928   13.211 1.00 48.73  ? 224  ALA E N   1 
ATOM   6300 C CA  . ALA D 2 78  ? 9.884  6.741   12.969 1.00 48.73  ? 224  ALA E CA  1 
ATOM   6301 C C   . ALA D 2 78  ? 11.142 7.006   12.154 1.00 48.73  ? 224  ALA E C   1 
ATOM   6302 O O   . ALA D 2 78  ? 12.250 6.647   12.565 1.00 48.73  ? 224  ALA E O   1 
ATOM   6303 C CB  . ALA D 2 78  ? 9.077  5.685   12.275 1.00 3.27   ? 224  ALA E CB  1 
ATOM   6304 N N   . VAL D 2 79  ? 10.969 7.606   10.984 1.00 50.23  ? 225  VAL E N   1 
ATOM   6305 C CA  . VAL D 2 79  ? 12.103 7.901   10.128 1.00 50.23  ? 225  VAL E CA  1 
ATOM   6306 C C   . VAL D 2 79  ? 12.948 8.960   10.814 1.00 50.23  ? 225  VAL E C   1 
ATOM   6307 O O   . VAL D 2 79  ? 14.172 8.923   10.746 1.00 50.23  ? 225  VAL E O   1 
ATOM   6308 C CB  . VAL D 2 79  ? 11.641 8.402   8.761  1.00 34.88  ? 225  VAL E CB  1 
ATOM   6309 C CG1 . VAL D 2 79  ? 10.798 9.647   8.939  1.00 34.88  ? 225  VAL E CG1 1 
ATOM   6310 C CG2 . VAL D 2 79  ? 12.850 8.652   7.858  1.00 34.88  ? 225  VAL E CG2 1 
ATOM   6311 N N   . LEU D 2 80  ? 12.289 9.895   11.487 1.00 36.20  ? 226  LEU E N   1 
ATOM   6312 C CA  . LEU D 2 80  ? 13.003 10.930  12.210 1.00 36.20  ? 226  LEU E CA  1 
ATOM   6313 C C   . LEU D 2 80  ? 13.891 10.298  13.294 1.00 36.20  ? 226  LEU E C   1 
ATOM   6314 O O   . LEU D 2 80  ? 15.028 10.722  13.518 1.00 36.20  ? 226  LEU E O   1 
ATOM   6315 C CB  . LEU D 2 80  ? 12.020 11.887  12.869 1.00 47.12  ? 226  LEU E CB  1 
ATOM   6316 C CG  . LEU D 2 80  ? 12.670 12.858  13.850 1.00 47.12  ? 226  LEU E CG  1 
ATOM   6317 C CD1 . LEU D 2 80  ? 13.294 13.995  13.092 1.00 47.12  ? 226  LEU E CD1 1 
ATOM   6318 C CD2 . LEU D 2 80  ? 11.635 13.387  14.806 1.00 47.12  ? 226  LEU E CD2 1 
ATOM   6319 N N   . LEU D 2 81  ? 13.368 9.285   13.973 1.00 46.87  ? 227  LEU E N   1 
ATOM   6320 C CA  . LEU D 2 81  ? 14.133 8.630   15.026 1.00 46.87  ? 227  LEU E CA  1 
ATOM   6321 C C   . LEU D 2 81  ? 15.242 7.750   14.466 1.00 46.87  ? 227  LEU E C   1 
ATOM   6322 O O   . LEU D 2 81  ? 16.247 7.495   15.138 1.00 46.87  ? 227  LEU E O   1 
ATOM   6323 C CB  . LEU D 2 81  ? 13.198 7.820   15.925 1.00 45.77  ? 227  LEU E CB  1 
ATOM   6324 C CG  . LEU D 2 81  ? 12.898 8.476   17.273 1.00 45.77  ? 227  LEU E CG  1 
ATOM   6325 C CD1 . LEU D 2 81  ? 13.037 9.980   17.152 1.00 45.77  ? 227  LEU E CD1 1 
ATOM   6326 C CD2 . LEU D 2 81  ? 11.499 8.096   17.736 1.00 45.77  ? 227  LEU E CD2 1 
ATOM   6327 N N   . THR D 2 82  ? 15.057 7.291   13.233 1.00 43.95  ? 228  THR E N   1 
ATOM   6328 C CA  . THR D 2 82  ? 16.059 6.460   12.583 1.00 43.95  ? 228  THR E CA  1 
ATOM   6329 C C   . THR D 2 82  ? 17.269 7.353   12.352 1.00 43.95  ? 228  THR E C   1 
ATOM   6330 O O   . THR D 2 82  ? 18.414 6.956   12.575 1.00 43.95  ? 228  THR E O   1 
ATOM   6331 C CB  . THR D 2 82  ? 15.546 5.926   11.243 1.00 43.76  ? 228  THR E CB  1 
ATOM   6332 O OG1 . THR D 2 82  ? 14.323 5.218   11.466 1.00 43.76  ? 228  THR E OG1 1 
ATOM   6333 C CG2 . THR D 2 82  ? 16.547 4.980   10.622 1.00 43.76  ? 228  THR E CG2 1 
ATOM   6334 N N   . CYS D 2 83  ? 17.004 8.576   11.916 1.00 41.70  ? 229  CYS E N   1 
ATOM   6335 C CA  . CYS D 2 83  ? 18.073 9.526   11.682 1.00 41.70  ? 229  CYS E CA  1 
ATOM   6336 C C   . CYS D 2 83  ? 18.753 9.850   13.014 1.00 41.70  ? 229  CYS E C   1 
ATOM   6337 O O   . CYS D 2 83  ? 19.983 9.823   13.123 1.00 41.70  ? 229  CYS E O   1 
ATOM   6338 C CB  . CYS D 2 83  ? 17.505 10.794  11.040 1.00 55.85  ? 229  CYS E CB  1 
ATOM   6339 S SG  . CYS D 2 83  ? 16.792 10.506  9.391  1.00 55.85  ? 229  CYS E SG  1 
ATOM   6340 N N   . LEU D 2 84  ? 17.942 10.124  14.031 1.00 35.21  ? 230  LEU E N   1 
ATOM   6341 C CA  . LEU D 2 84  ? 18.459 10.469  15.344 1.00 35.21  ? 230  LEU E CA  1 
ATOM   6342 C C   . LEU D 2 84  ? 19.409 9.398   15.831 1.00 35.21  ? 230  LEU E C   1 
ATOM   6343 O O   . LEU D 2 84  ? 20.513 9.700   16.307 1.00 35.21  ? 230  LEU E O   1 
ATOM   6344 C CB  . LEU D 2 84  ? 17.314 10.647  16.352 1.00 41.67  ? 230  LEU E CB  1 
ATOM   6345 C CG  . LEU D 2 84  ? 17.738 11.164  17.736 1.00 41.67  ? 230  LEU E CG  1 
ATOM   6346 C CD1 . LEU D 2 84  ? 18.383 12.530  17.592 1.00 41.67  ? 230  LEU E CD1 1 
ATOM   6347 C CD2 . LEU D 2 84  ? 16.544 11.252  18.657 1.00 41.67  ? 230  LEU E CD2 1 
ATOM   6348 N N   . TYR D 2 85  ? 18.971 8.146   15.710 1.00 31.79  ? 231  TYR E N   1 
ATOM   6349 C CA  . TYR D 2 85  ? 19.770 6.995   16.132 1.00 31.79  ? 231  TYR E CA  1 
ATOM   6350 C C   . TYR D 2 85  ? 21.110 7.046   15.397 1.00 31.79  ? 231  TYR E C   1 
ATOM   6351 O O   . TYR D 2 85  ? 22.169 6.962   16.021 1.00 31.79  ? 231  TYR E O   1 
ATOM   6352 C CB  . TYR D 2 85  ? 19.009 5.706   15.807 1.00 47.01  ? 231  TYR E CB  1 
ATOM   6353 C CG  . TYR D 2 85  ? 19.700 4.424   16.205 1.00 47.01  ? 231  TYR E CG  1 
ATOM   6354 C CD1 . TYR D 2 85  ? 19.989 4.139   17.545 1.00 47.01  ? 231  TYR E CD1 1 
ATOM   6355 C CD2 . TYR D 2 85  ? 20.055 3.486   15.241 1.00 47.01  ? 231  TYR E CD2 1 
ATOM   6356 C CE1 . TYR D 2 85  ? 20.622 2.948   17.913 1.00 47.01  ? 231  TYR E CE1 1 
ATOM   6357 C CE2 . TYR D 2 85  ? 20.682 2.292   15.594 1.00 47.01  ? 231  TYR E CE2 1 
ATOM   6358 C CZ  . TYR D 2 85  ? 20.969 2.028   16.930 1.00 47.01  ? 231  TYR E CZ  1 
ATOM   6359 O OH  . TYR D 2 85  ? 21.640 0.863   17.252 1.00 47.01  ? 231  TYR E OH  1 
ATOM   6360 N N   . LEU D 2 86  ? 21.066 7.220   14.074 1.00 27.34  ? 232  LEU E N   1 
ATOM   6361 C CA  . LEU D 2 86  ? 22.287 7.302   13.276 1.00 27.34  ? 232  LEU E CA  1 
ATOM   6362 C C   . LEU D 2 86  ? 23.162 8.473   13.712 1.00 27.34  ? 232  LEU E C   1 
ATOM   6363 O O   . LEU D 2 86  ? 24.384 8.384   13.690 1.00 27.34  ? 232  LEU E O   1 
ATOM   6364 C CB  . LEU D 2 86  ? 21.939 7.417   11.797 1.00 46.29  ? 232  LEU E CB  1 
ATOM   6365 C CG  . LEU D 2 86  ? 21.427 6.108   11.200 1.00 46.29  ? 232  LEU E CG  1 
ATOM   6366 C CD1 . LEU D 2 86  ? 21.157 6.277   9.727  1.00 46.29  ? 232  LEU E CD1 1 
ATOM   6367 C CD2 . LEU D 2 86  ? 22.473 5.022   11.413 1.00 46.29  ? 232  LEU E CD2 1 
ATOM   6368 N N   . SER D 2 87  ? 22.527 9.570   14.115 1.00 31.12  ? 233  SER E N   1 
ATOM   6369 C CA  . SER D 2 87  ? 23.261 10.739  14.584 1.00 31.12  ? 233  SER E CA  1 
ATOM   6370 C C   . SER D 2 87  ? 24.033 10.340  15.852 1.00 31.12  ? 233  SER E C   1 
ATOM   6371 O O   . SER D 2 87  ? 25.203 10.715  16.038 1.00 31.12  ? 233  SER E O   1 
ATOM   6372 C CB  . SER D 2 87  ? 22.289 11.877  14.893 1.00 49.34  ? 233  SER E CB  1 
ATOM   6373 O OG  . SER D 2 87  ? 21.516 12.224  13.753 1.00 49.34  ? 233  SER E OG  1 
ATOM   6374 N N   . TYR D 2 88  ? 23.373 9.573   16.718 1.00 39.13  ? 234  TYR E N   1 
ATOM   6375 C CA  . TYR D 2 88  ? 23.990 9.108   17.965 1.00 39.13  ? 234  TYR E CA  1 
ATOM   6376 C C   . TYR D 2 88  ? 25.122 8.126   17.671 1.00 39.13  ? 234  TYR E C   1 
ATOM   6377 O O   . TYR D 2 88  ? 26.196 8.180   18.268 1.00 39.13  ? 234  TYR E O   1 
ATOM   6378 C CB  . TYR D 2 88  ? 22.967 8.387   18.852 1.00 39.43  ? 234  TYR E CB  1 
ATOM   6379 C CG  . TYR D 2 88  ? 22.163 9.279   19.769 1.00 39.43  ? 234  TYR E CG  1 
ATOM   6380 C CD1 . TYR D 2 88  ? 20.932 9.810   19.365 1.00 39.43  ? 234  TYR E CD1 1 
ATOM   6381 C CD2 . TYR D 2 88  ? 22.608 9.553   21.065 1.00 39.43  ? 234  TYR E CD2 1 
ATOM   6382 C CE1 . TYR D 2 88  ? 20.162 10.585  20.240 1.00 39.43  ? 234  TYR E CE1 1 
ATOM   6383 C CE2 . TYR D 2 88  ? 21.847 10.324  21.946 1.00 39.43  ? 234  TYR E CE2 1 
ATOM   6384 C CZ  . TYR D 2 88  ? 20.627 10.835  21.529 1.00 39.43  ? 234  TYR E CZ  1 
ATOM   6385 O OH  . TYR D 2 88  ? 19.873 11.580  22.402 1.00 39.43  ? 234  TYR E OH  1 
ATOM   6386 N N   . SER D 2 89  ? 24.850 7.207   16.756 1.00 45.63  ? 235  SER E N   1 
ATOM   6387 C CA  . SER D 2 89  ? 25.827 6.213   16.384 1.00 45.63  ? 235  SER E CA  1 
ATOM   6388 C C   . SER D 2 89  ? 27.054 6.851   15.749 1.00 45.63  ? 235  SER E C   1 
ATOM   6389 O O   . SER D 2 89  ? 28.188 6.439   16.015 1.00 45.63  ? 235  SER E O   1 
ATOM   6390 C CB  . SER D 2 89  ? 25.197 5.222   15.413 1.00 59.18  ? 235  SER E CB  1 
ATOM   6391 O OG  . SER D 2 89  ? 24.031 4.657   15.977 1.00 59.18  ? 235  SER E OG  1 
ATOM   6392 N N   . TYR D 2 90  ? 26.833 7.871   14.928 1.00 41.68  ? 236  TYR E N   1 
ATOM   6393 C CA  . TYR D 2 90  ? 27.936 8.523   14.235 1.00 41.68  ? 236  TYR E CA  1 
ATOM   6394 C C   . TYR D 2 90  ? 28.659 9.671   14.975 1.00 41.68  ? 236  TYR E C   1 
ATOM   6395 O O   . TYR D 2 90  ? 29.858 9.826   14.813 1.00 41.68  ? 236  TYR E O   1 
ATOM   6396 C CB  . TYR D 2 90  ? 27.441 8.984   12.851 1.00 30.70  ? 236  TYR E CB  1 
ATOM   6397 C CG  . TYR D 2 90  ? 28.537 9.288   11.854 1.00 30.70  ? 236  TYR E CG  1 
ATOM   6398 C CD1 . TYR D 2 90  ? 29.028 10.573  11.705 1.00 30.70  ? 236  TYR E CD1 1 
ATOM   6399 C CD2 . TYR D 2 90  ? 29.096 8.283   11.074 1.00 30.70  ? 236  TYR E CD2 1 
ATOM   6400 C CE1 . TYR D 2 90  ? 30.047 10.858  10.806 1.00 30.70  ? 236  TYR E CE1 1 
ATOM   6401 C CE2 . TYR D 2 90  ? 30.120 8.558   10.171 1.00 30.70  ? 236  TYR E CE2 1 
ATOM   6402 C CZ  . TYR D 2 90  ? 30.586 9.854   10.045 1.00 30.70  ? 236  TYR E CZ  1 
ATOM   6403 O OH  . TYR D 2 90  ? 31.584 10.154  9.144  1.00 30.70  ? 236  TYR E OH  1 
ATOM   6404 N N   . MET D 2 91  ? 27.952 10.466  15.777 1.00 33.64  ? 237  MET E N   1 
ATOM   6405 C CA  . MET D 2 91  ? 28.583 11.583  16.500 1.00 33.64  ? 237  MET E CA  1 
ATOM   6406 C C   . MET D 2 91  ? 28.533 11.411  18.023 1.00 33.64  ? 237  MET E C   1 
ATOM   6407 O O   . MET D 2 91  ? 29.177 12.153  18.757 1.00 33.64  ? 237  MET E O   1 
ATOM   6408 C CB  . MET D 2 91  ? 27.902 12.914  16.154 1.00 37.52  ? 237  MET E CB  1 
ATOM   6409 C CG  . MET D 2 91  ? 27.856 13.253  14.681 1.00 37.52  ? 237  MET E CG  1 
ATOM   6410 S SD  . MET D 2 91  ? 29.448 13.674  13.988 1.00 37.52  ? 237  MET E SD  1 
ATOM   6411 C CE  . MET D 2 91  ? 29.298 15.393  13.923 1.00 37.52  ? 237  MET E CE  1 
ATOM   6412 N N   . GLY D 2 92  ? 27.747 10.449  18.494 1.00 43.96  ? 238  GLY E N   1 
ATOM   6413 C CA  . GLY D 2 92  ? 27.647 10.230  19.922 1.00 43.96  ? 238  GLY E CA  1 
ATOM   6414 C C   . GLY D 2 92  ? 29.031 10.217  20.533 1.00 43.96  ? 238  GLY E C   1 
ATOM   6415 O O   . GLY D 2 92  ? 29.941 9.587   19.990 1.00 43.96  ? 238  GLY E O   1 
ATOM   6416 N N   . ASN D 2 93  ? 29.187 10.925  21.648 1.00 80.86  ? 239  ASN E N   1 
ATOM   6417 C CA  . ASN D 2 93  ? 30.452 11.002  22.357 1.00 80.86  ? 239  ASN E CA  1 
ATOM   6418 C C   . ASN D 2 93  ? 30.743 9.663   23.007 1.00 80.86  ? 239  ASN E C   1 
ATOM   6419 O O   . ASN D 2 93  ? 31.894 9.265   23.124 1.00 80.86  ? 239  ASN E O   1 
ATOM   6420 C CB  . ASN D 2 93  ? 30.397 12.115  23.405 1.00 103.45 ? 239  ASN E CB  1 
ATOM   6421 C CG  . ASN D 2 93  ? 30.088 13.464  22.794 1.00 103.45 ? 239  ASN E CG  1 
ATOM   6422 O OD1 . ASN D 2 93  ? 30.834 13.958  21.950 1.00 103.45 ? 239  ASN E OD1 1 
ATOM   6423 N ND2 . ASN D 2 93  ? 28.980 14.066  23.212 1.00 103.45 ? 239  ASN E ND2 1 
ATOM   6424 N N   . GLU D 2 94  ? 29.695 8.975   23.442 1.00 57.28  ? 240  GLU E N   1 
ATOM   6425 C CA  . GLU D 2 94  ? 29.857 7.655   24.031 1.00 57.28  ? 240  GLU E CA  1 
ATOM   6426 C C   . GLU D 2 94  ? 30.205 6.784   22.831 1.00 57.28  ? 240  GLU E C   1 
ATOM   6427 O O   . GLU D 2 94  ? 30.204 7.273   21.708 1.00 57.28  ? 240  GLU E O   1 
ATOM   6428 C CB  . GLU D 2 94  ? 28.548 7.176   24.679 1.00 67.19  ? 240  GLU E CB  1 
ATOM   6429 C CG  . GLU D 2 94  ? 28.603 7.041   26.206 1.00 67.19  ? 240  GLU E CG  1 
ATOM   6430 C CD  . GLU D 2 94  ? 28.972 8.341   26.923 1.00 67.19  ? 240  GLU E CD  1 
ATOM   6431 O OE1 . GLU D 2 94  ? 28.197 9.314   26.853 1.00 67.19  ? 240  GLU E OE1 1 
ATOM   6432 O OE2 . GLU D 2 94  ? 30.048 8.393   27.554 1.00 67.19  ? 240  GLU E OE2 1 
ATOM   6433 N N   . ILE D 2 95  ? 30.494 5.505   23.043 1.00 92.54  ? 241  ILE E N   1 
ATOM   6434 C CA  . ILE D 2 95  ? 30.847 4.642   21.920 1.00 92.54  ? 241  ILE E CA  1 
ATOM   6435 C C   . ILE D 2 95  ? 29.696 3.790   21.402 1.00 92.54  ? 241  ILE E C   1 
ATOM   6436 O O   . ILE D 2 95  ? 29.825 3.124   20.378 1.00 92.54  ? 241  ILE E O   1 
ATOM   6437 C CB  . ILE D 2 95  ? 32.054 3.735   22.267 1.00 73.94  ? 241  ILE E CB  1 
ATOM   6438 C CG1 . ILE D 2 95  ? 31.743 2.885   23.496 1.00 73.94  ? 241  ILE E CG1 1 
ATOM   6439 C CG2 . ILE D 2 95  ? 33.288 4.599   22.509 1.00 73.94  ? 241  ILE E CG2 1 
ATOM   6440 C CD1 . ILE D 2 95  ? 32.884 1.989   23.930 1.00 73.94  ? 241  ILE E CD1 1 
ATOM   6441 N N   . SER D 2 96  ? 28.568 3.824   22.102 1.00 81.00  ? 242  SER E N   1 
ATOM   6442 C CA  . SER D 2 96  ? 27.398 3.055   21.692 1.00 81.00  ? 242  SER E CA  1 
ATOM   6443 C C   . SER D 2 96  ? 26.135 3.451   22.453 1.00 81.00  ? 242  SER E C   1 
ATOM   6444 O O   . SER D 2 96  ? 26.220 4.020   23.541 1.00 81.00  ? 242  SER E O   1 
ATOM   6445 C CB  . SER D 2 96  ? 27.677 1.560   21.842 1.00 52.80  ? 242  SER E CB  1 
ATOM   6446 O OG  . SER D 2 96  ? 28.458 1.310   22.987 1.00 52.80  ? 242  SER E OG  1 
ATOM   6447 N N   . TYR D 2 97  ? 24.967 3.159   21.879 1.00 51.26  ? 243  TYR E N   1 
ATOM   6448 C CA  . TYR D 2 97  ? 23.703 3.527   22.509 1.00 51.26  ? 243  TYR E CA  1 
ATOM   6449 C C   . TYR D 2 97  ? 22.627 2.484   22.390 1.00 51.26  ? 243  TYR E C   1 
ATOM   6450 O O   . TYR D 2 97  ? 22.680 1.609   21.531 1.00 51.26  ? 243  TYR E O   1 
ATOM   6451 C CB  . TYR D 2 97  ? 23.152 4.819   21.921 1.00 41.64  ? 243  TYR E CB  1 
ATOM   6452 C CG  . TYR D 2 97  ? 24.036 6.013   22.150 1.00 41.64  ? 243  TYR E CG  1 
ATOM   6453 C CD1 . TYR D 2 97  ? 25.124 6.262   21.321 1.00 41.64  ? 243  TYR E CD1 1 
ATOM   6454 C CD2 . TYR D 2 97  ? 23.808 6.881   23.218 1.00 41.64  ? 243  TYR E CD2 1 
ATOM   6455 C CE1 . TYR D 2 97  ? 25.964 7.349   21.543 1.00 41.64  ? 243  TYR E CE1 1 
ATOM   6456 C CE2 . TYR D 2 97  ? 24.646 7.962   23.454 1.00 41.64  ? 243  TYR E CE2 1 
ATOM   6457 C CZ  . TYR D 2 97  ? 25.717 8.189   22.608 1.00 41.64  ? 243  TYR E CZ  1 
ATOM   6458 O OH  . TYR D 2 97  ? 26.536 9.273   22.813 1.00 41.64  ? 243  TYR E OH  1 
ATOM   6459 N N   . PRO D 2 98  ? 21.613 2.577   23.255 1.00 58.61  ? 244  PRO E N   1 
ATOM   6460 C CA  . PRO D 2 98  ? 20.492 1.641   23.264 1.00 58.61  ? 244  PRO E CA  1 
ATOM   6461 C C   . PRO D 2 98  ? 19.605 1.911   22.065 1.00 58.61  ? 244  PRO E C   1 
ATOM   6462 O O   . PRO D 2 98  ? 19.694 2.959   21.435 1.00 58.61  ? 244  PRO E O   1 
ATOM   6463 C CB  . PRO D 2 98  ? 19.766 1.971   24.570 1.00 64.46  ? 244  PRO E CB  1 
ATOM   6464 C CG  . PRO D 2 98  ? 20.798 2.681   25.403 1.00 64.46  ? 244  PRO E CG  1 
ATOM   6465 C CD  . PRO D 2 98  ? 21.510 3.514   24.384 1.00 64.46  ? 244  PRO E CD  1 
ATOM   6466 N N   . LEU D 2 99  ? 18.746 0.954   21.768 1.00 71.24  ? 245  LEU E N   1 
ATOM   6467 C CA  . LEU D 2 99  ? 17.814 1.065   20.671 1.00 71.24  ? 245  LEU E CA  1 
ATOM   6468 C C   . LEU D 2 99  ? 16.438 1.098   21.323 1.00 71.24  ? 245  LEU E C   1 
ATOM   6469 O O   . LEU D 2 99  ? 15.403 0.984   20.660 1.00 71.24  ? 245  LEU E O   1 
ATOM   6470 C CB  . LEU D 2 99  ? 17.930 -0.155  19.765 1.00 89.43  ? 245  LEU E CB  1 
ATOM   6471 C CG  . LEU D 2 99  ? 17.004 -0.134  18.550 1.00 89.43  ? 245  LEU E CG  1 
ATOM   6472 C CD1 . LEU D 2 99  ? 17.434 0.975   17.583 1.00 89.43  ? 245  LEU E CD1 1 
ATOM   6473 C CD2 . LEU D 2 99  ? 17.038 -1.488  17.882 1.00 89.43  ? 245  LEU E CD2 1 
ATOM   6474 N N   . LYS D 2 100 ? 16.441 1.247   22.642 1.00 56.70  ? 246  LYS E N   1 
ATOM   6475 C CA  . LYS D 2 100 ? 15.209 1.278   23.416 1.00 56.70  ? 246  LYS E CA  1 
ATOM   6476 C C   . LYS D 2 100 ? 14.344 2.502   23.083 1.00 56.70  ? 246  LYS E C   1 
ATOM   6477 O O   . LYS D 2 100 ? 13.161 2.369   22.747 1.00 56.70  ? 246  LYS E O   1 
ATOM   6478 C CB  . LYS D 2 100 ? 15.566 1.229   24.916 1.00 45.30  ? 246  LYS E CB  1 
ATOM   6479 C CG  . LYS D 2 100 ? 14.734 2.135   25.848 1.00 45.30  ? 246  LYS E CG  1 
ATOM   6480 C CD  . LYS D 2 100 ? 15.586 2.727   26.980 1.00 45.30  ? 246  LYS E CD  1 
ATOM   6481 C CE  . LYS D 2 100 ? 15.012 4.044   27.453 1.00 45.30  ? 246  LYS E CE  1 
ATOM   6482 N NZ  . LYS D 2 100 ? 16.100 5.031   27.535 1.00 45.30  ? 246  LYS E NZ  1 
ATOM   6483 N N   . PRO D 2 101 ? 14.926 3.709   23.145 1.00 54.69  ? 247  PRO E N   1 
ATOM   6484 C CA  . PRO D 2 101 ? 14.147 4.914   22.850 1.00 54.69  ? 247  PRO E CA  1 
ATOM   6485 C C   . PRO D 2 101 ? 13.955 5.255   21.376 1.00 54.69  ? 247  PRO E C   1 
ATOM   6486 O O   . PRO D 2 101 ? 13.075 6.045   21.026 1.00 54.69  ? 247  PRO E O   1 
ATOM   6487 C CB  . PRO D 2 101 ? 14.922 5.993   23.589 1.00 77.38  ? 247  PRO E CB  1 
ATOM   6488 C CG  . PRO D 2 101 ? 16.333 5.561   23.374 1.00 77.38  ? 247  PRO E CG  1 
ATOM   6489 C CD  . PRO D 2 101 ? 16.293 4.059   23.579 1.00 77.38  ? 247  PRO E CD  1 
ATOM   6490 N N   . PHE D 2 102 ? 14.761 4.657   20.510 1.00 66.72  ? 248  PHE E N   1 
ATOM   6491 C CA  . PHE D 2 102 ? 14.658 4.967   19.096 1.00 66.72  ? 248  PHE E CA  1 
ATOM   6492 C C   . PHE D 2 102 ? 13.634 4.168   18.318 1.00 66.72  ? 248  PHE E C   1 
ATOM   6493 O O   . PHE D 2 102 ? 13.068 4.672   17.353 1.00 66.72  ? 248  PHE E O   1 
ATOM   6494 C CB  . PHE D 2 102 ? 16.017 4.809   18.425 1.00 59.69  ? 248  PHE E CB  1 
ATOM   6495 C CG  . PHE D 2 102 ? 17.089 5.640   19.044 1.00 59.69  ? 248  PHE E CG  1 
ATOM   6496 C CD1 . PHE D 2 102 ? 17.828 5.155   20.112 1.00 59.69  ? 248  PHE E CD1 1 
ATOM   6497 C CD2 . PHE D 2 102 ? 17.352 6.916   18.567 1.00 59.69  ? 248  PHE E CD2 1 
ATOM   6498 C CE1 . PHE D 2 102 ? 18.827 5.933   20.701 1.00 59.69  ? 248  PHE E CE1 1 
ATOM   6499 C CE2 . PHE D 2 102 ? 18.346 7.706   19.146 1.00 59.69  ? 248  PHE E CE2 1 
ATOM   6500 C CZ  . PHE D 2 102 ? 19.087 7.215   20.215 1.00 59.69  ? 248  PHE E CZ  1 
ATOM   6501 N N   . LEU D 2 103 ? 13.396 2.929   18.732 1.00 68.17  ? 249  LEU E N   1 
ATOM   6502 C CA  . LEU D 2 103 ? 12.461 2.058   18.033 1.00 68.17  ? 249  LEU E CA  1 
ATOM   6503 C C   . LEU D 2 103 ? 11.010 2.221   18.459 1.00 68.17  ? 249  LEU E C   1 
ATOM   6504 O O   . LEU D 2 103 ? 10.532 1.501   19.328 1.00 68.17  ? 249  LEU E O   1 
ATOM   6505 C CB  . LEU D 2 103 ? 12.885 0.601   18.211 1.00 78.51  ? 249  LEU E CB  1 
ATOM   6506 C CG  . LEU D 2 103 ? 11.984 -0.424  17.529 1.00 78.51  ? 249  LEU E CG  1 
ATOM   6507 C CD1 . LEU D 2 103 ? 11.942 -0.150  16.038 1.00 78.51  ? 249  LEU E CD1 1 
ATOM   6508 C CD2 . LEU D 2 103 ? 12.503 -1.820  17.808 1.00 78.51  ? 249  LEU E CD2 1 
ATOM   6509 N N   . VAL D 2 104 ? 10.316 3.164   17.830 1.00 82.36  ? 250  VAL E N   1 
ATOM   6510 C CA  . VAL D 2 104 ? 8.908  3.429   18.118 1.00 82.36  ? 250  VAL E CA  1 
ATOM   6511 C C   . VAL D 2 104 ? 8.044  2.755   17.050 1.00 82.36  ? 250  VAL E C   1 
ATOM   6512 O O   . VAL D 2 104 ? 6.817  2.823   17.088 1.00 82.36  ? 250  VAL E O   1 
ATOM   6513 C CB  . VAL D 2 104 ? 8.612  4.951   18.102 1.00 104.75 ? 250  VAL E CB  1 
ATOM   6514 C CG1 . VAL D 2 104 ? 8.846  5.515   16.705 1.00 104.75 ? 250  VAL E CG1 1 
ATOM   6515 C CG2 . VAL D 2 104 ? 7.181  5.212   18.546 1.00 104.75 ? 250  VAL E CG2 1 
ATOM   6516 N N   . GLU D 2 105 ? 8.708  2.107   16.097 1.00 91.51  ? 251  GLU E N   1 
ATOM   6517 C CA  . GLU D 2 105 ? 8.047  1.420   14.989 1.00 91.51  ? 251  GLU E CA  1 
ATOM   6518 C C   . GLU D 2 105 ? 7.676  0.008   15.410 1.00 91.51  ? 251  GLU E C   1 
ATOM   6519 O O   . GLU D 2 105 ? 8.319  -0.563  16.288 1.00 91.51  ? 251  GLU E O   1 
ATOM   6520 C CB  . GLU D 2 105 ? 8.999  1.387   13.795 1.00 84.53  ? 251  GLU E CB  1 
ATOM   6521 C CG  . GLU D 2 105 ? 8.474  0.721   12.549 1.00 84.53  ? 251  GLU E CG  1 
ATOM   6522 C CD  . GLU D 2 105 ? 9.416  0.922   11.375 1.00 84.53  ? 251  GLU E CD  1 
ATOM   6523 O OE1 . GLU D 2 105 ? 9.598  2.080   10.956 1.00 84.53  ? 251  GLU E OE1 1 
ATOM   6524 O OE2 . GLU D 2 105 ? 9.980  -0.071  10.874 1.00 84.53  ? 251  GLU E OE2 1 
ATOM   6525 N N   . SER D 2 106 ? 6.646  -0.555  14.789 1.00 69.84  ? 252  SER E N   1 
ATOM   6526 C CA  . SER D 2 106 ? 6.206  -1.906  15.134 1.00 69.84  ? 252  SER E CA  1 
ATOM   6527 C C   . SER D 2 106 ? 7.017  -3.015  14.469 1.00 69.84  ? 252  SER E C   1 
ATOM   6528 O O   . SER D 2 106 ? 7.348  -4.020  15.105 1.00 69.84  ? 252  SER E O   1 
ATOM   6529 C CB  . SER D 2 106 ? 4.735  -2.094  14.770 1.00 140.67 ? 252  SER E CB  1 
ATOM   6530 O OG  . SER D 2 106 ? 4.350  -3.449  14.939 1.00 140.67 ? 252  SER E OG  1 
ATOM   6531 N N   . CYS D 2 107 ? 7.327  -2.822  13.190 1.00 64.17  ? 253  CYS E N   1 
ATOM   6532 C CA  . CYS D 2 107 ? 8.080  -3.794  12.404 1.00 64.17  ? 253  CYS E CA  1 
ATOM   6533 C C   . CYS D 2 107 ? 9.597  -3.601  12.538 1.00 64.17  ? 253  CYS E C   1 
ATOM   6534 O O   . CYS D 2 107 ? 10.217 -2.950  11.696 1.00 64.17  ? 253  CYS E O   1 
ATOM   6535 C CB  . CYS D 2 107 ? 7.661  -3.665  10.934 1.00 75.74  ? 253  CYS E CB  1 
ATOM   6536 S SG  . CYS D 2 107 ? 8.187  -4.997  9.825  1.00 75.74  ? 253  CYS E SG  1 
ATOM   6537 N N   . LYS D 2 108 ? 10.192 -4.158  13.591 1.00 50.16  ? 254  LYS E N   1 
ATOM   6538 C CA  . LYS D 2 108 ? 11.640 -4.050  13.795 1.00 50.16  ? 254  LYS E CA  1 
ATOM   6539 C C   . LYS D 2 108 ? 12.432 -4.178  12.488 1.00 50.16  ? 254  LYS E C   1 
ATOM   6540 O O   . LYS D 2 108 ? 13.308 -3.365  12.205 1.00 50.16  ? 254  LYS E O   1 
ATOM   6541 C CB  . LYS D 2 108 ? 12.127 -5.124  14.772 1.00 64.09  ? 254  LYS E CB  1 
ATOM   6542 C CG  . LYS D 2 108 ? 12.037 -4.757  16.237 1.00 64.09  ? 254  LYS E CG  1 
ATOM   6543 C CD  . LYS D 2 108 ? 12.798 -5.772  17.082 1.00 64.09  ? 254  LYS E CD  1 
ATOM   6544 C CE  . LYS D 2 108 ? 13.107 -5.231  18.471 1.00 64.09  ? 254  LYS E CE  1 
ATOM   6545 N NZ  . LYS D 2 108 ? 14.082 -6.104  19.195 1.00 64.09  ? 254  LYS E NZ  1 
ATOM   6546 N N   . GLU D 2 109 ? 12.122 -5.208  11.702 1.00 65.10  ? 255  GLU E N   1 
ATOM   6547 C CA  . GLU D 2 109 ? 12.799 -5.450  10.429 1.00 65.10  ? 255  GLU E CA  1 
ATOM   6548 C C   . GLU D 2 109 ? 12.890 -4.180  9.580  1.00 65.10  ? 255  GLU E C   1 
ATOM   6549 O O   . GLU D 2 109 ? 13.961 -3.814  9.107  1.00 65.10  ? 255  GLU E O   1 
ATOM   6550 C CB  . GLU D 2 109 ? 12.073 -6.549  9.638  1.00 109.81 ? 255  GLU E CB  1 
ATOM   6551 C CG  . GLU D 2 109 ? 12.567 -6.715  8.200  1.00 109.81 ? 255  GLU E CG  1 
ATOM   6552 C CD  . GLU D 2 109 ? 11.796 -7.772  7.416  1.00 109.81 ? 255  GLU E CD  1 
ATOM   6553 O OE1 . GLU D 2 109 ? 11.950 -8.974  7.726  1.00 109.81 ? 255  GLU E OE1 1 
ATOM   6554 O OE2 . GLU D 2 109 ? 11.036 -7.404  6.490  1.00 109.81 ? 255  GLU E OE2 1 
ATOM   6555 N N   . ALA D 2 110 ? 11.766 -3.503  9.388  1.00 58.54  ? 256  ALA E N   1 
ATOM   6556 C CA  . ALA D 2 110 ? 11.763 -2.279  8.599  1.00 58.54  ? 256  ALA E CA  1 
ATOM   6557 C C   . ALA D 2 110 ? 12.721 -1.227  9.186  1.00 58.54  ? 256  ALA E C   1 
ATOM   6558 O O   . ALA D 2 110 ? 13.425 -0.537  8.447  1.00 58.54  ? 256  ALA E O   1 
ATOM   6559 C CB  . ALA D 2 110 ? 10.346 -1.728  8.506  1.00 33.97  ? 256  ALA E CB  1 
ATOM   6560 N N   . PHE D 2 111 ? 12.754 -1.113  10.510 1.00 50.65  ? 257  PHE E N   1 
ATOM   6561 C CA  . PHE D 2 111 ? 13.635 -0.156  11.163 1.00 50.65  ? 257  PHE E CA  1 
ATOM   6562 C C   . PHE D 2 111 ? 15.071 -0.342  10.691 1.00 50.65  ? 257  PHE E C   1 
ATOM   6563 O O   . PHE D 2 111 ? 15.709 0.599   10.218 1.00 50.65  ? 257  PHE E O   1 
ATOM   6564 C CB  . PHE D 2 111 ? 13.600 -0.323  12.689 1.00 33.30  ? 257  PHE E CB  1 
ATOM   6565 C CG  . PHE D 2 111 ? 14.531 0.618   13.418 1.00 33.30  ? 257  PHE E CG  1 
ATOM   6566 C CD1 . PHE D 2 111 ? 14.158 1.931   13.666 1.00 33.30  ? 257  PHE E CD1 1 
ATOM   6567 C CD2 . PHE D 2 111 ? 15.816 0.206   13.782 1.00 33.30  ? 257  PHE E CD2 1 
ATOM   6568 C CE1 . PHE D 2 111 ? 15.048 2.822   14.260 1.00 33.30  ? 257  PHE E CE1 1 
ATOM   6569 C CE2 . PHE D 2 111 ? 16.724 1.101   14.383 1.00 33.30  ? 257  PHE E CE2 1 
ATOM   6570 C CZ  . PHE D 2 111 ? 16.344 2.402   14.619 1.00 33.30  ? 257  PHE E CZ  1 
ATOM   6571 N N   . TRP D 2 112 ? 15.581 -1.561  10.839 1.00 48.90  ? 258  TRP E N   1 
ATOM   6572 C CA  . TRP D 2 112 ? 16.948 -1.862  10.436 1.00 48.90  ? 258  TRP E CA  1 
ATOM   6573 C C   . TRP D 2 112 ? 17.146 -1.594  8.953  1.00 48.90  ? 258  TRP E C   1 
ATOM   6574 O O   . TRP D 2 112 ? 18.270 -1.375  8.492  1.00 48.90  ? 258  TRP E O   1 
ATOM   6575 C CB  . TRP D 2 112 ? 17.302 -3.318  10.777 1.00 41.66  ? 258  TRP E CB  1 
ATOM   6576 C CG  . TRP D 2 112 ? 17.413 -3.543  12.256 1.00 41.66  ? 258  TRP E CG  1 
ATOM   6577 C CD1 . TRP D 2 112 ? 16.617 -4.340  13.032 1.00 41.66  ? 258  TRP E CD1 1 
ATOM   6578 C CD2 . TRP D 2 112 ? 18.314 -2.887  13.152 1.00 41.66  ? 258  TRP E CD2 1 
ATOM   6579 N NE1 . TRP D 2 112 ? 16.962 -4.213  14.357 1.00 41.66  ? 258  TRP E NE1 1 
ATOM   6580 C CE2 . TRP D 2 112 ? 18.004 -3.329  14.456 1.00 41.66  ? 258  TRP E CE2 1 
ATOM   6581 C CE3 . TRP D 2 112 ? 19.351 -1.965  12.980 1.00 41.66  ? 258  TRP E CE3 1 
ATOM   6582 C CZ2 . TRP D 2 112 ? 18.693 -2.880  15.576 1.00 41.66  ? 258  TRP E CZ2 1 
ATOM   6583 C CZ3 . TRP D 2 112 ? 20.033 -1.518  14.090 1.00 41.66  ? 258  TRP E CZ3 1 
ATOM   6584 C CH2 . TRP D 2 112 ? 19.702 -1.977  15.376 1.00 41.66  ? 258  TRP E CH2 1 
ATOM   6585 N N   . ASP D 2 113 ? 16.051 -1.603  8.203  1.00 61.79  ? 259  ASP E N   1 
ATOM   6586 C CA  . ASP D 2 113 ? 16.147 -1.334  6.781  1.00 61.79  ? 259  ASP E CA  1 
ATOM   6587 C C   . ASP D 2 113 ? 16.424 0.141   6.528  1.00 61.79  ? 259  ASP E C   1 
ATOM   6588 O O   . ASP D 2 113 ? 17.328 0.470   5.755  1.00 61.79  ? 259  ASP E O   1 
ATOM   6589 C CB  . ASP D 2 113 ? 14.876 -1.763  6.052  1.00 84.80  ? 259  ASP E CB  1 
ATOM   6590 C CG  . ASP D 2 113 ? 14.898 -3.225  5.674  1.00 84.80  ? 259  ASP E CG  1 
ATOM   6591 O OD1 . ASP D 2 113 ? 15.974 -3.720  5.273  1.00 84.80  ? 259  ASP E OD1 1 
ATOM   6592 O OD2 . ASP D 2 113 ? 13.839 -3.876  5.764  1.00 84.80  ? 259  ASP E OD2 1 
ATOM   6593 N N   . ARG D 2 114 ? 15.662 1.029   7.171  1.00 42.36  ? 260  ARG E N   1 
ATOM   6594 C CA  . ARG D 2 114 ? 15.897 2.454   6.970  1.00 42.36  ? 260  ARG E CA  1 
ATOM   6595 C C   . ARG D 2 114 ? 17.333 2.847   7.335  1.00 42.36  ? 260  ARG E C   1 
ATOM   6596 O O   . ARG D 2 114 ? 17.915 3.724   6.679  1.00 42.36  ? 260  ARG E O   1 
ATOM   6597 C CB  . ARG D 2 114 ? 14.899 3.313   7.757  1.00 44.46  ? 260  ARG E CB  1 
ATOM   6598 C CG  . ARG D 2 114 ? 13.610 3.602   7.000  1.00 44.46  ? 260  ARG E CG  1 
ATOM   6599 C CD  . ARG D 2 114 ? 12.825 4.718   7.641  1.00 44.46  ? 260  ARG E CD  1 
ATOM   6600 N NE  . ARG D 2 114 ? 12.597 4.431   9.043  1.00 44.46  ? 260  ARG E NE  1 
ATOM   6601 C CZ  . ARG D 2 114 ? 11.761 3.504   9.490  1.00 44.46  ? 260  ARG E CZ  1 
ATOM   6602 N NH1 . ARG D 2 114 ? 11.052 2.776   8.634  1.00 44.46  ? 260  ARG E NH1 1 
ATOM   6603 N NH2 . ARG D 2 114 ? 11.666 3.281   10.799 1.00 44.46  ? 260  ARG E NH2 1 
ATOM   6604 N N   . CYS D 2 115 ? 17.895 2.196   8.363  1.00 36.51  ? 261  CYS E N   1 
ATOM   6605 C CA  . CYS D 2 115 ? 19.271 2.458   8.800  1.00 36.51  ? 261  CYS E CA  1 
ATOM   6606 C C   . CYS D 2 115 ? 20.279 2.177   7.675  1.00 36.51  ? 261  CYS E C   1 
ATOM   6607 O O   . CYS D 2 115 ? 21.242 2.934   7.497  1.00 36.51  ? 261  CYS E O   1 
ATOM   6608 C CB  . CYS D 2 115 ? 19.633 1.611   10.028 1.00 43.96  ? 261  CYS E CB  1 
ATOM   6609 S SG  . CYS D 2 115 ? 18.782 2.064   11.562 1.00 43.96  ? 261  CYS E SG  1 
ATOM   6610 N N   . LEU D 2 116 ? 20.071 1.092   6.927  1.00 43.18  ? 262  LEU E N   1 
ATOM   6611 C CA  . LEU D 2 116 ? 20.965 0.767   5.807  1.00 43.18  ? 262  LEU E CA  1 
ATOM   6612 C C   . LEU D 2 116 ? 20.692 1.702   4.638  1.00 43.18  ? 262  LEU E C   1 
ATOM   6613 O O   . LEU D 2 116 ? 21.624 2.192   3.996  1.00 43.18  ? 262  LEU E O   1 
ATOM   6614 C CB  . LEU D 2 116 ? 20.768 -0.670  5.340  1.00 46.60  ? 262  LEU E CB  1 
ATOM   6615 C CG  . LEU D 2 116 ? 21.225 -1.712  6.357  1.00 46.60  ? 262  LEU E CG  1 
ATOM   6616 C CD1 . LEU D 2 116 ? 20.840 -3.096  5.852  1.00 46.60  ? 262  LEU E CD1 1 
ATOM   6617 C CD2 . LEU D 2 116 ? 22.750 -1.592  6.569  1.00 46.60  ? 262  LEU E CD2 1 
ATOM   6618 N N   . SER D 2 117 ? 19.409 1.939   4.365  1.00 42.40  ? 263  SER E N   1 
ATOM   6619 C CA  . SER D 2 117 ? 19.022 2.832   3.285  1.00 42.40  ? 263  SER E CA  1 
ATOM   6620 C C   . SER D 2 117 ? 19.693 4.177   3.509  1.00 42.40  ? 263  SER E C   1 
ATOM   6621 O O   . SER D 2 117 ? 20.438 4.655   2.654  1.00 42.40  ? 263  SER E O   1 
ATOM   6622 C CB  . SER D 2 117 ? 17.506 3.023   3.255  1.00 62.42  ? 263  SER E CB  1 
ATOM   6623 O OG  . SER D 2 117 ? 16.851 1.807   2.968  1.00 62.42  ? 263  SER E OG  1 
ATOM   6624 N N   . VAL D 2 118 ? 19.434 4.782   4.668  1.00 31.91  ? 264  VAL E N   1 
ATOM   6625 C CA  . VAL D 2 118 ? 20.022 6.074   4.965  1.00 31.91  ? 264  VAL E CA  1 
ATOM   6626 C C   . VAL D 2 118 ? 21.550 6.039   4.932  1.00 31.91  ? 264  VAL E C   1 
ATOM   6627 O O   . VAL D 2 118 ? 22.179 6.946   4.382  1.00 31.91  ? 264  VAL E O   1 
ATOM   6628 C CB  . VAL D 2 118 ? 19.582 6.606   6.330  1.00 27.47  ? 264  VAL E CB  1 
ATOM   6629 C CG1 . VAL D 2 118 ? 20.239 7.954   6.581  1.00 27.47  ? 264  VAL E CG1 1 
ATOM   6630 C CG2 . VAL D 2 118 ? 18.052 6.726   6.383  1.00 27.47  ? 264  VAL E CG2 1 
ATOM   6631 N N   . ILE D 2 119 ? 22.151 5.002   5.510  1.00 30.43  ? 265  ILE E N   1 
ATOM   6632 C CA  . ILE D 2 119 ? 23.602 4.933   5.498  1.00 30.43  ? 265  ILE E CA  1 
ATOM   6633 C C   . ILE D 2 119 ? 24.174 4.866   4.073  1.00 30.43  ? 265  ILE E C   1 
ATOM   6634 O O   . ILE D 2 119 ? 25.176 5.519   3.759  1.00 30.43  ? 265  ILE E O   1 
ATOM   6635 C CB  . ILE D 2 119 ? 24.122 3.727   6.305  1.00 45.41  ? 265  ILE E CB  1 
ATOM   6636 C CG1 . ILE D 2 119 ? 23.983 4.003   7.798  1.00 45.41  ? 265  ILE E CG1 1 
ATOM   6637 C CG2 . ILE D 2 119 ? 25.587 3.469   5.982  1.00 45.41  ? 265  ILE E CG2 1 
ATOM   6638 C CD1 . ILE D 2 119 ? 24.513 2.863   8.650  1.00 45.41  ? 265  ILE E CD1 1 
ATOM   6639 N N   . ASN D 2 120 ? 23.532 4.082   3.217  1.00 41.21  ? 266  ASN E N   1 
ATOM   6640 C CA  . ASN D 2 120 ? 23.998 3.924   1.853  1.00 41.21  ? 266  ASN E CA  1 
ATOM   6641 C C   . ASN D 2 120 ? 23.817 5.187   1.037  1.00 41.21  ? 266  ASN E C   1 
ATOM   6642 O O   . ASN D 2 120 ? 24.439 5.352   -0.007 1.00 41.21  ? 266  ASN E O   1 
ATOM   6643 C CB  . ASN D 2 120 ? 23.264 2.770   1.172  1.00 43.75  ? 266  ASN E CB  1 
ATOM   6644 C CG  . ASN D 2 120 ? 23.646 1.414   1.747  1.00 43.75  ? 266  ASN E CG  1 
ATOM   6645 O OD1 . ASN D 2 120 ? 24.827 1.140   1.984  1.00 43.75  ? 266  ASN E OD1 1 
ATOM   6646 N ND2 . ASN D 2 120 ? 22.650 0.552   1.961  1.00 43.75  ? 266  ASN E ND2 1 
ATOM   6647 N N   . LEU D 2 121 ? 22.983 6.092   1.533  1.00 38.40  ? 267  LEU E N   1 
ATOM   6648 C CA  . LEU D 2 121 ? 22.678 7.342   0.834  1.00 38.40  ? 267  LEU E CA  1 
ATOM   6649 C C   . LEU D 2 121 ? 23.383 8.545   1.467  1.00 38.40  ? 267  LEU E C   1 
ATOM   6650 O O   . LEU D 2 121 ? 23.734 9.490   0.775  1.00 38.40  ? 267  LEU E O   1 
ATOM   6651 C CB  . LEU D 2 121 ? 21.147 7.537   0.833  1.00 30.28  ? 267  LEU E CB  1 
ATOM   6652 C CG  . LEU D 2 121 ? 20.350 8.519   -0.045 1.00 30.28  ? 267  LEU E CG  1 
ATOM   6653 C CD1 . LEU D 2 121 ? 20.036 9.774   0.737  1.00 30.28  ? 267  LEU E CD1 1 
ATOM   6654 C CD2 . LEU D 2 121 ? 21.089 8.818   -1.332 1.00 30.28  ? 267  LEU E CD2 1 
ATOM   6655 N N   . MET D 2 122 ? 23.613 8.500   2.774  1.00 32.28  ? 268  MET E N   1 
ATOM   6656 C CA  . MET D 2 122 ? 24.249 9.615   3.453  1.00 32.28  ? 268  MET E CA  1 
ATOM   6657 C C   . MET D 2 122 ? 25.664 9.378   3.976  1.00 32.28  ? 268  MET E C   1 
ATOM   6658 O O   . MET D 2 122 ? 26.256 10.283  4.555  1.00 32.28  ? 268  MET E O   1 
ATOM   6659 C CB  . MET D 2 122 ? 23.372 10.092  4.612  1.00 41.12  ? 268  MET E CB  1 
ATOM   6660 C CG  . MET D 2 122 ? 21.943 10.419  4.224  1.00 41.12  ? 268  MET E CG  1 
ATOM   6661 S SD  . MET D 2 122 ? 21.809 11.523  2.796  1.00 41.12  ? 268  MET E SD  1 
ATOM   6662 C CE  . MET D 2 122 ? 21.710 13.063  3.575  1.00 41.12  ? 268  MET E CE  1 
ATOM   6663 N N   . SER D 2 123 ? 26.232 8.198   3.765  1.00 36.57  ? 269  SER E N   1 
ATOM   6664 C CA  . SER D 2 123 ? 27.574 7.951   4.290  1.00 36.57  ? 269  SER E CA  1 
ATOM   6665 C C   . SER D 2 123 ? 28.631 8.983   3.876  1.00 36.57  ? 269  SER E C   1 
ATOM   6666 O O   . SER D 2 123 ? 29.534 9.300   4.657  1.00 36.57  ? 269  SER E O   1 
ATOM   6667 C CB  . SER D 2 123 ? 28.042 6.544   3.916  1.00 40.08  ? 269  SER E CB  1 
ATOM   6668 O OG  . SER D 2 123 ? 29.058 6.577   2.935  1.00 40.08  ? 269  SER E OG  1 
ATOM   6669 N N   . SER D 2 124 ? 28.526 9.517   2.663  1.00 44.76  ? 270  SER E N   1 
ATOM   6670 C CA  . SER D 2 124 ? 29.506 10.501  2.202  1.00 44.76  ? 270  SER E CA  1 
ATOM   6671 C C   . SER D 2 124 ? 29.297 11.838  2.900  1.00 44.76  ? 270  SER E C   1 
ATOM   6672 O O   . SER D 2 124 ? 30.248 12.445  3.384  1.00 44.76  ? 270  SER E O   1 
ATOM   6673 C CB  . SER D 2 124 ? 29.399 10.705  0.690  1.00 36.84  ? 270  SER E CB  1 
ATOM   6674 O OG  . SER D 2 124 ? 29.457 9.472   -0.008 1.00 36.84  ? 270  SER E OG  1 
ATOM   6675 N N   . LYS D 2 125 ? 28.048 12.295  2.939  1.00 43.88  ? 271  LYS E N   1 
ATOM   6676 C CA  . LYS D 2 125 ? 27.707 13.566  3.570  1.00 43.88  ? 271  LYS E CA  1 
ATOM   6677 C C   . LYS D 2 125 ? 27.945 13.567  5.075  1.00 43.88  ? 271  LYS E C   1 
ATOM   6678 O O   . LYS D 2 125 ? 28.285 14.598  5.656  1.00 43.88  ? 271  LYS E O   1 
ATOM   6679 C CB  . LYS D 2 125 ? 26.243 13.910  3.306  1.00 34.78  ? 271  LYS E CB  1 
ATOM   6680 C CG  . LYS D 2 125 ? 25.943 14.241  1.866  1.00 34.78  ? 271  LYS E CG  1 
ATOM   6681 C CD  . LYS D 2 125 ? 24.453 14.344  1.627  1.00 34.78  ? 271  LYS E CD  1 
ATOM   6682 C CE  . LYS D 2 125 ? 24.206 14.590  0.164  1.00 34.78  ? 271  LYS E CE  1 
ATOM   6683 N NZ  . LYS D 2 125 ? 22.761 14.676  -0.112 1.00 34.78  ? 271  LYS E NZ  1 
ATOM   6684 N N   . MET D 2 126 ? 27.753 12.413  5.703  1.00 37.56  ? 272  MET E N   1 
ATOM   6685 C CA  . MET D 2 126 ? 27.941 12.310  7.132  1.00 37.56  ? 272  MET E CA  1 
ATOM   6686 C C   . MET D 2 126 ? 29.397 12.564  7.469  1.00 37.56  ? 272  MET E C   1 
ATOM   6687 O O   . MET D 2 126 ? 29.705 13.090  8.534  1.00 37.56  ? 272  MET E O   1 
ATOM   6688 C CB  . MET D 2 126 ? 27.494 10.929  7.623  1.00 33.17  ? 272  MET E CB  1 
ATOM   6689 C CG  . MET D 2 126 ? 25.976 10.730  7.600  1.00 33.17  ? 272  MET E CG  1 
ATOM   6690 S SD  . MET D 2 126 ? 25.460 9.004   7.747  1.00 33.17  ? 272  MET E SD  1 
ATOM   6691 C CE  . MET D 2 126 ? 25.534 8.753   9.543  1.00 33.17  ? 272  MET E CE  1 
ATOM   6692 N N   . LEU D 2 127 ? 30.290 12.210  6.552  1.00 40.25  ? 273  LEU E N   1 
ATOM   6693 C CA  . LEU D 2 127 ? 31.716 12.413  6.776  1.00 40.25  ? 273  LEU E CA  1 
ATOM   6694 C C   . LEU D 2 127 ? 32.142 13.799  6.315  1.00 40.25  ? 273  LEU E C   1 
ATOM   6695 O O   . LEU D 2 127 ? 33.047 14.412  6.883  1.00 40.25  ? 273  LEU E O   1 
ATOM   6696 C CB  . LEU D 2 127 ? 32.555 11.379  6.020  1.00 25.86  ? 273  LEU E CB  1 
ATOM   6697 C CG  . LEU D 2 127 ? 34.065 11.500  6.296  1.00 25.86  ? 273  LEU E CG  1 
ATOM   6698 C CD1 . LEU D 2 127 ? 34.322 11.323  7.803  1.00 25.86  ? 273  LEU E CD1 1 
ATOM   6699 C CD2 . LEU D 2 127 ? 34.831 10.465  5.488  1.00 25.86  ? 273  LEU E CD2 1 
ATOM   6700 N N   . GLN D 2 128 ? 31.499 14.297  5.271  1.00 52.42  ? 274  GLN E N   1 
ATOM   6701 C CA  . GLN D 2 128 ? 31.870 15.608  4.790  1.00 52.42  ? 274  GLN E CA  1 
ATOM   6702 C C   . GLN D 2 128 ? 31.521 16.697  5.794  1.00 52.42  ? 274  GLN E C   1 
ATOM   6703 O O   . GLN D 2 128 ? 32.364 17.522  6.114  1.00 52.42  ? 274  GLN E O   1 
ATOM   6704 C CB  . GLN D 2 128 ? 31.200 15.912  3.451  1.00 51.12  ? 274  GLN E CB  1 
ATOM   6705 C CG  . GLN D 2 128 ? 31.636 17.245  2.869  1.00 51.12  ? 274  GLN E CG  1 
ATOM   6706 C CD  . GLN D 2 128 ? 30.987 17.535  1.546  1.00 51.12  ? 274  GLN E CD  1 
ATOM   6707 O OE1 . GLN D 2 128 ? 31.215 18.585  0.951  1.00 51.12  ? 274  GLN E OE1 1 
ATOM   6708 N NE2 . GLN D 2 128 ? 30.170 16.604  1.072  1.00 51.12  ? 274  GLN E NE2 1 
ATOM   6709 N N   . ILE D 2 129 ? 30.296 16.700  6.310  1.00 33.78  ? 275  ILE E N   1 
ATOM   6710 C CA  . ILE D 2 129 ? 29.925 17.749  7.242  1.00 33.78  ? 275  ILE E CA  1 
ATOM   6711 C C   . ILE D 2 129 ? 30.943 17.850  8.346  1.00 33.78  ? 275  ILE E C   1 
ATOM   6712 O O   . ILE D 2 129 ? 31.102 18.911  8.956  1.00 33.78  ? 275  ILE E O   1 
ATOM   6713 C CB  . ILE D 2 129 ? 28.574 17.529  7.888  1.00 31.43  ? 275  ILE E CB  1 
ATOM   6714 C CG1 . ILE D 2 129 ? 28.082 18.870  8.461  1.00 31.43  ? 275  ILE E CG1 1 
ATOM   6715 C CG2 . ILE D 2 129 ? 28.690 16.503  9.001  1.00 31.43  ? 275  ILE E CG2 1 
ATOM   6716 C CD1 . ILE D 2 129 ? 26.575 18.913  8.817  1.00 31.43  ? 275  ILE E CD1 1 
ATOM   6717 N N   . ASN D 2 130 ? 31.624 16.735  8.594  1.00 52.24  ? 276  ASN E N   1 
ATOM   6718 C CA  . ASN D 2 130 ? 32.652 16.664  9.622  1.00 52.24  ? 276  ASN E CA  1 
ATOM   6719 C C   . ASN D 2 130 ? 34.007 17.106  9.078  1.00 52.24  ? 276  ASN E C   1 
ATOM   6720 O O   . ASN D 2 130 ? 34.711 17.868  9.725  1.00 52.24  ? 276  ASN E O   1 
ATOM   6721 C CB  . ASN D 2 130 ? 32.764 15.232  10.167 1.00 39.53  ? 276  ASN E CB  1 
ATOM   6722 C CG  . ASN D 2 130 ? 31.857 14.983  11.356 1.00 39.53  ? 276  ASN E CG  1 
ATOM   6723 O OD1 . ASN D 2 130 ? 32.146 15.407  12.473 1.00 39.53  ? 276  ASN E OD1 1 
ATOM   6724 N ND2 . ASN D 2 130 ? 30.756 14.294  11.120 1.00 39.53  ? 276  ASN E ND2 1 
ATOM   6725 N N   . ALA D 2 131 ? 34.353 16.643  7.883  1.00 43.99  ? 277  ALA E N   1 
ATOM   6726 C CA  . ALA D 2 131 ? 35.639 16.966  7.275  1.00 43.99  ? 277  ALA E CA  1 
ATOM   6727 C C   . ALA D 2 131 ? 35.719 18.245  6.467  1.00 43.99  ? 277  ALA E C   1 
ATOM   6728 O O   . ALA D 2 131 ? 36.809 18.633  6.056  1.00 43.99  ? 277  ALA E O   1 
ATOM   6729 C CB  . ALA D 2 131 ? 36.109 15.807  6.400  1.00 15.27  ? 277  ALA E CB  1 
ATOM   6730 N N   . ASP D 2 132 ? 34.594 18.908  6.243  1.00 37.45  ? 278  ASP E N   1 
ATOM   6731 C CA  . ASP D 2 132 ? 34.594 20.123  5.436  1.00 37.45  ? 278  ASP E CA  1 
ATOM   6732 C C   . ASP D 2 132 ? 33.827 21.260  6.115  1.00 37.45  ? 278  ASP E C   1 
ATOM   6733 O O   . ASP D 2 132 ? 32.623 21.413  5.901  1.00 37.45  ? 278  ASP E O   1 
ATOM   6734 C CB  . ASP D 2 132 ? 33.986 19.771  4.080  1.00 51.75  ? 278  ASP E CB  1 
ATOM   6735 C CG  . ASP D 2 132 ? 33.798 20.959  3.185  1.00 51.75  ? 278  ASP E CG  1 
ATOM   6736 O OD1 . ASP D 2 132 ? 33.400 20.743  2.024  1.00 51.75  ? 278  ASP E OD1 1 
ATOM   6737 O OD2 . ASP D 2 132 ? 34.036 22.095  3.627  1.00 51.75  ? 278  ASP E OD2 1 
ATOM   6738 N N   . PRO D 2 133 ? 34.525 22.087  6.930  1.00 52.84  ? 279  PRO E N   1 
ATOM   6739 C CA  . PRO D 2 133 ? 33.944 23.221  7.663  1.00 52.84  ? 279  PRO E CA  1 
ATOM   6740 C C   . PRO D 2 133 ? 33.071 24.104  6.804  1.00 52.84  ? 279  PRO E C   1 
ATOM   6741 O O   . PRO D 2 133 ? 32.069 24.639  7.269  1.00 52.84  ? 279  PRO E O   1 
ATOM   6742 C CB  . PRO D 2 133 ? 35.167 23.957  8.187  1.00 36.94  ? 279  PRO E CB  1 
ATOM   6743 C CG  . PRO D 2 133 ? 36.119 22.856  8.443  1.00 36.94  ? 279  PRO E CG  1 
ATOM   6744 C CD  . PRO D 2 133 ? 35.977 22.017  7.180  1.00 36.94  ? 279  PRO E CD  1 
ATOM   6745 N N   . HIS D 2 134 ? 33.463 24.279  5.550  1.00 52.44  ? 280  HIS E N   1 
ATOM   6746 C CA  . HIS D 2 134 ? 32.668 25.082  4.640  1.00 52.44  ? 280  HIS E CA  1 
ATOM   6747 C C   . HIS D 2 134 ? 31.300 24.394  4.512  1.00 52.44  ? 280  HIS E C   1 
ATOM   6748 O O   . HIS D 2 134 ? 30.252 25.039  4.636  1.00 52.44  ? 280  HIS E O   1 
ATOM   6749 C CB  . HIS D 2 134 ? 33.353 25.166  3.273  1.00 88.35  ? 280  HIS E CB  1 
ATOM   6750 C CG  . HIS D 2 134 ? 32.615 26.006  2.278  1.00 88.35  ? 280  HIS E CG  1 
ATOM   6751 N ND1 . HIS D 2 134 ? 32.314 27.332  2.501  1.00 88.35  ? 280  HIS E ND1 1 
ATOM   6752 C CD2 . HIS D 2 134 ? 32.120 25.708  1.054  1.00 88.35  ? 280  HIS E CD2 1 
ATOM   6753 C CE1 . HIS D 2 134 ? 31.664 27.815  1.457  1.00 88.35  ? 280  HIS E CE1 1 
ATOM   6754 N NE2 . HIS D 2 134 ? 31.533 26.849  0.565  1.00 88.35  ? 280  HIS E NE2 1 
ATOM   6755 N N   . TYR D 2 135 ? 31.311 23.081  4.285  1.00 41.42  ? 281  TYR E N   1 
ATOM   6756 C CA  . TYR D 2 135 ? 30.064 22.343  4.146  1.00 41.42  ? 281  TYR E CA  1 
ATOM   6757 C C   . TYR D 2 135 ? 29.243 22.431  5.426  1.00 41.42  ? 281  TYR E C   1 
ATOM   6758 O O   . TYR D 2 135 ? 28.032 22.633  5.377  1.00 41.42  ? 281  TYR E O   1 
ATOM   6759 C CB  . TYR D 2 135 ? 30.332 20.875  3.770  1.00 37.56  ? 281  TYR E CB  1 
ATOM   6760 C CG  . TYR D 2 135 ? 29.069 20.027  3.619  1.00 37.56  ? 281  TYR E CG  1 
ATOM   6761 C CD1 . TYR D 2 135 ? 27.947 20.511  2.946  1.00 37.56  ? 281  TYR E CD1 1 
ATOM   6762 C CD2 . TYR D 2 135 ? 29.004 18.741  4.149  1.00 37.56  ? 281  TYR E CD2 1 
ATOM   6763 C CE1 . TYR D 2 135 ? 26.797 19.739  2.808  1.00 37.56  ? 281  TYR E CE1 1 
ATOM   6764 C CE2 . TYR D 2 135 ? 27.854 17.951  4.016  1.00 37.56  ? 281  TYR E CE2 1 
ATOM   6765 C CZ  . TYR D 2 135 ? 26.753 18.455  3.348  1.00 37.56  ? 281  TYR E CZ  1 
ATOM   6766 O OH  . TYR D 2 135 ? 25.610 17.679  3.242  1.00 37.56  ? 281  TYR E OH  1 
ATOM   6767 N N   . PHE D 2 136 ? 29.896 22.294  6.573  1.00 40.07  ? 282  PHE E N   1 
ATOM   6768 C CA  . PHE D 2 136 ? 29.173 22.372  7.832  1.00 40.07  ? 282  PHE E CA  1 
ATOM   6769 C C   . PHE D 2 136 ? 28.415 23.693  7.932  1.00 40.07  ? 282  PHE E C   1 
ATOM   6770 O O   . PHE D 2 136 ? 27.244 23.706  8.289  1.00 40.07  ? 282  PHE E O   1 
ATOM   6771 C CB  . PHE D 2 136 ? 30.121 22.239  9.027  1.00 47.55  ? 282  PHE E CB  1 
ATOM   6772 C CG  . PHE D 2 136 ? 29.424 22.323  10.361 1.00 47.55  ? 282  PHE E CG  1 
ATOM   6773 C CD1 . PHE D 2 136 ? 28.555 21.325  10.770 1.00 47.55  ? 282  PHE E CD1 1 
ATOM   6774 C CD2 . PHE D 2 136 ? 29.609 23.421  11.190 1.00 47.55  ? 282  PHE E CD2 1 
ATOM   6775 C CE1 . PHE D 2 136 ? 27.873 21.417  11.994 1.00 47.55  ? 282  PHE E CE1 1 
ATOM   6776 C CE2 . PHE D 2 136 ? 28.932 23.525  12.416 1.00 47.55  ? 282  PHE E CE2 1 
ATOM   6777 C CZ  . PHE D 2 136 ? 28.063 22.522  12.817 1.00 47.55  ? 282  PHE E CZ  1 
ATOM   6778 N N   . THR D 2 137 ? 29.082 24.799  7.607  1.00 39.08  ? 283  THR E N   1 
ATOM   6779 C CA  . THR D 2 137 ? 28.468 26.121  7.671  1.00 39.08  ? 283  THR E CA  1 
ATOM   6780 C C   . THR D 2 137 ? 27.284 26.281  6.730  1.00 39.08  ? 283  THR E C   1 
ATOM   6781 O O   . THR D 2 137 ? 26.307 26.954  7.061  1.00 39.08  ? 283  THR E O   1 
ATOM   6782 C CB  . THR D 2 137 ? 29.514 27.240  7.393  1.00 49.77  ? 283  THR E CB  1 
ATOM   6783 O OG1 . THR D 2 137 ? 30.189 27.569  8.614  1.00 49.77  ? 283  THR E OG1 1 
ATOM   6784 C CG2 . THR D 2 137 ? 28.851 28.495  6.844  1.00 49.77  ? 283  THR E CG2 1 
ATOM   6785 N N   . GLN D 2 138 ? 27.364 25.667  5.558  1.00 39.62  ? 284  GLN E N   1 
ATOM   6786 C CA  . GLN D 2 138 ? 26.267 25.753  4.597  1.00 39.62  ? 284  GLN E CA  1 
ATOM   6787 C C   . GLN D 2 138 ? 25.053 25.041  5.169  1.00 39.62  ? 284  GLN E C   1 
ATOM   6788 O O   . GLN D 2 138 ? 23.949 25.584  5.167  1.00 39.62  ? 284  GLN E O   1 
ATOM   6789 C CB  . GLN D 2 138 ? 26.648 25.105  3.266  1.00 88.68  ? 284  GLN E CB  1 
ATOM   6790 C CG  . GLN D 2 138 ? 27.924 25.637  2.657  1.00 88.68  ? 284  GLN E CG  1 
ATOM   6791 C CD  . GLN D 2 138 ? 28.083 25.226  1.213  1.00 88.68  ? 284  GLN E CD  1 
ATOM   6792 O OE1 . GLN D 2 138 ? 28.069 24.036  0.884  1.00 88.68  ? 284  GLN E OE1 1 
ATOM   6793 N NE2 . GLN D 2 138 ? 28.236 26.213  0.334  1.00 88.68  ? 284  GLN E NE2 1 
ATOM   6794 N N   . VAL D 2 139 ? 25.257 23.831  5.681  1.00 41.77  ? 285  VAL E N   1 
ATOM   6795 C CA  . VAL D 2 139 ? 24.142 23.085  6.233  1.00 41.77  ? 285  VAL E CA  1 
ATOM   6796 C C   . VAL D 2 139 ? 23.609 23.855  7.427  1.00 41.77  ? 285  VAL E C   1 
ATOM   6797 O O   . VAL D 2 139 ? 22.397 24.086  7.557  1.00 41.77  ? 285  VAL E O   1 
ATOM   6798 C CB  . VAL D 2 139 ? 24.563 21.665  6.677  1.00 32.34  ? 285  VAL E CB  1 
ATOM   6799 C CG1 . VAL D 2 139 ? 23.339 20.880  7.126  1.00 32.34  ? 285  VAL E CG1 1 
ATOM   6800 C CG2 . VAL D 2 139 ? 25.249 20.941  5.523  1.00 32.34  ? 285  VAL E CG2 1 
ATOM   6801 N N   . PHE D 2 140 ? 24.525 24.264  8.293  1.00 49.95  ? 286  PHE E N   1 
ATOM   6802 C CA  . PHE D 2 140 ? 24.154 25.009  9.484  1.00 49.95  ? 286  PHE E CA  1 
ATOM   6803 C C   . PHE D 2 140 ? 23.368 26.254  9.114  1.00 49.95  ? 286  PHE E C   1 
ATOM   6804 O O   . PHE D 2 140 ? 22.409 26.640  9.794  1.00 49.95  ? 286  PHE E O   1 
ATOM   6805 C CB  . PHE D 2 140 ? 25.396 25.434  10.263 1.00 55.78  ? 286  PHE E CB  1 
ATOM   6806 C CG  . PHE D 2 140 ? 25.120 26.482  11.289 1.00 55.78  ? 286  PHE E CG  1 
ATOM   6807 C CD1 . PHE D 2 140 ? 24.352 26.191  12.404 1.00 55.78  ? 286  PHE E CD1 1 
ATOM   6808 C CD2 . PHE D 2 140 ? 25.574 27.776  11.110 1.00 55.78  ? 286  PHE E CD2 1 
ATOM   6809 C CE1 . PHE D 2 140 ? 24.037 27.179  13.327 1.00 55.78  ? 286  PHE E CE1 1 
ATOM   6810 C CE2 . PHE D 2 140 ? 25.265 28.764  12.023 1.00 55.78  ? 286  PHE E CE2 1 
ATOM   6811 C CZ  . PHE D 2 140 ? 24.493 28.466  13.133 1.00 55.78  ? 286  PHE E CZ  1 
ATOM   6812 N N   . SER D 2 141 ? 23.788 26.891  8.032  1.00 48.05  ? 287  SER E N   1 
ATOM   6813 C CA  . SER D 2 141 ? 23.124 28.099  7.597  1.00 48.05  ? 287  SER E CA  1 
ATOM   6814 C C   . SER D 2 141 ? 21.702 27.811  7.104  1.00 48.05  ? 287  SER E C   1 
ATOM   6815 O O   . SER D 2 141 ? 20.761 28.498  7.492  1.00 48.05  ? 287  SER E O   1 
ATOM   6816 C CB  . SER D 2 141 ? 23.952 28.771  6.505  1.00 49.65  ? 287  SER E CB  1 
ATOM   6817 O OG  . SER D 2 141 ? 23.325 29.954  6.074  1.00 49.65  ? 287  SER E OG  1 
ATOM   6818 N N   . ASP D 2 142 ? 21.542 26.793  6.260  1.00 50.10  ? 288  ASP E N   1 
ATOM   6819 C CA  . ASP D 2 142 ? 20.224 26.460  5.746  1.00 50.10  ? 288  ASP E CA  1 
ATOM   6820 C C   . ASP D 2 142 ? 19.283 26.176  6.908  1.00 50.10  ? 288  ASP E C   1 
ATOM   6821 O O   . ASP D 2 142 ? 18.140 26.636  6.913  1.00 50.10  ? 288  ASP E O   1 
ATOM   6822 C CB  . ASP D 2 142 ? 20.280 25.233  4.831  1.00 69.49  ? 288  ASP E CB  1 
ATOM   6823 C CG  . ASP D 2 142 ? 21.329 25.352  3.745  1.00 69.49  ? 288  ASP E CG  1 
ATOM   6824 O OD1 . ASP D 2 142 ? 21.487 26.450  3.170  1.00 69.49  ? 288  ASP E OD1 1 
ATOM   6825 O OD2 . ASP D 2 142 ? 21.989 24.332  3.453  1.00 69.49  ? 288  ASP E OD2 1 
ATOM   6826 N N   . LEU D 2 143 ? 19.751 25.416  7.895  1.00 43.55  ? 289  LEU E N   1 
ATOM   6827 C CA  . LEU D 2 143 ? 18.885 25.127  9.025  1.00 43.55  ? 289  LEU E CA  1 
ATOM   6828 C C   . LEU D 2 143 ? 18.436 26.461  9.620  1.00 43.55  ? 289  LEU E C   1 
ATOM   6829 O O   . LEU D 2 143 ? 17.265 26.634  9.989  1.00 43.55  ? 289  LEU E O   1 
ATOM   6830 C CB  . LEU D 2 143 ? 19.608 24.310  10.098 1.00 30.39  ? 289  LEU E CB  1 
ATOM   6831 C CG  . LEU D 2 143 ? 18.745 24.128  11.357 1.00 30.39  ? 289  LEU E CG  1 
ATOM   6832 C CD1 . LEU D 2 143 ? 17.384 23.544  10.964 1.00 30.39  ? 289  LEU E CD1 1 
ATOM   6833 C CD2 . LEU D 2 143 ? 19.436 23.224  12.359 1.00 30.39  ? 289  LEU E CD2 1 
ATOM   6834 N N   . LYS D 2 144 ? 19.368 27.408  9.690  1.00 46.33  ? 290  LYS E N   1 
ATOM   6835 C CA  . LYS D 2 144 ? 19.079 28.722  10.240 1.00 46.33  ? 290  LYS E CA  1 
ATOM   6836 C C   . LYS D 2 144 ? 17.914 29.396  9.499  1.00 46.33  ? 290  LYS E C   1 
ATOM   6837 O O   . LYS D 2 144 ? 17.003 29.939  10.128 1.00 46.33  ? 290  LYS E O   1 
ATOM   6838 C CB  . LYS D 2 144 ? 20.341 29.591  10.169 1.00 149.95 ? 290  LYS E CB  1 
ATOM   6839 C CG  . LYS D 2 144 ? 20.292 30.862  11.010 1.00 149.95 ? 290  LYS E CG  1 
ATOM   6840 C CD  . LYS D 2 144 ? 21.607 31.639  10.915 1.00 149.95 ? 290  LYS E CD  1 
ATOM   6841 C CE  . LYS D 2 144 ? 21.575 32.911  11.761 1.00 149.95 ? 290  LYS E CE  1 
ATOM   6842 N NZ  . LYS D 2 144 ? 22.816 33.727  11.607 1.00 149.95 ? 290  LYS E NZ  1 
ATOM   6843 N N   . ASN D 2 145 ? 17.940 29.329  8.167  1.00 48.31  ? 291  ASN E N   1 
ATOM   6844 C CA  . ASN D 2 145 ? 16.917 29.939  7.310  1.00 48.31  ? 291  ASN E CA  1 
ATOM   6845 C C   . ASN D 2 145 ? 15.604 29.167  7.236  1.00 48.31  ? 291  ASN E C   1 
ATOM   6846 O O   . ASN D 2 145 ? 14.625 29.653  6.665  1.00 48.31  ? 291  ASN E O   1 
ATOM   6847 C CB  . ASN D 2 145 ? 17.451 30.124  5.885  1.00 90.49  ? 291  ASN E CB  1 
ATOM   6848 C CG  . ASN D 2 145 ? 18.490 31.230  5.786  1.00 90.49  ? 291  ASN E CG  1 
ATOM   6849 O OD1 . ASN D 2 145 ? 18.264 32.351  6.240  1.00 90.49  ? 291  ASN E OD1 1 
ATOM   6850 N ND2 . ASN D 2 145 ? 19.632 30.920  5.185  1.00 90.49  ? 291  ASN E ND2 1 
ATOM   6851 N N   . GLU D 2 146 ? 15.575 27.969  7.811  1.00 62.62  ? 292  GLU E N   1 
ATOM   6852 C CA  . GLU D 2 146 ? 14.367 27.147  7.790  1.00 62.62  ? 292  GLU E CA  1 
ATOM   6853 C C   . GLU D 2 146 ? 13.245 27.798  8.587  1.00 62.62  ? 292  GLU E C   1 
ATOM   6854 O O   . GLU D 2 146 ? 12.075 27.471  8.400  1.00 62.62  ? 292  GLU E O   1 
ATOM   6855 C CB  . GLU D 2 146 ? 14.666 25.765  8.360  1.00 63.48  ? 292  GLU E CB  1 
ATOM   6856 C CG  . GLU D 2 146 ? 14.092 24.643  7.528  1.00 63.48  ? 292  GLU E CG  1 
ATOM   6857 C CD  . GLU D 2 146 ? 14.712 24.561  6.151  1.00 63.48  ? 292  GLU E CD  1 
ATOM   6858 O OE1 . GLU D 2 146 ? 15.955 24.507  6.070  1.00 63.48  ? 292  GLU E OE1 1 
ATOM   6859 O OE2 . GLU D 2 146 ? 13.964 24.541  5.152  1.00 63.48  ? 292  GLU E OE2 1 
ATOM   6860 N N   . SER D 2 147 ? 13.608 28.721  9.473  1.00 116.62 ? 293  SER E N   1 
ATOM   6861 C CA  . SER D 2 147 ? 12.626 29.412  10.297 1.00 116.62 ? 293  SER E CA  1 
ATOM   6862 C C   . SER D 2 147 ? 11.627 30.176  9.431  1.00 116.62 ? 293  SER E C   1 
ATOM   6863 O O   . SER D 2 147 ? 10.431 29.806  9.448  1.00 116.62 ? 293  SER E O   1 
ATOM   6864 C CB  . SER D 2 147 ? 13.324 30.382  11.249 1.00 67.53  ? 293  SER E CB  1 
ATOM   6865 O OG  . SER D 2 147 ? 12.396 30.977  12.142 1.00 67.53  ? 293  SER E OG  1 
ATOM   6866 O OXT . SER D 2 147 ? 12.050 31.130  8.740  1.00 67.53  ? 293  SER E OXT 1 
HETATM 6867 O O   . HOH E 3 .   ? 24.732 -24.513 15.268 1.00 49.49  ? 2001 HOH A O   1 
HETATM 6868 O O   . HOH E 3 .   ? 50.242 -27.121 46.634 1.00 68.44  ? 2002 HOH A O   1 
HETATM 6869 O O   . HOH E 3 .   ? 37.811 -27.807 40.296 1.00 54.98  ? 2003 HOH A O   1 
HETATM 6870 O O   . HOH E 3 .   ? 21.355 -16.780 31.286 1.00 62.56  ? 2004 HOH A O   1 
HETATM 6871 O O   . HOH E 3 .   ? 24.419 -11.381 27.156 1.00 56.02  ? 2005 HOH A O   1 
HETATM 6872 O O   . HOH E 3 .   ? 45.027 -5.906  29.379 1.00 54.35  ? 2006 HOH A O   1 
HETATM 6873 O O   . HOH E 3 .   ? 57.197 -14.387 26.838 1.00 80.47  ? 2007 HOH A O   1 
HETATM 6874 O O   . HOH E 3 .   ? 62.181 -25.483 33.645 1.00 52.69  ? 2008 HOH A O   1 
HETATM 6875 O O   . HOH E 3 .   ? 35.688 -40.714 37.075 1.00 46.56  ? 2009 HOH A O   1 
HETATM 6876 O O   . HOH E 3 .   ? 37.827 -29.317 25.885 1.00 61.67  ? 2010 HOH A O   1 
HETATM 6877 O O   . HOH E 3 .   ? 44.818 -31.374 23.756 1.00 38.07  ? 2011 HOH A O   1 
HETATM 6878 O O   . HOH E 3 .   ? 34.971 -24.649 26.336 1.00 45.29  ? 2012 HOH A O   1 
HETATM 6879 O O   . HOH E 3 .   ? 33.936 -37.251 20.371 1.00 47.09  ? 2013 HOH A O   1 
HETATM 6880 O O   . HOH E 3 .   ? 36.137 -36.890 12.528 1.00 39.73  ? 2014 HOH A O   1 
HETATM 6881 O O   . HOH E 3 .   ? 53.073 -26.189 18.329 1.00 39.84  ? 2015 HOH A O   1 
HETATM 6882 O O   . HOH E 3 .   ? 51.435 -30.277 17.067 1.00 50.74  ? 2016 HOH A O   1 
HETATM 6883 O O   . HOH E 3 .   ? 45.428 -42.835 18.283 1.00 46.57  ? 2017 HOH A O   1 
HETATM 6884 O O   . HOH E 3 .   ? 58.661 -13.912 22.835 1.00 42.16  ? 2018 HOH A O   1 
HETATM 6885 O O   . HOH E 3 .   ? 57.594 -26.666 2.592  1.00 62.78  ? 2019 HOH A O   1 
HETATM 6886 O O   . HOH E 3 .   ? 60.039 -27.541 12.590 1.00 51.04  ? 2020 HOH A O   1 
HETATM 6887 O O   . HOH E 3 .   ? 46.322 -39.233 3.059  1.00 44.54  ? 2021 HOH A O   1 
HETATM 6888 O O   . HOH E 3 .   ? 48.773 -34.104 5.190  1.00 54.54  ? 2022 HOH A O   1 
HETATM 6889 O O   . HOH E 3 .   ? 55.324 -39.708 6.738  1.00 56.90  ? 2023 HOH A O   1 
HETATM 6890 O O   . HOH E 3 .   ? 58.645 -39.249 17.700 1.00 53.11  ? 2024 HOH A O   1 
HETATM 6891 O O   . HOH E 3 .   ? 57.737 -42.308 17.524 1.00 22.63  ? 2025 HOH A O   1 
HETATM 6892 O O   . HOH E 3 .   ? 46.632 -39.336 20.215 1.00 39.64  ? 2026 HOH A O   1 
HETATM 6893 O O   . HOH E 3 .   ? 48.327 -40.430 34.059 1.00 52.70  ? 2027 HOH A O   1 
HETATM 6894 O O   . HOH E 3 .   ? 65.117 -30.707 37.058 1.00 55.84  ? 2028 HOH A O   1 
HETATM 6895 O O   . HOH F 3 .   ? 31.017 -22.636 9.988  1.00 52.24  ? 2001 HOH B O   1 
HETATM 6896 O O   . HOH F 3 .   ? 21.961 -8.207  23.955 1.00 66.69  ? 2002 HOH B O   1 
HETATM 6897 O O   . HOH F 3 .   ? 39.772 0.122   1.450  1.00 41.34  ? 2003 HOH B O   1 
HETATM 6898 O O   . HOH F 3 .   ? 38.675 -10.917 -0.372 1.00 50.35  ? 2004 HOH B O   1 
HETATM 6899 O O   . HOH F 3 .   ? 37.469 12.947  4.165  1.00 43.38  ? 2005 HOH B O   1 
HETATM 6900 O O   . HOH F 3 .   ? 33.535 9.179   20.412 1.00 56.79  ? 2006 HOH B O   1 
HETATM 6901 O O   . HOH F 3 .   ? 35.568 -3.442  14.748 1.00 56.16  ? 2007 HOH B O   1 
HETATM 6902 O O   . HOH F 3 .   ? 38.055 1.340   15.511 1.00 37.89  ? 2008 HOH B O   1 
HETATM 6903 O O   . HOH F 3 .   ? 39.282 0.415   24.720 1.00 56.88  ? 2009 HOH B O   1 
HETATM 6904 O O   . HOH F 3 .   ? 44.887 14.704  24.392 1.00 35.45  ? 2010 HOH B O   1 
HETATM 6905 O O   . HOH F 3 .   ? 44.901 3.627   18.240 1.00 39.95  ? 2011 HOH B O   1 
HETATM 6906 O O   . HOH F 3 .   ? 51.758 -9.512  20.127 1.00 66.67  ? 2012 HOH B O   1 
HETATM 6907 O O   . HOH F 3 .   ? 52.789 -1.708  24.249 1.00 51.43  ? 2013 HOH B O   1 
HETATM 6908 O O   . HOH F 3 .   ? 51.808 4.639   41.711 1.00 52.81  ? 2014 HOH B O   1 
HETATM 6909 O O   . HOH F 3 .   ? 58.668 -0.374  31.228 1.00 48.65  ? 2015 HOH B O   1 
HETATM 6910 O O   . HOH F 3 .   ? 51.033 21.065  27.163 1.00 47.99  ? 2016 HOH B O   1 
HETATM 6911 O O   . HOH F 3 .   ? 38.159 11.185  34.039 1.00 65.12  ? 2017 HOH B O   1 
HETATM 6912 O O   . HOH F 3 .   ? 53.329 11.464  36.715 1.00 60.25  ? 2018 HOH B O   1 
HETATM 6913 O O   . HOH F 3 .   ? 71.762 6.112   27.781 1.00 94.59  ? 2019 HOH B O   1 
HETATM 6914 O O   . HOH F 3 .   ? 58.265 11.486  25.644 1.00 47.32  ? 2020 HOH B O   1 
HETATM 6915 O O   . HOH F 3 .   ? 57.154 14.627  26.030 1.00 19.93  ? 2021 HOH B O   1 
HETATM 6916 O O   . HOH G 3 .   ? 21.914 -58.421 23.564 1.00 46.09  ? 2001 HOH D O   1 
HETATM 6917 O O   . HOH G 3 .   ? 14.508 -58.716 19.206 1.00 47.21  ? 2002 HOH D O   1 
HETATM 6918 O O   . HOH G 3 .   ? 19.454 -44.596 35.769 1.00 59.87  ? 2003 HOH D O   1 
HETATM 6919 O O   . HOH G 3 .   ? 3.254  -30.725 19.032 1.00 51.56  ? 2004 HOH D O   1 
HETATM 6920 O O   . HOH G 3 .   ? 31.198 -36.541 27.416 1.00 37.41  ? 2005 HOH D O   1 
HETATM 6921 O O   . HOH G 3 .   ? 29.790 -36.275 33.594 1.00 39.26  ? 2006 HOH D O   1 
HETATM 6922 O O   . HOH G 3 .   ? 24.356 -38.489 38.855 1.00 39.61  ? 2007 HOH D O   1 
HETATM 6923 O O   . HOH G 3 .   ? 26.376 -45.886 41.396 1.00 57.19  ? 2008 HOH D O   1 
HETATM 6924 O O   . HOH G 3 .   ? 21.327 -45.834 36.922 1.00 67.14  ? 2009 HOH D O   1 
HETATM 6925 O O   . HOH H 3 .   ? 24.374 29.660  18.106 1.00 51.51  ? 2001 HOH E O   1 
HETATM 6926 O O   . HOH H 3 .   ? -0.019 10.461  -2.150 1.00 49.17  ? 2002 HOH E O   1 
HETATM 6927 O O   . HOH H 3 .   ? 16.740 4.986   31.814 1.00 67.30  ? 2003 HOH E O   1 
HETATM 6928 O O   . HOH H 3 .   ? 28.509 18.377  19.349 1.00 54.95  ? 2004 HOH E O   1 
HETATM 6929 O O   . HOH H 3 .   ? 21.400 17.742  0.034  1.00 47.95  ? 2005 HOH E O   1 
HETATM 6930 O O   . HOH H 3 .   ? 10.191 9.329   4.815  1.00 48.10  ? 2006 HOH E O   1 
HETATM 6931 O O   . HOH H 3 .   ? 31.841 8.660   13.178 1.00 32.75  ? 2007 HOH E O   1 
HETATM 6932 O O   . HOH H 3 .   ? 28.434 14.581  19.734 1.00 52.03  ? 2008 HOH E O   1 
HETATM 6933 O O   . HOH H 3 .   ? 30.349 8.089   17.840 1.00 74.03  ? 2009 HOH E O   1 
HETATM 6934 O O   . HOH H 3 .   ? 26.381 7.268   0.884  1.00 50.20  ? 2010 HOH E O   1 
HETATM 6935 O O   . HOH H 3 .   ? 26.312 10.663  1.233  1.00 43.49  ? 2011 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLN 2   2   2   GLN GLN A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  THR 14  14  ?   ?   ?   A . n 
A 1 15  TYR 15  15  15  TYR TYR A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ASP 39  39  ?   ?   ?   A . n 
A 1 40  ASP 40  40  ?   ?   ?   A . n 
A 1 41  ASP 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 CYS 117 117 117 CYS CYS A . n 
A 1 118 HIS 118 118 118 HIS HIS A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 HIS 124 124 124 HIS HIS A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 GLN 130 130 130 GLN GLN A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 CYS 157 157 157 CYS CYS A . n 
A 1 158 TYR 158 158 158 TYR TYR A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 TRP 166 166 166 TRP TRP A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 TRP 186 186 186 TRP TRP A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 CYS 190 190 190 CYS CYS A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PRO 201 201 201 PRO PRO A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 PRO 234 234 234 PRO PRO A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 LYS 237 237 237 LYS LYS A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 TYR 242 242 242 TYR TYR A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 CYS 269 269 269 CYS CYS A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 GLN 273 273 273 GLN GLN A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 TYR 285 285 285 TYR TYR A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 ASP 288 288 ?   ?   ?   A . n 
A 1 289 PHE 289 289 ?   ?   ?   A . n 
A 1 290 CYS 290 290 ?   ?   ?   A . n 
A 1 291 PRO 291 291 ?   ?   ?   A . n 
A 1 292 PRO 292 292 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLN 2   2   2   GLN GLN B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   TYR 4   4   4   TYR TYR B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   GLU 8   8   8   GLU GLU B . n 
B 1 9   LYS 9   9   9   LYS LYS B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLY 11  11  ?   ?   ?   B . n 
B 1 12  GLU 12  12  ?   ?   ?   B . n 
B 1 13  GLY 13  13  ?   ?   ?   B . n 
B 1 14  THR 14  14  ?   ?   ?   B . n 
B 1 15  TYR 15  15  15  TYR TYR B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  PHE 19  19  19  PHE PHE B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  ASN 23  23  23  ASN ASN B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  ILE 29  29  29  ILE ILE B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  ASP 39  39  ?   ?   ?   B . n 
B 1 40  ASP 40  40  ?   ?   ?   B . n 
B 1 41  ASP 41  41  ?   ?   ?   B . n 
B 1 42  GLU 42  42  ?   ?   ?   B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  PRO 45  45  45  PRO PRO B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  SER 47  47  47  SER SER B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  ARG 50  50  50  ARG ARG B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  CYS 53  53  53  CYS CYS B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  ASN 62  62  62  ASN ASN B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  ASP 68  68  68  ASP ASP B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  HIS 71  71  71  HIS HIS B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  ASP 73  73  73  ASP ASP B . n 
B 1 74  LYS 74  74  74  LYS LYS B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  CYS 83  83  83  CYS CYS B . n 
B 1 84  ASP 84  84  84  ASP ASP B . n 
B 1 85  GLN 85  85  85  GLN GLN B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  TYR 90  90  90  TYR TYR B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  CYS 94  94  94  CYS CYS B . n 
B 1 95  ASN 95  95  95  ASN ASN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  ASP 99  99  99  ASP ASP B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 GLU 101 101 101 GLU GLU B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 PHE 108 108 108 PHE PHE B . n 
B 1 109 GLN 109 109 109 GLN GLN B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 GLY 113 113 113 GLY GLY B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 CYS 117 117 117 CYS CYS B . n 
B 1 118 HIS 118 118 118 HIS HIS B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 ARG 120 120 120 ARG ARG B . n 
B 1 121 ASN 121 121 121 ASN ASN B . n 
B 1 122 VAL 122 122 122 VAL VAL B . n 
B 1 123 LEU 123 123 123 LEU LEU B . n 
B 1 124 HIS 124 124 124 HIS HIS B . n 
B 1 125 ARG 125 125 125 ARG ARG B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 PRO 129 129 129 PRO PRO B . n 
B 1 130 GLN 130 130 130 GLN GLN B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 ILE 134 134 134 ILE ILE B . n 
B 1 135 ASN 135 135 135 ASN ASN B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 PHE 145 145 145 PHE PHE B . n 
B 1 146 GLY 146 146 146 GLY GLY B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 ARG 149 149 149 ARG ARG B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 PHE 151 151 151 PHE PHE B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ARG 156 156 156 ARG ARG B . n 
B 1 157 CYS 157 157 157 CYS CYS B . n 
B 1 158 TYR 158 158 158 TYR TYR B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 GLU 161 161 161 GLU GLU B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 LEU 165 165 165 LEU LEU B . n 
B 1 166 TRP 166 166 166 TRP TRP B . n 
B 1 167 TYR 167 167 167 TYR TYR B . n 
B 1 168 ARG 168 168 168 ARG ARG B . n 
B 1 169 PRO 169 169 169 PRO PRO B . n 
B 1 170 PRO 170 170 170 PRO PRO B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 TYR 179 179 179 TYR TYR B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 MET 185 185 185 MET MET B . n 
B 1 186 TRP 186 186 186 TRP TRP B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 CYS 190 190 190 CYS CYS B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 ASN 197 197 197 ASN ASN B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PRO 201 201 201 PRO PRO B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 PHE 203 203 203 PHE PHE B . n 
B 1 204 PRO 204 204 204 PRO PRO B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 ASP 207 207 207 ASP ASP B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 ASP 209 209 209 ASP ASP B . n 
B 1 210 ASP 210 210 210 ASP ASP B . n 
B 1 211 GLN 211 211 211 GLN GLN B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 LYS 213 213 213 LYS LYS B . n 
B 1 214 ARG 214 214 214 ARG ARG B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 PHE 216 216 216 PHE PHE B . n 
B 1 217 ARG 217 217 217 ARG ARG B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 THR 221 221 221 THR THR B . n 
B 1 222 PRO 222 222 222 PRO PRO B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 GLU 224 224 224 GLU GLU B . n 
B 1 225 GLU 225 225 225 GLU GLU B . n 
B 1 226 GLN 226 226 226 GLN GLN B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 PRO 228 228 228 PRO PRO B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 MET 230 230 230 MET MET B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 LYS 232 232 232 LYS LYS B . n 
B 1 233 LEU 233 233 233 LEU LEU B . n 
B 1 234 PRO 234 234 234 PRO PRO B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 TYR 236 236 236 TYR TYR B . n 
B 1 237 LYS 237 237 237 LYS LYS B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 PRO 240 240 240 PRO PRO B . n 
B 1 241 MET 241 241 241 MET MET B . n 
B 1 242 TYR 242 242 242 TYR TYR B . n 
B 1 243 PRO 243 243 243 PRO PRO B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 THR 245 245 245 THR THR B . n 
B 1 246 THR 246 246 246 THR THR B . n 
B 1 247 SER 247 247 247 SER SER B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 VAL 249 249 249 VAL VAL B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 PRO 253 253 253 PRO PRO B . n 
B 1 254 LYS 254 254 254 LYS LYS B . n 
B 1 255 LEU 255 255 255 LEU LEU B . n 
B 1 256 ASN 256 256 256 ASN ASN B . n 
B 1 257 ALA 257 257 257 ALA ALA B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 ASP 261 261 261 ASP ASP B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 GLN 264 264 264 GLN GLN B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 LYS 268 268 268 LYS LYS B . n 
B 1 269 CYS 269 269 269 CYS CYS B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 GLN 273 273 273 GLN GLN B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 SER 276 276 276 SER SER B . n 
B 1 277 ALA 277 277 277 ALA ALA B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 GLU 279 279 279 GLU GLU B . n 
B 1 280 ALA 280 280 280 ALA ALA B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 GLN 282 282 282 GLN GLN B . n 
B 1 283 HIS 283 283 283 HIS HIS B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 TYR 285 285 285 TYR TYR B . n 
B 1 286 PHE 286 286 286 PHE PHE B . n 
B 1 287 SER 287 287 287 SER SER B . n 
B 1 288 ASP 288 288 ?   ?   ?   B . n 
B 1 289 PHE 289 289 ?   ?   ?   B . n 
B 1 290 CYS 290 290 ?   ?   ?   B . n 
B 1 291 PRO 291 291 ?   ?   ?   B . n 
B 1 292 PRO 292 292 ?   ?   ?   B . n 
C 2 1   SER 1   147 147 SER SER D . n 
C 2 2   THR 2   148 148 THR THR D . n 
C 2 3   SER 3   149 149 SER SER D . n 
C 2 4   GLU 4   150 150 GLU GLU D . n 
C 2 5   LEU 5   151 151 LEU LEU D . n 
C 2 6   LEU 6   152 152 LEU LEU D . n 
C 2 7   ARG 7   153 153 ARG ARG D . n 
C 2 8   CYS 8   154 154 CYS CYS D . n 
C 2 9   LEU 9   155 155 LEU LEU D . n 
C 2 10  GLY 10  156 156 GLY GLY D . n 
C 2 11  GLU 11  157 157 GLU GLU D . n 
C 2 12  PHE 12  158 158 PHE PHE D . n 
C 2 13  LEU 13  159 159 LEU LEU D . n 
C 2 14  CYS 14  160 160 CYS CYS D . n 
C 2 15  ARG 15  161 161 ARG ARG D . n 
C 2 16  ARG 16  162 162 ARG ARG D . n 
C 2 17  CYS 17  163 163 CYS CYS D . n 
C 2 18  TYR 18  164 164 TYR TYR D . n 
C 2 19  ARG 19  165 165 ARG ARG D . n 
C 2 20  LEU 20  166 166 LEU LEU D . n 
C 2 21  LYS 21  167 167 LYS LYS D . n 
C 2 22  HIS 22  168 168 HIS HIS D . n 
C 2 23  LEU 23  169 169 LEU LEU D . n 
C 2 24  SER 24  170 170 SER SER D . n 
C 2 25  PRO 25  171 171 PRO PRO D . n 
C 2 26  THR 26  172 172 THR THR D . n 
C 2 27  ASP 27  173 173 ASP ASP D . n 
C 2 28  PRO 28  174 174 PRO PRO D . n 
C 2 29  VAL 29  175 175 VAL VAL D . n 
C 2 30  LEU 30  176 176 LEU LEU D . n 
C 2 31  TRP 31  177 177 TRP TRP D . n 
C 2 32  LEU 32  178 178 LEU LEU D . n 
C 2 33  ARG 33  179 179 ARG ARG D . n 
C 2 34  SER 34  180 180 SER SER D . n 
C 2 35  VAL 35  181 181 VAL VAL D . n 
C 2 36  ASP 36  182 182 ASP ASP D . n 
C 2 37  ARG 37  183 183 ARG ARG D . n 
C 2 38  SER 38  184 184 SER SER D . n 
C 2 39  LEU 39  185 185 LEU LEU D . n 
C 2 40  LEU 40  186 186 LEU LEU D . n 
C 2 41  LEU 41  187 187 LEU LEU D . n 
C 2 42  GLN 42  188 188 GLN GLN D . n 
C 2 43  GLY 43  189 189 GLY GLY D . n 
C 2 44  TRP 44  190 190 TRP TRP D . n 
C 2 45  GLN 45  191 191 GLN GLN D . n 
C 2 46  ASP 46  192 192 ASP ASP D . n 
C 2 47  GLN 47  193 193 GLN GLN D . n 
C 2 48  GLY 48  194 194 GLY GLY D . n 
C 2 49  PHE 49  195 195 PHE PHE D . n 
C 2 50  ILE 50  196 196 ILE ILE D . n 
C 2 51  THR 51  197 197 THR THR D . n 
C 2 52  PRO 52  198 198 PRO PRO D . n 
C 2 53  ALA 53  199 199 ALA ALA D . n 
C 2 54  ASN 54  200 200 ASN ASN D . n 
C 2 55  VAL 55  201 201 VAL VAL D . n 
C 2 56  VAL 56  202 202 VAL VAL D . n 
C 2 57  PHE 57  203 203 PHE PHE D . n 
C 2 58  LEU 58  204 204 LEU LEU D . n 
C 2 59  TYR 59  205 205 TYR TYR D . n 
C 2 60  MET 60  206 206 MET MET D . n 
C 2 61  LEU 61  207 207 LEU LEU D . n 
C 2 62  CYS 62  208 208 CYS CYS D . n 
C 2 63  ARG 63  209 209 ARG ARG D . n 
C 2 64  ASP 64  210 210 ASP ASP D . n 
C 2 65  VAL 65  211 211 VAL VAL D . n 
C 2 66  ILE 66  212 212 ILE ILE D . n 
C 2 67  SER 67  213 213 SER SER D . n 
C 2 68  SER 68  214 214 SER SER D . n 
C 2 69  GLU 69  215 215 GLU GLU D . n 
C 2 70  VAL 70  216 216 VAL VAL D . n 
C 2 71  GLY 71  217 217 GLY GLY D . n 
C 2 72  SER 72  218 218 SER SER D . n 
C 2 73  ASP 73  219 219 ASP ASP D . n 
C 2 74  HIS 74  220 220 HIS HIS D . n 
C 2 75  GLU 75  221 221 GLU GLU D . n 
C 2 76  LEU 76  222 222 LEU LEU D . n 
C 2 77  GLN 77  223 223 GLN GLN D . n 
C 2 78  ALA 78  224 224 ALA ALA D . n 
C 2 79  VAL 79  225 225 VAL VAL D . n 
C 2 80  LEU 80  226 226 LEU LEU D . n 
C 2 81  LEU 81  227 227 LEU LEU D . n 
C 2 82  THR 82  228 228 THR THR D . n 
C 2 83  CYS 83  229 229 CYS CYS D . n 
C 2 84  LEU 84  230 230 LEU LEU D . n 
C 2 85  TYR 85  231 231 TYR TYR D . n 
C 2 86  LEU 86  232 232 LEU LEU D . n 
C 2 87  SER 87  233 233 SER SER D . n 
C 2 88  TYR 88  234 234 TYR TYR D . n 
C 2 89  SER 89  235 235 SER SER D . n 
C 2 90  TYR 90  236 236 TYR TYR D . n 
C 2 91  MET 91  237 237 MET MET D . n 
C 2 92  GLY 92  238 238 GLY GLY D . n 
C 2 93  ASN 93  239 239 ASN ASN D . n 
C 2 94  GLU 94  240 240 GLU GLU D . n 
C 2 95  ILE 95  241 241 ILE ILE D . n 
C 2 96  SER 96  242 242 SER SER D . n 
C 2 97  TYR 97  243 243 TYR TYR D . n 
C 2 98  PRO 98  244 244 PRO PRO D . n 
C 2 99  LEU 99  245 245 LEU LEU D . n 
C 2 100 LYS 100 246 246 LYS LYS D . n 
C 2 101 PRO 101 247 247 PRO PRO D . n 
C 2 102 PHE 102 248 248 PHE PHE D . n 
C 2 103 LEU 103 249 249 LEU LEU D . n 
C 2 104 VAL 104 250 250 VAL VAL D . n 
C 2 105 GLU 105 251 251 GLU GLU D . n 
C 2 106 SER 106 252 252 SER SER D . n 
C 2 107 CYS 107 253 253 CYS CYS D . n 
C 2 108 LYS 108 254 254 LYS LYS D . n 
C 2 109 GLU 109 255 255 GLU GLU D . n 
C 2 110 ALA 110 256 256 ALA ALA D . n 
C 2 111 PHE 111 257 257 PHE PHE D . n 
C 2 112 TRP 112 258 258 TRP TRP D . n 
C 2 113 ASP 113 259 259 ASP ASP D . n 
C 2 114 ARG 114 260 260 ARG ARG D . n 
C 2 115 CYS 115 261 261 CYS CYS D . n 
C 2 116 LEU 116 262 262 LEU LEU D . n 
C 2 117 SER 117 263 263 SER SER D . n 
C 2 118 VAL 118 264 264 VAL VAL D . n 
C 2 119 ILE 119 265 265 ILE ILE D . n 
C 2 120 ASN 120 266 266 ASN ASN D . n 
C 2 121 LEU 121 267 267 LEU LEU D . n 
C 2 122 MET 122 268 268 MET MET D . n 
C 2 123 SER 123 269 269 SER SER D . n 
C 2 124 SER 124 270 270 SER SER D . n 
C 2 125 LYS 125 271 271 LYS LYS D . n 
C 2 126 MET 126 272 272 MET MET D . n 
C 2 127 LEU 127 273 273 LEU LEU D . n 
C 2 128 GLN 128 274 274 GLN GLN D . n 
C 2 129 ILE 129 275 275 ILE ILE D . n 
C 2 130 ASN 130 276 276 ASN ASN D . n 
C 2 131 ALA 131 277 277 ALA ALA D . n 
C 2 132 ASP 132 278 278 ASP ASP D . n 
C 2 133 PRO 133 279 279 PRO PRO D . n 
C 2 134 HIS 134 280 280 HIS HIS D . n 
C 2 135 TYR 135 281 281 TYR TYR D . n 
C 2 136 PHE 136 282 282 PHE PHE D . n 
C 2 137 THR 137 283 283 THR THR D . n 
C 2 138 GLN 138 284 284 GLN GLN D . n 
C 2 139 VAL 139 285 285 VAL VAL D . n 
C 2 140 PHE 140 286 286 PHE PHE D . n 
C 2 141 SER 141 287 287 SER SER D . n 
C 2 142 ASP 142 288 288 ASP ASP D . n 
C 2 143 LEU 143 289 289 LEU LEU D . n 
C 2 144 LYS 144 290 290 LYS LYS D . n 
C 2 145 ASN 145 291 291 ASN ASN D . n 
C 2 146 GLU 146 292 292 GLU GLU D . n 
C 2 147 SER 147 293 293 SER SER D . n 
D 2 1   SER 1   147 147 SER SER E . n 
D 2 2   THR 2   148 148 THR THR E . n 
D 2 3   SER 3   149 149 SER SER E . n 
D 2 4   GLU 4   150 150 GLU GLU E . n 
D 2 5   LEU 5   151 151 LEU LEU E . n 
D 2 6   LEU 6   152 152 LEU LEU E . n 
D 2 7   ARG 7   153 153 ARG ARG E . n 
D 2 8   CYS 8   154 154 CYS CYS E . n 
D 2 9   LEU 9   155 155 LEU LEU E . n 
D 2 10  GLY 10  156 156 GLY GLY E . n 
D 2 11  GLU 11  157 157 GLU GLU E . n 
D 2 12  PHE 12  158 158 PHE PHE E . n 
D 2 13  LEU 13  159 159 LEU LEU E . n 
D 2 14  CYS 14  160 160 CYS CYS E . n 
D 2 15  ARG 15  161 161 ARG ARG E . n 
D 2 16  ARG 16  162 162 ARG ARG E . n 
D 2 17  CYS 17  163 163 CYS CYS E . n 
D 2 18  TYR 18  164 164 TYR TYR E . n 
D 2 19  ARG 19  165 165 ARG ARG E . n 
D 2 20  LEU 20  166 166 LEU LEU E . n 
D 2 21  LYS 21  167 167 LYS LYS E . n 
D 2 22  HIS 22  168 168 HIS HIS E . n 
D 2 23  LEU 23  169 169 LEU LEU E . n 
D 2 24  SER 24  170 170 SER SER E . n 
D 2 25  PRO 25  171 171 PRO PRO E . n 
D 2 26  THR 26  172 172 THR THR E . n 
D 2 27  ASP 27  173 173 ASP ASP E . n 
D 2 28  PRO 28  174 174 PRO PRO E . n 
D 2 29  VAL 29  175 175 VAL VAL E . n 
D 2 30  LEU 30  176 176 LEU LEU E . n 
D 2 31  TRP 31  177 177 TRP TRP E . n 
D 2 32  LEU 32  178 178 LEU LEU E . n 
D 2 33  ARG 33  179 179 ARG ARG E . n 
D 2 34  SER 34  180 180 SER SER E . n 
D 2 35  VAL 35  181 181 VAL VAL E . n 
D 2 36  ASP 36  182 182 ASP ASP E . n 
D 2 37  ARG 37  183 183 ARG ARG E . n 
D 2 38  SER 38  184 184 SER SER E . n 
D 2 39  LEU 39  185 185 LEU LEU E . n 
D 2 40  LEU 40  186 186 LEU LEU E . n 
D 2 41  LEU 41  187 187 LEU LEU E . n 
D 2 42  GLN 42  188 188 GLN GLN E . n 
D 2 43  GLY 43  189 189 GLY GLY E . n 
D 2 44  TRP 44  190 190 TRP TRP E . n 
D 2 45  GLN 45  191 191 GLN GLN E . n 
D 2 46  ASP 46  192 192 ASP ASP E . n 
D 2 47  GLN 47  193 193 GLN GLN E . n 
D 2 48  GLY 48  194 194 GLY GLY E . n 
D 2 49  PHE 49  195 195 PHE PHE E . n 
D 2 50  ILE 50  196 196 ILE ILE E . n 
D 2 51  THR 51  197 197 THR THR E . n 
D 2 52  PRO 52  198 198 PRO PRO E . n 
D 2 53  ALA 53  199 199 ALA ALA E . n 
D 2 54  ASN 54  200 200 ASN ASN E . n 
D 2 55  VAL 55  201 201 VAL VAL E . n 
D 2 56  VAL 56  202 202 VAL VAL E . n 
D 2 57  PHE 57  203 203 PHE PHE E . n 
D 2 58  LEU 58  204 204 LEU LEU E . n 
D 2 59  TYR 59  205 205 TYR TYR E . n 
D 2 60  MET 60  206 206 MET MET E . n 
D 2 61  LEU 61  207 207 LEU LEU E . n 
D 2 62  CYS 62  208 208 CYS CYS E . n 
D 2 63  ARG 63  209 209 ARG ARG E . n 
D 2 64  ASP 64  210 210 ASP ASP E . n 
D 2 65  VAL 65  211 211 VAL VAL E . n 
D 2 66  ILE 66  212 212 ILE ILE E . n 
D 2 67  SER 67  213 213 SER SER E . n 
D 2 68  SER 68  214 214 SER SER E . n 
D 2 69  GLU 69  215 215 GLU GLU E . n 
D 2 70  VAL 70  216 216 VAL VAL E . n 
D 2 71  GLY 71  217 217 GLY GLY E . n 
D 2 72  SER 72  218 218 SER SER E . n 
D 2 73  ASP 73  219 219 ASP ASP E . n 
D 2 74  HIS 74  220 220 HIS HIS E . n 
D 2 75  GLU 75  221 221 GLU GLU E . n 
D 2 76  LEU 76  222 222 LEU LEU E . n 
D 2 77  GLN 77  223 223 GLN GLN E . n 
D 2 78  ALA 78  224 224 ALA ALA E . n 
D 2 79  VAL 79  225 225 VAL VAL E . n 
D 2 80  LEU 80  226 226 LEU LEU E . n 
D 2 81  LEU 81  227 227 LEU LEU E . n 
D 2 82  THR 82  228 228 THR THR E . n 
D 2 83  CYS 83  229 229 CYS CYS E . n 
D 2 84  LEU 84  230 230 LEU LEU E . n 
D 2 85  TYR 85  231 231 TYR TYR E . n 
D 2 86  LEU 86  232 232 LEU LEU E . n 
D 2 87  SER 87  233 233 SER SER E . n 
D 2 88  TYR 88  234 234 TYR TYR E . n 
D 2 89  SER 89  235 235 SER SER E . n 
D 2 90  TYR 90  236 236 TYR TYR E . n 
D 2 91  MET 91  237 237 MET MET E . n 
D 2 92  GLY 92  238 238 GLY GLY E . n 
D 2 93  ASN 93  239 239 ASN ASN E . n 
D 2 94  GLU 94  240 240 GLU GLU E . n 
D 2 95  ILE 95  241 241 ILE ILE E . n 
D 2 96  SER 96  242 242 SER SER E . n 
D 2 97  TYR 97  243 243 TYR TYR E . n 
D 2 98  PRO 98  244 244 PRO PRO E . n 
D 2 99  LEU 99  245 245 LEU LEU E . n 
D 2 100 LYS 100 246 246 LYS LYS E . n 
D 2 101 PRO 101 247 247 PRO PRO E . n 
D 2 102 PHE 102 248 248 PHE PHE E . n 
D 2 103 LEU 103 249 249 LEU LEU E . n 
D 2 104 VAL 104 250 250 VAL VAL E . n 
D 2 105 GLU 105 251 251 GLU GLU E . n 
D 2 106 SER 106 252 252 SER SER E . n 
D 2 107 CYS 107 253 253 CYS CYS E . n 
D 2 108 LYS 108 254 254 LYS LYS E . n 
D 2 109 GLU 109 255 255 GLU GLU E . n 
D 2 110 ALA 110 256 256 ALA ALA E . n 
D 2 111 PHE 111 257 257 PHE PHE E . n 
D 2 112 TRP 112 258 258 TRP TRP E . n 
D 2 113 ASP 113 259 259 ASP ASP E . n 
D 2 114 ARG 114 260 260 ARG ARG E . n 
D 2 115 CYS 115 261 261 CYS CYS E . n 
D 2 116 LEU 116 262 262 LEU LEU E . n 
D 2 117 SER 117 263 263 SER SER E . n 
D 2 118 VAL 118 264 264 VAL VAL E . n 
D 2 119 ILE 119 265 265 ILE ILE E . n 
D 2 120 ASN 120 266 266 ASN ASN E . n 
D 2 121 LEU 121 267 267 LEU LEU E . n 
D 2 122 MET 122 268 268 MET MET E . n 
D 2 123 SER 123 269 269 SER SER E . n 
D 2 124 SER 124 270 270 SER SER E . n 
D 2 125 LYS 125 271 271 LYS LYS E . n 
D 2 126 MET 126 272 272 MET MET E . n 
D 2 127 LEU 127 273 273 LEU LEU E . n 
D 2 128 GLN 128 274 274 GLN GLN E . n 
D 2 129 ILE 129 275 275 ILE ILE E . n 
D 2 130 ASN 130 276 276 ASN ASN E . n 
D 2 131 ALA 131 277 277 ALA ALA E . n 
D 2 132 ASP 132 278 278 ASP ASP E . n 
D 2 133 PRO 133 279 279 PRO PRO E . n 
D 2 134 HIS 134 280 280 HIS HIS E . n 
D 2 135 TYR 135 281 281 TYR TYR E . n 
D 2 136 PHE 136 282 282 PHE PHE E . n 
D 2 137 THR 137 283 283 THR THR E . n 
D 2 138 GLN 138 284 284 GLN GLN E . n 
D 2 139 VAL 139 285 285 VAL VAL E . n 
D 2 140 PHE 140 286 286 PHE PHE E . n 
D 2 141 SER 141 287 287 SER SER E . n 
D 2 142 ASP 142 288 288 ASP ASP E . n 
D 2 143 LEU 143 289 289 LEU LEU E . n 
D 2 144 LYS 144 290 290 LYS LYS E . n 
D 2 145 ASN 145 291 291 ASN ASN E . n 
D 2 146 GLU 146 292 292 GLU GLU E . n 
D 2 147 SER 147 293 293 SER SER E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  2001 2001 HOH HOH A . 
E 3 HOH 2  2002 2002 HOH HOH A . 
E 3 HOH 3  2003 2003 HOH HOH A . 
E 3 HOH 4  2004 2004 HOH HOH A . 
E 3 HOH 5  2005 2005 HOH HOH A . 
E 3 HOH 6  2006 2006 HOH HOH A . 
E 3 HOH 7  2007 2007 HOH HOH A . 
E 3 HOH 8  2008 2008 HOH HOH A . 
E 3 HOH 9  2009 2009 HOH HOH A . 
E 3 HOH 10 2010 2010 HOH HOH A . 
E 3 HOH 11 2011 2011 HOH HOH A . 
E 3 HOH 12 2012 2012 HOH HOH A . 
E 3 HOH 13 2013 2013 HOH HOH A . 
E 3 HOH 14 2014 2014 HOH HOH A . 
E 3 HOH 15 2015 2015 HOH HOH A . 
E 3 HOH 16 2016 2016 HOH HOH A . 
E 3 HOH 17 2017 2017 HOH HOH A . 
E 3 HOH 18 2018 2018 HOH HOH A . 
E 3 HOH 19 2019 2019 HOH HOH A . 
E 3 HOH 20 2020 2020 HOH HOH A . 
E 3 HOH 21 2021 2021 HOH HOH A . 
E 3 HOH 22 2022 2022 HOH HOH A . 
E 3 HOH 23 2023 2023 HOH HOH A . 
E 3 HOH 24 2024 2024 HOH HOH A . 
E 3 HOH 25 2025 2025 HOH HOH A . 
E 3 HOH 26 2026 2026 HOH HOH A . 
E 3 HOH 27 2027 2027 HOH HOH A . 
E 3 HOH 28 2028 2028 HOH HOH A . 
F 3 HOH 1  2001 2001 HOH HOH B . 
F 3 HOH 2  2002 2002 HOH HOH B . 
F 3 HOH 3  2003 2003 HOH HOH B . 
F 3 HOH 4  2004 2004 HOH HOH B . 
F 3 HOH 5  2005 2005 HOH HOH B . 
F 3 HOH 6  2006 2006 HOH HOH B . 
F 3 HOH 7  2007 2007 HOH HOH B . 
F 3 HOH 8  2008 2008 HOH HOH B . 
F 3 HOH 9  2009 2009 HOH HOH B . 
F 3 HOH 10 2010 2010 HOH HOH B . 
F 3 HOH 11 2011 2011 HOH HOH B . 
F 3 HOH 12 2012 2012 HOH HOH B . 
F 3 HOH 13 2013 2013 HOH HOH B . 
F 3 HOH 14 2014 2014 HOH HOH B . 
F 3 HOH 15 2015 2015 HOH HOH B . 
F 3 HOH 16 2016 2016 HOH HOH B . 
F 3 HOH 17 2017 2017 HOH HOH B . 
F 3 HOH 18 2018 2018 HOH HOH B . 
F 3 HOH 19 2019 2019 HOH HOH B . 
F 3 HOH 20 2020 2020 HOH HOH B . 
F 3 HOH 21 2021 2021 HOH HOH B . 
G 3 HOH 1  2001 2001 HOH HOH D . 
G 3 HOH 2  2002 2002 HOH HOH D . 
G 3 HOH 3  2003 2003 HOH HOH D . 
G 3 HOH 4  2004 2004 HOH HOH D . 
G 3 HOH 5  2005 2005 HOH HOH D . 
G 3 HOH 6  2006 2006 HOH HOH D . 
G 3 HOH 7  2007 2007 HOH HOH D . 
G 3 HOH 8  2008 2008 HOH HOH D . 
G 3 HOH 9  2009 2009 HOH HOH D . 
H 3 HOH 1  2001 2001 HOH HOH E . 
H 3 HOH 2  2002 2002 HOH HOH E . 
H 3 HOH 3  2003 2003 HOH HOH E . 
H 3 HOH 4  2004 2004 HOH HOH E . 
H 3 HOH 5  2005 2005 HOH HOH E . 
H 3 HOH 6  2006 2006 HOH HOH E . 
H 3 HOH 7  2007 2007 HOH HOH E . 
H 3 HOH 8  2008 2008 HOH HOH E . 
H 3 HOH 9  2009 2009 HOH HOH E . 
H 3 HOH 10 2010 2010 HOH HOH E . 
H 3 HOH 11 2011 2011 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-14 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2019-05-08 
5 'Structure model' 2 1 2019-07-10 
6 'Structure model' 2 2 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
8 6 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site            
2 4 'Structure model' diffrn_source        
3 4 'Structure model' exptl_crystal_grow   
4 4 'Structure model' pdbx_database_proc   
5 4 'Structure model' pdbx_database_status 
6 4 'Structure model' struct_biol          
7 5 'Structure model' diffrn_source        
8 6 'Structure model' diffrn_source        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
2 4 'Structure model' '_exptl_crystal_grow.method'                  
3 4 'Structure model' '_exptl_crystal_grow.temp'                    
4 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
5 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
6 6 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
CNS       refinement       1.0 ? 1 ? ? ? ? 
DENZO     'data reduction' .   ? 2 ? ? ? ? 
SCALEPACK 'data scaling'   .   ? 3 ? ? ? ? 
AMoRE     phasing          .   ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A VAL 252 ? ? N  A PRO 253 ? ? CA A PRO 253 ? ? 129.89 119.30 10.59  1.50 Y 
2 1 C B TRP 227 ? ? N  B PRO 228 ? ? CA B PRO 228 ? ? 128.50 119.30 9.20   1.50 Y 
3 1 N E GLY 189 ? ? CA E GLY 189 ? ? C  E GLY 189 ? ? 93.64  113.10 -19.46 2.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 3   ? ? -66.49  29.13   
2  1 LEU A 7   ? ? -134.49 -147.36 
3  1 ARG A 24  ? ? 64.08   -39.57  
4  1 VAL A 30  ? ? -121.46 -162.30 
5  1 ARG A 34  ? ? 51.99   101.01  
6  1 SER A 93  ? ? -49.94  -73.25  
7  1 CYS A 94  ? ? -79.38  -168.81 
8  1 ASN A 121 ? ? 70.38   44.55   
9  1 ASP A 126 ? ? -154.28 47.89   
10 1 ASN A 137 ? ? -63.26  5.28    
11 1 ASP A 144 ? ? 53.14   75.93   
12 1 PRO A 154 ? ? -57.47  92.78   
13 1 TYR A 158 ? ? -101.66 -120.77 
14 1 GLU A 161 ? ? -94.00  55.58   
15 1 VAL A 163 ? ? 67.70   126.90  
16 1 SER A 180 ? ? -117.53 -164.11 
17 1 ALA A 196 ? ? -84.00  31.12   
18 1 ALA A 198 ? ? -56.73  7.95    
19 1 THR A 245 ? ? -68.65  36.78   
20 1 THR A 246 ? ? -50.16  -5.76   
21 1 VAL A 252 ? ? -165.20 72.33   
22 1 LYS A 254 ? ? -76.05  43.76   
23 1 ASN A 256 ? ? -61.32  -177.12 
24 1 LEU A 267 ? ? -93.52  40.68   
25 1 LYS B 6   ? ? -46.12  157.42  
26 1 LEU B 7   ? ? -146.51 -144.25 
27 1 ARG B 24  ? ? 50.16   -29.68  
28 1 HIS B 27  ? ? 41.69   29.80   
29 1 SER B 93  ? ? -56.16  -82.43  
30 1 ASN B 95  ? ? -88.64  46.18   
31 1 ASN B 121 ? ? 75.36   44.48   
32 1 ARG B 125 ? ? 59.20   10.17   
33 1 ASP B 126 ? ? -141.99 40.37   
34 1 ASP B 144 ? ? 52.72   73.32   
35 1 PRO B 154 ? ? -48.99  99.45   
36 1 TYR B 158 ? ? -92.79  -130.33 
37 1 GLU B 161 ? ? -90.03  55.65   
38 1 VAL B 163 ? ? 72.68   133.70  
39 1 SER B 180 ? ? -111.63 -160.76 
40 1 ASN B 197 ? ? -68.56  -105.87 
41 1 TRP B 227 ? ? -155.83 71.82   
42 1 THR B 245 ? ? -65.63  27.47   
43 1 THR B 246 ? ? -56.28  21.73   
44 1 LEU B 248 ? ? -23.27  -14.72  
45 1 VAL B 252 ? ? -154.75 63.79   
46 1 LYS B 254 ? ? -64.81  34.10   
47 1 LEU B 267 ? ? -91.94  34.42   
48 1 TYR B 285 ? ? -38.39  -36.33  
49 1 THR D 148 ? ? -41.18  -92.01  
50 1 SER D 149 ? ? -14.67  -68.17  
51 1 CYS D 163 ? ? -94.32  44.37   
52 1 ARG D 165 ? ? -62.53  6.36    
53 1 LYS D 167 ? ? -72.45  32.98   
54 1 LEU D 186 ? ? -80.13  45.19   
55 1 LEU D 187 ? ? -94.47  40.46   
56 1 GLN D 188 ? ? 16.30   148.45  
57 1 ILE D 196 ? ? -48.35  107.12  
58 1 SER D 218 ? ? 97.93   135.35  
59 1 GLN E 188 ? ? 36.89   62.44   
60 1 TRP E 190 ? ? 89.04   102.89  
61 1 GLN E 191 ? ? 177.31  86.86   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 D SER 147 ? OG ? C SER 1 OG 
2 1 Y 1 E SER 147 ? OG ? D SER 1 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 11  ? A GLY 11  
3  1 Y 1 A GLU 12  ? A GLU 12  
4  1 Y 1 A GLY 13  ? A GLY 13  
5  1 Y 1 A THR 14  ? A THR 14  
6  1 Y 1 A ASP 39  ? A ASP 39  
7  1 Y 1 A ASP 40  ? A ASP 40  
8  1 Y 1 A ASP 41  ? A ASP 41  
9  1 Y 1 A GLU 42  ? A GLU 42  
10 1 Y 1 A ASP 288 ? A ASP 288 
11 1 Y 1 A PHE 289 ? A PHE 289 
12 1 Y 1 A CYS 290 ? A CYS 290 
13 1 Y 1 A PRO 291 ? A PRO 291 
14 1 Y 1 A PRO 292 ? A PRO 292 
15 1 Y 1 B MET 1   ? B MET 1   
16 1 Y 1 B GLY 11  ? B GLY 11  
17 1 Y 1 B GLU 12  ? B GLU 12  
18 1 Y 1 B GLY 13  ? B GLY 13  
19 1 Y 1 B THR 14  ? B THR 14  
20 1 Y 1 B ASP 39  ? B ASP 39  
21 1 Y 1 B ASP 40  ? B ASP 40  
22 1 Y 1 B ASP 41  ? B ASP 41  
23 1 Y 1 B GLU 42  ? B GLU 42  
24 1 Y 1 B ASP 288 ? B ASP 288 
25 1 Y 1 B PHE 289 ? B PHE 289 
26 1 Y 1 B CYS 290 ? B CYS 290 
27 1 Y 1 B PRO 291 ? B PRO 291 
28 1 Y 1 B PRO 292 ? B PRO 292 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#