data_1H8F
# 
_entry.id   1H8F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H8F         
PDBE  EBI-5868     
WWPDB D_1290005868 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H8F 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-02-05 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dajani, R.'  1 
'Pearl, L.H.' 2 
'Roe, S.M.'   3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Glycogen Synthase Kinase 3Beta . Structural Basis for Phosphate-Primed Substrate Specificity and Autoinhibition
;
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            105 
_citation.page_first                721 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11440715 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(01)00374-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dajani, R.'  1 
primary 'Fraser, E.'  2 
primary 'Roe, S.M.'   3 
primary 'Young, N.'   4 
primary 'Good, V.'    5 
primary 'Dale, T.C.'  6 
primary 'Pearl, L.H.' 7 
# 
_cell.entry_id           1H8F 
_cell.length_a           83.199 
_cell.length_b           86.060 
_cell.length_c           178.093 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H8F 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA'                     39799.746 2   2.7.1.37 ? ? ? 
2 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   2   ?        ? ? ? 
3 water       nat water                                                 18.015    161 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GSK3B 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGR
DTPALFNFTTQELSSNPPLATILIPPHARIQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGR
DTPALFNFTTQELSSNPPLATILIPPHARIQA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   THR n 
1 6   VAL n 
1 7   VAL n 
1 8   ALA n 
1 9   THR n 
1 10  PRO n 
1 11  GLY n 
1 12  GLN n 
1 13  GLY n 
1 14  PRO n 
1 15  ASP n 
1 16  ARG n 
1 17  PRO n 
1 18  GLN n 
1 19  GLU n 
1 20  VAL n 
1 21  SER n 
1 22  TYR n 
1 23  THR n 
1 24  ASP n 
1 25  THR n 
1 26  LYS n 
1 27  VAL n 
1 28  ILE n 
1 29  GLY n 
1 30  ASN n 
1 31  GLY n 
1 32  SER n 
1 33  PHE n 
1 34  GLY n 
1 35  VAL n 
1 36  VAL n 
1 37  TYR n 
1 38  GLN n 
1 39  ALA n 
1 40  LYS n 
1 41  LEU n 
1 42  CYS n 
1 43  ASP n 
1 44  SER n 
1 45  GLY n 
1 46  GLU n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  ILE n 
1 51  LYS n 
1 52  LYS n 
1 53  VAL n 
1 54  LEU n 
1 55  GLN n 
1 56  GLY n 
1 57  LYS n 
1 58  ALA n 
1 59  PHE n 
1 60  LYS n 
1 61  ASN n 
1 62  ARG n 
1 63  GLU n 
1 64  LEU n 
1 65  GLN n 
1 66  ILE n 
1 67  MET n 
1 68  ARG n 
1 69  LYS n 
1 70  LEU n 
1 71  ASP n 
1 72  HIS n 
1 73  CYS n 
1 74  ASN n 
1 75  ILE n 
1 76  VAL n 
1 77  ARG n 
1 78  LEU n 
1 79  ARG n 
1 80  TYR n 
1 81  PHE n 
1 82  PHE n 
1 83  TYR n 
1 84  SER n 
1 85  SER n 
1 86  GLY n 
1 87  GLU n 
1 88  LYS n 
1 89  LYS n 
1 90  ASP n 
1 91  GLU n 
1 92  VAL n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  VAL n 
1 98  LEU n 
1 99  ASP n 
1 100 TYR n 
1 101 VAL n 
1 102 PRO n 
1 103 GLU n 
1 104 THR n 
1 105 VAL n 
1 106 TYR n 
1 107 ARG n 
1 108 VAL n 
1 109 ALA n 
1 110 ARG n 
1 111 HIS n 
1 112 TYR n 
1 113 SER n 
1 114 ARG n 
1 115 ALA n 
1 116 LYS n 
1 117 GLN n 
1 118 THR n 
1 119 LEU n 
1 120 PRO n 
1 121 VAL n 
1 122 ILE n 
1 123 TYR n 
1 124 VAL n 
1 125 LYS n 
1 126 LEU n 
1 127 TYR n 
1 128 MET n 
1 129 TYR n 
1 130 GLN n 
1 131 LEU n 
1 132 PHE n 
1 133 ARG n 
1 134 SER n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 ILE n 
1 139 HIS n 
1 140 SER n 
1 141 PHE n 
1 142 GLY n 
1 143 ILE n 
1 144 CYS n 
1 145 HIS n 
1 146 ARG n 
1 147 ASP n 
1 148 ILE n 
1 149 LYS n 
1 150 PRO n 
1 151 GLN n 
1 152 ASN n 
1 153 LEU n 
1 154 LEU n 
1 155 LEU n 
1 156 ASP n 
1 157 PRO n 
1 158 ASP n 
1 159 THR n 
1 160 ALA n 
1 161 VAL n 
1 162 LEU n 
1 163 LYS n 
1 164 LEU n 
1 165 CYS n 
1 166 ASP n 
1 167 PHE n 
1 168 GLY n 
1 169 SER n 
1 170 ALA n 
1 171 LYS n 
1 172 GLN n 
1 173 LEU n 
1 174 VAL n 
1 175 ARG n 
1 176 GLY n 
1 177 GLU n 
1 178 PRO n 
1 179 ASN n 
1 180 VAL n 
1 181 SER n 
1 182 TYR n 
1 183 ILE n 
1 184 CYS n 
1 185 SER n 
1 186 ARG n 
1 187 TYR n 
1 188 TYR n 
1 189 ARG n 
1 190 ALA n 
1 191 PRO n 
1 192 GLU n 
1 193 LEU n 
1 194 ILE n 
1 195 PHE n 
1 196 GLY n 
1 197 ALA n 
1 198 THR n 
1 199 ASP n 
1 200 TYR n 
1 201 THR n 
1 202 SER n 
1 203 SER n 
1 204 ILE n 
1 205 ASP n 
1 206 VAL n 
1 207 TRP n 
1 208 SER n 
1 209 ALA n 
1 210 GLY n 
1 211 CYS n 
1 212 VAL n 
1 213 LEU n 
1 214 ALA n 
1 215 GLU n 
1 216 LEU n 
1 217 LEU n 
1 218 LEU n 
1 219 GLY n 
1 220 GLN n 
1 221 PRO n 
1 222 ILE n 
1 223 PHE n 
1 224 PRO n 
1 225 GLY n 
1 226 ASP n 
1 227 SER n 
1 228 GLY n 
1 229 VAL n 
1 230 ASP n 
1 231 GLN n 
1 232 LEU n 
1 233 VAL n 
1 234 GLU n 
1 235 ILE n 
1 236 ILE n 
1 237 LYS n 
1 238 VAL n 
1 239 LEU n 
1 240 GLY n 
1 241 THR n 
1 242 PRO n 
1 243 THR n 
1 244 ARG n 
1 245 GLU n 
1 246 GLN n 
1 247 ILE n 
1 248 ARG n 
1 249 GLU n 
1 250 MET n 
1 251 ASN n 
1 252 PRO n 
1 253 ASN n 
1 254 TYR n 
1 255 THR n 
1 256 GLU n 
1 257 PHE n 
1 258 ALA n 
1 259 PHE n 
1 260 PRO n 
1 261 GLN n 
1 262 ILE n 
1 263 LYS n 
1 264 ALA n 
1 265 HIS n 
1 266 PRO n 
1 267 TRP n 
1 268 THR n 
1 269 LYS n 
1 270 VAL n 
1 271 PHE n 
1 272 ARG n 
1 273 PRO n 
1 274 ARG n 
1 275 THR n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 ALA n 
1 280 ILE n 
1 281 ALA n 
1 282 LEU n 
1 283 CYS n 
1 284 SER n 
1 285 ARG n 
1 286 LEU n 
1 287 LEU n 
1 288 GLU n 
1 289 TYR n 
1 290 THR n 
1 291 PRO n 
1 292 THR n 
1 293 ALA n 
1 294 ARG n 
1 295 LEU n 
1 296 THR n 
1 297 PRO n 
1 298 LEU n 
1 299 GLU n 
1 300 ALA n 
1 301 CYS n 
1 302 ALA n 
1 303 HIS n 
1 304 SER n 
1 305 PHE n 
1 306 PHE n 
1 307 ASP n 
1 308 GLU n 
1 309 LEU n 
1 310 ARG n 
1 311 ASP n 
1 312 PRO n 
1 313 ASN n 
1 314 VAL n 
1 315 LYS n 
1 316 LEU n 
1 317 PRO n 
1 318 ASN n 
1 319 GLY n 
1 320 ARG n 
1 321 ASP n 
1 322 THR n 
1 323 PRO n 
1 324 ALA n 
1 325 LEU n 
1 326 PHE n 
1 327 ASN n 
1 328 PHE n 
1 329 THR n 
1 330 THR n 
1 331 GLN n 
1 332 GLU n 
1 333 LEU n 
1 334 SER n 
1 335 SER n 
1 336 ASN n 
1 337 PRO n 
1 338 PRO n 
1 339 LEU n 
1 340 ALA n 
1 341 THR n 
1 342 ILE n 
1 343 LEU n 
1 344 ILE n 
1 345 PRO n 
1 346 PRO n 
1 347 HIS n 
1 348 ALA n 
1 349 ARG n 
1 350 ILE n 
1 351 GLN n 
1 352 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      BACULOVIRUS 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10469 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PFASTBAC HTA' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KG3B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1H8F A 1 ? 352 ? P49841 35 ? 386 ? 35 386 
2 1 1H8F B 1 ? 352 ? P49841 35 ? 386 ? 35 386 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1H8F ALA A 258 ? UNP P49841 LYS 292 conflict 292 1 
1 1H8F LEU A 316 ? UNP P49841 HIS 350 conflict 350 2 
2 1H8F ALA B 258 ? UNP P49841 LYS 292 conflict 292 3 
2 1H8F LEU B 316 ? UNP P49841 HIS 350 conflict 350 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                              ?     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?     'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ?     'C3 H7 N O2 S'   121.158 
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                               ?     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                 ?     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                ?     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                            ?     'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                         ?     'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                               ?     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                ?     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                             ?     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                ?     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H8F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.2 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTAL WERE GROWN BY THE HANGING DROP METHOD. 1UL OF PROTEIN SOLUTION (4MG/ML IN 20MM HEPES-NAOH, 500MM NACL, 2MM MGCL2, 1MM DTT, PH 7.2) WAS MIXED WITH 1UL PRECIPITANT (6% PEG8000, 100MM TRIS-HCL, PH 7.5)
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2000-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.2 
_diffrn_source.pdbx_wavelength             1.488 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H8F 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.000 
_reflns.d_resolution_high            2.750 
_reflns.number_obs                   34002 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07400 
_reflns.pdbx_netI_over_sigmaI        8.4000 
_reflns.B_iso_Wilson_estimate        30.7 
_reflns.pdbx_redundancy              5.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.32300 
_reflns_shell.meanI_over_sigI_obs    2.300 
_reflns_shell.pdbx_redundancy        5.60 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H8F 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     32181 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1640575.05 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.12 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1601 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               58.5 
_refine.aniso_B[1][1]                            6.52 
_refine.aniso_B[2][2]                            12.83 
_refine.aniso_B[3][3]                            -19.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.34558 
_refine.solvent_model_param_bsol                 36.7 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1PME' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1H8F 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.45 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5595 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             161 
_refine_hist.number_atoms_total               5786 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        35.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.96  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             5050 
_refine_ls_shell.R_factor_R_work                  0.288 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.350 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             252 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 HEP.PAR           HEP.TOP     
# 
_struct.entry_id                  1H8F 
_struct.title                     'Glycogen Synthase Kinase 3 beta.' 
_struct.pdbx_descriptor           'GLYCOGEN SYNTHASE KINASE-3 BETA (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H8F 
_struct_keywords.pdbx_keywords   KINASE 
_struct_keywords.text            'KINASE, INSULIN PATHWAY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 61  ? LYS A 69  ? ASN A 95  LYS A 103 1 ? 9  
HELX_P HELX_P2  2  VAL A 105 ? ARG A 114 ? VAL A 139 ARG A 148 1 ? 10 
HELX_P HELX_P3  3  PRO A 120 ? PHE A 141 ? PRO A 154 PHE A 175 1 ? 22 
HELX_P HELX_P4  4  LYS A 149 ? GLN A 151 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 185 ? ARG A 189 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 190 ? PHE A 195 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 202 ? GLY A 219 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P8  8  SER A 227 ? GLY A 240 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 243 ? MET A 250 ? THR A 277 MET A 284 1 ? 8  
HELX_P HELX_P10 10 PRO A 266 ? VAL A 270 ? PRO A 300 VAL A 304 5 ? 5  
HELX_P HELX_P11 11 PRO A 276 ? LEU A 287 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P12 12 THR A 290 ? ARG A 294 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P13 13 THR A 296 ? ALA A 302 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P14 14 HIS A 303 ? ASP A 311 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P15 15 THR A 329 ? SER A 334 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P16 16 ASN A 336 ? PRO A 338 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P17 17 LEU A 339 ? ILE A 344 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P18 18 PRO A 345 ? ILE A 350 ? PRO A 379 ILE A 384 5 ? 6  
HELX_P HELX_P19 19 ASN B 61  ? LEU B 70  ? ASN B 95  LEU B 104 1 ? 10 
HELX_P HELX_P20 20 VAL B 105 ? ARG B 114 ? VAL B 139 ARG B 148 1 ? 10 
HELX_P HELX_P21 21 PRO B 120 ? PHE B 141 ? PRO B 154 PHE B 175 1 ? 22 
HELX_P HELX_P22 22 LYS B 149 ? GLN B 151 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P23 23 SER B 185 ? ARG B 189 ? SER B 219 ARG B 223 5 ? 5  
HELX_P HELX_P24 24 ALA B 190 ? PHE B 195 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P25 25 SER B 202 ? GLY B 219 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P26 26 SER B 227 ? GLY B 240 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P27 27 THR B 243 ? MET B 250 ? THR B 277 MET B 284 1 ? 8  
HELX_P HELX_P28 28 PRO B 266 ? VAL B 270 ? PRO B 300 VAL B 304 5 ? 5  
HELX_P HELX_P29 29 PRO B 276 ? LEU B 287 ? PRO B 310 LEU B 321 1 ? 12 
HELX_P HELX_P30 30 THR B 290 ? ARG B 294 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P31 31 THR B 296 ? ALA B 302 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P32 32 HIS B 303 ? ASP B 311 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P33 33 THR B 329 ? SER B 334 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P34 34 ASN B 336 ? PRO B 338 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P35 35 LEU B 339 ? ILE B 344 ? LEU B 373 ILE B 378 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 3 ? 
AC ? 2 ? 
BA ? 7 ? 
BB ? 3 ? 
BC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AA 2 GLN A 18  ? GLY A 31  ? GLN A 52  GLY A 65  
AA 3 GLY A 34  ? LEU A 41  ? GLY A 68  LEU A 75  
AA 4 LEU A 47  ? GLN A 55  ? LEU A 81  GLN A 89  
AA 5 VAL A 92  ? ASP A 99  ? VAL A 126 ASP A 133 
AA 6 LEU A 78  ? SER A 85  ? LEU A 112 SER A 119 
AA 7 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AB 1 GLU A 103 ? THR A 104 ? GLU A 137 THR A 138 
AB 2 LEU A 153 ? LEU A 155 ? LEU A 187 LEU A 189 
AB 3 LEU A 162 ? LEU A 164 ? LEU A 196 LEU A 198 
AC 1 ILE A 143 ? CYS A 144 ? ILE A 177 CYS A 178 
AC 2 LYS A 171 ? GLN A 172 ? LYS A 205 GLN A 206 
BA 1 THR B 4   ? PRO B 10  ? THR B 38  PRO B 44  
BA 2 GLN B 18  ? GLY B 31  ? GLN B 52  GLY B 65  
BA 3 GLY B 34  ? LEU B 41  ? GLY B 68  LEU B 75  
BA 4 LEU B 47  ? GLN B 55  ? LEU B 81  GLN B 89  
BA 5 VAL B 92  ? ASP B 99  ? VAL B 126 ASP B 133 
BA 6 LEU B 78  ? SER B 85  ? LEU B 112 SER B 119 
BA 7 THR B 4   ? PRO B 10  ? THR B 38  PRO B 44  
BB 1 GLU B 103 ? THR B 104 ? GLU B 137 THR B 138 
BB 2 LEU B 153 ? LEU B 155 ? LEU B 187 LEU B 189 
BB 3 LEU B 162 ? LEU B 164 ? LEU B 196 LEU B 198 
BC 1 ILE B 143 ? CYS B 144 ? ILE B 177 CYS B 178 
BC 2 LYS B 171 ? GLN B 172 ? LYS B 205 GLN B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 8   ? N ALA A 42  O GLN A 18  ? O GLN A 52  
AA 2 3 N GLY A 31  ? N GLY A 65  O GLY A 34  ? O GLY A 68  
AA 3 4 N ALA A 39  ? N ALA A 73  O VAL A 48  ? O VAL A 82  
AA 4 5 N GLN A 55  ? N GLN A 89  O VAL A 92  ? O VAL A 126 
AA 5 6 O VAL A 97  ? O VAL A 131 N ARG A 79  ? N ARG A 113 
AA 6 7 N PHE A 81  ? N PHE A 115 O THR A 9   ? O THR A 43  
AB 1 2 N GLU A 103 ? N GLU A 137 O LEU A 155 ? O LEU A 189 
AB 2 3 N LEU A 154 ? N LEU A 188 O LYS A 163 ? O LYS A 197 
AC 1 2 N CYS A 144 ? N CYS A 178 O LYS A 171 ? O LYS A 205 
BA 1 2 N ALA B 8   ? N ALA B 42  O GLN B 18  ? O GLN B 52  
BA 2 3 N GLY B 31  ? N GLY B 65  O GLY B 34  ? O GLY B 68  
BA 3 4 N ALA B 39  ? N ALA B 73  O VAL B 48  ? O VAL B 82  
BA 4 5 N GLN B 55  ? N GLN B 89  O VAL B 92  ? O VAL B 126 
BA 5 6 O VAL B 97  ? O VAL B 131 N ARG B 79  ? N ARG B 113 
BA 6 7 N PHE B 81  ? N PHE B 115 O THR B 9   ? O THR B 43  
BB 1 2 N GLU B 103 ? N GLU B 137 O LEU B 155 ? O LEU B 189 
BB 2 3 N LEU B 154 ? N LEU B 188 O LYS B 163 ? O LYS B 197 
BC 1 2 N CYS B 144 ? N CYS B 178 O LYS B 171 ? O LYS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EPE A 400' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EPE B 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 PHE A 33  ? PHE A 67   . ? 1_555 ? 
2  AC1 10 ARG A 62  ? ARG A 96   . ? 1_555 ? 
3  AC1 10 ARG A 146 ? ARG A 180  . ? 1_555 ? 
4  AC1 10 GLY A 168 ? GLY A 202  . ? 1_555 ? 
5  AC1 10 SER A 169 ? SER A 203  . ? 1_555 ? 
6  AC1 10 LYS A 171 ? LYS A 205  . ? 1_555 ? 
7  AC1 10 VAL A 180 ? VAL A 214  . ? 1_555 ? 
8  AC1 10 HOH E .   ? HOH A 2082 . ? 1_555 ? 
9  AC1 10 VAL B 229 ? VAL B 263  . ? 1_555 ? 
10 AC1 10 ALA B 258 ? ALA B 292  . ? 1_555 ? 
11 AC2 10 VAL A 229 ? VAL A 263  . ? 1_555 ? 
12 AC2 10 ALA A 258 ? ALA A 292  . ? 1_555 ? 
13 AC2 10 PHE A 259 ? PHE A 293  . ? 1_555 ? 
14 AC2 10 PHE B 33  ? PHE B 67   . ? 1_555 ? 
15 AC2 10 ARG B 62  ? ARG B 96   . ? 1_555 ? 
16 AC2 10 ARG B 146 ? ARG B 180  . ? 1_555 ? 
17 AC2 10 GLY B 168 ? GLY B 202  . ? 1_555 ? 
18 AC2 10 SER B 169 ? SER B 203  . ? 1_555 ? 
19 AC2 10 LYS B 171 ? LYS B 205  . ? 1_555 ? 
20 AC2 10 VAL B 180 ? VAL B 214  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1H8F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H8F 
_atom_sites.fract_transf_matrix[1][1]   0.012019 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011620 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005615 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 63.222 12.946  34.164  1.00 93.98  ? 35   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 61.753 12.966  33.889  1.00 94.13  ? 35   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 61.224 14.399  33.731  1.00 93.79  ? 35   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 61.485 15.264  34.572  1.00 94.70  ? 35   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 60.993 12.250  35.019  1.00 94.26  ? 35   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 61.236 12.851  36.283  1.00 93.92  ? 35   SER A OG  1 
ATOM   7    N N   . LYS A 1 2   ? 60.490 14.641  32.645  1.00 92.35  ? 36   LYS A N   1 
ATOM   8    C CA  . LYS A 1 2   ? 59.912 15.958  32.368  1.00 90.43  ? 36   LYS A CA  1 
ATOM   9    C C   . LYS A 1 2   ? 58.934 16.367  33.464  1.00 88.70  ? 36   LYS A C   1 
ATOM   10   O O   . LYS A 1 2   ? 57.961 15.656  33.739  1.00 89.10  ? 36   LYS A O   1 
ATOM   11   C CB  . LYS A 1 2   ? 59.164 15.953  31.026  1.00 90.87  ? 36   LYS A CB  1 
ATOM   12   C CG  . LYS A 1 2   ? 58.367 17.234  30.760  1.00 91.64  ? 36   LYS A CG  1 
ATOM   13   C CD  . LYS A 1 2   ? 57.416 17.113  29.564  1.00 92.59  ? 36   LYS A CD  1 
ATOM   14   C CE  . LYS A 1 2   ? 58.161 16.869  28.256  1.00 93.91  ? 36   LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 2   ? 57.240 16.782  27.089  1.00 93.85  ? 36   LYS A NZ  1 
ATOM   16   N N   . VAL A 1 3   ? 59.189 17.511  34.088  1.00 85.61  ? 37   VAL A N   1 
ATOM   17   C CA  . VAL A 1 3   ? 58.303 18.006  35.133  1.00 82.58  ? 37   VAL A CA  1 
ATOM   18   C C   . VAL A 1 3   ? 57.488 19.172  34.587  1.00 80.05  ? 37   VAL A C   1 
ATOM   19   O O   . VAL A 1 3   ? 58.030 20.234  34.300  1.00 79.75  ? 37   VAL A O   1 
ATOM   20   C CB  . VAL A 1 3   ? 59.097 18.466  36.373  1.00 82.04  ? 37   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 3   ? 58.156 19.096  37.392  1.00 82.47  ? 37   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 3   ? 59.816 17.279  36.995  1.00 81.78  ? 37   VAL A CG2 1 
ATOM   23   N N   . THR A 1 4   ? 56.185 18.962  34.427  1.00 76.93  ? 38   THR A N   1 
ATOM   24   C CA  . THR A 1 4   ? 55.322 20.013  33.910  1.00 74.12  ? 38   THR A CA  1 
ATOM   25   C C   . THR A 1 4   ? 54.756 20.860  35.043  1.00 72.64  ? 38   THR A C   1 
ATOM   26   O O   . THR A 1 4   ? 54.336 20.338  36.080  1.00 72.68  ? 38   THR A O   1 
ATOM   27   C CB  . THR A 1 4   ? 54.144 19.436  33.095  1.00 73.22  ? 38   THR A CB  1 
ATOM   28   O OG1 . THR A 1 4   ? 54.655 18.682  31.993  1.00 73.69  ? 38   THR A OG1 1 
ATOM   29   C CG2 . THR A 1 4   ? 53.258 20.558  32.566  1.00 70.77  ? 38   THR A CG2 1 
ATOM   30   N N   . THR A 1 5   ? 54.761 22.174  34.852  1.00 70.21  ? 39   THR A N   1 
ATOM   31   C CA  . THR A 1 5   ? 54.218 23.069  35.861  1.00 67.35  ? 39   THR A CA  1 
ATOM   32   C C   . THR A 1 5   ? 53.186 23.969  35.208  1.00 64.76  ? 39   THR A C   1 
ATOM   33   O O   . THR A 1 5   ? 53.430 24.524  34.139  1.00 63.96  ? 39   THR A O   1 
ATOM   34   C CB  . THR A 1 5   ? 55.311 23.935  36.502  1.00 67.50  ? 39   THR A CB  1 
ATOM   35   O OG1 . THR A 1 5   ? 56.298 23.096  37.119  1.00 67.17  ? 39   THR A OG1 1 
ATOM   36   C CG2 . THR A 1 5   ? 54.698 24.834  37.563  1.00 67.37  ? 39   THR A CG2 1 
ATOM   37   N N   . VAL A 1 6   ? 52.026 24.089  35.846  1.00 62.52  ? 40   VAL A N   1 
ATOM   38   C CA  . VAL A 1 6   ? 50.945 24.918  35.324  1.00 60.54  ? 40   VAL A CA  1 
ATOM   39   C C   . VAL A 1 6   ? 50.238 25.686  36.439  1.00 59.33  ? 40   VAL A C   1 
ATOM   40   O O   . VAL A 1 6   ? 50.450 25.424  37.623  1.00 58.66  ? 40   VAL A O   1 
ATOM   41   C CB  . VAL A 1 6   ? 49.888 24.057  34.569  1.00 61.32  ? 40   VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 6   ? 50.508 23.444  33.317  1.00 62.02  ? 40   VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 6   ? 49.359 22.958  35.476  1.00 58.73  ? 40   VAL A CG2 1 
ATOM   44   N N   . VAL A 1 7   ? 49.413 26.652  36.059  1.00 58.12  ? 41   VAL A N   1 
ATOM   45   C CA  . VAL A 1 7   ? 48.669 27.420  37.043  1.00 57.54  ? 41   VAL A CA  1 
ATOM   46   C C   . VAL A 1 7   ? 47.238 26.959  36.896  1.00 57.81  ? 41   VAL A C   1 
ATOM   47   O O   . VAL A 1 7   ? 46.570 27.278  35.910  1.00 57.67  ? 41   VAL A O   1 
ATOM   48   C CB  . VAL A 1 7   ? 48.761 28.944  36.791  1.00 57.55  ? 41   VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 7   ? 47.886 29.698  37.805  1.00 55.76  ? 41   VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 7   ? 50.214 29.399  36.911  1.00 53.51  ? 41   VAL A CG2 1 
ATOM   51   N N   . ALA A 1 8   ? 46.786 26.189  37.881  1.00 57.97  ? 42   ALA A N   1 
ATOM   52   C CA  . ALA A 1 8   ? 45.444 25.634  37.869  1.00 58.47  ? 42   ALA A CA  1 
ATOM   53   C C   . ALA A 1 8   ? 44.550 26.228  38.945  1.00 59.43  ? 42   ALA A C   1 
ATOM   54   O O   . ALA A 1 8   ? 45.021 26.665  39.996  1.00 59.41  ? 42   ALA A O   1 
ATOM   55   C CB  . ALA A 1 8   ? 45.517 24.121  38.040  1.00 57.32  ? 42   ALA A CB  1 
ATOM   56   N N   . THR A 1 9   ? 43.251 26.228  38.663  1.00 60.10  ? 43   THR A N   1 
ATOM   57   C CA  . THR A 1 9   ? 42.234 26.731  39.579  1.00 60.86  ? 43   THR A CA  1 
ATOM   58   C C   . THR A 1 9   ? 41.679 25.546  40.358  1.00 61.94  ? 43   THR A C   1 
ATOM   59   O O   . THR A 1 9   ? 41.275 24.552  39.763  1.00 63.08  ? 43   THR A O   1 
ATOM   60   C CB  . THR A 1 9   ? 41.055 27.341  38.817  1.00 60.69  ? 43   THR A CB  1 
ATOM   61   O OG1 . THR A 1 9   ? 41.528 28.330  37.896  1.00 62.86  ? 43   THR A OG1 1 
ATOM   62   C CG2 . THR A 1 9   ? 40.076 27.963  39.783  1.00 60.43  ? 43   THR A CG2 1 
ATOM   63   N N   . PRO A 1 10  ? 41.647 25.634  41.694  1.00 63.56  ? 44   PRO A N   1 
ATOM   64   C CA  . PRO A 1 10  ? 41.125 24.539  42.522  1.00 63.65  ? 44   PRO A CA  1 
ATOM   65   C C   . PRO A 1 10  ? 39.723 24.096  42.095  1.00 65.17  ? 44   PRO A C   1 
ATOM   66   O O   . PRO A 1 10  ? 38.965 24.874  41.505  1.00 65.34  ? 44   PRO A O   1 
ATOM   67   C CB  . PRO A 1 10  ? 41.141 25.137  43.922  1.00 63.91  ? 44   PRO A CB  1 
ATOM   68   C CG  . PRO A 1 10  ? 42.355 26.019  43.879  1.00 64.52  ? 44   PRO A CG  1 
ATOM   69   C CD  . PRO A 1 10  ? 42.188 26.716  42.535  1.00 63.49  ? 44   PRO A CD  1 
ATOM   70   N N   . GLY A 1 11  ? 39.389 22.845  42.403  1.00 67.11  ? 45   GLY A N   1 
ATOM   71   C CA  . GLY A 1 11  ? 38.088 22.295  42.056  1.00 70.15  ? 45   GLY A CA  1 
ATOM   72   C C   . GLY A 1 11  ? 36.909 22.994  42.698  1.00 72.99  ? 45   GLY A C   1 
ATOM   73   O O   . GLY A 1 11  ? 36.193 23.732  42.018  1.00 72.94  ? 45   GLY A O   1 
ATOM   74   N N   . GLN A 1 12  ? 36.674 22.764  43.990  1.00 76.80  ? 46   GLN A N   1 
ATOM   75   C CA  . GLN A 1 12  ? 35.554 23.455  44.620  1.00 81.81  ? 46   GLN A CA  1 
ATOM   76   C C   . GLN A 1 12  ? 35.951 24.699  45.414  1.00 83.12  ? 46   GLN A C   1 
ATOM   77   O O   . GLN A 1 12  ? 35.147 25.620  45.545  1.00 84.27  ? 46   GLN A O   1 
ATOM   78   C CB  . GLN A 1 12  ? 34.655 22.541  45.504  1.00 83.31  ? 46   GLN A CB  1 
ATOM   79   C CG  . GLN A 1 12  ? 35.056 21.113  45.823  1.00 87.03  ? 46   GLN A CG  1 
ATOM   80   C CD  . GLN A 1 12  ? 35.429 20.251  44.629  1.00 89.37  ? 46   GLN A CD  1 
ATOM   81   O OE1 . GLN A 1 12  ? 36.237 19.331  44.778  1.00 90.56  ? 46   GLN A OE1 1 
ATOM   82   N NE2 . GLN A 1 12  ? 34.847 20.522  43.454  1.00 89.66  ? 46   GLN A NE2 1 
ATOM   83   N N   . GLY A 1 13  ? 37.180 24.749  45.920  1.00 83.87  ? 47   GLY A N   1 
ATOM   84   C CA  . GLY A 1 13  ? 37.599 25.915  46.686  1.00 85.45  ? 47   GLY A CA  1 
ATOM   85   C C   . GLY A 1 13  ? 37.408 27.244  45.961  1.00 86.55  ? 47   GLY A C   1 
ATOM   86   O O   . GLY A 1 13  ? 36.913 27.262  44.829  1.00 87.41  ? 47   GLY A O   1 
ATOM   87   N N   . PRO A 1 14  ? 37.778 28.382  46.590  1.00 86.37  ? 48   PRO A N   1 
ATOM   88   C CA  . PRO A 1 14  ? 37.637 29.708  45.969  1.00 84.58  ? 48   PRO A CA  1 
ATOM   89   C C   . PRO A 1 14  ? 38.416 29.715  44.660  1.00 83.19  ? 48   PRO A C   1 
ATOM   90   O O   . PRO A 1 14  ? 39.404 28.995  44.530  1.00 83.13  ? 48   PRO A O   1 
ATOM   91   C CB  . PRO A 1 14  ? 38.256 30.641  47.002  1.00 85.14  ? 48   PRO A CB  1 
ATOM   92   C CG  . PRO A 1 14  ? 38.005 29.936  48.296  1.00 85.39  ? 48   PRO A CG  1 
ATOM   93   C CD  . PRO A 1 14  ? 38.319 28.499  47.956  1.00 86.10  ? 48   PRO A CD  1 
ATOM   94   N N   . ASP A 1 15  ? 37.984 30.531  43.704  1.00 81.65  ? 49   ASP A N   1 
ATOM   95   C CA  . ASP A 1 15  ? 38.638 30.601  42.398  1.00 80.56  ? 49   ASP A CA  1 
ATOM   96   C C   . ASP A 1 15  ? 39.997 31.315  42.456  1.00 78.64  ? 49   ASP A C   1 
ATOM   97   O O   . ASP A 1 15  ? 40.242 32.275  41.725  1.00 78.74  ? 49   ASP A O   1 
ATOM   98   C CB  . ASP A 1 15  ? 37.702 31.301  41.400  1.00 82.33  ? 49   ASP A CB  1 
ATOM   99   C CG  . ASP A 1 15  ? 38.082 31.040  39.952  1.00 83.72  ? 49   ASP A CG  1 
ATOM   100  O OD1 . ASP A 1 15  ? 39.251 31.333  39.587  1.00 84.31  ? 49   ASP A OD1 1 
ATOM   101  O OD2 . ASP A 1 15  ? 37.207 30.548  39.187  1.00 83.12  ? 49   ASP A OD2 1 
ATOM   102  N N   . ARG A 1 16  ? 40.875 30.817  43.324  1.00 76.70  ? 50   ARG A N   1 
ATOM   103  C CA  . ARG A 1 16  ? 42.210 31.373  43.524  1.00 75.78  ? 50   ARG A CA  1 
ATOM   104  C C   . ARG A 1 16  ? 43.313 30.456  42.982  1.00 74.51  ? 50   ARG A C   1 
ATOM   105  O O   . ARG A 1 16  ? 43.852 29.611  43.706  1.00 72.89  ? 50   ARG A O   1 
ATOM   106  C CB  . ARG A 1 16  ? 42.422 31.638  45.013  1.00 78.07  ? 50   ARG A CB  1 
ATOM   107  C CG  . ARG A 1 16  ? 41.639 32.853  45.532  1.00 82.43  ? 50   ARG A CG  1 
ATOM   108  C CD  . ARG A 1 16  ? 42.271 34.176  45.054  1.00 85.51  ? 50   ARG A CD  1 
ATOM   109  N NE  . ARG A 1 16  ? 41.446 35.347  45.352  1.00 87.44  ? 50   ARG A NE  1 
ATOM   110  C CZ  . ARG A 1 16  ? 40.668 35.964  44.464  1.00 88.21  ? 50   ARG A CZ  1 
ATOM   111  N NH1 . ARG A 1 16  ? 40.605 35.528  43.206  1.00 88.20  ? 50   ARG A NH1 1 
ATOM   112  N NH2 . ARG A 1 16  ? 39.950 37.019  44.835  1.00 87.54  ? 50   ARG A NH2 1 
ATOM   113  N N   . PRO A 1 17  ? 43.686 30.640  41.700  1.00 73.83  ? 51   PRO A N   1 
ATOM   114  C CA  . PRO A 1 17  ? 44.714 29.835  41.037  1.00 72.14  ? 51   PRO A CA  1 
ATOM   115  C C   . PRO A 1 17  ? 45.934 29.505  41.868  1.00 70.58  ? 51   PRO A C   1 
ATOM   116  O O   . PRO A 1 17  ? 46.335 30.277  42.727  1.00 70.58  ? 51   PRO A O   1 
ATOM   117  C CB  . PRO A 1 17  ? 45.035 30.653  39.793  1.00 73.44  ? 51   PRO A CB  1 
ATOM   118  C CG  . PRO A 1 17  ? 43.667 31.205  39.430  1.00 75.35  ? 51   PRO A CG  1 
ATOM   119  C CD  . PRO A 1 17  ? 43.195 31.698  40.793  1.00 74.90  ? 51   PRO A CD  1 
ATOM   120  N N   . GLN A 1 18  ? 46.503 28.330  41.604  1.00 70.35  ? 52   GLN A N   1 
ATOM   121  C CA  . GLN A 1 18  ? 47.687 27.839  42.302  1.00 69.31  ? 52   GLN A CA  1 
ATOM   122  C C   . GLN A 1 18  ? 48.651 27.192  41.323  1.00 68.27  ? 52   GLN A C   1 
ATOM   123  O O   . GLN A 1 18  ? 48.270 26.784  40.229  1.00 67.23  ? 52   GLN A O   1 
ATOM   124  C CB  . GLN A 1 18  ? 47.294 26.801  43.332  1.00 70.48  ? 52   GLN A CB  1 
ATOM   125  C CG  . GLN A 1 18  ? 45.965 27.099  43.966  1.00 74.68  ? 52   GLN A CG  1 
ATOM   126  C CD  . GLN A 1 18  ? 45.709 26.258  45.189  1.00 76.01  ? 52   GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 18  ? 45.898 25.034  45.165  1.00 76.30  ? 52   GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 18  ? 45.263 26.904  46.273  1.00 75.95  ? 52   GLN A NE2 1 
ATOM   129  N N   . GLU A 1 19  ? 49.907 27.093  41.730  1.00 68.47  ? 53   GLU A N   1 
ATOM   130  C CA  . GLU A 1 19  ? 50.919 26.496  40.882  1.00 68.59  ? 53   GLU A CA  1 
ATOM   131  C C   . GLU A 1 19  ? 50.952 25.001  41.133  1.00 67.55  ? 53   GLU A C   1 
ATOM   132  O O   . GLU A 1 19  ? 51.128 24.557  42.265  1.00 67.15  ? 53   GLU A O   1 
ATOM   133  C CB  . GLU A 1 19  ? 52.293 27.117  41.167  1.00 69.15  ? 53   GLU A CB  1 
ATOM   134  C CG  . GLU A 1 19  ? 52.948 27.714  39.932  1.00 71.83  ? 53   GLU A CG  1 
ATOM   135  C CD  . GLU A 1 19  ? 54.253 28.441  40.227  1.00 72.97  ? 53   GLU A CD  1 
ATOM   136  O OE1 . GLU A 1 19  ? 55.210 27.786  40.685  1.00 71.19  ? 53   GLU A OE1 1 
ATOM   137  O OE2 . GLU A 1 19  ? 54.313 29.668  39.995  1.00 74.46  ? 53   GLU A OE2 1 
ATOM   138  N N   . VAL A 1 20  ? 50.773 24.224  40.071  1.00 67.12  ? 54   VAL A N   1 
ATOM   139  C CA  . VAL A 1 20  ? 50.784 22.769  40.187  1.00 65.82  ? 54   VAL A CA  1 
ATOM   140  C C   . VAL A 1 20  ? 51.804 22.135  39.248  1.00 65.61  ? 54   VAL A C   1 
ATOM   141  O O   . VAL A 1 20  ? 51.855 22.453  38.057  1.00 65.12  ? 54   VAL A O   1 
ATOM   142  C CB  . VAL A 1 20  ? 49.399 22.171  39.879  1.00 64.67  ? 54   VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 20  ? 49.431 20.671  40.088  1.00 63.08  ? 54   VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 20  ? 48.345 22.817  40.764  1.00 63.47  ? 54   VAL A CG2 1 
ATOM   145  N N   . SER A 1 21  ? 52.609 21.234  39.805  1.00 65.91  ? 55   SER A N   1 
ATOM   146  C CA  . SER A 1 21  ? 53.653 20.535  39.061  1.00 66.55  ? 55   SER A CA  1 
ATOM   147  C C   . SER A 1 21  ? 53.445 19.032  39.128  1.00 67.44  ? 55   SER A C   1 
ATOM   148  O O   . SER A 1 21  ? 53.200 18.474  40.197  1.00 67.82  ? 55   SER A O   1 
ATOM   149  C CB  . SER A 1 21  ? 55.040 20.870  39.625  1.00 66.36  ? 55   SER A CB  1 
ATOM   150  O OG  . SER A 1 21  ? 55.387 22.221  39.385  1.00 65.52  ? 55   SER A OG  1 
ATOM   151  N N   . TYR A 1 22  ? 53.563 18.377  37.980  1.00 68.52  ? 56   TYR A N   1 
ATOM   152  C CA  . TYR A 1 22  ? 53.376 16.937  37.909  1.00 69.52  ? 56   TYR A CA  1 
ATOM   153  C C   . TYR A 1 22  ? 54.341 16.294  36.926  1.00 72.23  ? 56   TYR A C   1 
ATOM   154  O O   . TYR A 1 22  ? 54.801 16.932  35.974  1.00 72.43  ? 56   TYR A O   1 
ATOM   155  C CB  . TYR A 1 22  ? 51.937 16.623  37.508  1.00 66.61  ? 56   TYR A CB  1 
ATOM   156  C CG  . TYR A 1 22  ? 51.514 17.199  36.171  1.00 62.67  ? 56   TYR A CG  1 
ATOM   157  C CD1 . TYR A 1 22  ? 51.958 16.637  34.980  1.00 61.44  ? 56   TYR A CD1 1 
ATOM   158  C CD2 . TYR A 1 22  ? 50.624 18.272  36.100  1.00 60.98  ? 56   TYR A CD2 1 
ATOM   159  C CE1 . TYR A 1 22  ? 51.521 17.119  33.746  1.00 60.07  ? 56   TYR A CE1 1 
ATOM   160  C CE2 . TYR A 1 22  ? 50.180 18.763  34.871  1.00 59.50  ? 56   TYR A CE2 1 
ATOM   161  C CZ  . TYR A 1 22  ? 50.630 18.176  33.697  1.00 59.09  ? 56   TYR A CZ  1 
ATOM   162  O OH  . TYR A 1 22  ? 50.161 18.616  32.480  1.00 58.08  ? 56   TYR A OH  1 
ATOM   163  N N   . THR A 1 23  ? 54.633 15.020  37.158  1.00 75.10  ? 57   THR A N   1 
ATOM   164  C CA  . THR A 1 23  ? 55.557 14.283  36.309  1.00 77.93  ? 57   THR A CA  1 
ATOM   165  C C   . THR A 1 23  ? 55.033 12.877  36.019  1.00 79.04  ? 57   THR A C   1 
ATOM   166  O O   . THR A 1 23  ? 53.998 12.470  36.549  1.00 79.57  ? 57   THR A O   1 
ATOM   167  C CB  . THR A 1 23  ? 56.954 14.194  36.984  1.00 78.81  ? 57   THR A CB  1 
ATOM   168  O OG1 . THR A 1 23  ? 57.868 13.498  36.126  1.00 78.90  ? 57   THR A OG1 1 
ATOM   169  C CG2 . THR A 1 23  ? 56.854 13.476  38.331  1.00 78.52  ? 57   THR A CG2 1 
ATOM   170  N N   . ASP A 1 24  ? 55.758 12.146  35.175  1.00 80.56  ? 58   ASP A N   1 
ATOM   171  C CA  . ASP A 1 24  ? 55.395 10.780  34.784  1.00 81.97  ? 58   ASP A CA  1 
ATOM   172  C C   . ASP A 1 24  ? 54.086 10.764  33.997  1.00 81.64  ? 58   ASP A C   1 
ATOM   173  O O   . ASP A 1 24  ? 53.234 9.899   34.200  1.00 81.62  ? 58   ASP A O   1 
ATOM   174  C CB  . ASP A 1 24  ? 55.266 9.867   36.016  1.00 83.99  ? 58   ASP A CB  1 
ATOM   175  C CG  . ASP A 1 24  ? 56.519 9.863   36.883  1.00 86.28  ? 58   ASP A CG  1 
ATOM   176  O OD1 . ASP A 1 24  ? 57.637 9.713   36.331  1.00 87.36  ? 58   ASP A OD1 1 
ATOM   177  O OD2 . ASP A 1 24  ? 56.380 9.996   38.122  1.00 87.11  ? 58   ASP A OD2 1 
ATOM   178  N N   . THR A 1 25  ? 53.940 11.724  33.094  1.00 81.18  ? 59   THR A N   1 
ATOM   179  C CA  . THR A 1 25  ? 52.743 11.830  32.277  1.00 81.31  ? 59   THR A CA  1 
ATOM   180  C C   . THR A 1 25  ? 52.699 10.727  31.235  1.00 81.36  ? 59   THR A C   1 
ATOM   181  O O   . THR A 1 25  ? 53.588 10.629  30.394  1.00 81.34  ? 59   THR A O   1 
ATOM   182  C CB  . THR A 1 25  ? 52.689 13.186  31.553  1.00 81.37  ? 59   THR A CB  1 
ATOM   183  O OG1 . THR A 1 25  ? 52.656 14.240  32.520  1.00 82.80  ? 59   THR A OG1 1 
ATOM   184  C CG2 . THR A 1 25  ? 51.456 13.279  30.676  1.00 81.45  ? 59   THR A CG2 1 
ATOM   185  N N   . LYS A 1 26  ? 51.659 9.901   31.292  1.00 82.17  ? 60   LYS A N   1 
ATOM   186  C CA  . LYS A 1 26  ? 51.490 8.798   30.345  1.00 81.95  ? 60   LYS A CA  1 
ATOM   187  C C   . LYS A 1 26  ? 50.025 8.707   29.923  1.00 81.57  ? 60   LYS A C   1 
ATOM   188  O O   . LYS A 1 26  ? 49.130 9.066   30.686  1.00 81.97  ? 60   LYS A O   1 
ATOM   189  C CB  . LYS A 1 26  ? 51.932 7.477   30.989  1.00 82.08  ? 60   LYS A CB  1 
ATOM   190  C CG  . LYS A 1 26  ? 51.026 6.984   32.109  1.00 84.22  ? 60   LYS A CG  1 
ATOM   191  C CD  . LYS A 1 26  ? 51.639 5.815   32.874  1.00 85.73  ? 60   LYS A CD  1 
ATOM   192  C CE  . LYS A 1 26  ? 52.882 6.248   33.648  1.00 87.88  ? 60   LYS A CE  1 
ATOM   193  N NZ  . LYS A 1 26  ? 53.505 5.123   34.411  1.00 88.81  ? 60   LYS A NZ  1 
ATOM   194  N N   . VAL A 1 27  ? 49.778 8.236   28.708  1.00 81.04  ? 61   VAL A N   1 
ATOM   195  C CA  . VAL A 1 27  ? 48.407 8.112   28.229  1.00 80.71  ? 61   VAL A CA  1 
ATOM   196  C C   . VAL A 1 27  ? 47.772 6.840   28.784  1.00 81.98  ? 61   VAL A C   1 
ATOM   197  O O   . VAL A 1 27  ? 48.308 5.746   28.607  1.00 82.75  ? 61   VAL A O   1 
ATOM   198  C CB  . VAL A 1 27  ? 48.349 8.050   26.697  1.00 78.87  ? 61   VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 27  ? 46.904 8.071   26.240  1.00 78.51  ? 61   VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 27  ? 49.114 9.211   26.101  1.00 77.95  ? 61   VAL A CG2 1 
ATOM   201  N N   . ILE A 1 28  ? 46.638 6.976   29.464  1.00 81.83  ? 62   ILE A N   1 
ATOM   202  C CA  . ILE A 1 28  ? 45.970 5.808   30.021  1.00 81.71  ? 62   ILE A CA  1 
ATOM   203  C C   . ILE A 1 28  ? 44.572 5.663   29.453  1.00 82.30  ? 62   ILE A C   1 
ATOM   204  O O   . ILE A 1 28  ? 43.739 4.934   29.993  1.00 82.27  ? 62   ILE A O   1 
ATOM   205  C CB  . ILE A 1 28  ? 45.855 5.880   31.554  1.00 80.75  ? 62   ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 28  ? 45.029 7.102   31.961  1.00 80.79  ? 62   ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 28  ? 47.238 5.897   32.168  1.00 80.79  ? 62   ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 28  ? 44.674 7.148   33.444  1.00 79.70  ? 62   ILE A CD1 1 
ATOM   209  N N   . GLY A 1 29  ? 44.310 6.355   28.357  1.00 82.59  ? 63   GLY A N   1 
ATOM   210  C CA  . GLY A 1 29  ? 42.993 6.265   27.769  1.00 83.11  ? 63   GLY A CA  1 
ATOM   211  C C   . GLY A 1 29  ? 42.831 7.275   26.666  1.00 84.05  ? 63   GLY A C   1 
ATOM   212  O O   . GLY A 1 29  ? 43.478 8.321   26.661  1.00 84.43  ? 63   GLY A O   1 
ATOM   213  N N   . ASN A 1 30  ? 41.962 6.952   25.722  1.00 85.26  ? 64   ASN A N   1 
ATOM   214  C CA  . ASN A 1 30  ? 41.711 7.835   24.604  1.00 86.32  ? 64   ASN A CA  1 
ATOM   215  C C   . ASN A 1 30  ? 40.214 7.898   24.367  1.00 86.18  ? 64   ASN A C   1 
ATOM   216  O O   . ASN A 1 30  ? 39.698 7.239   23.470  1.00 86.21  ? 64   ASN A O   1 
ATOM   217  C CB  . ASN A 1 30  ? 42.417 7.315   23.356  1.00 86.99  ? 64   ASN A CB  1 
ATOM   218  C CG  . ASN A 1 30  ? 42.660 8.404   22.343  1.00 88.58  ? 64   ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 30  ? 41.725 9.077   21.898  1.00 89.64  ? 64   ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 30  ? 43.923 8.595   21.976  1.00 89.22  ? 64   ASN A ND2 1 
ATOM   221  N N   . GLY A 1 31  ? 39.525 8.699   25.176  1.00 86.60  ? 65   GLY A N   1 
ATOM   222  C CA  . GLY A 1 31  ? 38.081 8.827   25.057  1.00 86.11  ? 65   GLY A CA  1 
ATOM   223  C C   . GLY A 1 31  ? 37.554 9.625   23.875  1.00 85.39  ? 65   GLY A C   1 
ATOM   224  O O   . GLY A 1 31  ? 38.312 10.270  23.146  1.00 84.60  ? 65   GLY A O   1 
ATOM   225  N N   . SER A 1 32  ? 36.235 9.575   23.699  1.00 85.25  ? 66   SER A N   1 
ATOM   226  C CA  . SER A 1 32  ? 35.544 10.274  22.618  1.00 84.95  ? 66   SER A CA  1 
ATOM   227  C C   . SER A 1 32  ? 35.966 11.729  22.478  1.00 85.05  ? 66   SER A C   1 
ATOM   228  O O   . SER A 1 32  ? 36.472 12.148  21.431  1.00 85.19  ? 66   SER A O   1 
ATOM   229  C CB  . SER A 1 32  ? 34.023 10.230  22.832  1.00 84.23  ? 66   SER A CB  1 
ATOM   230  O OG  . SER A 1 32  ? 33.514 8.914   22.780  1.00 83.03  ? 66   SER A OG  1 
ATOM   231  N N   . PHE A 1 33  ? 35.753 12.500  23.539  1.00 85.01  ? 67   PHE A N   1 
ATOM   232  C CA  . PHE A 1 33  ? 36.080 13.917  23.522  1.00 84.84  ? 67   PHE A CA  1 
ATOM   233  C C   . PHE A 1 33  ? 37.551 14.293  23.758  1.00 83.47  ? 67   PHE A C   1 
ATOM   234  O O   . PHE A 1 33  ? 37.916 15.462  23.625  1.00 83.29  ? 67   PHE A O   1 
ATOM   235  C CB  . PHE A 1 33  ? 35.153 14.660  24.502  1.00 86.01  ? 67   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 33  ? 33.742 14.836  23.984  1.00 87.49  ? 67   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 33  ? 32.917 13.733  23.766  1.00 87.21  ? 67   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 33  ? 33.257 16.108  23.665  1.00 88.59  ? 67   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 33  ? 31.632 13.896  23.228  1.00 87.49  ? 67   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 33  ? 31.973 16.283  23.127  1.00 88.64  ? 67   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 33  ? 31.160 15.174  22.908  1.00 87.89  ? 67   PHE A CZ  1 
ATOM   242  N N   . GLY A 1 34  ? 38.396 13.315  24.078  1.00 81.09  ? 68   GLY A N   1 
ATOM   243  C CA  . GLY A 1 34  ? 39.799 13.625  24.290  1.00 78.99  ? 68   GLY A CA  1 
ATOM   244  C C   . GLY A 1 34  ? 40.652 12.536  24.914  1.00 77.66  ? 68   GLY A C   1 
ATOM   245  O O   . GLY A 1 34  ? 40.182 11.427  25.189  1.00 77.88  ? 68   GLY A O   1 
ATOM   246  N N   . VAL A 1 35  ? 41.919 12.859  25.147  1.00 75.27  ? 69   VAL A N   1 
ATOM   247  C CA  . VAL A 1 35  ? 42.846 11.910  25.740  1.00 74.00  ? 69   VAL A CA  1 
ATOM   248  C C   . VAL A 1 35  ? 42.892 12.057  27.250  1.00 72.11  ? 69   VAL A C   1 
ATOM   249  O O   . VAL A 1 35  ? 42.700 13.146  27.774  1.00 72.81  ? 69   VAL A O   1 
ATOM   250  C CB  . VAL A 1 35  ? 44.256 12.118  25.192  1.00 73.60  ? 69   VAL A CB  1 
ATOM   251  C CG1 . VAL A 1 35  ? 45.182 11.033  25.731  1.00 75.06  ? 69   VAL A CG1 1 
ATOM   252  C CG2 . VAL A 1 35  ? 44.223 12.108  23.679  1.00 73.48  ? 69   VAL A CG2 1 
ATOM   253  N N   . VAL A 1 36  ? 43.139 10.955  27.944  1.00 70.02  ? 70   VAL A N   1 
ATOM   254  C CA  . VAL A 1 36  ? 43.225 10.985  29.394  1.00 68.88  ? 70   VAL A CA  1 
ATOM   255  C C   . VAL A 1 36  ? 44.610 10.507  29.815  1.00 70.13  ? 70   VAL A C   1 
ATOM   256  O O   . VAL A 1 36  ? 45.021 9.381   29.497  1.00 70.61  ? 70   VAL A O   1 
ATOM   257  C CB  . VAL A 1 36  ? 42.155 10.084  30.046  1.00 67.11  ? 70   VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 36  ? 42.255 10.169  31.560  1.00 64.91  ? 70   VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 36  ? 40.782 10.505  29.584  1.00 64.60  ? 70   VAL A CG2 1 
ATOM   260  N N   . TYR A 1 37  ? 45.326 11.373  30.527  1.00 69.30  ? 71   TYR A N   1 
ATOM   261  C CA  . TYR A 1 37  ? 46.661 11.048  30.983  1.00 69.60  ? 71   TYR A CA  1 
ATOM   262  C C   . TYR A 1 37  ? 46.659 10.632  32.437  1.00 70.37  ? 71   TYR A C   1 
ATOM   263  O O   . TYR A 1 37  ? 45.622 10.622  33.091  1.00 69.70  ? 71   TYR A O   1 
ATOM   264  C CB  . TYR A 1 37  ? 47.597 12.242  30.800  1.00 68.90  ? 71   TYR A CB  1 
ATOM   265  C CG  . TYR A 1 37  ? 47.612 12.821  29.410  1.00 68.58  ? 71   TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 37  ? 46.563 13.619  28.953  1.00 68.14  ? 71   TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 37  ? 48.696 12.604  28.561  1.00 68.76  ? 71   TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 37  ? 46.597 14.194  27.683  1.00 68.70  ? 71   TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 37  ? 48.743 13.171  27.291  1.00 68.24  ? 71   TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 37  ? 47.693 13.968  26.859  1.00 68.96  ? 71   TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 37  ? 47.749 14.566  25.618  1.00 67.70  ? 71   TYR A OH  1 
ATOM   272  N N   . GLN A 1 38  ? 47.840 10.292  32.933  1.00 71.99  ? 72   GLN A N   1 
ATOM   273  C CA  . GLN A 1 38  ? 48.007 9.881   34.313  1.00 73.21  ? 72   GLN A CA  1 
ATOM   274  C C   . GLN A 1 38  ? 49.359 10.408  34.748  1.00 74.18  ? 72   GLN A C   1 
ATOM   275  O O   . GLN A 1 38  ? 50.393 9.940   34.280  1.00 75.59  ? 72   GLN A O   1 
ATOM   276  C CB  . GLN A 1 38  ? 47.976 8.358   34.417  1.00 73.42  ? 72   GLN A CB  1 
ATOM   277  C CG  . GLN A 1 38  ? 47.868 7.845   35.840  1.00 75.53  ? 72   GLN A CG  1 
ATOM   278  C CD  . GLN A 1 38  ? 49.173 7.310   36.390  1.00 77.10  ? 72   GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 38  ? 49.262 6.974   37.570  1.00 78.76  ? 72   GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 38  ? 50.190 7.214   35.537  1.00 77.86  ? 72   GLN A NE2 1 
ATOM   281  N N   . ALA A 1 39  ? 49.348 11.394  35.633  1.00 74.65  ? 73   ALA A N   1 
ATOM   282  C CA  . ALA A 1 39  ? 50.584 11.979  36.108  1.00 74.11  ? 73   ALA A CA  1 
ATOM   283  C C   . ALA A 1 39  ? 50.697 11.877  37.618  1.00 75.32  ? 73   ALA A C   1 
ATOM   284  O O   . ALA A 1 39  ? 49.758 11.458  38.305  1.00 74.87  ? 73   ALA A O   1 
ATOM   285  C CB  . ALA A 1 39  ? 50.665 13.429  35.671  1.00 73.72  ? 73   ALA A CB  1 
ATOM   286  N N   . LYS A 1 40  ? 51.861 12.267  38.125  1.00 76.73  ? 74   LYS A N   1 
ATOM   287  C CA  . LYS A 1 40  ? 52.135 12.232  39.550  1.00 78.28  ? 74   LYS A CA  1 
ATOM   288  C C   . LYS A 1 40  ? 52.495 13.633  40.043  1.00 79.12  ? 74   LYS A C   1 
ATOM   289  O O   . LYS A 1 40  ? 53.470 14.226  39.583  1.00 79.79  ? 74   LYS A O   1 
ATOM   290  C CB  . LYS A 1 40  ? 53.290 11.262  39.823  1.00 78.79  ? 74   LYS A CB  1 
ATOM   291  C CG  . LYS A 1 40  ? 53.664 11.127  41.286  1.00 80.96  ? 74   LYS A CG  1 
ATOM   292  C CD  . LYS A 1 40  ? 54.782 10.113  41.471  1.00 82.64  ? 74   LYS A CD  1 
ATOM   293  C CE  . LYS A 1 40  ? 55.211 10.014  42.937  1.00 85.30  ? 74   LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 40  ? 55.800 11.291  43.457  1.00 86.48  ? 74   LYS A NZ  1 
ATOM   295  N N   . LEU A 1 41  ? 51.696 14.155  40.969  1.00 79.72  ? 75   LEU A N   1 
ATOM   296  C CA  . LEU A 1 41  ? 51.933 15.475  41.530  1.00 80.96  ? 75   LEU A CA  1 
ATOM   297  C C   . LEU A 1 41  ? 53.280 15.481  42.254  1.00 83.30  ? 75   LEU A C   1 
ATOM   298  O O   . LEU A 1 41  ? 53.495 14.691  43.176  1.00 84.08  ? 75   LEU A O   1 
ATOM   299  C CB  . LEU A 1 41  ? 50.808 15.840  42.503  1.00 79.25  ? 75   LEU A CB  1 
ATOM   300  C CG  . LEU A 1 41  ? 49.393 15.917  41.929  1.00 77.16  ? 75   LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 41  ? 48.422 16.300  43.032  1.00 77.04  ? 75   LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 41  ? 49.344 16.935  40.808  1.00 75.96  ? 75   LEU A CD2 1 
ATOM   303  N N   . CYS A 1 42  ? 54.184 16.367  41.838  1.00 85.30  ? 76   CYS A N   1 
ATOM   304  C CA  . CYS A 1 42  ? 55.512 16.453  42.445  1.00 87.02  ? 76   CYS A CA  1 
ATOM   305  C C   . CYS A 1 42  ? 55.502 16.628  43.963  1.00 88.26  ? 76   CYS A C   1 
ATOM   306  O O   . CYS A 1 42  ? 56.370 16.099  44.659  1.00 88.81  ? 76   CYS A O   1 
ATOM   307  C CB  . CYS A 1 42  ? 56.308 17.588  41.798  1.00 86.95  ? 76   CYS A CB  1 
ATOM   308  S SG  . CYS A 1 42  ? 56.844 17.212  40.122  1.00 89.84  ? 76   CYS A SG  1 
ATOM   309  N N   . ASP A 1 43  ? 54.521 17.368  44.470  1.00 89.61  ? 77   ASP A N   1 
ATOM   310  C CA  . ASP A 1 43  ? 54.405 17.609  45.905  1.00 90.96  ? 77   ASP A CA  1 
ATOM   311  C C   . ASP A 1 43  ? 53.939 16.360  46.675  1.00 91.23  ? 77   ASP A C   1 
ATOM   312  O O   . ASP A 1 43  ? 54.763 15.557  47.133  1.00 90.76  ? 77   ASP A O   1 
ATOM   313  C CB  . ASP A 1 43  ? 53.457 18.799  46.169  1.00 92.03  ? 77   ASP A CB  1 
ATOM   314  C CG  . ASP A 1 43  ? 52.219 18.791  45.268  1.00 93.47  ? 77   ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 43  ? 52.370 18.929  44.030  1.00 94.61  ? 77   ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 43  ? 51.090 18.657  45.796  1.00 93.54  ? 77   ASP A OD2 1 
ATOM   317  N N   . SER A 1 44  ? 52.623 16.198  46.805  1.00 90.72  ? 78   SER A N   1 
ATOM   318  C CA  . SER A 1 44  ? 52.038 15.066  47.524  1.00 89.34  ? 78   SER A CA  1 
ATOM   319  C C   . SER A 1 44  ? 52.470 13.707  46.978  1.00 88.39  ? 78   SER A C   1 
ATOM   320  O O   . SER A 1 44  ? 52.443 12.705  47.696  1.00 88.40  ? 78   SER A O   1 
ATOM   321  C CB  . SER A 1 44  ? 50.505 15.164  47.495  1.00 89.52  ? 78   SER A CB  1 
ATOM   322  O OG  . SER A 1 44  ? 50.010 15.223  46.164  1.00 88.85  ? 78   SER A OG  1 
ATOM   323  N N   . GLY A 1 45  ? 52.873 13.675  45.712  1.00 87.02  ? 79   GLY A N   1 
ATOM   324  C CA  . GLY A 1 45  ? 53.282 12.419  45.107  1.00 85.00  ? 79   GLY A CA  1 
ATOM   325  C C   . GLY A 1 45  ? 52.084 11.596  44.648  1.00 84.04  ? 79   GLY A C   1 
ATOM   326  O O   . GLY A 1 45  ? 52.243 10.592  43.956  1.00 84.45  ? 79   GLY A O   1 
ATOM   327  N N   . GLU A 1 46  ? 50.883 12.028  45.033  1.00 82.09  ? 80   GLU A N   1 
ATOM   328  C CA  . GLU A 1 46  ? 49.635 11.349  44.677  1.00 78.96  ? 80   GLU A CA  1 
ATOM   329  C C   . GLU A 1 46  ? 49.451 11.235  43.167  1.00 76.26  ? 80   GLU A C   1 
ATOM   330  O O   . GLU A 1 46  ? 49.969 12.046  42.401  1.00 76.73  ? 80   GLU A O   1 
ATOM   331  C CB  . GLU A 1 46  ? 48.435 12.104  45.270  1.00 80.27  ? 80   GLU A CB  1 
ATOM   332  C CG  . GLU A 1 46  ? 48.428 12.191  46.797  1.00 82.45  ? 80   GLU A CG  1 
ATOM   333  C CD  . GLU A 1 46  ? 47.355 13.127  47.333  1.00 84.31  ? 80   GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 46  ? 47.473 14.360  47.135  1.00 84.90  ? 80   GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 46  ? 46.388 12.628  47.951  1.00 85.62  ? 80   GLU A OE2 1 
ATOM   336  N N   . LEU A 1 47  ? 48.706 10.224  42.737  1.00 72.81  ? 81   LEU A N   1 
ATOM   337  C CA  . LEU A 1 47  ? 48.450 10.022  41.311  1.00 68.13  ? 81   LEU A CA  1 
ATOM   338  C C   . LEU A 1 47  ? 47.144 10.692  40.909  1.00 65.01  ? 81   LEU A C   1 
ATOM   339  O O   . LEU A 1 47  ? 46.182 10.719  41.679  1.00 64.08  ? 81   LEU A O   1 
ATOM   340  C CB  . LEU A 1 47  ? 48.384 8.525   40.995  1.00 67.83  ? 81   LEU A CB  1 
ATOM   341  C CG  . LEU A 1 47  ? 49.706 7.767   41.171  1.00 68.33  ? 81   LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 47  ? 49.472 6.273   41.131  1.00 66.90  ? 81   LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 47  ? 50.675 8.194   40.079  1.00 67.94  ? 81   LEU A CD2 1 
ATOM   344  N N   . VAL A 1 48  ? 47.117 11.244  39.704  1.00 61.02  ? 82   VAL A N   1 
ATOM   345  C CA  . VAL A 1 48  ? 45.915 11.907  39.215  1.00 58.38  ? 82   VAL A CA  1 
ATOM   346  C C   . VAL A 1 48  ? 45.722 11.615  37.746  1.00 58.57  ? 82   VAL A C   1 
ATOM   347  O O   . VAL A 1 48  ? 46.633 11.161  37.061  1.00 59.24  ? 82   VAL A O   1 
ATOM   348  C CB  . VAL A 1 48  ? 45.968 13.455  39.365  1.00 57.26  ? 82   VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 48  ? 46.067 13.842  40.828  1.00 56.37  ? 82   VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 48  ? 47.131 14.016  38.561  1.00 54.84  ? 82   VAL A CG2 1 
ATOM   351  N N   . ALA A 1 49  ? 44.526 11.892  37.258  1.00 57.86  ? 83   ALA A N   1 
ATOM   352  C CA  . ALA A 1 49  ? 44.225 11.667  35.863  1.00 56.86  ? 83   ALA A CA  1 
ATOM   353  C C   . ALA A 1 49  ? 43.866 13.010  35.242  1.00 58.24  ? 83   ALA A C   1 
ATOM   354  O O   . ALA A 1 49  ? 43.074 13.776  35.802  1.00 60.11  ? 83   ALA A O   1 
ATOM   355  C CB  . ALA A 1 49  ? 43.068 10.702  35.744  1.00 54.84  ? 83   ALA A CB  1 
ATOM   356  N N   . ILE A 1 50  ? 44.465 13.307  34.096  1.00 57.24  ? 84   ILE A N   1 
ATOM   357  C CA  . ILE A 1 50  ? 44.181 14.556  33.411  1.00 57.17  ? 84   ILE A CA  1 
ATOM   358  C C   . ILE A 1 50  ? 43.342 14.260  32.172  1.00 58.56  ? 84   ILE A C   1 
ATOM   359  O O   . ILE A 1 50  ? 43.765 13.508  31.301  1.00 59.98  ? 84   ILE A O   1 
ATOM   360  C CB  . ILE A 1 50  ? 45.480 15.273  32.957  1.00 55.99  ? 84   ILE A CB  1 
ATOM   361  C CG1 . ILE A 1 50  ? 46.374 15.576  34.159  1.00 54.77  ? 84   ILE A CG1 1 
ATOM   362  C CG2 . ILE A 1 50  ? 45.129 16.575  32.232  1.00 54.66  ? 84   ILE A CG2 1 
ATOM   363  C CD1 . ILE A 1 50  ? 47.730 16.134  33.782  1.00 51.30  ? 84   ILE A CD1 1 
ATOM   364  N N   . LYS A 1 51  ? 42.152 14.844  32.092  1.00 58.57  ? 85   LYS A N   1 
ATOM   365  C CA  . LYS A 1 51  ? 41.292 14.626  30.937  1.00 58.26  ? 85   LYS A CA  1 
ATOM   366  C C   . LYS A 1 51  ? 41.257 15.871  30.057  1.00 59.30  ? 85   LYS A C   1 
ATOM   367  O O   . LYS A 1 51  ? 40.670 16.884  30.435  1.00 58.59  ? 85   LYS A O   1 
ATOM   368  C CB  . LYS A 1 51  ? 39.867 14.266  31.389  1.00 57.88  ? 85   LYS A CB  1 
ATOM   369  C CG  . LYS A 1 51  ? 38.914 14.038  30.224  1.00 59.63  ? 85   LYS A CG  1 
ATOM   370  C CD  . LYS A 1 51  ? 37.705 13.181  30.586  1.00 60.07  ? 85   LYS A CD  1 
ATOM   371  C CE  . LYS A 1 51  ? 36.637 13.961  31.322  1.00 60.36  ? 85   LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 51  ? 35.430 13.123  31.532  1.00 60.87  ? 85   LYS A NZ  1 
ATOM   373  N N   . LYS A 1 52  ? 41.887 15.806  28.887  1.00 60.79  ? 86   LYS A N   1 
ATOM   374  C CA  . LYS A 1 52  ? 41.895 16.958  27.984  1.00 63.12  ? 86   LYS A CA  1 
ATOM   375  C C   . LYS A 1 52  ? 40.703 16.927  27.045  1.00 64.88  ? 86   LYS A C   1 
ATOM   376  O O   . LYS A 1 52  ? 40.392 15.890  26.470  1.00 65.90  ? 86   LYS A O   1 
ATOM   377  C CB  . LYS A 1 52  ? 43.170 16.988  27.141  1.00 62.91  ? 86   LYS A CB  1 
ATOM   378  C CG  . LYS A 1 52  ? 44.444 17.023  27.940  1.00 64.81  ? 86   LYS A CG  1 
ATOM   379  C CD  . LYS A 1 52  ? 45.657 17.299  27.064  1.00 66.59  ? 86   LYS A CD  1 
ATOM   380  C CE  . LYS A 1 52  ? 45.550 18.644  26.353  1.00 67.84  ? 86   LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 52  ? 46.864 19.023  25.747  1.00 70.29  ? 86   LYS A NZ  1 
ATOM   382  N N   . VAL A 1 53  ? 40.040 18.065  26.885  1.00 66.02  ? 87   VAL A N   1 
ATOM   383  C CA  . VAL A 1 53  ? 38.894 18.137  25.992  1.00 68.84  ? 87   VAL A CA  1 
ATOM   384  C C   . VAL A 1 53  ? 38.927 19.440  25.219  1.00 71.18  ? 87   VAL A C   1 
ATOM   385  O O   . VAL A 1 53  ? 39.342 20.469  25.741  1.00 71.60  ? 87   VAL A O   1 
ATOM   386  C CB  . VAL A 1 53  ? 37.550 18.035  26.755  1.00 68.44  ? 87   VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 53  ? 37.404 16.653  27.384  1.00 68.11  ? 87   VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 53  ? 37.472 19.110  27.810  1.00 68.47  ? 87   VAL A CG2 1 
ATOM   389  N N   . LEU A 1 54  ? 38.499 19.380  23.965  1.00 74.47  ? 88   LEU A N   1 
ATOM   390  C CA  . LEU A 1 54  ? 38.472 20.544  23.096  1.00 77.88  ? 88   LEU A CA  1 
ATOM   391  C C   . LEU A 1 54  ? 37.432 21.538  23.608  1.00 80.44  ? 88   LEU A C   1 
ATOM   392  O O   . LEU A 1 54  ? 36.252 21.206  23.696  1.00 80.78  ? 88   LEU A O   1 
ATOM   393  C CB  . LEU A 1 54  ? 38.101 20.109  21.681  1.00 78.35  ? 88   LEU A CB  1 
ATOM   394  C CG  . LEU A 1 54  ? 38.249 21.171  20.598  1.00 79.76  ? 88   LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 54  ? 39.704 21.202  20.163  1.00 78.94  ? 88   LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 54  ? 37.336 20.858  19.409  1.00 79.73  ? 88   LEU A CD2 1 
ATOM   397  N N   . GLN A 1 55  ? 37.867 22.750  23.948  1.00 83.02  ? 89   GLN A N   1 
ATOM   398  C CA  . GLN A 1 55  ? 36.953 23.779  24.440  1.00 85.28  ? 89   GLN A CA  1 
ATOM   399  C C   . GLN A 1 55  ? 36.782 24.890  23.409  1.00 87.69  ? 89   GLN A C   1 
ATOM   400  O O   . GLN A 1 55  ? 37.747 25.574  23.046  1.00 87.97  ? 89   GLN A O   1 
ATOM   401  C CB  . GLN A 1 55  ? 37.464 24.373  25.750  1.00 85.74  ? 89   GLN A CB  1 
ATOM   402  C CG  . GLN A 1 55  ? 36.493 25.349  26.394  1.00 86.44  ? 89   GLN A CG  1 
ATOM   403  C CD  . GLN A 1 55  ? 35.076 24.797  26.449  1.00 86.99  ? 89   GLN A CD  1 
ATOM   404  O OE1 . GLN A 1 55  ? 34.865 23.643  26.824  1.00 86.75  ? 89   GLN A OE1 1 
ATOM   405  N NE2 . GLN A 1 55  ? 34.097 25.622  26.080  1.00 87.10  ? 89   GLN A NE2 1 
ATOM   406  N N   . GLY A 1 56  ? 35.544 25.075  22.958  1.00 89.81  ? 90   GLY A N   1 
ATOM   407  C CA  . GLY A 1 56  ? 35.250 26.083  21.948  1.00 92.57  ? 90   GLY A CA  1 
ATOM   408  C C   . GLY A 1 56  ? 35.124 27.529  22.400  1.00 93.99  ? 90   GLY A C   1 
ATOM   409  O O   . GLY A 1 56  ? 35.029 28.431  21.562  1.00 94.42  ? 90   GLY A O   1 
ATOM   410  N N   . LYS A 1 57  ? 35.116 27.753  23.713  1.00 94.89  ? 91   LYS A N   1 
ATOM   411  C CA  . LYS A 1 57  ? 35.004 29.101  24.271  1.00 95.95  ? 91   LYS A CA  1 
ATOM   412  C C   . LYS A 1 57  ? 33.693 29.805  23.918  1.00 95.93  ? 91   LYS A C   1 
ATOM   413  O O   . LYS A 1 57  ? 33.278 30.741  24.612  1.00 95.88  ? 91   LYS A O   1 
ATOM   414  C CB  . LYS A 1 57  ? 36.194 29.955  23.820  1.00 96.51  ? 91   LYS A CB  1 
ATOM   415  C CG  . LYS A 1 57  ? 37.495 29.576  24.507  1.00 97.41  ? 91   LYS A CG  1 
ATOM   416  C CD  . LYS A 1 57  ? 37.360 29.755  26.013  1.00 96.87  ? 91   LYS A CD  1 
ATOM   417  C CE  . LYS A 1 57  ? 38.614 29.318  26.742  1.00 96.97  ? 91   LYS A CE  1 
ATOM   418  N NZ  . LYS A 1 57  ? 38.482 29.572  28.201  1.00 96.77  ? 91   LYS A NZ  1 
ATOM   419  N N   . ALA A 1 58  ? 33.047 29.350  22.844  1.00 95.32  ? 92   ALA A N   1 
ATOM   420  C CA  . ALA A 1 58  ? 31.777 29.912  22.397  1.00 94.76  ? 92   ALA A CA  1 
ATOM   421  C C   . ALA A 1 58  ? 30.689 29.574  23.411  1.00 94.48  ? 92   ALA A C   1 
ATOM   422  O O   . ALA A 1 58  ? 29.584 30.118  23.358  1.00 94.07  ? 92   ALA A O   1 
ATOM   423  C CB  . ALA A 1 58  ? 31.409 29.348  21.029  1.00 95.09  ? 92   ALA A CB  1 
ATOM   424  N N   . PHE A 1 59  ? 31.014 28.660  24.325  1.00 93.93  ? 93   PHE A N   1 
ATOM   425  C CA  . PHE A 1 59  ? 30.094 28.226  25.378  1.00 92.81  ? 93   PHE A CA  1 
ATOM   426  C C   . PHE A 1 59  ? 30.841 27.934  26.685  1.00 89.95  ? 93   PHE A C   1 
ATOM   427  O O   . PHE A 1 59  ? 32.071 28.049  26.768  1.00 89.50  ? 93   PHE A O   1 
ATOM   428  C CB  . PHE A 1 59  ? 29.329 26.948  24.970  1.00 96.19  ? 93   PHE A CB  1 
ATOM   429  C CG  . PHE A 1 59  ? 28.308 27.151  23.869  1.00 100.18 ? 93   PHE A CG  1 
ATOM   430  C CD1 . PHE A 1 59  ? 28.705 27.270  22.533  1.00 101.51 ? 93   PHE A CD1 1 
ATOM   431  C CD2 . PHE A 1 59  ? 26.942 27.199  24.167  1.00 101.10 ? 93   PHE A CD2 1 
ATOM   432  C CE1 . PHE A 1 59  ? 27.760 27.434  21.512  1.00 101.91 ? 93   PHE A CE1 1 
ATOM   433  C CE2 . PHE A 1 59  ? 25.989 27.362  23.153  1.00 101.56 ? 93   PHE A CE2 1 
ATOM   434  C CZ  . PHE A 1 59  ? 26.400 27.478  21.822  1.00 101.68 ? 93   PHE A CZ  1 
ATOM   435  N N   . LYS A 1 60  ? 30.068 27.560  27.701  1.00 85.91  ? 94   LYS A N   1 
ATOM   436  C CA  . LYS A 1 60  ? 30.582 27.196  29.019  1.00 81.12  ? 94   LYS A CA  1 
ATOM   437  C C   . LYS A 1 60  ? 30.600 25.674  29.051  1.00 76.59  ? 94   LYS A C   1 
ATOM   438  O O   . LYS A 1 60  ? 29.603 25.038  28.702  1.00 75.57  ? 94   LYS A O   1 
ATOM   439  C CB  . LYS A 1 60  ? 29.638 27.708  30.110  1.00 83.44  ? 94   LYS A CB  1 
ATOM   440  C CG  . LYS A 1 60  ? 30.089 28.980  30.796  1.00 86.21  ? 94   LYS A CG  1 
ATOM   441  C CD  . LYS A 1 60  ? 31.331 28.719  31.630  1.00 87.47  ? 94   LYS A CD  1 
ATOM   442  C CE  . LYS A 1 60  ? 31.749 29.953  32.407  1.00 87.37  ? 94   LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 60  ? 32.865 29.631  33.337  1.00 88.11  ? 94   LYS A NZ  1 
ATOM   444  N N   . ASN A 1 61  ? 31.718 25.090  29.468  1.00 70.81  ? 95   ASN A N   1 
ATOM   445  C CA  . ASN A 1 61  ? 31.827 23.636  29.534  1.00 65.00  ? 95   ASN A CA  1 
ATOM   446  C C   . ASN A 1 61  ? 30.889 23.049  30.605  1.00 62.43  ? 95   ASN A C   1 
ATOM   447  O O   . ASN A 1 61  ? 31.106 23.225  31.805  1.00 60.81  ? 95   ASN A O   1 
ATOM   448  C CB  . ASN A 1 61  ? 33.275 23.244  29.816  1.00 63.62  ? 95   ASN A CB  1 
ATOM   449  C CG  . ASN A 1 61  ? 33.531 21.773  29.587  1.00 63.63  ? 95   ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 61  ? 33.055 20.922  30.337  1.00 63.95  ? 95   ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 61  ? 34.282 21.464  28.538  1.00 62.82  ? 95   ASN A ND2 1 
ATOM   452  N N   . ARG A 1 62  ? 29.852 22.349  30.151  1.00 59.05  ? 96   ARG A N   1 
ATOM   453  C CA  . ARG A 1 62  ? 28.853 21.751  31.027  1.00 56.04  ? 96   ARG A CA  1 
ATOM   454  C C   . ARG A 1 62  ? 29.371 20.738  32.051  1.00 55.53  ? 96   ARG A C   1 
ATOM   455  O O   . ARG A 1 62  ? 28.866 20.666  33.176  1.00 55.26  ? 96   ARG A O   1 
ATOM   456  C CB  . ARG A 1 62  ? 27.774 21.099  30.177  1.00 54.58  ? 96   ARG A CB  1 
ATOM   457  C CG  . ARG A 1 62  ? 26.741 20.356  30.965  1.00 55.65  ? 96   ARG A CG  1 
ATOM   458  C CD  . ARG A 1 62  ? 25.798 19.659  30.022  1.00 56.89  ? 96   ARG A CD  1 
ATOM   459  N NE  . ARG A 1 62  ? 24.783 20.562  29.507  1.00 59.22  ? 96   ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 62  ? 24.028 20.300  28.447  1.00 60.49  ? 96   ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 62  ? 24.193 19.160  27.797  1.00 59.65  ? 96   ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 62  ? 23.101 21.168  28.048  1.00 60.73  ? 96   ARG A NH2 1 
ATOM   463  N N   . GLU A 1 63  ? 30.364 19.947  31.663  1.00 54.40  ? 97   GLU A N   1 
ATOM   464  C CA  . GLU A 1 63  ? 30.932 18.949  32.558  1.00 53.35  ? 97   GLU A CA  1 
ATOM   465  C C   . GLU A 1 63  ? 31.634 19.684  33.686  1.00 52.50  ? 97   GLU A C   1 
ATOM   466  O O   . GLU A 1 63  ? 31.436 19.364  34.854  1.00 51.91  ? 97   GLU A O   1 
ATOM   467  C CB  . GLU A 1 63  ? 31.932 18.075  31.802  1.00 54.22  ? 97   GLU A CB  1 
ATOM   468  C CG  . GLU A 1 63  ? 32.301 16.778  32.498  1.00 55.04  ? 97   GLU A CG  1 
ATOM   469  C CD  . GLU A 1 63  ? 33.369 16.005  31.734  1.00 56.36  ? 97   GLU A CD  1 
ATOM   470  O OE1 . GLU A 1 63  ? 33.416 16.143  30.487  1.00 56.93  ? 97   GLU A OE1 1 
ATOM   471  O OE2 . GLU A 1 63  ? 34.143 15.255  32.376  1.00 54.45  ? 97   GLU A OE2 1 
ATOM   472  N N   . LEU A 1 64  ? 32.437 20.685  33.332  1.00 51.55  ? 98   LEU A N   1 
ATOM   473  C CA  . LEU A 1 64  ? 33.164 21.458  34.333  1.00 51.54  ? 98   LEU A CA  1 
ATOM   474  C C   . LEU A 1 64  ? 32.245 22.140  35.348  1.00 51.84  ? 98   LEU A C   1 
ATOM   475  O O   . LEU A 1 64  ? 32.501 22.098  36.543  1.00 51.51  ? 98   LEU A O   1 
ATOM   476  C CB  . LEU A 1 64  ? 34.037 22.516  33.660  1.00 50.04  ? 98   LEU A CB  1 
ATOM   477  C CG  . LEU A 1 64  ? 34.819 23.412  34.622  1.00 49.29  ? 98   LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 64  ? 35.764 22.574  35.469  1.00 47.76  ? 98   LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 64  ? 35.585 24.447  33.822  1.00 48.89  ? 98   LEU A CD2 1 
ATOM   480  N N   . GLN A 1 65  ? 31.172 22.762  34.873  1.00 52.50  ? 99   GLN A N   1 
ATOM   481  C CA  . GLN A 1 65  ? 30.253 23.450  35.761  1.00 53.18  ? 99   GLN A CA  1 
ATOM   482  C C   . GLN A 1 65  ? 29.583 22.513  36.753  1.00 53.47  ? 99   GLN A C   1 
ATOM   483  O O   . GLN A 1 65  ? 29.256 22.911  37.873  1.00 54.25  ? 99   GLN A O   1 
ATOM   484  C CB  . GLN A 1 65  ? 29.192 24.210  34.958  1.00 56.62  ? 99   GLN A CB  1 
ATOM   485  C CG  . GLN A 1 65  ? 29.770 25.324  34.074  1.00 64.73  ? 99   GLN A CG  1 
ATOM   486  C CD  . GLN A 1 65  ? 30.883 26.125  34.775  1.00 69.72  ? 99   GLN A CD  1 
ATOM   487  O OE1 . GLN A 1 65  ? 30.695 26.637  35.892  1.00 71.54  ? 99   GLN A OE1 1 
ATOM   488  N NE2 . GLN A 1 65  ? 32.046 26.236  34.117  1.00 70.78  ? 99   GLN A NE2 1 
ATOM   489  N N   . ILE A 1 66  ? 29.373 21.265  36.347  1.00 52.86  ? 100  ILE A N   1 
ATOM   490  C CA  . ILE A 1 66  ? 28.752 20.277  37.224  1.00 50.07  ? 100  ILE A CA  1 
ATOM   491  C C   . ILE A 1 66  ? 29.791 19.763  38.223  1.00 51.58  ? 100  ILE A C   1 
ATOM   492  O O   . ILE A 1 66  ? 29.524 19.685  39.421  1.00 51.55  ? 100  ILE A O   1 
ATOM   493  C CB  . ILE A 1 66  ? 28.146 19.111  36.389  1.00 46.65  ? 100  ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 66  ? 26.837 19.596  35.741  1.00 43.84  ? 100  ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 66  ? 27.915 17.888  37.264  1.00 44.18  ? 100  ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 66  ? 26.208 18.643  34.752  1.00 42.10  ? 100  ILE A CD1 1 
ATOM   497  N N   . MET A 1 67  ? 30.987 19.450  37.732  1.00 52.72  ? 101  MET A N   1 
ATOM   498  C CA  . MET A 1 67  ? 32.055 18.946  38.591  1.00 55.89  ? 101  MET A CA  1 
ATOM   499  C C   . MET A 1 67  ? 32.417 19.896  39.740  1.00 56.37  ? 101  MET A C   1 
ATOM   500  O O   . MET A 1 67  ? 32.725 19.460  40.855  1.00 56.47  ? 101  MET A O   1 
ATOM   501  C CB  . MET A 1 67  ? 33.303 18.673  37.754  1.00 58.59  ? 101  MET A CB  1 
ATOM   502  C CG  . MET A 1 67  ? 33.124 17.578  36.722  1.00 61.40  ? 101  MET A CG  1 
ATOM   503  S SD  . MET A 1 67  ? 33.749 16.012  37.295  1.00 66.13  ? 101  MET A SD  1 
ATOM   504  C CE  . MET A 1 67  ? 32.529 15.605  38.544  1.00 63.12  ? 101  MET A CE  1 
ATOM   505  N N   . ARG A 1 68  ? 32.383 21.195  39.467  1.00 56.70  ? 102  ARG A N   1 
ATOM   506  C CA  . ARG A 1 68  ? 32.726 22.190  40.474  1.00 56.74  ? 102  ARG A CA  1 
ATOM   507  C C   . ARG A 1 68  ? 31.682 22.288  41.572  1.00 55.75  ? 102  ARG A C   1 
ATOM   508  O O   . ARG A 1 68  ? 31.981 22.675  42.699  1.00 56.51  ? 102  ARG A O   1 
ATOM   509  C CB  . ARG A 1 68  ? 32.896 23.558  39.821  1.00 57.38  ? 102  ARG A CB  1 
ATOM   510  C CG  . ARG A 1 68  ? 33.969 23.606  38.772  1.00 60.06  ? 102  ARG A CG  1 
ATOM   511  C CD  . ARG A 1 68  ? 34.306 25.036  38.440  1.00 63.14  ? 102  ARG A CD  1 
ATOM   512  N NE  . ARG A 1 68  ? 34.950 25.693  39.576  1.00 67.41  ? 102  ARG A NE  1 
ATOM   513  C CZ  . ARG A 1 68  ? 35.311 26.974  39.588  1.00 69.69  ? 102  ARG A CZ  1 
ATOM   514  N NH1 . ARG A 1 68  ? 35.086 27.743  38.522  1.00 68.43  ? 102  ARG A NH1 1 
ATOM   515  N NH2 . ARG A 1 68  ? 35.905 27.486  40.663  1.00 70.20  ? 102  ARG A NH2 1 
ATOM   516  N N   . LYS A 1 69  ? 30.456 21.929  41.231  1.00 54.79  ? 103  LYS A N   1 
ATOM   517  C CA  . LYS A 1 69  ? 29.349 21.992  42.164  1.00 53.94  ? 103  LYS A CA  1 
ATOM   518  C C   . LYS A 1 69  ? 29.244 20.736  43.035  1.00 53.31  ? 103  LYS A C   1 
ATOM   519  O O   . LYS A 1 69  ? 28.400 20.667  43.919  1.00 52.69  ? 103  LYS A O   1 
ATOM   520  C CB  . LYS A 1 69  ? 28.057 22.189  41.367  1.00 54.32  ? 103  LYS A CB  1 
ATOM   521  C CG  . LYS A 1 69  ? 26.806 22.318  42.211  1.00 59.27  ? 103  LYS A CG  1 
ATOM   522  C CD  . LYS A 1 69  ? 25.550 22.267  41.364  1.00 60.11  ? 103  LYS A CD  1 
ATOM   523  C CE  . LYS A 1 69  ? 25.571 23.295  40.242  1.00 61.42  ? 103  LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 69  ? 24.342 23.158  39.414  1.00 64.28  ? 103  LYS A NZ  1 
ATOM   525  N N   . LEU A 1 70  ? 30.115 19.756  42.806  1.00 53.45  ? 104  LEU A N   1 
ATOM   526  C CA  . LEU A 1 70  ? 30.053 18.487  43.541  1.00 52.06  ? 104  LEU A CA  1 
ATOM   527  C C   . LEU A 1 70  ? 31.155 18.217  44.560  1.00 52.96  ? 104  LEU A C   1 
ATOM   528  O O   . LEU A 1 70  ? 32.339 18.463  44.306  1.00 53.10  ? 104  LEU A O   1 
ATOM   529  C CB  . LEU A 1 70  ? 30.017 17.321  42.544  1.00 49.85  ? 104  LEU A CB  1 
ATOM   530  C CG  . LEU A 1 70  ? 28.861 17.313  41.544  1.00 49.06  ? 104  LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 70  ? 28.970 16.095  40.646  1.00 50.04  ? 104  LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 70  ? 27.548 17.315  42.289  1.00 45.55  ? 104  LEU A CD2 1 
ATOM   533  N N   . ASP A 1 71  ? 30.761 17.691  45.717  1.00 52.36  ? 105  ASP A N   1 
ATOM   534  C CA  . ASP A 1 71  ? 31.726 17.367  46.760  1.00 52.31  ? 105  ASP A CA  1 
ATOM   535  C C   . ASP A 1 71  ? 31.156 16.205  47.565  1.00 51.03  ? 105  ASP A C   1 
ATOM   536  O O   . ASP A 1 71  ? 30.456 16.408  48.557  1.00 52.24  ? 105  ASP A O   1 
ATOM   537  C CB  . ASP A 1 71  ? 31.949 18.583  47.657  1.00 54.89  ? 105  ASP A CB  1 
ATOM   538  C CG  . ASP A 1 71  ? 32.938 18.314  48.778  1.00 57.82  ? 105  ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 71  ? 32.720 18.849  49.890  1.00 59.47  ? 105  ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 71  ? 33.927 17.582  48.551  1.00 58.66  ? 105  ASP A OD2 1 
ATOM   541  N N   . HIS A 1 72  ? 31.456 14.983  47.132  1.00 48.56  ? 106  HIS A N   1 
ATOM   542  C CA  . HIS A 1 72  ? 30.941 13.783  47.792  1.00 45.73  ? 106  HIS A CA  1 
ATOM   543  C C   . HIS A 1 72  ? 32.003 12.702  47.779  1.00 46.57  ? 106  HIS A C   1 
ATOM   544  O O   . HIS A 1 72  ? 32.731 12.540  46.800  1.00 47.48  ? 106  HIS A O   1 
ATOM   545  C CB  . HIS A 1 72  ? 29.698 13.289  47.055  1.00 43.79  ? 106  HIS A CB  1 
ATOM   546  C CG  . HIS A 1 72  ? 28.927 12.242  47.786  1.00 41.66  ? 106  HIS A CG  1 
ATOM   547  N ND1 . HIS A 1 72  ? 27.872 12.541  48.621  1.00 42.08  ? 106  HIS A ND1 1 
ATOM   548  C CD2 . HIS A 1 72  ? 29.049 10.893  47.806  1.00 40.58  ? 106  HIS A CD2 1 
ATOM   549  C CE1 . HIS A 1 72  ? 27.379 11.424  49.125  1.00 41.11  ? 106  HIS A CE1 1 
ATOM   550  N NE2 . HIS A 1 72  ? 28.076 10.409  48.646  1.00 41.41  ? 106  HIS A NE2 1 
ATOM   551  N N   . CYS A 1 73  ? 32.096 11.952  48.865  1.00 48.10  ? 107  CYS A N   1 
ATOM   552  C CA  . CYS A 1 73  ? 33.109 10.905  48.944  1.00 49.22  ? 107  CYS A CA  1 
ATOM   553  C C   . CYS A 1 73  ? 32.907 9.730   47.988  1.00 48.36  ? 107  CYS A C   1 
ATOM   554  O O   . CYS A 1 73  ? 33.817 8.920   47.802  1.00 49.98  ? 107  CYS A O   1 
ATOM   555  C CB  . CYS A 1 73  ? 33.254 10.430  50.395  1.00 51.02  ? 107  CYS A CB  1 
ATOM   556  S SG  . CYS A 1 73  ? 34.363 11.547  51.372  1.00 54.70  ? 107  CYS A SG  1 
ATOM   557  N N   . ASN A 1 74  ? 31.728 9.647   47.372  1.00 46.33  ? 108  ASN A N   1 
ATOM   558  C CA  . ASN A 1 74  ? 31.450 8.585   46.410  1.00 43.87  ? 108  ASN A CA  1 
ATOM   559  C C   . ASN A 1 74  ? 31.394 9.143   44.991  1.00 42.70  ? 108  ASN A C   1 
ATOM   560  O O   . ASN A 1 74  ? 30.783 8.560   44.099  1.00 42.88  ? 108  ASN A O   1 
ATOM   561  C CB  . ASN A 1 74  ? 30.138 7.878   46.746  1.00 43.97  ? 108  ASN A CB  1 
ATOM   562  C CG  . ASN A 1 74  ? 30.215 7.121   48.041  1.00 44.25  ? 108  ASN A CG  1 
ATOM   563  O OD1 . ASN A 1 74  ? 31.090 6.287   48.217  1.00 46.48  ? 108  ASN A OD1 1 
ATOM   564  N ND2 . ASN A 1 74  ? 29.297 7.401   48.959  1.00 45.85  ? 108  ASN A ND2 1 
ATOM   565  N N   . ILE A 1 75  ? 32.024 10.289  44.790  1.00 41.68  ? 109  ILE A N   1 
ATOM   566  C CA  . ILE A 1 75  ? 32.057 10.907  43.475  1.00 42.62  ? 109  ILE A CA  1 
ATOM   567  C C   . ILE A 1 75  ? 33.482 11.362  43.214  1.00 43.14  ? 109  ILE A C   1 
ATOM   568  O O   . ILE A 1 75  ? 34.093 11.979  44.074  1.00 44.51  ? 109  ILE A O   1 
ATOM   569  C CB  . ILE A 1 75  ? 31.095 12.102  43.397  1.00 41.90  ? 109  ILE A CB  1 
ATOM   570  C CG1 . ILE A 1 75  ? 29.662 11.596  43.531  1.00 41.25  ? 109  ILE A CG1 1 
ATOM   571  C CG2 . ILE A 1 75  ? 31.312 12.863  42.090  1.00 40.91  ? 109  ILE A CG2 1 
ATOM   572  C CD1 . ILE A 1 75  ? 28.609 12.619  43.277  1.00 42.60  ? 109  ILE A CD1 1 
ATOM   573  N N   . VAL A 1 76  ? 34.021 11.039  42.045  1.00 43.67  ? 110  VAL A N   1 
ATOM   574  C CA  . VAL A 1 76  ? 35.394 11.420  41.757  1.00 46.32  ? 110  VAL A CA  1 
ATOM   575  C C   . VAL A 1 76  ? 35.505 12.923  41.876  1.00 48.27  ? 110  VAL A C   1 
ATOM   576  O O   . VAL A 1 76  ? 34.660 13.654  41.358  1.00 49.51  ? 110  VAL A O   1 
ATOM   577  C CB  . VAL A 1 76  ? 35.855 10.952  40.353  1.00 45.17  ? 110  VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 76  ? 35.007 11.595  39.270  1.00 46.66  ? 110  VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 76  ? 37.309 11.292  40.168  1.00 44.58  ? 110  VAL A CG2 1 
ATOM   580  N N   . ARG A 1 77  ? 36.533 13.393  42.578  1.00 49.89  ? 111  ARG A N   1 
ATOM   581  C CA  . ARG A 1 77  ? 36.680 14.830  42.754  1.00 51.68  ? 111  ARG A CA  1 
ATOM   582  C C   . ARG A 1 77  ? 37.610 15.513  41.767  1.00 50.23  ? 111  ARG A C   1 
ATOM   583  O O   . ARG A 1 77  ? 38.646 14.974  41.354  1.00 49.21  ? 111  ARG A O   1 
ATOM   584  C CB  . ARG A 1 77  ? 37.121 15.159  44.187  1.00 56.38  ? 111  ARG A CB  1 
ATOM   585  C CG  . ARG A 1 77  ? 38.619 15.055  44.486  1.00 62.00  ? 111  ARG A CG  1 
ATOM   586  C CD  . ARG A 1 77  ? 38.896 15.541  45.913  1.00 66.76  ? 111  ARG A CD  1 
ATOM   587  N NE  . ARG A 1 77  ? 38.288 16.852  46.145  1.00 73.29  ? 111  ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 77  ? 38.127 17.418  47.343  1.00 77.89  ? 111  ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 77  ? 38.529 16.795  48.454  1.00 79.04  ? 111  ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 77  ? 37.556 18.618  47.438  1.00 79.62  ? 111  ARG A NH2 1 
ATOM   591  N N   . LEU A 1 78  ? 37.209 16.714  41.378  1.00 49.75  ? 112  LEU A N   1 
ATOM   592  C CA  . LEU A 1 78  ? 37.989 17.531  40.465  1.00 49.70  ? 112  LEU A CA  1 
ATOM   593  C C   . LEU A 1 78  ? 38.987 18.276  41.353  1.00 49.95  ? 112  LEU A C   1 
ATOM   594  O O   . LEU A 1 78  ? 38.603 19.157  42.112  1.00 49.28  ? 112  LEU A O   1 
ATOM   595  C CB  . LEU A 1 78  ? 37.071 18.522  39.756  1.00 47.98  ? 112  LEU A CB  1 
ATOM   596  C CG  . LEU A 1 78  ? 37.718 19.480  38.761  1.00 49.44  ? 112  LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 78  ? 38.241 18.724  37.549  1.00 49.63  ? 112  LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 78  ? 36.688 20.502  38.341  1.00 48.84  ? 112  LEU A CD2 1 
ATOM   599  N N   . ARG A 1 79  ? 40.258 17.902  41.284  1.00 50.03  ? 113  ARG A N   1 
ATOM   600  C CA  . ARG A 1 79  ? 41.266 18.554  42.104  1.00 52.90  ? 113  ARG A CA  1 
ATOM   601  C C   . ARG A 1 79  ? 41.573 19.961  41.593  1.00 54.20  ? 113  ARG A C   1 
ATOM   602  O O   . ARG A 1 79  ? 41.551 20.929  42.355  1.00 52.87  ? 113  ARG A O   1 
ATOM   603  C CB  . ARG A 1 79  ? 42.549 17.729  42.119  1.00 55.01  ? 113  ARG A CB  1 
ATOM   604  C CG  . ARG A 1 79  ? 42.527 16.531  43.060  1.00 59.42  ? 113  ARG A CG  1 
ATOM   605  C CD  . ARG A 1 79  ? 43.533 15.501  42.587  1.00 64.82  ? 113  ARG A CD  1 
ATOM   606  N NE  . ARG A 1 79  ? 44.099 14.693  43.660  1.00 68.32  ? 113  ARG A NE  1 
ATOM   607  C CZ  . ARG A 1 79  ? 44.868 15.178  44.629  1.00 70.93  ? 113  ARG A CZ  1 
ATOM   608  N NH1 . ARG A 1 79  ? 45.159 16.478  44.665  1.00 71.97  ? 113  ARG A NH1 1 
ATOM   609  N NH2 . ARG A 1 79  ? 45.360 14.362  45.553  1.00 71.36  ? 113  ARG A NH2 1 
ATOM   610  N N   . TYR A 1 80  ? 41.866 20.055  40.297  1.00 55.13  ? 114  TYR A N   1 
ATOM   611  C CA  . TYR A 1 80  ? 42.185 21.312  39.640  1.00 54.90  ? 114  TYR A CA  1 
ATOM   612  C C   . TYR A 1 80  ? 41.660 21.256  38.216  1.00 54.79  ? 114  TYR A C   1 
ATOM   613  O O   . TYR A 1 80  ? 41.089 20.258  37.795  1.00 55.21  ? 114  TYR A O   1 
ATOM   614  C CB  . TYR A 1 80  ? 43.703 21.524  39.574  1.00 55.25  ? 114  TYR A CB  1 
ATOM   615  C CG  . TYR A 1 80  ? 44.431 21.385  40.881  1.00 57.73  ? 114  TYR A CG  1 
ATOM   616  C CD1 . TYR A 1 80  ? 45.064 20.191  41.229  1.00 58.91  ? 114  TYR A CD1 1 
ATOM   617  C CD2 . TYR A 1 80  ? 44.471 22.439  41.787  1.00 59.02  ? 114  TYR A CD2 1 
ATOM   618  C CE1 . TYR A 1 80  ? 45.719 20.051  42.462  1.00 60.07  ? 114  TYR A CE1 1 
ATOM   619  C CE2 . TYR A 1 80  ? 45.117 22.309  43.016  1.00 60.48  ? 114  TYR A CE2 1 
ATOM   620  C CZ  . TYR A 1 80  ? 45.734 21.114  43.347  1.00 60.93  ? 114  TYR A CZ  1 
ATOM   621  O OH  . TYR A 1 80  ? 46.335 20.988  44.579  1.00 64.03  ? 114  TYR A OH  1 
ATOM   622  N N   . PHE A 1 81  ? 41.874 22.336  37.478  1.00 54.92  ? 115  PHE A N   1 
ATOM   623  C CA  . PHE A 1 81  ? 41.477 22.412  36.079  1.00 56.14  ? 115  PHE A CA  1 
ATOM   624  C C   . PHE A 1 81  ? 42.115 23.656  35.476  1.00 57.40  ? 115  PHE A C   1 
ATOM   625  O O   . PHE A 1 81  ? 42.126 24.716  36.095  1.00 58.43  ? 115  PHE A O   1 
ATOM   626  C CB  . PHE A 1 81  ? 39.956 22.447  35.936  1.00 54.74  ? 115  PHE A CB  1 
ATOM   627  C CG  . PHE A 1 81  ? 39.335 23.749  36.303  1.00 53.49  ? 115  PHE A CG  1 
ATOM   628  C CD1 . PHE A 1 81  ? 39.117 24.721  35.336  1.00 53.11  ? 115  PHE A CD1 1 
ATOM   629  C CD2 . PHE A 1 81  ? 38.927 23.990  37.609  1.00 53.69  ? 115  PHE A CD2 1 
ATOM   630  C CE1 . PHE A 1 81  ? 38.491 25.922  35.657  1.00 52.74  ? 115  PHE A CE1 1 
ATOM   631  C CE2 . PHE A 1 81  ? 38.299 25.186  37.952  1.00 55.03  ? 115  PHE A CE2 1 
ATOM   632  C CZ  . PHE A 1 81  ? 38.078 26.158  36.969  1.00 54.43  ? 115  PHE A CZ  1 
ATOM   633  N N   . PHE A 1 82  ? 42.661 23.517  34.275  1.00 58.13  ? 116  PHE A N   1 
ATOM   634  C CA  . PHE A 1 82  ? 43.336 24.618  33.616  1.00 59.08  ? 116  PHE A CA  1 
ATOM   635  C C   . PHE A 1 82  ? 43.184 24.531  32.108  1.00 62.26  ? 116  PHE A C   1 
ATOM   636  O O   . PHE A 1 82  ? 42.615 23.568  31.585  1.00 63.76  ? 116  PHE A O   1 
ATOM   637  C CB  . PHE A 1 82  ? 44.816 24.576  33.987  1.00 57.98  ? 116  PHE A CB  1 
ATOM   638  C CG  . PHE A 1 82  ? 45.513 23.290  33.606  1.00 57.13  ? 116  PHE A CG  1 
ATOM   639  C CD1 . PHE A 1 82  ? 46.181 23.174  32.390  1.00 56.22  ? 116  PHE A CD1 1 
ATOM   640  C CD2 . PHE A 1 82  ? 45.521 22.203  34.478  1.00 57.63  ? 116  PHE A CD2 1 
ATOM   641  C CE1 . PHE A 1 82  ? 46.850 21.993  32.050  1.00 57.23  ? 116  PHE A CE1 1 
ATOM   642  C CE2 . PHE A 1 82  ? 46.187 21.015  34.147  1.00 57.04  ? 116  PHE A CE2 1 
ATOM   643  C CZ  . PHE A 1 82  ? 46.852 20.914  32.931  1.00 57.21  ? 116  PHE A CZ  1 
ATOM   644  N N   . TYR A 1 83  ? 43.686 25.533  31.395  1.00 63.81  ? 117  TYR A N   1 
ATOM   645  C CA  . TYR A 1 83  ? 43.603 25.502  29.940  1.00 65.21  ? 117  TYR A CA  1 
ATOM   646  C C   . TYR A 1 83  ? 44.992 25.458  29.300  1.00 68.76  ? 117  TYR A C   1 
ATOM   647  O O   . TYR A 1 83  ? 45.988 25.824  29.926  1.00 68.79  ? 117  TYR A O   1 
ATOM   648  C CB  . TYR A 1 83  ? 42.823 26.707  29.429  1.00 61.51  ? 117  TYR A CB  1 
ATOM   649  C CG  . TYR A 1 83  ? 41.395 26.758  29.922  1.00 59.84  ? 117  TYR A CG  1 
ATOM   650  C CD1 . TYR A 1 83  ? 41.095 27.229  31.199  1.00 58.68  ? 117  TYR A CD1 1 
ATOM   651  C CD2 . TYR A 1 83  ? 40.339 26.337  29.110  1.00 58.58  ? 117  TYR A CD2 1 
ATOM   652  C CE1 . TYR A 1 83  ? 39.778 27.287  31.652  1.00 57.45  ? 117  TYR A CE1 1 
ATOM   653  C CE2 . TYR A 1 83  ? 39.020 26.386  29.555  1.00 56.48  ? 117  TYR A CE2 1 
ATOM   654  C CZ  . TYR A 1 83  ? 38.746 26.865  30.823  1.00 57.49  ? 117  TYR A CZ  1 
ATOM   655  O OH  . TYR A 1 83  ? 37.438 26.940  31.254  1.00 56.85  ? 117  TYR A OH  1 
ATOM   656  N N   . SER A 1 84  ? 45.054 24.983  28.061  1.00 73.01  ? 118  SER A N   1 
ATOM   657  C CA  . SER A 1 84  ? 46.315 24.885  27.345  1.00 77.82  ? 118  SER A CA  1 
ATOM   658  C C   . SER A 1 84  ? 46.056 24.704  25.857  1.00 82.09  ? 118  SER A C   1 
ATOM   659  O O   . SER A 1 84  ? 45.385 23.757  25.438  1.00 83.18  ? 118  SER A O   1 
ATOM   660  C CB  . SER A 1 84  ? 47.155 23.713  27.877  1.00 77.23  ? 118  SER A CB  1 
ATOM   661  O OG  . SER A 1 84  ? 46.528 22.461  27.649  1.00 77.83  ? 118  SER A OG  1 
ATOM   662  N N   . SER A 1 85  ? 46.579 25.627  25.060  1.00 86.55  ? 119  SER A N   1 
ATOM   663  C CA  . SER A 1 85  ? 46.399 25.564  23.620  1.00 91.28  ? 119  SER A CA  1 
ATOM   664  C C   . SER A 1 85  ? 46.986 24.274  23.052  1.00 94.38  ? 119  SER A C   1 
ATOM   665  O O   . SER A 1 85  ? 48.021 23.789  23.521  1.00 94.24  ? 119  SER A O   1 
ATOM   666  C CB  . SER A 1 85  ? 47.044 26.786  22.968  1.00 91.42  ? 119  SER A CB  1 
ATOM   667  O OG  . SER A 1 85  ? 48.298 27.061  23.569  1.00 92.83  ? 119  SER A OG  1 
ATOM   668  N N   . GLY A 1 86  ? 46.307 23.720  22.049  1.00 98.28  ? 120  GLY A N   1 
ATOM   669  C CA  . GLY A 1 86  ? 46.758 22.485  21.429  1.00 102.92 ? 120  GLY A CA  1 
ATOM   670  C C   . GLY A 1 86  ? 47.408 22.709  20.077  1.00 105.74 ? 120  GLY A C   1 
ATOM   671  O O   . GLY A 1 86  ? 48.503 23.271  19.995  1.00 105.77 ? 120  GLY A O   1 
ATOM   672  N N   . GLU A 1 87  ? 46.739 22.270  19.015  1.00 108.10 ? 121  GLU A N   1 
ATOM   673  C CA  . GLU A 1 87  ? 47.270 22.434  17.668  1.00 110.40 ? 121  GLU A CA  1 
ATOM   674  C C   . GLU A 1 87  ? 46.201 22.101  16.632  1.00 111.96 ? 121  GLU A C   1 
ATOM   675  O O   . GLU A 1 87  ? 45.002 22.131  16.931  1.00 112.34 ? 121  GLU A O   1 
ATOM   676  C CB  . GLU A 1 87  ? 48.487 21.523  17.460  1.00 111.08 ? 121  GLU A CB  1 
ATOM   677  C CG  . GLU A 1 87  ? 49.613 22.169  16.666  1.00 111.76 ? 121  GLU A CG  1 
ATOM   678  C CD  . GLU A 1 87  ? 50.296 23.286  17.437  1.00 112.71 ? 121  GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 87  ? 50.994 22.981  18.430  1.00 112.55 ? 121  GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 87  ? 50.123 24.467  17.060  1.00 113.26 ? 121  GLU A OE2 1 
ATOM   681  N N   . LYS A 1 88  ? 46.654 21.779  15.418  1.00 113.24 ? 122  LYS A N   1 
ATOM   682  C CA  . LYS A 1 88  ? 45.790 21.428  14.283  1.00 113.71 ? 122  LYS A CA  1 
ATOM   683  C C   . LYS A 1 88  ? 44.984 22.640  13.804  1.00 113.60 ? 122  LYS A C   1 
ATOM   684  O O   . LYS A 1 88  ? 44.441 22.642  12.693  1.00 113.91 ? 122  LYS A O   1 
ATOM   685  C CB  . LYS A 1 88  ? 44.835 20.282  14.659  1.00 113.89 ? 122  LYS A CB  1 
ATOM   686  C CG  . LYS A 1 88  ? 44.170 19.598  13.459  1.00 113.47 ? 122  LYS A CG  1 
ATOM   687  C CD  . LYS A 1 88  ? 45.197 18.875  12.589  1.00 113.08 ? 122  LYS A CD  1 
ATOM   688  C CE  . LYS A 1 88  ? 44.559 18.306  11.330  1.00 112.92 ? 122  LYS A CE  1 
ATOM   689  N NZ  . LYS A 1 88  ? 43.439 17.376  11.641  1.00 112.54 ? 122  LYS A NZ  1 
ATOM   690  N N   . LYS A 1 89  ? 44.927 23.667  14.651  1.00 112.77 ? 123  LYS A N   1 
ATOM   691  C CA  . LYS A 1 89  ? 44.198 24.896  14.357  1.00 111.64 ? 123  LYS A CA  1 
ATOM   692  C C   . LYS A 1 89  ? 44.321 25.828  15.572  1.00 110.91 ? 123  LYS A C   1 
ATOM   693  O O   . LYS A 1 89  ? 43.547 26.781  15.721  1.00 111.05 ? 123  LYS A O   1 
ATOM   694  C CB  . LYS A 1 89  ? 42.722 24.564  14.083  1.00 111.60 ? 123  LYS A CB  1 
ATOM   695  C CG  . LYS A 1 89  ? 41.968 25.559  13.206  1.00 110.85 ? 123  LYS A CG  1 
ATOM   696  C CD  . LYS A 1 89  ? 40.568 25.039  12.897  1.00 110.90 ? 123  LYS A CD  1 
ATOM   697  C CE  . LYS A 1 89  ? 39.816 25.953  11.946  1.00 110.82 ? 123  LYS A CE  1 
ATOM   698  N NZ  . LYS A 1 89  ? 38.435 25.452  11.679  1.00 110.62 ? 123  LYS A NZ  1 
ATOM   699  N N   . ASP A 1 90  ? 45.304 25.549  16.431  1.00 109.16 ? 124  ASP A N   1 
ATOM   700  C CA  . ASP A 1 90  ? 45.526 26.337  17.643  1.00 107.53 ? 124  ASP A CA  1 
ATOM   701  C C   . ASP A 1 90  ? 44.253 26.400  18.476  1.00 106.06 ? 124  ASP A C   1 
ATOM   702  O O   . ASP A 1 90  ? 43.672 27.472  18.691  1.00 106.01 ? 124  ASP A O   1 
ATOM   703  C CB  . ASP A 1 90  ? 45.991 27.747  17.295  1.00 108.01 ? 124  ASP A CB  1 
ATOM   704  C CG  . ASP A 1 90  ? 47.380 27.764  16.722  1.00 108.32 ? 124  ASP A CG  1 
ATOM   705  O OD1 . ASP A 1 90  ? 48.286 27.194  17.371  1.00 108.58 ? 124  ASP A OD1 1 
ATOM   706  O OD2 . ASP A 1 90  ? 47.567 28.350  15.634  1.00 108.16 ? 124  ASP A OD2 1 
ATOM   707  N N   . GLU A 1 91  ? 43.831 25.227  18.936  1.00 103.54 ? 125  GLU A N   1 
ATOM   708  C CA  . GLU A 1 91  ? 42.626 25.077  19.736  1.00 100.31 ? 125  GLU A CA  1 
ATOM   709  C C   . GLU A 1 91  ? 42.912 25.261  21.225  1.00 97.62  ? 125  GLU A C   1 
ATOM   710  O O   . GLU A 1 91  ? 44.058 25.163  21.670  1.00 97.05  ? 125  GLU A O   1 
ATOM   711  C CB  . GLU A 1 91  ? 42.034 23.686  19.498  1.00 101.89 ? 125  GLU A CB  1 
ATOM   712  C CG  . GLU A 1 91  ? 41.682 23.385  18.043  1.00 103.39 ? 125  GLU A CG  1 
ATOM   713  C CD  . GLU A 1 91  ? 40.511 24.215  17.534  1.00 104.59 ? 125  GLU A CD  1 
ATOM   714  O OE1 . GLU A 1 91  ? 39.402 24.097  18.101  1.00 104.16 ? 125  GLU A OE1 1 
ATOM   715  O OE2 . GLU A 1 91  ? 40.698 24.984  16.564  1.00 105.63 ? 125  GLU A OE2 1 
ATOM   716  N N   . VAL A 1 92  ? 41.856 25.528  21.987  1.00 94.12  ? 126  VAL A N   1 
ATOM   717  C CA  . VAL A 1 92  ? 41.960 25.711  23.431  1.00 89.88  ? 126  VAL A CA  1 
ATOM   718  C C   . VAL A 1 92  ? 41.512 24.417  24.109  1.00 87.21  ? 126  VAL A C   1 
ATOM   719  O O   . VAL A 1 92  ? 40.382 23.965  23.917  1.00 86.63  ? 126  VAL A O   1 
ATOM   720  C CB  . VAL A 1 92  ? 41.055 26.869  23.913  1.00 90.28  ? 126  VAL A CB  1 
ATOM   721  C CG1 . VAL A 1 92  ? 41.238 27.093  25.409  1.00 89.76  ? 126  VAL A CG1 1 
ATOM   722  C CG2 . VAL A 1 92  ? 41.379 28.136  23.141  1.00 90.06  ? 126  VAL A CG2 1 
ATOM   723  N N   . TYR A 1 93  ? 42.399 23.820  24.894  1.00 83.75  ? 127  TYR A N   1 
ATOM   724  C CA  . TYR A 1 93  ? 42.075 22.577  25.581  1.00 80.58  ? 127  TYR A CA  1 
ATOM   725  C C   . TYR A 1 93  ? 41.763 22.788  27.059  1.00 77.28  ? 127  TYR A C   1 
ATOM   726  O O   . TYR A 1 93  ? 42.461 23.528  27.751  1.00 77.22  ? 127  TYR A O   1 
ATOM   727  C CB  . TYR A 1 93  ? 43.231 21.584  25.435  1.00 82.49  ? 127  TYR A CB  1 
ATOM   728  C CG  . TYR A 1 93  ? 43.383 21.015  24.038  1.00 85.33  ? 127  TYR A CG  1 
ATOM   729  C CD1 . TYR A 1 93  ? 44.591 20.443  23.623  1.00 86.81  ? 127  TYR A CD1 1 
ATOM   730  C CD2 . TYR A 1 93  ? 42.316 21.031  23.134  1.00 86.82  ? 127  TYR A CD2 1 
ATOM   731  C CE1 . TYR A 1 93  ? 44.735 19.901  22.340  1.00 87.64  ? 127  TYR A CE1 1 
ATOM   732  C CE2 . TYR A 1 93  ? 42.445 20.491  21.852  1.00 87.71  ? 127  TYR A CE2 1 
ATOM   733  C CZ  . TYR A 1 93  ? 43.656 19.930  21.462  1.00 88.22  ? 127  TYR A CZ  1 
ATOM   734  O OH  . TYR A 1 93  ? 43.787 19.404  20.198  1.00 87.98  ? 127  TYR A OH  1 
ATOM   735  N N   . LEU A 1 94  ? 40.702 22.139  27.531  1.00 72.58  ? 128  LEU A N   1 
ATOM   736  C CA  . LEU A 1 94  ? 40.301 22.222  28.931  1.00 67.86  ? 128  LEU A CA  1 
ATOM   737  C C   . LEU A 1 94  ? 40.806 20.962  29.631  1.00 65.16  ? 128  LEU A C   1 
ATOM   738  O O   . LEU A 1 94  ? 40.362 19.866  29.322  1.00 66.42  ? 128  LEU A O   1 
ATOM   739  C CB  . LEU A 1 94  ? 38.776 22.301  29.039  1.00 66.78  ? 128  LEU A CB  1 
ATOM   740  C CG  . LEU A 1 94  ? 38.189 22.142  30.445  1.00 67.08  ? 128  LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 94  ? 38.743 23.229  31.347  1.00 68.32  ? 128  LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 94  ? 36.676 22.219  30.397  1.00 65.31  ? 128  LEU A CD2 1 
ATOM   743  N N   . ASN A 1 95  ? 41.739 21.113  30.563  1.00 62.18  ? 129  ASN A N   1 
ATOM   744  C CA  . ASN A 1 95  ? 42.276 19.961  31.277  1.00 59.75  ? 129  ASN A CA  1 
ATOM   745  C C   . ASN A 1 95  ? 41.620 19.805  32.643  1.00 58.58  ? 129  ASN A C   1 
ATOM   746  O O   . ASN A 1 95  ? 41.640 20.735  33.437  1.00 58.88  ? 129  ASN A O   1 
ATOM   747  C CB  . ASN A 1 95  ? 43.789 20.104  31.474  1.00 59.25  ? 129  ASN A CB  1 
ATOM   748  C CG  . ASN A 1 95  ? 44.514 20.489  30.198  1.00 59.35  ? 129  ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 95  ? 44.318 21.584  29.665  1.00 59.33  ? 129  ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 95  ? 45.363 19.595  29.704  1.00 57.74  ? 129  ASN A ND2 1 
ATOM   751  N N   . LEU A 1 96  ? 41.045 18.633  32.917  1.00 56.81  ? 130  LEU A N   1 
ATOM   752  C CA  . LEU A 1 96  ? 40.415 18.376  34.210  1.00 53.42  ? 130  LEU A CA  1 
ATOM   753  C C   . LEU A 1 96  ? 41.296 17.420  34.999  1.00 52.92  ? 130  LEU A C   1 
ATOM   754  O O   . LEU A 1 96  ? 41.473 16.270  34.612  1.00 53.04  ? 130  LEU A O   1 
ATOM   755  C CB  . LEU A 1 96  ? 39.038 17.751  34.022  1.00 52.82  ? 130  LEU A CB  1 
ATOM   756  C CG  . LEU A 1 96  ? 38.059 18.554  33.166  1.00 53.07  ? 130  LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 96  ? 36.776 17.768  32.978  1.00 51.94  ? 130  LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 96  ? 37.764 19.884  33.826  1.00 54.38  ? 130  LEU A CD2 1 
ATOM   759  N N   . VAL A 1 97  ? 41.862 17.903  36.100  1.00 52.16  ? 131  VAL A N   1 
ATOM   760  C CA  . VAL A 1 97  ? 42.725 17.069  36.928  1.00 50.60  ? 131  VAL A CA  1 
ATOM   761  C C   . VAL A 1 97  ? 41.884 16.379  37.979  1.00 51.29  ? 131  VAL A C   1 
ATOM   762  O O   . VAL A 1 97  ? 41.562 16.962  39.022  1.00 52.15  ? 131  VAL A O   1 
ATOM   763  C CB  . VAL A 1 97  ? 43.819 17.895  37.616  1.00 49.38  ? 131  VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 97  ? 44.722 16.989  38.434  1.00 47.71  ? 131  VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 97  ? 44.627 18.638  36.570  1.00 48.84  ? 131  VAL A CG2 1 
ATOM   766  N N   . LEU A 1 98  ? 41.534 15.127  37.697  1.00 51.68  ? 132  LEU A N   1 
ATOM   767  C CA  . LEU A 1 98  ? 40.702 14.334  38.593  1.00 52.03  ? 132  LEU A CA  1 
ATOM   768  C C   . LEU A 1 98  ? 41.544 13.330  39.357  1.00 53.18  ? 132  LEU A C   1 
ATOM   769  O O   . LEU A 1 98  ? 42.673 13.034  38.970  1.00 52.14  ? 132  LEU A O   1 
ATOM   770  C CB  . LEU A 1 98  ? 39.651 13.588  37.777  1.00 50.34  ? 132  LEU A CB  1 
ATOM   771  C CG  . LEU A 1 98  ? 38.796 14.425  36.824  1.00 49.85  ? 132  LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 98  ? 38.477 13.603  35.601  1.00 49.12  ? 132  LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 98  ? 37.532 14.906  37.523  1.00 48.08  ? 132  LEU A CD2 1 
ATOM   774  N N   . ASP A 1 99  ? 40.997 12.821  40.456  1.00 55.44  ? 133  ASP A N   1 
ATOM   775  C CA  . ASP A 1 99  ? 41.707 11.817  41.235  1.00 57.68  ? 133  ASP A CA  1 
ATOM   776  C C   . ASP A 1 99  ? 41.823 10.557  40.386  1.00 58.42  ? 133  ASP A C   1 
ATOM   777  O O   . ASP A 1 99  ? 40.957 10.277  39.552  1.00 57.02  ? 133  ASP A O   1 
ATOM   778  C CB  . ASP A 1 99  ? 40.963 11.481  42.530  1.00 59.54  ? 133  ASP A CB  1 
ATOM   779  C CG  . ASP A 1 99  ? 41.479 12.271  43.719  1.00 63.82  ? 133  ASP A CG  1 
ATOM   780  O OD1 . ASP A 1 99  ? 42.730 12.371  43.872  1.00 64.93  ? 133  ASP A OD1 1 
ATOM   781  O OD2 . ASP A 1 99  ? 40.639 12.775  44.510  1.00 64.32  ? 133  ASP A OD2 1 
ATOM   782  N N   . TYR A 1 100 ? 42.898 9.806   40.602  1.00 59.57  ? 134  TYR A N   1 
ATOM   783  C CA  . TYR A 1 100 ? 43.144 8.568   39.874  1.00 60.55  ? 134  TYR A CA  1 
ATOM   784  C C   . TYR A 1 100 ? 42.747 7.355   40.704  1.00 61.38  ? 134  TYR A C   1 
ATOM   785  O O   . TYR A 1 100 ? 43.275 7.156   41.801  1.00 63.23  ? 134  TYR A O   1 
ATOM   786  C CB  . TYR A 1 100 ? 44.620 8.438   39.536  1.00 61.86  ? 134  TYR A CB  1 
ATOM   787  C CG  . TYR A 1 100 ? 44.939 7.189   38.758  1.00 63.59  ? 134  TYR A CG  1 
ATOM   788  C CD1 . TYR A 1 100 ? 44.669 7.118   37.389  1.00 63.63  ? 134  TYR A CD1 1 
ATOM   789  C CD2 . TYR A 1 100 ? 45.471 6.056   39.393  1.00 64.58  ? 134  TYR A CD2 1 
ATOM   790  C CE1 . TYR A 1 100 ? 44.916 5.951   36.664  1.00 64.82  ? 134  TYR A CE1 1 
ATOM   791  C CE2 . TYR A 1 100 ? 45.719 4.878   38.677  1.00 65.49  ? 134  TYR A CE2 1 
ATOM   792  C CZ  . TYR A 1 100 ? 45.437 4.838   37.313  1.00 65.98  ? 134  TYR A CZ  1 
ATOM   793  O OH  . TYR A 1 100 ? 45.657 3.688   36.596  1.00 68.19  ? 134  TYR A OH  1 
ATOM   794  N N   . VAL A 1 101 ? 41.830 6.541   40.186  1.00 60.70  ? 135  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 41.406 5.346   40.904  1.00 59.86  ? 135  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 41.824 4.118   40.093  1.00 60.37  ? 135  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 41.600 4.040   38.881  1.00 58.86  ? 135  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 39.891 5.340   41.151  1.00 59.60  ? 135  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 39.509 4.173   42.034  1.00 58.11  ? 135  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 39.476 6.640   41.815  1.00 59.55  ? 135  VAL A CG2 1 
ATOM   801  N N   . PRO A 1 102 ? 42.445 3.135   40.769  1.00 61.83  ? 136  PRO A N   1 
ATOM   802  C CA  . PRO A 1 102 ? 42.947 1.867   40.210  1.00 61.45  ? 136  PRO A CA  1 
ATOM   803  C C   . PRO A 1 102 ? 41.970 1.060   39.331  1.00 59.18  ? 136  PRO A C   1 
ATOM   804  O O   . PRO A 1 102 ? 42.035 1.102   38.106  1.00 58.77  ? 136  PRO A O   1 
ATOM   805  C CB  . PRO A 1 102 ? 43.345 1.069   41.462  1.00 62.41  ? 136  PRO A CB  1 
ATOM   806  C CG  . PRO A 1 102 ? 43.626 2.124   42.491  1.00 63.07  ? 136  PRO A CG  1 
ATOM   807  C CD  . PRO A 1 102 ? 42.538 3.118   42.245  1.00 62.71  ? 136  PRO A CD  1 
ATOM   808  N N   . GLU A 1 103 ? 41.076 0.324   39.990  1.00 56.30  ? 137  GLU A N   1 
ATOM   809  C CA  . GLU A 1 103 ? 40.106 -0.534  39.330  1.00 53.98  ? 137  GLU A CA  1 
ATOM   810  C C   . GLU A 1 103 ? 38.733 0.092   39.067  1.00 50.47  ? 137  GLU A C   1 
ATOM   811  O O   . GLU A 1 103 ? 38.444 1.203   39.491  1.00 49.25  ? 137  GLU A O   1 
ATOM   812  C CB  . GLU A 1 103 ? 39.922 -1.820  40.154  1.00 56.84  ? 137  GLU A CB  1 
ATOM   813  C CG  . GLU A 1 103 ? 41.099 -2.791  40.161  1.00 61.61  ? 137  GLU A CG  1 
ATOM   814  C CD  . GLU A 1 103 ? 41.489 -3.270  38.764  1.00 67.09  ? 137  GLU A CD  1 
ATOM   815  O OE1 . GLU A 1 103 ? 40.596 -3.735  38.014  1.00 69.04  ? 137  GLU A OE1 1 
ATOM   816  O OE2 . GLU A 1 103 ? 42.696 -3.191  38.415  1.00 70.22  ? 137  GLU A OE2 1 
ATOM   817  N N   . THR A 1 104 ? 37.886 -0.646  38.360  1.00 47.47  ? 138  THR A N   1 
ATOM   818  C CA  . THR A 1 104 ? 36.533 -0.204  38.057  1.00 44.56  ? 138  THR A CA  1 
ATOM   819  C C   . THR A 1 104 ? 35.628 -1.403  38.265  1.00 43.53  ? 138  THR A C   1 
ATOM   820  O O   . THR A 1 104 ? 36.076 -2.541  38.188  1.00 42.15  ? 138  THR A O   1 
ATOM   821  C CB  . THR A 1 104 ? 36.384 0.266   36.591  1.00 44.46  ? 138  THR A CB  1 
ATOM   822  O OG1 . THR A 1 104 ? 36.481 -0.858  35.704  1.00 41.74  ? 138  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 104 ? 37.459 1.283   36.246  1.00 41.87  ? 138  THR A CG2 1 
ATOM   824  N N   . VAL A 1 105 ? 34.358 -1.156  38.539  1.00 42.31  ? 139  VAL A N   1 
ATOM   825  C CA  . VAL A 1 105 ? 33.447 -2.259  38.737  1.00 42.10  ? 139  VAL A CA  1 
ATOM   826  C C   . VAL A 1 105 ? 33.472 -3.163  37.502  1.00 42.90  ? 139  VAL A C   1 
ATOM   827  O O   . VAL A 1 105 ? 33.286 -4.367  37.618  1.00 41.97  ? 139  VAL A O   1 
ATOM   828  C CB  . VAL A 1 105 ? 32.023 -1.744  39.004  1.00 42.44  ? 139  VAL A CB  1 
ATOM   829  C CG1 . VAL A 1 105 ? 31.008 -2.885  38.852  1.00 40.71  ? 139  VAL A CG1 1 
ATOM   830  C CG2 . VAL A 1 105 ? 31.958 -1.161  40.420  1.00 38.76  ? 139  VAL A CG2 1 
ATOM   831  N N   . TYR A 1 106 ? 33.721 -2.578  36.331  1.00 42.99  ? 140  TYR A N   1 
ATOM   832  C CA  . TYR A 1 106 ? 33.773 -3.320  35.080  1.00 42.60  ? 140  TYR A CA  1 
ATOM   833  C C   . TYR A 1 106 ? 34.887 -4.366  35.104  1.00 45.32  ? 140  TYR A C   1 
ATOM   834  O O   . TYR A 1 106 ? 34.643 -5.553  34.859  1.00 44.40  ? 140  TYR A O   1 
ATOM   835  C CB  . TYR A 1 106 ? 34.028 -2.359  33.924  1.00 43.24  ? 140  TYR A CB  1 
ATOM   836  C CG  . TYR A 1 106 ? 34.226 -3.045  32.589  1.00 44.47  ? 140  TYR A CG  1 
ATOM   837  C CD1 . TYR A 1 106 ? 33.134 -3.483  31.843  1.00 46.03  ? 140  TYR A CD1 1 
ATOM   838  C CD2 . TYR A 1 106 ? 35.507 -3.306  32.102  1.00 45.34  ? 140  TYR A CD2 1 
ATOM   839  C CE1 . TYR A 1 106 ? 33.299 -4.164  30.646  1.00 47.08  ? 140  TYR A CE1 1 
ATOM   840  C CE2 . TYR A 1 106 ? 35.696 -3.992  30.911  1.00 47.65  ? 140  TYR A CE2 1 
ATOM   841  C CZ  . TYR A 1 106 ? 34.577 -4.420  30.184  1.00 49.84  ? 140  TYR A CZ  1 
ATOM   842  O OH  . TYR A 1 106 ? 34.742 -5.116  29.009  1.00 52.22  ? 140  TYR A OH  1 
ATOM   843  N N   . ARG A 1 107 ? 36.111 -3.914  35.375  1.00 46.06  ? 141  ARG A N   1 
ATOM   844  C CA  . ARG A 1 107 ? 37.263 -4.800  35.432  1.00 47.90  ? 141  ARG A CA  1 
ATOM   845  C C   . ARG A 1 107 ? 37.112 -5.879  36.500  1.00 48.33  ? 141  ARG A C   1 
ATOM   846  O O   . ARG A 1 107 ? 37.407 -7.050  36.257  1.00 49.40  ? 141  ARG A O   1 
ATOM   847  C CB  . ARG A 1 107 ? 38.538 -4.001  35.684  1.00 51.20  ? 141  ARG A CB  1 
ATOM   848  C CG  . ARG A 1 107 ? 39.102 -3.350  34.433  1.00 57.27  ? 141  ARG A CG  1 
ATOM   849  C CD  . ARG A 1 107 ? 40.599 -3.149  34.579  1.00 63.19  ? 141  ARG A CD  1 
ATOM   850  N NE  . ARG A 1 107 ? 40.920 -2.021  35.443  1.00 68.99  ? 141  ARG A NE  1 
ATOM   851  C CZ  . ARG A 1 107 ? 40.761 -0.746  35.084  1.00 71.13  ? 141  ARG A CZ  1 
ATOM   852  N NH1 . ARG A 1 107 ? 40.286 -0.455  33.873  1.00 70.83  ? 141  ARG A NH1 1 
ATOM   853  N NH2 . ARG A 1 107 ? 41.070 0.237   35.932  1.00 70.29  ? 141  ARG A NH2 1 
ATOM   854  N N   . VAL A 1 108 ? 36.651 -5.493  37.682  1.00 47.18  ? 142  VAL A N   1 
ATOM   855  C CA  . VAL A 1 108 ? 36.465 -6.460  38.750  1.00 45.36  ? 142  VAL A CA  1 
ATOM   856  C C   . VAL A 1 108 ? 35.461 -7.518  38.308  1.00 46.07  ? 142  VAL A C   1 
ATOM   857  O O   . VAL A 1 108 ? 35.755 -8.699  38.360  1.00 46.52  ? 142  VAL A O   1 
ATOM   858  C CB  . VAL A 1 108 ? 35.982 -5.767  40.043  1.00 44.50  ? 142  VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 108 ? 35.590 -6.793  41.079  1.00 43.16  ? 142  VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 108 ? 37.094 -4.868  40.584  1.00 44.92  ? 142  VAL A CG2 1 
ATOM   861  N N   . ALA A 1 109 ? 34.287 -7.097  37.855  1.00 47.10  ? 143  ALA A N   1 
ATOM   862  C CA  . ALA A 1 109 ? 33.269 -8.043  37.418  1.00 47.49  ? 143  ALA A CA  1 
ATOM   863  C C   . ALA A 1 109 ? 33.788 -8.995  36.345  1.00 50.12  ? 143  ALA A C   1 
ATOM   864  O O   . ALA A 1 109 ? 33.458 -10.176 36.360  1.00 49.42  ? 143  ALA A O   1 
ATOM   865  C CB  . ALA A 1 109 ? 32.054 -7.302  36.903  1.00 44.22  ? 143  ALA A CB  1 
ATOM   866  N N   . ARG A 1 110 ? 34.599 -8.488  35.419  1.00 53.56  ? 144  ARG A N   1 
ATOM   867  C CA  . ARG A 1 110 ? 35.135 -9.322  34.349  1.00 56.78  ? 144  ARG A CA  1 
ATOM   868  C C   . ARG A 1 110 ? 36.111 -10.357 34.901  1.00 58.60  ? 144  ARG A C   1 
ATOM   869  O O   . ARG A 1 110 ? 36.168 -11.479 34.411  1.00 59.32  ? 144  ARG A O   1 
ATOM   870  C CB  . ARG A 1 110 ? 35.818 -8.456  33.286  1.00 58.92  ? 144  ARG A CB  1 
ATOM   871  C CG  . ARG A 1 110 ? 36.219 -9.222  32.034  1.00 64.24  ? 144  ARG A CG  1 
ATOM   872  C CD  . ARG A 1 110 ? 36.772 -8.298  30.957  1.00 68.22  ? 144  ARG A CD  1 
ATOM   873  N NE  . ARG A 1 110 ? 37.936 -7.549  31.437  1.00 73.19  ? 144  ARG A NE  1 
ATOM   874  C CZ  . ARG A 1 110 ? 38.538 -6.577  30.749  1.00 75.53  ? 144  ARG A CZ  1 
ATOM   875  N NH1 . ARG A 1 110 ? 38.091 -6.232  29.541  1.00 76.71  ? 144  ARG A NH1 1 
ATOM   876  N NH2 . ARG A 1 110 ? 39.579 -5.937  31.269  1.00 75.50  ? 144  ARG A NH2 1 
ATOM   877  N N   . HIS A 1 111 ? 36.873 -9.977  35.922  1.00 59.74  ? 145  HIS A N   1 
ATOM   878  C CA  . HIS A 1 111 ? 37.823 -10.887 36.556  1.00 61.13  ? 145  HIS A CA  1 
ATOM   879  C C   . HIS A 1 111 ? 37.076 -12.113 37.059  1.00 60.31  ? 145  HIS A C   1 
ATOM   880  O O   . HIS A 1 111 ? 37.475 -13.234 36.785  1.00 61.56  ? 145  HIS A O   1 
ATOM   881  C CB  . HIS A 1 111 ? 38.514 -10.196 37.738  1.00 65.72  ? 145  HIS A CB  1 
ATOM   882  C CG  . HIS A 1 111 ? 39.347 -11.111 38.586  1.00 70.87  ? 145  HIS A CG  1 
ATOM   883  N ND1 . HIS A 1 111 ? 40.696 -11.303 38.375  1.00 72.65  ? 145  HIS A ND1 1 
ATOM   884  C CD2 . HIS A 1 111 ? 39.027 -11.866 39.667  1.00 72.86  ? 145  HIS A CD2 1 
ATOM   885  C CE1 . HIS A 1 111 ? 41.173 -12.130 39.290  1.00 72.90  ? 145  HIS A CE1 1 
ATOM   886  N NE2 . HIS A 1 111 ? 40.181 -12.486 40.086  1.00 74.20  ? 145  HIS A NE2 1 
ATOM   887  N N   . TYR A 1 112 ? 35.994 -11.896 37.801  1.00 58.91  ? 146  TYR A N   1 
ATOM   888  C CA  . TYR A 1 112 ? 35.220 -13.008 38.325  1.00 57.60  ? 146  TYR A CA  1 
ATOM   889  C C   . TYR A 1 112 ? 34.485 -13.765 37.242  1.00 57.70  ? 146  TYR A C   1 
ATOM   890  O O   . TYR A 1 112 ? 34.444 -14.983 37.257  1.00 58.16  ? 146  TYR A O   1 
ATOM   891  C CB  . TYR A 1 112 ? 34.205 -12.538 39.378  1.00 53.02  ? 146  TYR A CB  1 
ATOM   892  C CG  . TYR A 1 112 ? 34.814 -12.155 40.701  1.00 51.72  ? 146  TYR A CG  1 
ATOM   893  C CD1 . TYR A 1 112 ? 35.506 -10.959 40.843  1.00 51.10  ? 146  TYR A CD1 1 
ATOM   894  C CD2 . TYR A 1 112 ? 34.718 -12.994 41.812  1.00 50.35  ? 146  TYR A CD2 1 
ATOM   895  C CE1 . TYR A 1 112 ? 36.087 -10.606 42.054  1.00 50.26  ? 146  TYR A CE1 1 
ATOM   896  C CE2 . TYR A 1 112 ? 35.304 -12.646 43.032  1.00 48.85  ? 146  TYR A CE2 1 
ATOM   897  C CZ  . TYR A 1 112 ? 35.986 -11.452 43.137  1.00 49.38  ? 146  TYR A CZ  1 
ATOM   898  O OH  . TYR A 1 112 ? 36.599 -11.097 44.311  1.00 51.74  ? 146  TYR A OH  1 
ATOM   899  N N   . SER A 1 113 ? 33.905 -13.038 36.303  1.00 60.01  ? 147  SER A N   1 
ATOM   900  C CA  . SER A 1 113 ? 33.135 -13.657 35.239  1.00 62.35  ? 147  SER A CA  1 
ATOM   901  C C   . SER A 1 113 ? 33.946 -14.640 34.423  1.00 64.18  ? 147  SER A C   1 
ATOM   902  O O   . SER A 1 113 ? 33.526 -15.779 34.218  1.00 64.26  ? 147  SER A O   1 
ATOM   903  C CB  . SER A 1 113 ? 32.555 -12.595 34.318  1.00 63.24  ? 147  SER A CB  1 
ATOM   904  O OG  . SER A 1 113 ? 31.569 -13.149 33.470  1.00 65.24  ? 147  SER A OG  1 
ATOM   905  N N   . ARG A 1 114 ? 35.104 -14.212 33.943  1.00 66.74  ? 148  ARG A N   1 
ATOM   906  C CA  . ARG A 1 114 ? 35.933 -15.117 33.162  1.00 69.42  ? 148  ARG A CA  1 
ATOM   907  C C   . ARG A 1 114 ? 36.827 -15.900 34.107  1.00 69.52  ? 148  ARG A C   1 
ATOM   908  O O   . ARG A 1 114 ? 38.017 -16.065 33.872  1.00 71.98  ? 148  ARG A O   1 
ATOM   909  C CB  . ARG A 1 114 ? 36.759 -14.348 32.115  1.00 71.47  ? 148  ARG A CB  1 
ATOM   910  C CG  . ARG A 1 114 ? 37.865 -13.463 32.649  1.00 75.37  ? 148  ARG A CG  1 
ATOM   911  C CD  . ARG A 1 114 ? 38.372 -12.557 31.531  1.00 79.71  ? 148  ARG A CD  1 
ATOM   912  N NE  . ARG A 1 114 ? 39.519 -11.752 31.941  1.00 83.99  ? 148  ARG A NE  1 
ATOM   913  C CZ  . ARG A 1 114 ? 40.028 -10.757 31.217  1.00 86.68  ? 148  ARG A CZ  1 
ATOM   914  N NH1 . ARG A 1 114 ? 39.488 -10.440 30.039  1.00 87.63  ? 148  ARG A NH1 1 
ATOM   915  N NH2 . ARG A 1 114 ? 41.077 -10.074 31.668  1.00 87.09  ? 148  ARG A NH2 1 
ATOM   916  N N   . ALA A 1 115 ? 36.227 -16.360 35.194  1.00 68.50  ? 149  ALA A N   1 
ATOM   917  C CA  . ALA A 1 115 ? 36.911 -17.144 36.200  1.00 68.17  ? 149  ALA A CA  1 
ATOM   918  C C   . ALA A 1 115 ? 35.825 -18.039 36.754  1.00 68.64  ? 149  ALA A C   1 
ATOM   919  O O   . ALA A 1 115 ? 35.976 -18.670 37.795  1.00 68.57  ? 149  ALA A O   1 
ATOM   920  C CB  . ALA A 1 115 ? 37.475 -16.252 37.289  1.00 67.44  ? 149  ALA A CB  1 
ATOM   921  N N   . LYS A 1 116 ? 34.713 -18.066 36.031  1.00 70.06  ? 150  LYS A N   1 
ATOM   922  C CA  . LYS A 1 116 ? 33.574 -18.886 36.385  1.00 71.92  ? 150  LYS A CA  1 
ATOM   923  C C   . LYS A 1 116 ? 33.099 -18.632 37.807  1.00 72.54  ? 150  LYS A C   1 
ATOM   924  O O   . LYS A 1 116 ? 32.752 -19.568 38.522  1.00 72.91  ? 150  LYS A O   1 
ATOM   925  C CB  . LYS A 1 116 ? 33.949 -20.353 36.212  1.00 73.42  ? 150  LYS A CB  1 
ATOM   926  C CG  . LYS A 1 116 ? 34.436 -20.684 34.815  1.00 75.33  ? 150  LYS A CG  1 
ATOM   927  C CD  . LYS A 1 116 ? 33.331 -20.474 33.803  1.00 76.32  ? 150  LYS A CD  1 
ATOM   928  C CE  . LYS A 1 116 ? 33.807 -20.802 32.398  1.00 78.80  ? 150  LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 116 ? 32.708 -20.672 31.398  1.00 79.16  ? 150  LYS A NZ  1 
ATOM   930  N N   . GLN A 1 117 ? 33.077 -17.368 38.218  1.00 72.66  ? 151  GLN A N   1 
ATOM   931  C CA  . GLN A 1 117 ? 32.637 -17.031 39.567  1.00 72.61  ? 151  GLN A CA  1 
ATOM   932  C C   . GLN A 1 117 ? 31.823 -15.757 39.655  1.00 70.18  ? 151  GLN A C   1 
ATOM   933  O O   . GLN A 1 117 ? 31.667 -15.030 38.673  1.00 70.01  ? 151  GLN A O   1 
ATOM   934  C CB  . GLN A 1 117 ? 33.836 -16.901 40.493  1.00 74.85  ? 151  GLN A CB  1 
ATOM   935  C CG  . GLN A 1 117 ? 34.613 -18.166 40.635  1.00 80.43  ? 151  GLN A CG  1 
ATOM   936  C CD  . GLN A 1 117 ? 35.595 -18.075 41.765  1.00 84.77  ? 151  GLN A CD  1 
ATOM   937  O OE1 . GLN A 1 117 ? 35.208 -17.997 42.943  1.00 85.94  ? 151  GLN A OE1 1 
ATOM   938  N NE2 . GLN A 1 117 ? 36.882 -18.074 41.424  1.00 85.80  ? 151  GLN A NE2 1 
ATOM   939  N N   . THR A 1 118 ? 31.286 -15.502 40.842  1.00 67.17  ? 152  THR A N   1 
ATOM   940  C CA  . THR A 1 118 ? 30.511 -14.293 41.070  1.00 64.47  ? 152  THR A CA  1 
ATOM   941  C C   . THR A 1 118 ? 31.098 -13.532 42.243  1.00 61.67  ? 152  THR A C   1 
ATOM   942  O O   . THR A 1 118 ? 31.601 -14.115 43.204  1.00 62.51  ? 152  THR A O   1 
ATOM   943  C CB  . THR A 1 118 ? 29.018 -14.589 41.352  1.00 64.69  ? 152  THR A CB  1 
ATOM   944  O OG1 . THR A 1 118 ? 28.909 -15.771 42.155  1.00 66.58  ? 152  THR A OG1 1 
ATOM   945  C CG2 . THR A 1 118 ? 28.254 -14.765 40.049  1.00 63.14  ? 152  THR A CG2 1 
ATOM   946  N N   . LEU A 1 119 ? 31.058 -12.216 42.137  1.00 58.92  ? 153  LEU A N   1 
ATOM   947  C CA  . LEU A 1 119 ? 31.567 -11.344 43.177  1.00 55.01  ? 153  LEU A CA  1 
ATOM   948  C C   . LEU A 1 119 ? 30.774 -11.572 44.470  1.00 52.90  ? 153  LEU A C   1 
ATOM   949  O O   . LEU A 1 119 ? 29.542 -11.640 44.447  1.00 53.26  ? 153  LEU A O   1 
ATOM   950  C CB  . LEU A 1 119 ? 31.412 -9.895  42.717  1.00 53.78  ? 153  LEU A CB  1 
ATOM   951  C CG  . LEU A 1 119 ? 31.827 -8.793  43.679  1.00 54.66  ? 153  LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 119 ? 33.342 -8.826  43.860  1.00 54.77  ? 153  LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 119 ? 31.387 -7.452  43.129  1.00 52.52  ? 153  LEU A CD2 1 
ATOM   954  N N   . PRO A 1 120 ? 31.469 -11.734 45.608  1.00 50.76  ? 154  PRO A N   1 
ATOM   955  C CA  . PRO A 1 120 ? 30.805 -11.946 46.902  1.00 50.13  ? 154  PRO A CA  1 
ATOM   956  C C   . PRO A 1 120 ? 29.741 -10.873 47.183  1.00 50.74  ? 154  PRO A C   1 
ATOM   957  O O   . PRO A 1 120 ? 30.009 -9.675  47.041  1.00 51.93  ? 154  PRO A O   1 
ATOM   958  C CB  . PRO A 1 120 ? 31.961 -11.860 47.894  1.00 48.32  ? 154  PRO A CB  1 
ATOM   959  C CG  . PRO A 1 120 ? 33.073 -12.481 47.142  1.00 47.72  ? 154  PRO A CG  1 
ATOM   960  C CD  . PRO A 1 120 ? 32.925 -11.938 45.732  1.00 49.57  ? 154  PRO A CD  1 
ATOM   961  N N   . VAL A 1 121 ? 28.549 -11.307 47.590  1.00 50.69  ? 155  VAL A N   1 
ATOM   962  C CA  . VAL A 1 121 ? 27.439 -10.407 47.882  1.00 48.58  ? 155  VAL A CA  1 
ATOM   963  C C   . VAL A 1 121 ? 27.829 -9.222  48.753  1.00 47.54  ? 155  VAL A C   1 
ATOM   964  O O   . VAL A 1 121 ? 27.289 -8.136  48.596  1.00 49.85  ? 155  VAL A O   1 
ATOM   965  C CB  . VAL A 1 121 ? 26.286 -11.170 48.555  1.00 48.72  ? 155  VAL A CB  1 
ATOM   966  C CG1 . VAL A 1 121 ? 25.083 -10.260 48.732  1.00 50.69  ? 155  VAL A CG1 1 
ATOM   967  C CG2 . VAL A 1 121 ? 25.903 -12.371 47.698  1.00 52.02  ? 155  VAL A CG2 1 
ATOM   968  N N   . ILE A 1 122 ? 28.772 -9.416  49.663  1.00 46.45  ? 156  ILE A N   1 
ATOM   969  C CA  . ILE A 1 122 ? 29.196 -8.324  50.534  1.00 45.18  ? 156  ILE A CA  1 
ATOM   970  C C   . ILE A 1 122 ? 29.701 -7.149  49.694  1.00 44.98  ? 156  ILE A C   1 
ATOM   971  O O   . ILE A 1 122 ? 29.402 -5.987  49.991  1.00 45.09  ? 156  ILE A O   1 
ATOM   972  C CB  . ILE A 1 122 ? 30.300 -8.803  51.518  1.00 45.11  ? 156  ILE A CB  1 
ATOM   973  C CG1 . ILE A 1 122 ? 30.778 -7.642  52.387  1.00 44.96  ? 156  ILE A CG1 1 
ATOM   974  C CG2 . ILE A 1 122 ? 31.439 -9.448  50.760  1.00 47.77  ? 156  ILE A CG2 1 
ATOM   975  C CD1 . ILE A 1 122 ? 29.689 -7.061  53.276  1.00 42.82  ? 156  ILE A CD1 1 
ATOM   976  N N   . TYR A 1 123 ? 30.456 -7.458  48.642  1.00 43.79  ? 157  TYR A N   1 
ATOM   977  C CA  . TYR A 1 123 ? 30.967 -6.435  47.740  1.00 44.43  ? 157  TYR A CA  1 
ATOM   978  C C   . TYR A 1 123 ? 29.836 -5.869  46.877  1.00 43.27  ? 157  TYR A C   1 
ATOM   979  O O   . TYR A 1 123 ? 29.836 -4.685  46.542  1.00 43.41  ? 157  TYR A O   1 
ATOM   980  C CB  . TYR A 1 123 ? 32.065 -7.016  46.849  1.00 46.71  ? 157  TYR A CB  1 
ATOM   981  C CG  . TYR A 1 123 ? 33.332 -7.315  47.603  1.00 49.72  ? 157  TYR A CG  1 
ATOM   982  C CD1 . TYR A 1 123 ? 34.040 -6.293  48.254  1.00 52.38  ? 157  TYR A CD1 1 
ATOM   983  C CD2 . TYR A 1 123 ? 33.822 -8.614  47.691  1.00 51.17  ? 157  TYR A CD2 1 
ATOM   984  C CE1 . TYR A 1 123 ? 35.204 -6.563  48.975  1.00 52.84  ? 157  TYR A CE1 1 
ATOM   985  C CE2 . TYR A 1 123 ? 34.982 -8.892  48.408  1.00 52.94  ? 157  TYR A CE2 1 
ATOM   986  C CZ  . TYR A 1 123 ? 35.665 -7.864  49.042  1.00 54.00  ? 157  TYR A CZ  1 
ATOM   987  O OH  . TYR A 1 123 ? 36.830 -8.131  49.720  1.00 57.49  ? 157  TYR A OH  1 
ATOM   988  N N   . VAL A 1 124 ? 28.877 -6.712  46.509  1.00 40.56  ? 158  VAL A N   1 
ATOM   989  C CA  . VAL A 1 124 ? 27.770 -6.229  45.706  1.00 41.20  ? 158  VAL A CA  1 
ATOM   990  C C   . VAL A 1 124 ? 26.990 -5.179  46.514  1.00 41.89  ? 158  VAL A C   1 
ATOM   991  O O   . VAL A 1 124 ? 26.586 -4.148  45.972  1.00 42.14  ? 158  VAL A O   1 
ATOM   992  C CB  . VAL A 1 124 ? 26.831 -7.387  45.268  1.00 40.06  ? 158  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 124 ? 25.672 -6.839  44.455  1.00 38.23  ? 158  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 124 ? 27.599 -8.387  44.442  1.00 39.03  ? 158  VAL A CG2 1 
ATOM   995  N N   . LYS A 1 125 ? 26.805 -5.437  47.810  1.00 40.85  ? 159  LYS A N   1 
ATOM   996  C CA  . LYS A 1 125 ? 26.098 -4.519  48.703  1.00 40.35  ? 159  LYS A CA  1 
ATOM   997  C C   . LYS A 1 125 ? 26.879 -3.225  48.867  1.00 40.50  ? 159  LYS A C   1 
ATOM   998  O O   . LYS A 1 125 ? 26.335 -2.137  48.694  1.00 40.75  ? 159  LYS A O   1 
ATOM   999  C CB  . LYS A 1 125 ? 25.897 -5.161  50.079  1.00 42.26  ? 159  LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 125 ? 24.949 -6.359  50.071  1.00 44.93  ? 159  LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 125 ? 24.835 -7.011  51.434  1.00 44.03  ? 159  LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 125 ? 23.909 -8.205  51.380  1.00 45.00  ? 159  LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 125 ? 23.694 -8.786  52.743  1.00 45.88  ? 159  LYS A NZ  1 
ATOM   1004 N N   . LEU A 1 126 ? 28.156 -3.346  49.213  1.00 40.20  ? 160  LEU A N   1 
ATOM   1005 C CA  . LEU A 1 126 ? 29.000 -2.174  49.381  1.00 40.23  ? 160  LEU A CA  1 
ATOM   1006 C C   . LEU A 1 126 ? 29.037 -1.294  48.137  1.00 39.81  ? 160  LEU A C   1 
ATOM   1007 O O   . LEU A 1 126 ? 28.880 -0.075  48.230  1.00 41.64  ? 160  LEU A O   1 
ATOM   1008 C CB  . LEU A 1 126 ? 30.424 -2.583  49.737  1.00 41.15  ? 160  LEU A CB  1 
ATOM   1009 C CG  . LEU A 1 126 ? 30.696 -2.783  51.222  1.00 43.84  ? 160  LEU A CG  1 
ATOM   1010 C CD1 . LEU A 1 126 ? 32.075 -3.401  51.398  1.00 44.32  ? 160  LEU A CD1 1 
ATOM   1011 C CD2 . LEU A 1 126 ? 30.608 -1.447  51.951  1.00 42.81  ? 160  LEU A CD2 1 
ATOM   1012 N N   . TYR A 1 127 ? 29.250 -1.906  46.976  1.00 38.10  ? 161  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 127 ? 29.309 -1.147  45.735  1.00 36.95  ? 161  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 127 ? 27.964 -0.505  45.362  1.00 36.13  ? 161  TYR A C   1 
ATOM   1015 O O   . TYR A 1 127 ? 27.901 0.684   45.057  1.00 35.90  ? 161  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 127 ? 29.806 -2.037  44.584  1.00 37.29  ? 161  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 127 ? 31.206 -2.590  44.774  1.00 39.84  ? 161  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 127 ? 32.065 -2.050  45.739  1.00 38.81  ? 161  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 127 ? 31.685 -3.651  43.978  1.00 39.67  ? 161  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 127 ? 33.355 -2.545  45.911  1.00 39.97  ? 161  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 127 ? 32.980 -4.153  44.147  1.00 38.60  ? 161  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 127 ? 33.806 -3.591  45.116  1.00 40.90  ? 161  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 127 ? 35.089 -4.062  45.312  1.00 42.01  ? 161  TYR A OH  1 
ATOM   1024 N N   . MET A 1 128 ? 26.887 -1.276  45.392  1.00 33.50  ? 162  MET A N   1 
ATOM   1025 C CA  . MET A 1 128 ? 25.601 -0.708  45.036  1.00 35.27  ? 162  MET A CA  1 
ATOM   1026 C C   . MET A 1 128 ? 25.161 0.409   45.976  1.00 36.48  ? 162  MET A C   1 
ATOM   1027 O O   . MET A 1 128 ? 24.670 1.454   45.533  1.00 37.72  ? 162  MET A O   1 
ATOM   1028 C CB  . MET A 1 128 ? 24.532 -1.800  44.962  1.00 34.55  ? 162  MET A CB  1 
ATOM   1029 C CG  . MET A 1 128 ? 24.801 -2.799  43.824  1.00 38.39  ? 162  MET A CG  1 
ATOM   1030 S SD  . MET A 1 128 ? 25.213 -1.968  42.240  1.00 39.52  ? 162  MET A SD  1 
ATOM   1031 C CE  . MET A 1 128 ? 23.660 -1.124  41.971  1.00 39.77  ? 162  MET A CE  1 
ATOM   1032 N N   . TYR A 1 129 ? 25.348 0.205   47.273  1.00 36.66  ? 163  TYR A N   1 
ATOM   1033 C CA  . TYR A 1 129 ? 24.946 1.203   48.245  1.00 36.15  ? 163  TYR A CA  1 
ATOM   1034 C C   . TYR A 1 129 ? 25.642 2.532   48.004  1.00 36.71  ? 163  TYR A C   1 
ATOM   1035 O O   . TYR A 1 129 ? 25.014 3.599   48.066  1.00 37.31  ? 163  TYR A O   1 
ATOM   1036 C CB  . TYR A 1 129 ? 25.277 0.717   49.635  1.00 38.21  ? 163  TYR A CB  1 
ATOM   1037 C CG  . TYR A 1 129 ? 24.908 1.688   50.726  1.00 36.86  ? 163  TYR A CG  1 
ATOM   1038 C CD1 . TYR A 1 129 ? 23.631 1.678   51.293  1.00 34.04  ? 163  TYR A CD1 1 
ATOM   1039 C CD2 . TYR A 1 129 ? 25.852 2.586   51.216  1.00 35.46  ? 163  TYR A CD2 1 
ATOM   1040 C CE1 . TYR A 1 129 ? 23.308 2.529   52.323  1.00 33.58  ? 163  TYR A CE1 1 
ATOM   1041 C CE2 . TYR A 1 129 ? 25.547 3.438   52.244  1.00 37.20  ? 163  TYR A CE2 1 
ATOM   1042 C CZ  . TYR A 1 129 ? 24.272 3.406   52.805  1.00 36.95  ? 163  TYR A CZ  1 
ATOM   1043 O OH  . TYR A 1 129 ? 24.003 4.219   53.889  1.00 38.88  ? 163  TYR A OH  1 
ATOM   1044 N N   . GLN A 1 130 ? 26.945 2.479   47.756  1.00 35.76  ? 164  GLN A N   1 
ATOM   1045 C CA  . GLN A 1 130 ? 27.673 3.703   47.494  1.00 34.97  ? 164  GLN A CA  1 
ATOM   1046 C C   . GLN A 1 130 ? 27.198 4.320   46.180  1.00 34.83  ? 164  GLN A C   1 
ATOM   1047 O O   . GLN A 1 130 ? 27.102 5.541   46.075  1.00 35.03  ? 164  GLN A O   1 
ATOM   1048 C CB  . GLN A 1 130 ? 29.179 3.428   47.482  1.00 34.77  ? 164  GLN A CB  1 
ATOM   1049 C CG  . GLN A 1 130 ? 29.698 3.088   48.873  1.00 34.98  ? 164  GLN A CG  1 
ATOM   1050 C CD  . GLN A 1 130 ? 31.136 2.645   48.872  1.00 37.56  ? 164  GLN A CD  1 
ATOM   1051 O OE1 . GLN A 1 130 ? 32.054 3.465   48.802  1.00 38.67  ? 164  GLN A OE1 1 
ATOM   1052 N NE2 . GLN A 1 130 ? 31.346 1.332   48.913  1.00 37.80  ? 164  GLN A NE2 1 
ATOM   1053 N N   . LEU A 1 131 ? 26.875 3.498   45.184  1.00 34.37  ? 165  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 131 ? 26.406 4.069   43.932  1.00 33.71  ? 165  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 131 ? 25.085 4.804   44.163  1.00 35.76  ? 165  LEU A C   1 
ATOM   1056 O O   . LEU A 1 131 ? 24.887 5.891   43.611  1.00 36.20  ? 165  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 131 ? 26.224 2.994   42.860  1.00 32.79  ? 165  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 131 ? 25.441 3.356   41.577  1.00 31.07  ? 165  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 131 ? 26.000 4.602   40.889  1.00 31.39  ? 165  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 131 ? 25.483 2.168   40.651  1.00 30.02  ? 165  LEU A CD2 1 
ATOM   1061 N N   . PHE A 1 132 ? 24.190 4.231   44.977  1.00 35.86  ? 166  PHE A N   1 
ATOM   1062 C CA  . PHE A 1 132 ? 22.913 4.891   45.245  1.00 35.45  ? 166  PHE A CA  1 
ATOM   1063 C C   . PHE A 1 132 ? 23.080 6.185   46.036  1.00 37.18  ? 166  PHE A C   1 
ATOM   1064 O O   . PHE A 1 132 ? 22.296 7.115   45.859  1.00 39.38  ? 166  PHE A O   1 
ATOM   1065 C CB  . PHE A 1 132 ? 21.937 3.948   45.950  1.00 33.07  ? 166  PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 132 ? 21.373 2.892   45.041  1.00 34.15  ? 166  PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 132 ? 20.829 3.243   43.813  1.00 31.94  ? 166  PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 132 ? 21.431 1.542   45.383  1.00 34.50  ? 166  PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 132 ? 20.360 2.270   42.938  1.00 32.65  ? 166  PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 132 ? 20.961 0.563   44.509  1.00 32.83  ? 166  PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 132 ? 20.426 0.931   43.281  1.00 31.82  ? 166  PHE A CZ  1 
ATOM   1072 N N   . ARG A 1 133 ? 24.095 6.264   46.892  1.00 37.53  ? 167  ARG A N   1 
ATOM   1073 C CA  . ARG A 1 133 ? 24.323 7.499   47.630  1.00 37.83  ? 167  ARG A CA  1 
ATOM   1074 C C   . ARG A 1 133 ? 24.753 8.568   46.649  1.00 37.80  ? 167  ARG A C   1 
ATOM   1075 O O   . ARG A 1 133 ? 24.211 9.664   46.638  1.00 39.77  ? 167  ARG A O   1 
ATOM   1076 C CB  . ARG A 1 133 ? 25.427 7.348   48.672  1.00 39.05  ? 167  ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 133 ? 24.945 6.926   50.035  1.00 41.64  ? 167  ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 133 ? 26.047 7.071   51.067  1.00 42.18  ? 167  ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 133 ? 26.218 8.445   51.537  1.00 44.41  ? 167  ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 133 ? 27.160 8.807   52.409  1.00 46.08  ? 167  ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 133 ? 28.005 7.903   52.884  1.00 46.47  ? 167  ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 133 ? 27.250 10.057  52.837  1.00 45.67  ? 167  ARG A NH2 1 
ATOM   1083 N N   . SER A 1 134 ? 25.737 8.251   45.820  1.00 37.10  ? 168  SER A N   1 
ATOM   1084 C CA  . SER A 1 134 ? 26.207 9.232   44.858  1.00 38.15  ? 168  SER A CA  1 
ATOM   1085 C C   . SER A 1 134 ? 25.036 9.662   43.979  1.00 38.46  ? 168  SER A C   1 
ATOM   1086 O O   . SER A 1 134 ? 24.918 10.838  43.597  1.00 40.73  ? 168  SER A O   1 
ATOM   1087 C CB  . SER A 1 134 ? 27.358 8.677   44.009  1.00 36.82  ? 168  SER A CB  1 
ATOM   1088 O OG  . SER A 1 134 ? 26.911 7.681   43.138  1.00 37.78  ? 168  SER A OG  1 
ATOM   1089 N N   . LEU A 1 135 ? 24.156 8.718   43.669  1.00 36.74  ? 169  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 135 ? 22.996 9.031   42.847  1.00 35.77  ? 169  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 135 ? 22.019 9.916   43.624  1.00 36.31  ? 169  LEU A C   1 
ATOM   1092 O O   . LEU A 1 135 ? 21.506 10.896  43.077  1.00 38.70  ? 169  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 135 ? 22.323 7.742   42.383  1.00 34.61  ? 169  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 135 ? 22.445 7.389   40.880  1.00 35.24  ? 169  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 135 ? 23.795 7.785   40.283  1.00 29.30  ? 169  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 135 ? 22.197 5.884   40.728  1.00 31.43  ? 169  LEU A CD2 1 
ATOM   1097 N N   . ALA A 1 136 ? 21.782 9.596   44.900  1.00 34.25  ? 170  ALA A N   1 
ATOM   1098 C CA  . ALA A 1 136 ? 20.884 10.400  45.735  1.00 32.75  ? 170  ALA A CA  1 
ATOM   1099 C C   . ALA A 1 136 ? 21.426 11.837  45.811  1.00 34.98  ? 170  ALA A C   1 
ATOM   1100 O O   . ALA A 1 136 ? 20.668 12.821  45.785  1.00 33.81  ? 170  ALA A O   1 
ATOM   1101 C CB  . ALA A 1 136 ? 20.795 9.810   47.130  1.00 28.26  ? 170  ALA A CB  1 
ATOM   1102 N N   . TYR A 1 137 ? 22.749 11.941  45.880  1.00 35.86  ? 171  TYR A N   1 
ATOM   1103 C CA  . TYR A 1 137 ? 23.415 13.223  45.979  1.00 37.53  ? 171  TYR A CA  1 
ATOM   1104 C C   . TYR A 1 137 ? 23.288 14.091  44.743  1.00 39.22  ? 171  TYR A C   1 
ATOM   1105 O O   . TYR A 1 137 ? 22.758 15.192  44.831  1.00 40.49  ? 171  TYR A O   1 
ATOM   1106 C CB  . TYR A 1 137 ? 24.885 13.014  46.315  1.00 38.10  ? 171  TYR A CB  1 
ATOM   1107 C CG  . TYR A 1 137 ? 25.674 14.295  46.395  1.00 39.21  ? 171  TYR A CG  1 
ATOM   1108 C CD1 . TYR A 1 137 ? 26.581 14.627  45.395  1.00 39.85  ? 171  TYR A CD1 1 
ATOM   1109 C CD2 . TYR A 1 137 ? 25.535 15.166  47.480  1.00 39.23  ? 171  TYR A CD2 1 
ATOM   1110 C CE1 . TYR A 1 137 ? 27.340 15.788  45.466  1.00 42.54  ? 171  TYR A CE1 1 
ATOM   1111 C CE2 . TYR A 1 137 ? 26.292 16.339  47.568  1.00 39.26  ? 171  TYR A CE2 1 
ATOM   1112 C CZ  . TYR A 1 137 ? 27.196 16.642  46.558  1.00 42.15  ? 171  TYR A CZ  1 
ATOM   1113 O OH  . TYR A 1 137 ? 27.999 17.762  46.616  1.00 44.73  ? 171  TYR A OH  1 
ATOM   1114 N N   . ILE A 1 138 ? 23.778 13.626  43.594  1.00 40.94  ? 172  ILE A N   1 
ATOM   1115 C CA  . ILE A 1 138 ? 23.676 14.440  42.387  1.00 39.33  ? 172  ILE A CA  1 
ATOM   1116 C C   . ILE A 1 138 ? 22.209 14.667  42.006  1.00 40.13  ? 172  ILE A C   1 
ATOM   1117 O O   . ILE A 1 138 ? 21.874 15.706  41.454  1.00 39.91  ? 172  ILE A O   1 
ATOM   1118 C CB  . ILE A 1 138 ? 24.390 13.806  41.168  1.00 40.53  ? 172  ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 138 ? 23.745 12.458  40.836  1.00 40.87  ? 172  ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 138 ? 25.892 13.670  41.434  1.00 40.56  ? 172  ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 138 ? 24.209 11.875  39.521  1.00 39.24  ? 172  ILE A CD1 1 
ATOM   1122 N N   . HIS A 1 139 ? 21.325 13.719  42.297  1.00 39.79  ? 173  HIS A N   1 
ATOM   1123 C CA  . HIS A 1 139 ? 19.931 13.940  41.937  1.00 41.51  ? 173  HIS A CA  1 
ATOM   1124 C C   . HIS A 1 139 ? 19.306 15.080  42.740  1.00 43.74  ? 173  HIS A C   1 
ATOM   1125 O O   . HIS A 1 139 ? 18.440 15.800  42.231  1.00 44.43  ? 173  HIS A O   1 
ATOM   1126 C CB  . HIS A 1 139 ? 19.095 12.661  42.108  1.00 38.68  ? 173  HIS A CB  1 
ATOM   1127 C CG  . HIS A 1 139 ? 19.309 11.648  41.024  1.00 40.50  ? 173  HIS A CG  1 
ATOM   1128 N ND1 . HIS A 1 139 ? 18.641 10.446  40.990  1.00 41.51  ? 173  HIS A ND1 1 
ATOM   1129 C CD2 . HIS A 1 139 ? 20.150 11.647  39.961  1.00 39.67  ? 173  HIS A CD2 1 
ATOM   1130 C CE1 . HIS A 1 139 ? 19.067 9.740   39.951  1.00 38.55  ? 173  HIS A CE1 1 
ATOM   1131 N NE2 . HIS A 1 139 ? 19.978 10.446  39.318  1.00 38.07  ? 173  HIS A NE2 1 
ATOM   1132 N N   . SER A 1 140 ? 19.744 15.252  43.987  1.00 45.95  ? 174  SER A N   1 
ATOM   1133 C CA  . SER A 1 140 ? 19.195 16.309  44.832  1.00 46.23  ? 174  SER A CA  1 
ATOM   1134 C C   . SER A 1 140 ? 19.499 17.686  44.216  1.00 47.73  ? 174  SER A C   1 
ATOM   1135 O O   . SER A 1 140 ? 18.816 18.668  44.517  1.00 50.71  ? 174  SER A O   1 
ATOM   1136 C CB  . SER A 1 140 ? 19.759 16.222  46.255  1.00 44.17  ? 174  SER A CB  1 
ATOM   1137 O OG  . SER A 1 140 ? 21.089 16.690  46.290  1.00 45.54  ? 174  SER A OG  1 
ATOM   1138 N N   . PHE A 1 141 ? 20.517 17.757  43.360  1.00 46.87  ? 175  PHE A N   1 
ATOM   1139 C CA  . PHE A 1 141 ? 20.855 19.004  42.686  1.00 46.62  ? 175  PHE A CA  1 
ATOM   1140 C C   . PHE A 1 141 ? 20.095 19.088  41.366  1.00 45.84  ? 175  PHE A C   1 
ATOM   1141 O O   . PHE A 1 141 ? 20.173 20.085  40.663  1.00 46.25  ? 175  PHE A O   1 
ATOM   1142 C CB  . PHE A 1 141 ? 22.353 19.095  42.362  1.00 49.60  ? 175  PHE A CB  1 
ATOM   1143 C CG  . PHE A 1 141 ? 23.234 19.341  43.547  1.00 53.73  ? 175  PHE A CG  1 
ATOM   1144 C CD1 . PHE A 1 141 ? 23.599 18.293  44.386  1.00 56.34  ? 175  PHE A CD1 1 
ATOM   1145 C CD2 . PHE A 1 141 ? 23.720 20.619  43.815  1.00 54.44  ? 175  PHE A CD2 1 
ATOM   1146 C CE1 . PHE A 1 141 ? 24.445 18.512  45.485  1.00 58.99  ? 175  PHE A CE1 1 
ATOM   1147 C CE2 . PHE A 1 141 ? 24.564 20.852  44.907  1.00 56.61  ? 175  PHE A CE2 1 
ATOM   1148 C CZ  . PHE A 1 141 ? 24.927 19.798  45.745  1.00 57.63  ? 175  PHE A CZ  1 
ATOM   1149 N N   . GLY A 1 142 ? 19.365 18.036  41.025  1.00 45.52  ? 176  GLY A N   1 
ATOM   1150 C CA  . GLY A 1 142 ? 18.647 18.032  39.765  1.00 44.31  ? 176  GLY A CA  1 
ATOM   1151 C C   . GLY A 1 142 ? 19.513 17.519  38.617  1.00 45.01  ? 176  GLY A C   1 
ATOM   1152 O O   . GLY A 1 142 ? 19.091 17.528  37.454  1.00 45.70  ? 176  GLY A O   1 
ATOM   1153 N N   . ILE A 1 143 ? 20.725 17.069  38.944  1.00 43.30  ? 177  ILE A N   1 
ATOM   1154 C CA  . ILE A 1 143 ? 21.667 16.544  37.959  1.00 42.03  ? 177  ILE A CA  1 
ATOM   1155 C C   . ILE A 1 143 ? 21.489 15.045  37.733  1.00 42.64  ? 177  ILE A C   1 
ATOM   1156 O O   . ILE A 1 143 ? 21.425 14.264  38.685  1.00 43.56  ? 177  ILE A O   1 
ATOM   1157 C CB  . ILE A 1 143 ? 23.115 16.802  38.399  1.00 42.37  ? 177  ILE A CB  1 
ATOM   1158 C CG1 . ILE A 1 143 ? 23.330 18.306  38.537  1.00 43.97  ? 177  ILE A CG1 1 
ATOM   1159 C CG2 . ILE A 1 143 ? 24.094 16.192  37.394  1.00 39.37  ? 177  ILE A CG2 1 
ATOM   1160 C CD1 . ILE A 1 143 ? 24.709 18.694  39.046  1.00 46.48  ? 177  ILE A CD1 1 
ATOM   1161 N N   . CYS A 1 144 ? 21.392 14.663  36.463  1.00 40.89  ? 178  CYS A N   1 
ATOM   1162 C CA  . CYS A 1 144 ? 21.228 13.271  36.055  1.00 39.57  ? 178  CYS A CA  1 
ATOM   1163 C C   . CYS A 1 144 ? 22.530 12.891  35.347  1.00 38.48  ? 178  CYS A C   1 
ATOM   1164 O O   . CYS A 1 144 ? 23.014 13.626  34.476  1.00 38.30  ? 178  CYS A O   1 
ATOM   1165 C CB  . CYS A 1 144 ? 20.033 13.168  35.110  1.00 42.02  ? 178  CYS A CB  1 
ATOM   1166 S SG  . CYS A 1 144 ? 19.544 11.510  34.566  1.00 51.43  ? 178  CYS A SG  1 
ATOM   1167 N N   . HIS A 1 145 ? 23.115 11.766  35.752  1.00 36.64  ? 179  HIS A N   1 
ATOM   1168 C CA  . HIS A 1 145 ? 24.372 11.304  35.172  1.00 35.08  ? 179  HIS A CA  1 
ATOM   1169 C C   . HIS A 1 145 ? 24.195 10.924  33.693  1.00 35.21  ? 179  HIS A C   1 
ATOM   1170 O O   . HIS A 1 145 ? 25.003 11.286  32.834  1.00 33.43  ? 179  HIS A O   1 
ATOM   1171 C CB  . HIS A 1 145 ? 24.911 10.123  35.977  1.00 33.50  ? 179  HIS A CB  1 
ATOM   1172 C CG  . HIS A 1 145 ? 26.292 9.705   35.574  1.00 32.37  ? 179  HIS A CG  1 
ATOM   1173 N ND1 . HIS A 1 145 ? 26.542 8.953   34.450  1.00 30.83  ? 179  HIS A ND1 1 
ATOM   1174 C CD2 . HIS A 1 145 ? 27.498 9.956   36.137  1.00 32.50  ? 179  HIS A CD2 1 
ATOM   1175 C CE1 . HIS A 1 145 ? 27.842 8.750   34.336  1.00 29.04  ? 179  HIS A CE1 1 
ATOM   1176 N NE2 . HIS A 1 145 ? 28.444 9.349   35.346  1.00 31.73  ? 179  HIS A NE2 1 
ATOM   1177 N N   . ARG A 1 146 ? 23.123 10.195  33.413  1.00 34.93  ? 180  ARG A N   1 
ATOM   1178 C CA  . ARG A 1 146 ? 22.778 9.777   32.065  1.00 35.72  ? 180  ARG A CA  1 
ATOM   1179 C C   . ARG A 1 146 ? 23.684 8.746   31.379  1.00 36.93  ? 180  ARG A C   1 
ATOM   1180 O O   . ARG A 1 146 ? 23.473 8.416   30.208  1.00 39.39  ? 180  ARG A O   1 
ATOM   1181 C CB  . ARG A 1 146 ? 22.603 11.009  31.187  1.00 32.53  ? 180  ARG A CB  1 
ATOM   1182 C CG  . ARG A 1 146 ? 21.487 11.891  31.711  1.00 34.04  ? 180  ARG A CG  1 
ATOM   1183 C CD  . ARG A 1 146 ? 20.890 12.749  30.629  1.00 31.53  ? 180  ARG A CD  1 
ATOM   1184 N NE  . ARG A 1 146 ? 21.906 13.554  29.976  1.00 31.45  ? 180  ARG A NE  1 
ATOM   1185 C CZ  . ARG A 1 146 ? 21.654 14.354  28.948  1.00 33.13  ? 180  ARG A CZ  1 
ATOM   1186 N NH1 . ARG A 1 146 ? 20.409 14.440  28.474  1.00 29.15  ? 180  ARG A NH1 1 
ATOM   1187 N NH2 . ARG A 1 146 ? 22.643 15.058  28.396  1.00 30.18  ? 180  ARG A NH2 1 
ATOM   1188 N N   . ASP A 1 147 ? 24.662 8.209   32.108  1.00 35.31  ? 181  ASP A N   1 
ATOM   1189 C CA  . ASP A 1 147 ? 25.531 7.192   31.550  1.00 34.40  ? 181  ASP A CA  1 
ATOM   1190 C C   . ASP A 1 147 ? 26.126 6.261   32.607  1.00 35.06  ? 181  ASP A C   1 
ATOM   1191 O O   . ASP A 1 147 ? 27.316 5.933   32.560  1.00 34.99  ? 181  ASP A O   1 
ATOM   1192 C CB  . ASP A 1 147 ? 26.640 7.829   30.714  1.00 36.68  ? 181  ASP A CB  1 
ATOM   1193 C CG  . ASP A 1 147 ? 27.377 6.805   29.834  1.00 40.11  ? 181  ASP A CG  1 
ATOM   1194 O OD1 . ASP A 1 147 ? 26.737 5.817   29.395  1.00 39.78  ? 181  ASP A OD1 1 
ATOM   1195 O OD2 . ASP A 1 147 ? 28.584 7.004   29.552  1.00 40.68  ? 181  ASP A OD2 1 
ATOM   1196 N N   . ILE A 1 148 ? 25.302 5.836   33.561  1.00 32.80  ? 182  ILE A N   1 
ATOM   1197 C CA  . ILE A 1 148 ? 25.773 4.927   34.594  1.00 32.80  ? 182  ILE A CA  1 
ATOM   1198 C C   . ILE A 1 148 ? 26.047 3.565   33.946  1.00 35.06  ? 182  ILE A C   1 
ATOM   1199 O O   . ILE A 1 148 ? 25.195 3.023   33.241  1.00 36.23  ? 182  ILE A O   1 
ATOM   1200 C CB  . ILE A 1 148 ? 24.714 4.722   35.700  1.00 33.25  ? 182  ILE A CB  1 
ATOM   1201 C CG1 . ILE A 1 148 ? 24.312 6.063   36.317  1.00 32.21  ? 182  ILE A CG1 1 
ATOM   1202 C CG2 . ILE A 1 148 ? 25.252 3.766   36.763  1.00 30.36  ? 182  ILE A CG2 1 
ATOM   1203 C CD1 . ILE A 1 148 ? 25.429 6.770   37.065  1.00 34.02  ? 182  ILE A CD1 1 
ATOM   1204 N N   . LYS A 1 149 ? 27.240 3.029   34.180  1.00 33.56  ? 183  LYS A N   1 
ATOM   1205 C CA  . LYS A 1 149 ? 27.639 1.728   33.664  1.00 30.66  ? 183  LYS A CA  1 
ATOM   1206 C C   . LYS A 1 149 ? 28.887 1.308   34.432  1.00 32.36  ? 183  LYS A C   1 
ATOM   1207 O O   . LYS A 1 149 ? 29.630 2.153   34.930  1.00 32.77  ? 183  LYS A O   1 
ATOM   1208 C CB  . LYS A 1 149 ? 27.929 1.793   32.178  1.00 30.88  ? 183  LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 149 ? 29.007 2.771   31.794  1.00 33.42  ? 183  LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 149 ? 29.189 2.779   30.293  1.00 33.81  ? 183  LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 149 ? 29.879 4.032   29.829  1.00 35.32  ? 183  LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 149 ? 30.023 3.999   28.356  1.00 39.99  ? 183  LYS A NZ  1 
ATOM   1213 N N   . PRO A 1 150 ? 29.137 -0.007  34.536  1.00 34.46  ? 184  PRO A N   1 
ATOM   1214 C CA  . PRO A 1 150 ? 30.291 -0.561  35.252  1.00 32.07  ? 184  PRO A CA  1 
ATOM   1215 C C   . PRO A 1 150 ? 31.641 0.135   35.011  1.00 32.69  ? 184  PRO A C   1 
ATOM   1216 O O   . PRO A 1 150 ? 32.460 0.236   35.926  1.00 34.44  ? 184  PRO A O   1 
ATOM   1217 C CB  . PRO A 1 150 ? 30.291 -2.021  34.804  1.00 33.21  ? 184  PRO A CB  1 
ATOM   1218 C CG  . PRO A 1 150 ? 28.837 -2.298  34.572  1.00 32.36  ? 184  PRO A CG  1 
ATOM   1219 C CD  . PRO A 1 150 ? 28.412 -1.074  33.819  1.00 32.01  ? 184  PRO A CD  1 
ATOM   1220 N N   . GLN A 1 151 ? 31.868 0.612   33.791  1.00 33.50  ? 185  GLN A N   1 
ATOM   1221 C CA  . GLN A 1 151 ? 33.120 1.291   33.451  1.00 36.21  ? 185  GLN A CA  1 
ATOM   1222 C C   . GLN A 1 151 ? 33.271 2.666   34.133  1.00 37.10  ? 185  GLN A C   1 
ATOM   1223 O O   . GLN A 1 151 ? 34.382 3.168   34.282  1.00 37.36  ? 185  GLN A O   1 
ATOM   1224 C CB  . GLN A 1 151 ? 33.230 1.469   31.928  1.00 36.89  ? 185  GLN A CB  1 
ATOM   1225 C CG  . GLN A 1 151 ? 33.237 0.174   31.087  1.00 42.14  ? 185  GLN A CG  1 
ATOM   1226 C CD  . GLN A 1 151 ? 31.839 -0.308  30.650  1.00 45.66  ? 185  GLN A CD  1 
ATOM   1227 O OE1 . GLN A 1 151 ? 31.625 -0.633  29.478  1.00 48.85  ? 185  GLN A OE1 1 
ATOM   1228 N NE2 . GLN A 1 151 ? 30.896 -0.360  31.588  1.00 45.15  ? 185  GLN A NE2 1 
ATOM   1229 N N   . ASN A 1 152 ? 32.154 3.270   34.535  1.00 38.06  ? 186  ASN A N   1 
ATOM   1230 C CA  . ASN A 1 152 ? 32.178 4.580   35.176  1.00 38.55  ? 186  ASN A CA  1 
ATOM   1231 C C   . ASN A 1 152 ? 32.123 4.488   36.693  1.00 39.16  ? 186  ASN A C   1 
ATOM   1232 O O   . ASN A 1 152 ? 31.930 5.498   37.383  1.00 40.13  ? 186  ASN A O   1 
ATOM   1233 C CB  . ASN A 1 152 ? 31.011 5.447   34.695  1.00 40.14  ? 186  ASN A CB  1 
ATOM   1234 C CG  . ASN A 1 152 ? 31.132 5.833   33.239  1.00 45.49  ? 186  ASN A CG  1 
ATOM   1235 O OD1 . ASN A 1 152 ? 32.233 6.113   32.743  1.00 47.96  ? 186  ASN A OD1 1 
ATOM   1236 N ND2 . ASN A 1 152 ? 29.998 5.873   32.541  1.00 46.60  ? 186  ASN A ND2 1 
ATOM   1237 N N   . LEU A 1 153 ? 32.276 3.283   37.222  1.00 36.36  ? 187  LEU A N   1 
ATOM   1238 C CA  . LEU A 1 153 ? 32.253 3.123   38.660  1.00 36.30  ? 187  LEU A CA  1 
ATOM   1239 C C   . LEU A 1 153 ? 33.667 2.754   39.100  1.00 38.98  ? 187  LEU A C   1 
ATOM   1240 O O   . LEU A 1 153 ? 34.078 1.599   38.999  1.00 39.03  ? 187  LEU A O   1 
ATOM   1241 C CB  . LEU A 1 153 ? 31.235 2.044   39.039  1.00 34.51  ? 187  LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 153 ? 29.823 2.279   38.462  1.00 35.30  ? 187  LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 153 ? 28.884 1.163   38.912  1.00 31.95  ? 187  LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 153 ? 29.279 3.652   38.908  1.00 32.51  ? 187  LEU A CD2 1 
ATOM   1245 N N   . LEU A 1 154 ? 34.423 3.752   39.561  1.00 40.70  ? 188  LEU A N   1 
ATOM   1246 C CA  . LEU A 1 154 ? 35.796 3.526   40.003  1.00 42.73  ? 188  LEU A CA  1 
ATOM   1247 C C   . LEU A 1 154 ? 35.826 2.889   41.387  1.00 44.16  ? 188  LEU A C   1 
ATOM   1248 O O   . LEU A 1 154 ? 35.038 3.246   42.261  1.00 46.12  ? 188  LEU A O   1 
ATOM   1249 C CB  . LEU A 1 154 ? 36.568 4.843   40.035  1.00 43.15  ? 188  LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 154 ? 36.436 5.741   38.801  1.00 45.38  ? 188  LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 154 ? 37.496 6.828   38.869  1.00 43.77  ? 188  LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 154 ? 36.589 4.925   37.523  1.00 43.05  ? 188  LEU A CD2 1 
ATOM   1253 N N   . LEU A 1 155 ? 36.743 1.948   41.580  1.00 44.96  ? 189  LEU A N   1 
ATOM   1254 C CA  . LEU A 1 155 ? 36.876 1.248   42.848  1.00 45.96  ? 189  LEU A CA  1 
ATOM   1255 C C   . LEU A 1 155 ? 38.287 1.271   43.407  1.00 48.00  ? 189  LEU A C   1 
ATOM   1256 O O   . LEU A 1 155 ? 39.261 1.412   42.674  1.00 49.29  ? 189  LEU A O   1 
ATOM   1257 C CB  . LEU A 1 155 ? 36.474 -0.213  42.690  1.00 45.38  ? 189  LEU A CB  1 
ATOM   1258 C CG  . LEU A 1 155 ? 35.014 -0.573  42.476  1.00 47.34  ? 189  LEU A CG  1 
ATOM   1259 C CD1 . LEU A 1 155 ? 34.924 -2.064  42.206  1.00 48.56  ? 189  LEU A CD1 1 
ATOM   1260 C CD2 . LEU A 1 155 ? 34.188 -0.193  43.693  1.00 48.17  ? 189  LEU A CD2 1 
ATOM   1261 N N   . ASP A 1 156 ? 38.381 1.121   44.721  1.00 50.37  ? 190  ASP A N   1 
ATOM   1262 C CA  . ASP A 1 156 ? 39.655 1.057   45.412  1.00 54.34  ? 190  ASP A CA  1 
ATOM   1263 C C   . ASP A 1 156 ? 39.622 -0.301  46.101  1.00 56.86  ? 190  ASP A C   1 
ATOM   1264 O O   . ASP A 1 156 ? 38.852 -0.516  47.042  1.00 57.59  ? 190  ASP A O   1 
ATOM   1265 C CB  . ASP A 1 156 ? 39.775 2.159   46.453  1.00 57.57  ? 190  ASP A CB  1 
ATOM   1266 C CG  . ASP A 1 156 ? 41.112 2.130   47.176  1.00 62.12  ? 190  ASP A CG  1 
ATOM   1267 O OD1 . ASP A 1 156 ? 41.407 1.126   47.877  1.00 62.68  ? 190  ASP A OD1 1 
ATOM   1268 O OD2 . ASP A 1 156 ? 41.872 3.116   47.038  1.00 64.91  ? 190  ASP A OD2 1 
ATOM   1269 N N   . PRO A 1 157 ? 40.467 -1.235  45.645  1.00 58.67  ? 191  PRO A N   1 
ATOM   1270 C CA  . PRO A 1 157 ? 40.549 -2.594  46.193  1.00 59.69  ? 191  PRO A CA  1 
ATOM   1271 C C   . PRO A 1 157 ? 40.595 -2.689  47.719  1.00 59.88  ? 191  PRO A C   1 
ATOM   1272 O O   . PRO A 1 157 ? 39.791 -3.393  48.333  1.00 59.29  ? 191  PRO A O   1 
ATOM   1273 C CB  . PRO A 1 157 ? 41.821 -3.141  45.552  1.00 60.58  ? 191  PRO A CB  1 
ATOM   1274 C CG  . PRO A 1 157 ? 41.888 -2.399  44.252  1.00 60.99  ? 191  PRO A CG  1 
ATOM   1275 C CD  . PRO A 1 157 ? 41.555 -1.000  44.681  1.00 59.43  ? 191  PRO A CD  1 
ATOM   1276 N N   . ASP A 1 158 ? 41.538 -1.970  48.318  1.00 59.90  ? 192  ASP A N   1 
ATOM   1277 C CA  . ASP A 1 158 ? 41.728 -1.987  49.762  1.00 60.37  ? 192  ASP A CA  1 
ATOM   1278 C C   . ASP A 1 158 ? 40.584 -1.422  50.598  1.00 58.61  ? 192  ASP A C   1 
ATOM   1279 O O   . ASP A 1 158 ? 40.055 -2.114  51.473  1.00 58.72  ? 192  ASP A O   1 
ATOM   1280 C CB  . ASP A 1 158 ? 43.024 -1.253  50.125  1.00 63.34  ? 192  ASP A CB  1 
ATOM   1281 C CG  . ASP A 1 158 ? 44.176 -1.599  49.186  1.00 66.30  ? 192  ASP A CG  1 
ATOM   1282 O OD1 . ASP A 1 158 ? 44.296 -2.788  48.778  1.00 65.30  ? 192  ASP A OD1 1 
ATOM   1283 O OD2 . ASP A 1 158 ? 44.969 -0.677  48.872  1.00 67.53  ? 192  ASP A OD2 1 
ATOM   1284 N N   . THR A 1 159 ? 40.204 -0.172  50.340  1.00 56.05  ? 193  THR A N   1 
ATOM   1285 C CA  . THR A 1 159 ? 39.149 0.474   51.115  1.00 52.96  ? 193  THR A CA  1 
ATOM   1286 C C   . THR A 1 159 ? 37.727 0.096   50.730  1.00 50.31  ? 193  THR A C   1 
ATOM   1287 O O   . THR A 1 159 ? 36.810 0.302   51.515  1.00 48.90  ? 193  THR A O   1 
ATOM   1288 C CB  . THR A 1 159 ? 39.266 1.999   51.030  1.00 54.37  ? 193  THR A CB  1 
ATOM   1289 O OG1 . THR A 1 159 ? 38.997 2.429   49.685  1.00 55.84  ? 193  THR A OG1 1 
ATOM   1290 C CG2 . THR A 1 159 ? 40.671 2.439   51.433  1.00 53.85  ? 193  THR A CG2 1 
ATOM   1291 N N   . ALA A 1 160 ? 37.543 -0.451  49.530  1.00 47.91  ? 194  ALA A N   1 
ATOM   1292 C CA  . ALA A 1 160 ? 36.213 -0.844  49.058  1.00 45.05  ? 194  ALA A CA  1 
ATOM   1293 C C   . ALA A 1 160 ? 35.323 0.376   48.788  1.00 43.84  ? 194  ALA A C   1 
ATOM   1294 O O   . ALA A 1 160 ? 34.104 0.274   48.763  1.00 44.88  ? 194  ALA A O   1 
ATOM   1295 C CB  . ALA A 1 160 ? 35.547 -1.757  50.078  1.00 42.38  ? 194  ALA A CB  1 
ATOM   1296 N N   . VAL A 1 161 ? 35.945 1.531   48.591  1.00 43.01  ? 195  VAL A N   1 
ATOM   1297 C CA  . VAL A 1 161 ? 35.227 2.764   48.305  1.00 40.82  ? 195  VAL A CA  1 
ATOM   1298 C C   . VAL A 1 161 ? 34.940 2.822   46.816  1.00 40.88  ? 195  VAL A C   1 
ATOM   1299 O O   . VAL A 1 161 ? 35.799 2.483   45.985  1.00 39.40  ? 195  VAL A O   1 
ATOM   1300 C CB  . VAL A 1 161 ? 36.065 4.015   48.682  1.00 40.75  ? 195  VAL A CB  1 
ATOM   1301 C CG1 . VAL A 1 161 ? 35.335 5.281   48.276  1.00 41.99  ? 195  VAL A CG1 1 
ATOM   1302 C CG2 . VAL A 1 161 ? 36.329 4.032   50.176  1.00 42.17  ? 195  VAL A CG2 1 
ATOM   1303 N N   . LEU A 1 162 ? 33.727 3.245   46.474  1.00 38.71  ? 196  LEU A N   1 
ATOM   1304 C CA  . LEU A 1 162 ? 33.351 3.360   45.073  1.00 36.46  ? 196  LEU A CA  1 
ATOM   1305 C C   . LEU A 1 162 ? 33.083 4.830   44.774  1.00 37.04  ? 196  LEU A C   1 
ATOM   1306 O O   . LEU A 1 162 ? 32.531 5.550   45.599  1.00 37.31  ? 196  LEU A O   1 
ATOM   1307 C CB  . LEU A 1 162 ? 32.114 2.512   44.798  1.00 34.48  ? 196  LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 162 ? 31.435 2.632   43.437  1.00 33.96  ? 196  LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 162 ? 30.587 1.400   43.188  1.00 33.31  ? 196  LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 162 ? 30.573 3.893   43.394  1.00 32.27  ? 196  LEU A CD2 1 
ATOM   1311 N N   . LYS A 1 163 ? 33.498 5.269   43.595  1.00 36.36  ? 197  LYS A N   1 
ATOM   1312 C CA  . LYS A 1 163 ? 33.319 6.647   43.175  1.00 37.00  ? 197  LYS A CA  1 
ATOM   1313 C C   . LYS A 1 163 ? 32.781 6.695   41.751  1.00 37.87  ? 197  LYS A C   1 
ATOM   1314 O O   . LYS A 1 163 ? 33.304 6.018   40.854  1.00 39.05  ? 197  LYS A O   1 
ATOM   1315 C CB  . LYS A 1 163 ? 34.651 7.407   43.240  1.00 37.89  ? 197  LYS A CB  1 
ATOM   1316 C CG  . LYS A 1 163 ? 35.255 7.565   44.647  1.00 41.41  ? 197  LYS A CG  1 
ATOM   1317 C CD  . LYS A 1 163 ? 36.570 8.354   44.574  1.00 45.80  ? 197  LYS A CD  1 
ATOM   1318 C CE  . LYS A 1 163 ? 37.287 8.470   45.919  1.00 46.72  ? 197  LYS A CE  1 
ATOM   1319 N NZ  . LYS A 1 163 ? 36.530 9.244   46.942  1.00 47.85  ? 197  LYS A NZ  1 
ATOM   1320 N N   . LEU A 1 164 ? 31.732 7.486   41.543  1.00 36.94  ? 198  LEU A N   1 
ATOM   1321 C CA  . LEU A 1 164 ? 31.127 7.633   40.223  1.00 36.79  ? 198  LEU A CA  1 
ATOM   1322 C C   . LEU A 1 164 ? 32.008 8.591   39.414  1.00 37.21  ? 198  LEU A C   1 
ATOM   1323 O O   . LEU A 1 164 ? 32.483 9.580   39.950  1.00 37.75  ? 198  LEU A O   1 
ATOM   1324 C CB  . LEU A 1 164 ? 29.719 8.194   40.390  1.00 36.63  ? 198  LEU A CB  1 
ATOM   1325 C CG  . LEU A 1 164 ? 28.917 8.502   39.140  1.00 37.95  ? 198  LEU A CG  1 
ATOM   1326 C CD1 . LEU A 1 164 ? 28.720 7.247   38.315  1.00 36.61  ? 198  LEU A CD1 1 
ATOM   1327 C CD2 . LEU A 1 164 ? 27.585 9.092   39.566  1.00 39.27  ? 198  LEU A CD2 1 
ATOM   1328 N N   . CYS A 1 165 ? 32.234 8.295   38.139  1.00 38.47  ? 199  CYS A N   1 
ATOM   1329 C CA  . CYS A 1 165 ? 33.074 9.144   37.304  1.00 39.86  ? 199  CYS A CA  1 
ATOM   1330 C C   . CYS A 1 165 ? 32.402 9.431   35.981  1.00 40.91  ? 199  CYS A C   1 
ATOM   1331 O O   . CYS A 1 165 ? 31.254 9.058   35.759  1.00 41.34  ? 199  CYS A O   1 
ATOM   1332 C CB  . CYS A 1 165 ? 34.430 8.468   37.037  1.00 41.51  ? 199  CYS A CB  1 
ATOM   1333 S SG  . CYS A 1 165 ? 35.765 9.561   36.421  1.00 51.01  ? 199  CYS A SG  1 
ATOM   1334 N N   . ASP A 1 166 ? 33.141 10.112  35.112  1.00 42.71  ? 200  ASP A N   1 
ATOM   1335 C CA  . ASP A 1 166 ? 32.698 10.461  33.768  1.00 42.93  ? 200  ASP A CA  1 
ATOM   1336 C C   . ASP A 1 166 ? 31.373 11.214  33.674  1.00 41.89  ? 200  ASP A C   1 
ATOM   1337 O O   . ASP A 1 166 ? 30.358 10.644  33.295  1.00 41.84  ? 200  ASP A O   1 
ATOM   1338 C CB  . ASP A 1 166 ? 32.618 9.195   32.916  1.00 46.57  ? 200  ASP A CB  1 
ATOM   1339 C CG  . ASP A 1 166 ? 32.646 9.495   31.438  1.00 52.51  ? 200  ASP A CG  1 
ATOM   1340 O OD1 . ASP A 1 166 ? 32.040 10.523  31.042  1.00 54.06  ? 200  ASP A OD1 1 
ATOM   1341 O OD2 . ASP A 1 166 ? 33.262 8.710   30.670  1.00 55.07  ? 200  ASP A OD2 1 
ATOM   1342 N N   . PHE A 1 167 ? 31.389 12.506  33.988  1.00 41.22  ? 201  PHE A N   1 
ATOM   1343 C CA  . PHE A 1 167 ? 30.172 13.307  33.903  1.00 39.35  ? 201  PHE A CA  1 
ATOM   1344 C C   . PHE A 1 167 ? 29.979 13.992  32.560  1.00 39.30  ? 201  PHE A C   1 
ATOM   1345 O O   . PHE A 1 167 ? 29.228 14.958  32.460  1.00 39.08  ? 201  PHE A O   1 
ATOM   1346 C CB  . PHE A 1 167 ? 30.130 14.342  35.022  1.00 35.94  ? 201  PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 167 ? 29.868 13.742  36.355  1.00 34.61  ? 201  PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 167 ? 30.862 13.017  37.011  1.00 33.61  ? 201  PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 167 ? 28.609 13.838  36.931  1.00 32.89  ? 201  PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 167 ? 30.606 12.396  38.223  1.00 34.39  ? 201  PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 167 ? 28.335 13.219  38.148  1.00 33.18  ? 201  PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 167 ? 29.334 12.494  38.796  1.00 34.45  ? 201  PHE A CZ  1 
ATOM   1353 N N   . GLY A 1 168 ? 30.644 13.476  31.527  1.00 39.43  ? 202  GLY A N   1 
ATOM   1354 C CA  . GLY A 1 168 ? 30.525 14.049  30.197  1.00 37.82  ? 202  GLY A CA  1 
ATOM   1355 C C   . GLY A 1 168 ? 29.127 14.024  29.603  1.00 38.49  ? 202  GLY A C   1 
ATOM   1356 O O   . GLY A 1 168 ? 28.856 14.755  28.655  1.00 39.89  ? 202  GLY A O   1 
ATOM   1357 N N   . SER A 1 169 ? 28.237 13.193  30.140  1.00 38.39  ? 203  SER A N   1 
ATOM   1358 C CA  . SER A 1 169 ? 26.867 13.121  29.633  1.00 38.93  ? 203  SER A CA  1 
ATOM   1359 C C   . SER A 1 169 ? 25.875 13.704  30.637  1.00 40.38  ? 203  SER A C   1 
ATOM   1360 O O   . SER A 1 169 ? 24.680 13.811  30.339  1.00 40.31  ? 203  SER A O   1 
ATOM   1361 C CB  . SER A 1 169 ? 26.462 11.669  29.332  1.00 40.46  ? 203  SER A CB  1 
ATOM   1362 O OG  . SER A 1 169 ? 27.170 11.128  28.219  1.00 44.12  ? 203  SER A OG  1 
ATOM   1363 N N   . ALA A 1 170 ? 26.366 14.088  31.816  1.00 39.03  ? 204  ALA A N   1 
ATOM   1364 C CA  . ALA A 1 170 ? 25.504 14.636  32.858  1.00 39.24  ? 204  ALA A CA  1 
ATOM   1365 C C   . ALA A 1 170 ? 24.862 15.950  32.467  1.00 41.09  ? 204  ALA A C   1 
ATOM   1366 O O   . ALA A 1 170 ? 25.422 16.725  31.693  1.00 39.52  ? 204  ALA A O   1 
ATOM   1367 C CB  . ALA A 1 170 ? 26.283 14.812  34.144  1.00 40.76  ? 204  ALA A CB  1 
ATOM   1368 N N   . LYS A 1 171 ? 23.682 16.200  33.024  1.00 43.68  ? 205  LYS A N   1 
ATOM   1369 C CA  . LYS A 1 171 ? 22.947 17.421  32.723  1.00 45.62  ? 205  LYS A CA  1 
ATOM   1370 C C   . LYS A 1 171 ? 21.891 17.747  33.769  1.00 47.10  ? 205  LYS A C   1 
ATOM   1371 O O   . LYS A 1 171 ? 21.274 16.851  34.343  1.00 46.95  ? 205  LYS A O   1 
ATOM   1372 C CB  . LYS A 1 171 ? 22.267 17.283  31.365  1.00 46.32  ? 205  LYS A CB  1 
ATOM   1373 C CG  . LYS A 1 171 ? 21.506 18.507  30.928  1.00 46.78  ? 205  LYS A CG  1 
ATOM   1374 C CD  . LYS A 1 171 ? 20.499 18.174  29.851  1.00 46.92  ? 205  LYS A CD  1 
ATOM   1375 C CE  . LYS A 1 171 ? 19.697 19.408  29.447  1.00 46.24  ? 205  LYS A CE  1 
ATOM   1376 N NZ  . LYS A 1 171 ? 18.653 19.093  28.420  1.00 43.66  ? 205  LYS A NZ  1 
ATOM   1377 N N   . GLN A 1 172 ? 21.689 19.041  34.003  1.00 49.69  ? 206  GLN A N   1 
ATOM   1378 C CA  . GLN A 1 172 ? 20.693 19.530  34.956  1.00 51.70  ? 206  GLN A CA  1 
ATOM   1379 C C   . GLN A 1 172 ? 19.350 19.324  34.239  1.00 50.48  ? 206  GLN A C   1 
ATOM   1380 O O   . GLN A 1 172 ? 19.103 19.971  33.231  1.00 51.40  ? 206  GLN A O   1 
ATOM   1381 C CB  . GLN A 1 172 ? 20.933 21.028  35.202  1.00 55.25  ? 206  GLN A CB  1 
ATOM   1382 C CG  . GLN A 1 172 ? 20.530 21.579  36.581  1.00 61.29  ? 206  GLN A CG  1 
ATOM   1383 C CD  . GLN A 1 172 ? 21.709 21.613  37.568  1.00 64.43  ? 206  GLN A CD  1 
ATOM   1384 O OE1 . GLN A 1 172 ? 22.829 22.036  37.225  1.00 63.03  ? 206  GLN A OE1 1 
ATOM   1385 N NE2 . GLN A 1 172 ? 21.452 21.198  38.804  1.00 66.45  ? 206  GLN A NE2 1 
ATOM   1386 N N   . LEU A 1 173 ? 18.502 18.418  34.717  1.00 49.63  ? 207  LEU A N   1 
ATOM   1387 C CA  . LEU A 1 173 ? 17.223 18.193  34.041  1.00 50.12  ? 207  LEU A CA  1 
ATOM   1388 C C   . LEU A 1 173 ? 16.120 19.080  34.567  1.00 52.78  ? 207  LEU A C   1 
ATOM   1389 O O   . LEU A 1 173 ? 15.672 18.932  35.704  1.00 55.16  ? 207  LEU A O   1 
ATOM   1390 C CB  . LEU A 1 173 ? 16.757 16.753  34.170  1.00 47.04  ? 207  LEU A CB  1 
ATOM   1391 C CG  . LEU A 1 173 ? 17.604 15.644  33.580  1.00 45.69  ? 207  LEU A CG  1 
ATOM   1392 C CD1 . LEU A 1 173 ? 16.791 14.368  33.696  1.00 46.13  ? 207  LEU A CD1 1 
ATOM   1393 C CD2 . LEU A 1 173 ? 17.974 15.932  32.128  1.00 45.46  ? 207  LEU A CD2 1 
ATOM   1394 N N   . VAL A 1 174 ? 15.661 19.989  33.721  1.00 54.84  ? 208  VAL A N   1 
ATOM   1395 C CA  . VAL A 1 174 ? 14.607 20.918  34.092  1.00 56.78  ? 208  VAL A CA  1 
ATOM   1396 C C   . VAL A 1 174 ? 13.265 20.480  33.508  1.00 58.32  ? 208  VAL A C   1 
ATOM   1397 O O   . VAL A 1 174 ? 13.171 20.190  32.319  1.00 58.32  ? 208  VAL A O   1 
ATOM   1398 C CB  . VAL A 1 174 ? 14.946 22.320  33.574  1.00 56.57  ? 208  VAL A CB  1 
ATOM   1399 C CG1 . VAL A 1 174 ? 13.896 23.305  34.028  1.00 56.45  ? 208  VAL A CG1 1 
ATOM   1400 C CG2 . VAL A 1 174 ? 16.332 22.722  34.049  1.00 54.53  ? 208  VAL A CG2 1 
ATOM   1401 N N   . ARG A 1 175 ? 12.232 20.429  34.343  1.00 60.38  ? 209  ARG A N   1 
ATOM   1402 C CA  . ARG A 1 175 ? 10.900 20.036  33.885  1.00 63.39  ? 209  ARG A CA  1 
ATOM   1403 C C   . ARG A 1 175 ? 10.436 20.912  32.724  1.00 64.11  ? 209  ARG A C   1 
ATOM   1404 O O   . ARG A 1 175 ? 10.614 22.134  32.736  1.00 64.03  ? 209  ARG A O   1 
ATOM   1405 C CB  . ARG A 1 175 ? 9.883  20.163  35.012  1.00 67.08  ? 209  ARG A CB  1 
ATOM   1406 C CG  . ARG A 1 175 ? 9.417  18.858  35.586  1.00 72.12  ? 209  ARG A CG  1 
ATOM   1407 C CD  . ARG A 1 175 ? 8.247  19.111  36.509  1.00 77.37  ? 209  ARG A CD  1 
ATOM   1408 N NE  . ARG A 1 175 ? 7.842  17.900  37.211  1.00 82.81  ? 209  ARG A NE  1 
ATOM   1409 C CZ  . ARG A 1 175 ? 6.833  17.842  38.078  1.00 85.28  ? 209  ARG A CZ  1 
ATOM   1410 N NH1 . ARG A 1 175 ? 6.124  18.936  38.348  1.00 85.74  ? 209  ARG A NH1 1 
ATOM   1411 N NH2 . ARG A 1 175 ? 6.533  16.691  38.677  1.00 85.61  ? 209  ARG A NH2 1 
ATOM   1412 N N   . GLY A 1 176 ? 9.828  20.287  31.723  1.00 63.55  ? 210  GLY A N   1 
ATOM   1413 C CA  . GLY A 1 176 ? 9.357  21.043  30.582  1.00 62.71  ? 210  GLY A CA  1 
ATOM   1414 C C   . GLY A 1 176 ? 10.404 21.267  29.510  1.00 62.91  ? 210  GLY A C   1 
ATOM   1415 O O   . GLY A 1 176 ? 10.064 21.635  28.392  1.00 63.45  ? 210  GLY A O   1 
ATOM   1416 N N   . GLU A 1 177 ? 11.677 21.059  29.831  1.00 63.76  ? 211  GLU A N   1 
ATOM   1417 C CA  . GLU A 1 177 ? 12.728 21.237  28.828  1.00 64.05  ? 211  GLU A CA  1 
ATOM   1418 C C   . GLU A 1 177 ? 13.143 19.887  28.260  1.00 61.78  ? 211  GLU A C   1 
ATOM   1419 O O   . GLU A 1 177 ? 13.443 18.959  29.003  1.00 62.18  ? 211  GLU A O   1 
ATOM   1420 C CB  . GLU A 1 177 ? 13.935 21.940  29.428  1.00 66.26  ? 211  GLU A CB  1 
ATOM   1421 C CG  . GLU A 1 177 ? 13.576 23.212  30.152  1.00 71.11  ? 211  GLU A CG  1 
ATOM   1422 C CD  . GLU A 1 177 ? 14.782 24.079  30.416  1.00 73.45  ? 211  GLU A CD  1 
ATOM   1423 O OE1 . GLU A 1 177 ? 15.836 23.532  30.801  1.00 75.76  ? 211  GLU A OE1 1 
ATOM   1424 O OE2 . GLU A 1 177 ? 14.674 25.311  30.253  1.00 75.65  ? 211  GLU A OE2 1 
ATOM   1425 N N   . PRO A 1 178 ? 13.162 19.768  26.923  1.00 60.16  ? 212  PRO A N   1 
ATOM   1426 C CA  . PRO A 1 178 ? 13.529 18.542  26.204  1.00 58.20  ? 212  PRO A CA  1 
ATOM   1427 C C   . PRO A 1 178 ? 14.976 18.090  26.400  1.00 54.99  ? 212  PRO A C   1 
ATOM   1428 O O   . PRO A 1 178 ? 15.897 18.904  26.440  1.00 55.74  ? 212  PRO A O   1 
ATOM   1429 C CB  . PRO A 1 178 ? 13.257 18.906  24.746  1.00 59.28  ? 212  PRO A CB  1 
ATOM   1430 C CG  . PRO A 1 178 ? 12.203 19.960  24.843  1.00 59.48  ? 212  PRO A CG  1 
ATOM   1431 C CD  . PRO A 1 178 ? 12.715 20.797  25.972  1.00 59.74  ? 212  PRO A CD  1 
ATOM   1432 N N   . ASN A 1 179 ? 15.167 16.782  26.505  1.00 51.58  ? 213  ASN A N   1 
ATOM   1433 C CA  . ASN A 1 179 ? 16.498 16.209  26.669  1.00 48.02  ? 213  ASN A CA  1 
ATOM   1434 C C   . ASN A 1 179 ? 16.729 15.185  25.555  1.00 45.36  ? 213  ASN A C   1 
ATOM   1435 O O   . ASN A 1 179 ? 15.806 14.443  25.197  1.00 43.53  ? 213  ASN A O   1 
ATOM   1436 C CB  . ASN A 1 179 ? 16.597 15.542  28.034  1.00 48.26  ? 213  ASN A CB  1 
ATOM   1437 C CG  . ASN A 1 179 ? 16.264 16.492  29.158  1.00 49.97  ? 213  ASN A CG  1 
ATOM   1438 O OD1 . ASN A 1 179 ? 16.904 17.536  29.315  1.00 49.73  ? 213  ASN A OD1 1 
ATOM   1439 N ND2 . ASN A 1 179 ? 15.254 16.139  29.953  1.00 50.07  ? 213  ASN A ND2 1 
ATOM   1440 N N   . VAL A 1 180 ? 17.942 15.143  24.998  1.00 42.72  ? 214  VAL A N   1 
ATOM   1441 C CA  . VAL A 1 180 ? 18.236 14.193  23.919  1.00 40.73  ? 214  VAL A CA  1 
ATOM   1442 C C   . VAL A 1 180 ? 18.046 12.749  24.406  1.00 40.10  ? 214  VAL A C   1 
ATOM   1443 O O   . VAL A 1 180 ? 18.264 12.444  25.575  1.00 37.63  ? 214  VAL A O   1 
ATOM   1444 C CB  . VAL A 1 180 ? 19.676 14.366  23.374  1.00 40.78  ? 214  VAL A CB  1 
ATOM   1445 C CG1 . VAL A 1 180 ? 19.898 15.806  22.958  1.00 38.41  ? 214  VAL A CG1 1 
ATOM   1446 C CG2 . VAL A 1 180 ? 20.704 13.920  24.412  1.00 40.48  ? 214  VAL A CG2 1 
ATOM   1447 N N   . SER A 1 181 ? 17.619 11.860  23.520  1.00 40.37  ? 215  SER A N   1 
ATOM   1448 C CA  . SER A 1 181 ? 17.395 10.481  23.931  1.00 40.82  ? 215  SER A CA  1 
ATOM   1449 C C   . SER A 1 181 ? 18.503 9.537   23.494  1.00 40.61  ? 215  SER A C   1 
ATOM   1450 O O   . SER A 1 181 ? 18.411 8.333   23.700  1.00 40.57  ? 215  SER A O   1 
ATOM   1451 C CB  . SER A 1 181 ? 16.047 9.981   23.398  1.00 41.17  ? 215  SER A CB  1 
ATOM   1452 O OG  . SER A 1 181 ? 15.929 10.252  22.018  1.00 44.52  ? 215  SER A OG  1 
ATOM   1453 N N   . TYR A 1 182 ? 19.554 10.084  22.899  1.00 40.78  ? 216  TYR A N   1 
ATOM   1454 C CA  . TYR A 1 182 ? 20.646 9.253   22.457  1.00 41.59  ? 216  TYR A CA  1 
ATOM   1455 C C   . TYR A 1 182 ? 21.820 9.175   23.439  1.00 43.11  ? 216  TYR A C   1 
ATOM   1456 O O   . TYR A 1 182 ? 22.964 8.987   23.013  1.00 45.10  ? 216  TYR A O   1 
ATOM   1457 C CB  . TYR A 1 182 ? 21.119 9.693   21.062  1.00 41.32  ? 216  TYR A CB  1 
ATOM   1458 C CG  . TYR A 1 182 ? 21.482 11.150  20.936  1.00 42.73  ? 216  TYR A CG  1 
ATOM   1459 C CD1 . TYR A 1 182 ? 22.701 11.627  21.405  1.00 44.15  ? 216  TYR A CD1 1 
ATOM   1460 C CD2 . TYR A 1 182 ? 20.597 12.062  20.359  1.00 43.36  ? 216  TYR A CD2 1 
ATOM   1461 C CE1 . TYR A 1 182 ? 23.030 12.977  21.302  1.00 45.08  ? 216  TYR A CE1 1 
ATOM   1462 C CE2 . TYR A 1 182 ? 20.919 13.412  20.259  1.00 43.92  ? 216  TYR A CE2 1 
ATOM   1463 C CZ  . TYR A 1 182 ? 22.135 13.860  20.732  1.00 44.64  ? 216  TYR A CZ  1 
ATOM   1464 O OH  . TYR A 1 182 ? 22.456 15.193  20.639  1.00 46.24  ? 216  TYR A OH  1 
ATOM   1465 N N   . ILE A 1 183 ? 21.555 9.335   24.741  1.00 41.10  ? 217  ILE A N   1 
ATOM   1466 C CA  . ILE A 1 183 ? 22.623 9.194   25.740  1.00 40.23  ? 217  ILE A CA  1 
ATOM   1467 C C   . ILE A 1 183 ? 22.470 7.841   26.440  1.00 40.65  ? 217  ILE A C   1 
ATOM   1468 O O   . ILE A 1 183 ? 21.486 7.128   26.225  1.00 40.56  ? 217  ILE A O   1 
ATOM   1469 C CB  . ILE A 1 183 ? 22.624 10.303  26.872  1.00 40.73  ? 217  ILE A CB  1 
ATOM   1470 C CG1 . ILE A 1 183 ? 21.423 10.138  27.824  1.00 37.78  ? 217  ILE A CG1 1 
ATOM   1471 C CG2 . ILE A 1 183 ? 22.762 11.676  26.275  1.00 42.10  ? 217  ILE A CG2 1 
ATOM   1472 C CD1 . ILE A 1 183 ? 20.093 10.119  27.194  1.00 37.39  ? 217  ILE A CD1 1 
ATOM   1473 N N   . CYS A 1 184 ? 23.456 7.495   27.262  1.00 39.61  ? 218  CYS A N   1 
ATOM   1474 C CA  . CYS A 1 184 ? 23.447 6.242   28.014  1.00 41.81  ? 218  CYS A CA  1 
ATOM   1475 C C   . CYS A 1 184 ? 23.927 5.079   27.144  1.00 42.83  ? 218  CYS A C   1 
ATOM   1476 O O   . CYS A 1 184 ? 23.625 5.036   25.958  1.00 45.15  ? 218  CYS A O   1 
ATOM   1477 C CB  . CYS A 1 184 ? 22.036 5.974   28.544  1.00 40.86  ? 218  CYS A CB  1 
ATOM   1478 S SG  . CYS A 1 184 ? 21.933 4.820   29.916  1.00 45.59  ? 218  CYS A SG  1 
ATOM   1479 N N   . SER A 1 185 ? 24.678 4.143   27.721  1.00 43.64  ? 219  SER A N   1 
ATOM   1480 C CA  . SER A 1 185 ? 25.193 3.017   26.945  1.00 43.03  ? 219  SER A CA  1 
ATOM   1481 C C   . SER A 1 185 ? 24.284 1.810   26.852  1.00 43.82  ? 219  SER A C   1 
ATOM   1482 O O   . SER A 1 185 ? 23.515 1.514   27.759  1.00 44.55  ? 219  SER A O   1 
ATOM   1483 C CB  . SER A 1 185 ? 26.547 2.567   27.479  1.00 42.85  ? 219  SER A CB  1 
ATOM   1484 O OG  . SER A 1 185 ? 27.490 3.626   27.408  1.00 46.24  ? 219  SER A OG  1 
ATOM   1485 N N   . ARG A 1 186 ? 24.427 1.120   25.727  1.00 45.50  ? 220  ARG A N   1 
ATOM   1486 C CA  . ARG A 1 186 ? 23.683 -0.077  25.333  1.00 47.67  ? 220  ARG A CA  1 
ATOM   1487 C C   . ARG A 1 186 ? 22.872 -0.917  26.324  1.00 46.57  ? 220  ARG A C   1 
ATOM   1488 O O   . ARG A 1 186 ? 21.626 -0.814  26.387  1.00 49.98  ? 220  ARG A O   1 
ATOM   1489 C CB  . ARG A 1 186 ? 24.624 -1.013  24.571  1.00 51.87  ? 220  ARG A CB  1 
ATOM   1490 C CG  . ARG A 1 186 ? 26.057 -1.034  25.113  1.00 58.76  ? 220  ARG A CG  1 
ATOM   1491 C CD  . ARG A 1 186 ? 26.104 -1.327  26.622  1.00 61.87  ? 220  ARG A CD  1 
ATOM   1492 N NE  . ARG A 1 186 ? 27.453 -1.287  27.199  1.00 65.01  ? 220  ARG A NE  1 
ATOM   1493 C CZ  . ARG A 1 186 ? 28.526 -1.854  26.652  1.00 65.98  ? 220  ARG A CZ  1 
ATOM   1494 N NH1 . ARG A 1 186 ? 28.427 -2.506  25.492  1.00 65.43  ? 220  ARG A NH1 1 
ATOM   1495 N NH2 . ARG A 1 186 ? 29.691 -1.793  27.286  1.00 65.51  ? 220  ARG A NH2 1 
ATOM   1496 N N   . TYR A 1 187 ? 23.550 -1.766  27.081  1.00 40.23  ? 221  TYR A N   1 
ATOM   1497 C CA  . TYR A 1 187 ? 22.845 -2.646  28.004  1.00 39.87  ? 221  TYR A CA  1 
ATOM   1498 C C   . TYR A 1 187 ? 22.164 -1.955  29.189  1.00 38.89  ? 221  TYR A C   1 
ATOM   1499 O O   . TYR A 1 187 ? 21.313 -2.544  29.858  1.00 36.84  ? 221  TYR A O   1 
ATOM   1500 C CB  . TYR A 1 187 ? 23.827 -3.691  28.516  1.00 41.76  ? 221  TYR A CB  1 
ATOM   1501 C CG  . TYR A 1 187 ? 24.609 -4.385  27.430  1.00 42.92  ? 221  TYR A CG  1 
ATOM   1502 C CD1 . TYR A 1 187 ? 25.836 -4.951  27.708  1.00 42.98  ? 221  TYR A CD1 1 
ATOM   1503 C CD2 . TYR A 1 187 ? 24.106 -4.506  26.136  1.00 46.53  ? 221  TYR A CD2 1 
ATOM   1504 C CE1 . TYR A 1 187 ? 26.548 -5.625  26.746  1.00 45.94  ? 221  TYR A CE1 1 
ATOM   1505 C CE2 . TYR A 1 187 ? 24.820 -5.184  25.142  1.00 47.23  ? 221  TYR A CE2 1 
ATOM   1506 C CZ  . TYR A 1 187 ? 26.045 -5.747  25.469  1.00 48.10  ? 221  TYR A CZ  1 
ATOM   1507 O OH  . TYR A 1 187 ? 26.772 -6.477  24.556  1.00 50.81  ? 221  TYR A OH  1 
ATOM   1508 N N   . TYR A 1 188 ? 22.522 -0.697  29.413  1.00 37.43  ? 222  TYR A N   1 
ATOM   1509 C CA  . TYR A 1 188 ? 22.016 0.050   30.545  1.00 37.90  ? 222  TYR A CA  1 
ATOM   1510 C C   . TYR A 1 188 ? 20.962 1.113   30.261  1.00 39.03  ? 222  TYR A C   1 
ATOM   1511 O O   . TYR A 1 188 ? 20.532 1.824   31.179  1.00 40.74  ? 222  TYR A O   1 
ATOM   1512 C CB  . TYR A 1 188 ? 23.210 0.663   31.269  1.00 37.04  ? 222  TYR A CB  1 
ATOM   1513 C CG  . TYR A 1 188 ? 24.317 -0.348  31.421  1.00 36.46  ? 222  TYR A CG  1 
ATOM   1514 C CD1 . TYR A 1 188 ? 24.222 -1.369  32.364  1.00 36.51  ? 222  TYR A CD1 1 
ATOM   1515 C CD2 . TYR A 1 188 ? 25.410 -0.352  30.548  1.00 35.60  ? 222  TYR A CD2 1 
ATOM   1516 C CE1 . TYR A 1 188 ? 25.174 -2.373  32.433  1.00 37.07  ? 222  TYR A CE1 1 
ATOM   1517 C CE2 . TYR A 1 188 ? 26.375 -1.358  30.602  1.00 36.97  ? 222  TYR A CE2 1 
ATOM   1518 C CZ  . TYR A 1 188 ? 26.250 -2.367  31.549  1.00 38.28  ? 222  TYR A CZ  1 
ATOM   1519 O OH  . TYR A 1 188 ? 27.197 -3.367  31.625  1.00 38.59  ? 222  TYR A OH  1 
ATOM   1520 N N   . ARG A 1 189 ? 20.529 1.219   29.009  1.00 38.43  ? 223  ARG A N   1 
ATOM   1521 C CA  . ARG A 1 189 ? 19.516 2.211   28.642  1.00 36.82  ? 223  ARG A CA  1 
ATOM   1522 C C   . ARG A 1 189 ? 18.157 1.783   29.185  1.00 36.05  ? 223  ARG A C   1 
ATOM   1523 O O   . ARG A 1 189 ? 17.771 0.619   29.074  1.00 34.24  ? 223  ARG A O   1 
ATOM   1524 C CB  . ARG A 1 189 ? 19.425 2.360   27.117  1.00 37.75  ? 223  ARG A CB  1 
ATOM   1525 C CG  . ARG A 1 189 ? 20.766 2.408   26.400  1.00 40.60  ? 223  ARG A CG  1 
ATOM   1526 C CD  . ARG A 1 189 ? 20.863 3.607   25.481  1.00 43.68  ? 223  ARG A CD  1 
ATOM   1527 N NE  . ARG A 1 189 ? 19.839 3.612   24.438  1.00 45.61  ? 223  ARG A NE  1 
ATOM   1528 C CZ  . ARG A 1 189 ? 19.288 4.720   23.944  1.00 47.40  ? 223  ARG A CZ  1 
ATOM   1529 N NH1 . ARG A 1 189 ? 19.664 5.913   24.398  1.00 46.65  ? 223  ARG A NH1 1 
ATOM   1530 N NH2 . ARG A 1 189 ? 18.355 4.640   23.004  1.00 47.87  ? 223  ARG A NH2 1 
ATOM   1531 N N   . ALA A 1 190 ? 17.449 2.735   29.786  1.00 35.00  ? 224  ALA A N   1 
ATOM   1532 C CA  . ALA A 1 190 ? 16.123 2.495   30.338  1.00 35.10  ? 224  ALA A CA  1 
ATOM   1533 C C   . ALA A 1 190 ? 15.100 2.420   29.195  1.00 36.85  ? 224  ALA A C   1 
ATOM   1534 O O   . ALA A 1 190 ? 15.292 3.022   28.141  1.00 37.60  ? 224  ALA A O   1 
ATOM   1535 C CB  . ALA A 1 190 ? 15.764 3.613   31.289  1.00 34.18  ? 224  ALA A CB  1 
ATOM   1536 N N   . PRO A 1 191 ? 13.995 1.687   29.393  1.00 39.07  ? 225  PRO A N   1 
ATOM   1537 C CA  . PRO A 1 191 ? 12.949 1.543   28.360  1.00 39.14  ? 225  PRO A CA  1 
ATOM   1538 C C   . PRO A 1 191 ? 12.552 2.850   27.659  1.00 39.11  ? 225  PRO A C   1 
ATOM   1539 O O   . PRO A 1 191 ? 12.530 2.923   26.430  1.00 38.52  ? 225  PRO A O   1 
ATOM   1540 C CB  . PRO A 1 191 ? 11.782 0.937   29.129  1.00 39.59  ? 225  PRO A CB  1 
ATOM   1541 C CG  . PRO A 1 191 ? 12.466 0.136   30.205  1.00 40.06  ? 225  PRO A CG  1 
ATOM   1542 C CD  . PRO A 1 191 ? 13.584 1.049   30.656  1.00 39.48  ? 225  PRO A CD  1 
ATOM   1543 N N   . GLU A 1 192 ? 12.235 3.878   28.439  1.00 38.64  ? 226  GLU A N   1 
ATOM   1544 C CA  . GLU A 1 192 ? 11.846 5.152   27.860  1.00 38.74  ? 226  GLU A CA  1 
ATOM   1545 C C   . GLU A 1 192 ? 12.941 5.713   26.943  1.00 39.98  ? 226  GLU A C   1 
ATOM   1546 O O   . GLU A 1 192 ? 12.658 6.437   25.986  1.00 41.16  ? 226  GLU A O   1 
ATOM   1547 C CB  . GLU A 1 192 ? 11.487 6.161   28.965  1.00 38.43  ? 226  GLU A CB  1 
ATOM   1548 C CG  . GLU A 1 192 ? 12.605 6.461   29.979  1.00 39.54  ? 226  GLU A CG  1 
ATOM   1549 C CD  . GLU A 1 192 ? 12.490 5.653   31.271  1.00 40.77  ? 226  GLU A CD  1 
ATOM   1550 O OE1 . GLU A 1 192 ? 12.295 4.412   31.209  1.00 41.13  ? 226  GLU A OE1 1 
ATOM   1551 O OE2 . GLU A 1 192 ? 12.624 6.267   32.353  1.00 40.43  ? 226  GLU A OE2 1 
ATOM   1552 N N   . LEU A 1 193 ? 14.197 5.387   27.217  1.00 40.27  ? 227  LEU A N   1 
ATOM   1553 C CA  . LEU A 1 193 ? 15.280 5.870   26.356  1.00 40.97  ? 227  LEU A CA  1 
ATOM   1554 C C   . LEU A 1 193 ? 15.247 5.121   25.011  1.00 41.88  ? 227  LEU A C   1 
ATOM   1555 O O   . LEU A 1 193 ? 15.446 5.713   23.951  1.00 43.13  ? 227  LEU A O   1 
ATOM   1556 C CB  . LEU A 1 193 ? 16.636 5.684   27.054  1.00 39.14  ? 227  LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 193 ? 17.357 6.919   27.638  1.00 40.02  ? 227  LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 193 ? 16.380 7.922   28.253  1.00 38.74  ? 227  LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 193 ? 18.372 6.447   28.679  1.00 38.30  ? 227  LEU A CD2 1 
ATOM   1560 N N   . ILE A 1 194 ? 14.969 3.820   25.058  1.00 41.66  ? 228  ILE A N   1 
ATOM   1561 C CA  . ILE A 1 194 ? 14.897 2.998   23.854  1.00 40.88  ? 228  ILE A CA  1 
ATOM   1562 C C   . ILE A 1 194 ? 13.704 3.455   23.024  1.00 42.47  ? 228  ILE A C   1 
ATOM   1563 O O   . ILE A 1 194 ? 13.752 3.442   21.793  1.00 44.08  ? 228  ILE A O   1 
ATOM   1564 C CB  . ILE A 1 194 ? 14.741 1.500   24.223  1.00 38.46  ? 228  ILE A CB  1 
ATOM   1565 C CG1 . ILE A 1 194 ? 15.915 1.080   25.108  1.00 36.81  ? 228  ILE A CG1 1 
ATOM   1566 C CG2 . ILE A 1 194 ? 14.680 0.640   22.978  1.00 36.33  ? 228  ILE A CG2 1 
ATOM   1567 C CD1 . ILE A 1 194 ? 15.801 -0.298  25.678  1.00 33.95  ? 228  ILE A CD1 1 
ATOM   1568 N N   . PHE A 1 195 ? 12.625 3.846   23.696  1.00 43.17  ? 229  PHE A N   1 
ATOM   1569 C CA  . PHE A 1 195 ? 11.440 4.331   22.990  1.00 43.09  ? 229  PHE A CA  1 
ATOM   1570 C C   . PHE A 1 195 ? 11.599 5.778   22.518  1.00 43.72  ? 229  PHE A C   1 
ATOM   1571 O O   . PHE A 1 195 ? 10.646 6.368   22.020  1.00 45.71  ? 229  PHE A O   1 
ATOM   1572 C CB  . PHE A 1 195 ? 10.203 4.243   23.875  1.00 40.93  ? 229  PHE A CB  1 
ATOM   1573 C CG  . PHE A 1 195 ? 9.701  2.859   24.068  1.00 41.00  ? 229  PHE A CG  1 
ATOM   1574 C CD1 . PHE A 1 195 ? 9.390  2.061   22.970  1.00 41.70  ? 229  PHE A CD1 1 
ATOM   1575 C CD2 . PHE A 1 195 ? 9.539  2.343   25.343  1.00 40.94  ? 229  PHE A CD2 1 
ATOM   1576 C CE1 . PHE A 1 195 ? 8.932  0.764   23.136  1.00 41.16  ? 229  PHE A CE1 1 
ATOM   1577 C CE2 . PHE A 1 195 ? 9.081  1.047   25.525  1.00 41.99  ? 229  PHE A CE2 1 
ATOM   1578 C CZ  . PHE A 1 195 ? 8.775  0.250   24.419  1.00 42.34  ? 229  PHE A CZ  1 
ATOM   1579 N N   . GLY A 1 196 ? 12.789 6.349   22.676  1.00 42.94  ? 230  GLY A N   1 
ATOM   1580 C CA  . GLY A 1 196 ? 13.017 7.711   22.224  1.00 43.30  ? 230  GLY A CA  1 
ATOM   1581 C C   . GLY A 1 196 ? 12.404 8.843   23.034  1.00 43.12  ? 230  GLY A C   1 
ATOM   1582 O O   . GLY A 1 196 ? 12.283 9.958   22.527  1.00 42.61  ? 230  GLY A O   1 
ATOM   1583 N N   . ALA A 1 197 ? 12.024 8.564   24.280  1.00 42.06  ? 231  ALA A N   1 
ATOM   1584 C CA  . ALA A 1 197 ? 11.447 9.569   25.157  1.00 41.11  ? 231  ALA A CA  1 
ATOM   1585 C C   . ALA A 1 197 ? 12.346 10.784  25.214  1.00 42.88  ? 231  ALA A C   1 
ATOM   1586 O O   . ALA A 1 197 ? 13.573 10.688  25.248  1.00 40.88  ? 231  ALA A O   1 
ATOM   1587 C CB  . ALA A 1 197 ? 11.254 9.010   26.538  1.00 40.24  ? 231  ALA A CB  1 
ATOM   1588 N N   . THR A 1 198 ? 11.729 11.948  25.246  1.00 46.64  ? 232  THR A N   1 
ATOM   1589 C CA  . THR A 1 198 ? 12.512 13.166  25.260  1.00 48.82  ? 232  THR A CA  1 
ATOM   1590 C C   . THR A 1 198 ? 12.293 13.939  26.571  1.00 47.77  ? 232  THR A C   1 
ATOM   1591 O O   . THR A 1 198 ? 12.993 14.913  26.867  1.00 47.10  ? 232  THR A O   1 
ATOM   1592 C CB  . THR A 1 198 ? 12.125 14.005  24.029  1.00 49.72  ? 232  THR A CB  1 
ATOM   1593 O OG1 . THR A 1 198 ? 13.134 14.980  23.788  1.00 54.83  ? 232  THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 198 ? 10.780 14.700  24.245  1.00 51.89  ? 232  THR A CG2 1 
ATOM   1595 N N   . ASP A 1 199 ? 11.326 13.475  27.359  1.00 47.39  ? 233  ASP A N   1 
ATOM   1596 C CA  . ASP A 1 199 ? 10.996 14.115  28.628  1.00 47.93  ? 233  ASP A CA  1 
ATOM   1597 C C   . ASP A 1 199 ? 11.192 13.171  29.818  1.00 46.82  ? 233  ASP A C   1 
ATOM   1598 O O   . ASP A 1 199 ? 10.337 13.082  30.710  1.00 46.56  ? 233  ASP A O   1 
ATOM   1599 C CB  . ASP A 1 199 ? 9.548  14.588  28.599  1.00 49.53  ? 233  ASP A CB  1 
ATOM   1600 C CG  . ASP A 1 199 ? 8.562  13.429  28.520  1.00 52.88  ? 233  ASP A CG  1 
ATOM   1601 O OD1 . ASP A 1 199 ? 7.348  13.705  28.580  1.00 55.94  ? 233  ASP A OD1 1 
ATOM   1602 O OD2 . ASP A 1 199 ? 8.987  12.249  28.393  1.00 51.80  ? 233  ASP A OD2 1 
ATOM   1603 N N   . TYR A 1 200 ? 12.314 12.462  29.820  1.00 44.47  ? 234  TYR A N   1 
ATOM   1604 C CA  . TYR A 1 200 ? 12.616 11.528  30.894  1.00 41.81  ? 234  TYR A CA  1 
ATOM   1605 C C   . TYR A 1 200 ? 13.159 12.271  32.106  1.00 41.40  ? 234  TYR A C   1 
ATOM   1606 O O   . TYR A 1 200 ? 13.560 13.429  32.010  1.00 41.97  ? 234  TYR A O   1 
ATOM   1607 C CB  . TYR A 1 200 ? 13.625 10.483  30.406  1.00 36.57  ? 234  TYR A CB  1 
ATOM   1608 C CG  . TYR A 1 200 ? 14.872 11.092  29.810  1.00 32.65  ? 234  TYR A CG  1 
ATOM   1609 C CD1 . TYR A 1 200 ? 15.928 11.504  30.620  1.00 30.45  ? 234  TYR A CD1 1 
ATOM   1610 C CD2 . TYR A 1 200 ? 14.986 11.284  28.437  1.00 30.40  ? 234  TYR A CD2 1 
ATOM   1611 C CE1 . TYR A 1 200 ? 17.065 12.094  30.066  1.00 31.01  ? 234  TYR A CE1 1 
ATOM   1612 C CE2 . TYR A 1 200 ? 16.114 11.870  27.879  1.00 29.49  ? 234  TYR A CE2 1 
ATOM   1613 C CZ  . TYR A 1 200 ? 17.143 12.273  28.685  1.00 29.97  ? 234  TYR A CZ  1 
ATOM   1614 O OH  . TYR A 1 200 ? 18.250 12.875  28.134  1.00 28.96  ? 234  TYR A OH  1 
ATOM   1615 N N   . THR A 1 201 ? 13.170 11.589  33.244  1.00 41.08  ? 235  THR A N   1 
ATOM   1616 C CA  . THR A 1 201 ? 13.654 12.167  34.484  1.00 40.88  ? 235  THR A CA  1 
ATOM   1617 C C   . THR A 1 201 ? 14.891 11.439  34.969  1.00 41.24  ? 235  THR A C   1 
ATOM   1618 O O   . THR A 1 201 ? 15.444 10.603  34.268  1.00 42.20  ? 235  THR A O   1 
ATOM   1619 C CB  . THR A 1 201 ? 12.590 12.057  35.571  1.00 41.03  ? 235  THR A CB  1 
ATOM   1620 O OG1 . THR A 1 201 ? 12.339 10.672  35.840  1.00 40.75  ? 235  THR A OG1 1 
ATOM   1621 C CG2 . THR A 1 201 ? 11.305 12.715  35.119  1.00 39.91  ? 235  THR A CG2 1 
ATOM   1622 N N   . SER A 1 202 ? 15.309 11.755  36.187  1.00 42.18  ? 236  SER A N   1 
ATOM   1623 C CA  . SER A 1 202 ? 16.473 11.115  36.772  1.00 41.55  ? 236  SER A CA  1 
ATOM   1624 C C   . SER A 1 202 ? 16.238 9.637   37.065  1.00 40.66  ? 236  SER A C   1 
ATOM   1625 O O   . SER A 1 202 ? 17.173 8.915   37.398  1.00 41.76  ? 236  SER A O   1 
ATOM   1626 C CB  . SER A 1 202 ? 16.877 11.835  38.054  1.00 43.53  ? 236  SER A CB  1 
ATOM   1627 O OG  . SER A 1 202 ? 17.375 13.135  37.744  1.00 48.31  ? 236  SER A OG  1 
ATOM   1628 N N   . SER A 1 203 ? 15.004 9.170   36.936  1.00 37.95  ? 237  SER A N   1 
ATOM   1629 C CA  . SER A 1 203 ? 14.763 7.769   37.195  1.00 37.26  ? 237  SER A CA  1 
ATOM   1630 C C   . SER A 1 203 ? 15.484 6.892   36.166  1.00 38.19  ? 237  SER A C   1 
ATOM   1631 O O   . SER A 1 203 ? 15.586 5.680   36.375  1.00 39.09  ? 237  SER A O   1 
ATOM   1632 C CB  . SER A 1 203 ? 13.259 7.457   37.221  1.00 37.46  ? 237  SER A CB  1 
ATOM   1633 O OG  . SER A 1 203 ? 12.594 7.877   36.036  1.00 40.21  ? 237  SER A OG  1 
ATOM   1634 N N   . ILE A 1 204 ? 15.990 7.469   35.065  1.00 36.48  ? 238  ILE A N   1 
ATOM   1635 C CA  . ILE A 1 204 ? 16.717 6.637   34.098  1.00 36.48  ? 238  ILE A CA  1 
ATOM   1636 C C   . ILE A 1 204 ? 18.012 6.107   34.746  1.00 37.18  ? 238  ILE A C   1 
ATOM   1637 O O   . ILE A 1 204 ? 18.426 4.975   34.476  1.00 37.33  ? 238  ILE A O   1 
ATOM   1638 C CB  . ILE A 1 204 ? 17.107 7.359   32.750  1.00 35.55  ? 238  ILE A CB  1 
ATOM   1639 C CG1 . ILE A 1 204 ? 18.002 8.562   33.008  1.00 35.95  ? 238  ILE A CG1 1 
ATOM   1640 C CG2 . ILE A 1 204 ? 15.886 7.714   31.961  1.00 35.62  ? 238  ILE A CG2 1 
ATOM   1641 C CD1 . ILE A 1 204 ? 18.777 8.993   31.765  1.00 32.28  ? 238  ILE A CD1 1 
ATOM   1642 N N   . ASP A 1 205 ? 18.645 6.915   35.599  1.00 35.86  ? 239  ASP A N   1 
ATOM   1643 C CA  . ASP A 1 205 ? 19.860 6.472   36.285  1.00 35.84  ? 239  ASP A CA  1 
ATOM   1644 C C   . ASP A 1 205 ? 19.525 5.307   37.218  1.00 36.36  ? 239  ASP A C   1 
ATOM   1645 O O   . ASP A 1 205 ? 20.311 4.359   37.345  1.00 37.57  ? 239  ASP A O   1 
ATOM   1646 C CB  . ASP A 1 205 ? 20.503 7.589   37.114  1.00 33.36  ? 239  ASP A CB  1 
ATOM   1647 C CG  . ASP A 1 205 ? 21.284 8.578   36.264  1.00 36.03  ? 239  ASP A CG  1 
ATOM   1648 O OD1 . ASP A 1 205 ? 21.655 8.250   35.113  1.00 36.23  ? 239  ASP A OD1 1 
ATOM   1649 O OD2 . ASP A 1 205 ? 21.553 9.695   36.747  1.00 37.24  ? 239  ASP A OD2 1 
ATOM   1650 N N   . VAL A 1 206 ? 18.367 5.358   37.874  1.00 34.82  ? 240  VAL A N   1 
ATOM   1651 C CA  . VAL A 1 206 ? 18.015 4.267   38.766  1.00 35.03  ? 240  VAL A CA  1 
ATOM   1652 C C   . VAL A 1 206 ? 17.910 2.978   37.964  1.00 35.13  ? 240  VAL A C   1 
ATOM   1653 O O   . VAL A 1 206 ? 18.346 1.928   38.428  1.00 35.49  ? 240  VAL A O   1 
ATOM   1654 C CB  . VAL A 1 206 ? 16.694 4.532   39.517  1.00 32.94  ? 240  VAL A CB  1 
ATOM   1655 C CG1 . VAL A 1 206 ? 16.318 3.317   40.340  1.00 33.61  ? 240  VAL A CG1 1 
ATOM   1656 C CG2 . VAL A 1 206 ? 16.852 5.722   40.431  1.00 33.79  ? 240  VAL A CG2 1 
ATOM   1657 N N   . TRP A 1 207 ? 17.350 3.059   36.755  1.00 35.60  ? 241  TRP A N   1 
ATOM   1658 C CA  . TRP A 1 207 ? 17.216 1.874   35.908  1.00 33.04  ? 241  TRP A CA  1 
ATOM   1659 C C   . TRP A 1 207 ? 18.616 1.352   35.594  1.00 32.07  ? 241  TRP A C   1 
ATOM   1660 O O   . TRP A 1 207 ? 18.890 0.164   35.746  1.00 31.47  ? 241  TRP A O   1 
ATOM   1661 C CB  . TRP A 1 207 ? 16.458 2.210   34.607  1.00 32.99  ? 241  TRP A CB  1 
ATOM   1662 C CG  . TRP A 1 207 ? 16.453 1.073   33.588  1.00 33.86  ? 241  TRP A CG  1 
ATOM   1663 C CD1 . TRP A 1 207 ? 17.487 0.702   32.771  1.00 32.86  ? 241  TRP A CD1 1 
ATOM   1664 C CD2 . TRP A 1 207 ? 15.408 0.108   33.369  1.00 33.62  ? 241  TRP A CD2 1 
ATOM   1665 N NE1 . TRP A 1 207 ? 17.157 -0.427  32.072  1.00 32.45  ? 241  TRP A NE1 1 
ATOM   1666 C CE2 . TRP A 1 207 ? 15.886 -0.812  32.411  1.00 33.01  ? 241  TRP A CE2 1 
ATOM   1667 C CE3 . TRP A 1 207 ? 14.117 -0.067  33.888  1.00 34.77  ? 241  TRP A CE3 1 
ATOM   1668 C CZ2 . TRP A 1 207 ? 15.118 -1.900  31.960  1.00 32.50  ? 241  TRP A CZ2 1 
ATOM   1669 C CZ3 . TRP A 1 207 ? 13.354 -1.156  33.441  1.00 34.40  ? 241  TRP A CZ3 1 
ATOM   1670 C CH2 . TRP A 1 207 ? 13.860 -2.051  32.484  1.00 32.72  ? 241  TRP A CH2 1 
ATOM   1671 N N   . SER A 1 208 ? 19.497 2.254   35.171  1.00 31.17  ? 242  SER A N   1 
ATOM   1672 C CA  . SER A 1 208 ? 20.871 1.894   34.854  1.00 30.63  ? 242  SER A CA  1 
ATOM   1673 C C   . SER A 1 208 ? 21.530 1.193   36.031  1.00 31.21  ? 242  SER A C   1 
ATOM   1674 O O   . SER A 1 208 ? 22.209 0.169   35.865  1.00 32.23  ? 242  SER A O   1 
ATOM   1675 C CB  . SER A 1 208 ? 21.672 3.137   34.494  1.00 31.32  ? 242  SER A CB  1 
ATOM   1676 O OG  . SER A 1 208 ? 21.101 3.775   33.359  1.00 35.68  ? 242  SER A OG  1 
ATOM   1677 N N   . ALA A 1 209 ? 21.329 1.736   37.226  1.00 31.20  ? 243  ALA A N   1 
ATOM   1678 C CA  . ALA A 1 209 ? 21.918 1.132   38.417  1.00 31.59  ? 243  ALA A CA  1 
ATOM   1679 C C   . ALA A 1 209 ? 21.314 -0.257  38.663  1.00 32.18  ? 243  ALA A C   1 
ATOM   1680 O O   . ALA A 1 209 ? 22.016 -1.172  39.092  1.00 33.26  ? 243  ALA A O   1 
ATOM   1681 C CB  . ALA A 1 209 ? 21.718 2.040   39.631  1.00 28.32  ? 243  ALA A CB  1 
ATOM   1682 N N   . GLY A 1 210 ? 20.024 -0.423  38.382  1.00 31.07  ? 244  GLY A N   1 
ATOM   1683 C CA  . GLY A 1 210 ? 19.414 -1.727  38.566  1.00 32.25  ? 244  GLY A CA  1 
ATOM   1684 C C   . GLY A 1 210 ? 20.065 -2.737  37.631  1.00 34.21  ? 244  GLY A C   1 
ATOM   1685 O O   . GLY A 1 210 ? 20.212 -3.891  37.987  1.00 35.22  ? 244  GLY A O   1 
ATOM   1686 N N   . CYS A 1 211 ? 20.454 -2.302  36.433  1.00 34.71  ? 245  CYS A N   1 
ATOM   1687 C CA  . CYS A 1 211 ? 21.107 -3.172  35.474  1.00 34.83  ? 245  CYS A CA  1 
ATOM   1688 C C   . CYS A 1 211 ? 22.506 -3.549  35.948  1.00 35.69  ? 245  CYS A C   1 
ATOM   1689 O O   . CYS A 1 211 ? 23.002 -4.622  35.636  1.00 38.02  ? 245  CYS A O   1 
ATOM   1690 C CB  . CYS A 1 211 ? 21.208 -2.484  34.113  1.00 34.37  ? 245  CYS A CB  1 
ATOM   1691 S SG  . CYS A 1 211 ? 19.653 -2.303  33.228  1.00 39.08  ? 245  CYS A SG  1 
ATOM   1692 N N   . VAL A 1 212 ? 23.163 -2.666  36.683  1.00 35.90  ? 246  VAL A N   1 
ATOM   1693 C CA  . VAL A 1 212 ? 24.497 -2.984  37.170  1.00 35.72  ? 246  VAL A CA  1 
ATOM   1694 C C   . VAL A 1 212 ? 24.378 -4.008  38.285  1.00 36.37  ? 246  VAL A C   1 
ATOM   1695 O O   . VAL A 1 212 ? 25.148 -4.970  38.330  1.00 36.83  ? 246  VAL A O   1 
ATOM   1696 C CB  . VAL A 1 212 ? 25.223 -1.728  37.700  1.00 36.51  ? 246  VAL A CB  1 
ATOM   1697 C CG1 . VAL A 1 212 ? 26.570 -2.101  38.292  1.00 31.99  ? 246  VAL A CG1 1 
ATOM   1698 C CG2 . VAL A 1 212 ? 25.404 -0.731  36.554  1.00 36.11  ? 246  VAL A CG2 1 
ATOM   1699 N N   . LEU A 1 213 ? 23.411 -3.803  39.177  1.00 36.06  ? 247  LEU A N   1 
ATOM   1700 C CA  . LEU A 1 213 ? 23.185 -4.725  40.292  1.00 37.21  ? 247  LEU A CA  1 
ATOM   1701 C C   . LEU A 1 213 ? 22.881 -6.118  39.762  1.00 37.47  ? 247  LEU A C   1 
ATOM   1702 O O   . LEU A 1 213 ? 23.500 -7.094  40.180  1.00 40.46  ? 247  LEU A O   1 
ATOM   1703 C CB  . LEU A 1 213 ? 22.009 -4.265  41.159  1.00 36.99  ? 247  LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 213 ? 21.444 -5.332  42.115  1.00 37.53  ? 247  LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 213 ? 22.495 -5.737  43.139  1.00 34.09  ? 247  LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 213 ? 20.208 -4.781  42.824  1.00 37.71  ? 247  LEU A CD2 1 
ATOM   1707 N N   . ALA A 1 214 ? 21.921 -6.205  38.849  1.00 35.68  ? 248  ALA A N   1 
ATOM   1708 C CA  . ALA A 1 214 ? 21.559 -7.478  38.282  1.00 34.99  ? 248  ALA A CA  1 
ATOM   1709 C C   . ALA A 1 214 ? 22.775 -8.120  37.620  1.00 36.97  ? 248  ALA A C   1 
ATOM   1710 O O   . ALA A 1 214 ? 22.974 -9.327  37.723  1.00 38.73  ? 248  ALA A O   1 
ATOM   1711 C CB  . ALA A 1 214 ? 20.433 -7.306  37.289  1.00 33.17  ? 248  ALA A CB  1 
ATOM   1712 N N   . GLU A 1 215 ? 23.601 -7.320  36.955  1.00 37.64  ? 249  GLU A N   1 
ATOM   1713 C CA  . GLU A 1 215 ? 24.787 -7.851  36.280  1.00 37.87  ? 249  GLU A CA  1 
ATOM   1714 C C   . GLU A 1 215 ? 25.829 -8.401  37.247  1.00 38.83  ? 249  GLU A C   1 
ATOM   1715 O O   . GLU A 1 215 ? 26.594 -9.307  36.911  1.00 40.37  ? 249  GLU A O   1 
ATOM   1716 C CB  . GLU A 1 215 ? 25.438 -6.767  35.424  1.00 37.01  ? 249  GLU A CB  1 
ATOM   1717 C CG  . GLU A 1 215 ? 26.431 -7.316  34.430  1.00 37.16  ? 249  GLU A CG  1 
ATOM   1718 C CD  . GLU A 1 215 ? 27.044 -6.243  33.566  1.00 37.35  ? 249  GLU A CD  1 
ATOM   1719 O OE1 . GLU A 1 215 ? 26.290 -5.370  33.097  1.00 36.55  ? 249  GLU A OE1 1 
ATOM   1720 O OE2 . GLU A 1 215 ? 28.272 -6.284  33.340  1.00 38.00  ? 249  GLU A OE2 1 
ATOM   1721 N N   . LEU A 1 216 ? 25.881 -7.826  38.441  1.00 39.31  ? 250  LEU A N   1 
ATOM   1722 C CA  . LEU A 1 216 ? 26.832 -8.271  39.443  1.00 39.02  ? 250  LEU A CA  1 
ATOM   1723 C C   . LEU A 1 216 ? 26.352 -9.598  40.041  1.00 42.15  ? 250  LEU A C   1 
ATOM   1724 O O   . LEU A 1 216 ? 27.163 -10.443 40.431  1.00 44.82  ? 250  LEU A O   1 
ATOM   1725 C CB  . LEU A 1 216 ? 26.983 -7.194  40.517  1.00 37.55  ? 250  LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 216 ? 28.239 -6.311  40.474  1.00 36.72  ? 250  LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 216 ? 28.787 -6.222  39.075  1.00 36.65  ? 250  LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 216 ? 27.918 -4.931  41.033  1.00 32.92  ? 250  LEU A CD2 1 
ATOM   1729 N N   . LEU A 1 217 ? 25.036 -9.788  40.083  1.00 41.77  ? 251  LEU A N   1 
ATOM   1730 C CA  . LEU A 1 217 ? 24.459 -11.011 40.610  1.00 40.63  ? 251  LEU A CA  1 
ATOM   1731 C C   . LEU A 1 217 ? 24.480 -12.138 39.579  1.00 41.49  ? 251  LEU A C   1 
ATOM   1732 O O   . LEU A 1 217 ? 24.704 -13.290 39.923  1.00 45.16  ? 251  LEU A O   1 
ATOM   1733 C CB  . LEU A 1 217 ? 23.020 -10.755 41.049  1.00 38.85  ? 251  LEU A CB  1 
ATOM   1734 C CG  . LEU A 1 217 ? 22.806 -9.723  42.154  1.00 38.36  ? 251  LEU A CG  1 
ATOM   1735 C CD1 . LEU A 1 217 ? 21.322 -9.439  42.304  1.00 34.26  ? 251  LEU A CD1 1 
ATOM   1736 C CD2 . LEU A 1 217 ? 23.408 -10.231 43.464  1.00 34.28  ? 251  LEU A CD2 1 
ATOM   1737 N N   . LEU A 1 218 ? 24.250 -11.810 38.316  1.00 41.84  ? 252  LEU A N   1 
ATOM   1738 C CA  . LEU A 1 218 ? 24.217 -12.817 37.257  1.00 43.01  ? 252  LEU A CA  1 
ATOM   1739 C C   . LEU A 1 218 ? 25.554 -13.254 36.703  1.00 43.37  ? 252  LEU A C   1 
ATOM   1740 O O   . LEU A 1 218 ? 25.735 -14.423 36.415  1.00 45.68  ? 252  LEU A O   1 
ATOM   1741 C CB  . LEU A 1 218 ? 23.383 -12.322 36.089  1.00 45.38  ? 252  LEU A CB  1 
ATOM   1742 C CG  . LEU A 1 218 ? 21.885 -12.567 36.094  1.00 47.18  ? 252  LEU A CG  1 
ATOM   1743 C CD1 . LEU A 1 218 ? 21.265 -11.690 35.015  1.00 49.51  ? 252  LEU A CD1 1 
ATOM   1744 C CD2 . LEU A 1 218 ? 21.585 -14.024 35.840  1.00 46.27  ? 252  LEU A CD2 1 
ATOM   1745 N N   . GLY A 1 219 ? 26.476 -12.316 36.527  1.00 43.18  ? 253  GLY A N   1 
ATOM   1746 C CA  . GLY A 1 219 ? 27.772 -12.651 35.975  1.00 42.15  ? 253  GLY A CA  1 
ATOM   1747 C C   . GLY A 1 219 ? 27.849 -12.184 34.537  1.00 43.95  ? 253  GLY A C   1 
ATOM   1748 O O   . GLY A 1 219 ? 28.831 -12.414 33.837  1.00 45.15  ? 253  GLY A O   1 
ATOM   1749 N N   . GLN A 1 220 ? 26.793 -11.530 34.082  1.00 45.72  ? 254  GLN A N   1 
ATOM   1750 C CA  . GLN A 1 220 ? 26.752 -11.012 32.721  1.00 48.11  ? 254  GLN A CA  1 
ATOM   1751 C C   . GLN A 1 220 ? 25.599 -10.029 32.634  1.00 47.55  ? 254  GLN A C   1 
ATOM   1752 O O   . GLN A 1 220 ? 24.735 -10.002 33.505  1.00 48.04  ? 254  GLN A O   1 
ATOM   1753 C CB  . GLN A 1 220 ? 26.524 -12.143 31.733  1.00 50.21  ? 254  GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 220 ? 25.266 -12.927 32.041  1.00 55.79  ? 254  GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 220 ? 25.009 -14.041 31.043  1.00 58.53  ? 254  GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 220 ? 24.831 -13.797 29.844  1.00 60.78  ? 254  GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 220 ? 24.979 -15.273 31.536  1.00 59.94  ? 254  GLN A NE2 1 
ATOM   1758 N N   . PRO A 1 221 ? 25.576 -9.202  31.586  1.00 46.79  ? 255  PRO A N   1 
ATOM   1759 C CA  . PRO A 1 221 ? 24.515 -8.215  31.399  1.00 45.66  ? 255  PRO A CA  1 
ATOM   1760 C C   . PRO A 1 221 ? 23.162 -8.893  31.368  1.00 45.21  ? 255  PRO A C   1 
ATOM   1761 O O   . PRO A 1 221 ? 22.995 -9.934  30.742  1.00 46.53  ? 255  PRO A O   1 
ATOM   1762 C CB  . PRO A 1 221 ? 24.866 -7.591  30.062  1.00 46.47  ? 255  PRO A CB  1 
ATOM   1763 C CG  . PRO A 1 221 ? 26.354 -7.643  30.055  1.00 46.16  ? 255  PRO A CG  1 
ATOM   1764 C CD  . PRO A 1 221 ? 26.621 -9.042  30.565  1.00 47.01  ? 255  PRO A CD  1 
ATOM   1765 N N   . ILE A 1 222 ? 22.195 -8.290  32.041  1.00 44.33  ? 256  ILE A N   1 
ATOM   1766 C CA  . ILE A 1 222 ? 20.859 -8.840  32.092  1.00 43.02  ? 256  ILE A CA  1 
ATOM   1767 C C   . ILE A 1 222 ? 20.030 -8.555  30.837  1.00 43.44  ? 256  ILE A C   1 
ATOM   1768 O O   . ILE A 1 222 ? 19.185 -9.368  30.463  1.00 43.83  ? 256  ILE A O   1 
ATOM   1769 C CB  . ILE A 1 222 ? 20.113 -8.313  33.333  1.00 43.58  ? 256  ILE A CB  1 
ATOM   1770 C CG1 . ILE A 1 222 ? 18.730 -8.939  33.410  1.00 42.51  ? 256  ILE A CG1 1 
ATOM   1771 C CG2 . ILE A 1 222 ? 20.002 -6.803  33.281  1.00 42.78  ? 256  ILE A CG2 1 
ATOM   1772 C CD1 . ILE A 1 222 ? 18.054 -8.700  34.718  1.00 43.01  ? 256  ILE A CD1 1 
ATOM   1773 N N   . PHE A 1 223 ? 20.268 -7.414  30.188  1.00 42.57  ? 257  PHE A N   1 
ATOM   1774 C CA  . PHE A 1 223 ? 19.513 -7.047  28.987  1.00 41.22  ? 257  PHE A CA  1 
ATOM   1775 C C   . PHE A 1 223 ? 20.375 -6.764  27.761  1.00 39.89  ? 257  PHE A C   1 
ATOM   1776 O O   . PHE A 1 223 ? 20.349 -5.667  27.234  1.00 39.68  ? 257  PHE A O   1 
ATOM   1777 C CB  . PHE A 1 223 ? 18.642 -5.815  29.264  1.00 42.67  ? 257  PHE A CB  1 
ATOM   1778 C CG  . PHE A 1 223 ? 17.684 -5.987  30.410  1.00 43.51  ? 257  PHE A CG  1 
ATOM   1779 C CD1 . PHE A 1 223 ? 16.920 -7.148  30.534  1.00 45.12  ? 257  PHE A CD1 1 
ATOM   1780 C CD2 . PHE A 1 223 ? 17.534 -4.986  31.355  1.00 43.56  ? 257  PHE A CD2 1 
ATOM   1781 C CE1 . PHE A 1 223 ? 16.016 -7.315  31.588  1.00 44.98  ? 257  PHE A CE1 1 
ATOM   1782 C CE2 . PHE A 1 223 ? 16.637 -5.135  32.414  1.00 45.56  ? 257  PHE A CE2 1 
ATOM   1783 C CZ  . PHE A 1 223 ? 15.873 -6.308  32.529  1.00 45.86  ? 257  PHE A CZ  1 
ATOM   1784 N N   . PRO A 1 224 ? 21.122 -7.765  27.270  1.00 40.88  ? 258  PRO A N   1 
ATOM   1785 C CA  . PRO A 1 224 ? 21.995 -7.612  26.096  1.00 39.84  ? 258  PRO A CA  1 
ATOM   1786 C C   . PRO A 1 224 ? 21.197 -7.262  24.840  1.00 39.32  ? 258  PRO A C   1 
ATOM   1787 O O   . PRO A 1 224 ? 19.969 -7.347  24.832  1.00 40.09  ? 258  PRO A O   1 
ATOM   1788 C CB  . PRO A 1 224 ? 22.646 -8.993  25.958  1.00 39.76  ? 258  PRO A CB  1 
ATOM   1789 C CG  . PRO A 1 224 ? 22.455 -9.641  27.273  1.00 41.71  ? 258  PRO A CG  1 
ATOM   1790 C CD  . PRO A 1 224 ? 21.093 -9.171  27.703  1.00 41.84  ? 258  PRO A CD  1 
ATOM   1791 N N   . GLY A 1 225 ? 21.905 -6.894  23.780  1.00 36.57  ? 259  GLY A N   1 
ATOM   1792 C CA  . GLY A 1 225 ? 21.243 -6.571  22.542  1.00 37.37  ? 259  GLY A CA  1 
ATOM   1793 C C   . GLY A 1 225 ? 22.013 -5.540  21.757  1.00 41.16  ? 259  GLY A C   1 
ATOM   1794 O O   . GLY A 1 225 ? 22.461 -4.535  22.316  1.00 42.35  ? 259  GLY A O   1 
ATOM   1795 N N   . ASP A 1 226 ? 22.183 -5.778  20.461  1.00 41.10  ? 260  ASP A N   1 
ATOM   1796 C CA  . ASP A 1 226 ? 22.899 -4.824  19.641  1.00 42.69  ? 260  ASP A CA  1 
ATOM   1797 C C   . ASP A 1 226 ? 21.938 -3.783  19.098  1.00 43.33  ? 260  ASP A C   1 
ATOM   1798 O O   . ASP A 1 226 ? 22.351 -2.714  18.635  1.00 44.28  ? 260  ASP A O   1 
ATOM   1799 C CB  . ASP A 1 226 ? 23.626 -5.545  18.512  1.00 47.41  ? 260  ASP A CB  1 
ATOM   1800 C CG  . ASP A 1 226 ? 24.765 -6.410  19.021  1.00 50.94  ? 260  ASP A CG  1 
ATOM   1801 O OD1 . ASP A 1 226 ? 25.194 -7.328  18.276  1.00 51.71  ? 260  ASP A OD1 1 
ATOM   1802 O OD2 . ASP A 1 226 ? 25.228 -6.166  20.165  1.00 51.14  ? 260  ASP A OD2 1 
ATOM   1803 N N   . SER A 1 227 ? 20.650 -4.089  19.155  1.00 41.22  ? 261  SER A N   1 
ATOM   1804 C CA  . SER A 1 227 ? 19.659 -3.130  18.695  1.00 42.06  ? 261  SER A CA  1 
ATOM   1805 C C   . SER A 1 227 ? 18.647 -2.906  19.811  1.00 42.43  ? 261  SER A C   1 
ATOM   1806 O O   . SER A 1 227 ? 18.539 -3.712  20.734  1.00 40.71  ? 261  SER A O   1 
ATOM   1807 C CB  . SER A 1 227 ? 18.943 -3.635  17.443  1.00 42.41  ? 261  SER A CB  1 
ATOM   1808 O OG  . SER A 1 227 ? 18.116 -4.752  17.736  1.00 43.95  ? 261  SER A OG  1 
ATOM   1809 N N   . GLY A 1 228 ? 17.917 -1.797  19.723  1.00 42.81  ? 262  GLY A N   1 
ATOM   1810 C CA  . GLY A 1 228 ? 16.921 -1.493  20.724  1.00 42.46  ? 262  GLY A CA  1 
ATOM   1811 C C   . GLY A 1 228 ? 15.930 -2.634  20.764  1.00 43.28  ? 262  GLY A C   1 
ATOM   1812 O O   . GLY A 1 228 ? 15.438 -3.001  21.827  1.00 44.65  ? 262  GLY A O   1 
ATOM   1813 N N   . VAL A 1 229 ? 15.646 -3.201  19.597  1.00 43.11  ? 263  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 229 ? 14.709 -4.302  19.487  1.00 44.47  ? 263  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 229 ? 15.174 -5.480  20.331  1.00 44.79  ? 263  VAL A C   1 
ATOM   1816 O O   . VAL A 1 229 ? 14.433 -5.972  21.188  1.00 45.26  ? 263  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 229 ? 14.573 -4.770  18.026  1.00 44.82  ? 263  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 229 ? 13.495 -5.821  17.925  1.00 45.31  ? 263  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 229 ? 14.248 -3.599  17.139  1.00 46.18  ? 263  VAL A CG2 1 
ATOM   1820 N N   . ASP A 1 230 ? 16.397 -5.939  20.084  1.00 44.64  ? 264  ASP A N   1 
ATOM   1821 C CA  . ASP A 1 230 ? 16.936 -7.065  20.834  1.00 43.98  ? 264  ASP A CA  1 
ATOM   1822 C C   . ASP A 1 230 ? 16.956 -6.787  22.335  1.00 43.60  ? 264  ASP A C   1 
ATOM   1823 O O   . ASP A 1 230 ? 16.755 -7.699  23.133  1.00 43.98  ? 264  ASP A O   1 
ATOM   1824 C CB  . ASP A 1 230 ? 18.344 -7.404  20.345  1.00 45.45  ? 264  ASP A CB  1 
ATOM   1825 C CG  . ASP A 1 230 ? 18.364 -7.877  18.904  1.00 47.87  ? 264  ASP A CG  1 
ATOM   1826 O OD1 . ASP A 1 230 ? 17.272 -8.108  18.346  1.00 50.03  ? 264  ASP A OD1 1 
ATOM   1827 O OD2 . ASP A 1 230 ? 19.468 -8.021  18.329  1.00 48.72  ? 264  ASP A OD2 1 
ATOM   1828 N N   . GLN A 1 231 ? 17.193 -5.533  22.719  1.00 42.57  ? 265  GLN A N   1 
ATOM   1829 C CA  . GLN A 1 231 ? 17.225 -5.181  24.132  1.00 40.49  ? 265  GLN A CA  1 
ATOM   1830 C C   . GLN A 1 231 ? 15.800 -5.223  24.658  1.00 40.87  ? 265  GLN A C   1 
ATOM   1831 O O   . GLN A 1 231 ? 15.527 -5.781  25.720  1.00 41.43  ? 265  GLN A O   1 
ATOM   1832 C CB  . GLN A 1 231 ? 17.842 -3.790  24.328  1.00 40.51  ? 265  GLN A CB  1 
ATOM   1833 C CG  . GLN A 1 231 ? 19.290 -3.674  23.834  1.00 40.15  ? 265  GLN A CG  1 
ATOM   1834 C CD  . GLN A 1 231 ? 19.764 -2.233  23.721  1.00 40.68  ? 265  GLN A CD  1 
ATOM   1835 O OE1 . GLN A 1 231 ? 18.965 -1.295  23.675  1.00 41.84  ? 265  GLN A OE1 1 
ATOM   1836 N NE2 . GLN A 1 231 ? 21.070 -2.054  23.640  1.00 43.14  ? 265  GLN A NE2 1 
ATOM   1837 N N   . LEU A 1 232 ? 14.881 -4.650  23.898  1.00 41.39  ? 266  LEU A N   1 
ATOM   1838 C CA  . LEU A 1 232 ? 13.479 -4.646  24.288  1.00 42.60  ? 266  LEU A CA  1 
ATOM   1839 C C   . LEU A 1 232 ? 12.970 -6.071  24.487  1.00 44.20  ? 266  LEU A C   1 
ATOM   1840 O O   . LEU A 1 232 ? 12.184 -6.323  25.391  1.00 45.10  ? 266  LEU A O   1 
ATOM   1841 C CB  . LEU A 1 232 ? 12.651 -3.939  23.224  1.00 42.79  ? 266  LEU A CB  1 
ATOM   1842 C CG  . LEU A 1 232 ? 11.865 -2.735  23.721  1.00 44.14  ? 266  LEU A CG  1 
ATOM   1843 C CD1 . LEU A 1 232 ? 12.654 -1.949  24.742  1.00 42.04  ? 266  LEU A CD1 1 
ATOM   1844 C CD2 . LEU A 1 232 ? 11.511 -1.869  22.519  1.00 45.61  ? 266  LEU A CD2 1 
ATOM   1845 N N   . VAL A 1 233 ? 13.430 -7.005  23.658  1.00 44.91  ? 267  VAL A N   1 
ATOM   1846 C CA  . VAL A 1 233 ? 12.997 -8.395  23.781  1.00 45.22  ? 267  VAL A CA  1 
ATOM   1847 C C   . VAL A 1 233 ? 13.480 -9.028  25.082  1.00 45.75  ? 267  VAL A C   1 
ATOM   1848 O O   . VAL A 1 233 ? 12.746 -9.775  25.719  1.00 46.77  ? 267  VAL A O   1 
ATOM   1849 C CB  . VAL A 1 233 ? 13.493 -9.263  22.588  1.00 45.33  ? 267  VAL A CB  1 
ATOM   1850 C CG1 . VAL A 1 233 ? 13.113 -10.712 22.802  1.00 43.86  ? 267  VAL A CG1 1 
ATOM   1851 C CG2 . VAL A 1 233 ? 12.896 -8.760  21.284  1.00 46.02  ? 267  VAL A CG2 1 
ATOM   1852 N N   . GLU A 1 234 ? 14.711 -8.731  25.476  1.00 45.82  ? 268  GLU A N   1 
ATOM   1853 C CA  . GLU A 1 234 ? 15.263 -9.281  26.713  1.00 47.32  ? 268  GLU A CA  1 
ATOM   1854 C C   . GLU A 1 234 ? 14.559 -8.728  27.952  1.00 47.54  ? 268  GLU A C   1 
ATOM   1855 O O   . GLU A 1 234 ? 14.360 -9.442  28.929  1.00 46.38  ? 268  GLU A O   1 
ATOM   1856 C CB  . GLU A 1 234 ? 16.759 -8.978  26.789  1.00 48.55  ? 268  GLU A CB  1 
ATOM   1857 C CG  . GLU A 1 234 ? 17.536 -9.642  25.684  1.00 50.55  ? 268  GLU A CG  1 
ATOM   1858 C CD  . GLU A 1 234 ? 17.424 -11.151 25.765  1.00 52.41  ? 268  GLU A CD  1 
ATOM   1859 O OE1 . GLU A 1 234 ? 17.599 -11.830 24.734  1.00 54.56  ? 268  GLU A OE1 1 
ATOM   1860 O OE2 . GLU A 1 234 ? 17.165 -11.660 26.874  1.00 52.26  ? 268  GLU A OE2 1 
ATOM   1861 N N   . ILE A 1 235 ? 14.187 -7.451  27.896  1.00 48.21  ? 269  ILE A N   1 
ATOM   1862 C CA  . ILE A 1 235 ? 13.502 -6.781  28.995  1.00 47.75  ? 269  ILE A CA  1 
ATOM   1863 C C   . ILE A 1 235 ? 12.108 -7.357  29.146  1.00 50.25  ? 269  ILE A C   1 
ATOM   1864 O O   . ILE A 1 235 ? 11.656 -7.639  30.263  1.00 51.03  ? 269  ILE A O   1 
ATOM   1865 C CB  . ILE A 1 235 ? 13.380 -5.265  28.728  1.00 46.49  ? 269  ILE A CB  1 
ATOM   1866 C CG1 . ILE A 1 235 ? 14.777 -4.635  28.723  1.00 43.58  ? 269  ILE A CG1 1 
ATOM   1867 C CG2 . ILE A 1 235 ? 12.451 -4.611  29.759  1.00 41.62  ? 269  ILE A CG2 1 
ATOM   1868 C CD1 . ILE A 1 235 ? 14.782 -3.181  28.318  1.00 41.41  ? 269  ILE A CD1 1 
ATOM   1869 N N   . ILE A 1 236 ? 11.425 -7.521  28.015  1.00 50.86  ? 270  ILE A N   1 
ATOM   1870 C CA  . ILE A 1 236 ? 10.075 -8.075  28.010  1.00 52.43  ? 270  ILE A CA  1 
ATOM   1871 C C   . ILE A 1 236 ? 10.085 -9.513  28.558  1.00 54.02  ? 270  ILE A C   1 
ATOM   1872 O O   . ILE A 1 236 ? 9.177  -9.896  29.292  1.00 54.15  ? 270  ILE A O   1 
ATOM   1873 C CB  . ILE A 1 236 ? 9.448  -8.024  26.570  1.00 51.92  ? 270  ILE A CB  1 
ATOM   1874 C CG1 . ILE A 1 236 ? 9.024  -6.586  26.225  1.00 51.16  ? 270  ILE A CG1 1 
ATOM   1875 C CG2 . ILE A 1 236 ? 8.223  -8.898  26.492  1.00 52.92  ? 270  ILE A CG2 1 
ATOM   1876 C CD1 . ILE A 1 236 ? 8.536  -6.413  24.802  1.00 47.23  ? 270  ILE A CD1 1 
ATOM   1877 N N   . LYS A 1 237 ? 11.108 -10.302 28.229  1.00 55.00  ? 271  LYS A N   1 
ATOM   1878 C CA  . LYS A 1 237 ? 11.173 -11.672 28.739  1.00 56.63  ? 271  LYS A CA  1 
ATOM   1879 C C   . LYS A 1 237 ? 11.139 -11.710 30.259  1.00 56.65  ? 271  LYS A C   1 
ATOM   1880 O O   . LYS A 1 237 ? 10.578 -12.630 30.844  1.00 58.39  ? 271  LYS A O   1 
ATOM   1881 C CB  . LYS A 1 237 ? 12.451 -12.385 28.297  1.00 57.06  ? 271  LYS A CB  1 
ATOM   1882 C CG  . LYS A 1 237 ? 12.493 -12.868 26.869  1.00 58.71  ? 271  LYS A CG  1 
ATOM   1883 C CD  . LYS A 1 237 ? 13.812 -13.597 26.642  1.00 59.87  ? 271  LYS A CD  1 
ATOM   1884 C CE  . LYS A 1 237 ? 14.015 -13.959 25.186  1.00 63.84  ? 271  LYS A CE  1 
ATOM   1885 N NZ  . LYS A 1 237 ? 15.379 -14.531 24.951  1.00 64.43  ? 271  LYS A NZ  1 
ATOM   1886 N N   . VAL A 1 238 ? 11.746 -10.714 30.895  1.00 56.80  ? 272  VAL A N   1 
ATOM   1887 C CA  . VAL A 1 238 ? 11.801 -10.672 32.346  1.00 56.22  ? 272  VAL A CA  1 
ATOM   1888 C C   . VAL A 1 238 ? 10.686 -9.876  32.993  1.00 58.46  ? 272  VAL A C   1 
ATOM   1889 O O   . VAL A 1 238 ? 10.119 -10.306 33.994  1.00 59.32  ? 272  VAL A O   1 
ATOM   1890 C CB  . VAL A 1 238 ? 13.136 -10.105 32.828  1.00 54.03  ? 272  VAL A CB  1 
ATOM   1891 C CG1 . VAL A 1 238 ? 13.159 -10.044 34.343  1.00 50.51  ? 272  VAL A CG1 1 
ATOM   1892 C CG2 . VAL A 1 238 ? 14.271 -10.960 32.300  1.00 52.29  ? 272  VAL A CG2 1 
ATOM   1893 N N   . LEU A 1 239 ? 10.356 -8.724  32.429  1.00 59.86  ? 273  LEU A N   1 
ATOM   1894 C CA  . LEU A 1 239 ? 9.303  -7.910  33.020  1.00 61.46  ? 273  LEU A CA  1 
ATOM   1895 C C   . LEU A 1 239 ? 7.904  -8.231  32.514  1.00 63.67  ? 273  LEU A C   1 
ATOM   1896 O O   . LEU A 1 239 ? 6.921  -7.886  33.156  1.00 65.17  ? 273  LEU A O   1 
ATOM   1897 C CB  . LEU A 1 239 ? 9.591  -6.421  32.800  1.00 58.92  ? 273  LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 239 ? 10.929 -5.853  33.279  1.00 56.26  ? 273  LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 239 ? 10.818 -4.336  33.269  1.00 54.87  ? 273  LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 239 ? 11.272 -6.358  34.656  1.00 53.02  ? 273  LEU A CD2 1 
ATOM   1901 N N   . GLY A 1 240 ? 7.808  -8.896  31.372  1.00 65.89  ? 274  GLY A N   1 
ATOM   1902 C CA  . GLY A 1 240 ? 6.499  -9.209  30.833  1.00 67.96  ? 274  GLY A CA  1 
ATOM   1903 C C   . GLY A 1 240 ? 6.118  -8.196  29.772  1.00 70.57  ? 274  GLY A C   1 
ATOM   1904 O O   . GLY A 1 240 ? 6.969  -7.436  29.306  1.00 70.89  ? 274  GLY A O   1 
ATOM   1905 N N   . THR A 1 241 ? 4.848  -8.167  29.385  1.00 72.21  ? 275  THR A N   1 
ATOM   1906 C CA  . THR A 1 241 ? 4.421  -7.230  28.356  1.00 74.81  ? 275  THR A CA  1 
ATOM   1907 C C   . THR A 1 241 ? 3.954  -5.906  28.963  1.00 75.82  ? 275  THR A C   1 
ATOM   1908 O O   . THR A 1 241 ? 3.142  -5.881  29.888  1.00 76.26  ? 275  THR A O   1 
ATOM   1909 C CB  . THR A 1 241 ? 3.291  -7.842  27.477  1.00 75.46  ? 275  THR A CB  1 
ATOM   1910 O OG1 . THR A 1 241 ? 3.714  -9.118  26.973  1.00 75.66  ? 275  THR A OG1 1 
ATOM   1911 C CG2 . THR A 1 241 ? 2.990  -6.937  26.288  1.00 75.14  ? 275  THR A CG2 1 
ATOM   1912 N N   . PRO A 1 242 ? 4.487  -4.784  28.463  1.00 76.88  ? 276  PRO A N   1 
ATOM   1913 C CA  . PRO A 1 242 ? 4.118  -3.453  28.958  1.00 78.29  ? 276  PRO A CA  1 
ATOM   1914 C C   . PRO A 1 242 ? 2.646  -3.137  28.688  1.00 80.27  ? 276  PRO A C   1 
ATOM   1915 O O   . PRO A 1 242 ? 2.189  -3.206  27.543  1.00 81.01  ? 276  PRO A O   1 
ATOM   1916 C CB  . PRO A 1 242 ? 5.040  -2.522  28.174  1.00 77.67  ? 276  PRO A CB  1 
ATOM   1917 C CG  . PRO A 1 242 ? 6.213  -3.381  27.858  1.00 77.65  ? 276  PRO A CG  1 
ATOM   1918 C CD  . PRO A 1 242 ? 5.588  -4.696  27.493  1.00 77.17  ? 276  PRO A CD  1 
ATOM   1919 N N   . THR A 1 243 ? 1.908  -2.786  29.738  1.00 81.46  ? 277  THR A N   1 
ATOM   1920 C CA  . THR A 1 243 ? 0.496  -2.454  29.587  1.00 82.58  ? 277  THR A CA  1 
ATOM   1921 C C   . THR A 1 243 ? 0.380  -1.149  28.797  1.00 84.34  ? 277  THR A C   1 
ATOM   1922 O O   . THR A 1 243 ? 1.331  -0.366  28.737  1.00 84.71  ? 277  THR A O   1 
ATOM   1923 C CB  . THR A 1 243 ? -0.191 -2.275  30.960  1.00 81.99  ? 277  THR A CB  1 
ATOM   1924 O OG1 . THR A 1 243 ? 0.223  -1.037  31.553  1.00 81.91  ? 277  THR A OG1 1 
ATOM   1925 C CG2 . THR A 1 243 ? 0.184  -3.417  31.890  1.00 80.33  ? 277  THR A CG2 1 
ATOM   1926 N N   . ARG A 1 244 ? -0.777 -0.921  28.186  1.00 85.84  ? 278  ARG A N   1 
ATOM   1927 C CA  . ARG A 1 244 ? -0.995 0.293   27.405  1.00 87.75  ? 278  ARG A CA  1 
ATOM   1928 C C   . ARG A 1 244 ? -0.635 1.500   28.263  1.00 86.88  ? 278  ARG A C   1 
ATOM   1929 O O   . ARG A 1 244 ? -0.095 2.497   27.774  1.00 86.62  ? 278  ARG A O   1 
ATOM   1930 C CB  . ARG A 1 244 ? -2.466 0.380   26.970  1.00 90.50  ? 278  ARG A CB  1 
ATOM   1931 C CG  . ARG A 1 244 ? -2.790 1.506   25.986  1.00 93.72  ? 278  ARG A CG  1 
ATOM   1932 C CD  . ARG A 1 244 ? -4.276 1.494   25.634  1.00 96.44  ? 278  ARG A CD  1 
ATOM   1933 N NE  . ARG A 1 244 ? -4.710 0.165   25.199  1.00 98.98  ? 278  ARG A NE  1 
ATOM   1934 C CZ  . ARG A 1 244 ? -5.970 -0.167  24.920  1.00 100.17 ? 278  ARG A CZ  1 
ATOM   1935 N NH1 . ARG A 1 244 ? -6.943 0.735   25.028  1.00 100.70 ? 278  ARG A NH1 1 
ATOM   1936 N NH2 . ARG A 1 244 ? -6.260 -1.406  24.535  1.00 100.10 ? 278  ARG A NH2 1 
ATOM   1937 N N   . GLU A 1 245 ? -0.935 1.384   29.553  1.00 86.09  ? 279  GLU A N   1 
ATOM   1938 C CA  . GLU A 1 245 ? -0.671 2.441   30.519  1.00 86.25  ? 279  GLU A CA  1 
ATOM   1939 C C   . GLU A 1 245 ? 0.835  2.652   30.735  1.00 84.64  ? 279  GLU A C   1 
ATOM   1940 O O   . GLU A 1 245 ? 1.330  3.781   30.651  1.00 84.07  ? 279  GLU A O   1 
ATOM   1941 C CB  . GLU A 1 245 ? -1.345 2.097   31.846  1.00 88.36  ? 279  GLU A CB  1 
ATOM   1942 C CG  . GLU A 1 245 ? -1.199 3.162   32.915  1.00 93.13  ? 279  GLU A CG  1 
ATOM   1943 C CD  . GLU A 1 245 ? -1.552 2.634   34.296  1.00 96.85  ? 279  GLU A CD  1 
ATOM   1944 O OE1 . GLU A 1 245 ? -0.933 1.631   34.723  1.00 99.06  ? 279  GLU A OE1 1 
ATOM   1945 O OE2 . GLU A 1 245 ? -2.438 3.220   34.959  1.00 98.97  ? 279  GLU A OE2 1 
ATOM   1946 N N   . GLN A 1 246 ? 1.556  1.567   31.016  1.00 81.92  ? 280  GLN A N   1 
ATOM   1947 C CA  . GLN A 1 246 ? 2.993  1.647   31.233  1.00 79.72  ? 280  GLN A CA  1 
ATOM   1948 C C   . GLN A 1 246 ? 3.686  2.218   29.996  1.00 79.63  ? 280  GLN A C   1 
ATOM   1949 O O   . GLN A 1 246 ? 4.566  3.070   30.107  1.00 79.36  ? 280  GLN A O   1 
ATOM   1950 C CB  . GLN A 1 246 ? 3.562  0.263   31.568  1.00 77.53  ? 280  GLN A CB  1 
ATOM   1951 C CG  . GLN A 1 246 ? 3.118  -0.288  32.917  1.00 74.11  ? 280  GLN A CG  1 
ATOM   1952 C CD  . GLN A 1 246 ? 3.542  -1.744  33.141  1.00 73.34  ? 280  GLN A CD  1 
ATOM   1953 O OE1 . GLN A 1 246 ? 3.206  -2.634  32.352  1.00 73.71  ? 280  GLN A OE1 1 
ATOM   1954 N NE2 . GLN A 1 246 ? 4.263  -1.992  34.233  1.00 71.05  ? 280  GLN A NE2 1 
ATOM   1955 N N   . ILE A 1 247 ? 3.285  1.760   28.817  1.00 80.07  ? 281  ILE A N   1 
ATOM   1956 C CA  . ILE A 1 247 ? 3.885  2.247   27.580  1.00 81.05  ? 281  ILE A CA  1 
ATOM   1957 C C   . ILE A 1 247 ? 3.679  3.747   27.441  1.00 81.64  ? 281  ILE A C   1 
ATOM   1958 O O   . ILE A 1 247 ? 4.472  4.434   26.795  1.00 81.34  ? 281  ILE A O   1 
ATOM   1959 C CB  . ILE A 1 247 ? 3.273  1.559   26.348  1.00 81.00  ? 281  ILE A CB  1 
ATOM   1960 C CG1 . ILE A 1 247 ? 3.458  0.046   26.468  1.00 81.14  ? 281  ILE A CG1 1 
ATOM   1961 C CG2 . ILE A 1 247 ? 3.927  2.094   25.071  1.00 80.24  ? 281  ILE A CG2 1 
ATOM   1962 C CD1 . ILE A 1 247 ? 2.874  -0.746  25.316  1.00 81.69  ? 281  ILE A CD1 1 
ATOM   1963 N N   . ARG A 1 248 ? 2.611  4.246   28.056  1.00 82.90  ? 282  ARG A N   1 
ATOM   1964 C CA  . ARG A 1 248 ? 2.279  5.663   27.997  1.00 84.64  ? 282  ARG A CA  1 
ATOM   1965 C C   . ARG A 1 248 ? 3.024  6.479   29.046  1.00 84.50  ? 282  ARG A C   1 
ATOM   1966 O O   . ARG A 1 248 ? 3.245  7.675   28.862  1.00 83.97  ? 282  ARG A O   1 
ATOM   1967 C CB  . ARG A 1 248 ? 0.768  5.851   28.164  1.00 86.99  ? 282  ARG A CB  1 
ATOM   1968 C CG  . ARG A 1 248 ? 0.280  7.283   27.947  1.00 90.29  ? 282  ARG A CG  1 
ATOM   1969 C CD  . ARG A 1 248 ? -1.242 7.319   27.845  1.00 92.81  ? 282  ARG A CD  1 
ATOM   1970 N NE  . ARG A 1 248 ? -1.717 6.300   26.908  1.00 96.01  ? 282  ARG A NE  1 
ATOM   1971 C CZ  . ARG A 1 248 ? -2.989 6.104   26.574  1.00 96.75  ? 282  ARG A CZ  1 
ATOM   1972 N NH1 . ARG A 1 248 ? -3.942 6.866   27.101  1.00 97.26  ? 282  ARG A NH1 1 
ATOM   1973 N NH2 . ARG A 1 248 ? -3.306 5.138   25.715  1.00 97.00  ? 282  ARG A NH2 1 
ATOM   1974 N N   . GLU A 1 249 ? 3.407  5.841   30.148  1.00 84.88  ? 283  GLU A N   1 
ATOM   1975 C CA  . GLU A 1 249 ? 4.139  6.545   31.197  1.00 84.93  ? 283  GLU A CA  1 
ATOM   1976 C C   . GLU A 1 249 ? 5.607  6.659   30.800  1.00 84.66  ? 283  GLU A C   1 
ATOM   1977 O O   . GLU A 1 249 ? 6.303  7.589   31.217  1.00 84.02  ? 283  GLU A O   1 
ATOM   1978 C CB  . GLU A 1 249 ? 3.985  5.823   32.536  1.00 85.78  ? 283  GLU A CB  1 
ATOM   1979 C CG  . GLU A 1 249 ? 2.530  5.654   32.947  1.00 87.63  ? 283  GLU A CG  1 
ATOM   1980 C CD  . GLU A 1 249 ? 2.368  5.331   34.414  1.00 89.00  ? 283  GLU A CD  1 
ATOM   1981 O OE1 . GLU A 1 249 ? 2.673  6.208   35.250  1.00 89.75  ? 283  GLU A OE1 1 
ATOM   1982 O OE2 . GLU A 1 249 ? 1.934  4.203   34.734  1.00 90.63  ? 283  GLU A OE2 1 
ATOM   1983 N N   . MET A 1 250 ? 6.064  5.709   29.982  1.00 85.33  ? 284  MET A N   1 
ATOM   1984 C CA  . MET A 1 250 ? 7.435  5.706   29.467  1.00 86.21  ? 284  MET A CA  1 
ATOM   1985 C C   . MET A 1 250 ? 7.470  6.834   28.437  1.00 88.30  ? 284  MET A C   1 
ATOM   1986 O O   . MET A 1 250 ? 8.526  7.245   27.957  1.00 88.17  ? 284  MET A O   1 
ATOM   1987 C CB  . MET A 1 250 ? 7.763  4.349   28.824  1.00 83.33  ? 284  MET A CB  1 
ATOM   1988 C CG  . MET A 1 250 ? 7.769  3.204   29.843  1.00 80.73  ? 284  MET A CG  1 
ATOM   1989 S SD  . MET A 1 250 ? 8.367  1.587   29.291  1.00 78.23  ? 284  MET A SD  1 
ATOM   1990 C CE  . MET A 1 250 ? 6.839  0.772   28.855  1.00 78.16  ? 284  MET A CE  1 
ATOM   1991 N N   . ASN A 1 251 ? 6.265  7.313   28.139  1.00 91.75  ? 285  ASN A N   1 
ATOM   1992 C CA  . ASN A 1 251 ? 5.957  8.416   27.234  1.00 94.59  ? 285  ASN A CA  1 
ATOM   1993 C C   . ASN A 1 251 ? 5.803  8.145   25.736  1.00 96.33  ? 285  ASN A C   1 
ATOM   1994 O O   . ASN A 1 251 ? 4.682  7.902   25.282  1.00 96.50  ? 285  ASN A O   1 
ATOM   1995 C CB  . ASN A 1 251 ? 6.915  9.594   27.451  1.00 95.35  ? 285  ASN A CB  1 
ATOM   1996 C CG  . ASN A 1 251 ? 6.499  10.819  26.662  1.00 95.86  ? 285  ASN A CG  1 
ATOM   1997 O OD1 . ASN A 1 251 ? 5.359  11.283  26.781  1.00 95.37  ? 285  ASN A OD1 1 
ATOM   1998 N ND2 . ASN A 1 251 ? 7.415  11.352  25.849  1.00 96.11  ? 285  ASN A ND2 1 
ATOM   1999 N N   . PRO A 1 252 ? 6.905  8.171   24.952  1.00 96.96  ? 286  PRO A N   1 
ATOM   2000 C CA  . PRO A 1 252 ? 6.794  7.930   23.509  1.00 97.75  ? 286  PRO A CA  1 
ATOM   2001 C C   . PRO A 1 252 ? 5.458  7.364   23.052  1.00 99.23  ? 286  PRO A C   1 
ATOM   2002 O O   . PRO A 1 252 ? 5.076  6.251   23.435  1.00 99.71  ? 286  PRO A O   1 
ATOM   2003 C CB  . PRO A 1 252 ? 7.962  7.008   23.240  1.00 97.65  ? 286  PRO A CB  1 
ATOM   2004 C CG  . PRO A 1 252 ? 9.013  7.665   24.063  1.00 97.86  ? 286  PRO A CG  1 
ATOM   2005 C CD  . PRO A 1 252 ? 8.298  7.950   25.381  1.00 96.88  ? 286  PRO A CD  1 
ATOM   2006 N N   . ASN A 1 253 ? 4.757  8.159   22.241  1.00 99.36  ? 287  ASN A N   1 
ATOM   2007 C CA  . ASN A 1 253 ? 3.436  7.819   21.708  1.00 99.65  ? 287  ASN A CA  1 
ATOM   2008 C C   . ASN A 1 253 ? 3.419  6.528   20.894  1.00 100.05 ? 287  ASN A C   1 
ATOM   2009 O O   . ASN A 1 253 ? 2.758  6.434   19.857  1.00 100.04 ? 287  ASN A O   1 
ATOM   2010 C CB  . ASN A 1 253 ? 2.917  8.984   20.866  1.00 99.96  ? 287  ASN A CB  1 
ATOM   2011 C CG  . ASN A 1 253 ? 3.050  10.317  21.583  1.00 100.99 ? 287  ASN A CG  1 
ATOM   2012 O OD1 . ASN A 1 253 ? 4.163  10.766  21.883  1.00 100.97 ? 287  ASN A OD1 1 
ATOM   2013 N ND2 . ASN A 1 253 ? 1.915  10.958  21.864  1.00 100.79 ? 287  ASN A ND2 1 
ATOM   2014 N N   . TYR A 1 254 ? 4.157  5.535   21.384  1.00 100.68 ? 288  TYR A N   1 
ATOM   2015 C CA  . TYR A 1 254 ? 4.242  4.224   20.758  1.00 100.79 ? 288  TYR A CA  1 
ATOM   2016 C C   . TYR A 1 254 ? 3.134  3.342   21.326  1.00 101.21 ? 288  TYR A C   1 
ATOM   2017 O O   . TYR A 1 254 ? 3.319  2.128   21.472  1.00 101.89 ? 288  TYR A O   1 
ATOM   2018 C CB  . TYR A 1 254 ? 5.601  3.573   21.049  1.00 99.60  ? 288  TYR A CB  1 
ATOM   2019 C CG  . TYR A 1 254 ? 6.762  4.159   20.280  1.00 98.90  ? 288  TYR A CG  1 
ATOM   2020 C CD1 . TYR A 1 254 ? 7.053  5.528   20.343  1.00 98.37  ? 288  TYR A CD1 1 
ATOM   2021 C CD2 . TYR A 1 254 ? 7.590  3.342   19.509  1.00 98.34  ? 288  TYR A CD2 1 
ATOM   2022 C CE1 . TYR A 1 254 ? 8.144  6.068   19.660  1.00 98.29  ? 288  TYR A CE1 1 
ATOM   2023 C CE2 . TYR A 1 254 ? 8.684  3.871   18.822  1.00 98.60  ? 288  TYR A CE2 1 
ATOM   2024 C CZ  . TYR A 1 254 ? 8.957  5.231   18.903  1.00 98.50  ? 288  TYR A CZ  1 
ATOM   2025 O OH  . TYR A 1 254 ? 10.050 5.746   18.241  1.00 98.21  ? 288  TYR A OH  1 
ATOM   2026 N N   . THR A 1 255 ? 1.992  3.949   21.662  1.00 101.05 ? 289  THR A N   1 
ATOM   2027 C CA  . THR A 1 255 ? 0.865  3.189   22.205  1.00 100.81 ? 289  THR A CA  1 
ATOM   2028 C C   . THR A 1 255 ? 0.549  2.096   21.187  1.00 100.99 ? 289  THR A C   1 
ATOM   2029 O O   . THR A 1 255 ? -0.054 1.067   21.517  1.00 101.64 ? 289  THR A O   1 
ATOM   2030 C CB  . THR A 1 255 ? -0.382 4.083   22.430  1.00 100.72 ? 289  THR A CB  1 
ATOM   2031 O OG1 . THR A 1 255 ? -0.042 5.172   23.300  1.00 100.71 ? 289  THR A OG1 1 
ATOM   2032 C CG2 . THR A 1 255 ? -1.509 3.279   23.078  1.00 100.03 ? 289  THR A CG2 1 
ATOM   2033 N N   . GLU A 1 256 ? 0.974  2.340   19.946  1.00 100.19 ? 290  GLU A N   1 
ATOM   2034 C CA  . GLU A 1 256 ? 0.814  1.396   18.844  1.00 99.21  ? 290  GLU A CA  1 
ATOM   2035 C C   . GLU A 1 256 ? 2.055  0.494   18.934  1.00 98.03  ? 290  GLU A C   1 
ATOM   2036 O O   . GLU A 1 256 ? 2.970  0.563   18.100  1.00 97.26  ? 290  GLU A O   1 
ATOM   2037 C CB  . GLU A 1 256 ? 0.783  2.155   17.512  1.00 100.43 ? 290  GLU A CB  1 
ATOM   2038 C CG  . GLU A 1 256 ? 0.522  1.292   16.280  1.00 101.52 ? 290  GLU A CG  1 
ATOM   2039 C CD  . GLU A 1 256 ? 0.328  2.121   15.014  1.00 102.42 ? 290  GLU A CD  1 
ATOM   2040 O OE1 . GLU A 1 256 ? 1.245  2.900   14.654  1.00 102.24 ? 290  GLU A OE1 1 
ATOM   2041 O OE2 . GLU A 1 256 ? -0.744 1.989   14.378  1.00 102.38 ? 290  GLU A OE2 1 
ATOM   2042 N N   . PHE A 1 257 ? 2.069  -0.333  19.978  1.00 95.89  ? 291  PHE A N   1 
ATOM   2043 C CA  . PHE A 1 257 ? 3.172  -1.242  20.265  1.00 94.37  ? 291  PHE A CA  1 
ATOM   2044 C C   . PHE A 1 257 ? 3.010  -2.589  19.543  1.00 93.81  ? 291  PHE A C   1 
ATOM   2045 O O   . PHE A 1 257 ? 1.988  -3.264  19.689  1.00 93.61  ? 291  PHE A O   1 
ATOM   2046 C CB  . PHE A 1 257 ? 3.266  -1.435  21.790  1.00 92.84  ? 291  PHE A CB  1 
ATOM   2047 C CG  . PHE A 1 257 ? 4.567  -2.028  22.250  1.00 91.09  ? 291  PHE A CG  1 
ATOM   2048 C CD1 . PHE A 1 257 ? 5.780  -1.456  21.872  1.00 90.31  ? 291  PHE A CD1 1 
ATOM   2049 C CD2 . PHE A 1 257 ? 4.582  -3.175  23.039  1.00 90.05  ? 291  PHE A CD2 1 
ATOM   2050 C CE1 . PHE A 1 257 ? 6.991  -2.022  22.264  1.00 89.39  ? 291  PHE A CE1 1 
ATOM   2051 C CE2 . PHE A 1 257 ? 5.785  -3.749  23.437  1.00 89.53  ? 291  PHE A CE2 1 
ATOM   2052 C CZ  . PHE A 1 257 ? 6.994  -3.171  23.048  1.00 89.32  ? 291  PHE A CZ  1 
ATOM   2053 N N   . ALA A 1 258 ? 4.021  -2.965  18.760  1.00 92.87  ? 292  ALA A N   1 
ATOM   2054 C CA  . ALA A 1 258 ? 3.994  -4.216  18.007  1.00 92.69  ? 292  ALA A CA  1 
ATOM   2055 C C   . ALA A 1 258 ? 5.014  -5.227  18.523  1.00 92.50  ? 292  ALA A C   1 
ATOM   2056 O O   . ALA A 1 258 ? 6.115  -5.348  17.981  1.00 92.97  ? 292  ALA A O   1 
ATOM   2057 C CB  . ALA A 1 258 ? 4.243  -3.937  16.519  1.00 92.16  ? 292  ALA A CB  1 
ATOM   2058 N N   . PHE A 1 259 ? 4.640  -5.953  19.572  1.00 92.07  ? 293  PHE A N   1 
ATOM   2059 C CA  . PHE A 1 259 ? 5.502  -6.966  20.172  1.00 91.86  ? 293  PHE A CA  1 
ATOM   2060 C C   . PHE A 1 259 ? 4.667  -8.105  20.758  1.00 92.63  ? 293  PHE A C   1 
ATOM   2061 O O   . PHE A 1 259 ? 3.556  -7.879  21.255  1.00 92.66  ? 293  PHE A O   1 
ATOM   2062 C CB  . PHE A 1 259 ? 6.356  -6.354  21.288  1.00 91.14  ? 293  PHE A CB  1 
ATOM   2063 C CG  . PHE A 1 259 ? 7.748  -5.989  20.863  1.00 90.28  ? 293  PHE A CG  1 
ATOM   2064 C CD1 . PHE A 1 259 ? 8.013  -4.763  20.257  1.00 90.65  ? 293  PHE A CD1 1 
ATOM   2065 C CD2 . PHE A 1 259 ? 8.794  -6.885  21.053  1.00 89.23  ? 293  PHE A CD2 1 
ATOM   2066 C CE1 . PHE A 1 259 ? 9.308  -4.430  19.849  1.00 90.22  ? 293  PHE A CE1 1 
ATOM   2067 C CE2 . PHE A 1 259 ? 10.088 -6.567  20.651  1.00 89.25  ? 293  PHE A CE2 1 
ATOM   2068 C CZ  . PHE A 1 259 ? 10.347 -5.336  20.045  1.00 89.71  ? 293  PHE A CZ  1 
ATOM   2069 N N   . PRO A 1 260 ? 5.191  -9.348  20.706  1.00 93.22  ? 294  PRO A N   1 
ATOM   2070 C CA  . PRO A 1 260 ? 4.490  -10.528 21.240  1.00 93.90  ? 294  PRO A CA  1 
ATOM   2071 C C   . PRO A 1 260 ? 3.957  -10.342 22.677  1.00 94.67  ? 294  PRO A C   1 
ATOM   2072 O O   . PRO A 1 260 ? 4.465  -9.505  23.432  1.00 94.77  ? 294  PRO A O   1 
ATOM   2073 C CB  . PRO A 1 260 ? 5.556  -11.623 21.150  1.00 92.62  ? 294  PRO A CB  1 
ATOM   2074 C CG  . PRO A 1 260 ? 6.287  -11.241 19.899  1.00 91.83  ? 294  PRO A CG  1 
ATOM   2075 C CD  . PRO A 1 260 ? 6.448  -9.743  20.041  1.00 92.07  ? 294  PRO A CD  1 
ATOM   2076 N N   . GLN A 1 261 ? 2.935  -11.119 23.044  1.00 95.20  ? 295  GLN A N   1 
ATOM   2077 C CA  . GLN A 1 261 ? 2.343  -11.044 24.387  1.00 95.92  ? 295  GLN A CA  1 
ATOM   2078 C C   . GLN A 1 261 ? 3.032  -12.031 25.337  1.00 95.62  ? 295  GLN A C   1 
ATOM   2079 O O   . GLN A 1 261 ? 2.450  -13.051 25.723  1.00 94.86  ? 295  GLN A O   1 
ATOM   2080 C CB  . GLN A 1 261 ? 0.839  -11.355 24.338  1.00 96.52  ? 295  GLN A CB  1 
ATOM   2081 C CG  . GLN A 1 261 ? 0.110  -11.159 25.673  1.00 97.85  ? 295  GLN A CG  1 
ATOM   2082 C CD  . GLN A 1 261 ? -1.321 -11.704 25.658  1.00 99.44  ? 295  GLN A CD  1 
ATOM   2083 O OE1 . GLN A 1 261 ? -2.107 -11.401 24.751  1.00 98.86  ? 295  GLN A OE1 1 
ATOM   2084 N NE2 . GLN A 1 261 ? -1.663 -12.508 26.671  1.00 99.87  ? 295  GLN A NE2 1 
ATOM   2085 N N   . ILE A 1 262 ? 4.272  -11.718 25.710  1.00 95.35  ? 296  ILE A N   1 
ATOM   2086 C CA  . ILE A 1 262 ? 5.049  -12.572 26.604  1.00 94.87  ? 296  ILE A CA  1 
ATOM   2087 C C   . ILE A 1 262 ? 4.913  -12.105 28.055  1.00 95.53  ? 296  ILE A C   1 
ATOM   2088 O O   . ILE A 1 262 ? 5.225  -10.959 28.383  1.00 96.35  ? 296  ILE A O   1 
ATOM   2089 C CB  . ILE A 1 262 ? 6.556  -12.579 26.195  1.00 93.46  ? 296  ILE A CB  1 
ATOM   2090 C CG1 . ILE A 1 262 ? 6.700  -13.013 24.725  1.00 92.36  ? 296  ILE A CG1 1 
ATOM   2091 C CG2 . ILE A 1 262 ? 7.341  -13.518 27.102  1.00 92.12  ? 296  ILE A CG2 1 
ATOM   2092 C CD1 . ILE A 1 262 ? 8.112  -12.936 24.172  1.00 91.55  ? 296  ILE A CD1 1 
ATOM   2093 N N   . LYS A 1 263 ? 4.420  -12.991 28.915  1.00 95.80  ? 297  LYS A N   1 
ATOM   2094 C CA  . LYS A 1 263 ? 4.256  -12.679 30.333  1.00 95.58  ? 297  LYS A CA  1 
ATOM   2095 C C   . LYS A 1 263 ? 5.590  -12.970 31.024  1.00 95.29  ? 297  LYS A C   1 
ATOM   2096 O O   . LYS A 1 263 ? 6.403  -13.742 30.513  1.00 95.04  ? 297  LYS A O   1 
ATOM   2097 C CB  . LYS A 1 263 ? 3.104  -13.513 30.916  1.00 95.20  ? 297  LYS A CB  1 
ATOM   2098 C CG  . LYS A 1 263 ? 1.764  -13.178 30.245  1.00 95.35  ? 297  LYS A CG  1 
ATOM   2099 C CD  . LYS A 1 263 ? 0.649  -14.164 30.559  1.00 95.18  ? 297  LYS A CD  1 
ATOM   2100 C CE  . LYS A 1 263 ? -0.577 -13.874 29.693  1.00 94.96  ? 297  LYS A CE  1 
ATOM   2101 N NZ  . LYS A 1 263 ? -1.670 -14.870 29.883  1.00 93.95  ? 297  LYS A NZ  1 
ATOM   2102 N N   . ALA A 1 264 ? 5.818  -12.348 32.176  1.00 95.22  ? 298  ALA A N   1 
ATOM   2103 C CA  . ALA A 1 264 ? 7.080  -12.506 32.892  1.00 95.41  ? 298  ALA A CA  1 
ATOM   2104 C C   . ALA A 1 264 ? 7.315  -13.816 33.632  1.00 95.66  ? 298  ALA A C   1 
ATOM   2105 O O   . ALA A 1 264 ? 6.447  -14.287 34.377  1.00 95.30  ? 298  ALA A O   1 
ATOM   2106 C CB  . ALA A 1 264 ? 7.263  -11.341 33.864  1.00 95.48  ? 298  ALA A CB  1 
ATOM   2107 N N   . HIS A 1 265 ? 8.493  -14.405 33.406  1.00 96.27  ? 299  HIS A N   1 
ATOM   2108 C CA  . HIS A 1 265 ? 8.882  -15.630 34.101  1.00 96.16  ? 299  HIS A CA  1 
ATOM   2109 C C   . HIS A 1 265 ? 9.715  -15.125 35.273  1.00 94.29  ? 299  HIS A C   1 
ATOM   2110 O O   . HIS A 1 265 ? 10.929 -14.927 35.167  1.00 94.33  ? 299  HIS A O   1 
ATOM   2111 C CB  . HIS A 1 265 ? 9.674  -16.617 33.195  1.00 97.95  ? 299  HIS A CB  1 
ATOM   2112 C CG  . HIS A 1 265 ? 11.000 -16.111 32.709  1.00 99.53  ? 299  HIS A CG  1 
ATOM   2113 N ND1 . HIS A 1 265 ? 11.120 -15.120 31.755  1.00 100.45 ? 299  HIS A ND1 1 
ATOM   2114 C CD2 . HIS A 1 265 ? 12.263 -16.510 32.992  1.00 99.99  ? 299  HIS A CD2 1 
ATOM   2115 C CE1 . HIS A 1 265 ? 12.395 -14.938 31.469  1.00 100.87 ? 299  HIS A CE1 1 
ATOM   2116 N NE2 . HIS A 1 265 ? 13.113 -15.771 32.204  1.00 100.76 ? 299  HIS A NE2 1 
ATOM   2117 N N   . PRO A 1 266 ? 9.038  -14.891 36.408  1.00 92.89  ? 300  PRO A N   1 
ATOM   2118 C CA  . PRO A 1 266 ? 9.529  -14.399 37.694  1.00 91.38  ? 300  PRO A CA  1 
ATOM   2119 C C   . PRO A 1 266 ? 11.026 -14.230 37.872  1.00 88.79  ? 300  PRO A C   1 
ATOM   2120 O O   . PRO A 1 266 ? 11.844 -15.007 37.374  1.00 88.91  ? 300  PRO A O   1 
ATOM   2121 C CB  . PRO A 1 266 ? 8.917  -15.386 38.680  1.00 91.82  ? 300  PRO A CB  1 
ATOM   2122 C CG  . PRO A 1 266 ? 7.536  -15.517 38.130  1.00 93.02  ? 300  PRO A CG  1 
ATOM   2123 C CD  . PRO A 1 266 ? 7.738  -15.568 36.601  1.00 93.12  ? 300  PRO A CD  1 
ATOM   2124 N N   . TRP A 1 267 ? 11.363 -13.185 38.606  1.00 85.64  ? 301  TRP A N   1 
ATOM   2125 C CA  . TRP A 1 267 ? 12.739 -12.862 38.884  1.00 82.64  ? 301  TRP A CA  1 
ATOM   2126 C C   . TRP A 1 267 ? 13.519 -13.988 39.572  1.00 82.17  ? 301  TRP A C   1 
ATOM   2127 O O   . TRP A 1 267 ? 14.706 -14.176 39.303  1.00 82.24  ? 301  TRP A O   1 
ATOM   2128 C CB  . TRP A 1 267 ? 12.787 -11.590 39.722  1.00 77.65  ? 301  TRP A CB  1 
ATOM   2129 C CG  . TRP A 1 267 ? 12.488 -10.343 38.958  1.00 71.42  ? 301  TRP A CG  1 
ATOM   2130 C CD1 . TRP A 1 267 ? 11.303 -9.666  38.899  1.00 69.66  ? 301  TRP A CD1 1 
ATOM   2131 C CD2 . TRP A 1 267 ? 13.428 -9.572  38.212  1.00 68.98  ? 301  TRP A CD2 1 
ATOM   2132 N NE1 . TRP A 1 267 ? 11.462 -8.499  38.183  1.00 67.21  ? 301  TRP A NE1 1 
ATOM   2133 C CE2 . TRP A 1 267 ? 12.764 -8.411  37.769  1.00 67.04  ? 301  TRP A CE2 1 
ATOM   2134 C CE3 . TRP A 1 267 ? 14.790 -9.727  37.921  1.00 68.37  ? 301  TRP A CE3 1 
ATOM   2135 C CZ2 . TRP A 1 267 ? 13.395 -7.441  37.008  1.00 66.83  ? 301  TRP A CZ2 1 
ATOM   2136 C CZ3 . TRP A 1 267 ? 15.423 -8.758  37.163  1.00 67.56  ? 301  TRP A CZ3 1 
ATOM   2137 C CH2 . TRP A 1 267 ? 14.729 -7.616  36.734  1.00 67.81  ? 301  TRP A CH2 1 
ATOM   2138 N N   . THR A 1 268 ? 12.866 -14.744 40.450  1.00 83.16  ? 302  THR A N   1 
ATOM   2139 C CA  . THR A 1 268 ? 13.549 -15.839 41.158  1.00 84.70  ? 302  THR A CA  1 
ATOM   2140 C C   . THR A 1 268 ? 14.043 -16.895 40.168  1.00 83.32  ? 302  THR A C   1 
ATOM   2141 O O   . THR A 1 268 ? 14.898 -17.720 40.495  1.00 83.96  ? 302  THR A O   1 
ATOM   2142 C CB  . THR A 1 268 ? 12.615 -16.518 42.195  1.00 84.48  ? 302  THR A CB  1 
ATOM   2143 O OG1 . THR A 1 268 ? 12.084 -15.525 43.087  1.00 85.28  ? 302  THR A OG1 1 
ATOM   2144 C CG2 . THR A 1 268 ? 13.386 -17.556 43.003  1.00 83.51  ? 302  THR A CG2 1 
ATOM   2145 N N   . LYS A 1 269 ? 13.497 -16.834 38.954  1.00 82.62  ? 303  LYS A N   1 
ATOM   2146 C CA  . LYS A 1 269 ? 13.827 -17.745 37.858  1.00 81.30  ? 303  LYS A CA  1 
ATOM   2147 C C   . LYS A 1 269 ? 14.995 -17.172 37.037  1.00 79.62  ? 303  LYS A C   1 
ATOM   2148 O O   . LYS A 1 269 ? 15.569 -17.853 36.182  1.00 79.41  ? 303  LYS A O   1 
ATOM   2149 C CB  . LYS A 1 269 ? 12.591 -17.904 36.955  1.00 82.25  ? 303  LYS A CB  1 
ATOM   2150 C CG  . LYS A 1 269 ? 12.667 -19.005 35.901  1.00 83.73  ? 303  LYS A CG  1 
ATOM   2151 C CD  . LYS A 1 269 ? 12.517 -20.394 36.528  1.00 85.56  ? 303  LYS A CD  1 
ATOM   2152 C CE  . LYS A 1 269 ? 12.499 -21.497 35.464  1.00 86.69  ? 303  LYS A CE  1 
ATOM   2153 N NZ  . LYS A 1 269 ? 12.197 -22.845 36.034  1.00 86.93  ? 303  LYS A NZ  1 
ATOM   2154 N N   . VAL A 1 270 ? 15.341 -15.917 37.310  1.00 76.93  ? 304  VAL A N   1 
ATOM   2155 C CA  . VAL A 1 270 ? 16.404 -15.221 36.591  1.00 72.76  ? 304  VAL A CA  1 
ATOM   2156 C C   . VAL A 1 270 ? 17.799 -15.408 37.180  1.00 71.44  ? 304  VAL A C   1 
ATOM   2157 O O   . VAL A 1 270 ? 18.770 -15.598 36.448  1.00 68.92  ? 304  VAL A O   1 
ATOM   2158 C CB  . VAL A 1 270 ? 16.110 -13.705 36.528  1.00 71.75  ? 304  VAL A CB  1 
ATOM   2159 C CG1 . VAL A 1 270 ? 17.209 -12.994 35.772  1.00 71.69  ? 304  VAL A CG1 1 
ATOM   2160 C CG2 . VAL A 1 270 ? 14.764 -13.464 35.875  1.00 71.21  ? 304  VAL A CG2 1 
ATOM   2161 N N   . PHE A 1 271 ? 17.890 -15.353 38.505  1.00 70.74  ? 305  PHE A N   1 
ATOM   2162 C CA  . PHE A 1 271 ? 19.169 -15.479 39.190  1.00 70.90  ? 305  PHE A CA  1 
ATOM   2163 C C   . PHE A 1 271 ? 19.430 -16.877 39.729  1.00 73.05  ? 305  PHE A C   1 
ATOM   2164 O O   . PHE A 1 271 ? 18.514 -17.697 39.824  1.00 74.09  ? 305  PHE A O   1 
ATOM   2165 C CB  . PHE A 1 271 ? 19.230 -14.472 40.338  1.00 68.09  ? 305  PHE A CB  1 
ATOM   2166 C CG  . PHE A 1 271 ? 19.003 -13.049 39.910  1.00 64.77  ? 305  PHE A CG  1 
ATOM   2167 C CD1 . PHE A 1 271 ? 20.024 -12.317 39.317  1.00 63.28  ? 305  PHE A CD1 1 
ATOM   2168 C CD2 . PHE A 1 271 ? 17.764 -12.447 40.086  1.00 63.96  ? 305  PHE A CD2 1 
ATOM   2169 C CE1 . PHE A 1 271 ? 19.813 -11.003 38.911  1.00 63.24  ? 305  PHE A CE1 1 
ATOM   2170 C CE2 . PHE A 1 271 ? 17.543 -11.133 39.682  1.00 63.55  ? 305  PHE A CE2 1 
ATOM   2171 C CZ  . PHE A 1 271 ? 18.568 -10.408 39.093  1.00 62.54  ? 305  PHE A CZ  1 
ATOM   2172 N N   . ARG A 1 272 ? 20.687 -17.136 40.085  1.00 75.26  ? 306  ARG A N   1 
ATOM   2173 C CA  . ARG A 1 272 ? 21.100 -18.429 40.630  1.00 78.13  ? 306  ARG A CA  1 
ATOM   2174 C C   . ARG A 1 272 ? 20.342 -18.719 41.924  1.00 78.96  ? 306  ARG A C   1 
ATOM   2175 O O   . ARG A 1 272 ? 19.900 -17.803 42.611  1.00 79.13  ? 306  ARG A O   1 
ATOM   2176 C CB  . ARG A 1 272 ? 22.603 -18.426 40.910  1.00 80.09  ? 306  ARG A CB  1 
ATOM   2177 C CG  . ARG A 1 272 ? 23.442 -17.957 39.737  1.00 84.74  ? 306  ARG A CG  1 
ATOM   2178 C CD  . ARG A 1 272 ? 24.932 -17.992 40.057  1.00 88.48  ? 306  ARG A CD  1 
ATOM   2179 N NE  . ARG A 1 272 ? 25.742 -17.646 38.884  1.00 92.26  ? 306  ARG A NE  1 
ATOM   2180 C CZ  . ARG A 1 272 ? 27.071 -17.745 38.830  1.00 93.74  ? 306  ARG A CZ  1 
ATOM   2181 N NH1 . ARG A 1 272 ? 27.751 -18.182 39.886  1.00 94.01  ? 306  ARG A NH1 1 
ATOM   2182 N NH2 . ARG A 1 272 ? 27.725 -17.409 37.721  1.00 93.80  ? 306  ARG A NH2 1 
ATOM   2183 N N   . PRO A 1 273 ? 20.184 -20.004 42.270  1.00 80.13  ? 307  PRO A N   1 
ATOM   2184 C CA  . PRO A 1 273 ? 19.476 -20.437 43.480  1.00 80.24  ? 307  PRO A CA  1 
ATOM   2185 C C   . PRO A 1 273 ? 19.963 -19.796 44.784  1.00 80.13  ? 307  PRO A C   1 
ATOM   2186 O O   . PRO A 1 273 ? 19.161 -19.479 45.665  1.00 80.12  ? 307  PRO A O   1 
ATOM   2187 C CB  . PRO A 1 273 ? 19.673 -21.952 43.462  1.00 81.04  ? 307  PRO A CB  1 
ATOM   2188 C CG  . PRO A 1 273 ? 19.687 -22.257 41.994  1.00 80.84  ? 307  PRO A CG  1 
ATOM   2189 C CD  . PRO A 1 273 ? 20.599 -21.170 41.470  1.00 80.74  ? 307  PRO A CD  1 
ATOM   2190 N N   . ARG A 1 274 ? 21.272 -19.604 44.912  1.00 79.73  ? 308  ARG A N   1 
ATOM   2191 C CA  . ARG A 1 274 ? 21.833 -18.997 46.122  1.00 79.15  ? 308  ARG A CA  1 
ATOM   2192 C C   . ARG A 1 274 ? 21.581 -17.482 46.250  1.00 76.55  ? 308  ARG A C   1 
ATOM   2193 O O   . ARG A 1 274 ? 21.798 -16.904 47.317  1.00 76.36  ? 308  ARG A O   1 
ATOM   2194 C CB  . ARG A 1 274 ? 23.341 -19.257 46.182  1.00 82.82  ? 308  ARG A CB  1 
ATOM   2195 C CG  . ARG A 1 274 ? 23.725 -20.702 46.459  1.00 86.68  ? 308  ARG A CG  1 
ATOM   2196 C CD  . ARG A 1 274 ? 23.252 -21.134 47.835  1.00 88.33  ? 308  ARG A CD  1 
ATOM   2197 N NE  . ARG A 1 274 ? 23.647 -22.503 48.159  1.00 91.23  ? 308  ARG A NE  1 
ATOM   2198 C CZ  . ARG A 1 274 ? 23.245 -23.584 47.491  1.00 93.06  ? 308  ARG A CZ  1 
ATOM   2199 N NH1 . ARG A 1 274 ? 22.432 -23.469 46.446  1.00 93.06  ? 308  ARG A NH1 1 
ATOM   2200 N NH2 . ARG A 1 274 ? 23.646 -24.791 47.879  1.00 94.26  ? 308  ARG A NH2 1 
ATOM   2201 N N   . THR A 1 275 ? 21.133 -16.846 45.170  1.00 72.95  ? 309  THR A N   1 
ATOM   2202 C CA  . THR A 1 275 ? 20.877 -15.410 45.183  1.00 69.64  ? 309  THR A CA  1 
ATOM   2203 C C   . THR A 1 275 ? 19.905 -15.002 46.285  1.00 67.72  ? 309  THR A C   1 
ATOM   2204 O O   . THR A 1 275 ? 18.778 -15.502 46.357  1.00 67.22  ? 309  THR A O   1 
ATOM   2205 C CB  . THR A 1 275 ? 20.314 -14.919 43.838  1.00 68.75  ? 309  THR A CB  1 
ATOM   2206 O OG1 . THR A 1 275 ? 21.255 -15.200 42.798  1.00 67.70  ? 309  THR A OG1 1 
ATOM   2207 C CG2 . THR A 1 275 ? 20.052 -13.420 43.888  1.00 68.27  ? 309  THR A CG2 1 
ATOM   2208 N N   . PRO A 1 276 ? 20.334 -14.078 47.161  1.00 65.71  ? 310  PRO A N   1 
ATOM   2209 C CA  . PRO A 1 276 ? 19.520 -13.580 48.275  1.00 64.71  ? 310  PRO A CA  1 
ATOM   2210 C C   . PRO A 1 276 ? 18.209 -12.975 47.803  1.00 64.44  ? 310  PRO A C   1 
ATOM   2211 O O   . PRO A 1 276 ? 18.179 -12.159 46.887  1.00 65.05  ? 310  PRO A O   1 
ATOM   2212 C CB  . PRO A 1 276 ? 20.416 -12.533 48.923  1.00 63.43  ? 310  PRO A CB  1 
ATOM   2213 C CG  . PRO A 1 276 ? 21.779 -13.045 48.638  1.00 64.04  ? 310  PRO A CG  1 
ATOM   2214 C CD  . PRO A 1 276 ? 21.678 -13.479 47.203  1.00 63.79  ? 310  PRO A CD  1 
ATOM   2215 N N   . PRO A 1 277 ? 17.104 -13.375 48.429  1.00 64.00  ? 311  PRO A N   1 
ATOM   2216 C CA  . PRO A 1 277 ? 15.781 -12.864 48.069  1.00 62.83  ? 311  PRO A CA  1 
ATOM   2217 C C   . PRO A 1 277 ? 15.710 -11.339 48.031  1.00 61.07  ? 311  PRO A C   1 
ATOM   2218 O O   . PRO A 1 277 ? 15.088 -10.769 47.138  1.00 61.28  ? 311  PRO A O   1 
ATOM   2219 C CB  . PRO A 1 277 ? 14.886 -13.462 49.149  1.00 63.04  ? 311  PRO A CB  1 
ATOM   2220 C CG  . PRO A 1 277 ? 15.530 -14.792 49.386  1.00 63.53  ? 311  PRO A CG  1 
ATOM   2221 C CD  . PRO A 1 277 ? 17.000 -14.438 49.443  1.00 63.95  ? 311  PRO A CD  1 
ATOM   2222 N N   . GLU A 1 278 ? 16.345 -10.682 48.998  1.00 59.72  ? 312  GLU A N   1 
ATOM   2223 C CA  . GLU A 1 278 ? 16.329 -9.219  49.060  1.00 58.87  ? 312  GLU A CA  1 
ATOM   2224 C C   . GLU A 1 278 ? 16.960 -8.597  47.817  1.00 57.30  ? 312  GLU A C   1 
ATOM   2225 O O   . GLU A 1 278 ? 16.480 -7.577  47.310  1.00 57.11  ? 312  GLU A O   1 
ATOM   2226 C CB  . GLU A 1 278 ? 17.059 -8.723  50.311  1.00 60.19  ? 312  GLU A CB  1 
ATOM   2227 C CG  . GLU A 1 278 ? 16.380 -9.119  51.611  1.00 63.64  ? 312  GLU A CG  1 
ATOM   2228 C CD  . GLU A 1 278 ? 16.620 -10.576 51.989  1.00 66.79  ? 312  GLU A CD  1 
ATOM   2229 O OE1 . GLU A 1 278 ? 15.957 -11.054 52.941  1.00 67.76  ? 312  GLU A OE1 1 
ATOM   2230 O OE2 . GLU A 1 278 ? 17.476 -11.241 51.350  1.00 67.45  ? 312  GLU A OE2 1 
ATOM   2231 N N   . ALA A 1 279 ? 18.032 -9.223  47.337  1.00 54.55  ? 313  ALA A N   1 
ATOM   2232 C CA  . ALA A 1 279 ? 18.738 -8.764  46.155  1.00 51.97  ? 313  ALA A CA  1 
ATOM   2233 C C   . ALA A 1 279 ? 17.813 -8.774  44.954  1.00 51.06  ? 313  ALA A C   1 
ATOM   2234 O O   . ALA A 1 279 ? 17.791 -7.835  44.163  1.00 51.39  ? 313  ALA A O   1 
ATOM   2235 C CB  . ALA A 1 279 ? 19.933 -9.648  45.898  1.00 52.07  ? 313  ALA A CB  1 
ATOM   2236 N N   . ILE A 1 280 ? 17.046 -9.847  44.822  1.00 51.42  ? 314  ILE A N   1 
ATOM   2237 C CA  . ILE A 1 280 ? 16.111 -9.985  43.717  1.00 51.21  ? 314  ILE A CA  1 
ATOM   2238 C C   . ILE A 1 280 ? 14.966 -8.988  43.858  1.00 50.58  ? 314  ILE A C   1 
ATOM   2239 O O   . ILE A 1 280 ? 14.486 -8.433  42.870  1.00 51.30  ? 314  ILE A O   1 
ATOM   2240 C CB  . ILE A 1 280 ? 15.550 -11.413 43.658  1.00 52.36  ? 314  ILE A CB  1 
ATOM   2241 C CG1 . ILE A 1 280 ? 16.694 -12.399 43.385  1.00 52.11  ? 314  ILE A CG1 1 
ATOM   2242 C CG2 . ILE A 1 280 ? 14.487 -11.513 42.564  1.00 54.00  ? 314  ILE A CG2 1 
ATOM   2243 C CD1 . ILE A 1 280 ? 16.272 -13.867 43.400  1.00 49.98  ? 314  ILE A CD1 1 
ATOM   2244 N N   . ALA A 1 281 ? 14.541 -8.751  45.094  1.00 49.96  ? 315  ALA A N   1 
ATOM   2245 C CA  . ALA A 1 281 ? 13.459 -7.815  45.375  1.00 48.29  ? 315  ALA A CA  1 
ATOM   2246 C C   . ALA A 1 281 ? 13.848 -6.407  44.923  1.00 47.82  ? 315  ALA A C   1 
ATOM   2247 O O   . ALA A 1 281 ? 13.053 -5.699  44.308  1.00 46.88  ? 315  ALA A O   1 
ATOM   2248 C CB  . ALA A 1 281 ? 13.144 -7.827  46.872  1.00 47.72  ? 315  ALA A CB  1 
ATOM   2249 N N   . LEU A 1 282 ? 15.078 -6.010  45.247  1.00 47.64  ? 316  LEU A N   1 
ATOM   2250 C CA  . LEU A 1 282 ? 15.602 -4.698  44.881  1.00 45.56  ? 316  LEU A CA  1 
ATOM   2251 C C   . LEU A 1 282 ? 15.572 -4.534  43.356  1.00 46.71  ? 316  LEU A C   1 
ATOM   2252 O O   . LEU A 1 282 ? 15.169 -3.486  42.849  1.00 48.15  ? 316  LEU A O   1 
ATOM   2253 C CB  . LEU A 1 282 ? 17.042 -4.537  45.381  1.00 42.25  ? 316  LEU A CB  1 
ATOM   2254 C CG  . LEU A 1 282 ? 17.499 -3.214  45.999  1.00 41.72  ? 316  LEU A CG  1 
ATOM   2255 C CD1 . LEU A 1 282 ? 19.022 -3.081  45.850  1.00 40.45  ? 316  LEU A CD1 1 
ATOM   2256 C CD2 . LEU A 1 282 ? 16.813 -2.046  45.332  1.00 40.14  ? 316  LEU A CD2 1 
ATOM   2257 N N   . CYS A 1 283 ? 15.998 -5.552  42.614  1.00 46.26  ? 317  CYS A N   1 
ATOM   2258 C CA  . CYS A 1 283 ? 15.970 -5.432  41.164  1.00 46.99  ? 317  CYS A CA  1 
ATOM   2259 C C   . CYS A 1 283 ? 14.559 -5.196  40.682  1.00 47.69  ? 317  CYS A C   1 
ATOM   2260 O O   . CYS A 1 283 ? 14.316 -4.303  39.880  1.00 49.95  ? 317  CYS A O   1 
ATOM   2261 C CB  . CYS A 1 283 ? 16.501 -6.686  40.492  1.00 47.16  ? 317  CYS A CB  1 
ATOM   2262 S SG  . CYS A 1 283 ? 18.224 -6.975  40.794  1.00 50.46  ? 317  CYS A SG  1 
ATOM   2263 N N   . SER A 1 284 ? 13.624 -5.999  41.166  1.00 47.12  ? 318  SER A N   1 
ATOM   2264 C CA  . SER A 1 284 ? 12.249 -5.850  40.740  1.00 48.25  ? 318  SER A CA  1 
ATOM   2265 C C   . SER A 1 284 ? 11.693 -4.438  40.972  1.00 48.92  ? 318  SER A C   1 
ATOM   2266 O O   . SER A 1 284 ? 10.876 -3.967  40.179  1.00 49.69  ? 318  SER A O   1 
ATOM   2267 C CB  . SER A 1 284 ? 11.388 -6.878  41.454  1.00 47.60  ? 318  SER A CB  1 
ATOM   2268 O OG  . SER A 1 284 ? 11.485 -6.699  42.854  1.00 52.41  ? 318  SER A OG  1 
ATOM   2269 N N   . ARG A 1 285 ? 12.147 -3.772  42.040  1.00 48.40  ? 319  ARG A N   1 
ATOM   2270 C CA  . ARG A 1 285 ? 11.699 -2.419  42.401  1.00 48.43  ? 319  ARG A CA  1 
ATOM   2271 C C   . ARG A 1 285 ? 12.507 -1.323  41.715  1.00 47.68  ? 319  ARG A C   1 
ATOM   2272 O O   . ARG A 1 285 ? 12.161 -0.136  41.760  1.00 47.72  ? 319  ARG A O   1 
ATOM   2273 C CB  . ARG A 1 285 ? 11.773 -2.212  43.924  1.00 51.01  ? 319  ARG A CB  1 
ATOM   2274 C CG  . ARG A 1 285 ? 10.739 -2.995  44.751  1.00 53.38  ? 319  ARG A CG  1 
ATOM   2275 C CD  . ARG A 1 285 ? 9.349  -2.890  44.144  1.00 56.88  ? 319  ARG A CD  1 
ATOM   2276 N NE  . ARG A 1 285 ? 8.988  -1.510  43.819  1.00 59.86  ? 319  ARG A NE  1 
ATOM   2277 C CZ  . ARG A 1 285 ? 8.743  -0.573  44.729  1.00 61.66  ? 319  ARG A CZ  1 
ATOM   2278 N NH1 . ARG A 1 285 ? 8.816  -0.869  46.028  1.00 61.55  ? 319  ARG A NH1 1 
ATOM   2279 N NH2 . ARG A 1 285 ? 8.436  0.662   44.344  1.00 62.23  ? 319  ARG A NH2 1 
ATOM   2280 N N   . LEU A 1 286 ? 13.606 -1.732  41.096  1.00 47.14  ? 320  LEU A N   1 
ATOM   2281 C CA  . LEU A 1 286 ? 14.490 -0.820  40.383  1.00 44.22  ? 320  LEU A CA  1 
ATOM   2282 C C   . LEU A 1 286 ? 14.175 -0.915  38.883  1.00 43.62  ? 320  LEU A C   1 
ATOM   2283 O O   . LEU A 1 286 ? 14.060 0.098   38.196  1.00 43.96  ? 320  LEU A O   1 
ATOM   2284 C CB  . LEU A 1 286 ? 15.946 -1.215  40.667  1.00 42.08  ? 320  LEU A CB  1 
ATOM   2285 C CG  . LEU A 1 286 ? 16.851 -0.386  41.603  1.00 43.53  ? 320  LEU A CG  1 
ATOM   2286 C CD1 . LEU A 1 286 ? 16.107 0.208   42.783  1.00 41.87  ? 320  LEU A CD1 1 
ATOM   2287 C CD2 . LEU A 1 286 ? 17.977 -1.287  42.079  1.00 40.81  ? 320  LEU A CD2 1 
ATOM   2288 N N   . LEU A 1 287 ? 14.001 -2.133  38.383  1.00 42.20  ? 321  LEU A N   1 
ATOM   2289 C CA  . LEU A 1 287 ? 13.712 -2.333  36.964  1.00 43.32  ? 321  LEU A CA  1 
ATOM   2290 C C   . LEU A 1 287 ? 12.209 -2.391  36.664  1.00 44.22  ? 321  LEU A C   1 
ATOM   2291 O O   . LEU A 1 287 ? 11.639 -3.456  36.441  1.00 44.87  ? 321  LEU A O   1 
ATOM   2292 C CB  . LEU A 1 287 ? 14.439 -3.598  36.475  1.00 39.87  ? 321  LEU A CB  1 
ATOM   2293 C CG  . LEU A 1 287 ? 15.948 -3.465  36.753  1.00 36.19  ? 321  LEU A CG  1 
ATOM   2294 C CD1 . LEU A 1 287 ? 16.663 -4.763  36.475  1.00 33.43  ? 321  LEU A CD1 1 
ATOM   2295 C CD2 . LEU A 1 287 ? 16.507 -2.318  35.920  1.00 31.87  ? 321  LEU A CD2 1 
ATOM   2296 N N   . GLU A 1 288 ? 11.584 -1.217  36.665  1.00 45.52  ? 322  GLU A N   1 
ATOM   2297 C CA  . GLU A 1 288 ? 10.156 -1.070  36.412  1.00 45.50  ? 322  GLU A CA  1 
ATOM   2298 C C   . GLU A 1 288 ? 9.933  -0.276  35.133  1.00 46.07  ? 322  GLU A C   1 
ATOM   2299 O O   . GLU A 1 288 ? 10.705 0.634   34.819  1.00 45.86  ? 322  GLU A O   1 
ATOM   2300 C CB  . GLU A 1 288 ? 9.480  -0.316  37.567  1.00 48.01  ? 322  GLU A CB  1 
ATOM   2301 C CG  . GLU A 1 288 ? 9.635  -0.934  38.956  1.00 52.09  ? 322  GLU A CG  1 
ATOM   2302 C CD  . GLU A 1 288 ? 8.543  -1.940  39.304  1.00 54.78  ? 322  GLU A CD  1 
ATOM   2303 O OE1 . GLU A 1 288 ? 8.437  -2.300  40.504  1.00 57.44  ? 322  GLU A OE1 1 
ATOM   2304 O OE2 . GLU A 1 288 ? 7.800  -2.374  38.390  1.00 56.51  ? 322  GLU A OE2 1 
ATOM   2305 N N   . TYR A 1 289 ? 8.871  -0.620  34.402  1.00 46.72  ? 323  TYR A N   1 
ATOM   2306 C CA  . TYR A 1 289 ? 8.524  0.080   33.169  1.00 45.34  ? 323  TYR A CA  1 
ATOM   2307 C C   . TYR A 1 289 ? 8.150  1.508   33.513  1.00 46.08  ? 323  TYR A C   1 
ATOM   2308 O O   . TYR A 1 289 ? 8.636  2.456   32.900  1.00 46.14  ? 323  TYR A O   1 
ATOM   2309 C CB  . TYR A 1 289 ? 7.328  -0.570  32.492  1.00 46.07  ? 323  TYR A CB  1 
ATOM   2310 C CG  . TYR A 1 289 ? 7.645  -1.824  31.715  1.00 47.69  ? 323  TYR A CG  1 
ATOM   2311 C CD1 . TYR A 1 289 ? 7.031  -3.030  32.033  1.00 46.39  ? 323  TYR A CD1 1 
ATOM   2312 C CD2 . TYR A 1 289 ? 8.550  -1.801  30.651  1.00 47.22  ? 323  TYR A CD2 1 
ATOM   2313 C CE1 . TYR A 1 289 ? 7.309  -4.181  31.321  1.00 48.24  ? 323  TYR A CE1 1 
ATOM   2314 C CE2 . TYR A 1 289 ? 8.834  -2.946  29.928  1.00 46.58  ? 323  TYR A CE2 1 
ATOM   2315 C CZ  . TYR A 1 289 ? 8.212  -4.134  30.268  1.00 48.40  ? 323  TYR A CZ  1 
ATOM   2316 O OH  . TYR A 1 289 ? 8.482  -5.285  29.561  1.00 52.38  ? 323  TYR A OH  1 
ATOM   2317 N N   . THR A 1 290 ? 7.282  1.666   34.501  1.00 46.70  ? 324  THR A N   1 
ATOM   2318 C CA  . THR A 1 290 ? 6.880  3.003   34.882  1.00 47.16  ? 324  THR A CA  1 
ATOM   2319 C C   . THR A 1 290 ? 8.025  3.702   35.592  1.00 46.68  ? 324  THR A C   1 
ATOM   2320 O O   . THR A 1 290 ? 8.428  3.312   36.691  1.00 46.88  ? 324  THR A O   1 
ATOM   2321 C CB  . THR A 1 290 ? 5.662  2.978   35.804  1.00 47.10  ? 324  THR A CB  1 
ATOM   2322 O OG1 . THR A 1 290 ? 4.575  2.314   35.145  1.00 48.09  ? 324  THR A OG1 1 
ATOM   2323 C CG2 . THR A 1 290 ? 5.252  4.394   36.142  1.00 47.78  ? 324  THR A CG2 1 
ATOM   2324 N N   . PRO A 1 291 ? 8.580  4.741   34.966  1.00 44.59  ? 325  PRO A N   1 
ATOM   2325 C CA  . PRO A 1 291 ? 9.682  5.423   35.636  1.00 45.55  ? 325  PRO A CA  1 
ATOM   2326 C C   . PRO A 1 291 ? 9.383  6.015   37.013  1.00 45.48  ? 325  PRO A C   1 
ATOM   2327 O O   . PRO A 1 291 ? 10.276 6.097   37.851  1.00 47.75  ? 325  PRO A O   1 
ATOM   2328 C CB  . PRO A 1 291 ? 10.146 6.466   34.597  1.00 44.62  ? 325  PRO A CB  1 
ATOM   2329 C CG  . PRO A 1 291 ? 8.981  6.610   33.672  1.00 44.40  ? 325  PRO A CG  1 
ATOM   2330 C CD  . PRO A 1 291 ? 8.415  5.225   33.591  1.00 44.07  ? 325  PRO A CD  1 
ATOM   2331 N N   . THR A 1 292 ? 8.145  6.410   37.276  1.00 45.94  ? 326  THR A N   1 
ATOM   2332 C CA  . THR A 1 292 ? 7.818  6.987   38.593  1.00 45.45  ? 326  THR A CA  1 
ATOM   2333 C C   . THR A 1 292 ? 7.617  5.921   39.660  1.00 45.20  ? 326  THR A C   1 
ATOM   2334 O O   . THR A 1 292 ? 7.501  6.248   40.839  1.00 45.68  ? 326  THR A O   1 
ATOM   2335 C CB  . THR A 1 292 ? 6.518  7.847   38.577  1.00 44.30  ? 326  THR A CB  1 
ATOM   2336 O OG1 . THR A 1 292 ? 5.430  7.073   38.048  1.00 44.38  ? 326  THR A OG1 1 
ATOM   2337 C CG2 . THR A 1 292 ? 6.713  9.101   37.757  1.00 42.34  ? 326  THR A CG2 1 
ATOM   2338 N N   . ALA A 1 293 ? 7.557  4.658   39.245  1.00 44.62  ? 327  ALA A N   1 
ATOM   2339 C CA  . ALA A 1 293 ? 7.369  3.551   40.183  1.00 44.86  ? 327  ALA A CA  1 
ATOM   2340 C C   . ALA A 1 293 ? 8.700  3.024   40.723  1.00 46.10  ? 327  ALA A C   1 
ATOM   2341 O O   . ALA A 1 293 ? 8.739  2.313   41.723  1.00 47.63  ? 327  ALA A O   1 
ATOM   2342 C CB  . ALA A 1 293 ? 6.602  2.420   39.519  1.00 40.56  ? 327  ALA A CB  1 
ATOM   2343 N N   . ARG A 1 294 ? 9.796  3.367   40.060  1.00 46.26  ? 328  ARG A N   1 
ATOM   2344 C CA  . ARG A 1 294 ? 11.098 2.903   40.512  1.00 45.91  ? 328  ARG A CA  1 
ATOM   2345 C C   . ARG A 1 294 ? 11.531 3.578   41.811  1.00 45.72  ? 328  ARG A C   1 
ATOM   2346 O O   . ARG A 1 294 ? 11.274 4.758   42.024  1.00 46.55  ? 328  ARG A O   1 
ATOM   2347 C CB  . ARG A 1 294 ? 12.156 3.164   39.432  1.00 43.47  ? 328  ARG A CB  1 
ATOM   2348 C CG  . ARG A 1 294 ? 11.898 2.437   38.138  1.00 40.97  ? 328  ARG A CG  1 
ATOM   2349 C CD  . ARG A 1 294 ? 12.825 2.922   37.051  1.00 39.59  ? 328  ARG A CD  1 
ATOM   2350 N NE  . ARG A 1 294 ? 12.251 2.650   35.735  1.00 39.27  ? 328  ARG A NE  1 
ATOM   2351 C CZ  . ARG A 1 294 ? 12.486 3.372   34.648  1.00 37.19  ? 328  ARG A CZ  1 
ATOM   2352 N NH1 . ARG A 1 294 ? 13.294 4.420   34.703  1.00 37.24  ? 328  ARG A NH1 1 
ATOM   2353 N NH2 . ARG A 1 294 ? 11.887 3.053   33.515  1.00 36.42  ? 328  ARG A NH2 1 
ATOM   2354 N N   . LEU A 1 295 ? 12.189 2.823   42.682  1.00 45.12  ? 329  LEU A N   1 
ATOM   2355 C CA  . LEU A 1 295 ? 12.693 3.385   43.926  1.00 43.89  ? 329  LEU A CA  1 
ATOM   2356 C C   . LEU A 1 295 ? 13.579 4.572   43.606  1.00 43.09  ? 329  LEU A C   1 
ATOM   2357 O O   . LEU A 1 295 ? 14.125 4.671   42.500  1.00 43.26  ? 329  LEU A O   1 
ATOM   2358 C CB  . LEU A 1 295 ? 13.539 2.357   44.670  1.00 44.54  ? 329  LEU A CB  1 
ATOM   2359 C CG  . LEU A 1 295 ? 12.867 1.499   45.731  1.00 46.54  ? 329  LEU A CG  1 
ATOM   2360 C CD1 . LEU A 1 295 ? 11.527 1.002   45.242  1.00 47.50  ? 329  LEU A CD1 1 
ATOM   2361 C CD2 . LEU A 1 295 ? 13.792 0.343   46.071  1.00 47.72  ? 329  LEU A CD2 1 
ATOM   2362 N N   . THR A 1 296 ? 13.726 5.472   44.573  1.00 41.27  ? 330  THR A N   1 
ATOM   2363 C CA  . THR A 1 296 ? 14.599 6.629   44.391  1.00 40.37  ? 330  THR A CA  1 
ATOM   2364 C C   . THR A 1 296 ? 15.949 6.180   44.910  1.00 39.53  ? 330  THR A C   1 
ATOM   2365 O O   . THR A 1 296 ? 16.032 5.237   45.691  1.00 38.99  ? 330  THR A O   1 
ATOM   2366 C CB  . THR A 1 296 ? 14.171 7.838   45.247  1.00 41.23  ? 330  THR A CB  1 
ATOM   2367 O OG1 . THR A 1 296 ? 14.150 7.450   46.624  1.00 42.76  ? 330  THR A OG1 1 
ATOM   2368 C CG2 . THR A 1 296 ? 12.809 8.352   44.839  1.00 40.30  ? 330  THR A CG2 1 
ATOM   2369 N N   . PRO A 1 297 ? 17.028 6.838   44.489  1.00 39.02  ? 331  PRO A N   1 
ATOM   2370 C CA  . PRO A 1 297 ? 18.302 6.367   45.023  1.00 39.82  ? 331  PRO A CA  1 
ATOM   2371 C C   . PRO A 1 297 ? 18.356 6.308   46.548  1.00 41.47  ? 331  PRO A C   1 
ATOM   2372 O O   . PRO A 1 297 ? 19.000 5.429   47.127  1.00 43.02  ? 331  PRO A O   1 
ATOM   2373 C CB  . PRO A 1 297 ? 19.324 7.338   44.417  1.00 38.55  ? 331  PRO A CB  1 
ATOM   2374 C CG  . PRO A 1 297 ? 18.487 8.515   43.930  1.00 40.98  ? 331  PRO A CG  1 
ATOM   2375 C CD  . PRO A 1 297 ? 17.232 7.861   43.454  1.00 40.00  ? 331  PRO A CD  1 
ATOM   2376 N N   . LEU A 1 298 ? 17.657 7.217   47.210  1.00 42.95  ? 332  LEU A N   1 
ATOM   2377 C CA  . LEU A 1 298 ? 17.679 7.227   48.668  1.00 43.53  ? 332  LEU A CA  1 
ATOM   2378 C C   . LEU A 1 298 ? 16.864 6.078   49.248  1.00 44.40  ? 332  LEU A C   1 
ATOM   2379 O O   . LEU A 1 298 ? 17.230 5.499   50.272  1.00 45.07  ? 332  LEU A O   1 
ATOM   2380 C CB  . LEU A 1 298 ? 17.144 8.548   49.184  1.00 42.57  ? 332  LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 298 ? 17.606 8.905   50.583  1.00 41.97  ? 332  LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 298 ? 19.130 8.988   50.649  1.00 42.27  ? 332  LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 298 ? 17.000 10.250  50.933  1.00 43.22  ? 332  LEU A CD2 1 
ATOM   2384 N N   . GLU A 1 299 ? 15.761 5.746   48.587  1.00 44.50  ? 333  GLU A N   1 
ATOM   2385 C CA  . GLU A 1 299 ? 14.914 4.652   49.036  1.00 45.68  ? 333  GLU A CA  1 
ATOM   2386 C C   . GLU A 1 299 ? 15.611 3.315   48.866  1.00 45.75  ? 333  GLU A C   1 
ATOM   2387 O O   . GLU A 1 299 ? 15.339 2.375   49.596  1.00 48.08  ? 333  GLU A O   1 
ATOM   2388 C CB  . GLU A 1 299 ? 13.600 4.643   48.255  1.00 45.59  ? 333  GLU A CB  1 
ATOM   2389 C CG  . GLU A 1 299 ? 12.735 5.849   48.517  1.00 49.59  ? 333  GLU A CG  1 
ATOM   2390 C CD  . GLU A 1 299 ? 11.540 5.930   47.596  1.00 51.24  ? 333  GLU A CD  1 
ATOM   2391 O OE1 . GLU A 1 299 ? 10.649 6.771   47.859  1.00 52.41  ? 333  GLU A OE1 1 
ATOM   2392 O OE2 . GLU A 1 299 ? 11.495 5.164   46.608  1.00 53.41  ? 333  GLU A OE2 1 
ATOM   2393 N N   . ALA A 1 300 ? 16.504 3.225   47.891  1.00 45.68  ? 334  ALA A N   1 
ATOM   2394 C CA  . ALA A 1 300 ? 17.216 1.979   47.648  1.00 44.78  ? 334  ALA A CA  1 
ATOM   2395 C C   . ALA A 1 300 ? 18.215 1.735   48.774  1.00 44.10  ? 334  ALA A C   1 
ATOM   2396 O O   . ALA A 1 300 ? 18.334 0.617   49.270  1.00 42.33  ? 334  ALA A O   1 
ATOM   2397 C CB  . ALA A 1 300 ? 17.936 2.036   46.291  1.00 44.48  ? 334  ALA A CB  1 
ATOM   2398 N N   . CYS A 1 301 ? 18.930 2.788   49.169  1.00 44.07  ? 335  CYS A N   1 
ATOM   2399 C CA  . CYS A 1 301 ? 19.915 2.701   50.245  1.00 43.77  ? 335  CYS A CA  1 
ATOM   2400 C C   . CYS A 1 301 ? 19.262 2.181   51.515  1.00 44.34  ? 335  CYS A C   1 
ATOM   2401 O O   . CYS A 1 301 ? 19.919 1.548   52.339  1.00 46.67  ? 335  CYS A O   1 
ATOM   2402 C CB  . CYS A 1 301 ? 20.512 4.073   50.557  1.00 42.24  ? 335  CYS A CB  1 
ATOM   2403 S SG  . CYS A 1 301 ? 21.672 4.726   49.381  1.00 43.74  ? 335  CYS A SG  1 
ATOM   2404 N N   . ALA A 1 302 ? 17.972 2.456   51.680  1.00 43.74  ? 336  ALA A N   1 
ATOM   2405 C CA  . ALA A 1 302 ? 17.265 2.021   52.875  1.00 43.68  ? 336  ALA A CA  1 
ATOM   2406 C C   . ALA A 1 302 ? 16.625 0.663   52.689  1.00 43.51  ? 336  ALA A C   1 
ATOM   2407 O O   . ALA A 1 302 ? 15.929 0.172   53.575  1.00 44.73  ? 336  ALA A O   1 
ATOM   2408 C CB  . ALA A 1 302 ? 16.213 3.044   53.262  1.00 42.59  ? 336  ALA A CB  1 
ATOM   2409 N N   . HIS A 1 303 ? 16.876 0.052   51.538  1.00 42.36  ? 337  HIS A N   1 
ATOM   2410 C CA  . HIS A 1 303 ? 16.316 -1.259  51.231  1.00 42.20  ? 337  HIS A CA  1 
ATOM   2411 C C   . HIS A 1 303 ? 16.911 -2.355  52.118  1.00 42.50  ? 337  HIS A C   1 
ATOM   2412 O O   . HIS A 1 303 ? 18.086 -2.298  52.480  1.00 42.21  ? 337  HIS A O   1 
ATOM   2413 C CB  . HIS A 1 303 ? 16.544 -1.598  49.758  1.00 41.12  ? 337  HIS A CB  1 
ATOM   2414 C CG  . HIS A 1 303 ? 15.746 -2.770  49.292  1.00 40.94  ? 337  HIS A CG  1 
ATOM   2415 N ND1 . HIS A 1 303 ? 16.058 -4.068  49.637  1.00 40.72  ? 337  HIS A ND1 1 
ATOM   2416 C CD2 . HIS A 1 303 ? 14.613 -2.839  48.553  1.00 39.62  ? 337  HIS A CD2 1 
ATOM   2417 C CE1 . HIS A 1 303 ? 15.152 -4.884  49.133  1.00 41.03  ? 337  HIS A CE1 1 
ATOM   2418 N NE2 . HIS A 1 303 ? 14.262 -4.164  48.471  1.00 40.32  ? 337  HIS A NE2 1 
ATOM   2419 N N   . SER A 1 304 ? 16.101 -3.358  52.455  1.00 43.22  ? 338  SER A N   1 
ATOM   2420 C CA  . SER A 1 304 ? 16.545 -4.442  53.328  1.00 44.03  ? 338  SER A CA  1 
ATOM   2421 C C   . SER A 1 304 ? 17.769 -5.187  52.818  1.00 43.25  ? 338  SER A C   1 
ATOM   2422 O O   . SER A 1 304 ? 18.484 -5.817  53.599  1.00 42.99  ? 338  SER A O   1 
ATOM   2423 C CB  . SER A 1 304 ? 15.406 -5.433  53.568  1.00 44.73  ? 338  SER A CB  1 
ATOM   2424 O OG  . SER A 1 304 ? 15.045 -6.083  52.363  1.00 50.62  ? 338  SER A OG  1 
ATOM   2425 N N   . PHE A 1 305 ? 18.011 -5.112  51.513  1.00 42.68  ? 339  PHE A N   1 
ATOM   2426 C CA  . PHE A 1 305 ? 19.165 -5.774  50.905  1.00 41.36  ? 339  PHE A CA  1 
ATOM   2427 C C   . PHE A 1 305 ? 20.470 -5.240  51.480  1.00 41.37  ? 339  PHE A C   1 
ATOM   2428 O O   . PHE A 1 305 ? 21.472 -5.947  51.502  1.00 42.06  ? 339  PHE A O   1 
ATOM   2429 C CB  . PHE A 1 305 ? 19.144 -5.571  49.388  1.00 43.01  ? 339  PHE A CB  1 
ATOM   2430 C CG  . PHE A 1 305 ? 20.370 -6.080  48.686  1.00 42.55  ? 339  PHE A CG  1 
ATOM   2431 C CD1 . PHE A 1 305 ? 20.728 -7.419  48.769  1.00 43.08  ? 339  PHE A CD1 1 
ATOM   2432 C CD2 . PHE A 1 305 ? 21.191 -5.214  47.969  1.00 41.10  ? 339  PHE A CD2 1 
ATOM   2433 C CE1 . PHE A 1 305 ? 21.891 -7.887  48.151  1.00 41.93  ? 339  PHE A CE1 1 
ATOM   2434 C CE2 . PHE A 1 305 ? 22.352 -5.677  47.352  1.00 39.95  ? 339  PHE A CE2 1 
ATOM   2435 C CZ  . PHE A 1 305 ? 22.702 -7.008  47.442  1.00 39.94  ? 339  PHE A CZ  1 
ATOM   2436 N N   . PHE A 1 306 ? 20.449 -3.999  51.956  1.00 41.88  ? 340  PHE A N   1 
ATOM   2437 C CA  . PHE A 1 306 ? 21.638 -3.378  52.531  1.00 42.32  ? 340  PHE A CA  1 
ATOM   2438 C C   . PHE A 1 306 ? 21.715 -3.455  54.048  1.00 42.88  ? 340  PHE A C   1 
ATOM   2439 O O   . PHE A 1 306 ? 22.616 -2.876  54.645  1.00 45.08  ? 340  PHE A O   1 
ATOM   2440 C CB  . PHE A 1 306 ? 21.734 -1.910  52.092  1.00 40.92  ? 340  PHE A CB  1 
ATOM   2441 C CG  . PHE A 1 306 ? 21.910 -1.741  50.616  1.00 42.06  ? 340  PHE A CG  1 
ATOM   2442 C CD1 . PHE A 1 306 ? 23.035 -2.252  49.974  1.00 42.10  ? 340  PHE A CD1 1 
ATOM   2443 C CD2 . PHE A 1 306 ? 20.922 -1.142  49.854  1.00 42.66  ? 340  PHE A CD2 1 
ATOM   2444 C CE1 . PHE A 1 306 ? 23.172 -2.175  48.592  1.00 40.23  ? 340  PHE A CE1 1 
ATOM   2445 C CE2 . PHE A 1 306 ? 21.045 -1.058  48.472  1.00 42.72  ? 340  PHE A CE2 1 
ATOM   2446 C CZ  . PHE A 1 306 ? 22.175 -1.580  47.842  1.00 42.97  ? 340  PHE A CZ  1 
ATOM   2447 N N   . ASP A 1 307 ? 20.792 -4.169  54.682  1.00 43.89  ? 341  ASP A N   1 
ATOM   2448 C CA  . ASP A 1 307 ? 20.806 -4.248  56.152  1.00 46.43  ? 341  ASP A CA  1 
ATOM   2449 C C   . ASP A 1 307 ? 22.128 -4.705  56.765  1.00 46.85  ? 341  ASP A C   1 
ATOM   2450 O O   . ASP A 1 307 ? 22.487 -4.242  57.847  1.00 47.07  ? 341  ASP A O   1 
ATOM   2451 C CB  . ASP A 1 307 ? 19.674 -5.140  56.673  1.00 45.43  ? 341  ASP A CB  1 
ATOM   2452 C CG  . ASP A 1 307 ? 18.297 -4.513  56.469  1.00 48.06  ? 341  ASP A CG  1 
ATOM   2453 O OD1 . ASP A 1 307 ? 18.219 -3.280  56.189  1.00 48.13  ? 341  ASP A OD1 1 
ATOM   2454 O OD2 . ASP A 1 307 ? 17.286 -5.249  56.602  1.00 47.17  ? 341  ASP A OD2 1 
ATOM   2455 N N   . GLU A 1 308 ? 22.850 -5.597  56.084  1.00 47.39  ? 342  GLU A N   1 
ATOM   2456 C CA  . GLU A 1 308 ? 24.123 -6.081  56.599  1.00 47.46  ? 342  GLU A CA  1 
ATOM   2457 C C   . GLU A 1 308 ? 25.123 -4.937  56.754  1.00 47.67  ? 342  GLU A C   1 
ATOM   2458 O O   . GLU A 1 308 ? 25.977 -4.969  57.635  1.00 47.64  ? 342  GLU A O   1 
ATOM   2459 C CB  . GLU A 1 308 ? 24.710 -7.147  55.673  1.00 48.43  ? 342  GLU A CB  1 
ATOM   2460 C CG  . GLU A 1 308 ? 25.791 -8.002  56.329  1.00 51.35  ? 342  GLU A CG  1 
ATOM   2461 C CD  . GLU A 1 308 ? 26.528 -8.903  55.344  1.00 54.38  ? 342  GLU A CD  1 
ATOM   2462 O OE1 . GLU A 1 308 ? 25.891 -9.383  54.376  1.00 54.56  ? 342  GLU A OE1 1 
ATOM   2463 O OE2 . GLU A 1 308 ? 27.743 -9.146  55.551  1.00 54.36  ? 342  GLU A OE2 1 
ATOM   2464 N N   . LEU A 1 309 ? 25.018 -3.921  55.907  1.00 47.89  ? 343  LEU A N   1 
ATOM   2465 C CA  . LEU A 1 309 ? 25.950 -2.804  55.989  1.00 48.85  ? 343  LEU A CA  1 
ATOM   2466 C C   . LEU A 1 309 ? 25.705 -1.966  57.228  1.00 48.19  ? 343  LEU A C   1 
ATOM   2467 O O   . LEU A 1 309 ? 26.603 -1.287  57.718  1.00 49.07  ? 343  LEU A O   1 
ATOM   2468 C CB  . LEU A 1 309 ? 25.850 -1.922  54.739  1.00 47.31  ? 343  LEU A CB  1 
ATOM   2469 C CG  . LEU A 1 309 ? 26.112 -2.648  53.423  1.00 48.53  ? 343  LEU A CG  1 
ATOM   2470 C CD1 . LEU A 1 309 ? 26.026 -1.647  52.267  1.00 47.47  ? 343  LEU A CD1 1 
ATOM   2471 C CD2 . LEU A 1 309 ? 27.495 -3.313  53.463  1.00 47.22  ? 343  LEU A CD2 1 
ATOM   2472 N N   . ARG A 1 310 ? 24.481 -2.022  57.731  1.00 48.63  ? 344  ARG A N   1 
ATOM   2473 C CA  . ARG A 1 310 ? 24.105 -1.262  58.917  1.00 50.26  ? 344  ARG A CA  1 
ATOM   2474 C C   . ARG A 1 310 ? 24.384 -2.031  60.206  1.00 53.21  ? 344  ARG A C   1 
ATOM   2475 O O   . ARG A 1 310 ? 24.139 -1.533  61.307  1.00 54.56  ? 344  ARG A O   1 
ATOM   2476 C CB  . ARG A 1 310 ? 22.627 -0.892  58.847  1.00 46.60  ? 344  ARG A CB  1 
ATOM   2477 C CG  . ARG A 1 310 ? 22.350 0.294   57.949  1.00 44.76  ? 344  ARG A CG  1 
ATOM   2478 C CD  . ARG A 1 310 ? 20.865 0.597   57.879  1.00 41.88  ? 344  ARG A CD  1 
ATOM   2479 N NE  . ARG A 1 310 ? 20.115 -0.300  56.993  1.00 41.48  ? 344  ARG A NE  1 
ATOM   2480 C CZ  . ARG A 1 310 ? 19.957 -0.102  55.683  1.00 40.74  ? 344  ARG A CZ  1 
ATOM   2481 N NH1 . ARG A 1 310 ? 20.499 0.953   55.087  1.00 38.48  ? 344  ARG A NH1 1 
ATOM   2482 N NH2 . ARG A 1 310 ? 19.212 -0.931  54.973  1.00 41.70  ? 344  ARG A NH2 1 
ATOM   2483 N N   . ASP A 1 311 ? 24.897 -3.248  60.053  1.00 55.89  ? 345  ASP A N   1 
ATOM   2484 C CA  . ASP A 1 311 ? 25.238 -4.101  61.180  1.00 56.57  ? 345  ASP A CA  1 
ATOM   2485 C C   . ASP A 1 311 ? 26.522 -3.573  61.816  1.00 56.98  ? 345  ASP A C   1 
ATOM   2486 O O   . ASP A 1 311 ? 27.529 -3.374  61.134  1.00 57.40  ? 345  ASP A O   1 
ATOM   2487 C CB  . ASP A 1 311 ? 25.456 -5.533  60.705  1.00 58.26  ? 345  ASP A CB  1 
ATOM   2488 C CG  . ASP A 1 311 ? 25.516 -6.524  61.855  1.00 60.48  ? 345  ASP A CG  1 
ATOM   2489 O OD1 . ASP A 1 311 ? 26.339 -6.333  62.781  1.00 60.52  ? 345  ASP A OD1 1 
ATOM   2490 O OD2 . ASP A 1 311 ? 24.740 -7.500  61.827  1.00 61.59  ? 345  ASP A OD2 1 
ATOM   2491 N N   . PRO A 1 312 ? 26.505 -3.356  63.139  1.00 57.06  ? 346  PRO A N   1 
ATOM   2492 C CA  . PRO A 1 312 ? 27.662 -2.844  63.879  1.00 57.44  ? 346  PRO A CA  1 
ATOM   2493 C C   . PRO A 1 312 ? 28.961 -3.602  63.635  1.00 58.47  ? 346  PRO A C   1 
ATOM   2494 O O   . PRO A 1 312 ? 30.035 -2.999  63.544  1.00 57.97  ? 346  PRO A O   1 
ATOM   2495 C CB  . PRO A 1 312 ? 27.213 -2.954  65.331  1.00 55.35  ? 346  PRO A CB  1 
ATOM   2496 C CG  . PRO A 1 312 ? 25.742 -2.797  65.239  1.00 56.49  ? 346  PRO A CG  1 
ATOM   2497 C CD  . PRO A 1 312 ? 25.391 -3.645  64.057  1.00 55.36  ? 346  PRO A CD  1 
ATOM   2498 N N   . ASN A 1 313 ? 28.858 -4.922  63.521  1.00 59.92  ? 347  ASN A N   1 
ATOM   2499 C CA  . ASN A 1 313 ? 30.039 -5.761  63.337  1.00 62.49  ? 347  ASN A CA  1 
ATOM   2500 C C   . ASN A 1 313 ? 30.425 -6.049  61.897  1.00 63.11  ? 347  ASN A C   1 
ATOM   2501 O O   . ASN A 1 313 ? 31.225 -6.947  61.630  1.00 64.75  ? 347  ASN A O   1 
ATOM   2502 C CB  . ASN A 1 313 ? 29.848 -7.078  64.085  1.00 63.54  ? 347  ASN A CB  1 
ATOM   2503 C CG  . ASN A 1 313 ? 29.446 -6.860  65.531  1.00 65.10  ? 347  ASN A CG  1 
ATOM   2504 O OD1 . ASN A 1 313 ? 30.100 -6.097  66.262  1.00 63.61  ? 347  ASN A OD1 1 
ATOM   2505 N ND2 . ASN A 1 313 ? 28.367 -7.524  65.955  1.00 63.51  ? 347  ASN A ND2 1 
ATOM   2506 N N   . VAL A 1 314 ? 29.865 -5.285  60.969  1.00 62.94  ? 348  VAL A N   1 
ATOM   2507 C CA  . VAL A 1 314 ? 30.172 -5.481  59.568  1.00 61.76  ? 348  VAL A CA  1 
ATOM   2508 C C   . VAL A 1 314 ? 31.639 -5.140  59.335  1.00 61.35  ? 348  VAL A C   1 
ATOM   2509 O O   . VAL A 1 314 ? 32.158 -4.170  59.884  1.00 60.62  ? 348  VAL A O   1 
ATOM   2510 C CB  . VAL A 1 314 ? 29.269 -4.590  58.673  1.00 61.97  ? 348  VAL A CB  1 
ATOM   2511 C CG1 . VAL A 1 314 ? 29.608 -3.118  58.868  1.00 62.63  ? 348  VAL A CG1 1 
ATOM   2512 C CG2 . VAL A 1 314 ? 29.423 -4.994  57.221  1.00 61.64  ? 348  VAL A CG2 1 
ATOM   2513 N N   . LYS A 1 315 ? 32.307 -5.957  58.530  1.00 61.11  ? 349  LYS A N   1 
ATOM   2514 C CA  . LYS A 1 315 ? 33.710 -5.744  58.211  1.00 61.20  ? 349  LYS A CA  1 
ATOM   2515 C C   . LYS A 1 315 ? 33.959 -6.206  56.786  1.00 60.76  ? 349  LYS A C   1 
ATOM   2516 O O   . LYS A 1 315 ? 33.164 -6.964  56.234  1.00 61.38  ? 349  LYS A O   1 
ATOM   2517 C CB  . LYS A 1 315 ? 34.599 -6.534  59.186  1.00 63.14  ? 349  LYS A CB  1 
ATOM   2518 C CG  . LYS A 1 315 ? 34.723 -5.924  60.580  1.00 64.89  ? 349  LYS A CG  1 
ATOM   2519 C CD  . LYS A 1 315 ? 35.494 -4.608  60.537  1.00 67.82  ? 349  LYS A CD  1 
ATOM   2520 C CE  . LYS A 1 315 ? 35.547 -3.960  61.908  1.00 68.53  ? 349  LYS A CE  1 
ATOM   2521 N NZ  . LYS A 1 315 ? 36.090 -4.902  62.918  1.00 71.74  ? 349  LYS A NZ  1 
ATOM   2522 N N   . LEU A 1 316 ? 35.048 -5.739  56.185  1.00 60.88  ? 350  LEU A N   1 
ATOM   2523 C CA  . LEU A 1 316 ? 35.394 -6.160  54.830  1.00 60.78  ? 350  LEU A CA  1 
ATOM   2524 C C   . LEU A 1 316 ? 36.074 -7.518  54.937  1.00 62.55  ? 350  LEU A C   1 
ATOM   2525 O O   . LEU A 1 316 ? 36.559 -7.895  56.009  1.00 63.77  ? 350  LEU A O   1 
ATOM   2526 C CB  . LEU A 1 316 ? 36.372 -5.179  54.181  1.00 59.87  ? 350  LEU A CB  1 
ATOM   2527 C CG  . LEU A 1 316 ? 35.928 -3.727  54.060  1.00 57.94  ? 350  LEU A CG  1 
ATOM   2528 C CD1 . LEU A 1 316 ? 36.988 -2.927  53.311  1.00 57.25  ? 350  LEU A CD1 1 
ATOM   2529 C CD2 . LEU A 1 316 ? 34.610 -3.676  53.335  1.00 57.68  ? 350  LEU A CD2 1 
ATOM   2530 N N   . PRO A 1 317 ? 36.112 -8.273  53.831  1.00 63.08  ? 351  PRO A N   1 
ATOM   2531 C CA  . PRO A 1 317 ? 36.754 -9.589  53.842  1.00 62.65  ? 351  PRO A CA  1 
ATOM   2532 C C   . PRO A 1 317 ? 38.218 -9.500  54.300  1.00 61.48  ? 351  PRO A C   1 
ATOM   2533 O O   . PRO A 1 317 ? 38.683 -10.340 55.061  1.00 60.28  ? 351  PRO A O   1 
ATOM   2534 C CB  . PRO A 1 317 ? 36.614 -10.044 52.392  1.00 63.15  ? 351  PRO A CB  1 
ATOM   2535 C CG  . PRO A 1 317 ? 35.299 -9.422  51.990  1.00 63.88  ? 351  PRO A CG  1 
ATOM   2536 C CD  . PRO A 1 317 ? 35.448 -8.022  52.540  1.00 63.72  ? 351  PRO A CD  1 
ATOM   2537 N N   . ASN A 1 318 ? 38.926 -8.466  53.850  1.00 61.46  ? 352  ASN A N   1 
ATOM   2538 C CA  . ASN A 1 318 ? 40.328 -8.278  54.211  1.00 62.27  ? 352  ASN A CA  1 
ATOM   2539 C C   . ASN A 1 318 ? 40.508 -7.809  55.662  1.00 62.28  ? 352  ASN A C   1 
ATOM   2540 O O   . ASN A 1 318 ? 41.596 -7.374  56.057  1.00 62.02  ? 352  ASN A O   1 
ATOM   2541 C CB  . ASN A 1 318 ? 40.996 -7.279  53.248  1.00 63.01  ? 352  ASN A CB  1 
ATOM   2542 C CG  . ASN A 1 318 ? 40.568 -5.838  53.499  1.00 64.69  ? 352  ASN A CG  1 
ATOM   2543 O OD1 . ASN A 1 318 ? 39.564 -5.581  54.175  1.00 65.40  ? 352  ASN A OD1 1 
ATOM   2544 N ND2 . ASN A 1 318 ? 41.324 -4.887  52.943  1.00 64.54  ? 352  ASN A ND2 1 
ATOM   2545 N N   . GLY A 1 319 ? 39.436 -7.892  56.447  1.00 62.19  ? 353  GLY A N   1 
ATOM   2546 C CA  . GLY A 1 319 ? 39.496 -7.494  57.845  1.00 62.25  ? 353  GLY A CA  1 
ATOM   2547 C C   . GLY A 1 319 ? 39.313 -6.020  58.182  1.00 62.72  ? 353  GLY A C   1 
ATOM   2548 O O   . GLY A 1 319 ? 39.030 -5.681  59.337  1.00 61.48  ? 353  GLY A O   1 
ATOM   2549 N N   . ARG A 1 320 ? 39.478 -5.139  57.196  1.00 63.41  ? 354  ARG A N   1 
ATOM   2550 C CA  . ARG A 1 320 ? 39.334 -3.699  57.428  1.00 64.51  ? 354  ARG A CA  1 
ATOM   2551 C C   . ARG A 1 320 ? 37.886 -3.277  57.687  1.00 64.04  ? 354  ARG A C   1 
ATOM   2552 O O   . ARG A 1 320 ? 36.945 -4.066  57.542  1.00 63.01  ? 354  ARG A O   1 
ATOM   2553 C CB  . ARG A 1 320 ? 39.856 -2.892  56.233  1.00 65.97  ? 354  ARG A CB  1 
ATOM   2554 C CG  . ARG A 1 320 ? 41.301 -3.146  55.841  1.00 68.71  ? 354  ARG A CG  1 
ATOM   2555 C CD  . ARG A 1 320 ? 41.798 -2.052  54.891  1.00 71.32  ? 354  ARG A CD  1 
ATOM   2556 N NE  . ARG A 1 320 ? 43.148 -2.312  54.402  1.00 75.25  ? 354  ARG A NE  1 
ATOM   2557 C CZ  . ARG A 1 320 ? 43.892 -1.427  53.741  1.00 77.32  ? 354  ARG A CZ  1 
ATOM   2558 N NH1 . ARG A 1 320 ? 43.416 -0.211  53.487  1.00 77.26  ? 354  ARG A NH1 1 
ATOM   2559 N NH2 . ARG A 1 320 ? 45.117 -1.758  53.332  1.00 78.17  ? 354  ARG A NH2 1 
ATOM   2560 N N   . ASP A 1 321 ? 37.718 -2.017  58.071  1.00 63.34  ? 355  ASP A N   1 
ATOM   2561 C CA  . ASP A 1 321 ? 36.388 -1.475  58.333  1.00 62.77  ? 355  ASP A CA  1 
ATOM   2562 C C   . ASP A 1 321 ? 35.745 -0.999  57.040  1.00 60.68  ? 355  ASP A C   1 
ATOM   2563 O O   . ASP A 1 321 ? 36.445 -0.666  56.082  1.00 61.09  ? 355  ASP A O   1 
ATOM   2564 C CB  . ASP A 1 321 ? 36.473 -0.304  59.307  1.00 64.81  ? 355  ASP A CB  1 
ATOM   2565 C CG  . ASP A 1 321 ? 36.350 -0.741  60.741  1.00 67.72  ? 355  ASP A CG  1 
ATOM   2566 O OD1 . ASP A 1 321 ? 35.260 -1.226  61.114  1.00 70.59  ? 355  ASP A OD1 1 
ATOM   2567 O OD2 . ASP A 1 321 ? 37.338 -0.614  61.492  1.00 69.48  ? 355  ASP A OD2 1 
ATOM   2568 N N   . THR A 1 322 ? 34.416 -0.974  57.003  1.00 56.52  ? 356  THR A N   1 
ATOM   2569 C CA  . THR A 1 322 ? 33.737 -0.511  55.802  1.00 54.91  ? 356  THR A CA  1 
ATOM   2570 C C   . THR A 1 322 ? 33.903 1.009   55.721  1.00 53.41  ? 356  THR A C   1 
ATOM   2571 O O   . THR A 1 322 ? 34.147 1.673   56.729  1.00 54.01  ? 356  THR A O   1 
ATOM   2572 C CB  . THR A 1 322 ? 32.208 -0.853  55.801  1.00 55.12  ? 356  THR A CB  1 
ATOM   2573 O OG1 . THR A 1 322 ? 31.555 -0.188  56.890  1.00 56.65  ? 356  THR A OG1 1 
ATOM   2574 C CG2 . THR A 1 322 ? 31.986 -2.358  55.935  1.00 54.71  ? 356  THR A CG2 1 
ATOM   2575 N N   . PRO A 1 323 ? 33.816 1.578   54.511  1.00 51.48  ? 357  PRO A N   1 
ATOM   2576 C CA  . PRO A 1 323 ? 33.963 3.034   54.394  1.00 48.78  ? 357  PRO A CA  1 
ATOM   2577 C C   . PRO A 1 323 ? 32.829 3.695   55.169  1.00 47.43  ? 357  PRO A C   1 
ATOM   2578 O O   . PRO A 1 323 ? 31.902 3.011   55.615  1.00 47.76  ? 357  PRO A O   1 
ATOM   2579 C CB  . PRO A 1 323 ? 33.827 3.282   52.891  1.00 48.93  ? 357  PRO A CB  1 
ATOM   2580 C CG  . PRO A 1 323 ? 34.272 2.001   52.273  1.00 50.00  ? 357  PRO A CG  1 
ATOM   2581 C CD  . PRO A 1 323 ? 33.698 0.944   53.187  1.00 50.05  ? 357  PRO A CD  1 
ATOM   2582 N N   . ALA A 1 324 ? 32.888 5.015   55.326  1.00 46.02  ? 358  ALA A N   1 
ATOM   2583 C CA  . ALA A 1 324 ? 31.825 5.739   56.032  1.00 45.17  ? 358  ALA A CA  1 
ATOM   2584 C C   . ALA A 1 324 ? 30.550 5.695   55.169  1.00 45.39  ? 358  ALA A C   1 
ATOM   2585 O O   . ALA A 1 324 ? 30.495 6.285   54.087  1.00 46.46  ? 358  ALA A O   1 
ATOM   2586 C CB  . ALA A 1 324 ? 32.248 7.181   56.272  1.00 44.79  ? 358  ALA A CB  1 
ATOM   2587 N N   . LEU A 1 325 ? 29.528 5.004   55.659  1.00 43.42  ? 359  LEU A N   1 
ATOM   2588 C CA  . LEU A 1 325 ? 28.289 4.850   54.913  1.00 43.82  ? 359  LEU A CA  1 
ATOM   2589 C C   . LEU A 1 325 ? 27.071 5.553   55.489  1.00 43.44  ? 359  LEU A C   1 
ATOM   2590 O O   . LEU A 1 325 ? 25.981 5.486   54.915  1.00 42.93  ? 359  LEU A O   1 
ATOM   2591 C CB  . LEU A 1 325 ? 27.950 3.369   54.791  1.00 44.03  ? 359  LEU A CB  1 
ATOM   2592 C CG  . LEU A 1 325 ? 29.078 2.491   54.274  1.00 44.08  ? 359  LEU A CG  1 
ATOM   2593 C CD1 . LEU A 1 325 ? 28.563 1.080   54.175  1.00 42.76  ? 359  LEU A CD1 1 
ATOM   2594 C CD2 . LEU A 1 325 ? 29.562 2.994   52.917  1.00 44.47  ? 359  LEU A CD2 1 
ATOM   2595 N N   . PHE A 1 326 ? 27.244 6.237   56.611  1.00 43.29  ? 360  PHE A N   1 
ATOM   2596 C CA  . PHE A 1 326 ? 26.116 6.883   57.245  1.00 42.23  ? 360  PHE A CA  1 
ATOM   2597 C C   . PHE A 1 326 ? 26.234 8.379   57.472  1.00 40.97  ? 360  PHE A C   1 
ATOM   2598 O O   . PHE A 1 326 ? 25.314 8.989   57.976  1.00 40.87  ? 360  PHE A O   1 
ATOM   2599 C CB  . PHE A 1 326 ? 25.838 6.183   58.575  1.00 43.62  ? 360  PHE A CB  1 
ATOM   2600 C CG  . PHE A 1 326 ? 25.893 4.691   58.494  1.00 43.43  ? 360  PHE A CG  1 
ATOM   2601 C CD1 . PHE A 1 326 ? 26.837 3.974   59.230  1.00 43.52  ? 360  PHE A CD1 1 
ATOM   2602 C CD2 . PHE A 1 326 ? 25.018 4.002   57.673  1.00 43.06  ? 360  PHE A CD2 1 
ATOM   2603 C CE1 . PHE A 1 326 ? 26.908 2.595   59.150  1.00 42.19  ? 360  PHE A CE1 1 
ATOM   2604 C CE2 . PHE A 1 326 ? 25.079 2.615   57.583  1.00 44.37  ? 360  PHE A CE2 1 
ATOM   2605 C CZ  . PHE A 1 326 ? 26.031 1.913   58.328  1.00 44.11  ? 360  PHE A CZ  1 
ATOM   2606 N N   . ASN A 1 327 ? 27.359 8.962   57.099  1.00 40.68  ? 361  ASN A N   1 
ATOM   2607 C CA  . ASN A 1 327 ? 27.559 10.383  57.275  1.00 40.26  ? 361  ASN A CA  1 
ATOM   2608 C C   . ASN A 1 327 ? 26.746 11.197  56.259  1.00 42.81  ? 361  ASN A C   1 
ATOM   2609 O O   . ASN A 1 327 ? 27.298 11.993  55.492  1.00 43.03  ? 361  ASN A O   1 
ATOM   2610 C CB  . ASN A 1 327 ? 29.058 10.705  57.160  1.00 41.43  ? 361  ASN A CB  1 
ATOM   2611 C CG  . ASN A 1 327 ? 29.660 10.253  55.837  1.00 45.47  ? 361  ASN A CG  1 
ATOM   2612 O OD1 . ASN A 1 327 ? 28.990 9.617   55.008  1.00 47.99  ? 361  ASN A OD1 1 
ATOM   2613 N ND2 . ASN A 1 327 ? 30.929 10.587  55.625  1.00 46.68  ? 361  ASN A ND2 1 
ATOM   2614 N N   . PHE A 1 328 ? 25.431 10.989  56.246  1.00 44.89  ? 362  PHE A N   1 
ATOM   2615 C CA  . PHE A 1 328 ? 24.538 11.705  55.327  1.00 48.32  ? 362  PHE A CA  1 
ATOM   2616 C C   . PHE A 1 328 ? 24.416 13.207  55.634  1.00 49.86  ? 362  PHE A C   1 
ATOM   2617 O O   . PHE A 1 328 ? 24.463 13.601  56.799  1.00 52.02  ? 362  PHE A O   1 
ATOM   2618 C CB  . PHE A 1 328 ? 23.132 11.090  55.373  1.00 49.33  ? 362  PHE A CB  1 
ATOM   2619 C CG  . PHE A 1 328 ? 23.018 9.747   54.692  1.00 51.91  ? 362  PHE A CG  1 
ATOM   2620 C CD1 . PHE A 1 328 ? 23.296 8.574   55.381  1.00 52.71  ? 362  PHE A CD1 1 
ATOM   2621 C CD2 . PHE A 1 328 ? 22.626 9.661   53.355  1.00 51.43  ? 362  PHE A CD2 1 
ATOM   2622 C CE1 . PHE A 1 328 ? 23.184 7.331   54.750  1.00 53.16  ? 362  PHE A CE1 1 
ATOM   2623 C CE2 . PHE A 1 328 ? 22.512 8.427   52.717  1.00 50.96  ? 362  PHE A CE2 1 
ATOM   2624 C CZ  . PHE A 1 328 ? 22.792 7.260   53.414  1.00 52.05  ? 362  PHE A CZ  1 
ATOM   2625 N N   . THR A 1 329 ? 24.269 14.038  54.597  1.00 49.88  ? 363  THR A N   1 
ATOM   2626 C CA  . THR A 1 329 ? 24.102 15.485  54.790  1.00 49.36  ? 363  THR A CA  1 
ATOM   2627 C C   . THR A 1 329 ? 22.639 15.863  54.565  1.00 51.27  ? 363  THR A C   1 
ATOM   2628 O O   . THR A 1 329 ? 21.836 15.050  54.108  1.00 53.33  ? 363  THR A O   1 
ATOM   2629 C CB  . THR A 1 329 ? 24.964 16.347  53.825  1.00 49.27  ? 363  THR A CB  1 
ATOM   2630 O OG1 . THR A 1 329 ? 24.598 16.076  52.465  1.00 51.21  ? 363  THR A OG1 1 
ATOM   2631 C CG2 . THR A 1 329 ? 26.447 16.086  54.031  1.00 44.44  ? 363  THR A CG2 1 
ATOM   2632 N N   . THR A 1 330 ? 22.282 17.093  54.909  1.00 52.27  ? 364  THR A N   1 
ATOM   2633 C CA  . THR A 1 330 ? 20.903 17.536  54.748  1.00 53.33  ? 364  THR A CA  1 
ATOM   2634 C C   . THR A 1 330 ? 20.571 17.488  53.268  1.00 53.89  ? 364  THR A C   1 
ATOM   2635 O O   . THR A 1 330 ? 19.469 17.097  52.869  1.00 54.32  ? 364  THR A O   1 
ATOM   2636 C CB  . THR A 1 330 ? 20.715 18.976  55.291  1.00 52.85  ? 364  THR A CB  1 
ATOM   2637 O OG1 . THR A 1 330 ? 21.027 18.998  56.688  1.00 52.61  ? 364  THR A OG1 1 
ATOM   2638 C CG2 . THR A 1 330 ? 19.284 19.447  55.098  1.00 50.86  ? 364  THR A CG2 1 
ATOM   2639 N N   . GLN A 1 331 ? 21.548 17.892  52.462  1.00 54.26  ? 365  GLN A N   1 
ATOM   2640 C CA  . GLN A 1 331 ? 21.419 17.903  51.010  1.00 55.09  ? 365  GLN A CA  1 
ATOM   2641 C C   . GLN A 1 331 ? 21.093 16.500  50.463  1.00 55.04  ? 365  GLN A C   1 
ATOM   2642 O O   . GLN A 1 331 ? 20.264 16.368  49.569  1.00 56.74  ? 365  GLN A O   1 
ATOM   2643 C CB  . GLN A 1 331 ? 22.724 18.434  50.391  1.00 55.71  ? 365  GLN A CB  1 
ATOM   2644 C CG  . GLN A 1 331 ? 22.735 18.522  48.871  1.00 57.90  ? 365  GLN A CG  1 
ATOM   2645 C CD  . GLN A 1 331 ? 21.658 19.439  48.311  1.00 60.07  ? 365  GLN A CD  1 
ATOM   2646 O OE1 . GLN A 1 331 ? 21.277 19.317  47.144  1.00 61.57  ? 365  GLN A OE1 1 
ATOM   2647 N NE2 . GLN A 1 331 ? 21.169 20.366  49.132  1.00 61.02  ? 365  GLN A NE2 1 
ATOM   2648 N N   . GLU A 1 332 ? 21.729 15.462  51.005  1.00 53.63  ? 366  GLU A N   1 
ATOM   2649 C CA  . GLU A 1 332 ? 21.495 14.099  50.539  1.00 53.13  ? 366  GLU A CA  1 
ATOM   2650 C C   . GLU A 1 332 ? 20.164 13.509  50.940  1.00 51.85  ? 366  GLU A C   1 
ATOM   2651 O O   . GLU A 1 332 ? 19.622 12.648  50.239  1.00 53.31  ? 366  GLU A O   1 
ATOM   2652 C CB  . GLU A 1 332 ? 22.560 13.154  51.061  1.00 54.41  ? 366  GLU A CB  1 
ATOM   2653 C CG  . GLU A 1 332 ? 23.951 13.412  50.573  1.00 56.74  ? 366  GLU A CG  1 
ATOM   2654 C CD  . GLU A 1 332 ? 24.916 12.371  51.107  1.00 58.68  ? 366  GLU A CD  1 
ATOM   2655 O OE1 . GLU A 1 332 ? 24.767 11.177  50.731  1.00 58.47  ? 366  GLU A OE1 1 
ATOM   2656 O OE2 . GLU A 1 332 ? 25.810 12.747  51.908  1.00 56.11  ? 366  GLU A OE2 1 
ATOM   2657 N N   . LEU A 1 333 ? 19.648 13.945  52.078  1.00 49.92  ? 367  LEU A N   1 
ATOM   2658 C CA  . LEU A 1 333 ? 18.390 13.421  52.586  1.00 49.26  ? 367  LEU A CA  1 
ATOM   2659 C C   . LEU A 1 333 ? 17.206 14.259  52.141  1.00 49.84  ? 367  LEU A C   1 
ATOM   2660 O O   . LEU A 1 333 ? 16.055 13.832  52.264  1.00 49.10  ? 367  LEU A O   1 
ATOM   2661 C CB  . LEU A 1 333 ? 18.447 13.379  54.110  1.00 48.69  ? 367  LEU A CB  1 
ATOM   2662 C CG  . LEU A 1 333 ? 19.563 12.505  54.684  1.00 50.73  ? 367  LEU A CG  1 
ATOM   2663 C CD1 . LEU A 1 333 ? 19.888 12.920  56.094  1.00 49.08  ? 367  LEU A CD1 1 
ATOM   2664 C CD2 . LEU A 1 333 ? 19.131 11.039  54.624  1.00 49.96  ? 367  LEU A CD2 1 
ATOM   2665 N N   . SER A 1 334 ? 17.495 15.439  51.598  1.00 50.15  ? 368  SER A N   1 
ATOM   2666 C CA  . SER A 1 334 ? 16.458 16.365  51.169  1.00 51.06  ? 368  SER A CA  1 
ATOM   2667 C C   . SER A 1 334 ? 15.258 15.759  50.439  1.00 52.31  ? 368  SER A C   1 
ATOM   2668 O O   . SER A 1 334 ? 14.139 16.233  50.606  1.00 53.21  ? 368  SER A O   1 
ATOM   2669 C CB  . SER A 1 334 ? 17.072 17.474  50.320  1.00 50.35  ? 368  SER A CB  1 
ATOM   2670 O OG  . SER A 1 334 ? 17.709 16.959  49.172  1.00 55.00  ? 368  SER A OG  1 
ATOM   2671 N N   . SER A 1 335 ? 15.466 14.712  49.650  1.00 52.96  ? 369  SER A N   1 
ATOM   2672 C CA  . SER A 1 335 ? 14.349 14.116  48.926  1.00 52.98  ? 369  SER A CA  1 
ATOM   2673 C C   . SER A 1 335 ? 13.354 13.395  49.846  1.00 53.82  ? 369  SER A C   1 
ATOM   2674 O O   . SER A 1 335 ? 12.227 13.108  49.434  1.00 53.58  ? 369  SER A O   1 
ATOM   2675 C CB  . SER A 1 335 ? 14.868 13.141  47.859  1.00 52.49  ? 369  SER A CB  1 
ATOM   2676 O OG  . SER A 1 335 ? 15.525 12.018  48.428  1.00 53.26  ? 369  SER A OG  1 
ATOM   2677 N N   . ASN A 1 336 ? 13.761 13.111  51.084  1.00 53.22  ? 370  ASN A N   1 
ATOM   2678 C CA  . ASN A 1 336 ? 12.898 12.392  52.024  1.00 53.38  ? 370  ASN A CA  1 
ATOM   2679 C C   . ASN A 1 336 ? 13.604 12.218  53.384  1.00 53.68  ? 370  ASN A C   1 
ATOM   2680 O O   . ASN A 1 336 ? 14.014 11.114  53.756  1.00 53.88  ? 370  ASN A O   1 
ATOM   2681 C CB  . ASN A 1 336 ? 12.537 11.027  51.419  1.00 51.70  ? 370  ASN A CB  1 
ATOM   2682 C CG  . ASN A 1 336 ? 11.527 10.255  52.245  1.00 54.92  ? 370  ASN A CG  1 
ATOM   2683 O OD1 . ASN A 1 336 ? 11.050 9.202   51.818  1.00 55.52  ? 370  ASN A OD1 1 
ATOM   2684 N ND2 . ASN A 1 336 ? 11.197 10.763  53.431  1.00 55.75  ? 370  ASN A ND2 1 
ATOM   2685 N N   . PRO A 1 337 ? 13.744 13.317  54.148  1.00 53.59  ? 371  PRO A N   1 
ATOM   2686 C CA  . PRO A 1 337 ? 14.398 13.325  55.464  1.00 52.99  ? 371  PRO A CA  1 
ATOM   2687 C C   . PRO A 1 337 ? 14.024 12.191  56.427  1.00 52.47  ? 371  PRO A C   1 
ATOM   2688 O O   . PRO A 1 337 ? 14.893 11.610  57.068  1.00 53.64  ? 371  PRO A O   1 
ATOM   2689 C CB  . PRO A 1 337 ? 14.062 14.718  56.000  1.00 52.85  ? 371  PRO A CB  1 
ATOM   2690 C CG  . PRO A 1 337 ? 14.073 15.550  54.733  1.00 51.61  ? 371  PRO A CG  1 
ATOM   2691 C CD  . PRO A 1 337 ? 13.261 14.668  53.803  1.00 52.47  ? 371  PRO A CD  1 
ATOM   2692 N N   . PRO A 1 338 ? 12.729 11.864  56.548  1.00 52.58  ? 372  PRO A N   1 
ATOM   2693 C CA  . PRO A 1 338 ? 12.308 10.783  57.445  1.00 52.78  ? 372  PRO A CA  1 
ATOM   2694 C C   . PRO A 1 338 ? 13.070 9.477   57.258  1.00 53.71  ? 372  PRO A C   1 
ATOM   2695 O O   . PRO A 1 338 ? 13.095 8.636   58.155  1.00 55.01  ? 372  PRO A O   1 
ATOM   2696 C CB  . PRO A 1 338 ? 10.826 10.627  57.121  1.00 51.98  ? 372  PRO A CB  1 
ATOM   2697 C CG  . PRO A 1 338 ? 10.414 12.034  56.902  1.00 52.01  ? 372  PRO A CG  1 
ATOM   2698 C CD  . PRO A 1 338 ? 11.554 12.595  56.043  1.00 53.24  ? 372  PRO A CD  1 
ATOM   2699 N N   . LEU A 1 339 ? 13.689 9.299   56.096  1.00 54.41  ? 373  LEU A N   1 
ATOM   2700 C CA  . LEU A 1 339 ? 14.440 8.076   55.837  1.00 53.65  ? 373  LEU A CA  1 
ATOM   2701 C C   . LEU A 1 339 ? 15.724 7.970   56.644  1.00 53.99  ? 373  LEU A C   1 
ATOM   2702 O O   . LEU A 1 339 ? 16.286 6.885   56.758  1.00 55.62  ? 373  LEU A O   1 
ATOM   2703 C CB  . LEU A 1 339 ? 14.754 7.944   54.345  1.00 52.16  ? 373  LEU A CB  1 
ATOM   2704 C CG  . LEU A 1 339 ? 13.567 7.550   53.460  1.00 50.18  ? 373  LEU A CG  1 
ATOM   2705 C CD1 . LEU A 1 339 ? 14.026 7.462   52.009  1.00 49.40  ? 373  LEU A CD1 1 
ATOM   2706 C CD2 . LEU A 1 339 ? 13.000 6.222   53.922  1.00 47.63  ? 373  LEU A CD2 1 
ATOM   2707 N N   . ALA A 1 340 ? 16.181 9.089   57.205  1.00 54.09  ? 374  ALA A N   1 
ATOM   2708 C CA  . ALA A 1 340 ? 17.404 9.104   58.016  1.00 54.96  ? 374  ALA A CA  1 
ATOM   2709 C C   . ALA A 1 340 ? 17.255 8.094   59.157  1.00 55.78  ? 374  ALA A C   1 
ATOM   2710 O O   . ALA A 1 340 ? 18.240 7.548   59.654  1.00 56.21  ? 374  ALA A O   1 
ATOM   2711 C CB  . ALA A 1 340 ? 17.650 10.503  58.574  1.00 53.61  ? 374  ALA A CB  1 
ATOM   2712 N N   . THR A 1 341 ? 16.003 7.869   59.547  1.00 55.66  ? 375  THR A N   1 
ATOM   2713 C CA  . THR A 1 341 ? 15.614 6.931   60.585  1.00 57.01  ? 375  THR A CA  1 
ATOM   2714 C C   . THR A 1 341 ? 16.204 5.546   60.357  1.00 57.66  ? 375  THR A C   1 
ATOM   2715 O O   . THR A 1 341 ? 16.510 4.817   61.314  1.00 58.99  ? 375  THR A O   1 
ATOM   2716 C CB  . THR A 1 341 ? 14.086 6.783   60.609  1.00 58.62  ? 375  THR A CB  1 
ATOM   2717 O OG1 . THR A 1 341 ? 13.505 7.963   61.171  1.00 58.49  ? 375  THR A OG1 1 
ATOM   2718 C CG2 . THR A 1 341 ? 13.671 5.560   61.407  1.00 59.37  ? 375  THR A CG2 1 
ATOM   2719 N N   . ILE A 1 342 ? 16.332 5.178   59.085  1.00 56.88  ? 376  ILE A N   1 
ATOM   2720 C CA  . ILE A 1 342 ? 16.888 3.883   58.706  1.00 54.31  ? 376  ILE A CA  1 
ATOM   2721 C C   . ILE A 1 342 ? 18.303 4.044   58.178  1.00 54.64  ? 376  ILE A C   1 
ATOM   2722 O O   . ILE A 1 342 ? 19.193 3.280   58.531  1.00 57.05  ? 376  ILE A O   1 
ATOM   2723 C CB  . ILE A 1 342 ? 16.062 3.222   57.609  1.00 52.77  ? 376  ILE A CB  1 
ATOM   2724 C CG1 . ILE A 1 342 ? 14.575 3.223   58.002  1.00 51.68  ? 376  ILE A CG1 1 
ATOM   2725 C CG2 . ILE A 1 342 ? 16.584 1.811   57.367  1.00 50.61  ? 376  ILE A CG2 1 
ATOM   2726 C CD1 . ILE A 1 342 ? 13.641 2.697   56.927  1.00 46.63  ? 376  ILE A CD1 1 
ATOM   2727 N N   . LEU A 1 343 ? 18.509 5.043   57.335  1.00 53.70  ? 377  LEU A N   1 
ATOM   2728 C CA  . LEU A 1 343 ? 19.824 5.266   56.772  1.00 54.03  ? 377  LEU A CA  1 
ATOM   2729 C C   . LEU A 1 343 ? 20.912 5.365   57.834  1.00 53.73  ? 377  LEU A C   1 
ATOM   2730 O O   . LEU A 1 343 ? 22.022 4.870   57.638  1.00 54.55  ? 377  LEU A O   1 
ATOM   2731 C CB  . LEU A 1 343 ? 19.807 6.521   55.896  1.00 53.80  ? 377  LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 343 ? 18.769 6.462   54.764  1.00 52.70  ? 377  LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 343 ? 18.864 7.709   53.912  1.00 50.97  ? 377  LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 343 ? 19.010 5.218   53.909  1.00 52.45  ? 377  LEU A CD2 1 
ATOM   2735 N N   . ILE A 1 344 ? 20.597 5.988   58.965  1.00 53.05  ? 378  ILE A N   1 
ATOM   2736 C CA  . ILE A 1 344 ? 21.581 6.149   60.040  1.00 52.71  ? 378  ILE A CA  1 
ATOM   2737 C C   . ILE A 1 344 ? 21.275 5.205   61.198  1.00 52.49  ? 378  ILE A C   1 
ATOM   2738 O O   . ILE A 1 344 ? 20.401 5.480   62.009  1.00 53.47  ? 378  ILE A O   1 
ATOM   2739 C CB  . ILE A 1 344 ? 21.596 7.599   60.532  1.00 50.59  ? 378  ILE A CB  1 
ATOM   2740 C CG1 . ILE A 1 344 ? 21.853 8.525   59.341  1.00 50.39  ? 378  ILE A CG1 1 
ATOM   2741 C CG2 . ILE A 1 344 ? 22.668 7.774   61.600  1.00 50.42  ? 378  ILE A CG2 1 
ATOM   2742 C CD1 . ILE A 1 344 ? 21.797 9.985   59.668  1.00 49.56  ? 378  ILE A CD1 1 
ATOM   2743 N N   . PRO A 1 345 ? 22.013 4.084   61.296  1.00 52.21  ? 379  PRO A N   1 
ATOM   2744 C CA  . PRO A 1 345 ? 21.827 3.076   62.341  1.00 51.77  ? 379  PRO A CA  1 
ATOM   2745 C C   . PRO A 1 345 ? 21.891 3.593   63.776  1.00 51.42  ? 379  PRO A C   1 
ATOM   2746 O O   . PRO A 1 345 ? 22.569 4.579   64.078  1.00 49.37  ? 379  PRO A O   1 
ATOM   2747 C CB  . PRO A 1 345 ? 22.951 2.080   62.067  1.00 52.35  ? 379  PRO A CB  1 
ATOM   2748 C CG  . PRO A 1 345 ? 23.268 2.279   60.654  1.00 52.72  ? 379  PRO A CG  1 
ATOM   2749 C CD  . PRO A 1 345 ? 23.219 3.768   60.518  1.00 52.16  ? 379  PRO A CD  1 
ATOM   2750 N N   . PRO A 1 346 ? 21.183 2.911   64.687  1.00 51.63  ? 380  PRO A N   1 
ATOM   2751 C CA  . PRO A 1 346 ? 21.179 3.311   66.094  1.00 52.90  ? 380  PRO A CA  1 
ATOM   2752 C C   . PRO A 1 346 ? 22.606 3.506   66.596  1.00 53.88  ? 380  PRO A C   1 
ATOM   2753 O O   . PRO A 1 346 ? 22.900 4.526   67.219  1.00 55.32  ? 380  PRO A O   1 
ATOM   2754 C CB  . PRO A 1 346 ? 20.471 2.147   66.773  1.00 52.13  ? 380  PRO A CB  1 
ATOM   2755 C CG  . PRO A 1 346 ? 19.465 1.740   65.730  1.00 51.68  ? 380  PRO A CG  1 
ATOM   2756 C CD  . PRO A 1 346 ? 20.278 1.771   64.462  1.00 50.82  ? 380  PRO A CD  1 
ATOM   2757 N N   . HIS A 1 347 ? 23.498 2.557   66.299  1.00 53.74  ? 381  HIS A N   1 
ATOM   2758 C CA  . HIS A 1 347 ? 24.884 2.672   66.750  1.00 53.79  ? 381  HIS A CA  1 
ATOM   2759 C C   . HIS A 1 347 ? 25.642 3.834   66.124  1.00 55.15  ? 381  HIS A C   1 
ATOM   2760 O O   . HIS A 1 347 ? 26.737 4.157   66.559  1.00 55.33  ? 381  HIS A O   1 
ATOM   2761 C CB  . HIS A 1 347 ? 25.672 1.378   66.493  1.00 52.69  ? 381  HIS A CB  1 
ATOM   2762 C CG  . HIS A 1 347 ? 26.205 1.241   65.095  1.00 52.98  ? 381  HIS A CG  1 
ATOM   2763 N ND1 . HIS A 1 347 ? 25.514 0.599   64.092  1.00 51.82  ? 381  HIS A ND1 1 
ATOM   2764 C CD2 . HIS A 1 347 ? 27.382 1.635   64.549  1.00 51.25  ? 381  HIS A CD2 1 
ATOM   2765 C CE1 . HIS A 1 347 ? 26.242 0.598   62.987  1.00 51.84  ? 381  HIS A CE1 1 
ATOM   2766 N NE2 . HIS A 1 347 ? 27.378 1.219   63.238  1.00 50.32  ? 381  HIS A NE2 1 
ATOM   2767 N N   . ALA A 1 348 ? 25.083 4.462   65.099  1.00 57.06  ? 382  ALA A N   1 
ATOM   2768 C CA  . ALA A 1 348 ? 25.783 5.579   64.471  1.00 58.90  ? 382  ALA A CA  1 
ATOM   2769 C C   . ALA A 1 348 ? 25.339 6.892   65.111  1.00 61.49  ? 382  ALA A C   1 
ATOM   2770 O O   . ALA A 1 348 ? 25.845 7.970   64.786  1.00 59.67  ? 382  ALA A O   1 
ATOM   2771 C CB  . ALA A 1 348 ? 25.519 5.595   62.977  1.00 58.32  ? 382  ALA A CB  1 
ATOM   2772 N N   . ARG A 1 349 ? 24.403 6.774   66.049  1.00 64.51  ? 383  ARG A N   1 
ATOM   2773 C CA  . ARG A 1 349 ? 23.855 7.914   66.765  1.00 67.48  ? 383  ARG A CA  1 
ATOM   2774 C C   . ARG A 1 349 ? 24.394 8.019   68.194  1.00 70.93  ? 383  ARG A C   1 
ATOM   2775 O O   . ARG A 1 349 ? 23.946 8.860   68.985  1.00 71.94  ? 383  ARG A O   1 
ATOM   2776 C CB  . ARG A 1 349 ? 22.329 7.815   66.762  1.00 66.44  ? 383  ARG A CB  1 
ATOM   2777 C CG  . ARG A 1 349 ? 21.772 7.950   65.358  1.00 66.50  ? 383  ARG A CG  1 
ATOM   2778 C CD  . ARG A 1 349 ? 20.265 8.012   65.297  1.00 66.66  ? 383  ARG A CD  1 
ATOM   2779 N NE  . ARG A 1 349 ? 19.681 6.700   65.078  1.00 68.32  ? 383  ARG A NE  1 
ATOM   2780 C CZ  . ARG A 1 349 ? 18.454 6.501   64.617  1.00 69.08  ? 383  ARG A CZ  1 
ATOM   2781 N NH1 . ARG A 1 349 ? 17.678 7.533   64.325  1.00 70.24  ? 383  ARG A NH1 1 
ATOM   2782 N NH2 . ARG A 1 349 ? 18.010 5.268   64.439  1.00 70.80  ? 383  ARG A NH2 1 
ATOM   2783 N N   . ILE A 1 350 ? 25.354 7.157   68.518  1.00 73.26  ? 384  ILE A N   1 
ATOM   2784 C CA  . ILE A 1 350 ? 25.981 7.152   69.831  1.00 75.64  ? 384  ILE A CA  1 
ATOM   2785 C C   . ILE A 1 350 ? 27.024 8.269   69.848  1.00 79.87  ? 384  ILE A C   1 
ATOM   2786 O O   . ILE A 1 350 ? 28.099 8.130   69.256  1.00 81.08  ? 384  ILE A O   1 
ATOM   2787 C CB  . ILE A 1 350 ? 26.673 5.812   70.091  1.00 73.72  ? 384  ILE A CB  1 
ATOM   2788 C CG1 . ILE A 1 350 ? 25.641 4.687   70.058  1.00 72.94  ? 384  ILE A CG1 1 
ATOM   2789 C CG2 . ILE A 1 350 ? 27.388 5.842   71.425  1.00 74.15  ? 384  ILE A CG2 1 
ATOM   2790 C CD1 . ILE A 1 350 ? 26.247 3.317   70.192  1.00 70.71  ? 384  ILE A CD1 1 
ATOM   2791 N N   . GLN A 1 351 ? 26.704 9.371   70.528  1.00 83.61  ? 385  GLN A N   1 
ATOM   2792 C CA  . GLN A 1 351 ? 27.595 10.536  70.597  1.00 86.74  ? 385  GLN A CA  1 
ATOM   2793 C C   . GLN A 1 351 ? 28.969 10.309  71.244  1.00 88.14  ? 385  GLN A C   1 
ATOM   2794 O O   . GLN A 1 351 ? 29.969 10.889  70.799  1.00 87.95  ? 385  GLN A O   1 
ATOM   2795 C CB  . GLN A 1 351 ? 26.885 11.715  71.299  1.00 87.58  ? 385  GLN A CB  1 
ATOM   2796 C CG  . GLN A 1 351 ? 26.566 11.512  72.785  1.00 87.48  ? 385  GLN A CG  1 
ATOM   2797 C CD  . GLN A 1 351 ? 26.146 12.805  73.492  1.00 87.62  ? 385  GLN A CD  1 
ATOM   2798 O OE1 . GLN A 1 351 ? 25.101 13.390  73.190  1.00 88.43  ? 385  GLN A OE1 1 
ATOM   2799 N NE2 . GLN A 1 351 ? 26.969 13.256  74.435  1.00 86.61  ? 385  GLN A NE2 1 
ATOM   2800 N N   . ALA A 1 352 ? 29.012 9.477   72.287  1.00 89.48  ? 386  ALA A N   1 
ATOM   2801 C CA  . ALA A 1 352 ? 30.251 9.169   73.014  1.00 90.66  ? 386  ALA A CA  1 
ATOM   2802 C C   . ALA A 1 352 ? 30.927 10.430  73.573  1.00 91.29  ? 386  ALA A C   1 
ATOM   2803 O O   . ALA A 1 352 ? 30.310 11.520  73.502  1.00 91.29  ? 386  ALA A O   1 
ATOM   2804 C CB  . ALA A 1 352 ? 31.226 8.403   72.107  1.00 90.70  ? 386  ALA A CB  1 
ATOM   2805 O OXT . ALA A 1 352 ? 32.066 10.314  74.084  1.00 91.19  ? 386  ALA A OXT 1 
ATOM   2806 N N   . SER B 1 1   ? 19.140 -42.199 12.866  1.00 93.90  ? 35   SER B N   1 
ATOM   2807 C CA  . SER B 1 1   ? 18.873 -40.730 12.868  1.00 93.73  ? 35   SER B CA  1 
ATOM   2808 C C   . SER B 1 1   ? 17.382 -40.428 12.728  1.00 93.18  ? 35   SER B C   1 
ATOM   2809 O O   . SER B 1 1   ? 16.723 -40.924 11.811  1.00 93.30  ? 35   SER B O   1 
ATOM   2810 C CB  . SER B 1 1   ? 19.642 -40.052 11.727  1.00 94.26  ? 35   SER B CB  1 
ATOM   2811 O OG  . SER B 1 1   ? 19.261 -40.576 10.464  1.00 94.55  ? 35   SER B OG  1 
ATOM   2812 N N   . LYS B 1 2   ? 16.859 -39.615 13.646  1.00 92.13  ? 36   LYS B N   1 
ATOM   2813 C CA  . LYS B 1 2   ? 15.445 -39.230 13.643  1.00 90.23  ? 36   LYS B CA  1 
ATOM   2814 C C   . LYS B 1 2   ? 15.070 -38.492 12.359  1.00 88.06  ? 36   LYS B C   1 
ATOM   2815 O O   . LYS B 1 2   ? 15.655 -37.458 12.038  1.00 88.50  ? 36   LYS B O   1 
ATOM   2816 C CB  . LYS B 1 2   ? 15.133 -38.319 14.841  1.00 91.22  ? 36   LYS B CB  1 
ATOM   2817 C CG  . LYS B 1 2   ? 13.717 -37.725 14.818  1.00 92.28  ? 36   LYS B CG  1 
ATOM   2818 C CD  . LYS B 1 2   ? 13.516 -36.612 15.851  1.00 92.74  ? 36   LYS B CD  1 
ATOM   2819 C CE  . LYS B 1 2   ? 13.626 -37.122 17.283  1.00 94.30  ? 36   LYS B CE  1 
ATOM   2820 N NZ  . LYS B 1 2   ? 13.403 -36.034 18.285  1.00 94.84  ? 36   LYS B NZ  1 
ATOM   2821 N N   . VAL B 1 3   ? 14.096 -39.022 11.627  1.00 84.89  ? 37   VAL B N   1 
ATOM   2822 C CA  . VAL B 1 3   ? 13.644 -38.388 10.392  1.00 81.28  ? 37   VAL B CA  1 
ATOM   2823 C C   . VAL B 1 3   ? 12.303 -37.712 10.637  1.00 78.77  ? 37   VAL B C   1 
ATOM   2824 O O   . VAL B 1 3   ? 11.295 -38.380 10.849  1.00 79.10  ? 37   VAL B O   1 
ATOM   2825 C CB  . VAL B 1 3   ? 13.475 -39.413 9.249   1.00 80.72  ? 37   VAL B CB  1 
ATOM   2826 C CG1 . VAL B 1 3   ? 12.904 -38.730 8.016   1.00 79.69  ? 37   VAL B CG1 1 
ATOM   2827 C CG2 . VAL B 1 3   ? 14.814 -40.052 8.925   1.00 80.44  ? 37   VAL B CG2 1 
ATOM   2828 N N   . THR B 1 4   ? 12.291 -36.386 10.616  1.00 75.56  ? 38   THR B N   1 
ATOM   2829 C CA  . THR B 1 4   ? 11.054 -35.659 10.842  1.00 72.30  ? 38   THR B CA  1 
ATOM   2830 C C   . THR B 1 4   ? 10.320 -35.393 9.539   1.00 70.42  ? 38   THR B C   1 
ATOM   2831 O O   . THR B 1 4   ? 10.923 -35.024 8.528   1.00 69.73  ? 38   THR B O   1 
ATOM   2832 C CB  . THR B 1 4   ? 11.312 -34.318 11.544  1.00 72.38  ? 38   THR B CB  1 
ATOM   2833 O OG1 . THR B 1 4   ? 11.886 -34.563 12.833  1.00 73.86  ? 38   THR B OG1 1 
ATOM   2834 C CG2 . THR B 1 4   ? 10.013 -33.543 11.717  1.00 70.70  ? 38   THR B CG2 1 
ATOM   2835 N N   . THR B 1 5   ? 9.011  -35.597 9.563   1.00 67.57  ? 39   THR B N   1 
ATOM   2836 C CA  . THR B 1 5   ? 8.198  -35.358 8.380   1.00 65.77  ? 39   THR B CA  1 
ATOM   2837 C C   . THR B 1 5   ? 7.073  -34.393 8.725   1.00 62.80  ? 39   THR B C   1 
ATOM   2838 O O   . THR B 1 5   ? 6.399  -34.556 9.739   1.00 61.95  ? 39   THR B O   1 
ATOM   2839 C CB  . THR B 1 5   ? 7.593  -36.665 7.835   1.00 66.22  ? 39   THR B CB  1 
ATOM   2840 O OG1 . THR B 1 5   ? 8.648  -37.581 7.515   1.00 67.83  ? 39   THR B OG1 1 
ATOM   2841 C CG2 . THR B 1 5   ? 6.784  -36.388 6.581   1.00 64.72  ? 39   THR B CG2 1 
ATOM   2842 N N   . VAL B 1 6   ? 6.882  -33.382 7.887   1.00 59.17  ? 40   VAL B N   1 
ATOM   2843 C CA  . VAL B 1 6   ? 5.836  -32.403 8.127   1.00 57.38  ? 40   VAL B CA  1 
ATOM   2844 C C   . VAL B 1 6   ? 5.152  -31.997 6.835   1.00 56.15  ? 40   VAL B C   1 
ATOM   2845 O O   . VAL B 1 6   ? 5.614  -32.337 5.746   1.00 56.33  ? 40   VAL B O   1 
ATOM   2846 C CB  . VAL B 1 6   ? 6.400  -31.130 8.809   1.00 57.19  ? 40   VAL B CB  1 
ATOM   2847 C CG1 . VAL B 1 6   ? 6.899  -31.462 10.199  1.00 57.54  ? 40   VAL B CG1 1 
ATOM   2848 C CG2 . VAL B 1 6   ? 7.525  -30.535 7.972   1.00 55.22  ? 40   VAL B CG2 1 
ATOM   2849 N N   . VAL B 1 7   ? 4.035  -31.286 6.958   1.00 54.40  ? 41   VAL B N   1 
ATOM   2850 C CA  . VAL B 1 7   ? 3.329  -30.815 5.780   1.00 53.50  ? 41   VAL B CA  1 
ATOM   2851 C C   . VAL B 1 7   ? 3.564  -29.321 5.748   1.00 53.54  ? 41   VAL B C   1 
ATOM   2852 O O   . VAL B 1 7   ? 3.021  -28.581 6.557   1.00 53.77  ? 41   VAL B O   1 
ATOM   2853 C CB  . VAL B 1 7   ? 1.820  -31.115 5.848   1.00 52.38  ? 41   VAL B CB  1 
ATOM   2854 C CG1 . VAL B 1 7   ? 1.129  -30.576 4.604   1.00 51.12  ? 41   VAL B CG1 1 
ATOM   2855 C CG2 . VAL B 1 7   ? 1.593  -32.614 5.958   1.00 50.51  ? 41   VAL B CG2 1 
ATOM   2856 N N   . ALA B 1 8   ? 4.407  -28.893 4.815   1.00 54.05  ? 42   ALA B N   1 
ATOM   2857 C CA  . ALA B 1 8   ? 4.751  -27.489 4.680   1.00 53.56  ? 42   ALA B CA  1 
ATOM   2858 C C   . ALA B 1 8   ? 4.248  -26.886 3.384   1.00 53.63  ? 42   ALA B C   1 
ATOM   2859 O O   . ALA B 1 8   ? 4.081  -27.570 2.376   1.00 52.70  ? 42   ALA B O   1 
ATOM   2860 C CB  . ALA B 1 8   ? 6.258  -27.310 4.783   1.00 53.86  ? 42   ALA B CB  1 
ATOM   2861 N N   . THR B 1 9   ? 4.024  -25.580 3.441   1.00 54.35  ? 43   THR B N   1 
ATOM   2862 C CA  . THR B 1 9   ? 3.540  -24.800 2.324   1.00 54.50  ? 43   THR B CA  1 
ATOM   2863 C C   . THR B 1 9   ? 4.723  -24.160 1.620   1.00 56.66  ? 43   THR B C   1 
ATOM   2864 O O   . THR B 1 9   ? 5.545  -23.509 2.254   1.00 57.12  ? 43   THR B O   1 
ATOM   2865 C CB  . THR B 1 9   ? 2.650  -23.663 2.813   1.00 53.83  ? 43   THR B CB  1 
ATOM   2866 O OG1 . THR B 1 9   ? 1.654  -24.192 3.690   1.00 54.61  ? 43   THR B OG1 1 
ATOM   2867 C CG2 . THR B 1 9   ? 2.000  -22.959 1.647   1.00 52.54  ? 43   THR B CG2 1 
ATOM   2868 N N   . PRO B 1 10  ? 4.828  -24.337 0.298   1.00 58.68  ? 44   PRO B N   1 
ATOM   2869 C CA  . PRO B 1 10  ? 5.923  -23.752 -0.476  1.00 60.00  ? 44   PRO B CA  1 
ATOM   2870 C C   . PRO B 1 10  ? 6.044  -22.253 -0.231  1.00 61.28  ? 44   PRO B C   1 
ATOM   2871 O O   . PRO B 1 10  ? 5.064  -21.587 0.083   1.00 60.64  ? 44   PRO B O   1 
ATOM   2872 C CB  . PRO B 1 10  ? 5.530  -24.078 -1.909  1.00 59.51  ? 44   PRO B CB  1 
ATOM   2873 C CG  . PRO B 1 10  ? 4.925  -25.427 -1.752  1.00 59.94  ? 44   PRO B CG  1 
ATOM   2874 C CD  . PRO B 1 10  ? 4.030  -25.244 -0.545  1.00 60.21  ? 44   PRO B CD  1 
ATOM   2875 N N   . GLY B 1 11  ? 7.255  -21.732 -0.382  1.00 64.17  ? 45   GLY B N   1 
ATOM   2876 C CA  . GLY B 1 11  ? 7.498  -20.322 -0.160  1.00 67.68  ? 45   GLY B CA  1 
ATOM   2877 C C   . GLY B 1 11  ? 6.781  -19.375 -1.099  1.00 71.39  ? 45   GLY B C   1 
ATOM   2878 O O   . GLY B 1 11  ? 5.854  -18.681 -0.686  1.00 71.33  ? 45   GLY B O   1 
ATOM   2879 N N   . GLN B 1 12  ? 7.216  -19.334 -2.357  1.00 75.74  ? 46   GLN B N   1 
ATOM   2880 C CA  . GLN B 1 12  ? 6.620  -18.446 -3.358  1.00 80.52  ? 46   GLN B CA  1 
ATOM   2881 C C   . GLN B 1 12  ? 5.472  -19.108 -4.104  1.00 82.29  ? 46   GLN B C   1 
ATOM   2882 O O   . GLN B 1 12  ? 4.451  -18.479 -4.374  1.00 83.70  ? 46   GLN B O   1 
ATOM   2883 C CB  . GLN B 1 12  ? 7.646  -18.034 -4.426  1.00 82.58  ? 46   GLN B CB  1 
ATOM   2884 C CG  . GLN B 1 12  ? 8.845  -17.190 -4.037  1.00 85.22  ? 46   GLN B CG  1 
ATOM   2885 C CD  . GLN B 1 12  ? 9.596  -17.669 -2.816  1.00 86.98  ? 46   GLN B CD  1 
ATOM   2886 O OE1 . GLN B 1 12  ? 10.508 -18.502 -2.893  1.00 87.47  ? 46   GLN B OE1 1 
ATOM   2887 N NE2 . GLN B 1 12  ? 9.209  -17.135 -1.667  1.00 87.27  ? 46   GLN B NE2 1 
ATOM   2888 N N   . GLY B 1 13  ? 5.668  -20.372 -4.465  1.00 84.16  ? 47   GLY B N   1 
ATOM   2889 C CA  . GLY B 1 13  ? 4.665  -21.101 -5.225  1.00 85.55  ? 47   GLY B CA  1 
ATOM   2890 C C   . GLY B 1 13  ? 3.232  -21.029 -4.722  1.00 86.21  ? 47   GLY B C   1 
ATOM   2891 O O   . GLY B 1 13  ? 2.953  -20.395 -3.695  1.00 86.44  ? 47   GLY B O   1 
ATOM   2892 N N   . PRO B 1 14  ? 2.289  -21.661 -5.446  1.00 85.90  ? 48   PRO B N   1 
ATOM   2893 C CA  . PRO B 1 14  ? 0.876  -21.665 -5.053  1.00 84.62  ? 48   PRO B CA  1 
ATOM   2894 C C   . PRO B 1 14  ? 0.774  -22.204 -3.629  1.00 82.72  ? 48   PRO B C   1 
ATOM   2895 O O   . PRO B 1 14  ? 1.630  -22.979 -3.197  1.00 83.40  ? 48   PRO B O   1 
ATOM   2896 C CB  . PRO B 1 14  ? 0.239  -22.608 -6.070  1.00 85.09  ? 48   PRO B CB  1 
ATOM   2897 C CG  . PRO B 1 14  ? 1.091  -22.411 -7.289  1.00 85.57  ? 48   PRO B CG  1 
ATOM   2898 C CD  . PRO B 1 14  ? 2.486  -22.389 -6.714  1.00 85.96  ? 48   PRO B CD  1 
ATOM   2899 N N   . ASP B 1 15  ? -0.264 -21.806 -2.905  1.00 79.91  ? 49   ASP B N   1 
ATOM   2900 C CA  . ASP B 1 15  ? -0.429 -22.260 -1.533  1.00 77.61  ? 49   ASP B CA  1 
ATOM   2901 C C   . ASP B 1 15  ? -0.903 -23.723 -1.446  1.00 76.25  ? 49   ASP B C   1 
ATOM   2902 O O   . ASP B 1 15  ? -1.920 -24.027 -0.830  1.00 75.51  ? 49   ASP B O   1 
ATOM   2903 C CB  . ASP B 1 15  ? -1.402 -21.332 -0.807  1.00 77.82  ? 49   ASP B CB  1 
ATOM   2904 C CG  . ASP B 1 15  ? -1.303 -21.449 0.699   1.00 79.46  ? 49   ASP B CG  1 
ATOM   2905 O OD1 . ASP B 1 15  ? -1.478 -22.573 1.219   1.00 80.38  ? 49   ASP B OD1 1 
ATOM   2906 O OD2 . ASP B 1 15  ? -1.052 -20.420 1.364   1.00 79.12  ? 49   ASP B OD2 1 
ATOM   2907 N N   . ARG B 1 16  ? -0.134 -24.620 -2.057  1.00 75.08  ? 50   ARG B N   1 
ATOM   2908 C CA  . ARG B 1 16  ? -0.437 -26.043 -2.077  1.00 73.47  ? 50   ARG B CA  1 
ATOM   2909 C C   . ARG B 1 16  ? 0.571  -26.864 -1.259  1.00 71.09  ? 50   ARG B C   1 
ATOM   2910 O O   . ARG B 1 16  ? 1.612  -27.282 -1.766  1.00 70.27  ? 50   ARG B O   1 
ATOM   2911 C CB  . ARG B 1 16  ? -0.472 -26.528 -3.530  1.00 75.97  ? 50   ARG B CB  1 
ATOM   2912 C CG  . ARG B 1 16  ? -1.678 -26.016 -4.316  1.00 79.96  ? 50   ARG B CG  1 
ATOM   2913 C CD  . ARG B 1 16  ? -2.938 -26.827 -3.993  1.00 84.37  ? 50   ARG B CD  1 
ATOM   2914 N NE  . ARG B 1 16  ? -4.139 -26.247 -4.591  1.00 86.85  ? 50   ARG B NE  1 
ATOM   2915 C CZ  . ARG B 1 16  ? -4.991 -25.458 -3.942  1.00 88.52  ? 50   ARG B CZ  1 
ATOM   2916 N NH1 . ARG B 1 16  ? -4.781 -25.158 -2.664  1.00 89.23  ? 50   ARG B NH1 1 
ATOM   2917 N NH2 . ARG B 1 16  ? -6.048 -24.961 -4.574  1.00 89.12  ? 50   ARG B NH2 1 
ATOM   2918 N N   . PRO B 1 17  ? 0.260  -27.108 0.025   1.00 69.24  ? 51   PRO B N   1 
ATOM   2919 C CA  . PRO B 1 17  ? 1.090  -27.870 0.962   1.00 68.56  ? 51   PRO B CA  1 
ATOM   2920 C C   . PRO B 1 17  ? 1.626  -29.182 0.419   1.00 68.30  ? 51   PRO B C   1 
ATOM   2921 O O   . PRO B 1 17  ? 0.955  -29.874 -0.338  1.00 69.03  ? 51   PRO B O   1 
ATOM   2922 C CB  . PRO B 1 17  ? 0.159  -28.081 2.145   1.00 68.47  ? 51   PRO B CB  1 
ATOM   2923 C CG  . PRO B 1 17  ? -0.616 -26.821 2.155   1.00 68.18  ? 51   PRO B CG  1 
ATOM   2924 C CD  . PRO B 1 17  ? -0.963 -26.640 0.698   1.00 69.00  ? 51   PRO B CD  1 
ATOM   2925 N N   . GLN B 1 18  ? 2.845  -29.515 0.829   1.00 68.28  ? 52   GLN B N   1 
ATOM   2926 C CA  . GLN B 1 18  ? 3.510  -30.734 0.397   1.00 66.56  ? 52   GLN B CA  1 
ATOM   2927 C C   . GLN B 1 18  ? 4.084  -31.421 1.612   1.00 65.72  ? 52   GLN B C   1 
ATOM   2928 O O   . GLN B 1 18  ? 4.165  -30.841 2.690   1.00 64.34  ? 52   GLN B O   1 
ATOM   2929 C CB  . GLN B 1 18  ? 4.639  -30.390 -0.577  1.00 68.70  ? 52   GLN B CB  1 
ATOM   2930 C CG  . GLN B 1 18  ? 4.350  -29.140 -1.382  1.00 72.60  ? 52   GLN B CG  1 
ATOM   2931 C CD  . GLN B 1 18  ? 5.295  -28.943 -2.543  1.00 73.20  ? 52   GLN B CD  1 
ATOM   2932 O OE1 . GLN B 1 18  ? 6.519  -28.982 -2.380  1.00 73.17  ? 52   GLN B OE1 1 
ATOM   2933 N NE2 . GLN B 1 18  ? 4.729  -28.714 -3.729  1.00 71.43  ? 52   GLN B NE2 1 
ATOM   2934 N N   . GLU B 1 19  ? 4.480  -32.667 1.435   1.00 66.79  ? 53   GLU B N   1 
ATOM   2935 C CA  . GLU B 1 19  ? 5.075  -33.413 2.526   1.00 67.74  ? 53   GLU B CA  1 
ATOM   2936 C C   . GLU B 1 19  ? 6.583  -33.233 2.444   1.00 67.22  ? 53   GLU B C   1 
ATOM   2937 O O   . GLU B 1 19  ? 7.179  -33.451 1.389   1.00 67.68  ? 53   GLU B O   1 
ATOM   2938 C CB  . GLU B 1 19  ? 4.720  -34.884 2.401   1.00 69.33  ? 53   GLU B CB  1 
ATOM   2939 C CG  . GLU B 1 19  ? 4.019  -35.434 3.618   1.00 71.67  ? 53   GLU B CG  1 
ATOM   2940 C CD  . GLU B 1 19  ? 3.550  -36.863 3.418   1.00 73.91  ? 53   GLU B CD  1 
ATOM   2941 O OE1 . GLU B 1 19  ? 4.422  -37.756 3.253   1.00 73.89  ? 53   GLU B OE1 1 
ATOM   2942 O OE2 . GLU B 1 19  ? 2.311  -37.085 3.418   1.00 72.21  ? 53   GLU B OE2 1 
ATOM   2943 N N   . VAL B 1 20  ? 7.190  -32.823 3.553   1.00 66.42  ? 54   VAL B N   1 
ATOM   2944 C CA  . VAL B 1 20  ? 8.626  -32.604 3.601   1.00 64.64  ? 54   VAL B CA  1 
ATOM   2945 C C   . VAL B 1 20  ? 9.253  -33.346 4.764   1.00 64.28  ? 54   VAL B C   1 
ATOM   2946 O O   . VAL B 1 20  ? 8.762  -33.280 5.888   1.00 63.98  ? 54   VAL B O   1 
ATOM   2947 C CB  . VAL B 1 20  ? 8.953  -31.109 3.740   1.00 64.83  ? 54   VAL B CB  1 
ATOM   2948 C CG1 . VAL B 1 20  ? 10.459 -30.907 3.734   1.00 64.65  ? 54   VAL B CG1 1 
ATOM   2949 C CG2 . VAL B 1 20  ? 8.296  -30.327 2.607   1.00 62.34  ? 54   VAL B CG2 1 
ATOM   2950 N N   . SER B 1 21  ? 10.339 -34.060 4.482   1.00 65.56  ? 55   SER B N   1 
ATOM   2951 C CA  . SER B 1 21  ? 11.062 -34.824 5.498   1.00 65.92  ? 55   SER B CA  1 
ATOM   2952 C C   . SER B 1 21  ? 12.510 -34.363 5.585   1.00 65.84  ? 55   SER B C   1 
ATOM   2953 O O   . SER B 1 21  ? 13.158 -34.123 4.571   1.00 65.44  ? 55   SER B O   1 
ATOM   2954 C CB  . SER B 1 21  ? 11.026 -36.315 5.162   1.00 66.22  ? 55   SER B CB  1 
ATOM   2955 O OG  . SER B 1 21  ? 9.706  -36.819 5.227   1.00 65.58  ? 55   SER B OG  1 
ATOM   2956 N N   . TYR B 1 22  ? 13.016 -34.253 6.803   1.00 66.67  ? 56   TYR B N   1 
ATOM   2957 C CA  . TYR B 1 22  ? 14.382 -33.813 6.999   1.00 68.12  ? 56   TYR B CA  1 
ATOM   2958 C C   . TYR B 1 22  ? 15.015 -34.542 8.180   1.00 70.94  ? 56   TYR B C   1 
ATOM   2959 O O   . TYR B 1 22  ? 14.313 -35.037 9.066   1.00 71.56  ? 56   TYR B O   1 
ATOM   2960 C CB  . TYR B 1 22  ? 14.399 -32.287 7.206   1.00 64.10  ? 56   TYR B CB  1 
ATOM   2961 C CG  . TYR B 1 22  ? 13.579 -31.784 8.383   1.00 60.50  ? 56   TYR B CG  1 
ATOM   2962 C CD1 . TYR B 1 22  ? 14.024 -31.952 9.693   1.00 59.55  ? 56   TYR B CD1 1 
ATOM   2963 C CD2 . TYR B 1 22  ? 12.379 -31.105 8.184   1.00 59.59  ? 56   TYR B CD2 1 
ATOM   2964 C CE1 . TYR B 1 22  ? 13.305 -31.454 10.775  1.00 58.39  ? 56   TYR B CE1 1 
ATOM   2965 C CE2 . TYR B 1 22  ? 11.648 -30.600 9.263   1.00 58.06  ? 56   TYR B CE2 1 
ATOM   2966 C CZ  . TYR B 1 22  ? 12.123 -30.779 10.557  1.00 58.67  ? 56   TYR B CZ  1 
ATOM   2967 O OH  . TYR B 1 22  ? 11.436 -30.269 11.635  1.00 58.84  ? 56   TYR B OH  1 
ATOM   2968 N N   . THR B 1 23  ? 16.342 -34.617 8.186   1.00 73.70  ? 57   THR B N   1 
ATOM   2969 C CA  . THR B 1 23  ? 17.048 -35.285 9.268   1.00 77.18  ? 57   THR B CA  1 
ATOM   2970 C C   . THR B 1 23  ? 18.300 -34.503 9.657   1.00 78.52  ? 57   THR B C   1 
ATOM   2971 O O   . THR B 1 23  ? 18.629 -33.501 9.022   1.00 78.80  ? 57   THR B O   1 
ATOM   2972 C CB  . THR B 1 23  ? 17.425 -36.738 8.866   1.00 77.77  ? 57   THR B CB  1 
ATOM   2973 O OG1 . THR B 1 23  ? 18.116 -37.373 9.950   1.00 78.65  ? 57   THR B OG1 1 
ATOM   2974 C CG2 . THR B 1 23  ? 18.302 -36.742 7.619   1.00 76.57  ? 57   THR B CG2 1 
ATOM   2975 N N   . ASP B 1 24  ? 18.984 -34.965 10.701  1.00 80.01  ? 58   ASP B N   1 
ATOM   2976 C CA  . ASP B 1 24  ? 20.197 -34.323 11.200  1.00 81.13  ? 58   ASP B CA  1 
ATOM   2977 C C   . ASP B 1 24  ? 19.906 -32.936 11.754  1.00 80.38  ? 58   ASP B C   1 
ATOM   2978 O O   . ASP B 1 24  ? 20.638 -31.985 11.505  1.00 80.55  ? 58   ASP B O   1 
ATOM   2979 C CB  . ASP B 1 24  ? 21.252 -34.225 10.092  1.00 83.60  ? 58   ASP B CB  1 
ATOM   2980 C CG  . ASP B 1 24  ? 21.590 -35.579 9.482   1.00 86.08  ? 58   ASP B CG  1 
ATOM   2981 O OD1 . ASP B 1 24  ? 21.806 -36.551 10.247  1.00 87.89  ? 58   ASP B OD1 1 
ATOM   2982 O OD2 . ASP B 1 24  ? 21.649 -35.667 8.235   1.00 86.24  ? 58   ASP B OD2 1 
ATOM   2983 N N   . THR B 1 25  ? 18.828 -32.832 12.515  1.00 80.29  ? 59   THR B N   1 
ATOM   2984 C CA  . THR B 1 25  ? 18.434 -31.568 13.105  1.00 80.86  ? 59   THR B CA  1 
ATOM   2985 C C   . THR B 1 25  ? 19.350 -31.186 14.261  1.00 81.30  ? 59   THR B C   1 
ATOM   2986 O O   . THR B 1 25  ? 19.465 -31.919 15.244  1.00 81.43  ? 59   THR B O   1 
ATOM   2987 C CB  . THR B 1 25  ? 16.988 -31.647 13.606  1.00 80.69  ? 59   THR B CB  1 
ATOM   2988 O OG1 . THR B 1 25  ? 16.125 -31.903 12.493  1.00 81.51  ? 59   THR B OG1 1 
ATOM   2989 C CG2 . THR B 1 25  ? 16.579 -30.355 14.284  1.00 80.60  ? 59   THR B CG2 1 
ATOM   2990 N N   . LYS B 1 26  ? 19.999 -30.032 14.138  1.00 81.72  ? 60   LYS B N   1 
ATOM   2991 C CA  . LYS B 1 26  ? 20.904 -29.543 15.176  1.00 81.74  ? 60   LYS B CA  1 
ATOM   2992 C C   . LYS B 1 26  ? 20.729 -28.036 15.363  1.00 80.95  ? 60   LYS B C   1 
ATOM   2993 O O   . LYS B 1 26  ? 20.409 -27.324 14.411  1.00 80.79  ? 60   LYS B O   1 
ATOM   2994 C CB  . LYS B 1 26  ? 22.351 -29.849 14.788  1.00 82.04  ? 60   LYS B CB  1 
ATOM   2995 C CG  . LYS B 1 26  ? 22.857 -29.049 13.602  1.00 83.00  ? 60   LYS B CG  1 
ATOM   2996 C CD  . LYS B 1 26  ? 24.204 -29.551 13.118  1.00 84.59  ? 60   LYS B CD  1 
ATOM   2997 C CE  . LYS B 1 26  ? 24.082 -30.957 12.539  1.00 86.56  ? 60   LYS B CE  1 
ATOM   2998 N NZ  . LYS B 1 26  ? 25.388 -31.481 12.039  1.00 87.89  ? 60   LYS B NZ  1 
ATOM   2999 N N   . VAL B 1 27  ? 20.935 -27.554 16.585  1.00 79.73  ? 61   VAL B N   1 
ATOM   3000 C CA  . VAL B 1 27  ? 20.796 -26.130 16.859  1.00 78.99  ? 61   VAL B CA  1 
ATOM   3001 C C   . VAL B 1 27  ? 22.029 -25.385 16.380  1.00 79.41  ? 61   VAL B C   1 
ATOM   3002 O O   . VAL B 1 27  ? 23.140 -25.709 16.777  1.00 80.02  ? 61   VAL B O   1 
ATOM   3003 C CB  . VAL B 1 27  ? 20.636 -25.851 18.355  1.00 77.47  ? 61   VAL B CB  1 
ATOM   3004 C CG1 . VAL B 1 27  ? 20.352 -24.376 18.567  1.00 77.18  ? 61   VAL B CG1 1 
ATOM   3005 C CG2 . VAL B 1 27  ? 19.527 -26.704 18.932  1.00 76.96  ? 61   VAL B CG2 1 
ATOM   3006 N N   . ILE B 1 28  ? 21.837 -24.390 15.524  1.00 79.25  ? 62   ILE B N   1 
ATOM   3007 C CA  . ILE B 1 28  ? 22.966 -23.621 15.021  1.00 78.95  ? 62   ILE B CA  1 
ATOM   3008 C C   . ILE B 1 28  ? 22.820 -22.152 15.363  1.00 79.20  ? 62   ILE B C   1 
ATOM   3009 O O   . ILE B 1 28  ? 23.476 -21.297 14.778  1.00 78.72  ? 62   ILE B O   1 
ATOM   3010 C CB  . ILE B 1 28  ? 23.110 -23.747 13.499  1.00 78.17  ? 62   ILE B CB  1 
ATOM   3011 C CG1 . ILE B 1 28  ? 21.877 -23.172 12.807  1.00 77.37  ? 62   ILE B CG1 1 
ATOM   3012 C CG2 . ILE B 1 28  ? 23.330 -25.197 13.129  1.00 77.89  ? 62   ILE B CG2 1 
ATOM   3013 C CD1 . ILE B 1 28  ? 22.020 -23.054 11.307  1.00 75.18  ? 62   ILE B CD1 1 
ATOM   3014 N N   . GLY B 1 29  ? 21.951 -21.858 16.314  1.00 79.47  ? 63   GLY B N   1 
ATOM   3015 C CA  . GLY B 1 29  ? 21.759 -20.480 16.689  1.00 80.48  ? 63   GLY B CA  1 
ATOM   3016 C C   . GLY B 1 29  ? 20.581 -20.352 17.611  1.00 82.07  ? 63   GLY B C   1 
ATOM   3017 O O   . GLY B 1 29  ? 19.675 -21.182 17.599  1.00 82.14  ? 63   GLY B O   1 
ATOM   3018 N N   . ASN B 1 30  ? 20.605 -19.307 18.424  1.00 83.99  ? 64   ASN B N   1 
ATOM   3019 C CA  . ASN B 1 30  ? 19.528 -19.059 19.357  1.00 85.83  ? 64   ASN B CA  1 
ATOM   3020 C C   . ASN B 1 30  ? 19.214 -17.568 19.345  1.00 86.67  ? 64   ASN B C   1 
ATOM   3021 O O   . ASN B 1 30  ? 19.629 -16.832 20.239  1.00 87.87  ? 64   ASN B O   1 
ATOM   3022 C CB  . ASN B 1 30  ? 19.932 -19.508 20.757  1.00 86.25  ? 64   ASN B CB  1 
ATOM   3023 C CG  . ASN B 1 30  ? 18.736 -19.774 21.638  1.00 88.16  ? 64   ASN B CG  1 
ATOM   3024 O OD1 . ASN B 1 30  ? 17.875 -18.903 21.824  1.00 88.27  ? 64   ASN B OD1 1 
ATOM   3025 N ND2 . ASN B 1 30  ? 18.667 -20.984 22.187  1.00 88.85  ? 64   ASN B ND2 1 
ATOM   3026 N N   . GLY B 1 31  ? 18.479 -17.131 18.323  1.00 86.88  ? 65   GLY B N   1 
ATOM   3027 C CA  . GLY B 1 31  ? 18.127 -15.726 18.190  1.00 86.05  ? 65   GLY B CA  1 
ATOM   3028 C C   . GLY B 1 31  ? 17.090 -15.181 19.162  1.00 86.18  ? 65   GLY B C   1 
ATOM   3029 O O   . GLY B 1 31  ? 16.468 -15.925 19.927  1.00 85.93  ? 65   GLY B O   1 
ATOM   3030 N N   . SER B 1 32  ? 16.915 -13.860 19.123  1.00 86.20  ? 66   SER B N   1 
ATOM   3031 C CA  . SER B 1 32  ? 15.961 -13.155 19.978  1.00 85.22  ? 66   SER B CA  1 
ATOM   3032 C C   . SER B 1 32  ? 14.580 -13.799 19.976  1.00 85.16  ? 66   SER B C   1 
ATOM   3033 O O   . SER B 1 32  ? 14.076 -14.217 21.020  1.00 85.36  ? 66   SER B O   1 
ATOM   3034 C CB  . SER B 1 32  ? 15.807 -11.689 19.533  1.00 84.37  ? 66   SER B CB  1 
ATOM   3035 O OG  . SER B 1 32  ? 16.997 -10.953 19.685  1.00 83.51  ? 66   SER B OG  1 
ATOM   3036 N N   . PHE B 1 33  ? 13.970 -13.872 18.797  1.00 84.59  ? 67   PHE B N   1 
ATOM   3037 C CA  . PHE B 1 33  ? 12.635 -14.423 18.689  1.00 84.34  ? 67   PHE B CA  1 
ATOM   3038 C C   . PHE B 1 33  ? 12.518 -15.947 18.660  1.00 82.79  ? 67   PHE B C   1 
ATOM   3039 O O   . PHE B 1 33  ? 11.409 -16.485 18.705  1.00 82.40  ? 67   PHE B O   1 
ATOM   3040 C CB  . PHE B 1 33  ? 11.911 -13.777 17.494  1.00 85.89  ? 67   PHE B CB  1 
ATOM   3041 C CG  . PHE B 1 33  ? 11.444 -12.360 17.769  1.00 88.22  ? 67   PHE B CG  1 
ATOM   3042 C CD1 . PHE B 1 33  ? 12.363 -11.329 17.980  1.00 87.76  ? 67   PHE B CD1 1 
ATOM   3043 C CD2 . PHE B 1 33  ? 10.079 -12.067 17.861  1.00 89.53  ? 67   PHE B CD2 1 
ATOM   3044 C CE1 . PHE B 1 33  ? 11.929 -10.033 18.291  1.00 87.92  ? 67   PHE B CE1 1 
ATOM   3045 C CE2 . PHE B 1 33  ? 9.637  -10.769 18.173  1.00 89.77  ? 67   PHE B CE2 1 
ATOM   3046 C CZ  . PHE B 1 33  ? 10.565 -9.752  18.384  1.00 88.25  ? 67   PHE B CZ  1 
ATOM   3047 N N   . GLY B 1 34  ? 13.649 -16.646 18.623  1.00 80.54  ? 68   GLY B N   1 
ATOM   3048 C CA  . GLY B 1 34  ? 13.589 -18.097 18.616  1.00 78.45  ? 68   GLY B CA  1 
ATOM   3049 C C   . GLY B 1 34  ? 14.869 -18.824 18.255  1.00 76.96  ? 68   GLY B C   1 
ATOM   3050 O O   . GLY B 1 34  ? 15.899 -18.213 17.987  1.00 77.27  ? 68   GLY B O   1 
ATOM   3051 N N   . VAL B 1 35  ? 14.794 -20.149 18.236  1.00 75.55  ? 69   VAL B N   1 
ATOM   3052 C CA  . VAL B 1 35  ? 15.945 -20.978 17.912  1.00 73.44  ? 69   VAL B CA  1 
ATOM   3053 C C   . VAL B 1 35  ? 16.029 -21.271 16.417  1.00 72.52  ? 69   VAL B C   1 
ATOM   3054 O O   . VAL B 1 35  ? 15.009 -21.354 15.731  1.00 72.61  ? 69   VAL B O   1 
ATOM   3055 C CB  . VAL B 1 35  ? 15.875 -22.308 18.665  1.00 73.09  ? 69   VAL B CB  1 
ATOM   3056 C CG1 . VAL B 1 35  ? 17.119 -23.122 18.392  1.00 72.94  ? 69   VAL B CG1 1 
ATOM   3057 C CG2 . VAL B 1 35  ? 15.707 -22.047 20.151  1.00 72.81  ? 69   VAL B CG2 1 
ATOM   3058 N N   . VAL B 1 36  ? 17.251 -21.430 15.920  1.00 70.08  ? 70   VAL B N   1 
ATOM   3059 C CA  . VAL B 1 36  ? 17.470 -21.725 14.511  1.00 67.72  ? 70   VAL B CA  1 
ATOM   3060 C C   . VAL B 1 36  ? 18.188 -23.062 14.363  1.00 68.09  ? 70   VAL B C   1 
ATOM   3061 O O   . VAL B 1 36  ? 19.319 -23.224 14.817  1.00 68.51  ? 70   VAL B O   1 
ATOM   3062 C CB  . VAL B 1 36  ? 18.319 -20.632 13.829  1.00 65.97  ? 70   VAL B CB  1 
ATOM   3063 C CG1 . VAL B 1 36  ? 18.484 -20.946 12.348  1.00 62.78  ? 70   VAL B CG1 1 
ATOM   3064 C CG2 . VAL B 1 36  ? 17.660 -19.277 14.015  1.00 65.18  ? 70   VAL B CG2 1 
ATOM   3065 N N   . TYR B 1 37  ? 17.524 -24.018 13.725  1.00 67.80  ? 71   TYR B N   1 
ATOM   3066 C CA  . TYR B 1 37  ? 18.105 -25.333 13.520  1.00 67.41  ? 71   TYR B CA  1 
ATOM   3067 C C   . TYR B 1 37  ? 18.718 -25.450 12.141  1.00 67.26  ? 71   TYR B C   1 
ATOM   3068 O O   . TYR B 1 37  ? 18.632 -24.535 11.332  1.00 65.49  ? 71   TYR B O   1 
ATOM   3069 C CB  . TYR B 1 37  ? 17.048 -26.427 13.686  1.00 66.96  ? 71   TYR B CB  1 
ATOM   3070 C CG  . TYR B 1 37  ? 16.269 -26.355 14.967  1.00 67.43  ? 71   TYR B CG  1 
ATOM   3071 C CD1 . TYR B 1 37  ? 15.290 -25.382 15.152  1.00 67.64  ? 71   TYR B CD1 1 
ATOM   3072 C CD2 . TYR B 1 37  ? 16.498 -27.268 15.992  1.00 67.22  ? 71   TYR B CD2 1 
ATOM   3073 C CE1 . TYR B 1 37  ? 14.552 -25.315 16.326  1.00 68.68  ? 71   TYR B CE1 1 
ATOM   3074 C CE2 . TYR B 1 37  ? 15.766 -27.213 17.174  1.00 68.69  ? 71   TYR B CE2 1 
ATOM   3075 C CZ  . TYR B 1 37  ? 14.792 -26.233 17.336  1.00 69.57  ? 71   TYR B CZ  1 
ATOM   3076 O OH  . TYR B 1 37  ? 14.056 -26.174 18.504  1.00 69.34  ? 71   TYR B OH  1 
ATOM   3077 N N   . GLN B 1 38  ? 19.334 -26.596 11.885  1.00 69.30  ? 72   GLN B N   1 
ATOM   3078 C CA  . GLN B 1 38  ? 19.962 -26.871 10.603  1.00 71.45  ? 72   GLN B CA  1 
ATOM   3079 C C   . GLN B 1 38  ? 19.717 -28.337 10.295  1.00 72.75  ? 72   GLN B C   1 
ATOM   3080 O O   . GLN B 1 38  ? 20.278 -29.214 10.943  1.00 75.62  ? 72   GLN B O   1 
ATOM   3081 C CB  . GLN B 1 38  ? 21.461 -26.608 10.681  1.00 71.39  ? 72   GLN B CB  1 
ATOM   3082 C CG  . GLN B 1 38  ? 22.154 -26.621 9.330   1.00 73.84  ? 72   GLN B CG  1 
ATOM   3083 C CD  . GLN B 1 38  ? 22.976 -27.870 9.078   1.00 74.80  ? 72   GLN B CD  1 
ATOM   3084 O OE1 . GLN B 1 38  ? 23.551 -28.034 8.004   1.00 74.48  ? 72   GLN B OE1 1 
ATOM   3085 N NE2 . GLN B 1 38  ? 23.044 -28.752 10.067  1.00 76.42  ? 72   GLN B NE2 1 
ATOM   3086 N N   . ALA B 1 39  ? 18.871 -28.609 9.312   1.00 73.10  ? 73   ALA B N   1 
ATOM   3087 C CA  . ALA B 1 39  ? 18.564 -29.983 8.964   1.00 72.78  ? 73   ALA B CA  1 
ATOM   3088 C C   . ALA B 1 39  ? 18.898 -30.301 7.518   1.00 72.86  ? 73   ALA B C   1 
ATOM   3089 O O   . ALA B 1 39  ? 19.270 -29.423 6.739   1.00 72.53  ? 73   ALA B O   1 
ATOM   3090 C CB  . ALA B 1 39  ? 17.093 -30.265 9.239   1.00 72.53  ? 73   ALA B CB  1 
ATOM   3091 N N   . LYS B 1 40  ? 18.761 -31.573 7.170   1.00 74.02  ? 74   LYS B N   1 
ATOM   3092 C CA  . LYS B 1 40  ? 19.044 -32.034 5.821   1.00 76.41  ? 74   LYS B CA  1 
ATOM   3093 C C   . LYS B 1 40  ? 17.799 -32.684 5.223   1.00 77.23  ? 74   LYS B C   1 
ATOM   3094 O O   . LYS B 1 40  ? 17.280 -33.664 5.758   1.00 77.77  ? 74   LYS B O   1 
ATOM   3095 C CB  . LYS B 1 40  ? 20.195 -33.041 5.855   1.00 77.53  ? 74   LYS B CB  1 
ATOM   3096 C CG  . LYS B 1 40  ? 20.604 -33.596 4.503   1.00 79.15  ? 74   LYS B CG  1 
ATOM   3097 C CD  . LYS B 1 40  ? 21.812 -34.513 4.649   1.00 82.53  ? 74   LYS B CD  1 
ATOM   3098 C CE  . LYS B 1 40  ? 22.223 -35.123 3.318   1.00 84.22  ? 74   LYS B CE  1 
ATOM   3099 N NZ  . LYS B 1 40  ? 21.155 -36.000 2.757   1.00 86.40  ? 74   LYS B NZ  1 
ATOM   3100 N N   . LEU B 1 41  ? 17.319 -32.124 4.119   1.00 77.68  ? 75   LEU B N   1 
ATOM   3101 C CA  . LEU B 1 41  ? 16.141 -32.651 3.444   1.00 79.37  ? 75   LEU B CA  1 
ATOM   3102 C C   . LEU B 1 41  ? 16.424 -34.064 2.937   1.00 81.83  ? 75   LEU B C   1 
ATOM   3103 O O   . LEU B 1 41  ? 17.340 -34.264 2.142   1.00 82.91  ? 75   LEU B O   1 
ATOM   3104 C CB  . LEU B 1 41  ? 15.764 -31.751 2.267   1.00 76.84  ? 75   LEU B CB  1 
ATOM   3105 C CG  . LEU B 1 41  ? 15.410 -30.296 2.574   1.00 74.66  ? 75   LEU B CG  1 
ATOM   3106 C CD1 . LEU B 1 41  ? 15.066 -29.582 1.278   1.00 73.20  ? 75   LEU B CD1 1 
ATOM   3107 C CD2 . LEU B 1 41  ? 14.247 -30.225 3.542   1.00 72.09  ? 75   LEU B CD2 1 
ATOM   3108 N N   . CYS B 1 42  ? 15.633 -35.037 3.384   1.00 83.79  ? 76   CYS B N   1 
ATOM   3109 C CA  . CYS B 1 42  ? 15.827 -36.431 2.984   1.00 85.76  ? 76   CYS B CA  1 
ATOM   3110 C C   . CYS B 1 42  ? 15.879 -36.666 1.479   1.00 86.83  ? 76   CYS B C   1 
ATOM   3111 O O   . CYS B 1 42  ? 16.602 -37.543 1.008   1.00 87.58  ? 76   CYS B O   1 
ATOM   3112 C CB  . CYS B 1 42  ? 14.740 -37.312 3.596   1.00 85.25  ? 76   CYS B CB  1 
ATOM   3113 S SG  . CYS B 1 42  ? 14.897 -37.518 5.376   1.00 88.82  ? 76   CYS B SG  1 
ATOM   3114 N N   . ASP B 1 43  ? 15.117 -35.888 0.724   1.00 87.60  ? 77   ASP B N   1 
ATOM   3115 C CA  . ASP B 1 43  ? 15.094 -36.037 -0.727  1.00 89.09  ? 77   ASP B CA  1 
ATOM   3116 C C   . ASP B 1 43  ? 16.360 -35.504 -1.404  1.00 89.31  ? 77   ASP B C   1 
ATOM   3117 O O   . ASP B 1 43  ? 17.304 -36.256 -1.654  1.00 89.60  ? 77   ASP B O   1 
ATOM   3118 C CB  . ASP B 1 43  ? 13.848 -35.348 -1.303  1.00 90.47  ? 77   ASP B CB  1 
ATOM   3119 C CG  . ASP B 1 43  ? 13.522 -34.033 -0.603  1.00 92.71  ? 77   ASP B CG  1 
ATOM   3120 O OD1 . ASP B 1 43  ? 13.219 -34.057 0.617   1.00 93.49  ? 77   ASP B OD1 1 
ATOM   3121 O OD2 . ASP B 1 43  ? 13.564 -32.975 -1.275  1.00 92.73  ? 77   ASP B OD2 1 
ATOM   3122 N N   . SER B 1 44  ? 16.370 -34.205 -1.692  1.00 89.37  ? 78   SER B N   1 
ATOM   3123 C CA  . SER B 1 44  ? 17.498 -33.531 -2.343  1.00 87.95  ? 78   SER B CA  1 
ATOM   3124 C C   . SER B 1 44  ? 18.809 -33.629 -1.563  1.00 87.08  ? 78   SER B C   1 
ATOM   3125 O O   . SER B 1 44  ? 19.891 -33.499 -2.138  1.00 86.39  ? 78   SER B O   1 
ATOM   3126 C CB  . SER B 1 44  ? 17.157 -32.052 -2.563  1.00 87.85  ? 78   SER B CB  1 
ATOM   3127 O OG  . SER B 1 44  ? 16.853 -31.407 -1.335  1.00 87.09  ? 78   SER B OG  1 
ATOM   3128 N N   . GLY B 1 45  ? 18.705 -33.850 -0.255  1.00 86.36  ? 79   GLY B N   1 
ATOM   3129 C CA  . GLY B 1 45  ? 19.890 -33.953 0.580   1.00 84.50  ? 79   GLY B CA  1 
ATOM   3130 C C   . GLY B 1 45  ? 20.438 -32.585 0.947   1.00 83.04  ? 79   GLY B C   1 
ATOM   3131 O O   . GLY B 1 45  ? 21.332 -32.473 1.794   1.00 83.10  ? 79   GLY B O   1 
ATOM   3132 N N   . GLU B 1 46  ? 19.895 -31.548 0.307   1.00 80.37  ? 80   GLU B N   1 
ATOM   3133 C CA  . GLU B 1 46  ? 20.306 -30.169 0.543   1.00 77.96  ? 80   GLU B CA  1 
ATOM   3134 C C   . GLU B 1 46  ? 20.170 -29.758 1.999   1.00 74.64  ? 80   GLU B C   1 
ATOM   3135 O O   . GLU B 1 46  ? 19.349 -30.306 2.735   1.00 74.98  ? 80   GLU B O   1 
ATOM   3136 C CB  . GLU B 1 46  ? 19.478 -29.222 -0.317  1.00 79.06  ? 80   GLU B CB  1 
ATOM   3137 C CG  . GLU B 1 46  ? 19.671 -29.416 -1.796  1.00 82.23  ? 80   GLU B CG  1 
ATOM   3138 C CD  . GLU B 1 46  ? 18.703 -28.588 -2.617  1.00 84.47  ? 80   GLU B CD  1 
ATOM   3139 O OE1 . GLU B 1 46  ? 17.487 -28.883 -2.571  1.00 85.45  ? 80   GLU B OE1 1 
ATOM   3140 O OE2 . GLU B 1 46  ? 19.153 -27.638 -3.301  1.00 85.66  ? 80   GLU B OE2 1 
ATOM   3141 N N   . LEU B 1 47  ? 20.978 -28.787 2.409   1.00 70.42  ? 81   LEU B N   1 
ATOM   3142 C CA  . LEU B 1 47  ? 20.939 -28.313 3.782   1.00 66.45  ? 81   LEU B CA  1 
ATOM   3143 C C   . LEU B 1 47  ? 20.037 -27.095 3.889   1.00 62.51  ? 81   LEU B C   1 
ATOM   3144 O O   . LEU B 1 47  ? 19.978 -26.263 2.982   1.00 59.77  ? 81   LEU B O   1 
ATOM   3145 C CB  . LEU B 1 47  ? 22.352 -27.980 4.268   1.00 66.57  ? 81   LEU B CB  1 
ATOM   3146 C CG  . LEU B 1 47  ? 23.290 -29.176 4.421   1.00 66.55  ? 81   LEU B CG  1 
ATOM   3147 C CD1 . LEU B 1 47  ? 24.707 -28.686 4.644   1.00 66.44  ? 81   LEU B CD1 1 
ATOM   3148 C CD2 . LEU B 1 47  ? 22.832 -30.048 5.585   1.00 67.22  ? 81   LEU B CD2 1 
ATOM   3149 N N   . VAL B 1 48  ? 19.318 -27.006 4.998   1.00 58.58  ? 82   VAL B N   1 
ATOM   3150 C CA  . VAL B 1 48  ? 18.425 -25.888 5.212   1.00 55.35  ? 82   VAL B CA  1 
ATOM   3151 C C   . VAL B 1 48  ? 18.455 -25.438 6.653   1.00 54.82  ? 82   VAL B C   1 
ATOM   3152 O O   . VAL B 1 48  ? 18.878 -26.166 7.548   1.00 53.61  ? 82   VAL B O   1 
ATOM   3153 C CB  . VAL B 1 48  ? 16.968 -26.244 4.863   1.00 54.57  ? 82   VAL B CB  1 
ATOM   3154 C CG1 . VAL B 1 48  ? 16.851 -26.597 3.399   1.00 53.43  ? 82   VAL B CG1 1 
ATOM   3155 C CG2 . VAL B 1 48  ? 16.489 -27.388 5.745   1.00 52.29  ? 82   VAL B CG2 1 
ATOM   3156 N N   . ALA B 1 49  ? 17.990 -24.221 6.868   1.00 54.15  ? 83   ALA B N   1 
ATOM   3157 C CA  . ALA B 1 49  ? 17.935 -23.676 8.200   1.00 54.40  ? 83   ALA B CA  1 
ATOM   3158 C C   . ALA B 1 49  ? 16.463 -23.472 8.565   1.00 55.60  ? 83   ALA B C   1 
ATOM   3159 O O   . ALA B 1 49  ? 15.688 -22.931 7.771   1.00 56.14  ? 83   ALA B O   1 
ATOM   3160 C CB  . ALA B 1 49  ? 18.680 -22.371 8.237   1.00 51.64  ? 83   ALA B CB  1 
ATOM   3161 N N   . ILE B 1 50  ? 16.081 -23.930 9.755   1.00 55.64  ? 84   ILE B N   1 
ATOM   3162 C CA  . ILE B 1 50  ? 14.713 -23.782 10.227  1.00 55.06  ? 84   ILE B CA  1 
ATOM   3163 C C   . ILE B 1 50  ? 14.688 -22.757 11.352  1.00 55.71  ? 84   ILE B C   1 
ATOM   3164 O O   . ILE B 1 50  ? 15.316 -22.952 12.380  1.00 55.70  ? 84   ILE B O   1 
ATOM   3165 C CB  . ILE B 1 50  ? 14.144 -25.112 10.780  1.00 53.83  ? 84   ILE B CB  1 
ATOM   3166 C CG1 . ILE B 1 50  ? 14.150 -26.190 9.705   1.00 53.11  ? 84   ILE B CG1 1 
ATOM   3167 C CG2 . ILE B 1 50  ? 12.719 -24.904 11.259  1.00 54.32  ? 84   ILE B CG2 1 
ATOM   3168 C CD1 . ILE B 1 50  ? 13.711 -27.549 10.226  1.00 51.64  ? 84   ILE B CD1 1 
ATOM   3169 N N   . LYS B 1 51  ? 13.968 -21.660 11.157  1.00 56.94  ? 85   LYS B N   1 
ATOM   3170 C CA  . LYS B 1 51  ? 13.870 -20.647 12.196  1.00 57.42  ? 85   LYS B CA  1 
ATOM   3171 C C   . LYS B 1 51  ? 12.495 -20.734 12.872  1.00 57.92  ? 85   LYS B C   1 
ATOM   3172 O O   . LYS B 1 51  ? 11.487 -20.472 12.233  1.00 58.45  ? 85   LYS B O   1 
ATOM   3173 C CB  . LYS B 1 51  ? 14.082 -19.254 11.586  1.00 56.55  ? 85   LYS B CB  1 
ATOM   3174 C CG  . LYS B 1 51  ? 13.928 -18.128 12.590  1.00 58.55  ? 85   LYS B CG  1 
ATOM   3175 C CD  . LYS B 1 51  ? 14.665 -16.855 12.184  1.00 58.82  ? 85   LYS B CD  1 
ATOM   3176 C CE  . LYS B 1 51  ? 13.928 -16.067 11.131  1.00 60.54  ? 85   LYS B CE  1 
ATOM   3177 N NZ  . LYS B 1 51  ? 14.634 -14.783 10.861  1.00 61.12  ? 85   LYS B NZ  1 
ATOM   3178 N N   . LYS B 1 52  ? 12.452 -21.116 14.148  1.00 58.71  ? 86   LYS B N   1 
ATOM   3179 C CA  . LYS B 1 52  ? 11.183 -21.209 14.880  1.00 60.04  ? 86   LYS B CA  1 
ATOM   3180 C C   . LYS B 1 52  ? 10.885 -19.927 15.629  1.00 60.22  ? 86   LYS B C   1 
ATOM   3181 O O   . LYS B 1 52  ? 11.743 -19.403 16.315  1.00 60.73  ? 86   LYS B O   1 
ATOM   3182 C CB  . LYS B 1 52  ? 11.206 -22.344 15.905  1.00 59.98  ? 86   LYS B CB  1 
ATOM   3183 C CG  . LYS B 1 52  ? 11.429 -23.709 15.331  1.00 62.43  ? 86   LYS B CG  1 
ATOM   3184 C CD  . LYS B 1 52  ? 11.241 -24.788 16.379  1.00 63.74  ? 86   LYS B CD  1 
ATOM   3185 C CE  . LYS B 1 52  ? 9.832  -24.819 16.910  1.00 65.23  ? 86   LYS B CE  1 
ATOM   3186 N NZ  . LYS B 1 52  ? 9.607  -26.071 17.683  1.00 67.20  ? 86   LYS B NZ  1 
ATOM   3187 N N   . VAL B 1 53  ? 9.664  -19.433 15.516  1.00 62.47  ? 87   VAL B N   1 
ATOM   3188 C CA  . VAL B 1 53  ? 9.294  -18.215 16.210  1.00 65.41  ? 87   VAL B CA  1 
ATOM   3189 C C   . VAL B 1 53  ? 7.907  -18.370 16.806  1.00 68.74  ? 87   VAL B C   1 
ATOM   3190 O O   . VAL B 1 53  ? 7.046  -19.030 16.229  1.00 69.98  ? 87   VAL B O   1 
ATOM   3191 C CB  . VAL B 1 53  ? 9.305  -17.004 15.256  1.00 64.64  ? 87   VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 53  ? 10.728 -16.702 14.806  1.00 64.60  ? 87   VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 53  ? 8.430  -17.287 14.061  1.00 64.11  ? 87   VAL B CG2 1 
ATOM   3194 N N   . LEU B 1 54  ? 7.699  -17.773 17.972  1.00 71.98  ? 88   LEU B N   1 
ATOM   3195 C CA  . LEU B 1 54  ? 6.412  -17.834 18.649  1.00 75.32  ? 88   LEU B CA  1 
ATOM   3196 C C   . LEU B 1 54  ? 5.381  -17.055 17.837  1.00 77.52  ? 88   LEU B C   1 
ATOM   3197 O O   . LEU B 1 54  ? 5.568  -15.870 17.580  1.00 78.25  ? 88   LEU B O   1 
ATOM   3198 C CB  . LEU B 1 54  ? 6.539  -17.205 20.034  1.00 76.66  ? 88   LEU B CB  1 
ATOM   3199 C CG  . LEU B 1 54  ? 5.363  -17.356 20.991  1.00 77.63  ? 88   LEU B CG  1 
ATOM   3200 C CD1 . LEU B 1 54  ? 5.481  -18.703 21.662  1.00 76.33  ? 88   LEU B CD1 1 
ATOM   3201 C CD2 . LEU B 1 54  ? 5.364  -16.230 22.031  1.00 77.63  ? 88   LEU B CD2 1 
ATOM   3202 N N   . GLN B 1 55  ? 4.298  -17.712 17.433  1.00 80.73  ? 89   GLN B N   1 
ATOM   3203 C CA  . GLN B 1 55  ? 3.250  -17.039 16.664  1.00 83.39  ? 89   GLN B CA  1 
ATOM   3204 C C   . GLN B 1 55  ? 1.992  -16.875 17.508  1.00 85.12  ? 89   GLN B C   1 
ATOM   3205 O O   . GLN B 1 55  ? 1.421  -17.859 17.975  1.00 85.81  ? 89   GLN B O   1 
ATOM   3206 C CB  . GLN B 1 55  ? 2.913  -17.830 15.401  1.00 83.82  ? 89   GLN B CB  1 
ATOM   3207 C CG  . GLN B 1 55  ? 1.928  -17.116 14.498  1.00 85.29  ? 89   GLN B CG  1 
ATOM   3208 C CD  . GLN B 1 55  ? 2.279  -15.646 14.338  1.00 85.98  ? 89   GLN B CD  1 
ATOM   3209 O OE1 . GLN B 1 55  ? 3.446  -15.296 14.155  1.00 84.98  ? 89   GLN B OE1 1 
ATOM   3210 N NE2 . GLN B 1 55  ? 1.271  -14.780 14.400  1.00 86.18  ? 89   GLN B NE2 1 
ATOM   3211 N N   . GLY B 1 56  ? 1.558  -15.630 17.684  1.00 87.00  ? 90   GLY B N   1 
ATOM   3212 C CA  . GLY B 1 56  ? 0.384  -15.360 18.495  1.00 90.01  ? 90   GLY B CA  1 
ATOM   3213 C C   . GLY B 1 56  ? -0.976 -15.582 17.858  1.00 91.84  ? 90   GLY B C   1 
ATOM   3214 O O   . GLY B 1 56  ? -1.990 -15.566 18.559  1.00 92.61  ? 90   GLY B O   1 
ATOM   3215 N N   . LYS B 1 57  ? -1.006 -15.785 16.542  1.00 92.88  ? 91   LYS B N   1 
ATOM   3216 C CA  . LYS B 1 57  ? -2.259 -16.002 15.808  1.00 94.20  ? 91   LYS B CA  1 
ATOM   3217 C C   . LYS B 1 57  ? -3.200 -14.798 15.860  1.00 94.49  ? 91   LYS B C   1 
ATOM   3218 O O   . LYS B 1 57  ? -4.086 -14.657 15.016  1.00 94.00  ? 91   LYS B O   1 
ATOM   3219 C CB  . LYS B 1 57  ? -2.981 -17.248 16.331  1.00 94.57  ? 91   LYS B CB  1 
ATOM   3220 C CG  . LYS B 1 57  ? -2.326 -18.550 15.909  1.00 95.54  ? 91   LYS B CG  1 
ATOM   3221 C CD  . LYS B 1 57  ? -2.297 -18.668 14.392  1.00 96.10  ? 91   LYS B CD  1 
ATOM   3222 C CE  . LYS B 1 57  ? -1.549 -19.914 13.935  1.00 95.91  ? 91   LYS B CE  1 
ATOM   3223 N NZ  . LYS B 1 57  ? -1.557 -20.013 12.448  1.00 94.72  ? 91   LYS B NZ  1 
ATOM   3224 N N   . ALA B 1 58  ? -2.994 -13.934 16.853  1.00 95.04  ? 92   ALA B N   1 
ATOM   3225 C CA  . ALA B 1 58  ? -3.791 -12.723 17.024  1.00 94.84  ? 92   ALA B CA  1 
ATOM   3226 C C   . ALA B 1 58  ? -3.458 -11.747 15.895  1.00 94.77  ? 92   ALA B C   1 
ATOM   3227 O O   . ALA B 1 58  ? -4.146 -10.740 15.700  1.00 94.69  ? 92   ALA B O   1 
ATOM   3228 C CB  . ALA B 1 58  ? -3.487 -12.080 18.377  1.00 94.88  ? 92   ALA B CB  1 
ATOM   3229 N N   . PHE B 1 59  ? -2.385 -12.053 15.168  1.00 94.21  ? 93   PHE B N   1 
ATOM   3230 C CA  . PHE B 1 59  ? -1.935 -11.235 14.042  1.00 92.56  ? 93   PHE B CA  1 
ATOM   3231 C C   . PHE B 1 59  ? -1.333 -12.095 12.921  1.00 88.94  ? 93   PHE B C   1 
ATOM   3232 O O   . PHE B 1 59  ? -1.239 -13.323 13.024  1.00 87.31  ? 93   PHE B O   1 
ATOM   3233 C CB  . PHE B 1 59  ? -0.870 -10.211 14.484  1.00 96.73  ? 93   PHE B CB  1 
ATOM   3234 C CG  . PHE B 1 59  ? -1.391 -9.098  15.367  1.00 100.47 ? 93   PHE B CG  1 
ATOM   3235 C CD1 . PHE B 1 59  ? -1.673 -9.327  16.718  1.00 101.85 ? 93   PHE B CD1 1 
ATOM   3236 C CD2 . PHE B 1 59  ? -1.568 -7.809  14.852  1.00 101.60 ? 93   PHE B CD2 1 
ATOM   3237 C CE1 . PHE B 1 59  ? -2.115 -8.287  17.547  1.00 102.86 ? 93   PHE B CE1 1 
ATOM   3238 C CE2 . PHE B 1 59  ? -2.010 -6.760  15.670  1.00 102.72 ? 93   PHE B CE2 1 
ATOM   3239 C CZ  . PHE B 1 59  ? -2.286 -6.999  17.021  1.00 103.05 ? 93   PHE B CZ  1 
ATOM   3240 N N   . LYS B 1 60  ? -0.934 -11.414 11.849  1.00 85.18  ? 94   LYS B N   1 
ATOM   3241 C CA  . LYS B 1 60  ? -0.298 -12.026 10.685  1.00 80.39  ? 94   LYS B CA  1 
ATOM   3242 C C   . LYS B 1 60  ? 1.194  -11.799 10.873  1.00 75.45  ? 94   LYS B C   1 
ATOM   3243 O O   . LYS B 1 60  ? 1.612  -10.679 11.172  1.00 74.08  ? 94   LYS B O   1 
ATOM   3244 C CB  . LYS B 1 60  ? -0.756 -11.332 9.393   1.00 82.21  ? 94   LYS B CB  1 
ATOM   3245 C CG  . LYS B 1 60  ? -1.839 -12.062 8.617   1.00 84.55  ? 94   LYS B CG  1 
ATOM   3246 C CD  . LYS B 1 60  ? -1.290 -13.358 8.034   1.00 87.16  ? 94   LYS B CD  1 
ATOM   3247 C CE  . LYS B 1 60  ? -2.324 -14.103 7.207   1.00 86.67  ? 94   LYS B CE  1 
ATOM   3248 N NZ  . LYS B 1 60  ? -1.696 -15.258 6.513   1.00 87.78  ? 94   LYS B NZ  1 
ATOM   3249 N N   . ASN B 1 61  ? 1.993  -12.847 10.697  1.00 69.46  ? 95   ASN B N   1 
ATOM   3250 C CA  . ASN B 1 61  ? 3.439  -12.723 10.859  1.00 62.86  ? 95   ASN B CA  1 
ATOM   3251 C C   . ASN B 1 61  ? 4.053  -11.867 9.752   1.00 60.13  ? 95   ASN B C   1 
ATOM   3252 O O   . ASN B 1 61  ? 4.120  -12.278 8.597   1.00 59.07  ? 95   ASN B O   1 
ATOM   3253 C CB  . ASN B 1 61  ? 4.088  -14.103 10.871  1.00 59.91  ? 95   ASN B CB  1 
ATOM   3254 C CG  . ASN B 1 61  ? 5.517  -14.056 11.323  1.00 57.69  ? 95   ASN B CG  1 
ATOM   3255 O OD1 . ASN B 1 61  ? 6.381  -13.517 10.641  1.00 59.27  ? 95   ASN B OD1 1 
ATOM   3256 N ND2 . ASN B 1 61  ? 5.777  -14.607 12.491  1.00 55.36  ? 95   ASN B ND2 1 
ATOM   3257 N N   . ARG B 1 62  ? 4.502  -10.673 10.125  1.00 57.32  ? 96   ARG B N   1 
ATOM   3258 C CA  . ARG B 1 62  ? 5.090  -9.720  9.191   1.00 54.29  ? 96   ARG B CA  1 
ATOM   3259 C C   . ARG B 1 62  ? 6.288  -10.235 8.387   1.00 53.06  ? 96   ARG B C   1 
ATOM   3260 O O   . ARG B 1 62  ? 6.419  -9.932  7.199   1.00 51.21  ? 96   ARG B O   1 
ATOM   3261 C CB  . ARG B 1 62  ? 5.484  -8.453  9.950   1.00 52.73  ? 96   ARG B CB  1 
ATOM   3262 C CG  . ARG B 1 62  ? 6.162  -7.416  9.097   1.00 55.17  ? 96   ARG B CG  1 
ATOM   3263 C CD  . ARG B 1 62  ? 6.568  -6.219  9.923   1.00 56.51  ? 96   ARG B CD  1 
ATOM   3264 N NE  . ARG B 1 62  ? 5.459  -5.306  10.159  1.00 59.97  ? 96   ARG B NE  1 
ATOM   3265 C CZ  . ARG B 1 62  ? 5.442  -4.390  11.124  1.00 60.90  ? 96   ARG B CZ  1 
ATOM   3266 N NH1 . ARG B 1 62  ? 6.475  -4.284  11.935  1.00 60.16  ? 96   ARG B NH1 1 
ATOM   3267 N NH2 . ARG B 1 62  ? 4.400  -3.578  11.278  1.00 61.99  ? 96   ARG B NH2 1 
ATOM   3268 N N   . GLU B 1 63  ? 7.155  -11.010 9.037   1.00 52.25  ? 97   GLU B N   1 
ATOM   3269 C CA  . GLU B 1 63  ? 8.347  -11.549 8.392   1.00 50.94  ? 97   GLU B CA  1 
ATOM   3270 C C   . GLU B 1 63  ? 7.934  -12.527 7.318   1.00 50.24  ? 97   GLU B C   1 
ATOM   3271 O O   . GLU B 1 63  ? 8.434  -12.477 6.199   1.00 49.18  ? 97   GLU B O   1 
ATOM   3272 C CB  . GLU B 1 63  ? 9.228  -12.262 9.415   1.00 53.19  ? 97   GLU B CB  1 
ATOM   3273 C CG  . GLU B 1 63  ? 10.688 -12.443 8.996   1.00 54.55  ? 97   GLU B CG  1 
ATOM   3274 C CD  . GLU B 1 63  ? 11.502 -13.240 10.026  1.00 56.04  ? 97   GLU B CD  1 
ATOM   3275 O OE1 . GLU B 1 63  ? 11.185 -13.140 11.240  1.00 56.39  ? 97   GLU B OE1 1 
ATOM   3276 O OE2 . GLU B 1 63  ? 12.467 -13.944 9.627   1.00 51.97  ? 97   GLU B OE2 1 
ATOM   3277 N N   . LEU B 1 64  ? 7.011  -13.418 7.661   1.00 49.24  ? 98   LEU B N   1 
ATOM   3278 C CA  . LEU B 1 64  ? 6.529  -14.392 6.696   1.00 48.02  ? 98   LEU B CA  1 
ATOM   3279 C C   . LEU B 1 64  ? 5.905  -13.709 5.475   1.00 48.50  ? 98   LEU B C   1 
ATOM   3280 O O   . LEU B 1 64  ? 6.207  -14.072 4.346   1.00 48.09  ? 98   LEU B O   1 
ATOM   3281 C CB  . LEU B 1 64  ? 5.503  -15.320 7.346   1.00 46.20  ? 98   LEU B CB  1 
ATOM   3282 C CG  . LEU B 1 64  ? 4.866  -16.356 6.412   1.00 45.86  ? 98   LEU B CG  1 
ATOM   3283 C CD1 . LEU B 1 64  ? 5.932  -17.276 5.834   1.00 43.89  ? 98   LEU B CD1 1 
ATOM   3284 C CD2 . LEU B 1 64  ? 3.831  -17.154 7.181   1.00 44.09  ? 98   LEU B CD2 1 
ATOM   3285 N N   . GLN B 1 65  ? 5.054  -12.711 5.702   1.00 49.36  ? 99   GLN B N   1 
ATOM   3286 C CA  . GLN B 1 65  ? 4.398  -12.023 4.601   1.00 51.59  ? 99   GLN B CA  1 
ATOM   3287 C C   . GLN B 1 65  ? 5.364  -11.363 3.628   1.00 49.89  ? 99   GLN B C   1 
ATOM   3288 O O   . GLN B 1 65  ? 5.109  -11.303 2.423   1.00 49.83  ? 99   GLN B O   1 
ATOM   3289 C CB  . GLN B 1 65  ? 3.373  -11.000 5.123   1.00 54.65  ? 99   GLN B CB  1 
ATOM   3290 C CG  . GLN B 1 65  ? 2.194  -11.615 5.899   1.00 62.63  ? 99   GLN B CG  1 
ATOM   3291 C CD  . GLN B 1 65  ? 1.676  -12.937 5.292   1.00 68.85  ? 99   GLN B CD  1 
ATOM   3292 O OE1 . GLN B 1 65  ? 1.339  -13.015 4.096   1.00 70.87  ? 99   GLN B OE1 1 
ATOM   3293 N NE2 . GLN B 1 65  ? 1.610  -13.980 6.126   1.00 70.24  ? 99   GLN B NE2 1 
ATOM   3294 N N   . ILE B 1 66  ? 6.475  -10.865 4.149   1.00 49.07  ? 100  ILE B N   1 
ATOM   3295 C CA  . ILE B 1 66  ? 7.490  -10.226 3.315   1.00 47.05  ? 100  ILE B CA  1 
ATOM   3296 C C   . ILE B 1 66  ? 8.300  -11.299 2.562   1.00 47.79  ? 100  ILE B C   1 
ATOM   3297 O O   . ILE B 1 66  ? 8.504  -11.198 1.360   1.00 46.66  ? 100  ILE B O   1 
ATOM   3298 C CB  . ILE B 1 66  ? 8.399  -9.305  4.198   1.00 44.06  ? 100  ILE B CB  1 
ATOM   3299 C CG1 . ILE B 1 66  ? 7.611  -8.034  4.543   1.00 41.30  ? 100  ILE B CG1 1 
ATOM   3300 C CG2 . ILE B 1 66  ? 9.706  -8.981  3.495   1.00 42.89  ? 100  ILE B CG2 1 
ATOM   3301 C CD1 . ILE B 1 66  ? 8.274  -7.103  5.513   1.00 38.40  ? 100  ILE B CD1 1 
ATOM   3302 N N   . MET B 1 67  ? 8.720  -12.346 3.262   1.00 49.64  ? 101  MET B N   1 
ATOM   3303 C CA  . MET B 1 67  ? 9.489  -13.418 2.641   1.00 52.27  ? 101  MET B CA  1 
ATOM   3304 C C   . MET B 1 67  ? 8.780  -14.079 1.458   1.00 52.17  ? 101  MET B C   1 
ATOM   3305 O O   . MET B 1 67  ? 9.420  -14.422 0.466   1.00 50.59  ? 101  MET B O   1 
ATOM   3306 C CB  . MET B 1 67  ? 9.824  -14.491 3.675   1.00 55.28  ? 101  MET B CB  1 
ATOM   3307 C CG  . MET B 1 67  ? 10.696 -14.011 4.820   1.00 59.03  ? 101  MET B CG  1 
ATOM   3308 S SD  . MET B 1 67  ? 12.433 -14.375 4.570   1.00 63.13  ? 101  MET B SD  1 
ATOM   3309 C CE  . MET B 1 67  ? 12.786 -13.290 3.219   1.00 60.52  ? 101  MET B CE  1 
ATOM   3310 N N   . ARG B 1 68  ? 7.467  -14.267 1.567   1.00 52.71  ? 102  ARG B N   1 
ATOM   3311 C CA  . ARG B 1 68  ? 6.697  -14.904 0.505   1.00 52.74  ? 102  ARG B CA  1 
ATOM   3312 C C   . ARG B 1 68  ? 6.631  -14.056 -0.755  1.00 52.03  ? 102  ARG B C   1 
ATOM   3313 O O   . ARG B 1 68  ? 6.518  -14.573 -1.862  1.00 52.19  ? 102  ARG B O   1 
ATOM   3314 C CB  . ARG B 1 68  ? 5.280  -15.210 0.990   1.00 53.52  ? 102  ARG B CB  1 
ATOM   3315 C CG  . ARG B 1 68  ? 5.220  -16.103 2.203   1.00 55.27  ? 102  ARG B CG  1 
ATOM   3316 C CD  . ARG B 1 68  ? 3.829  -16.649 2.396   1.00 56.77  ? 102  ARG B CD  1 
ATOM   3317 N NE  . ARG B 1 68  ? 3.455  -17.542 1.310   1.00 61.85  ? 102  ARG B NE  1 
ATOM   3318 C CZ  . ARG B 1 68  ? 2.265  -18.128 1.195   1.00 64.48  ? 102  ARG B CZ  1 
ATOM   3319 N NH1 . ARG B 1 68  ? 1.325  -17.912 2.109   1.00 63.59  ? 102  ARG B NH1 1 
ATOM   3320 N NH2 . ARG B 1 68  ? 2.013  -18.933 0.163   1.00 64.35  ? 102  ARG B NH2 1 
ATOM   3321 N N   . LYS B 1 69  ? 6.724  -12.749 -0.577  1.00 51.68  ? 103  LYS B N   1 
ATOM   3322 C CA  . LYS B 1 69  ? 6.658  -11.805 -1.678  1.00 52.03  ? 103  LYS B CA  1 
ATOM   3323 C C   . LYS B 1 69  ? 7.998  -11.605 -2.393  1.00 51.82  ? 103  LYS B C   1 
ATOM   3324 O O   . LYS B 1 69  ? 8.053  -10.941 -3.417  1.00 53.64  ? 103  LYS B O   1 
ATOM   3325 C CB  . LYS B 1 69  ? 6.147  -10.465 -1.134  1.00 53.44  ? 103  LYS B CB  1 
ATOM   3326 C CG  . LYS B 1 69  ? 5.947  -9.383  -2.172  1.00 59.42  ? 103  LYS B CG  1 
ATOM   3327 C CD  . LYS B 1 69  ? 5.699  -8.019  -1.524  1.00 62.87  ? 103  LYS B CD  1 
ATOM   3328 C CE  . LYS B 1 69  ? 4.495  -8.025  -0.575  1.00 63.66  ? 103  LYS B CE  1 
ATOM   3329 N NZ  . LYS B 1 69  ? 4.315  -6.678  0.050   1.00 63.52  ? 103  LYS B NZ  1 
ATOM   3330 N N   . LEU B 1 70  ? 9.071  -12.190 -1.867  1.00 51.80  ? 104  LEU B N   1 
ATOM   3331 C CA  . LEU B 1 70  ? 10.416 -12.033 -2.434  1.00 49.03  ? 104  LEU B CA  1 
ATOM   3332 C C   . LEU B 1 70  ? 10.999 -13.217 -3.214  1.00 48.51  ? 104  LEU B C   1 
ATOM   3333 O O   . LEU B 1 70  ? 10.934 -14.363 -2.776  1.00 47.22  ? 104  LEU B O   1 
ATOM   3334 C CB  . LEU B 1 70  ? 11.380 -11.681 -1.309  1.00 48.12  ? 104  LEU B CB  1 
ATOM   3335 C CG  . LEU B 1 70  ? 11.006 -10.441 -0.515  1.00 47.99  ? 104  LEU B CG  1 
ATOM   3336 C CD1 . LEU B 1 70  ? 12.049 -10.178 0.567   1.00 48.71  ? 104  LEU B CD1 1 
ATOM   3337 C CD2 . LEU B 1 70  ? 10.905 -9.278  -1.457  1.00 46.06  ? 104  LEU B CD2 1 
ATOM   3338 N N   . ASP B 1 71  ? 11.589 -12.926 -4.367  1.00 48.22  ? 105  ASP B N   1 
ATOM   3339 C CA  . ASP B 1 71  ? 12.205 -13.962 -5.189  1.00 50.36  ? 105  ASP B CA  1 
ATOM   3340 C C   . ASP B 1 71  ? 13.392 -13.333 -5.908  1.00 50.12  ? 105  ASP B C   1 
ATOM   3341 O O   . ASP B 1 71  ? 13.253 -12.833 -7.025  1.00 50.58  ? 105  ASP B O   1 
ATOM   3342 C CB  . ASP B 1 71  ? 11.201 -14.501 -6.209  1.00 53.45  ? 105  ASP B CB  1 
ATOM   3343 C CG  . ASP B 1 71  ? 11.769 -15.629 -7.060  1.00 56.76  ? 105  ASP B CG  1 
ATOM   3344 O OD1 . ASP B 1 71  ? 11.368 -15.727 -8.244  1.00 59.69  ? 105  ASP B OD1 1 
ATOM   3345 O OD2 . ASP B 1 71  ? 12.592 -16.424 -6.552  1.00 58.38  ? 105  ASP B OD2 1 
ATOM   3346 N N   . HIS B 1 72  ? 14.559 -13.360 -5.268  1.00 47.59  ? 106  HIS B N   1 
ATOM   3347 C CA  . HIS B 1 72  ? 15.751 -12.748 -5.844  1.00 45.11  ? 106  HIS B CA  1 
ATOM   3348 C C   . HIS B 1 72  ? 16.980 -13.580 -5.508  1.00 44.93  ? 106  HIS B C   1 
ATOM   3349 O O   . HIS B 1 72  ? 17.096 -14.116 -4.411  1.00 45.20  ? 106  HIS B O   1 
ATOM   3350 C CB  . HIS B 1 72  ? 15.901 -11.326 -5.295  1.00 44.87  ? 106  HIS B CB  1 
ATOM   3351 C CG  . HIS B 1 72  ? 16.954 -10.517 -5.976  1.00 43.99  ? 106  HIS B CG  1 
ATOM   3352 N ND1 . HIS B 1 72  ? 16.681 -9.697  -7.053  1.00 44.62  ? 106  HIS B ND1 1 
ATOM   3353 C CD2 . HIS B 1 72  ? 18.278 -10.380 -5.730  1.00 42.29  ? 106  HIS B CD2 1 
ATOM   3354 C CE1 . HIS B 1 72  ? 17.787 -9.089  -7.434  1.00 43.09  ? 106  HIS B CE1 1 
ATOM   3355 N NE2 . HIS B 1 72  ? 18.774 -9.485  -6.647  1.00 44.27  ? 106  HIS B NE2 1 
ATOM   3356 N N   . CYS B 1 73  ? 17.905 -13.680 -6.450  1.00 46.11  ? 107  CYS B N   1 
ATOM   3357 C CA  . CYS B 1 73  ? 19.094 -14.484 -6.233  1.00 46.43  ? 107  CYS B CA  1 
ATOM   3358 C C   . CYS B 1 73  ? 20.043 -13.965 -5.179  1.00 44.47  ? 107  CYS B C   1 
ATOM   3359 O O   . CYS B 1 73  ? 20.923 -14.688 -4.732  1.00 45.25  ? 107  CYS B O   1 
ATOM   3360 C CB  . CYS B 1 73  ? 19.810 -14.722 -7.562  1.00 49.25  ? 107  CYS B CB  1 
ATOM   3361 S SG  . CYS B 1 73  ? 19.026 -16.090 -8.474  1.00 54.54  ? 107  CYS B SG  1 
ATOM   3362 N N   . ASN B 1 74  ? 19.851 -12.721 -4.759  1.00 42.20  ? 108  ASN B N   1 
ATOM   3363 C CA  . ASN B 1 74  ? 20.699 -12.158 -3.714  1.00 40.01  ? 108  ASN B CA  1 
ATOM   3364 C C   . ASN B 1 74  ? 19.935 -12.012 -2.409  1.00 38.13  ? 108  ASN B C   1 
ATOM   3365 O O   . ASN B 1 74  ? 20.280 -11.197 -1.560  1.00 37.88  ? 108  ASN B O   1 
ATOM   3366 C CB  . ASN B 1 74  ? 21.274 -10.811 -4.148  1.00 38.73  ? 108  ASN B CB  1 
ATOM   3367 C CG  . ASN B 1 74  ? 22.243 -10.950 -5.289  1.00 38.53  ? 108  ASN B CG  1 
ATOM   3368 O OD1 . ASN B 1 74  ? 23.182 -11.729 -5.211  1.00 39.10  ? 108  ASN B OD1 1 
ATOM   3369 N ND2 . ASN B 1 74  ? 22.023 -10.199 -6.357  1.00 38.47  ? 108  ASN B ND2 1 
ATOM   3370 N N   . ILE B 1 75  ? 18.883 -12.806 -2.265  1.00 37.64  ? 109  ILE B N   1 
ATOM   3371 C CA  . ILE B 1 75  ? 18.069 -12.789 -1.061  1.00 39.18  ? 109  ILE B CA  1 
ATOM   3372 C C   . ILE B 1 75  ? 17.822 -14.224 -0.647  1.00 40.00  ? 109  ILE B C   1 
ATOM   3373 O O   . ILE B 1 75  ? 17.505 -15.062 -1.486  1.00 40.61  ? 109  ILE B O   1 
ATOM   3374 C CB  . ILE B 1 75  ? 16.733 -12.049 -1.297  1.00 38.54  ? 109  ILE B CB  1 
ATOM   3375 C CG1 . ILE B 1 75  ? 17.026 -10.568 -1.547  1.00 39.47  ? 109  ILE B CG1 1 
ATOM   3376 C CG2 . ILE B 1 75  ? 15.810 -12.222 -0.098  1.00 36.75  ? 109  ILE B CG2 1 
ATOM   3377 C CD1 . ILE B 1 75  ? 15.830 -9.690  -1.668  1.00 42.55  ? 109  ILE B CD1 1 
ATOM   3378 N N   . VAL B 1 76  ? 18.012 -14.527 0.632   1.00 41.09  ? 110  VAL B N   1 
ATOM   3379 C CA  . VAL B 1 76  ? 17.808 -15.896 1.086   1.00 43.50  ? 110  VAL B CA  1 
ATOM   3380 C C   . VAL B 1 76  ? 16.370 -16.248 0.778   1.00 43.26  ? 110  VAL B C   1 
ATOM   3381 O O   . VAL B 1 76  ? 15.474 -15.447 0.996   1.00 45.06  ? 110  VAL B O   1 
ATOM   3382 C CB  . VAL B 1 76  ? 18.111 -16.070 2.615   1.00 44.03  ? 110  VAL B CB  1 
ATOM   3383 C CG1 . VAL B 1 76  ? 17.184 -15.192 3.460   1.00 47.02  ? 110  VAL B CG1 1 
ATOM   3384 C CG2 . VAL B 1 76  ? 17.953 -17.515 2.997   1.00 45.22  ? 110  VAL B CG2 1 
ATOM   3385 N N   . ARG B 1 77  ? 16.146 -17.437 0.245   1.00 45.65  ? 111  ARG B N   1 
ATOM   3386 C CA  . ARG B 1 77  ? 14.794 -17.813 -0.098  1.00 47.89  ? 111  ARG B CA  1 
ATOM   3387 C C   . ARG B 1 77  ? 14.119 -18.698 0.915   1.00 46.01  ? 111  ARG B C   1 
ATOM   3388 O O   . ARG B 1 77  ? 14.740 -19.547 1.545   1.00 45.65  ? 111  ARG B O   1 
ATOM   3389 C CB  . ARG B 1 77  ? 14.746 -18.482 -1.477  1.00 53.60  ? 111  ARG B CB  1 
ATOM   3390 C CG  . ARG B 1 77  ? 15.096 -19.958 -1.513  1.00 61.34  ? 111  ARG B CG  1 
ATOM   3391 C CD  . ARG B 1 77  ? 14.907 -20.494 -2.928  1.00 67.66  ? 111  ARG B CD  1 
ATOM   3392 N NE  . ARG B 1 77  ? 13.571 -20.183 -3.424  1.00 74.29  ? 111  ARG B NE  1 
ATOM   3393 C CZ  . ARG B 1 77  ? 13.190 -20.295 -4.696  1.00 79.26  ? 111  ARG B CZ  1 
ATOM   3394 N NH1 . ARG B 1 77  ? 14.046 -20.714 -5.628  1.00 80.89  ? 111  ARG B NH1 1 
ATOM   3395 N NH2 . ARG B 1 77  ? 11.945 -19.983 -5.044  1.00 81.28  ? 111  ARG B NH2 1 
ATOM   3396 N N   . LEU B 1 78  ? 12.828 -18.467 1.075   1.00 46.38  ? 112  LEU B N   1 
ATOM   3397 C CA  . LEU B 1 78  ? 12.013 -19.250 1.979   1.00 47.56  ? 112  LEU B CA  1 
ATOM   3398 C C   . LEU B 1 78  ? 11.578 -20.448 1.145   1.00 48.09  ? 112  LEU B C   1 
ATOM   3399 O O   . LEU B 1 78  ? 10.837 -20.296 0.179   1.00 47.93  ? 112  LEU B O   1 
ATOM   3400 C CB  . LEU B 1 78  ? 10.802 -18.431 2.415   1.00 47.07  ? 112  LEU B CB  1 
ATOM   3401 C CG  . LEU B 1 78  ? 9.799  -19.074 3.377   1.00 48.35  ? 112  LEU B CG  1 
ATOM   3402 C CD1 . LEU B 1 78  ? 10.400 -19.302 4.750   1.00 47.29  ? 112  LEU B CD1 1 
ATOM   3403 C CD2 . LEU B 1 78  ? 8.597  -18.157 3.479   1.00 49.45  ? 112  LEU B CD2 1 
ATOM   3404 N N   . ARG B 1 79  ? 12.066 -21.630 1.489   1.00 49.14  ? 113  ARG B N   1 
ATOM   3405 C CA  . ARG B 1 79  ? 11.703 -22.819 0.739   1.00 51.93  ? 113  ARG B CA  1 
ATOM   3406 C C   . ARG B 1 79  ? 10.300 -23.272 1.132   1.00 52.73  ? 113  ARG B C   1 
ATOM   3407 O O   . ARG B 1 79  ? 9.451  -23.477 0.274   1.00 52.60  ? 113  ARG B O   1 
ATOM   3408 C CB  . ARG B 1 79  ? 12.706 -23.932 1.007   1.00 55.29  ? 113  ARG B CB  1 
ATOM   3409 C CG  . ARG B 1 79  ? 14.030 -23.783 0.287   1.00 59.15  ? 113  ARG B CG  1 
ATOM   3410 C CD  . ARG B 1 79  ? 15.089 -24.568 1.036   1.00 65.82  ? 113  ARG B CD  1 
ATOM   3411 N NE  . ARG B 1 79  ? 16.124 -25.122 0.167   1.00 70.33  ? 113  ARG B NE  1 
ATOM   3412 C CZ  . ARG B 1 79  ? 15.909 -26.080 -0.728  1.00 72.80  ? 113  ARG B CZ  1 
ATOM   3413 N NH1 . ARG B 1 79  ? 14.692 -26.596 -0.884  1.00 73.59  ? 113  ARG B NH1 1 
ATOM   3414 N NH2 . ARG B 1 79  ? 16.918 -26.537 -1.451  1.00 74.40  ? 113  ARG B NH2 1 
ATOM   3415 N N   . TYR B 1 80  ? 10.071 -23.423 2.433   1.00 53.22  ? 114  TYR B N   1 
ATOM   3416 C CA  . TYR B 1 80  ? 8.782  -23.835 2.966   1.00 54.20  ? 114  TYR B CA  1 
ATOM   3417 C C   . TYR B 1 80  ? 8.545  -23.135 4.295   1.00 54.45  ? 114  TYR B C   1 
ATOM   3418 O O   . TYR B 1 80  ? 9.380  -22.372 4.769   1.00 54.62  ? 114  TYR B O   1 
ATOM   3419 C CB  . TYR B 1 80  ? 8.740  -25.347 3.226   1.00 55.03  ? 114  TYR B CB  1 
ATOM   3420 C CG  . TYR B 1 80  ? 9.175  -26.212 2.077   1.00 56.95  ? 114  TYR B CG  1 
ATOM   3421 C CD1 . TYR B 1 80  ? 10.490 -26.661 1.980   1.00 56.99  ? 114  TYR B CD1 1 
ATOM   3422 C CD2 . TYR B 1 80  ? 8.279  -26.572 1.070   1.00 57.08  ? 114  TYR B CD2 1 
ATOM   3423 C CE1 . TYR B 1 80  ? 10.900 -27.446 0.908   1.00 57.64  ? 114  TYR B CE1 1 
ATOM   3424 C CE2 . TYR B 1 80  ? 8.686  -27.354 -0.009  1.00 57.28  ? 114  TYR B CE2 1 
ATOM   3425 C CZ  . TYR B 1 80  ? 9.995  -27.786 -0.083  1.00 57.56  ? 114  TYR B CZ  1 
ATOM   3426 O OH  . TYR B 1 80  ? 10.400 -28.542 -1.159  1.00 58.75  ? 114  TYR B OH  1 
ATOM   3427 N N   . PHE B 1 81  ? 7.401  -23.416 4.901   1.00 54.70  ? 115  PHE B N   1 
ATOM   3428 C CA  . PHE B 1 81  ? 7.069  -22.859 6.201   1.00 54.61  ? 115  PHE B CA  1 
ATOM   3429 C C   . PHE B 1 81  ? 5.880  -23.639 6.722   1.00 55.14  ? 115  PHE B C   1 
ATOM   3430 O O   . PHE B 1 81  ? 4.980  -23.979 5.964   1.00 56.51  ? 115  PHE B O   1 
ATOM   3431 C CB  . PHE B 1 81  ? 6.773  -21.358 6.093   1.00 53.51  ? 115  PHE B CB  1 
ATOM   3432 C CG  . PHE B 1 81  ? 5.457  -21.024 5.455   1.00 53.25  ? 115  PHE B CG  1 
ATOM   3433 C CD1 . PHE B 1 81  ? 4.316  -20.853 6.236   1.00 52.39  ? 115  PHE B CD1 1 
ATOM   3434 C CD2 . PHE B 1 81  ? 5.368  -20.813 4.081   1.00 53.03  ? 115  PHE B CD2 1 
ATOM   3435 C CE1 . PHE B 1 81  ? 3.110  -20.470 5.659   1.00 51.27  ? 115  PHE B CE1 1 
ATOM   3436 C CE2 . PHE B 1 81  ? 4.156  -20.428 3.491   1.00 52.01  ? 115  PHE B CE2 1 
ATOM   3437 C CZ  . PHE B 1 81  ? 3.033  -20.256 4.280   1.00 51.57  ? 115  PHE B CZ  1 
ATOM   3438 N N   . PHE B 1 82  ? 5.895  -23.948 8.010   1.00 55.09  ? 116  PHE B N   1 
ATOM   3439 C CA  . PHE B 1 82  ? 4.820  -24.710 8.611   1.00 56.47  ? 116  PHE B CA  1 
ATOM   3440 C C   . PHE B 1 82  ? 4.671  -24.342 10.072  1.00 58.21  ? 116  PHE B C   1 
ATOM   3441 O O   . PHE B 1 82  ? 5.486  -23.598 10.604  1.00 59.01  ? 116  PHE B O   1 
ATOM   3442 C CB  . PHE B 1 82  ? 5.128  -26.193 8.494   1.00 55.62  ? 116  PHE B CB  1 
ATOM   3443 C CG  . PHE B 1 82  ? 6.412  -26.592 9.145   1.00 54.50  ? 116  PHE B CG  1 
ATOM   3444 C CD1 . PHE B 1 82  ? 6.436  -27.024 10.464  1.00 54.63  ? 116  PHE B CD1 1 
ATOM   3445 C CD2 . PHE B 1 82  ? 7.608  -26.541 8.433   1.00 55.78  ? 116  PHE B CD2 1 
ATOM   3446 C CE1 . PHE B 1 82  ? 7.647  -27.403 11.071  1.00 55.85  ? 116  PHE B CE1 1 
ATOM   3447 C CE2 . PHE B 1 82  ? 8.824  -26.915 9.022   1.00 54.17  ? 116  PHE B CE2 1 
ATOM   3448 C CZ  . PHE B 1 82  ? 8.841  -27.349 10.344  1.00 56.01  ? 116  PHE B CZ  1 
ATOM   3449 N N   . TYR B 1 83  ? 3.635  -24.864 10.723  1.00 59.44  ? 117  TYR B N   1 
ATOM   3450 C CA  . TYR B 1 83  ? 3.427  -24.576 12.131  1.00 60.09  ? 117  TYR B CA  1 
ATOM   3451 C C   . TYR B 1 83  ? 3.584  -25.821 12.983  1.00 63.59  ? 117  TYR B C   1 
ATOM   3452 O O   . TYR B 1 83  ? 3.502  -26.934 12.478  1.00 63.31  ? 117  TYR B O   1 
ATOM   3453 C CB  . TYR B 1 83  ? 2.050  -23.959 12.344  1.00 56.53  ? 117  TYR B CB  1 
ATOM   3454 C CG  . TYR B 1 83  ? 1.860  -22.655 11.610  1.00 53.72  ? 117  TYR B CG  1 
ATOM   3455 C CD1 . TYR B 1 83  ? 1.542  -22.632 10.253  1.00 52.57  ? 117  TYR B CD1 1 
ATOM   3456 C CD2 . TYR B 1 83  ? 1.992  -21.443 12.271  1.00 51.61  ? 117  TYR B CD2 1 
ATOM   3457 C CE1 . TYR B 1 83  ? 1.355  -21.428 9.580   1.00 50.60  ? 117  TYR B CE1 1 
ATOM   3458 C CE2 . TYR B 1 83  ? 1.808  -20.242 11.607  1.00 50.13  ? 117  TYR B CE2 1 
ATOM   3459 C CZ  . TYR B 1 83  ? 1.489  -20.245 10.267  1.00 49.93  ? 117  TYR B CZ  1 
ATOM   3460 O OH  . TYR B 1 83  ? 1.287  -19.064 9.615   1.00 50.75  ? 117  TYR B OH  1 
ATOM   3461 N N   . SER B 1 84  ? 3.835  -25.626 14.273  1.00 68.99  ? 118  SER B N   1 
ATOM   3462 C CA  . SER B 1 84  ? 3.997  -26.744 15.195  1.00 74.97  ? 118  SER B CA  1 
ATOM   3463 C C   . SER B 1 84  ? 3.889  -26.274 16.636  1.00 79.30  ? 118  SER B C   1 
ATOM   3464 O O   . SER B 1 84  ? 4.653  -25.423 17.076  1.00 81.21  ? 118  SER B O   1 
ATOM   3465 C CB  . SER B 1 84  ? 5.346  -27.439 14.979  1.00 74.32  ? 118  SER B CB  1 
ATOM   3466 O OG  . SER B 1 84  ? 6.433  -26.601 15.322  1.00 73.31  ? 118  SER B OG  1 
ATOM   3467 N N   . SER B 1 85  ? 2.932  -26.829 17.370  1.00 85.10  ? 119  SER B N   1 
ATOM   3468 C CA  . SER B 1 85  ? 2.743  -26.447 18.760  1.00 90.15  ? 119  SER B CA  1 
ATOM   3469 C C   . SER B 1 85  ? 4.003  -26.725 19.576  1.00 93.87  ? 119  SER B C   1 
ATOM   3470 O O   . SER B 1 85  ? 4.710  -27.713 19.346  1.00 93.45  ? 119  SER B O   1 
ATOM   3471 C CB  . SER B 1 85  ? 1.540  -27.188 19.351  1.00 89.63  ? 119  SER B CB  1 
ATOM   3472 O OG  . SER B 1 85  ? 1.541  -28.544 18.952  1.00 90.89  ? 119  SER B OG  1 
ATOM   3473 N N   . GLY B 1 86  ? 4.285  -25.831 20.519  1.00 97.88  ? 120  GLY B N   1 
ATOM   3474 C CA  . GLY B 1 86  ? 5.460  -25.981 21.356  1.00 102.53 ? 120  GLY B CA  1 
ATOM   3475 C C   . GLY B 1 86  ? 5.116  -26.461 22.750  1.00 105.58 ? 120  GLY B C   1 
ATOM   3476 O O   . GLY B 1 86  ? 4.695  -27.605 22.933  1.00 106.30 ? 120  GLY B O   1 
ATOM   3477 N N   . GLU B 1 87  ? 5.293  -25.588 23.737  1.00 108.18 ? 121  GLU B N   1 
ATOM   3478 C CA  . GLU B 1 87  ? 4.999  -25.940 25.120  1.00 110.45 ? 121  GLU B CA  1 
ATOM   3479 C C   . GLU B 1 87  ? 5.018  -24.697 26.003  1.00 111.53 ? 121  GLU B C   1 
ATOM   3480 O O   . GLU B 1 87  ? 4.895  -23.568 25.509  1.00 111.44 ? 121  GLU B O   1 
ATOM   3481 C CB  . GLU B 1 87  ? 6.028  -26.951 25.640  1.00 110.63 ? 121  GLU B CB  1 
ATOM   3482 C CG  . GLU B 1 87  ? 5.426  -28.048 26.498  1.00 111.52 ? 121  GLU B CG  1 
ATOM   3483 C CD  . GLU B 1 87  ? 4.552  -28.995 25.693  1.00 112.04 ? 121  GLU B CD  1 
ATOM   3484 O OE1 . GLU B 1 87  ? 5.102  -29.764 24.873  1.00 111.36 ? 121  GLU B OE1 1 
ATOM   3485 O OE2 . GLU B 1 87  ? 3.314  -28.956 25.869  1.00 112.85 ? 121  GLU B OE2 1 
ATOM   3486 N N   . LYS B 1 88  ? 5.179  -24.925 27.308  1.00 112.46 ? 122  LYS B N   1 
ATOM   3487 C CA  . LYS B 1 88  ? 5.227  -23.871 28.327  1.00 113.25 ? 122  LYS B CA  1 
ATOM   3488 C C   . LYS B 1 88  ? 3.856  -23.212 28.507  1.00 113.24 ? 122  LYS B C   1 
ATOM   3489 O O   . LYS B 1 88  ? 3.609  -22.518 29.501  1.00 112.97 ? 122  LYS B O   1 
ATOM   3490 C CB  . LYS B 1 88  ? 6.277  -22.807 27.958  1.00 113.49 ? 122  LYS B CB  1 
ATOM   3491 C CG  . LYS B 1 88  ? 6.669  -21.883 29.114  1.00 113.57 ? 122  LYS B CG  1 
ATOM   3492 C CD  . LYS B 1 88  ? 7.395  -22.645 30.226  1.00 113.20 ? 122  LYS B CD  1 
ATOM   3493 C CE  . LYS B 1 88  ? 7.663  -21.753 31.430  1.00 112.95 ? 122  LYS B CE  1 
ATOM   3494 N NZ  . LYS B 1 88  ? 8.428  -20.529 31.056  1.00 113.00 ? 122  LYS B NZ  1 
ATOM   3495 N N   . LYS B 1 89  ? 2.971  -23.450 27.539  1.00 112.81 ? 123  LYS B N   1 
ATOM   3496 C CA  . LYS B 1 89  ? 1.620  -22.892 27.542  1.00 112.10 ? 123  LYS B CA  1 
ATOM   3497 C C   . LYS B 1 89  ? 0.905  -23.344 26.254  1.00 111.44 ? 123  LYS B C   1 
ATOM   3498 O O   . LYS B 1 89  ? -0.125 -22.777 25.867  1.00 111.87 ? 123  LYS B O   1 
ATOM   3499 C CB  . LYS B 1 89  ? 1.700  -21.353 27.606  1.00 111.80 ? 123  LYS B CB  1 
ATOM   3500 C CG  . LYS B 1 89  ? 0.484  -20.650 28.211  1.00 111.44 ? 123  LYS B CG  1 
ATOM   3501 C CD  . LYS B 1 89  ? 0.734  -19.151 28.365  1.00 110.86 ? 123  LYS B CD  1 
ATOM   3502 C CE  . LYS B 1 89  ? -0.426 -18.451 29.068  1.00 110.33 ? 123  LYS B CE  1 
ATOM   3503 N NZ  . LYS B 1 89  ? -0.212 -16.979 29.195  1.00 109.04 ? 123  LYS B NZ  1 
ATOM   3504 N N   . ASP B 1 90  ? 1.452  -24.376 25.605  1.00 109.87 ? 124  ASP B N   1 
ATOM   3505 C CA  . ASP B 1 90  ? 0.902  -24.897 24.348  1.00 107.85 ? 124  ASP B CA  1 
ATOM   3506 C C   . ASP B 1 90  ? 0.782  -23.776 23.327  1.00 105.69 ? 124  ASP B C   1 
ATOM   3507 O O   . ASP B 1 90  ? -0.317 -23.407 22.900  1.00 105.14 ? 124  ASP B O   1 
ATOM   3508 C CB  . ASP B 1 90  ? -0.461 -25.549 24.576  1.00 108.75 ? 124  ASP B CB  1 
ATOM   3509 C CG  . ASP B 1 90  ? -0.357 -26.829 25.370  1.00 109.71 ? 124  ASP B CG  1 
ATOM   3510 O OD1 . ASP B 1 90  ? 0.454  -27.702 24.980  1.00 109.94 ? 124  ASP B OD1 1 
ATOM   3511 O OD2 . ASP B 1 90  ? -1.089 -26.969 26.374  1.00 109.80 ? 124  ASP B OD2 1 
ATOM   3512 N N   . GLU B 1 91  ? 1.943  -23.244 22.953  1.00 103.08 ? 125  GLU B N   1 
ATOM   3513 C CA  . GLU B 1 91  ? 2.053  -22.150 22.001  1.00 99.36  ? 125  GLU B CA  1 
ATOM   3514 C C   . GLU B 1 91  ? 2.158  -22.666 20.571  1.00 96.47  ? 125  GLU B C   1 
ATOM   3515 O O   . GLU B 1 91  ? 2.503  -23.825 20.334  1.00 95.68  ? 125  GLU B O   1 
ATOM   3516 C CB  . GLU B 1 91  ? 3.292  -21.313 22.327  1.00 100.72 ? 125  GLU B CB  1 
ATOM   3517 C CG  . GLU B 1 91  ? 3.315  -20.718 23.730  1.00 101.93 ? 125  GLU B CG  1 
ATOM   3518 C CD  . GLU B 1 91  ? 2.258  -19.649 23.931  1.00 103.11 ? 125  GLU B CD  1 
ATOM   3519 O OE1 . GLU B 1 91  ? 2.304  -18.624 23.218  1.00 103.41 ? 125  GLU B OE1 1 
ATOM   3520 O OE2 . GLU B 1 91  ? 1.381  -19.835 24.801  1.00 103.84 ? 125  GLU B OE2 1 
ATOM   3521 N N   . VAL B 1 92  ? 1.859  -21.788 19.622  1.00 92.92  ? 126  VAL B N   1 
ATOM   3522 C CA  . VAL B 1 92  ? 1.923  -22.122 18.207  1.00 88.73  ? 126  VAL B CA  1 
ATOM   3523 C C   . VAL B 1 92  ? 3.239  -21.553 17.664  1.00 85.45  ? 126  VAL B C   1 
ATOM   3524 O O   . VAL B 1 92  ? 3.507  -20.356 17.786  1.00 84.61  ? 126  VAL B O   1 
ATOM   3525 C CB  . VAL B 1 92  ? 0.720  -21.501 17.449  1.00 88.84  ? 126  VAL B CB  1 
ATOM   3526 C CG1 . VAL B 1 92  ? 0.749  -21.894 15.981  1.00 88.21  ? 126  VAL B CG1 1 
ATOM   3527 C CG2 . VAL B 1 92  ? -0.579 -21.953 18.097  1.00 88.47  ? 126  VAL B CG2 1 
ATOM   3528 N N   . TYR B 1 93  ? 4.067  -22.415 17.084  1.00 81.15  ? 127  TYR B N   1 
ATOM   3529 C CA  . TYR B 1 93  ? 5.344  -21.979 16.527  1.00 77.39  ? 127  TYR B CA  1 
ATOM   3530 C C   . TYR B 1 93  ? 5.320  -21.924 15.008  1.00 72.91  ? 127  TYR B C   1 
ATOM   3531 O O   . TYR B 1 93  ? 4.804  -22.825 14.360  1.00 71.49  ? 127  TYR B O   1 
ATOM   3532 C CB  . TYR B 1 93  ? 6.472  -22.915 16.980  1.00 79.96  ? 127  TYR B CB  1 
ATOM   3533 C CG  . TYR B 1 93  ? 6.850  -22.779 18.436  1.00 83.65  ? 127  TYR B CG  1 
ATOM   3534 C CD1 . TYR B 1 93  ? 7.489  -23.819 19.110  1.00 85.18  ? 127  TYR B CD1 1 
ATOM   3535 C CD2 . TYR B 1 93  ? 6.565  -21.611 19.146  1.00 86.14  ? 127  TYR B CD2 1 
ATOM   3536 C CE1 . TYR B 1 93  ? 7.830  -23.700 20.458  1.00 86.90  ? 127  TYR B CE1 1 
ATOM   3537 C CE2 . TYR B 1 93  ? 6.902  -21.482 20.492  1.00 86.64  ? 127  TYR B CE2 1 
ATOM   3538 C CZ  . TYR B 1 93  ? 7.532  -22.531 21.141  1.00 87.29  ? 127  TYR B CZ  1 
ATOM   3539 O OH  . TYR B 1 93  ? 7.849  -22.416 22.476  1.00 88.62  ? 127  TYR B OH  1 
ATOM   3540 N N   . LEU B 1 94  ? 5.874  -20.854 14.448  1.00 68.56  ? 128  LEU B N   1 
ATOM   3541 C CA  . LEU B 1 94  ? 5.958  -20.691 12.999  1.00 64.10  ? 128  LEU B CA  1 
ATOM   3542 C C   . LEU B 1 94  ? 7.378  -21.063 12.580  1.00 61.86  ? 128  LEU B C   1 
ATOM   3543 O O   . LEU B 1 94  ? 8.331  -20.405 12.976  1.00 61.76  ? 128  LEU B O   1 
ATOM   3544 C CB  . LEU B 1 94  ? 5.680  -19.242 12.607  1.00 63.11  ? 128  LEU B CB  1 
ATOM   3545 C CG  . LEU B 1 94  ? 6.000  -18.855 11.162  1.00 62.85  ? 128  LEU B CG  1 
ATOM   3546 C CD1 . LEU B 1 94  ? 5.173  -19.683 10.193  1.00 62.42  ? 128  LEU B CD1 1 
ATOM   3547 C CD2 . LEU B 1 94  ? 5.721  -17.379 10.961  1.00 63.35  ? 128  LEU B CD2 1 
ATOM   3548 N N   . ASN B 1 95  ? 7.523  -22.124 11.795  1.00 59.20  ? 129  ASN B N   1 
ATOM   3549 C CA  . ASN B 1 95  ? 8.841  -22.555 11.343  1.00 56.35  ? 129  ASN B CA  1 
ATOM   3550 C C   . ASN B 1 95  ? 9.111  -22.083 9.918   1.00 54.78  ? 129  ASN B C   1 
ATOM   3551 O O   . ASN B 1 95  ? 8.339  -22.376 9.013   1.00 54.11  ? 129  ASN B O   1 
ATOM   3552 C CB  . ASN B 1 95  ? 8.951  -24.078 11.365  1.00 55.89  ? 129  ASN B CB  1 
ATOM   3553 C CG  . ASN B 1 95  ? 8.480  -24.679 12.660  1.00 55.58  ? 129  ASN B CG  1 
ATOM   3554 O OD1 . ASN B 1 95  ? 7.302  -24.612 12.989  1.00 56.05  ? 129  ASN B OD1 1 
ATOM   3555 N ND2 . ASN B 1 95  ? 9.399  -25.280 13.404  1.00 54.18  ? 129  ASN B ND2 1 
ATOM   3556 N N   . LEU B 1 96  ? 10.209 -21.359 9.721   1.00 52.63  ? 130  LEU B N   1 
ATOM   3557 C CA  . LEU B 1 96  ? 10.575 -20.873 8.399   1.00 51.01  ? 130  LEU B CA  1 
ATOM   3558 C C   . LEU B 1 96  ? 11.754 -21.682 7.882   1.00 50.68  ? 130  LEU B C   1 
ATOM   3559 O O   . LEU B 1 96  ? 12.847 -21.598 8.440   1.00 50.51  ? 130  LEU B O   1 
ATOM   3560 C CB  . LEU B 1 96  ? 10.964 -19.397 8.454   1.00 50.15  ? 130  LEU B CB  1 
ATOM   3561 C CG  . LEU B 1 96  ? 9.909  -18.456 9.015   1.00 49.91  ? 130  LEU B CG  1 
ATOM   3562 C CD1 . LEU B 1 96  ? 10.465 -17.055 9.063   1.00 49.65  ? 130  LEU B CD1 1 
ATOM   3563 C CD2 . LEU B 1 96  ? 8.662  -18.503 8.151   1.00 52.13  ? 130  LEU B CD2 1 
ATOM   3564 N N   . VAL B 1 97  ? 11.528 -22.468 6.829   1.00 49.17  ? 131  VAL B N   1 
ATOM   3565 C CA  . VAL B 1 97  ? 12.583 -23.288 6.243   1.00 47.53  ? 131  VAL B CA  1 
ATOM   3566 C C   . VAL B 1 97  ? 13.300 -22.509 5.168   1.00 47.27  ? 131  VAL B C   1 
ATOM   3567 O O   . VAL B 1 97  ? 12.867 -22.455 4.021   1.00 45.57  ? 131  VAL B O   1 
ATOM   3568 C CB  . VAL B 1 97  ? 12.032 -24.579 5.624   1.00 47.41  ? 131  VAL B CB  1 
ATOM   3569 C CG1 . VAL B 1 97  ? 13.166 -25.399 5.023   1.00 45.82  ? 131  VAL B CG1 1 
ATOM   3570 C CG2 . VAL B 1 97  ? 11.305 -25.384 6.683   1.00 48.35  ? 131  VAL B CG2 1 
ATOM   3571 N N   . LEU B 1 98  ? 14.420 -21.915 5.557   1.00 49.20  ? 132  LEU B N   1 
ATOM   3572 C CA  . LEU B 1 98  ? 15.231 -21.101 4.656   1.00 49.83  ? 132  LEU B CA  1 
ATOM   3573 C C   . LEU B 1 98  ? 16.442 -21.869 4.151   1.00 50.41  ? 132  LEU B C   1 
ATOM   3574 O O   . LEU B 1 98  ? 16.839 -22.875 4.732   1.00 50.03  ? 132  LEU B O   1 
ATOM   3575 C CB  . LEU B 1 98  ? 15.702 -19.852 5.404   1.00 47.38  ? 132  LEU B CB  1 
ATOM   3576 C CG  . LEU B 1 98  ? 14.608 -19.021 6.068   1.00 47.33  ? 132  LEU B CG  1 
ATOM   3577 C CD1 . LEU B 1 98  ? 15.174 -18.343 7.293   1.00 45.90  ? 132  LEU B CD1 1 
ATOM   3578 C CD2 . LEU B 1 98  ? 14.035 -18.015 5.076   1.00 45.76  ? 132  LEU B CD2 1 
ATOM   3579 N N   . ASP B 1 99  ? 17.023 -21.396 3.058   1.00 52.57  ? 133  ASP B N   1 
ATOM   3580 C CA  . ASP B 1 99  ? 18.223 -22.032 2.530   1.00 54.93  ? 133  ASP B CA  1 
ATOM   3581 C C   . ASP B 1 99  ? 19.351 -21.817 3.530   1.00 55.09  ? 133  ASP B C   1 
ATOM   3582 O O   . ASP B 1 99  ? 19.380 -20.796 4.229   1.00 54.75  ? 133  ASP B O   1 
ATOM   3583 C CB  . ASP B 1 99  ? 18.627 -21.426 1.187   1.00 55.35  ? 133  ASP B CB  1 
ATOM   3584 C CG  . ASP B 1 99  ? 18.114 -22.230 0.017   1.00 58.18  ? 133  ASP B CG  1 
ATOM   3585 O OD1 . ASP B 1 99  ? 18.189 -23.481 0.065   1.00 60.37  ? 133  ASP B OD1 1 
ATOM   3586 O OD2 . ASP B 1 99  ? 17.653 -21.623 -0.968  1.00 58.42  ? 133  ASP B OD2 1 
ATOM   3587 N N   . TYR B 1 100 ? 20.274 -22.774 3.592   1.00 56.10  ? 134  TYR B N   1 
ATOM   3588 C CA  . TYR B 1 100 ? 21.420 -22.698 4.503   1.00 57.38  ? 134  TYR B CA  1 
ATOM   3589 C C   . TYR B 1 100 ? 22.657 -22.186 3.774   1.00 56.60  ? 134  TYR B C   1 
ATOM   3590 O O   . TYR B 1 100 ? 23.062 -22.748 2.767   1.00 56.13  ? 134  TYR B O   1 
ATOM   3591 C CB  . TYR B 1 100 ? 21.741 -24.078 5.088   1.00 57.67  ? 134  TYR B CB  1 
ATOM   3592 C CG  . TYR B 1 100 ? 22.877 -24.067 6.082   1.00 60.24  ? 134  TYR B CG  1 
ATOM   3593 C CD1 . TYR B 1 100 ? 22.676 -23.624 7.385   1.00 61.58  ? 134  TYR B CD1 1 
ATOM   3594 C CD2 . TYR B 1 100 ? 24.163 -24.472 5.713   1.00 61.86  ? 134  TYR B CD2 1 
ATOM   3595 C CE1 . TYR B 1 100 ? 23.723 -23.583 8.299   1.00 63.41  ? 134  TYR B CE1 1 
ATOM   3596 C CE2 . TYR B 1 100 ? 25.223 -24.432 6.622   1.00 63.24  ? 134  TYR B CE2 1 
ATOM   3597 C CZ  . TYR B 1 100 ? 24.994 -23.985 7.915   1.00 64.53  ? 134  TYR B CZ  1 
ATOM   3598 O OH  . TYR B 1 100 ? 26.028 -23.922 8.830   1.00 67.42  ? 134  TYR B OH  1 
ATOM   3599 N N   . VAL B 1 101 ? 23.249 -21.111 4.277   1.00 56.86  ? 135  VAL B N   1 
ATOM   3600 C CA  . VAL B 1 101 ? 24.453 -20.571 3.665   1.00 56.46  ? 135  VAL B CA  1 
ATOM   3601 C C   . VAL B 1 101 ? 25.582 -20.645 4.690   1.00 56.97  ? 135  VAL B C   1 
ATOM   3602 O O   . VAL B 1 101 ? 25.428 -20.217 5.837   1.00 55.18  ? 135  VAL B O   1 
ATOM   3603 C CB  . VAL B 1 101 ? 24.249 -19.128 3.198   1.00 55.18  ? 135  VAL B CB  1 
ATOM   3604 C CG1 . VAL B 1 101 ? 25.470 -18.646 2.463   1.00 54.16  ? 135  VAL B CG1 1 
ATOM   3605 C CG2 . VAL B 1 101 ? 23.040 -19.057 2.301   1.00 54.34  ? 135  VAL B CG2 1 
ATOM   3606 N N   . PRO B 1 102 ? 26.737 -21.196 4.278   1.00 58.48  ? 136  PRO B N   1 
ATOM   3607 C CA  . PRO B 1 102 ? 27.956 -21.389 5.077   1.00 57.93  ? 136  PRO B CA  1 
ATOM   3608 C C   . PRO B 1 102 ? 28.486 -20.188 5.866   1.00 55.96  ? 136  PRO B C   1 
ATOM   3609 O O   . PRO B 1 102 ? 28.292 -20.086 7.069   1.00 56.54  ? 136  PRO B O   1 
ATOM   3610 C CB  . PRO B 1 102 ? 28.978 -21.865 4.042   1.00 59.68  ? 136  PRO B CB  1 
ATOM   3611 C CG  . PRO B 1 102 ? 28.140 -22.480 2.966   1.00 60.04  ? 136  PRO B CG  1 
ATOM   3612 C CD  . PRO B 1 102 ? 26.994 -21.527 2.864   1.00 58.96  ? 136  PRO B CD  1 
ATOM   3613 N N   . GLU B 1 103 ? 29.167 -19.286 5.173   1.00 54.03  ? 137  GLU B N   1 
ATOM   3614 C CA  . GLU B 1 103 ? 29.772 -18.120 5.804   1.00 52.75  ? 137  GLU B CA  1 
ATOM   3615 C C   . GLU B 1 103 ? 28.908 -16.862 5.771   1.00 49.10  ? 137  GLU B C   1 
ATOM   3616 O O   . GLU B 1 103 ? 27.813 -16.852 5.223   1.00 47.72  ? 137  GLU B O   1 
ATOM   3617 C CB  . GLU B 1 103 ? 31.140 -17.828 5.149   1.00 54.87  ? 137  GLU B CB  1 
ATOM   3618 C CG  . GLU B 1 103 ? 32.240 -18.859 5.439   1.00 60.25  ? 137  GLU B CG  1 
ATOM   3619 C CD  . GLU B 1 103 ? 32.569 -18.983 6.928   1.00 65.60  ? 137  GLU B CD  1 
ATOM   3620 O OE1 . GLU B 1 103 ? 32.834 -17.938 7.568   1.00 69.78  ? 137  GLU B OE1 1 
ATOM   3621 O OE2 . GLU B 1 103 ? 32.574 -20.124 7.456   1.00 65.95  ? 137  GLU B OE2 1 
ATOM   3622 N N   . THR B 1 104 ? 29.414 -15.802 6.386   1.00 45.88  ? 138  THR B N   1 
ATOM   3623 C CA  . THR B 1 104 ? 28.724 -14.524 6.412   1.00 44.03  ? 138  THR B CA  1 
ATOM   3624 C C   . THR B 1 104 ? 29.798 -13.475 6.229   1.00 43.14  ? 138  THR B C   1 
ATOM   3625 O O   . THR B 1 104 ? 30.954 -13.718 6.531   1.00 41.76  ? 138  THR B O   1 
ATOM   3626 C CB  . THR B 1 104 ? 28.019 -14.249 7.762   1.00 44.20  ? 138  THR B CB  1 
ATOM   3627 O OG1 . THR B 1 104 ? 29.006 -13.995 8.766   1.00 45.90  ? 138  THR B OG1 1 
ATOM   3628 C CG2 . THR B 1 104 ? 27.161 -15.420 8.182   1.00 41.62  ? 138  THR B CG2 1 
ATOM   3629 N N   . VAL B 1 105 ? 29.423 -12.307 5.734   1.00 43.13  ? 139  VAL B N   1 
ATOM   3630 C CA  . VAL B 1 105 ? 30.408 -11.260 5.541   1.00 42.22  ? 139  VAL B CA  1 
ATOM   3631 C C   . VAL B 1 105 ? 31.091 -10.954 6.872   1.00 42.43  ? 139  VAL B C   1 
ATOM   3632 O O   . VAL B 1 105 ? 32.234 -10.534 6.901   1.00 41.14  ? 139  VAL B O   1 
ATOM   3633 C CB  . VAL B 1 105 ? 29.755 -9.979  4.968   1.00 41.36  ? 139  VAL B CB  1 
ATOM   3634 C CG1 . VAL B 1 105 ? 30.707 -8.799  5.104   1.00 40.99  ? 139  VAL B CG1 1 
ATOM   3635 C CG2 . VAL B 1 105 ? 29.403 -10.192 3.509   1.00 37.70  ? 139  VAL B CG2 1 
ATOM   3636 N N   . TYR B 1 106 ? 30.384 -11.188 7.970   1.00 43.07  ? 140  TYR B N   1 
ATOM   3637 C CA  . TYR B 1 106 ? 30.922 -10.929 9.300   1.00 44.52  ? 140  TYR B CA  1 
ATOM   3638 C C   . TYR B 1 106 ? 32.114 -11.834 9.606   1.00 45.60  ? 140  TYR B C   1 
ATOM   3639 O O   . TYR B 1 106 ? 33.194 -11.363 9.971   1.00 44.03  ? 140  TYR B O   1 
ATOM   3640 C CB  . TYR B 1 106 ? 29.852 -11.171 10.357  1.00 44.98  ? 140  TYR B CB  1 
ATOM   3641 C CG  . TYR B 1 106 ? 30.370 -11.050 11.764  1.00 46.87  ? 140  TYR B CG  1 
ATOM   3642 C CD1 . TYR B 1 106 ? 30.505 -9.805  12.372  1.00 47.71  ? 140  TYR B CD1 1 
ATOM   3643 C CD2 . TYR B 1 106 ? 30.741 -12.185 12.488  1.00 48.15  ? 140  TYR B CD2 1 
ATOM   3644 C CE1 . TYR B 1 106 ? 30.994 -9.691  13.668  1.00 49.44  ? 140  TYR B CE1 1 
ATOM   3645 C CE2 . TYR B 1 106 ? 31.230 -12.084 13.788  1.00 48.48  ? 140  TYR B CE2 1 
ATOM   3646 C CZ  . TYR B 1 106 ? 31.352 -10.832 14.370  1.00 49.81  ? 140  TYR B CZ  1 
ATOM   3647 O OH  . TYR B 1 106 ? 31.824 -10.717 15.654  1.00 51.33  ? 140  TYR B OH  1 
ATOM   3648 N N   . ARG B 1 107 ? 31.893 -13.140 9.478   1.00 46.32  ? 141  ARG B N   1 
ATOM   3649 C CA  . ARG B 1 107 ? 32.936 -14.118 9.728   1.00 47.25  ? 141  ARG B CA  1 
ATOM   3650 C C   . ARG B 1 107 ? 34.127 -13.922 8.797   1.00 46.45  ? 141  ARG B C   1 
ATOM   3651 O O   . ARG B 1 107 ? 35.272 -13.928 9.239   1.00 47.31  ? 141  ARG B O   1 
ATOM   3652 C CB  . ARG B 1 107 ? 32.384 -15.539 9.595   1.00 49.61  ? 141  ARG B CB  1 
ATOM   3653 C CG  . ARG B 1 107 ? 31.671 -16.032 10.840  1.00 55.25  ? 141  ARG B CG  1 
ATOM   3654 C CD  . ARG B 1 107 ? 31.680 -17.560 10.912  1.00 61.17  ? 141  ARG B CD  1 
ATOM   3655 N NE  . ARG B 1 107 ? 30.751 -18.155 9.960   1.00 66.65  ? 141  ARG B NE  1 
ATOM   3656 C CZ  . ARG B 1 107 ? 29.428 -18.145 10.104  1.00 68.36  ? 141  ARG B CZ  1 
ATOM   3657 N NH1 . ARG B 1 107 ? 28.878 -17.575 11.169  1.00 68.91  ? 141  ARG B NH1 1 
ATOM   3658 N NH2 . ARG B 1 107 ? 28.652 -18.692 9.175   1.00 69.32  ? 141  ARG B NH2 1 
ATOM   3659 N N   . VAL B 1 108 ? 33.865 -13.736 7.514   1.00 44.52  ? 142  VAL B N   1 
ATOM   3660 C CA  . VAL B 1 108 ? 34.945 -13.531 6.568   1.00 44.27  ? 142  VAL B CA  1 
ATOM   3661 C C   . VAL B 1 108 ? 35.760 -12.317 6.970   1.00 46.06  ? 142  VAL B C   1 
ATOM   3662 O O   . VAL B 1 108 ? 36.964 -12.414 7.146   1.00 46.87  ? 142  VAL B O   1 
ATOM   3663 C CB  . VAL B 1 108 ? 34.399 -13.359 5.127   1.00 43.95  ? 142  VAL B CB  1 
ATOM   3664 C CG1 . VAL B 1 108 ? 35.498 -12.922 4.188   1.00 42.25  ? 142  VAL B CG1 1 
ATOM   3665 C CG2 . VAL B 1 108 ? 33.796 -14.683 4.647   1.00 42.26  ? 142  VAL B CG2 1 
ATOM   3666 N N   . ALA B 1 109 ? 35.113 -11.174 7.138   1.00 47.76  ? 143  ALA B N   1 
ATOM   3667 C CA  . ALA B 1 109 ? 35.836 -9.970  7.539   1.00 48.99  ? 143  ALA B CA  1 
ATOM   3668 C C   . ALA B 1 109 ? 36.675 -10.198 8.805   1.00 51.09  ? 143  ALA B C   1 
ATOM   3669 O O   . ALA B 1 109 ? 37.808 -9.736  8.882   1.00 51.20  ? 143  ALA B O   1 
ATOM   3670 C CB  . ALA B 1 109 ? 34.857 -8.817  7.764   1.00 46.41  ? 143  ALA B CB  1 
ATOM   3671 N N   . ARG B 1 110 ? 36.128 -10.909 9.789   1.00 53.35  ? 144  ARG B N   1 
ATOM   3672 C CA  . ARG B 1 110 ? 36.863 -11.154 11.024  1.00 56.64  ? 144  ARG B CA  1 
ATOM   3673 C C   . ARG B 1 110 ? 38.109 -11.990 10.750  1.00 57.90  ? 144  ARG B C   1 
ATOM   3674 O O   . ARG B 1 110 ? 39.153 -11.789 11.363  1.00 57.10  ? 144  ARG B O   1 
ATOM   3675 C CB  . ARG B 1 110 ? 35.967 -11.849 12.057  1.00 57.73  ? 144  ARG B CB  1 
ATOM   3676 C CG  . ARG B 1 110 ? 36.566 -11.891 13.452  1.00 62.10  ? 144  ARG B CG  1 
ATOM   3677 C CD  . ARG B 1 110 ? 35.583 -12.434 14.473  1.00 66.96  ? 144  ARG B CD  1 
ATOM   3678 N NE  . ARG B 1 110 ? 35.062 -13.741 14.080  1.00 71.72  ? 144  ARG B NE  1 
ATOM   3679 C CZ  . ARG B 1 110 ? 34.125 -14.407 14.753  1.00 73.67  ? 144  ARG B CZ  1 
ATOM   3680 N NH1 . ARG B 1 110 ? 33.603 -13.886 15.864  1.00 75.12  ? 144  ARG B NH1 1 
ATOM   3681 N NH2 . ARG B 1 110 ? 33.704 -15.590 14.310  1.00 73.19  ? 144  ARG B NH2 1 
ATOM   3682 N N   . HIS B 1 111 ? 37.994 -12.928 9.820   1.00 60.24  ? 145  HIS B N   1 
ATOM   3683 C CA  . HIS B 1 111 ? 39.115 -13.785 9.448   1.00 61.96  ? 145  HIS B CA  1 
ATOM   3684 C C   . HIS B 1 111 ? 40.302 -12.935 9.005   1.00 61.50  ? 145  HIS B C   1 
ATOM   3685 O O   . HIS B 1 111 ? 41.420 -13.118 9.490   1.00 63.09  ? 145  HIS B O   1 
ATOM   3686 C CB  . HIS B 1 111 ? 38.721 -14.706 8.298   1.00 65.17  ? 145  HIS B CB  1 
ATOM   3687 C CG  . HIS B 1 111 ? 39.866 -15.489 7.736   1.00 71.05  ? 145  HIS B CG  1 
ATOM   3688 N ND1 . HIS B 1 111 ? 40.201 -16.747 8.186   1.00 74.12  ? 145  HIS B ND1 1 
ATOM   3689 C CD2 . HIS B 1 111 ? 40.765 -15.181 6.770   1.00 72.22  ? 145  HIS B CD2 1 
ATOM   3690 C CE1 . HIS B 1 111 ? 41.255 -17.186 7.518   1.00 73.94  ? 145  HIS B CE1 1 
ATOM   3691 N NE2 . HIS B 1 111 ? 41.616 -16.255 6.653   1.00 73.12  ? 145  HIS B NE2 1 
ATOM   3692 N N   . TYR B 1 112 ? 40.058 -12.012 8.078   1.00 59.00  ? 146  TYR B N   1 
ATOM   3693 C CA  . TYR B 1 112 ? 41.114 -11.139 7.586   1.00 57.61  ? 146  TYR B CA  1 
ATOM   3694 C C   . TYR B 1 112 ? 41.589 -10.152 8.639   1.00 59.76  ? 146  TYR B C   1 
ATOM   3695 O O   . TYR B 1 112 ? 42.786 -9.933  8.794   1.00 59.01  ? 146  TYR B O   1 
ATOM   3696 C CB  . TYR B 1 112 ? 40.650 -10.352 6.353   1.00 54.79  ? 146  TYR B CB  1 
ATOM   3697 C CG  . TYR B 1 112 ? 40.540 -11.174 5.097   1.00 52.86  ? 146  TYR B CG  1 
ATOM   3698 C CD1 . TYR B 1 112 ? 39.493 -12.076 4.926   1.00 52.69  ? 146  TYR B CD1 1 
ATOM   3699 C CD2 . TYR B 1 112 ? 41.511 -11.097 4.099   1.00 51.58  ? 146  TYR B CD2 1 
ATOM   3700 C CE1 . TYR B 1 112 ? 39.411 -12.885 3.800   1.00 51.87  ? 146  TYR B CE1 1 
ATOM   3701 C CE2 . TYR B 1 112 ? 41.440 -11.909 2.963   1.00 50.55  ? 146  TYR B CE2 1 
ATOM   3702 C CZ  . TYR B 1 112 ? 40.388 -12.799 2.825   1.00 51.86  ? 146  TYR B CZ  1 
ATOM   3703 O OH  . TYR B 1 112 ? 40.299 -13.631 1.735   1.00 52.67  ? 146  TYR B OH  1 
ATOM   3704 N N   . SER B 1 113 ? 40.640 -9.550  9.350   1.00 62.37  ? 147  SER B N   1 
ATOM   3705 C CA  . SER B 1 113 ? 40.949 -8.569  10.373  1.00 64.31  ? 147  SER B CA  1 
ATOM   3706 C C   . SER B 1 113 ? 41.910 -9.131  11.405  1.00 66.19  ? 147  SER B C   1 
ATOM   3707 O O   . SER B 1 113 ? 42.982 -8.574  11.622  1.00 66.37  ? 147  SER B O   1 
ATOM   3708 C CB  . SER B 1 113 ? 39.666 -8.107  11.062  1.00 65.85  ? 147  SER B CB  1 
ATOM   3709 O OG  . SER B 1 113 ? 39.894 -6.928  11.818  1.00 68.87  ? 147  SER B OG  1 
ATOM   3710 N N   . ARG B 1 114 ? 41.544 -10.234 12.044  1.00 68.37  ? 148  ARG B N   1 
ATOM   3711 C CA  . ARG B 1 114 ? 42.434 -10.792 13.046  1.00 71.17  ? 148  ARG B CA  1 
ATOM   3712 C C   . ARG B 1 114 ? 43.479 -11.674 12.377  1.00 72.04  ? 148  ARG B C   1 
ATOM   3713 O O   . ARG B 1 114 ? 43.782 -12.776 12.833  1.00 74.44  ? 148  ARG B O   1 
ATOM   3714 C CB  . ARG B 1 114 ? 41.647 -11.560 14.121  1.00 72.47  ? 148  ARG B CB  1 
ATOM   3715 C CG  . ARG B 1 114 ? 41.049 -12.875 13.699  1.00 74.56  ? 148  ARG B CG  1 
ATOM   3716 C CD  . ARG B 1 114 ? 40.049 -13.329 14.745  1.00 78.40  ? 148  ARG B CD  1 
ATOM   3717 N NE  . ARG B 1 114 ? 39.459 -14.620 14.406  1.00 82.64  ? 148  ARG B NE  1 
ATOM   3718 C CZ  . ARG B 1 114 ? 38.442 -15.174 15.060  1.00 83.95  ? 148  ARG B CZ  1 
ATOM   3719 N NH1 . ARG B 1 114 ? 37.891 -14.543 16.093  1.00 84.07  ? 148  ARG B NH1 1 
ATOM   3720 N NH2 . ARG B 1 114 ? 37.982 -16.364 14.687  1.00 84.48  ? 148  ARG B NH2 1 
ATOM   3721 N N   . ALA B 1 115 ? 44.015 -11.177 11.269  1.00 71.10  ? 149  ALA B N   1 
ATOM   3722 C CA  . ALA B 1 115 ? 45.063 -11.864 10.518  1.00 69.62  ? 149  ALA B CA  1 
ATOM   3723 C C   . ALA B 1 115 ? 45.871 -10.730 9.921   1.00 69.72  ? 149  ALA B C   1 
ATOM   3724 O O   . ALA B 1 115 ? 46.678 -10.917 9.017   1.00 68.99  ? 149  ALA B O   1 
ATOM   3725 C CB  . ALA B 1 115 ? 44.477 -12.730 9.429   1.00 66.97  ? 149  ALA B CB  1 
ATOM   3726 N N   . LYS B 1 116 ? 45.619 -9.538  10.447  1.00 70.67  ? 150  LYS B N   1 
ATOM   3727 C CA  . LYS B 1 116 ? 46.310 -8.343  10.023  1.00 72.02  ? 150  LYS B CA  1 
ATOM   3728 C C   . LYS B 1 116 ? 46.229 -8.146  8.511   1.00 72.23  ? 150  LYS B C   1 
ATOM   3729 O O   . LYS B 1 116 ? 47.229 -7.854  7.855   1.00 73.54  ? 150  LYS B O   1 
ATOM   3730 C CB  . LYS B 1 116 ? 47.762 -8.422  10.488  1.00 73.56  ? 150  LYS B CB  1 
ATOM   3731 C CG  . LYS B 1 116 ? 47.910 -8.654  11.996  1.00 75.80  ? 150  LYS B CG  1 
ATOM   3732 C CD  . LYS B 1 116 ? 47.425 -7.453  12.797  1.00 78.03  ? 150  LYS B CD  1 
ATOM   3733 C CE  . LYS B 1 116 ? 47.623 -7.655  14.296  1.00 79.41  ? 150  LYS B CE  1 
ATOM   3734 N NZ  . LYS B 1 116 ? 47.190 -6.453  15.082  1.00 80.67  ? 150  LYS B NZ  1 
ATOM   3735 N N   . GLN B 1 117 ? 45.033 -8.307  7.954   1.00 72.09  ? 151  GLN B N   1 
ATOM   3736 C CA  . GLN B 1 117 ? 44.843 -8.124  6.519   1.00 71.00  ? 151  GLN B CA  1 
ATOM   3737 C C   . GLN B 1 117 ? 43.483 -7.586  6.140   1.00 68.71  ? 151  GLN B C   1 
ATOM   3738 O O   . GLN B 1 117 ? 42.568 -7.488  6.966   1.00 68.36  ? 151  GLN B O   1 
ATOM   3739 C CB  . GLN B 1 117 ? 45.055 -9.433  5.783   1.00 73.12  ? 151  GLN B CB  1 
ATOM   3740 C CG  . GLN B 1 117 ? 46.425 -9.994  5.969   1.00 77.98  ? 151  GLN B CG  1 
ATOM   3741 C CD  . GLN B 1 117 ? 46.697 -11.106 5.009   1.00 80.23  ? 151  GLN B CD  1 
ATOM   3742 O OE1 . GLN B 1 117 ? 46.770 -10.885 3.800   1.00 82.50  ? 151  GLN B OE1 1 
ATOM   3743 N NE2 . GLN B 1 117 ? 46.837 -12.320 5.531   1.00 81.04  ? 151  GLN B NE2 1 
ATOM   3744 N N   . THR B 1 118 ? 43.362 -7.231  4.871   1.00 66.01  ? 152  THR B N   1 
ATOM   3745 C CA  . THR B 1 118 ? 42.105 -6.717  4.359   1.00 64.42  ? 152  THR B CA  1 
ATOM   3746 C C   . THR B 1 118 ? 41.611 -7.578  3.213   1.00 61.46  ? 152  THR B C   1 
ATOM   3747 O O   . THR B 1 118 ? 42.390 -8.143  2.444   1.00 61.38  ? 152  THR B O   1 
ATOM   3748 C CB  . THR B 1 118 ? 42.230 -5.257  3.875   1.00 65.28  ? 152  THR B CB  1 
ATOM   3749 O OG1 . THR B 1 118 ? 43.486 -5.079  3.205   1.00 66.57  ? 152  THR B OG1 1 
ATOM   3750 C CG2 . THR B 1 118 ? 42.118 -4.296  5.058   1.00 64.48  ? 152  THR B CG2 1 
ATOM   3751 N N   . LEU B 1 119 ? 40.297 -7.686  3.124   1.00 57.66  ? 153  LEU B N   1 
ATOM   3752 C CA  . LEU B 1 119 ? 39.677 -8.469  2.088   1.00 53.15  ? 153  LEU B CA  1 
ATOM   3753 C C   . LEU B 1 119 ? 40.021 -7.843  0.749   1.00 50.19  ? 153  LEU B C   1 
ATOM   3754 O O   . LEU B 1 119 ? 39.930 -6.628  0.598   1.00 48.83  ? 153  LEU B O   1 
ATOM   3755 C CB  . LEU B 1 119 ? 38.168 -8.463  2.302   1.00 52.65  ? 153  LEU B CB  1 
ATOM   3756 C CG  . LEU B 1 119 ? 37.310 -9.229  1.308   1.00 52.48  ? 153  LEU B CG  1 
ATOM   3757 C CD1 . LEU B 1 119 ? 37.595 -10.722 1.413   1.00 55.07  ? 153  LEU B CD1 1 
ATOM   3758 C CD2 . LEU B 1 119 ? 35.865 -8.932  1.615   1.00 51.09  ? 153  LEU B CD2 1 
ATOM   3759 N N   . PRO B 1 120 ? 40.472 -8.657  -0.225  1.00 47.78  ? 154  PRO B N   1 
ATOM   3760 C CA  . PRO B 1 120 ? 40.808 -8.129  -1.547  1.00 45.91  ? 154  PRO B CA  1 
ATOM   3761 C C   . PRO B 1 120 ? 39.616 -7.343  -2.120  1.00 46.35  ? 154  PRO B C   1 
ATOM   3762 O O   . PRO B 1 120 ? 38.469 -7.779  -2.054  1.00 46.85  ? 154  PRO B O   1 
ATOM   3763 C CB  . PRO B 1 120 ? 41.097 -9.387  -2.352  1.00 43.81  ? 154  PRO B CB  1 
ATOM   3764 C CG  . PRO B 1 120 ? 41.691 -10.282 -1.364  1.00 44.53  ? 154  PRO B CG  1 
ATOM   3765 C CD  . PRO B 1 120 ? 40.889 -10.066 -0.104  1.00 46.25  ? 154  PRO B CD  1 
ATOM   3766 N N   . VAL B 1 121 ? 39.908 -6.182  -2.687  1.00 47.00  ? 155  VAL B N   1 
ATOM   3767 C CA  . VAL B 1 121 ? 38.904 -5.308  -3.282  1.00 46.83  ? 155  VAL B CA  1 
ATOM   3768 C C   . VAL B 1 121 ? 37.943 -6.018  -4.250  1.00 46.42  ? 155  VAL B C   1 
ATOM   3769 O O   . VAL B 1 121 ? 36.782 -5.630  -4.379  1.00 46.96  ? 155  VAL B O   1 
ATOM   3770 C CB  . VAL B 1 121 ? 39.597 -4.141  -4.020  1.00 46.17  ? 155  VAL B CB  1 
ATOM   3771 C CG1 . VAL B 1 121 ? 38.570 -3.160  -4.562  1.00 49.12  ? 155  VAL B CG1 1 
ATOM   3772 C CG2 . VAL B 1 121 ? 40.536 -3.441  -3.065  1.00 47.84  ? 155  VAL B CG2 1 
ATOM   3773 N N   . ILE B 1 122 ? 38.417 -7.049  -4.935  1.00 45.04  ? 156  ILE B N   1 
ATOM   3774 C CA  . ILE B 1 122 ? 37.558 -7.747  -5.870  1.00 43.80  ? 156  ILE B CA  1 
ATOM   3775 C C   . ILE B 1 122 ? 36.344 -8.281  -5.112  1.00 43.66  ? 156  ILE B C   1 
ATOM   3776 O O   . ILE B 1 122 ? 35.208 -8.138  -5.572  1.00 43.57  ? 156  ILE B O   1 
ATOM   3777 C CB  . ILE B 1 122 ? 38.343 -8.880  -6.599  1.00 43.85  ? 156  ILE B CB  1 
ATOM   3778 C CG1 . ILE B 1 122 ? 37.414 -9.640  -7.541  1.00 43.57  ? 156  ILE B CG1 1 
ATOM   3779 C CG2 . ILE B 1 122 ? 39.001 -9.808  -5.591  1.00 45.54  ? 156  ILE B CG2 1 
ATOM   3780 C CD1 . ILE B 1 122 ? 36.792 -8.769  -8.609  1.00 42.82  ? 156  ILE B CD1 1 
ATOM   3781 N N   . TYR B 1 123 ? 36.585 -8.866  -3.938  1.00 43.31  ? 157  TYR B N   1 
ATOM   3782 C CA  . TYR B 1 123 ? 35.506 -9.399  -3.095  1.00 43.09  ? 157  TYR B CA  1 
ATOM   3783 C C   . TYR B 1 123 ? 34.676 -8.273  -2.486  1.00 41.66  ? 157  TYR B C   1 
ATOM   3784 O O   . TYR B 1 123 ? 33.486 -8.428  -2.270  1.00 42.97  ? 157  TYR B O   1 
ATOM   3785 C CB  . TYR B 1 123 ? 36.068 -10.267 -1.966  1.00 45.08  ? 157  TYR B CB  1 
ATOM   3786 C CG  . TYR B 1 123 ? 36.668 -11.567 -2.434  1.00 48.17  ? 157  TYR B CG  1 
ATOM   3787 C CD1 . TYR B 1 123 ? 35.875 -12.550 -3.032  1.00 46.29  ? 157  TYR B CD1 1 
ATOM   3788 C CD2 . TYR B 1 123 ? 38.035 -11.812 -2.288  1.00 49.86  ? 157  TYR B CD2 1 
ATOM   3789 C CE1 . TYR B 1 123 ? 36.428 -13.740 -3.471  1.00 49.43  ? 157  TYR B CE1 1 
ATOM   3790 C CE2 . TYR B 1 123 ? 38.605 -13.004 -2.726  1.00 51.77  ? 157  TYR B CE2 1 
ATOM   3791 C CZ  . TYR B 1 123 ? 37.801 -13.964 -3.314  1.00 53.03  ? 157  TYR B CZ  1 
ATOM   3792 O OH  . TYR B 1 123 ? 38.386 -15.144 -3.730  1.00 55.76  ? 157  TYR B OH  1 
ATOM   3793 N N   . VAL B 1 124 ? 35.300 -7.140  -2.199  1.00 40.13  ? 158  VAL B N   1 
ATOM   3794 C CA  . VAL B 1 124 ? 34.554 -6.029  -1.645  1.00 39.57  ? 158  VAL B CA  1 
ATOM   3795 C C   . VAL B 1 124 ? 33.535 -5.565  -2.688  1.00 41.04  ? 158  VAL B C   1 
ATOM   3796 O O   . VAL B 1 124 ? 32.386 -5.279  -2.350  1.00 42.07  ? 158  VAL B O   1 
ATOM   3797 C CB  . VAL B 1 124 ? 35.489 -4.869  -1.265  1.00 39.50  ? 158  VAL B CB  1 
ATOM   3798 C CG1 . VAL B 1 124 ? 34.674 -3.673  -0.785  1.00 37.87  ? 158  VAL B CG1 1 
ATOM   3799 C CG2 . VAL B 1 124 ? 36.446 -5.327  -0.173  1.00 38.49  ? 158  VAL B CG2 1 
ATOM   3800 N N   . LYS B 1 125 ? 33.964 -5.504  -3.951  1.00 40.32  ? 159  LYS B N   1 
ATOM   3801 C CA  . LYS B 1 125 ? 33.109 -5.102  -5.066  1.00 40.20  ? 159  LYS B CA  1 
ATOM   3802 C C   . LYS B 1 125 ? 31.981 -6.103  -5.292  1.00 40.67  ? 159  LYS B C   1 
ATOM   3803 O O   . LYS B 1 125 ? 30.818 -5.731  -5.396  1.00 40.42  ? 159  LYS B O   1 
ATOM   3804 C CB  . LYS B 1 125 ? 33.931 -4.987  -6.353  1.00 41.36  ? 159  LYS B CB  1 
ATOM   3805 C CG  . LYS B 1 125 ? 34.937 -3.863  -6.346  1.00 42.49  ? 159  LYS B CG  1 
ATOM   3806 C CD  . LYS B 1 125 ? 35.727 -3.797  -7.643  1.00 42.55  ? 159  LYS B CD  1 
ATOM   3807 C CE  . LYS B 1 125 ? 36.756 -2.671  -7.590  1.00 42.43  ? 159  LYS B CE  1 
ATOM   3808 N NZ  . LYS B 1 125 ? 37.474 -2.526  -8.875  1.00 40.65  ? 159  LYS B NZ  1 
ATOM   3809 N N   . LEU B 1 126 ? 32.337 -7.377  -5.386  1.00 40.47  ? 160  LEU B N   1 
ATOM   3810 C CA  . LEU B 1 126 ? 31.355 -8.424  -5.589  1.00 40.45  ? 160  LEU B CA  1 
ATOM   3811 C C   . LEU B 1 126 ? 30.300 -8.436  -4.505  1.00 40.48  ? 160  LEU B C   1 
ATOM   3812 O O   . LEU B 1 126 ? 29.107 -8.537  -4.793  1.00 41.64  ? 160  LEU B O   1 
ATOM   3813 C CB  . LEU B 1 126 ? 32.036 -9.784  -5.611  1.00 42.01  ? 160  LEU B CB  1 
ATOM   3814 C CG  . LEU B 1 126 ? 32.513 -10.230 -6.987  1.00 44.42  ? 160  LEU B CG  1 
ATOM   3815 C CD1 . LEU B 1 126 ? 33.324 -11.491 -6.833  1.00 42.98  ? 160  LEU B CD1 1 
ATOM   3816 C CD2 . LEU B 1 126 ? 31.309 -10.455 -7.904  1.00 44.04  ? 160  LEU B CD2 1 
ATOM   3817 N N   . TYR B 1 127 ? 30.737 -8.345  -3.253  1.00 39.25  ? 161  TYR B N   1 
ATOM   3818 C CA  . TYR B 1 127 ? 29.815 -8.381  -2.132  1.00 36.91  ? 161  TYR B CA  1 
ATOM   3819 C C   . TYR B 1 127 ? 28.922 -7.154  -2.043  1.00 36.41  ? 161  TYR B C   1 
ATOM   3820 O O   . TYR B 1 127 ? 27.714 -7.283  -1.863  1.00 35.72  ? 161  TYR B O   1 
ATOM   3821 C CB  . TYR B 1 127 ? 30.589 -8.547  -0.827  1.00 37.02  ? 161  TYR B CB  1 
ATOM   3822 C CG  . TYR B 1 127 ? 31.363 -9.846  -0.719  1.00 38.57  ? 161  TYR B CG  1 
ATOM   3823 C CD1 . TYR B 1 127 ? 31.115 -10.901 -1.601  1.00 37.04  ? 161  TYR B CD1 1 
ATOM   3824 C CD2 . TYR B 1 127 ? 32.319 -10.038 0.296   1.00 38.23  ? 161  TYR B CD2 1 
ATOM   3825 C CE1 . TYR B 1 127 ? 31.785 -12.106 -1.478  1.00 38.32  ? 161  TYR B CE1 1 
ATOM   3826 C CE2 . TYR B 1 127 ? 32.998 -11.248 0.425   1.00 37.71  ? 161  TYR B CE2 1 
ATOM   3827 C CZ  . TYR B 1 127 ? 32.719 -12.279 -0.468  1.00 39.55  ? 161  TYR B CZ  1 
ATOM   3828 O OH  . TYR B 1 127 ? 33.341 -13.502 -0.349  1.00 42.28  ? 161  TYR B OH  1 
ATOM   3829 N N   . MET B 1 128 ? 29.507 -5.967  -2.172  1.00 35.29  ? 162  MET B N   1 
ATOM   3830 C CA  . MET B 1 128 ? 28.719 -4.749  -2.079  1.00 34.18  ? 162  MET B CA  1 
ATOM   3831 C C   . MET B 1 128 ? 27.722 -4.615  -3.219  1.00 35.97  ? 162  MET B C   1 
ATOM   3832 O O   . MET B 1 128 ? 26.578 -4.211  -3.016  1.00 36.94  ? 162  MET B O   1 
ATOM   3833 C CB  . MET B 1 128 ? 29.636 -3.536  -2.030  1.00 33.10  ? 162  MET B CB  1 
ATOM   3834 C CG  . MET B 1 128 ? 30.489 -3.479  -0.768  1.00 36.10  ? 162  MET B CG  1 
ATOM   3835 S SD  . MET B 1 128 ? 29.526 -3.667  0.769   1.00 43.57  ? 162  MET B SD  1 
ATOM   3836 C CE  . MET B 1 128 ? 28.444 -2.236  0.653   1.00 37.94  ? 162  MET B CE  1 
ATOM   3837 N N   . TYR B 1 129 ? 28.146 -4.972  -4.423  1.00 36.25  ? 163  TYR B N   1 
ATOM   3838 C CA  . TYR B 1 129 ? 27.259 -4.875  -5.559  1.00 35.45  ? 163  TYR B CA  1 
ATOM   3839 C C   . TYR B 1 129 ? 26.032 -5.756  -5.338  1.00 35.51  ? 163  TYR B C   1 
ATOM   3840 O O   . TYR B 1 129 ? 24.898 -5.323  -5.558  1.00 36.18  ? 163  TYR B O   1 
ATOM   3841 C CB  . TYR B 1 129 ? 27.989 -5.301  -6.820  1.00 35.77  ? 163  TYR B CB  1 
ATOM   3842 C CG  . TYR B 1 129 ? 27.143 -5.256  -8.065  1.00 35.36  ? 163  TYR B CG  1 
ATOM   3843 C CD1 . TYR B 1 129 ? 27.066 -4.098  -8.844  1.00 33.76  ? 163  TYR B CD1 1 
ATOM   3844 C CD2 . TYR B 1 129 ? 26.477 -6.398  -8.501  1.00 34.58  ? 163  TYR B CD2 1 
ATOM   3845 C CE1 . TYR B 1 129 ? 26.362 -4.090  -10.035 1.00 33.14  ? 163  TYR B CE1 1 
ATOM   3846 C CE2 . TYR B 1 129 ? 25.771 -6.402  -9.679  1.00 34.89  ? 163  TYR B CE2 1 
ATOM   3847 C CZ  . TYR B 1 129 ? 25.720 -5.252  -10.450 1.00 34.23  ? 163  TYR B CZ  1 
ATOM   3848 O OH  . TYR B 1 129 ? 25.066 -5.312  -11.657 1.00 34.57  ? 163  TYR B OH  1 
ATOM   3849 N N   . GLN B 1 130 ? 26.246 -6.994  -4.904  1.00 33.48  ? 164  GLN B N   1 
ATOM   3850 C CA  . GLN B 1 130 ? 25.104 -7.862  -4.672  1.00 32.47  ? 164  GLN B CA  1 
ATOM   3851 C C   . GLN B 1 130 ? 24.222 -7.312  -3.548  1.00 32.79  ? 164  GLN B C   1 
ATOM   3852 O O   . GLN B 1 130 ? 22.997 -7.401  -3.611  1.00 33.98  ? 164  GLN B O   1 
ATOM   3853 C CB  . GLN B 1 130 ? 25.568 -9.306  -4.402  1.00 30.05  ? 164  GLN B CB  1 
ATOM   3854 C CG  . GLN B 1 130 ? 26.206 -9.920  -5.626  1.00 31.35  ? 164  GLN B CG  1 
ATOM   3855 C CD  . GLN B 1 130 ? 26.868 -11.254 -5.375  1.00 33.34  ? 164  GLN B CD  1 
ATOM   3856 O OE1 . GLN B 1 130 ? 26.211 -12.297 -5.319  1.00 32.50  ? 164  GLN B OE1 1 
ATOM   3857 N NE2 . GLN B 1 130 ? 28.185 -11.229 -5.205  1.00 35.68  ? 164  GLN B NE2 1 
ATOM   3858 N N   . LEU B 1 131 ? 24.824 -6.716  -2.525  1.00 33.56  ? 165  LEU B N   1 
ATOM   3859 C CA  . LEU B 1 131 ? 24.007 -6.155  -1.457  1.00 32.03  ? 165  LEU B CA  1 
ATOM   3860 C C   . LEU B 1 131 ? 23.137 -5.019  -1.996  1.00 33.14  ? 165  LEU B C   1 
ATOM   3861 O O   . LEU B 1 131 ? 21.978 -4.912  -1.614  1.00 35.61  ? 165  LEU B O   1 
ATOM   3862 C CB  . LEU B 1 131 ? 24.865 -5.633  -0.311  1.00 29.98  ? 165  LEU B CB  1 
ATOM   3863 C CG  . LEU B 1 131 ? 24.144 -4.767  0.733   1.00 28.31  ? 165  LEU B CG  1 
ATOM   3864 C CD1 . LEU B 1 131 ? 22.906 -5.474  1.317   1.00 28.20  ? 165  LEU B CD1 1 
ATOM   3865 C CD2 . LEU B 1 131 ? 25.137 -4.417  1.810   1.00 24.77  ? 165  LEU B CD2 1 
ATOM   3866 N N   . PHE B 1 132 ? 23.674 -4.187  -2.888  1.00 32.13  ? 166  PHE B N   1 
ATOM   3867 C CA  . PHE B 1 132 ? 22.886 -3.096  -3.438  1.00 32.04  ? 166  PHE B CA  1 
ATOM   3868 C C   . PHE B 1 132 ? 21.789 -3.577  -4.377  1.00 34.27  ? 166  PHE B C   1 
ATOM   3869 O O   . PHE B 1 132 ? 20.762 -2.919  -4.510  1.00 35.60  ? 166  PHE B O   1 
ATOM   3870 C CB  . PHE B 1 132 ? 23.780 -2.080  -4.149  1.00 32.91  ? 166  PHE B CB  1 
ATOM   3871 C CG  . PHE B 1 132 ? 24.595 -1.233  -3.210  1.00 34.65  ? 166  PHE B CG  1 
ATOM   3872 C CD1 . PHE B 1 132 ? 23.982 -0.549  -2.162  1.00 32.48  ? 166  PHE B CD1 1 
ATOM   3873 C CD2 . PHE B 1 132 ? 25.977 -1.136  -3.359  1.00 34.74  ? 166  PHE B CD2 1 
ATOM   3874 C CE1 . PHE B 1 132 ? 24.731 0.213   -1.276  1.00 33.09  ? 166  PHE B CE1 1 
ATOM   3875 C CE2 . PHE B 1 132 ? 26.734 -0.372  -2.472  1.00 34.19  ? 166  PHE B CE2 1 
ATOM   3876 C CZ  . PHE B 1 132 ? 26.109 0.302   -1.427  1.00 33.37  ? 166  PHE B CZ  1 
ATOM   3877 N N   . ARG B 1 133 ? 21.993 -4.715  -5.031  1.00 35.25  ? 167  ARG B N   1 
ATOM   3878 C CA  . ARG B 1 133 ? 20.961 -5.233  -5.907  1.00 35.44  ? 167  ARG B CA  1 
ATOM   3879 C C   . ARG B 1 133 ? 19.814 -5.709  -5.043  1.00 36.65  ? 167  ARG B C   1 
ATOM   3880 O O   . ARG B 1 133 ? 18.659 -5.389  -5.304  1.00 39.70  ? 167  ARG B O   1 
ATOM   3881 C CB  . ARG B 1 133 ? 21.458 -6.410  -6.743  1.00 35.54  ? 167  ARG B CB  1 
ATOM   3882 C CG  . ARG B 1 133 ? 21.979 -6.031  -8.099  1.00 36.32  ? 167  ARG B CG  1 
ATOM   3883 C CD  . ARG B 1 133 ? 22.159 -7.259  -8.960  1.00 37.73  ? 167  ARG B CD  1 
ATOM   3884 N NE  . ARG B 1 133 ? 20.917 -7.718  -9.572  1.00 39.66  ? 167  ARG B NE  1 
ATOM   3885 C CZ  . ARG B 1 133 ? 20.824 -8.842  -10.279 1.00 42.37  ? 167  ARG B CZ  1 
ATOM   3886 N NH1 . ARG B 1 133 ? 21.899 -9.611  -10.449 1.00 40.00  ? 167  ARG B NH1 1 
ATOM   3887 N NH2 . ARG B 1 133 ? 19.665 -9.197  -10.822 1.00 42.93  ? 167  ARG B NH2 1 
ATOM   3888 N N   . SER B 1 134 ? 20.125 -6.473  -4.004  1.00 35.97  ? 168  SER B N   1 
ATOM   3889 C CA  . SER B 1 134 ? 19.067 -6.979  -3.140  1.00 36.86  ? 168  SER B CA  1 
ATOM   3890 C C   . SER B 1 134 ? 18.321 -5.792  -2.532  1.00 36.47  ? 168  SER B C   1 
ATOM   3891 O O   . SER B 1 134 ? 17.098 -5.827  -2.354  1.00 37.22  ? 168  SER B O   1 
ATOM   3892 C CB  . SER B 1 134 ? 19.639 -7.860  -2.027  1.00 36.35  ? 168  SER B CB  1 
ATOM   3893 O OG  . SER B 1 134 ? 20.335 -7.075  -1.088  1.00 37.86  ? 168  SER B OG  1 
ATOM   3894 N N   . LEU B 1 135 ? 19.066 -4.739  -2.222  1.00 33.91  ? 169  LEU B N   1 
ATOM   3895 C CA  . LEU B 1 135 ? 18.479 -3.544  -1.644  1.00 32.87  ? 169  LEU B CA  1 
ATOM   3896 C C   . LEU B 1 135 ? 17.607 -2.834  -2.698  1.00 33.32  ? 169  LEU B C   1 
ATOM   3897 O O   . LEU B 1 135 ? 16.500 -2.393  -2.392  1.00 33.32  ? 169  LEU B O   1 
ATOM   3898 C CB  . LEU B 1 135 ? 19.594 -2.633  -1.103  1.00 30.14  ? 169  LEU B CB  1 
ATOM   3899 C CG  . LEU B 1 135 ? 19.715 -2.413  0.416   1.00 28.94  ? 169  LEU B CG  1 
ATOM   3900 C CD1 . LEU B 1 135 ? 19.380 -3.647  1.201   1.00 27.12  ? 169  LEU B CD1 1 
ATOM   3901 C CD2 . LEU B 1 135 ? 21.106 -1.926  0.724   1.00 27.57  ? 169  LEU B CD2 1 
ATOM   3902 N N   . ALA B 1 136 ? 18.093 -2.744  -3.938  1.00 33.07  ? 170  ALA B N   1 
ATOM   3903 C CA  . ALA B 1 136 ? 17.328 -2.109  -5.017  1.00 33.54  ? 170  ALA B CA  1 
ATOM   3904 C C   . ALA B 1 136 ? 15.999 -2.845  -5.171  1.00 34.70  ? 170  ALA B C   1 
ATOM   3905 O O   . ALA B 1 136 ? 14.935 -2.233  -5.339  1.00 35.77  ? 170  ALA B O   1 
ATOM   3906 C CB  . ALA B 1 136 ? 18.103 -2.176  -6.338  1.00 30.15  ? 170  ALA B CB  1 
ATOM   3907 N N   . TYR B 1 137 ? 16.081 -4.168  -5.108  1.00 34.31  ? 171  TYR B N   1 
ATOM   3908 C CA  . TYR B 1 137 ? 14.923 -5.023  -5.240  1.00 35.46  ? 171  TYR B CA  1 
ATOM   3909 C C   . TYR B 1 137 ? 13.886 -4.841  -4.121  1.00 37.55  ? 171  TYR B C   1 
ATOM   3910 O O   . TYR B 1 137 ? 12.764 -4.433  -4.401  1.00 38.72  ? 171  TYR B O   1 
ATOM   3911 C CB  . TYR B 1 137 ? 15.375 -6.479  -5.316  1.00 34.85  ? 171  TYR B CB  1 
ATOM   3912 C CG  . TYR B 1 137 ? 14.241 -7.467  -5.409  1.00 34.67  ? 171  TYR B CG  1 
ATOM   3913 C CD1 . TYR B 1 137 ? 13.889 -8.241  -4.318  1.00 35.51  ? 171  TYR B CD1 1 
ATOM   3914 C CD2 . TYR B 1 137 ? 13.552 -7.663  -6.606  1.00 34.17  ? 171  TYR B CD2 1 
ATOM   3915 C CE1 . TYR B 1 137 ? 12.894 -9.199  -4.410  1.00 37.62  ? 171  TYR B CE1 1 
ATOM   3916 C CE2 . TYR B 1 137 ? 12.550 -8.614  -6.714  1.00 32.88  ? 171  TYR B CE2 1 
ATOM   3917 C CZ  . TYR B 1 137 ? 12.232 -9.384  -5.614  1.00 36.85  ? 171  TYR B CZ  1 
ATOM   3918 O OH  . TYR B 1 137 ? 11.286 -10.379 -5.695  1.00 41.34  ? 171  TYR B OH  1 
ATOM   3919 N N   . ILE B 1 138 ? 14.235 -5.137  -2.869  1.00 37.77  ? 172  ILE B N   1 
ATOM   3920 C CA  . ILE B 1 138 ? 13.248 -4.984  -1.812  1.00 37.46  ? 172  ILE B CA  1 
ATOM   3921 C C   . ILE B 1 138 ? 12.742 -3.543  -1.695  1.00 38.70  ? 172  ILE B C   1 
ATOM   3922 O O   . ILE B 1 138 ? 11.589 -3.328  -1.312  1.00 37.70  ? 172  ILE B O   1 
ATOM   3923 C CB  . ILE B 1 138 ? 13.760 -5.437  -0.424  1.00 36.90  ? 172  ILE B CB  1 
ATOM   3924 C CG1 . ILE B 1 138 ? 14.920 -4.559  0.023   1.00 36.95  ? 172  ILE B CG1 1 
ATOM   3925 C CG2 . ILE B 1 138 ? 14.133 -6.916  -0.447  1.00 37.49  ? 172  ILE B CG2 1 
ATOM   3926 C CD1 . ILE B 1 138 ? 15.248 -4.703  1.492   1.00 34.74  ? 172  ILE B CD1 1 
ATOM   3927 N N   . HIS B 1 139 ? 13.566 -2.549  -2.020  1.00 38.14  ? 173  HIS B N   1 
ATOM   3928 C CA  . HIS B 1 139 ? 13.074 -1.168  -1.918  1.00 40.52  ? 173  HIS B CA  1 
ATOM   3929 C C   . HIS B 1 139 ? 12.018 -0.869  -2.977  1.00 42.52  ? 173  HIS B C   1 
ATOM   3930 O O   . HIS B 1 139 ? 11.110 -0.073  -2.746  1.00 44.07  ? 173  HIS B O   1 
ATOM   3931 C CB  . HIS B 1 139 ? 14.210 -0.140  -2.015  1.00 36.98  ? 173  HIS B CB  1 
ATOM   3932 C CG  . HIS B 1 139 ? 15.069 -0.082  -0.793  1.00 38.12  ? 173  HIS B CG  1 
ATOM   3933 N ND1 . HIS B 1 139 ? 16.151 0.767   -0.684  1.00 38.98  ? 173  HIS B ND1 1 
ATOM   3934 C CD2 . HIS B 1 139 ? 15.032 -0.789  0.362   1.00 37.60  ? 173  HIS B CD2 1 
ATOM   3935 C CE1 . HIS B 1 139 ? 16.743 0.576   0.479   1.00 39.04  ? 173  HIS B CE1 1 
ATOM   3936 N NE2 . HIS B 1 139 ? 16.084 -0.365  1.135   1.00 37.14  ? 173  HIS B NE2 1 
ATOM   3937 N N   . SER B 1 140 ? 12.125 -1.514  -4.133  1.00 43.51  ? 174  SER B N   1 
ATOM   3938 C CA  . SER B 1 140 ? 11.152 -1.295  -5.186  1.00 43.07  ? 174  SER B CA  1 
ATOM   3939 C C   . SER B 1 140 ? 9.761  -1.736  -4.715  1.00 44.41  ? 174  SER B C   1 
ATOM   3940 O O   . SER B 1 140 ? 8.758  -1.289  -5.253  1.00 47.38  ? 174  SER B O   1 
ATOM   3941 C CB  . SER B 1 140 ? 11.548 -2.053  -6.450  1.00 40.25  ? 174  SER B CB  1 
ATOM   3942 O OG  . SER B 1 140 ? 11.366 -3.438  -6.291  1.00 40.21  ? 174  SER B OG  1 
ATOM   3943 N N   . PHE B 1 141 ? 9.698  -2.613  -3.718  1.00 45.16  ? 175  PHE B N   1 
ATOM   3944 C CA  . PHE B 1 141 ? 8.415  -3.060  -3.189  1.00 45.65  ? 175  PHE B CA  1 
ATOM   3945 C C   . PHE B 1 141 ? 8.043  -2.148  -2.035  1.00 46.29  ? 175  PHE B C   1 
ATOM   3946 O O   . PHE B 1 141 ? 6.977  -2.299  -1.448  1.00 46.20  ? 175  PHE B O   1 
ATOM   3947 C CB  . PHE B 1 141 ? 8.481  -4.489  -2.636  1.00 48.81  ? 175  PHE B CB  1 
ATOM   3948 C CG  . PHE B 1 141 ? 8.555  -5.550  -3.683  1.00 54.05  ? 175  PHE B CG  1 
ATOM   3949 C CD1 . PHE B 1 141 ? 9.750  -5.813  -4.341  1.00 56.50  ? 175  PHE B CD1 1 
ATOM   3950 C CD2 . PHE B 1 141 ? 7.428  -6.301  -4.010  1.00 56.47  ? 175  PHE B CD2 1 
ATOM   3951 C CE1 . PHE B 1 141 ? 9.824  -6.810  -5.310  1.00 59.42  ? 175  PHE B CE1 1 
ATOM   3952 C CE2 . PHE B 1 141 ? 7.492  -7.302  -4.980  1.00 58.96  ? 175  PHE B CE2 1 
ATOM   3953 C CZ  . PHE B 1 141 ? 8.694  -7.559  -5.632  1.00 58.72  ? 175  PHE B CZ  1 
ATOM   3954 N N   . GLY B 1 142 ? 8.929  -1.213  -1.698  1.00 45.33  ? 176  GLY B N   1 
ATOM   3955 C CA  . GLY B 1 142 ? 8.670  -0.324  -0.579  1.00 43.79  ? 176  GLY B CA  1 
ATOM   3956 C C   . GLY B 1 142 ? 9.064  -0.946  0.759   1.00 44.15  ? 176  GLY B C   1 
ATOM   3957 O O   . GLY B 1 142 ? 8.746  -0.403  1.815   1.00 45.71  ? 176  GLY B O   1 
ATOM   3958 N N   . ILE B 1 143 ? 9.759  -2.083  0.710   1.00 42.84  ? 177  ILE B N   1 
ATOM   3959 C CA  . ILE B 1 143 ? 10.207 -2.798  1.901   1.00 40.73  ? 177  ILE B CA  1 
ATOM   3960 C C   . ILE B 1 143 ? 11.604 -2.341  2.316   1.00 40.28  ? 177  ILE B C   1 
ATOM   3961 O O   . ILE B 1 143 ? 12.509 -2.246  1.491   1.00 41.42  ? 177  ILE B O   1 
ATOM   3962 C CB  . ILE B 1 143 ? 10.205 -4.326  1.642   1.00 40.84  ? 177  ILE B CB  1 
ATOM   3963 C CG1 . ILE B 1 143 ? 8.780  -4.772  1.312   1.00 41.62  ? 177  ILE B CG1 1 
ATOM   3964 C CG2 . ILE B 1 143 ? 10.766 -5.084  2.858   1.00 39.30  ? 177  ILE B CG2 1 
ATOM   3965 C CD1 . ILE B 1 143 ? 8.604  -6.269  1.091   1.00 42.40  ? 177  ILE B CD1 1 
ATOM   3966 N N   . CYS B 1 144 ? 11.753 -2.038  3.600   1.00 38.43  ? 178  CYS B N   1 
ATOM   3967 C CA  . CYS B 1 144 ? 13.013 -1.580  4.157   1.00 37.56  ? 178  CYS B CA  1 
ATOM   3968 C C   . CYS B 1 144 ? 13.446 -2.676  5.112   1.00 36.83  ? 178  CYS B C   1 
ATOM   3969 O O   . CYS B 1 144 ? 12.661 -3.125  5.957   1.00 37.44  ? 178  CYS B O   1 
ATOM   3970 C CB  . CYS B 1 144 ? 12.812 -0.246  4.895   1.00 38.72  ? 178  CYS B CB  1 
ATOM   3971 S SG  . CYS B 1 144 ? 14.317 0.539   5.602   1.00 44.36  ? 178  CYS B SG  1 
ATOM   3972 N N   . HIS B 1 145 ? 14.690 -3.127  4.955   1.00 36.03  ? 179  HIS B N   1 
ATOM   3973 C CA  . HIS B 1 145 ? 15.244 -4.201  5.787   1.00 34.90  ? 179  HIS B CA  1 
ATOM   3974 C C   . HIS B 1 145 ? 15.375 -3.747  7.244   1.00 34.65  ? 179  HIS B C   1 
ATOM   3975 O O   . HIS B 1 145 ? 15.017 -4.478  8.173   1.00 31.19  ? 179  HIS B O   1 
ATOM   3976 C CB  . HIS B 1 145 ? 16.607 -4.641  5.226   1.00 32.32  ? 179  HIS B CB  1 
ATOM   3977 C CG  . HIS B 1 145 ? 17.173 -5.840  5.899   1.00 29.69  ? 179  HIS B CG  1 
ATOM   3978 N ND1 . HIS B 1 145 ? 17.738 -5.784  7.157   1.00 27.55  ? 179  HIS B ND1 1 
ATOM   3979 C CD2 . HIS B 1 145 ? 17.190 -7.143  5.534   1.00 28.62  ? 179  HIS B CD2 1 
ATOM   3980 C CE1 . HIS B 1 145 ? 18.071 -7.003  7.538   1.00 27.74  ? 179  HIS B CE1 1 
ATOM   3981 N NE2 . HIS B 1 145 ? 17.748 -7.847  6.570   1.00 30.49  ? 179  HIS B NE2 1 
ATOM   3982 N N   . ARG B 1 146 ? 15.904 -2.535  7.413   1.00 35.38  ? 180  ARG B N   1 
ATOM   3983 C CA  . ARG B 1 146 ? 16.082 -1.897  8.713   1.00 36.59  ? 180  ARG B CA  1 
ATOM   3984 C C   . ARG B 1 146 ? 17.112 -2.492  9.688   1.00 37.50  ? 180  ARG B C   1 
ATOM   3985 O O   . ARG B 1 146 ? 17.203 -2.057  10.841  1.00 38.40  ? 180  ARG B O   1 
ATOM   3986 C CB  . ARG B 1 146 ? 14.719 -1.769  9.389   1.00 36.84  ? 180  ARG B CB  1 
ATOM   3987 C CG  . ARG B 1 146 ? 13.776 -0.886  8.581   1.00 36.45  ? 180  ARG B CG  1 
ATOM   3988 C CD  . ARG B 1 146 ? 12.664 -0.337  9.426   1.00 32.61  ? 180  ARG B CD  1 
ATOM   3989 N NE  . ARG B 1 146 ? 11.953 -1.396  10.115  1.00 33.39  ? 180  ARG B NE  1 
ATOM   3990 C CZ  . ARG B 1 146 ? 10.969 -1.167  10.970  1.00 33.45  ? 180  ARG B CZ  1 
ATOM   3991 N NH1 . ARG B 1 146 ? 10.627 0.094   11.207  1.00 29.59  ? 180  ARG B NH1 1 
ATOM   3992 N NH2 . ARG B 1 146 ? 10.335 -2.185  11.570  1.00 30.96  ? 180  ARG B NH2 1 
ATOM   3993 N N   . ASP B 1 147 ? 17.894 -3.466  9.227   1.00 37.45  ? 181  ASP B N   1 
ATOM   3994 C CA  . ASP B 1 147 ? 18.923 -4.069  10.066  1.00 37.14  ? 181  ASP B CA  1 
ATOM   3995 C C   . ASP B 1 147 ? 20.093 -4.660  9.250   1.00 35.68  ? 181  ASP B C   1 
ATOM   3996 O O   . ASP B 1 147 ? 20.574 -5.766  9.526   1.00 34.16  ? 181  ASP B O   1 
ATOM   3997 C CB  . ASP B 1 147 ? 18.309 -5.140  10.978  1.00 37.90  ? 181  ASP B CB  1 
ATOM   3998 C CG  . ASP B 1 147 ? 19.263 -5.586  12.074  1.00 40.54  ? 181  ASP B CG  1 
ATOM   3999 O OD1 . ASP B 1 147 ? 20.049 -4.733  12.563  1.00 43.05  ? 181  ASP B OD1 1 
ATOM   4000 O OD2 . ASP B 1 147 ? 19.209 -6.772  12.466  1.00 39.60  ? 181  ASP B OD2 1 
ATOM   4001 N N   . ILE B 1 148 ? 20.539 -3.920  8.241   1.00 33.20  ? 182  ILE B N   1 
ATOM   4002 C CA  . ILE B 1 148 ? 21.641 -4.377  7.424   1.00 33.31  ? 182  ILE B CA  1 
ATOM   4003 C C   . ILE B 1 148 ? 22.909 -4.328  8.262   1.00 33.82  ? 182  ILE B C   1 
ATOM   4004 O O   . ILE B 1 148 ? 23.238 -3.300  8.861   1.00 35.42  ? 182  ILE B O   1 
ATOM   4005 C CB  . ILE B 1 148 ? 21.848 -3.475  6.193   1.00 33.82  ? 182  ILE B CB  1 
ATOM   4006 C CG1 . ILE B 1 148 ? 20.579 -3.424  5.345   1.00 31.08  ? 182  ILE B CG1 1 
ATOM   4007 C CG2 . ILE B 1 148 ? 23.037 -3.974  5.381   1.00 32.45  ? 182  ILE B CG2 1 
ATOM   4008 C CD1 . ILE B 1 148 ? 20.181 -4.749  4.747   1.00 32.95  ? 182  ILE B CD1 1 
ATOM   4009 N N   . LYS B 1 149 ? 23.621 -5.444  8.298   1.00 33.73  ? 183  LYS B N   1 
ATOM   4010 C CA  . LYS B 1 149 ? 24.867 -5.553  9.043   1.00 32.56  ? 183  LYS B CA  1 
ATOM   4011 C C   . LYS B 1 149 ? 25.584 -6.808  8.541   1.00 32.71  ? 183  LYS B C   1 
ATOM   4012 O O   . LYS B 1 149 ? 24.947 -7.749  8.065   1.00 32.30  ? 183  LYS B O   1 
ATOM   4013 C CB  . LYS B 1 149 ? 24.581 -5.650  10.529  1.00 28.20  ? 183  LYS B CB  1 
ATOM   4014 C CG  . LYS B 1 149 ? 23.723 -6.822  10.919  1.00 27.46  ? 183  LYS B CG  1 
ATOM   4015 C CD  . LYS B 1 149 ? 23.570 -6.853  12.409  1.00 32.17  ? 183  LYS B CD  1 
ATOM   4016 C CE  . LYS B 1 149 ? 22.376 -7.656  12.827  1.00 34.77  ? 183  LYS B CE  1 
ATOM   4017 N NZ  . LYS B 1 149 ? 22.193 -7.576  14.296  1.00 38.48  ? 183  LYS B NZ  1 
ATOM   4018 N N   . PRO B 1 150 ? 26.920 -6.844  8.653   1.00 32.32  ? 184  PRO B N   1 
ATOM   4019 C CA  . PRO B 1 150 ? 27.717 -7.989  8.193   1.00 34.24  ? 184  PRO B CA  1 
ATOM   4020 C C   . PRO B 1 150 ? 27.173 -9.369  8.563   1.00 32.93  ? 184  PRO B C   1 
ATOM   4021 O O   . PRO B 1 150 ? 27.268 -10.312 7.775   1.00 33.67  ? 184  PRO B O   1 
ATOM   4022 C CB  . PRO B 1 150 ? 29.086 -7.714  8.803   1.00 35.33  ? 184  PRO B CB  1 
ATOM   4023 C CG  . PRO B 1 150 ? 29.128 -6.184  8.872   1.00 33.79  ? 184  PRO B CG  1 
ATOM   4024 C CD  . PRO B 1 150 ? 27.755 -5.876  9.393   1.00 33.33  ? 184  PRO B CD  1 
ATOM   4025 N N   . GLN B 1 151 ? 26.609 -9.495  9.757   1.00 32.17  ? 185  GLN B N   1 
ATOM   4026 C CA  . GLN B 1 151 ? 26.067 -10.780 10.201  1.00 35.60  ? 185  GLN B CA  1 
ATOM   4027 C C   . GLN B 1 151 ? 24.870 -11.277 9.365   1.00 36.58  ? 185  GLN B C   1 
ATOM   4028 O O   . GLN B 1 151 ? 24.612 -12.475 9.297   1.00 37.73  ? 185  GLN B O   1 
ATOM   4029 C CB  . GLN B 1 151 ? 25.652 -10.699 11.673  1.00 35.62  ? 185  GLN B CB  1 
ATOM   4030 C CG  . GLN B 1 151 ? 26.780 -10.430 12.666  1.00 41.57  ? 185  GLN B CG  1 
ATOM   4031 C CD  . GLN B 1 151 ? 27.015 -8.935  12.949  1.00 46.54  ? 185  GLN B CD  1 
ATOM   4032 O OE1 . GLN B 1 151 ? 27.174 -8.541  14.112  1.00 48.85  ? 185  GLN B OE1 1 
ATOM   4033 N NE2 . GLN B 1 151 ? 27.054 -8.105  11.893  1.00 44.86  ? 185  GLN B NE2 1 
ATOM   4034 N N   . ASN B 1 152 ? 24.148 -10.352 8.735   1.00 37.61  ? 186  ASN B N   1 
ATOM   4035 C CA  . ASN B 1 152 ? 22.979 -10.688 7.935   1.00 37.57  ? 186  ASN B CA  1 
ATOM   4036 C C   . ASN B 1 152 ? 23.289 -10.828 6.457   1.00 37.76  ? 186  ASN B C   1 
ATOM   4037 O O   . ASN B 1 152 ? 22.384 -10.892 5.633   1.00 39.57  ? 186  ASN B O   1 
ATOM   4038 C CB  . ASN B 1 152 ? 21.883 -9.632  8.109   1.00 38.84  ? 186  ASN B CB  1 
ATOM   4039 C CG  . ASN B 1 152 ? 21.332 -9.591  9.510   1.00 42.36  ? 186  ASN B CG  1 
ATOM   4040 O OD1 . ASN B 1 152 ? 21.172 -10.624 10.160  1.00 43.80  ? 186  ASN B OD1 1 
ATOM   4041 N ND2 . ASN B 1 152 ? 21.014 -8.392  9.983   1.00 44.42  ? 186  ASN B ND2 1 
ATOM   4042 N N   . LEU B 1 153 ? 24.562 -10.846 6.104   1.00 36.07  ? 187  LEU B N   1 
ATOM   4043 C CA  . LEU B 1 153 ? 24.925 -10.998 4.708   1.00 35.47  ? 187  LEU B CA  1 
ATOM   4044 C C   . LEU B 1 153 ? 25.567 -12.377 4.544   1.00 36.37  ? 187  LEU B C   1 
ATOM   4045 O O   . LEU B 1 153 ? 26.749 -12.555 4.814   1.00 36.71  ? 187  LEU B O   1 
ATOM   4046 C CB  . LEU B 1 153 ? 25.882 -9.875  4.297   1.00 33.82  ? 187  LEU B CB  1 
ATOM   4047 C CG  . LEU B 1 153 ? 25.360 -8.464  4.603   1.00 34.86  ? 187  LEU B CG  1 
ATOM   4048 C CD1 . LEU B 1 153 ? 26.370 -7.410  4.139   1.00 32.53  ? 187  LEU B CD1 1 
ATOM   4049 C CD2 . LEU B 1 153 ? 24.003 -8.244  3.906   1.00 33.19  ? 187  LEU B CD2 1 
ATOM   4050 N N   . LEU B 1 154 ? 24.770 -13.356 4.130   1.00 37.53  ? 188  LEU B N   1 
ATOM   4051 C CA  . LEU B 1 154 ? 25.268 -14.712 3.943   1.00 40.43  ? 188  LEU B CA  1 
ATOM   4052 C C   . LEU B 1 154 ? 26.118 -14.807 2.684   1.00 42.11  ? 188  LEU B C   1 
ATOM   4053 O O   . LEU B 1 154 ? 25.820 -14.167 1.679   1.00 41.28  ? 188  LEU B O   1 
ATOM   4054 C CB  . LEU B 1 154 ? 24.101 -15.697 3.862   1.00 41.37  ? 188  LEU B CB  1 
ATOM   4055 C CG  . LEU B 1 154 ? 23.023 -15.485 4.940   1.00 41.92  ? 188  LEU B CG  1 
ATOM   4056 C CD1 . LEU B 1 154 ? 22.084 -16.675 4.945   1.00 40.59  ? 188  LEU B CD1 1 
ATOM   4057 C CD2 . LEU B 1 154 ? 23.664 -15.290 6.310   1.00 37.72  ? 188  LEU B CD2 1 
ATOM   4058 N N   . LEU B 1 155 ? 27.176 -15.613 2.752   1.00 43.88  ? 189  LEU B N   1 
ATOM   4059 C CA  . LEU B 1 155 ? 28.095 -15.796 1.633   1.00 45.21  ? 189  LEU B CA  1 
ATOM   4060 C C   . LEU B 1 155 ? 28.371 -17.251 1.297   1.00 46.86  ? 189  LEU B C   1 
ATOM   4061 O O   . LEU B 1 155 ? 28.276 -18.132 2.145   1.00 47.38  ? 189  LEU B O   1 
ATOM   4062 C CB  . LEU B 1 155 ? 29.441 -15.140 1.942   1.00 45.00  ? 189  LEU B CB  1 
ATOM   4063 C CG  . LEU B 1 155 ? 29.576 -13.630 1.960   1.00 46.68  ? 189  LEU B CG  1 
ATOM   4064 C CD1 . LEU B 1 155 ? 30.977 -13.298 2.421   1.00 47.72  ? 189  LEU B CD1 1 
ATOM   4065 C CD2 . LEU B 1 155 ? 29.317 -13.049 0.570   1.00 46.70  ? 189  LEU B CD2 1 
ATOM   4066 N N   . ASP B 1 156 ? 28.717 -17.493 0.040   1.00 49.90  ? 190  ASP B N   1 
ATOM   4067 C CA  . ASP B 1 156 ? 29.087 -18.825 -0.401  1.00 52.52  ? 190  ASP B CA  1 
ATOM   4068 C C   . ASP B 1 156 ? 30.511 -18.649 -0.907  1.00 54.77  ? 190  ASP B C   1 
ATOM   4069 O O   . ASP B 1 156 ? 30.742 -17.964 -1.907  1.00 54.24  ? 190  ASP B O   1 
ATOM   4070 C CB  . ASP B 1 156 ? 28.198 -19.320 -1.532  1.00 53.77  ? 190  ASP B CB  1 
ATOM   4071 C CG  . ASP B 1 156 ? 28.575 -20.721 -1.991  1.00 56.26  ? 190  ASP B CG  1 
ATOM   4072 O OD1 . ASP B 1 156 ? 29.695 -20.924 -2.503  1.00 58.74  ? 190  ASP B OD1 1 
ATOM   4073 O OD2 . ASP B 1 156 ? 27.755 -21.638 -1.831  1.00 59.22  ? 190  ASP B OD2 1 
ATOM   4074 N N   . PRO B 1 157 ? 31.483 -19.262 -0.216  1.00 57.15  ? 191  PRO B N   1 
ATOM   4075 C CA  . PRO B 1 157 ? 32.910 -19.200 -0.551  1.00 58.54  ? 191  PRO B CA  1 
ATOM   4076 C C   . PRO B 1 157 ? 33.238 -19.433 -2.025  1.00 58.59  ? 191  PRO B C   1 
ATOM   4077 O O   . PRO B 1 157 ? 33.902 -18.613 -2.664  1.00 58.07  ? 191  PRO B O   1 
ATOM   4078 C CB  . PRO B 1 157 ? 33.515 -20.290 0.328   1.00 60.07  ? 191  PRO B CB  1 
ATOM   4079 C CG  . PRO B 1 157 ? 32.612 -20.301 1.518   1.00 60.48  ? 191  PRO B CG  1 
ATOM   4080 C CD  . PRO B 1 157 ? 31.251 -20.209 0.889   1.00 58.71  ? 191  PRO B CD  1 
ATOM   4081 N N   . ASP B 1 158 ? 32.756 -20.555 -2.552  1.00 57.47  ? 192  ASP B N   1 
ATOM   4082 C CA  . ASP B 1 158 ? 33.027 -20.943 -3.923  1.00 56.89  ? 192  ASP B CA  1 
ATOM   4083 C C   . ASP B 1 158 ? 32.438 -20.064 -5.010  1.00 55.07  ? 192  ASP B C   1 
ATOM   4084 O O   . ASP B 1 158 ? 33.154 -19.627 -5.909  1.00 54.81  ? 192  ASP B O   1 
ATOM   4085 C CB  . ASP B 1 158 ? 32.566 -22.383 -4.163  1.00 60.38  ? 192  ASP B CB  1 
ATOM   4086 C CG  . ASP B 1 158 ? 32.942 -23.323 -3.026  1.00 63.25  ? 192  ASP B CG  1 
ATOM   4087 O OD1 . ASP B 1 158 ? 34.059 -23.175 -2.461  1.00 61.70  ? 192  ASP B OD1 1 
ATOM   4088 O OD2 . ASP B 1 158 ? 32.116 -24.223 -2.715  1.00 64.18  ? 192  ASP B OD2 1 
ATOM   4089 N N   . THR B 1 159 ? 31.135 -19.817 -4.944  1.00 52.41  ? 193  THR B N   1 
ATOM   4090 C CA  . THR B 1 159 ? 30.477 -19.018 -5.971  1.00 49.27  ? 193  THR B CA  1 
ATOM   4091 C C   . THR B 1 159 ? 30.576 -17.516 -5.781  1.00 46.52  ? 193  THR B C   1 
ATOM   4092 O O   . THR B 1 159 ? 30.371 -16.763 -6.721  1.00 45.54  ? 193  THR B O   1 
ATOM   4093 C CB  . THR B 1 159 ? 29.010 -19.385 -6.087  1.00 49.59  ? 193  THR B CB  1 
ATOM   4094 O OG1 . THR B 1 159 ? 28.335 -19.022 -4.881  1.00 51.56  ? 193  THR B OG1 1 
ATOM   4095 C CG2 . THR B 1 159 ? 28.861 -20.881 -6.321  1.00 49.81  ? 193  THR B CG2 1 
ATOM   4096 N N   . ALA B 1 160 ? 30.896 -17.079 -4.569  1.00 43.59  ? 194  ALA B N   1 
ATOM   4097 C CA  . ALA B 1 160 ? 31.016 -15.649 -4.282  1.00 42.43  ? 194  ALA B CA  1 
ATOM   4098 C C   . ALA B 1 160 ? 29.648 -14.940 -4.320  1.00 41.57  ? 194  ALA B C   1 
ATOM   4099 O O   . ALA B 1 160 ? 29.565 -13.724 -4.469  1.00 41.02  ? 194  ALA B O   1 
ATOM   4100 C CB  . ALA B 1 160 ? 31.976 -14.996 -5.269  1.00 39.66  ? 194  ALA B CB  1 
ATOM   4101 N N   . VAL B 1 161 ? 28.584 -15.719 -4.170  1.00 40.62  ? 195  VAL B N   1 
ATOM   4102 C CA  . VAL B 1 161 ? 27.232 -15.204 -4.163  1.00 39.21  ? 195  VAL B CA  1 
ATOM   4103 C C   . VAL B 1 161 ? 26.886 -14.729 -2.763  1.00 39.97  ? 195  VAL B C   1 
ATOM   4104 O O   . VAL B 1 161 ? 27.172 -15.407 -1.769  1.00 40.60  ? 195  VAL B O   1 
ATOM   4105 C CB  . VAL B 1 161 ? 26.233 -16.296 -4.599  1.00 38.64  ? 195  VAL B CB  1 
ATOM   4106 C CG1 . VAL B 1 161 ? 24.803 -15.791 -4.471  1.00 38.45  ? 195  VAL B CG1 1 
ATOM   4107 C CG2 . VAL B 1 161 ? 26.511 -16.695 -6.040  1.00 39.08  ? 195  VAL B CG2 1 
ATOM   4108 N N   . LEU B 1 162 ? 26.286 -13.547 -2.684  1.00 38.09  ? 196  LEU B N   1 
ATOM   4109 C CA  . LEU B 1 162 ? 25.888 -12.980 -1.400  1.00 36.09  ? 196  LEU B CA  1 
ATOM   4110 C C   . LEU B 1 162 ? 24.356 -12.910 -1.349  1.00 36.39  ? 196  LEU B C   1 
ATOM   4111 O O   . LEU B 1 162 ? 23.714 -12.555 -2.332  1.00 37.46  ? 196  LEU B O   1 
ATOM   4112 C CB  . LEU B 1 162 ? 26.495 -11.580 -1.242  1.00 34.50  ? 196  LEU B CB  1 
ATOM   4113 C CG  . LEU B 1 162 ? 26.050 -10.750 -0.027  1.00 32.87  ? 196  LEU B CG  1 
ATOM   4114 C CD1 . LEU B 1 162 ? 27.033 -9.626  0.214   1.00 31.06  ? 196  LEU B CD1 1 
ATOM   4115 C CD2 . LEU B 1 162 ? 24.647 -10.197 -0.257  1.00 31.23  ? 196  LEU B CD2 1 
ATOM   4116 N N   . LYS B 1 163 ? 23.793 -13.245 -0.197  1.00 34.87  ? 197  LYS B N   1 
ATOM   4117 C CA  . LYS B 1 163 ? 22.358 -13.243 0.015   1.00 34.15  ? 197  LYS B CA  1 
ATOM   4118 C C   . LYS B 1 163 ? 21.977 -12.538 1.321   1.00 35.25  ? 197  LYS B C   1 
ATOM   4119 O O   . LYS B 1 163 ? 22.529 -12.831 2.387   1.00 35.16  ? 197  LYS B O   1 
ATOM   4120 C CB  . LYS B 1 163 ? 21.826 -14.676 0.066   1.00 34.13  ? 197  LYS B CB  1 
ATOM   4121 C CG  . LYS B 1 163 ? 21.963 -15.484 -1.220  1.00 36.49  ? 197  LYS B CG  1 
ATOM   4122 C CD  . LYS B 1 163 ? 21.341 -16.871 -1.027  1.00 40.15  ? 197  LYS B CD  1 
ATOM   4123 C CE  . LYS B 1 163 ? 21.532 -17.799 -2.240  1.00 44.64  ? 197  LYS B CE  1 
ATOM   4124 N NZ  . LYS B 1 163 ? 20.864 -17.335 -3.502  1.00 45.24  ? 197  LYS B NZ  1 
ATOM   4125 N N   . LEU B 1 164 ? 21.031 -11.606 1.245   1.00 35.80  ? 198  LEU B N   1 
ATOM   4126 C CA  . LEU B 1 164 ? 20.576 -10.890 2.432   1.00 34.59  ? 198  LEU B CA  1 
ATOM   4127 C C   . LEU B 1 164 ? 19.662 -11.829 3.225   1.00 34.75  ? 198  LEU B C   1 
ATOM   4128 O O   . LEU B 1 164 ? 18.906 -12.607 2.651   1.00 33.74  ? 198  LEU B O   1 
ATOM   4129 C CB  . LEU B 1 164 ? 19.824 -9.637  1.998   1.00 34.41  ? 198  LEU B CB  1 
ATOM   4130 C CG  . LEU B 1 164 ? 19.254 -8.680  3.039   1.00 36.59  ? 198  LEU B CG  1 
ATOM   4131 C CD1 . LEU B 1 164 ? 20.347 -8.154  3.967   1.00 35.27  ? 198  LEU B CD1 1 
ATOM   4132 C CD2 . LEU B 1 164 ? 18.571 -7.521  2.307   1.00 36.24  ? 198  LEU B CD2 1 
ATOM   4133 N N   . CYS B 1 165 ? 19.752 -11.782 4.546   1.00 37.41  ? 199  CYS B N   1 
ATOM   4134 C CA  . CYS B 1 165 ? 18.918 -12.635 5.389   1.00 38.47  ? 199  CYS B CA  1 
ATOM   4135 C C   . CYS B 1 165 ? 18.387 -11.824 6.561   1.00 37.98  ? 199  CYS B C   1 
ATOM   4136 O O   . CYS B 1 165 ? 18.595 -10.615 6.647   1.00 36.54  ? 199  CYS B O   1 
ATOM   4137 C CB  . CYS B 1 165 ? 19.714 -13.840 5.916   1.00 39.79  ? 199  CYS B CB  1 
ATOM   4138 S SG  . CYS B 1 165 ? 18.668 -15.242 6.481   1.00 49.32  ? 199  CYS B SG  1 
ATOM   4139 N N   . ASP B 1 166 ? 17.695 -12.515 7.452   1.00 38.77  ? 200  ASP B N   1 
ATOM   4140 C CA  . ASP B 1 166 ? 17.108 -11.926 8.640   1.00 40.92  ? 200  ASP B CA  1 
ATOM   4141 C C   . ASP B 1 166 ? 16.186 -10.728 8.357   1.00 41.88  ? 200  ASP B C   1 
ATOM   4142 O O   . ASP B 1 166 ? 16.577 -9.566  8.523   1.00 41.87  ? 200  ASP B O   1 
ATOM   4143 C CB  . ASP B 1 166 ? 18.197 -11.499 9.628   1.00 44.39  ? 200  ASP B CB  1 
ATOM   4144 C CG  . ASP B 1 166 ? 17.667 -11.368 11.051  1.00 50.79  ? 200  ASP B CG  1 
ATOM   4145 O OD1 . ASP B 1 166 ? 16.533 -10.864 11.221  1.00 50.98  ? 200  ASP B OD1 1 
ATOM   4146 O OD2 . ASP B 1 166 ? 18.381 -11.760 12.007  1.00 54.61  ? 200  ASP B OD2 1 
ATOM   4147 N N   . PHE B 1 167 ? 14.953 -11.016 7.949   1.00 40.67  ? 201  PHE B N   1 
ATOM   4148 C CA  . PHE B 1 167 ? 13.983 -9.971  7.673   1.00 38.10  ? 201  PHE B CA  1 
ATOM   4149 C C   . PHE B 1 167 ? 13.075 -9.716  8.858   1.00 38.21  ? 201  PHE B C   1 
ATOM   4150 O O   . PHE B 1 167 ? 12.003 -9.150  8.705   1.00 38.95  ? 201  PHE B O   1 
ATOM   4151 C CB  . PHE B 1 167 ? 13.157 -10.329 6.434   1.00 36.24  ? 201  PHE B CB  1 
ATOM   4152 C CG  . PHE B 1 167 ? 13.901 -10.136 5.156   1.00 33.92  ? 201  PHE B CG  1 
ATOM   4153 C CD1 . PHE B 1 167 ? 14.889 -11.028 4.785   1.00 32.55  ? 201  PHE B CD1 1 
ATOM   4154 C CD2 . PHE B 1 167 ? 13.686 -9.001  4.377   1.00 31.75  ? 201  PHE B CD2 1 
ATOM   4155 C CE1 . PHE B 1 167 ? 15.663 -10.797 3.663   1.00 32.96  ? 201  PHE B CE1 1 
ATOM   4156 C CE2 . PHE B 1 167 ? 14.450 -8.752  3.253   1.00 31.10  ? 201  PHE B CE2 1 
ATOM   4157 C CZ  . PHE B 1 167 ? 15.447 -9.652  2.894   1.00 34.32  ? 201  PHE B CZ  1 
ATOM   4158 N N   . GLY B 1 168 ? 13.522 -10.131 10.038  1.00 37.52  ? 202  GLY B N   1 
ATOM   4159 C CA  . GLY B 1 168 ? 12.749 -9.926  11.246  1.00 37.84  ? 202  GLY B CA  1 
ATOM   4160 C C   . GLY B 1 168 ? 12.478 -8.475  11.621  1.00 38.88  ? 202  GLY B C   1 
ATOM   4161 O O   . GLY B 1 168 ? 11.593 -8.200  12.435  1.00 41.70  ? 202  GLY B O   1 
ATOM   4162 N N   . SER B 1 169 ? 13.219 -7.537  11.043  1.00 38.73  ? 203  SER B N   1 
ATOM   4163 C CA  . SER B 1 169 ? 13.000 -6.130  11.347  1.00 39.08  ? 203  SER B CA  1 
ATOM   4164 C C   . SER B 1 169 ? 12.447 -5.397  10.140  1.00 40.18  ? 203  SER B C   1 
ATOM   4165 O O   . SER B 1 169 ? 12.169 -4.196  10.221  1.00 40.93  ? 203  SER B O   1 
ATOM   4166 C CB  . SER B 1 169 ? 14.302 -5.449  11.776  1.00 38.50  ? 203  SER B CB  1 
ATOM   4167 O OG  . SER B 1 169 ? 14.719 -5.901  13.054  1.00 41.12  ? 203  SER B OG  1 
ATOM   4168 N N   . ALA B 1 170 ? 12.285 -6.114  9.027   1.00 38.72  ? 204  ALA B N   1 
ATOM   4169 C CA  . ALA B 1 170 ? 11.798 -5.504  7.794   1.00 39.44  ? 204  ALA B CA  1 
ATOM   4170 C C   . ALA B 1 170 ? 10.347 -5.048  7.867   1.00 41.41  ? 204  ALA B C   1 
ATOM   4171 O O   . ALA B 1 170 ? 9.522  -5.627  8.582   1.00 39.34  ? 204  ALA B O   1 
ATOM   4172 C CB  . ALA B 1 170 ? 11.985 -6.458  6.634   1.00 39.67  ? 204  ALA B CB  1 
ATOM   4173 N N   . LYS B 1 171 ? 10.042 -4.003  7.107   1.00 43.14  ? 205  LYS B N   1 
ATOM   4174 C CA  . LYS B 1 171 ? 8.704  -3.445  7.102   1.00 44.57  ? 205  LYS B CA  1 
ATOM   4175 C C   . LYS B 1 171 ? 8.378  -2.637  5.845   1.00 46.94  ? 205  LYS B C   1 
ATOM   4176 O O   . LYS B 1 171 ? 9.247  -1.990  5.256   1.00 47.33  ? 205  LYS B O   1 
ATOM   4177 C CB  . LYS B 1 171 ? 8.543  -2.540  8.318   1.00 44.99  ? 205  LYS B CB  1 
ATOM   4178 C CG  . LYS B 1 171 ? 7.161  -1.966  8.458   1.00 46.42  ? 205  LYS B CG  1 
ATOM   4179 C CD  . LYS B 1 171 ? 7.149  -0.793  9.404   1.00 47.90  ? 205  LYS B CD  1 
ATOM   4180 C CE  . LYS B 1 171 ? 5.745  -0.194  9.523   1.00 46.67  ? 205  LYS B CE  1 
ATOM   4181 N NZ  . LYS B 1 171 ? 5.761  1.048   10.353  1.00 45.46  ? 205  LYS B NZ  1 
ATOM   4182 N N   . GLN B 1 172 ? 7.114  -2.674  5.443   1.00 48.85  ? 206  GLN B N   1 
ATOM   4183 C CA  . GLN B 1 172 ? 6.660  -1.914  4.287   1.00 50.32  ? 206  GLN B CA  1 
ATOM   4184 C C   . GLN B 1 172 ? 6.563  -0.471  4.806   1.00 49.51  ? 206  GLN B C   1 
ATOM   4185 O O   . GLN B 1 172 ? 5.730  -0.187  5.661   1.00 48.18  ? 206  GLN B O   1 
ATOM   4186 C CB  . GLN B 1 172 ? 5.272  -2.406  3.871   1.00 54.24  ? 206  GLN B CB  1 
ATOM   4187 C CG  . GLN B 1 172 ? 4.924  -2.302  2.381   1.00 59.59  ? 206  GLN B CG  1 
ATOM   4188 C CD  . GLN B 1 172 ? 5.218  -3.610  1.625   1.00 63.59  ? 206  GLN B CD  1 
ATOM   4189 O OE1 . GLN B 1 172 ? 4.929  -4.718  2.112   1.00 62.83  ? 206  GLN B OE1 1 
ATOM   4190 N NE2 . GLN B 1 172 ? 5.767  -3.483  0.423   1.00 65.61  ? 206  GLN B NE2 1 
ATOM   4191 N N   . LEU B 1 173 ? 7.416  0.432   4.328   1.00 49.67  ? 207  LEU B N   1 
ATOM   4192 C CA  . LEU B 1 173 ? 7.359  1.817   4.798   1.00 49.70  ? 207  LEU B CA  1 
ATOM   4193 C C   . LEU B 1 173 ? 6.420  2.672   3.973   1.00 53.96  ? 207  LEU B C   1 
ATOM   4194 O O   . LEU B 1 173 ? 6.695  2.983   2.812   1.00 55.74  ? 207  LEU B O   1 
ATOM   4195 C CB  . LEU B 1 173 ? 8.723  2.481   4.772   1.00 44.89  ? 207  LEU B CB  1 
ATOM   4196 C CG  . LEU B 1 173 ? 9.815  1.927   5.670   1.00 44.72  ? 207  LEU B CG  1 
ATOM   4197 C CD1 . LEU B 1 173 ? 10.996 2.886   5.597   1.00 42.76  ? 207  LEU B CD1 1 
ATOM   4198 C CD2 . LEU B 1 173 ? 9.327  1.768   7.113   1.00 41.24  ? 207  LEU B CD2 1 
ATOM   4199 N N   . VAL B 1 174 ? 5.321  3.077   4.598   1.00 56.17  ? 208  VAL B N   1 
ATOM   4200 C CA  . VAL B 1 174 ? 4.308  3.890   3.950   1.00 56.86  ? 208  VAL B CA  1 
ATOM   4201 C C   . VAL B 1 174 ? 4.453  5.346   4.352   1.00 58.92  ? 208  VAL B C   1 
ATOM   4202 O O   . VAL B 1 174 ? 4.565  5.649   5.539   1.00 60.61  ? 208  VAL B O   1 
ATOM   4203 C CB  . VAL B 1 174 ? 2.917  3.400   4.355   1.00 56.35  ? 208  VAL B CB  1 
ATOM   4204 C CG1 . VAL B 1 174 ? 1.859  4.191   3.624   1.00 54.94  ? 208  VAL B CG1 1 
ATOM   4205 C CG2 . VAL B 1 174 ? 2.800  1.907   4.076   1.00 53.96  ? 208  VAL B CG2 1 
ATOM   4206 N N   . ARG B 1 175 ? 4.448  6.249   3.375   1.00 61.27  ? 209  ARG B N   1 
ATOM   4207 C CA  . ARG B 1 175 ? 4.574  7.677   3.667   1.00 62.87  ? 209  ARG B CA  1 
ATOM   4208 C C   . ARG B 1 175 ? 3.492  8.148   4.635   1.00 62.75  ? 209  ARG B C   1 
ATOM   4209 O O   . ARG B 1 175 ? 2.326  7.768   4.514   1.00 61.90  ? 209  ARG B O   1 
ATOM   4210 C CB  . ARG B 1 175 ? 4.467  8.490   2.385   1.00 66.17  ? 209  ARG B CB  1 
ATOM   4211 C CG  . ARG B 1 175 ? 5.769  9.080   1.918   1.00 71.87  ? 209  ARG B CG  1 
ATOM   4212 C CD  . ARG B 1 175 ? 5.511  10.099  0.824   1.00 77.38  ? 209  ARG B CD  1 
ATOM   4213 N NE  . ARG B 1 175 ? 6.753  10.593  0.242   1.00 82.56  ? 209  ARG B NE  1 
ATOM   4214 C CZ  . ARG B 1 175 ? 6.812  11.474  -0.751  1.00 84.99  ? 209  ARG B CZ  1 
ATOM   4215 N NH1 . ARG B 1 175 ? 5.688  11.962  -1.275  1.00 86.05  ? 209  ARG B NH1 1 
ATOM   4216 N NH2 . ARG B 1 175 ? 7.993  11.862  -1.224  1.00 85.48  ? 209  ARG B NH2 1 
ATOM   4217 N N   . GLY B 1 176 ? 3.883  8.976   5.596   1.00 61.89  ? 210  GLY B N   1 
ATOM   4218 C CA  . GLY B 1 176 ? 2.921  9.477   6.554   1.00 62.07  ? 210  GLY B CA  1 
ATOM   4219 C C   . GLY B 1 176 ? 2.666  8.569   7.741   1.00 62.56  ? 210  GLY B C   1 
ATOM   4220 O O   . GLY B 1 176 ? 2.064  8.998   8.728   1.00 62.13  ? 210  GLY B O   1 
ATOM   4221 N N   . GLU B 1 177 ? 3.101  7.315   7.660   1.00 62.55  ? 211  GLU B N   1 
ATOM   4222 C CA  . GLU B 1 177 ? 2.913  6.403   8.784   1.00 63.52  ? 211  GLU B CA  1 
ATOM   4223 C C   . GLU B 1 177 ? 4.196  6.290   9.592   1.00 62.07  ? 211  GLU B C   1 
ATOM   4224 O O   . GLU B 1 177 ? 5.260  6.021   9.046   1.00 63.12  ? 211  GLU B O   1 
ATOM   4225 C CB  . GLU B 1 177 ? 2.492  5.032   8.301   1.00 65.58  ? 211  GLU B CB  1 
ATOM   4226 C CG  . GLU B 1 177 ? 1.305  5.089   7.384   1.00 70.53  ? 211  GLU B CG  1 
ATOM   4227 C CD  . GLU B 1 177 ? 0.674  3.740   7.191   1.00 73.56  ? 211  GLU B CD  1 
ATOM   4228 O OE1 . GLU B 1 177 ? 1.425  2.739   7.062   1.00 76.48  ? 211  GLU B OE1 1 
ATOM   4229 O OE2 . GLU B 1 177 ? -0.576 3.687   7.154   1.00 74.98  ? 211  GLU B OE2 1 
ATOM   4230 N N   . PRO B 1 178 ? 4.106  6.503   10.914  1.00 60.43  ? 212  PRO B N   1 
ATOM   4231 C CA  . PRO B 1 178 ? 5.237  6.441   11.843  1.00 57.68  ? 212  PRO B CA  1 
ATOM   4232 C C   . PRO B 1 178 ? 5.900  5.073   11.928  1.00 54.22  ? 212  PRO B C   1 
ATOM   4233 O O   . PRO B 1 178 ? 5.232  4.039   11.909  1.00 53.83  ? 212  PRO B O   1 
ATOM   4234 C CB  . PRO B 1 178 ? 4.609  6.836   13.181  1.00 57.80  ? 212  PRO B CB  1 
ATOM   4235 C CG  . PRO B 1 178 ? 3.473  7.679   12.790  1.00 59.31  ? 212  PRO B CG  1 
ATOM   4236 C CD  . PRO B 1 178 ? 2.891  6.929   11.626  1.00 59.80  ? 212  PRO B CD  1 
ATOM   4237 N N   . ASN B 1 179 ? 7.220  5.089   12.046  1.00 50.55  ? 213  ASN B N   1 
ATOM   4238 C CA  . ASN B 1 179 ? 8.001  3.873   12.168  1.00 47.51  ? 213  ASN B CA  1 
ATOM   4239 C C   . ASN B 1 179 ? 8.859  3.981   13.431  1.00 45.40  ? 213  ASN B C   1 
ATOM   4240 O O   . ASN B 1 179 ? 9.374  5.061   13.731  1.00 43.34  ? 213  ASN B O   1 
ATOM   4241 C CB  . ASN B 1 179 ? 8.866  3.719   10.927  1.00 46.89  ? 213  ASN B CB  1 
ATOM   4242 C CG  . ASN B 1 179 ? 8.043  3.721   9.661   1.00 48.62  ? 213  ASN B CG  1 
ATOM   4243 O OD1 . ASN B 1 179 ? 7.151  2.883   9.489   1.00 47.86  ? 213  ASN B OD1 1 
ATOM   4244 N ND2 . ASN B 1 179 ? 8.330  4.662   8.763   1.00 48.12  ? 213  ASN B ND2 1 
ATOM   4245 N N   . VAL B 1 180 ? 8.997  2.880   14.177  1.00 42.60  ? 214  VAL B N   1 
ATOM   4246 C CA  . VAL B 1 180 ? 9.799  2.892   15.405  1.00 40.73  ? 214  VAL B CA  1 
ATOM   4247 C C   . VAL B 1 180 ? 11.250 3.254   15.094  1.00 40.43  ? 214  VAL B C   1 
ATOM   4248 O O   . VAL B 1 180 ? 11.765 2.931   14.019  1.00 38.65  ? 214  VAL B O   1 
ATOM   4249 C CB  . VAL B 1 180 ? 9.756  1.524   16.133  1.00 41.12  ? 214  VAL B CB  1 
ATOM   4250 C CG1 . VAL B 1 180 ? 8.307  1.132   16.399  1.00 38.08  ? 214  VAL B CG1 1 
ATOM   4251 C CG2 . VAL B 1 180 ? 10.476 0.455   15.322  1.00 39.75  ? 214  VAL B CG2 1 
ATOM   4252 N N   . SER B 1 181 ? 11.917 3.934   16.019  1.00 40.75  ? 215  SER B N   1 
ATOM   4253 C CA  . SER B 1 181 ? 13.297 4.340   15.758  1.00 42.53  ? 215  SER B CA  1 
ATOM   4254 C C   . SER B 1 181 ? 14.334 3.493   16.474  1.00 42.47  ? 215  SER B C   1 
ATOM   4255 O O   . SER B 1 181 ? 15.530 3.790   16.417  1.00 42.93  ? 215  SER B O   1 
ATOM   4256 C CB  . SER B 1 181 ? 13.495 5.817   16.122  1.00 43.24  ? 215  SER B CB  1 
ATOM   4257 O OG  . SER B 1 181 ? 13.089 6.062   17.454  1.00 45.86  ? 215  SER B OG  1 
ATOM   4258 N N   . TYR B 1 182 ? 13.871 2.436   17.136  1.00 42.22  ? 216  TYR B N   1 
ATOM   4259 C CA  . TYR B 1 182 ? 14.767 1.566   17.859  1.00 42.24  ? 216  TYR B CA  1 
ATOM   4260 C C   . TYR B 1 182 ? 15.162 0.307   17.094  1.00 42.80  ? 216  TYR B C   1 
ATOM   4261 O O   . TYR B 1 182 ? 15.454 -0.718  17.707  1.00 45.29  ? 216  TYR B O   1 
ATOM   4262 C CB  . TYR B 1 182 ? 14.181 1.215   19.236  1.00 41.55  ? 216  TYR B CB  1 
ATOM   4263 C CG  . TYR B 1 182 ? 12.792 0.639   19.215  1.00 43.04  ? 216  TYR B CG  1 
ATOM   4264 C CD1 . TYR B 1 182 ? 12.577 -0.696  18.888  1.00 44.02  ? 216  TYR B CD1 1 
ATOM   4265 C CD2 . TYR B 1 182 ? 11.683 1.428   19.536  1.00 44.08  ? 216  TYR B CD2 1 
ATOM   4266 C CE1 . TYR B 1 182 ? 11.285 -1.237  18.887  1.00 45.56  ? 216  TYR B CE1 1 
ATOM   4267 C CE2 . TYR B 1 182 ? 10.389 0.903   19.531  1.00 43.53  ? 216  TYR B CE2 1 
ATOM   4268 C CZ  . TYR B 1 182 ? 10.192 -0.428  19.209  1.00 46.07  ? 216  TYR B CZ  1 
ATOM   4269 O OH  . TYR B 1 182 ? 8.907  -0.955  19.204  1.00 47.21  ? 216  TYR B OH  1 
ATOM   4270 N N   . ILE B 1 183 ? 15.171 0.367   15.760  1.00 40.46  ? 217  ILE B N   1 
ATOM   4271 C CA  . ILE B 1 183 ? 15.608 -0.796  14.979  1.00 38.92  ? 217  ILE B CA  1 
ATOM   4272 C C   . ILE B 1 183 ? 17.020 -0.528  14.460  1.00 38.55  ? 217  ILE B C   1 
ATOM   4273 O O   . ILE B 1 183 ? 17.546 0.579   14.618  1.00 38.28  ? 217  ILE B O   1 
ATOM   4274 C CB  . ILE B 1 183 ? 14.653 -1.157  13.739  1.00 39.34  ? 217  ILE B CB  1 
ATOM   4275 C CG1 . ILE B 1 183 ? 14.740 -0.116  12.601  1.00 36.23  ? 217  ILE B CG1 1 
ATOM   4276 C CG2 . ILE B 1 183 ? 13.254 -1.408  14.217  1.00 39.44  ? 217  ILE B CG2 1 
ATOM   4277 C CD1 . ILE B 1 183 ? 14.482 1.291   12.980  1.00 38.23  ? 217  ILE B CD1 1 
ATOM   4278 N N   . CYS B 1 184 ? 17.626 -1.544  13.857  1.00 37.06  ? 218  CYS B N   1 
ATOM   4279 C CA  . CYS B 1 184 ? 18.968 -1.413  13.308  1.00 39.63  ? 218  CYS B CA  1 
ATOM   4280 C C   . CYS B 1 184 ? 20.045 -1.561  14.405  1.00 40.20  ? 218  CYS B C   1 
ATOM   4281 O O   . CYS B 1 184 ? 19.885 -1.074  15.518  1.00 40.84  ? 218  CYS B O   1 
ATOM   4282 C CB  . CYS B 1 184 ? 19.088 -0.061  12.600  1.00 37.80  ? 218  CYS B CB  1 
ATOM   4283 S SG  . CYS B 1 184 ? 20.315 0.036   11.306  1.00 44.87  ? 218  CYS B SG  1 
ATOM   4284 N N   . SER B 1 185 ? 21.141 -2.238  14.085  1.00 41.93  ? 219  SER B N   1 
ATOM   4285 C CA  . SER B 1 185 ? 22.202 -2.459  15.058  1.00 42.47  ? 219  SER B CA  1 
ATOM   4286 C C   . SER B 1 185 ? 23.252 -1.354  15.153  1.00 43.04  ? 219  SER B C   1 
ATOM   4287 O O   . SER B 1 185 ? 23.572 -0.685  14.177  1.00 44.00  ? 219  SER B O   1 
ATOM   4288 C CB  . SER B 1 185 ? 22.885 -3.797  14.776  1.00 43.60  ? 219  SER B CB  1 
ATOM   4289 O OG  . SER B 1 185 ? 21.949 -4.860  14.815  1.00 44.39  ? 219  SER B OG  1 
ATOM   4290 N N   . ARG B 1 186 ? 23.788 -1.217  16.359  1.00 44.20  ? 220  ARG B N   1 
ATOM   4291 C CA  . ARG B 1 186 ? 24.789 -0.235  16.760  1.00 46.59  ? 220  ARG B CA  1 
ATOM   4292 C C   . ARG B 1 186 ? 25.638 0.565   15.761  1.00 45.91  ? 220  ARG B C   1 
ATOM   4293 O O   . ARG B 1 186 ? 25.349 1.744   15.452  1.00 48.08  ? 220  ARG B O   1 
ATOM   4294 C CB  . ARG B 1 186 ? 25.726 -0.881  17.780  1.00 50.81  ? 220  ARG B CB  1 
ATOM   4295 C CG  . ARG B 1 186 ? 26.022 -2.358  17.496  1.00 58.50  ? 220  ARG B CG  1 
ATOM   4296 C CD  . ARG B 1 186 ? 26.553 -2.584  16.073  1.00 60.10  ? 220  ARG B CD  1 
ATOM   4297 N NE  . ARG B 1 186 ? 26.804 -3.995  15.744  1.00 63.24  ? 220  ARG B NE  1 
ATOM   4298 C CZ  . ARG B 1 186 ? 27.429 -4.864  16.538  1.00 64.13  ? 220  ARG B CZ  1 
ATOM   4299 N NH1 . ARG B 1 186 ? 27.866 -4.487  17.738  1.00 64.13  ? 220  ARG B NH1 1 
ATOM   4300 N NH2 . ARG B 1 186 ? 27.654 -6.102  16.113  1.00 63.50  ? 220  ARG B NH2 1 
ATOM   4301 N N   . TYR B 1 187 ? 26.706 -0.042  15.272  1.00 41.69  ? 221  TYR B N   1 
ATOM   4302 C CA  . TYR B 1 187 ? 27.613 0.659   14.360  1.00 39.48  ? 221  TYR B CA  1 
ATOM   4303 C C   . TYR B 1 187 ? 27.029 1.012   12.988  1.00 37.82  ? 221  TYR B C   1 
ATOM   4304 O O   . TYR B 1 187 ? 27.617 1.796   12.253  1.00 34.97  ? 221  TYR B O   1 
ATOM   4305 C CB  . TYR B 1 187 ? 28.851 -0.201  14.156  1.00 40.63  ? 221  TYR B CB  1 
ATOM   4306 C CG  . TYR B 1 187 ? 29.469 -0.705  15.427  1.00 41.07  ? 221  TYR B CG  1 
ATOM   4307 C CD1 . TYR B 1 187 ? 30.264 -1.841  15.418  1.00 40.30  ? 221  TYR B CD1 1 
ATOM   4308 C CD2 . TYR B 1 187 ? 29.311 -0.011  16.632  1.00 43.39  ? 221  TYR B CD2 1 
ATOM   4309 C CE1 . TYR B 1 187 ? 30.893 -2.273  16.560  1.00 42.85  ? 221  TYR B CE1 1 
ATOM   4310 C CE2 . TYR B 1 187 ? 29.939 -0.437  17.793  1.00 43.87  ? 221  TYR B CE2 1 
ATOM   4311 C CZ  . TYR B 1 187 ? 30.737 -1.570  17.745  1.00 45.08  ? 221  TYR B CZ  1 
ATOM   4312 O OH  . TYR B 1 187 ? 31.428 -1.986  18.864  1.00 48.67  ? 221  TYR B OH  1 
ATOM   4313 N N   . TYR B 1 188 ? 25.863 0.455   12.676  1.00 35.89  ? 222  TYR B N   1 
ATOM   4314 C CA  . TYR B 1 188 ? 25.234 0.641   11.382  1.00 35.92  ? 222  TYR B CA  1 
ATOM   4315 C C   . TYR B 1 188 ? 24.019 1.554   11.323  1.00 37.61  ? 222  TYR B C   1 
ATOM   4316 O O   . TYR B 1 188 ? 23.445 1.759   10.238  1.00 36.76  ? 222  TYR B O   1 
ATOM   4317 C CB  . TYR B 1 188 ? 24.888 -0.744  10.845  1.00 35.30  ? 222  TYR B CB  1 
ATOM   4318 C CG  . TYR B 1 188 ? 26.069 -1.670  10.998  1.00 33.86  ? 222  TYR B CG  1 
ATOM   4319 C CD1 . TYR B 1 188 ? 27.188 -1.535  10.183  1.00 33.56  ? 222  TYR B CD1 1 
ATOM   4320 C CD2 . TYR B 1 188 ? 26.117 -2.594  12.024  1.00 31.98  ? 222  TYR B CD2 1 
ATOM   4321 C CE1 . TYR B 1 188 ? 28.324 -2.286  10.392  1.00 34.11  ? 222  TYR B CE1 1 
ATOM   4322 C CE2 . TYR B 1 188 ? 27.252 -3.354  12.243  1.00 34.25  ? 222  TYR B CE2 1 
ATOM   4323 C CZ  . TYR B 1 188 ? 28.354 -3.193  11.424  1.00 35.70  ? 222  TYR B CZ  1 
ATOM   4324 O OH  . TYR B 1 188 ? 29.494 -3.926  11.640  1.00 37.11  ? 222  TYR B OH  1 
ATOM   4325 N N   . ARG B 1 189 ? 23.623 2.095   12.476  1.00 37.15  ? 223  ARG B N   1 
ATOM   4326 C CA  . ARG B 1 189 ? 22.462 2.985   12.547  1.00 37.70  ? 223  ARG B CA  1 
ATOM   4327 C C   . ARG B 1 189 ? 22.754 4.337   11.872  1.00 37.29  ? 223  ARG B C   1 
ATOM   4328 O O   . ARG B 1 189 ? 23.805 4.957   12.097  1.00 35.99  ? 223  ARG B O   1 
ATOM   4329 C CB  . ARG B 1 189 ? 22.068 3.240   14.005  1.00 39.73  ? 223  ARG B CB  1 
ATOM   4330 C CG  . ARG B 1 189 ? 22.081 2.012   14.890  1.00 43.58  ? 223  ARG B CG  1 
ATOM   4331 C CD  . ARG B 1 189 ? 20.775 1.869   15.642  1.00 45.15  ? 223  ARG B CD  1 
ATOM   4332 N NE  . ARG B 1 189 ? 20.489 3.013   16.498  1.00 46.74  ? 223  ARG B NE  1 
ATOM   4333 C CZ  . ARG B 1 189 ? 19.259 3.430   16.789  1.00 47.87  ? 223  ARG B CZ  1 
ATOM   4334 N NH1 . ARG B 1 189 ? 18.204 2.794   16.283  1.00 45.51  ? 223  ARG B NH1 1 
ATOM   4335 N NH2 . ARG B 1 189 ? 19.090 4.479   17.587  1.00 47.23  ? 223  ARG B NH2 1 
ATOM   4336 N N   . ALA B 1 190 ? 21.814 4.771   11.041  1.00 35.96  ? 224  ALA B N   1 
ATOM   4337 C CA  . ALA B 1 190 ? 21.916 6.032   10.333  1.00 36.39  ? 224  ALA B CA  1 
ATOM   4338 C C   . ALA B 1 190 ? 21.672 7.182   11.307  1.00 37.57  ? 224  ALA B C   1 
ATOM   4339 O O   . ALA B 1 190 ? 20.952 7.030   12.291  1.00 37.03  ? 224  ALA B O   1 
ATOM   4340 C CB  . ALA B 1 190 ? 20.886 6.074   9.206   1.00 34.78  ? 224  ALA B CB  1 
ATOM   4341 N N   . PRO B 1 191 ? 22.257 8.358   11.033  1.00 38.18  ? 225  PRO B N   1 
ATOM   4342 C CA  . PRO B 1 191 ? 22.096 9.537   11.894  1.00 37.84  ? 225  PRO B CA  1 
ATOM   4343 C C   . PRO B 1 191 ? 20.637 9.794   12.312  1.00 37.99  ? 225  PRO B C   1 
ATOM   4344 O O   . PRO B 1 191 ? 20.344 9.929   13.496  1.00 40.24  ? 225  PRO B O   1 
ATOM   4345 C CB  . PRO B 1 191 ? 22.653 10.670  11.038  1.00 38.29  ? 225  PRO B CB  1 
ATOM   4346 C CG  . PRO B 1 191 ? 23.650 9.994   10.171  1.00 40.20  ? 225  PRO B CG  1 
ATOM   4347 C CD  . PRO B 1 191 ? 23.003 8.689   9.807   1.00 38.42  ? 225  PRO B CD  1 
ATOM   4348 N N   . GLU B 1 192 ? 19.723 9.861   11.350  1.00 35.97  ? 226  GLU B N   1 
ATOM   4349 C CA  . GLU B 1 192 ? 18.330 10.106  11.689  1.00 36.51  ? 226  GLU B CA  1 
ATOM   4350 C C   . GLU B 1 192 ? 17.797 9.090   12.706  1.00 37.51  ? 226  GLU B C   1 
ATOM   4351 O O   . GLU B 1 192 ? 16.920 9.409   13.505  1.00 37.02  ? 226  GLU B O   1 
ATOM   4352 C CB  . GLU B 1 192 ? 17.439 10.131  10.428  1.00 36.27  ? 226  GLU B CB  1 
ATOM   4353 C CG  . GLU B 1 192 ? 17.418 8.873   9.560   1.00 36.41  ? 226  GLU B CG  1 
ATOM   4354 C CD  . GLU B 1 192 ? 18.429 8.924   8.420   1.00 40.48  ? 226  GLU B CD  1 
ATOM   4355 O OE1 . GLU B 1 192 ? 19.594 9.333   8.647   1.00 42.40  ? 226  GLU B OE1 1 
ATOM   4356 O OE2 . GLU B 1 192 ? 18.062 8.530   7.291   1.00 41.30  ? 226  GLU B OE2 1 
ATOM   4357 N N   . LEU B 1 193 ? 18.322 7.868   12.679  1.00 38.20  ? 227  LEU B N   1 
ATOM   4358 C CA  . LEU B 1 193 ? 17.883 6.850   13.624  1.00 38.76  ? 227  LEU B CA  1 
ATOM   4359 C C   . LEU B 1 193 ? 18.418 7.221   15.023  1.00 40.40  ? 227  LEU B C   1 
ATOM   4360 O O   . LEU B 1 193 ? 17.692 7.142   16.019  1.00 40.90  ? 227  LEU B O   1 
ATOM   4361 C CB  . LEU B 1 193 ? 18.381 5.462   13.184  1.00 37.41  ? 227  LEU B CB  1 
ATOM   4362 C CG  . LEU B 1 193 ? 17.382 4.448   12.594  1.00 39.32  ? 227  LEU B CG  1 
ATOM   4363 C CD1 . LEU B 1 193 ? 16.326 5.140   11.738  1.00 38.34  ? 227  LEU B CD1 1 
ATOM   4364 C CD2 . LEU B 1 193 ? 18.145 3.401   11.777  1.00 37.12  ? 227  LEU B CD2 1 
ATOM   4365 N N   . ILE B 1 194 ? 19.673 7.656   15.091  1.00 40.08  ? 228  ILE B N   1 
ATOM   4366 C CA  . ILE B 1 194 ? 20.268 8.047   16.359  1.00 41.70  ? 228  ILE B CA  1 
ATOM   4367 C C   . ILE B 1 194 ? 19.493 9.230   16.951  1.00 43.18  ? 228  ILE B C   1 
ATOM   4368 O O   . ILE B 1 194 ? 19.293 9.313   18.165  1.00 43.54  ? 228  ILE B O   1 
ATOM   4369 C CB  . ILE B 1 194 ? 21.747 8.442   16.169  1.00 40.05  ? 228  ILE B CB  1 
ATOM   4370 C CG1 . ILE B 1 194 ? 22.511 7.258   15.583  1.00 38.48  ? 228  ILE B CG1 1 
ATOM   4371 C CG2 . ILE B 1 194 ? 22.360 8.860   17.510  1.00 39.09  ? 228  ILE B CG2 1 
ATOM   4372 C CD1 . ILE B 1 194 ? 23.958 7.554   15.248  1.00 34.44  ? 228  ILE B CD1 1 
ATOM   4373 N N   . PHE B 1 195 ? 19.068 10.145  16.086  1.00 43.21  ? 229  PHE B N   1 
ATOM   4374 C CA  . PHE B 1 195 ? 18.312 11.310  16.520  1.00 42.99  ? 229  PHE B CA  1 
ATOM   4375 C C   . PHE B 1 195 ? 16.842 10.981  16.781  1.00 44.08  ? 229  PHE B C   1 
ATOM   4376 O O   . PHE B 1 195 ? 16.021 11.885  16.948  1.00 43.87  ? 229  PHE B O   1 
ATOM   4377 C CB  . PHE B 1 195 ? 18.378 12.415  15.477  1.00 42.67  ? 229  PHE B CB  1 
ATOM   4378 C CG  . PHE B 1 195 ? 19.710 13.096  15.395  1.00 42.12  ? 229  PHE B CG  1 
ATOM   4379 C CD1 . PHE B 1 195 ? 20.278 13.682  16.518  1.00 42.76  ? 229  PHE B CD1 1 
ATOM   4380 C CD2 . PHE B 1 195 ? 20.381 13.184  14.186  1.00 42.37  ? 229  PHE B CD2 1 
ATOM   4381 C CE1 . PHE B 1 195 ? 21.499 14.349  16.439  1.00 42.54  ? 229  PHE B CE1 1 
ATOM   4382 C CE2 . PHE B 1 195 ? 21.596 13.843  14.092  1.00 42.33  ? 229  PHE B CE2 1 
ATOM   4383 C CZ  . PHE B 1 195 ? 22.159 14.431  15.224  1.00 42.89  ? 229  PHE B CZ  1 
ATOM   4384 N N   . GLY B 1 196 ? 16.498 9.695   16.797  1.00 44.44  ? 230  GLY B N   1 
ATOM   4385 C CA  . GLY B 1 196 ? 15.119 9.299   17.077  1.00 44.77  ? 230  GLY B CA  1 
ATOM   4386 C C   . GLY B 1 196 ? 14.043 9.597   16.043  1.00 44.60  ? 230  GLY B C   1 
ATOM   4387 O O   . GLY B 1 196 ? 12.854 9.595   16.373  1.00 45.25  ? 230  GLY B O   1 
ATOM   4388 N N   . ALA B 1 197 ? 14.456 9.839   14.799  1.00 44.88  ? 231  ALA B N   1 
ATOM   4389 C CA  . ALA B 1 197 ? 13.539 10.128  13.704  1.00 43.81  ? 231  ALA B CA  1 
ATOM   4390 C C   . ALA B 1 197 ? 12.500 9.041   13.611  1.00 44.27  ? 231  ALA B C   1 
ATOM   4391 O O   . ALA B 1 197 ? 12.798 7.861   13.754  1.00 43.71  ? 231  ALA B O   1 
ATOM   4392 C CB  . ALA B 1 197 ? 14.294 10.227  12.401  1.00 43.64  ? 231  ALA B CB  1 
ATOM   4393 N N   . THR B 1 198 ? 11.272 9.435   13.336  1.00 46.37  ? 232  THR B N   1 
ATOM   4394 C CA  . THR B 1 198 ? 10.198 8.464   13.273  1.00 47.83  ? 232  THR B CA  1 
ATOM   4395 C C   . THR B 1 198 ? 9.601  8.380   11.862  1.00 46.55  ? 232  THR B C   1 
ATOM   4396 O O   . THR B 1 198 ? 8.779  7.512   11.570  1.00 45.24  ? 232  THR B O   1 
ATOM   4397 C CB  . THR B 1 198 ? 9.132  8.865   14.295  1.00 49.70  ? 232  THR B CB  1 
ATOM   4398 O OG1 . THR B 1 198 ? 8.329  7.732   14.618  1.00 53.58  ? 232  THR B OG1 1 
ATOM   4399 C CG2 . THR B 1 198 ? 8.259  9.995   13.741  1.00 51.54  ? 232  THR B CG2 1 
ATOM   4400 N N   . ASP B 1 199 ? 10.045 9.279   10.988  1.00 46.34  ? 233  ASP B N   1 
ATOM   4401 C CA  . ASP B 1 199 ? 9.556  9.326   9.619   1.00 47.21  ? 233  ASP B CA  1 
ATOM   4402 C C   . ASP B 1 199 ? 10.695 9.141   8.621   1.00 47.02  ? 233  ASP B C   1 
ATOM   4403 O O   . ASP B 1 199 ? 10.813 9.896   7.639   1.00 46.64  ? 233  ASP B O   1 
ATOM   4404 C CB  . ASP B 1 199 ? 8.891  10.668  9.363   1.00 49.13  ? 233  ASP B CB  1 
ATOM   4405 C CG  . ASP B 1 199 ? 9.877  11.815  9.411   1.00 52.78  ? 233  ASP B CG  1 
ATOM   4406 O OD1 . ASP B 1 199 ? 9.461  12.957  9.103   1.00 55.09  ? 233  ASP B OD1 1 
ATOM   4407 O OD2 . ASP B 1 199 ? 11.067 11.576  9.757   1.00 52.96  ? 233  ASP B OD2 1 
ATOM   4408 N N   . TYR B 1 200 ? 11.544 8.148   8.878   1.00 45.48  ? 234  TYR B N   1 
ATOM   4409 C CA  . TYR B 1 200 ? 12.683 7.869   8.010   1.00 41.64  ? 234  TYR B CA  1 
ATOM   4410 C C   . TYR B 1 200 ? 12.263 7.028   6.811   1.00 40.92  ? 234  TYR B C   1 
ATOM   4411 O O   . TYR B 1 200 ? 11.198 6.419   6.808   1.00 42.45  ? 234  TYR B O   1 
ATOM   4412 C CB  . TYR B 1 200 ? 13.759 7.147   8.810   1.00 38.77  ? 234  TYR B CB  1 
ATOM   4413 C CG  . TYR B 1 200 ? 13.248 5.915   9.503   1.00 35.59  ? 234  TYR B CG  1 
ATOM   4414 C CD1 . TYR B 1 200 ? 13.167 4.691   8.834   1.00 33.63  ? 234  TYR B CD1 1 
ATOM   4415 C CD2 . TYR B 1 200 ? 12.814 5.976   10.820  1.00 34.70  ? 234  TYR B CD2 1 
ATOM   4416 C CE1 . TYR B 1 200 ? 12.664 3.555   9.471   1.00 33.87  ? 234  TYR B CE1 1 
ATOM   4417 C CE2 . TYR B 1 200 ? 12.304 4.840   11.469  1.00 35.99  ? 234  TYR B CE2 1 
ATOM   4418 C CZ  . TYR B 1 200 ? 12.232 3.645   10.794  1.00 34.26  ? 234  TYR B CZ  1 
ATOM   4419 O OH  . TYR B 1 200 ? 11.704 2.561   11.443  1.00 33.35  ? 234  TYR B OH  1 
ATOM   4420 N N   . THR B 1 201 ? 13.107 7.000   5.792   1.00 40.30  ? 235  THR B N   1 
ATOM   4421 C CA  . THR B 1 201 ? 12.815 6.249   4.583   1.00 40.04  ? 235  THR B CA  1 
ATOM   4422 C C   . THR B 1 201 ? 13.777 5.081   4.400   1.00 41.46  ? 235  THR B C   1 
ATOM   4423 O O   . THR B 1 201 ? 14.554 4.745   5.297   1.00 43.68  ? 235  THR B O   1 
ATOM   4424 C CB  . THR B 1 201 ? 12.903 7.150   3.339   1.00 39.32  ? 235  THR B CB  1 
ATOM   4425 O OG1 . THR B 1 201 ? 14.252 7.607   3.153   1.00 36.07  ? 235  THR B OG1 1 
ATOM   4426 C CG2 . THR B 1 201 ? 11.987 8.347   3.502   1.00 36.78  ? 235  THR B CG2 1 
ATOM   4427 N N   . SER B 1 202 ? 13.727 4.458   3.233   1.00 41.17  ? 236  SER B N   1 
ATOM   4428 C CA  . SER B 1 202 ? 14.595 3.325   2.972   1.00 41.88  ? 236  SER B CA  1 
ATOM   4429 C C   . SER B 1 202 ? 16.036 3.761   2.884   1.00 41.03  ? 236  SER B C   1 
ATOM   4430 O O   . SER B 1 202 ? 16.934 2.928   2.885   1.00 43.07  ? 236  SER B O   1 
ATOM   4431 C CB  . SER B 1 202 ? 14.190 2.631   1.678   1.00 42.03  ? 236  SER B CB  1 
ATOM   4432 O OG  . SER B 1 202 ? 12.906 2.051   1.838   1.00 47.69  ? 236  SER B OG  1 
ATOM   4433 N N   . SER B 1 203 ? 16.272 5.064   2.809   1.00 38.19  ? 237  SER B N   1 
ATOM   4434 C CA  . SER B 1 203 ? 17.639 5.503   2.719   1.00 36.27  ? 237  SER B CA  1 
ATOM   4435 C C   . SER B 1 203 ? 18.427 5.071   3.950   1.00 36.30  ? 237  SER B C   1 
ATOM   4436 O O   . SER B 1 203 ? 19.656 5.081   3.905   1.00 37.79  ? 237  SER B O   1 
ATOM   4437 C CB  . SER B 1 203 ? 17.723 7.022   2.491   1.00 36.43  ? 237  SER B CB  1 
ATOM   4438 O OG  . SER B 1 203 ? 17.011 7.762   3.466   1.00 40.40  ? 237  SER B OG  1 
ATOM   4439 N N   . ILE B 1 204 ? 17.757 4.673   5.042   1.00 35.23  ? 238  ILE B N   1 
ATOM   4440 C CA  . ILE B 1 204 ? 18.527 4.230   6.216   1.00 35.77  ? 238  ILE B CA  1 
ATOM   4441 C C   . ILE B 1 204 ? 19.373 2.984   5.884   1.00 36.58  ? 238  ILE B C   1 
ATOM   4442 O O   . ILE B 1 204 ? 20.494 2.848   6.391   1.00 36.76  ? 238  ILE B O   1 
ATOM   4443 C CB  . ILE B 1 204 ? 17.672 3.880   7.490   1.00 33.90  ? 238  ILE B CB  1 
ATOM   4444 C CG1 . ILE B 1 204 ? 16.694 2.750   7.205   1.00 33.58  ? 238  ILE B CG1 1 
ATOM   4445 C CG2 . ILE B 1 204 ? 17.001 5.101   8.038   1.00 34.30  ? 238  ILE B CG2 1 
ATOM   4446 C CD1 . ILE B 1 204 ? 16.208 2.063   8.490   1.00 27.89  ? 238  ILE B CD1 1 
ATOM   4447 N N   . ASP B 1 205 ? 18.835 2.090   5.042   1.00 35.76  ? 239  ASP B N   1 
ATOM   4448 C CA  . ASP B 1 205 ? 19.539 0.877   4.621   1.00 34.40  ? 239  ASP B CA  1 
ATOM   4449 C C   . ASP B 1 205 ? 20.791 1.244   3.824   1.00 33.92  ? 239  ASP B C   1 
ATOM   4450 O O   . ASP B 1 205 ? 21.835 0.607   3.983   1.00 33.26  ? 239  ASP B O   1 
ATOM   4451 C CB  . ASP B 1 205 ? 18.645 -0.025  3.749   1.00 34.02  ? 239  ASP B CB  1 
ATOM   4452 C CG  . ASP B 1 205 ? 17.670 -0.878  4.572   1.00 36.27  ? 239  ASP B CG  1 
ATOM   4453 O OD1 . ASP B 1 205 ? 17.882 -1.025  5.805   1.00 33.95  ? 239  ASP B OD1 1 
ATOM   4454 O OD2 . ASP B 1 205 ? 16.695 -1.414  3.979   1.00 35.40  ? 239  ASP B OD2 1 
ATOM   4455 N N   . VAL B 1 206 ? 20.691 2.264   2.969   1.00 33.09  ? 240  VAL B N   1 
ATOM   4456 C CA  . VAL B 1 206 ? 21.836 2.690   2.163   1.00 32.77  ? 240  VAL B CA  1 
ATOM   4457 C C   . VAL B 1 206 ? 22.966 3.148   3.082   1.00 33.30  ? 240  VAL B C   1 
ATOM   4458 O O   . VAL B 1 206 ? 24.132 2.895   2.813   1.00 33.92  ? 240  VAL B O   1 
ATOM   4459 C CB  . VAL B 1 206 ? 21.476 3.841   1.207   1.00 30.66  ? 240  VAL B CB  1 
ATOM   4460 C CG1 . VAL B 1 206 ? 22.714 4.328   0.490   1.00 31.54  ? 240  VAL B CG1 1 
ATOM   4461 C CG2 . VAL B 1 206 ? 20.458 3.365   0.207   1.00 32.89  ? 240  VAL B CG2 1 
ATOM   4462 N N   . TRP B 1 207 ? 22.618 3.818   4.176   1.00 34.08  ? 241  TRP B N   1 
ATOM   4463 C CA  . TRP B 1 207 ? 23.626 4.279   5.120   1.00 32.31  ? 241  TRP B CA  1 
ATOM   4464 C C   . TRP B 1 207 ? 24.279 3.039   5.738   1.00 31.68  ? 241  TRP B C   1 
ATOM   4465 O O   . TRP B 1 207 ? 25.515 2.922   5.773   1.00 30.26  ? 241  TRP B O   1 
ATOM   4466 C CB  . TRP B 1 207 ? 22.982 5.160   6.200   1.00 32.78  ? 241  TRP B CB  1 
ATOM   4467 C CG  . TRP B 1 207 ? 23.918 5.484   7.336   1.00 33.44  ? 241  TRP B CG  1 
ATOM   4468 C CD1 . TRP B 1 207 ? 24.289 4.649   8.353   1.00 31.96  ? 241  TRP B CD1 1 
ATOM   4469 C CD2 . TRP B 1 207 ? 24.663 6.699   7.523   1.00 34.63  ? 241  TRP B CD2 1 
ATOM   4470 N NE1 . TRP B 1 207 ? 25.218 5.262   9.148   1.00 34.68  ? 241  TRP B NE1 1 
ATOM   4471 C CE2 . TRP B 1 207 ? 25.471 6.519   8.666   1.00 33.95  ? 241  TRP B CE2 1 
ATOM   4472 C CE3 . TRP B 1 207 ? 24.735 7.915   6.827   1.00 35.87  ? 241  TRP B CE3 1 
ATOM   4473 C CZ2 . TRP B 1 207 ? 26.336 7.514   9.144   1.00 33.39  ? 241  TRP B CZ2 1 
ATOM   4474 C CZ3 . TRP B 1 207 ? 25.604 8.910   7.304   1.00 36.35  ? 241  TRP B CZ3 1 
ATOM   4475 C CH2 . TRP B 1 207 ? 26.392 8.696   8.453   1.00 34.36  ? 241  TRP B CH2 1 
ATOM   4476 N N   . SER B 1 208 ? 23.444 2.113   6.211   1.00 28.89  ? 242  SER B N   1 
ATOM   4477 C CA  . SER B 1 208 ? 23.930 0.869   6.796   1.00 29.01  ? 242  SER B CA  1 
ATOM   4478 C C   . SER B 1 208 ? 24.910 0.205   5.840   1.00 28.98  ? 242  SER B C   1 
ATOM   4479 O O   . SER B 1 208 ? 25.983 -0.226  6.243   1.00 28.86  ? 242  SER B O   1 
ATOM   4480 C CB  . SER B 1 208 ? 22.764 -0.080  7.060   1.00 29.67  ? 242  SER B CB  1 
ATOM   4481 O OG  . SER B 1 208 ? 21.883 0.477   8.016   1.00 32.54  ? 242  SER B OG  1 
ATOM   4482 N N   . ALA B 1 209 ? 24.523 0.135   4.567   1.00 30.52  ? 243  ALA B N   1 
ATOM   4483 C CA  . ALA B 1 209 ? 25.351 -0.470  3.544   1.00 30.01  ? 243  ALA B CA  1 
ATOM   4484 C C   . ALA B 1 209 ? 26.673 0.285   3.419   1.00 31.88  ? 243  ALA B C   1 
ATOM   4485 O O   . ALA B 1 209 ? 27.736 -0.329  3.273   1.00 33.21  ? 243  ALA B O   1 
ATOM   4486 C CB  . ALA B 1 209 ? 24.618 -0.489  2.229   1.00 26.85  ? 243  ALA B CB  1 
ATOM   4487 N N   . GLY B 1 210 ? 26.617 1.612   3.503   1.00 31.77  ? 244  GLY B N   1 
ATOM   4488 C CA  . GLY B 1 210 ? 27.834 2.394   3.401   1.00 32.65  ? 244  GLY B CA  1 
ATOM   4489 C C   . GLY B 1 210 ? 28.789 2.070   4.543   1.00 35.11  ? 244  GLY B C   1 
ATOM   4490 O O   . GLY B 1 210 ? 30.006 2.148   4.389   1.00 35.68  ? 244  GLY B O   1 
ATOM   4491 N N   . CYS B 1 211 ? 28.229 1.719   5.698   1.00 35.77  ? 245  CYS B N   1 
ATOM   4492 C CA  . CYS B 1 211 ? 29.019 1.374   6.875   1.00 36.28  ? 245  CYS B CA  1 
ATOM   4493 C C   . CYS B 1 211 ? 29.677 0.018   6.700   1.00 37.31  ? 245  CYS B C   1 
ATOM   4494 O O   . CYS B 1 211 ? 30.760 -0.230  7.238   1.00 39.03  ? 245  CYS B O   1 
ATOM   4495 C CB  . CYS B 1 211 ? 28.146 1.340   8.131   1.00 34.76  ? 245  CYS B CB  1 
ATOM   4496 S SG  . CYS B 1 211 ? 27.587 2.947   8.673   1.00 35.39  ? 245  CYS B SG  1 
ATOM   4497 N N   . VAL B 1 212 ? 29.017 -0.875  5.969   1.00 38.38  ? 246  VAL B N   1 
ATOM   4498 C CA  . VAL B 1 212 ? 29.576 -2.198  5.723   1.00 37.33  ? 246  VAL B CA  1 
ATOM   4499 C C   . VAL B 1 212 ? 30.738 -2.041  4.740   1.00 37.47  ? 246  VAL B C   1 
ATOM   4500 O O   . VAL B 1 212 ? 31.796 -2.606  4.952   1.00 38.48  ? 246  VAL B O   1 
ATOM   4501 C CB  . VAL B 1 212 ? 28.512 -3.144  5.130   1.00 38.13  ? 246  VAL B CB  1 
ATOM   4502 C CG1 . VAL B 1 212 ? 29.141 -4.491  4.793   1.00 36.23  ? 246  VAL B CG1 1 
ATOM   4503 C CG2 . VAL B 1 212 ? 27.373 -3.314  6.120   1.00 36.37  ? 246  VAL B CG2 1 
ATOM   4504 N N   . LEU B 1 213 ? 30.536 -1.257  3.679   1.00 37.48  ? 247  LEU B N   1 
ATOM   4505 C CA  . LEU B 1 213 ? 31.577 -1.027  2.681   1.00 37.10  ? 247  LEU B CA  1 
ATOM   4506 C C   . LEU B 1 213 ? 32.783 -0.440  3.356   1.00 37.96  ? 247  LEU B C   1 
ATOM   4507 O O   . LEU B 1 213 ? 33.892 -0.930  3.208   1.00 40.96  ? 247  LEU B O   1 
ATOM   4508 C CB  . LEU B 1 213 ? 31.116 -0.051  1.593   1.00 36.22  ? 247  LEU B CB  1 
ATOM   4509 C CG  . LEU B 1 213 ? 32.213 0.551   0.697   1.00 34.96  ? 247  LEU B CG  1 
ATOM   4510 C CD1 . LEU B 1 213 ? 32.946 -0.540  -0.058  1.00 33.62  ? 247  LEU B CD1 1 
ATOM   4511 C CD2 . LEU B 1 213 ? 31.604 1.543   -0.284  1.00 31.92  ? 247  LEU B CD2 1 
ATOM   4512 N N   . ALA B 1 214 ? 32.566 0.629   4.102   1.00 38.38  ? 248  ALA B N   1 
ATOM   4513 C CA  . ALA B 1 214 ? 33.669 1.270   4.775   1.00 38.04  ? 248  ALA B CA  1 
ATOM   4514 C C   . ALA B 1 214 ? 34.393 0.272   5.676   1.00 38.06  ? 248  ALA B C   1 
ATOM   4515 O O   . ALA B 1 214 ? 35.618 0.238   5.711   1.00 38.88  ? 248  ALA B O   1 
ATOM   4516 C CB  . ALA B 1 214 ? 33.167 2.463   5.576   1.00 36.62  ? 248  ALA B CB  1 
ATOM   4517 N N   . GLU B 1 215 ? 33.640 -0.561  6.380   1.00 37.42  ? 249  GLU B N   1 
ATOM   4518 C CA  . GLU B 1 215 ? 34.237 -1.543  7.288   1.00 37.19  ? 249  GLU B CA  1 
ATOM   4519 C C   . GLU B 1 215 ? 35.109 -2.549  6.553   1.00 38.97  ? 249  GLU B C   1 
ATOM   4520 O O   . GLU B 1 215 ? 36.144 -2.990  7.066   1.00 40.70  ? 249  GLU B O   1 
ATOM   4521 C CB  . GLU B 1 215 ? 33.143 -2.290  8.062   1.00 34.41  ? 249  GLU B CB  1 
ATOM   4522 C CG  . GLU B 1 215 ? 33.651 -2.956  9.310   1.00 35.31  ? 249  GLU B CG  1 
ATOM   4523 C CD  . GLU B 1 215 ? 32.566 -3.602  10.128  1.00 37.18  ? 249  GLU B CD  1 
ATOM   4524 O OE1 . GLU B 1 215 ? 31.519 -2.946  10.367  1.00 35.37  ? 249  GLU B OE1 1 
ATOM   4525 O OE2 . GLU B 1 215 ? 32.771 -4.767  10.552  1.00 38.29  ? 249  GLU B OE2 1 
ATOM   4526 N N   . LEU B 1 216 ? 34.680 -2.928  5.353   1.00 39.65  ? 250  LEU B N   1 
ATOM   4527 C CA  . LEU B 1 216 ? 35.419 -3.886  4.534   1.00 39.20  ? 250  LEU B CA  1 
ATOM   4528 C C   . LEU B 1 216 ? 36.741 -3.285  4.035   1.00 40.54  ? 250  LEU B C   1 
ATOM   4529 O O   . LEU B 1 216 ? 37.728 -4.007  3.862   1.00 40.71  ? 250  LEU B O   1 
ATOM   4530 C CB  . LEU B 1 216 ? 34.545 -4.332  3.360   1.00 37.81  ? 250  LEU B CB  1 
ATOM   4531 C CG  . LEU B 1 216 ? 33.876 -5.703  3.512   1.00 40.34  ? 250  LEU B CG  1 
ATOM   4532 C CD1 . LEU B 1 216 ? 33.647 -6.036  4.971   1.00 38.48  ? 250  LEU B CD1 1 
ATOM   4533 C CD2 . LEU B 1 216 ? 32.563 -5.734  2.726   1.00 37.11  ? 250  LEU B CD2 1 
ATOM   4534 N N   . LEU B 1 217 ? 36.759 -1.968  3.822   1.00 40.16  ? 251  LEU B N   1 
ATOM   4535 C CA  . LEU B 1 217 ? 37.962 -1.280  3.374   1.00 40.50  ? 251  LEU B CA  1 
ATOM   4536 C C   . LEU B 1 217 ? 38.912 -0.963  4.543   1.00 42.22  ? 251  LEU B C   1 
ATOM   4537 O O   . LEU B 1 217 ? 40.127 -1.021  4.381   1.00 43.77  ? 251  LEU B O   1 
ATOM   4538 C CB  . LEU B 1 217 ? 37.592 0.018   2.667   1.00 38.23  ? 251  LEU B CB  1 
ATOM   4539 C CG  . LEU B 1 217 ? 36.712 -0.083  1.424   1.00 39.19  ? 251  LEU B CG  1 
ATOM   4540 C CD1 . LEU B 1 217 ? 36.261 1.311   1.020   1.00 36.96  ? 251  LEU B CD1 1 
ATOM   4541 C CD2 . LEU B 1 217 ? 37.459 -0.762  0.292   1.00 36.10  ? 251  LEU B CD2 1 
ATOM   4542 N N   . LEU B 1 218 ? 38.359 -0.641  5.712   1.00 43.40  ? 252  LEU B N   1 
ATOM   4543 C CA  . LEU B 1 218 ? 39.155 -0.301  6.888   1.00 43.22  ? 252  LEU B CA  1 
ATOM   4544 C C   . LEU B 1 218 ? 39.682 -1.472  7.694   1.00 43.90  ? 252  LEU B C   1 
ATOM   4545 O O   . LEU B 1 218 ? 40.811 -1.438  8.169   1.00 45.71  ? 252  LEU B O   1 
ATOM   4546 C CB  . LEU B 1 218 ? 38.348 0.590   7.827   1.00 43.03  ? 252  LEU B CB  1 
ATOM   4547 C CG  . LEU B 1 218 ? 38.357 2.095   7.568   1.00 46.35  ? 252  LEU B CG  1 
ATOM   4548 C CD1 . LEU B 1 218 ? 37.232 2.761   8.374   1.00 46.27  ? 252  LEU B CD1 1 
ATOM   4549 C CD2 . LEU B 1 218 ? 39.718 2.676   7.954   1.00 45.73  ? 252  LEU B CD2 1 
ATOM   4550 N N   . GLY B 1 219 ? 38.860 -2.501  7.865   1.00 44.94  ? 253  GLY B N   1 
ATOM   4551 C CA  . GLY B 1 219 ? 39.265 -3.651  8.655   1.00 43.53  ? 253  GLY B CA  1 
ATOM   4552 C C   . GLY B 1 219 ? 38.624 -3.608  10.033  1.00 45.27  ? 253  GLY B C   1 
ATOM   4553 O O   . GLY B 1 219 ? 38.900 -4.443  10.893  1.00 45.30  ? 253  GLY B O   1 
ATOM   4554 N N   . GLN B 1 220 ? 37.765 -2.619  10.244  1.00 46.14  ? 254  GLN B N   1 
ATOM   4555 C CA  . GLN B 1 220 ? 37.072 -2.461  11.508  1.00 48.91  ? 254  GLN B CA  1 
ATOM   4556 C C   . GLN B 1 220 ? 35.924 -1.503  11.267  1.00 48.81  ? 254  GLN B C   1 
ATOM   4557 O O   . GLN B 1 220 ? 35.887 -0.836  10.235  1.00 50.05  ? 254  GLN B O   1 
ATOM   4558 C CB  . GLN B 1 220 ? 38.011 -1.879  12.555  1.00 50.67  ? 254  GLN B CB  1 
ATOM   4559 C CG  . GLN B 1 220 ? 38.605 -0.559  12.131  1.00 55.31  ? 254  GLN B CG  1 
ATOM   4560 C CD  . GLN B 1 220 ? 39.493 0.058   13.190  1.00 57.32  ? 254  GLN B CD  1 
ATOM   4561 O OE1 . GLN B 1 220 ? 39.029 0.419   14.263  1.00 60.33  ? 254  GLN B OE1 1 
ATOM   4562 N NE2 . GLN B 1 220 ? 40.781 0.173   12.893  1.00 58.93  ? 254  GLN B NE2 1 
ATOM   4563 N N   . PRO B 1 221 ? 34.964 -1.431  12.207  1.00 47.22  ? 255  PRO B N   1 
ATOM   4564 C CA  . PRO B 1 221 ? 33.813 -0.533  12.069  1.00 46.01  ? 255  PRO B CA  1 
ATOM   4565 C C   . PRO B 1 221 ? 34.254 0.925   11.929  1.00 46.01  ? 255  PRO B C   1 
ATOM   4566 O O   . PRO B 1 221 ? 35.172 1.383   12.613  1.00 46.36  ? 255  PRO B O   1 
ATOM   4567 C CB  . PRO B 1 221 ? 33.044 -0.777  13.359  1.00 45.86  ? 255  PRO B CB  1 
ATOM   4568 C CG  . PRO B 1 221 ? 33.311 -2.221  13.620  1.00 46.46  ? 255  PRO B CG  1 
ATOM   4569 C CD  . PRO B 1 221 ? 34.792 -2.314  13.373  1.00 46.06  ? 255  PRO B CD  1 
ATOM   4570 N N   . ILE B 1 222 ? 33.603 1.660   11.042  1.00 44.11  ? 256  ILE B N   1 
ATOM   4571 C CA  . ILE B 1 222 ? 33.969 3.049   10.862  1.00 43.56  ? 256  ILE B CA  1 
ATOM   4572 C C   . ILE B 1 222 ? 33.398 3.979   11.930  1.00 43.34  ? 256  ILE B C   1 
ATOM   4573 O O   . ILE B 1 222 ? 34.038 4.963   12.292  1.00 44.63  ? 256  ILE B O   1 
ATOM   4574 C CB  . ILE B 1 222 ? 33.561 3.571   9.464   1.00 43.79  ? 256  ILE B CB  1 
ATOM   4575 C CG1 . ILE B 1 222 ? 34.003 5.030   9.325   1.00 41.40  ? 256  ILE B CG1 1 
ATOM   4576 C CG2 . ILE B 1 222 ? 32.052 3.436   9.257   1.00 42.19  ? 256  ILE B CG2 1 
ATOM   4577 C CD1 . ILE B 1 222 ? 33.905 5.554   7.918   1.00 43.87  ? 256  ILE B CD1 1 
ATOM   4578 N N   . PHE B 1 223 ? 32.205 3.669   12.436  1.00 42.17  ? 257  PHE B N   1 
ATOM   4579 C CA  . PHE B 1 223 ? 31.561 4.503   13.452  1.00 40.52  ? 257  PHE B CA  1 
ATOM   4580 C C   . PHE B 1 223 ? 31.205 3.758   14.745  1.00 38.30  ? 257  PHE B C   1 
ATOM   4581 O O   . PHE B 1 223 ? 30.039 3.628   15.081  1.00 37.75  ? 257  PHE B O   1 
ATOM   4582 C CB  . PHE B 1 223 ? 30.282 5.136   12.886  1.00 40.82  ? 257  PHE B CB  1 
ATOM   4583 C CG  . PHE B 1 223 ? 30.487 5.936   11.626  1.00 42.76  ? 257  PHE B CG  1 
ATOM   4584 C CD1 . PHE B 1 223 ? 31.513 6.875   11.535  1.00 44.78  ? 257  PHE B CD1 1 
ATOM   4585 C CD2 . PHE B 1 223 ? 29.627 5.773   10.542  1.00 43.85  ? 257  PHE B CD2 1 
ATOM   4586 C CE1 . PHE B 1 223 ? 31.677 7.647   10.381  1.00 44.70  ? 257  PHE B CE1 1 
ATOM   4587 C CE2 . PHE B 1 223 ? 29.772 6.535   9.381   1.00 43.41  ? 257  PHE B CE2 1 
ATOM   4588 C CZ  . PHE B 1 223 ? 30.799 7.470   9.301   1.00 46.14  ? 257  PHE B CZ  1 
ATOM   4589 N N   . PRO B 1 224 ? 32.207 3.292   15.498  1.00 38.27  ? 258  PRO B N   1 
ATOM   4590 C CA  . PRO B 1 224 ? 32.038 2.557   16.761  1.00 38.95  ? 258  PRO B CA  1 
ATOM   4591 C C   . PRO B 1 224 ? 31.362 3.417   17.810  1.00 39.43  ? 258  PRO B C   1 
ATOM   4592 O O   . PRO B 1 224 ? 31.241 4.625   17.638  1.00 42.06  ? 258  PRO B O   1 
ATOM   4593 C CB  . PRO B 1 224 ? 33.469 2.237   17.192  1.00 38.37  ? 258  PRO B CB  1 
ATOM   4594 C CG  . PRO B 1 224 ? 34.279 2.391   15.958  1.00 41.29  ? 258  PRO B CG  1 
ATOM   4595 C CD  . PRO B 1 224 ? 33.630 3.545   15.239  1.00 39.82  ? 258  PRO B CD  1 
ATOM   4596 N N   . GLY B 1 225 ? 30.950 2.796   18.909  1.00 39.16  ? 259  GLY B N   1 
ATOM   4597 C CA  . GLY B 1 225 ? 30.312 3.544   19.971  1.00 40.04  ? 259  GLY B CA  1 
ATOM   4598 C C   . GLY B 1 225 ? 29.258 2.764   20.716  1.00 40.86  ? 259  GLY B C   1 
ATOM   4599 O O   . GLY B 1 225 ? 28.380 2.154   20.110  1.00 42.91  ? 259  GLY B O   1 
ATOM   4600 N N   . ASP B 1 226 ? 29.340 2.787   22.038  1.00 40.66  ? 260  ASP B N   1 
ATOM   4601 C CA  . ASP B 1 226 ? 28.379 2.079   22.859  1.00 41.47  ? 260  ASP B CA  1 
ATOM   4602 C C   . ASP B 1 226 ? 27.131 2.909   23.115  1.00 41.54  ? 260  ASP B C   1 
ATOM   4603 O O   . ASP B 1 226 ? 26.088 2.381   23.516  1.00 42.01  ? 260  ASP B O   1 
ATOM   4604 C CB  . ASP B 1 226 ? 29.032 1.664   24.171  1.00 45.80  ? 260  ASP B CB  1 
ATOM   4605 C CG  . ASP B 1 226 ? 30.110 0.614   23.965  1.00 51.24  ? 260  ASP B CG  1 
ATOM   4606 O OD1 . ASP B 1 226 ? 30.985 0.447   24.852  1.00 54.40  ? 260  ASP B OD1 1 
ATOM   4607 O OD2 . ASP B 1 226 ? 30.080 -0.049  22.898  1.00 52.87  ? 260  ASP B OD2 1 
ATOM   4608 N N   . SER B 1 227 ? 27.231 4.211   22.876  1.00 40.40  ? 261  SER B N   1 
ATOM   4609 C CA  . SER B 1 227 ? 26.092 5.098   23.057  1.00 40.60  ? 261  SER B CA  1 
ATOM   4610 C C   . SER B 1 227 ? 25.915 5.908   21.776  1.00 41.26  ? 261  SER B C   1 
ATOM   4611 O O   . SER B 1 227 ? 26.845 6.035   20.989  1.00 40.99  ? 261  SER B O   1 
ATOM   4612 C CB  . SER B 1 227 ? 26.338 6.044   24.224  1.00 40.30  ? 261  SER B CB  1 
ATOM   4613 O OG  . SER B 1 227 ? 27.337 6.991   23.900  1.00 41.28  ? 261  SER B OG  1 
ATOM   4614 N N   . GLY B 1 228 ? 24.723 6.457   21.578  1.00 41.11  ? 262  GLY B N   1 
ATOM   4615 C CA  . GLY B 1 228 ? 24.466 7.247   20.393  1.00 41.92  ? 262  GLY B CA  1 
ATOM   4616 C C   . GLY B 1 228 ? 25.400 8.433   20.328  1.00 43.92  ? 262  GLY B C   1 
ATOM   4617 O O   . GLY B 1 228 ? 25.742 8.922   19.248  1.00 44.62  ? 262  GLY B O   1 
ATOM   4618 N N   . VAL B 1 229 ? 25.811 8.902   21.498  1.00 45.25  ? 263  VAL B N   1 
ATOM   4619 C CA  . VAL B 1 229 ? 26.706 10.038  21.594  1.00 46.29  ? 263  VAL B CA  1 
ATOM   4620 C C   . VAL B 1 229 ? 28.063 9.656   21.017  1.00 46.19  ? 263  VAL B C   1 
ATOM   4621 O O   . VAL B 1 229 ? 28.580 10.332  20.118  1.00 46.13  ? 263  VAL B O   1 
ATOM   4622 C CB  . VAL B 1 229 ? 26.874 10.460  23.053  1.00 47.15  ? 263  VAL B CB  1 
ATOM   4623 C CG1 . VAL B 1 229 ? 27.693 11.728  23.135  1.00 48.51  ? 263  VAL B CG1 1 
ATOM   4624 C CG2 . VAL B 1 229 ? 25.511 10.672  23.673  1.00 49.46  ? 263  VAL B CG2 1 
ATOM   4625 N N   . ASP B 1 230 ? 28.642 8.573   21.524  1.00 44.06  ? 264  ASP B N   1 
ATOM   4626 C CA  . ASP B 1 230 ? 29.933 8.150   21.015  1.00 44.83  ? 264  ASP B CA  1 
ATOM   4627 C C   . ASP B 1 230 ? 29.884 7.886   19.500  1.00 44.77  ? 264  ASP B C   1 
ATOM   4628 O O   . ASP B 1 230 ? 30.853 8.154   18.790  1.00 45.64  ? 264  ASP B O   1 
ATOM   4629 C CB  . ASP B 1 230 ? 30.405 6.905   21.754  1.00 46.54  ? 264  ASP B CB  1 
ATOM   4630 C CG  . ASP B 1 230 ? 30.609 7.152   23.243  1.00 48.85  ? 264  ASP B CG  1 
ATOM   4631 O OD1 . ASP B 1 230 ? 30.633 8.332   23.641  1.00 50.47  ? 264  ASP B OD1 1 
ATOM   4632 O OD2 . ASP B 1 230 ? 30.745 6.169   24.009  1.00 48.19  ? 264  ASP B OD2 1 
ATOM   4633 N N   . GLN B 1 231 ? 28.753 7.381   19.009  1.00 42.52  ? 265  GLN B N   1 
ATOM   4634 C CA  . GLN B 1 231 ? 28.592 7.097   17.590  1.00 40.92  ? 265  GLN B CA  1 
ATOM   4635 C C   . GLN B 1 231 ? 28.510 8.399   16.817  1.00 41.78  ? 265  GLN B C   1 
ATOM   4636 O O   . GLN B 1 231 ? 29.109 8.555   15.748  1.00 42.20  ? 265  GLN B O   1 
ATOM   4637 C CB  . GLN B 1 231 ? 27.328 6.262   17.357  1.00 38.37  ? 265  GLN B CB  1 
ATOM   4638 C CG  . GLN B 1 231 ? 27.359 4.922   18.075  1.00 38.88  ? 265  GLN B CG  1 
ATOM   4639 C CD  . GLN B 1 231 ? 26.034 4.176   18.041  1.00 39.37  ? 265  GLN B CD  1 
ATOM   4640 O OE1 . GLN B 1 231 ? 24.980 4.742   17.749  1.00 40.36  ? 265  GLN B OE1 1 
ATOM   4641 N NE2 . GLN B 1 231 ? 26.086 2.896   18.366  1.00 40.01  ? 265  GLN B NE2 1 
ATOM   4642 N N   . LEU B 1 232 ? 27.767 9.343   17.372  1.00 42.29  ? 266  LEU B N   1 
ATOM   4643 C CA  . LEU B 1 232 ? 27.601 10.647  16.746  1.00 43.28  ? 266  LEU B CA  1 
ATOM   4644 C C   . LEU B 1 232 ? 28.943 11.374  16.649  1.00 44.15  ? 266  LEU B C   1 
ATOM   4645 O O   . LEU B 1 232 ? 29.210 12.076  15.680  1.00 44.96  ? 266  LEU B O   1 
ATOM   4646 C CB  . LEU B 1 232 ? 26.600 11.469  17.555  1.00 43.36  ? 266  LEU B CB  1 
ATOM   4647 C CG  . LEU B 1 232 ? 25.357 11.965  16.816  1.00 44.53  ? 266  LEU B CG  1 
ATOM   4648 C CD1 . LEU B 1 232 ? 24.823 10.927  15.842  1.00 42.58  ? 266  LEU B CD1 1 
ATOM   4649 C CD2 . LEU B 1 232 ? 24.313 12.326  17.853  1.00 44.94  ? 266  LEU B CD2 1 
ATOM   4650 N N   . VAL B 1 233 ? 29.797 11.189  17.649  1.00 45.11  ? 267  VAL B N   1 
ATOM   4651 C CA  . VAL B 1 233 ? 31.103 11.833  17.649  1.00 45.62  ? 267  VAL B CA  1 
ATOM   4652 C C   . VAL B 1 233 ? 31.994 11.285  16.541  1.00 45.93  ? 267  VAL B C   1 
ATOM   4653 O O   . VAL B 1 233 ? 32.741 12.034  15.914  1.00 45.41  ? 267  VAL B O   1 
ATOM   4654 C CB  . VAL B 1 233 ? 31.830 11.643  19.015  1.00 46.34  ? 267  VAL B CB  1 
ATOM   4655 C CG1 . VAL B 1 233 ? 33.231 12.261  18.968  1.00 42.97  ? 267  VAL B CG1 1 
ATOM   4656 C CG2 . VAL B 1 233 ? 31.009 12.264  20.129  1.00 45.94  ? 267  VAL B CG2 1 
ATOM   4657 N N   . GLU B 1 234 ? 31.927 9.976   16.314  1.00 46.08  ? 268  GLU B N   1 
ATOM   4658 C CA  . GLU B 1 234 ? 32.742 9.341   15.283  1.00 46.75  ? 268  GLU B CA  1 
ATOM   4659 C C   . GLU B 1 234 ? 32.284 9.752   13.888  1.00 46.91  ? 268  GLU B C   1 
ATOM   4660 O O   . GLU B 1 234 ? 33.101 9.921   12.986  1.00 46.33  ? 268  GLU B O   1 
ATOM   4661 C CB  . GLU B 1 234 ? 32.678 7.822   15.436  1.00 48.50  ? 268  GLU B CB  1 
ATOM   4662 C CG  . GLU B 1 234 ? 33.249 7.341   16.750  1.00 49.72  ? 268  GLU B CG  1 
ATOM   4663 C CD  . GLU B 1 234 ? 34.734 7.646   16.879  1.00 51.47  ? 268  GLU B CD  1 
ATOM   4664 O OE1 . GLU B 1 234 ? 35.247 7.656   18.018  1.00 53.02  ? 268  GLU B OE1 1 
ATOM   4665 O OE2 . GLU B 1 234 ? 35.393 7.861   15.840  1.00 52.35  ? 268  GLU B OE2 1 
ATOM   4666 N N   . ILE B 1 235 ? 30.974 9.917   13.722  1.00 46.45  ? 269  ILE B N   1 
ATOM   4667 C CA  . ILE B 1 235 ? 30.404 10.319  12.444  1.00 46.27  ? 269  ILE B CA  1 
ATOM   4668 C C   . ILE B 1 235 ? 30.810 11.757  12.149  1.00 48.87  ? 269  ILE B C   1 
ATOM   4669 O O   . ILE B 1 235 ? 31.243 12.076  11.037  1.00 50.19  ? 269  ILE B O   1 
ATOM   4670 C CB  . ILE B 1 235 ? 28.872 10.220  12.474  1.00 44.64  ? 269  ILE B CB  1 
ATOM   4671 C CG1 . ILE B 1 235 ? 28.454 8.754   12.576  1.00 42.29  ? 269  ILE B CG1 1 
ATOM   4672 C CG2 . ILE B 1 235 ? 28.273 10.858  11.231  1.00 43.00  ? 269  ILE B CG2 1 
ATOM   4673 C CD1 . ILE B 1 235 ? 26.979 8.561   12.728  1.00 39.31  ? 269  ILE B CD1 1 
ATOM   4674 N N   . ILE B 1 236 ? 30.673 12.620  13.152  1.00 49.96  ? 270  ILE B N   1 
ATOM   4675 C CA  . ILE B 1 236 ? 31.043 14.017  13.000  1.00 51.54  ? 270  ILE B CA  1 
ATOM   4676 C C   . ILE B 1 236 ? 32.541 14.168  12.686  1.00 53.68  ? 270  ILE B C   1 
ATOM   4677 O O   . ILE B 1 236 ? 32.929 15.030  11.903  1.00 54.08  ? 270  ILE B O   1 
ATOM   4678 C CB  . ILE B 1 236 ? 30.676 14.829  14.272  1.00 50.97  ? 270  ILE B CB  1 
ATOM   4679 C CG1 . ILE B 1 236 ? 29.154 14.967  14.383  1.00 49.66  ? 270  ILE B CG1 1 
ATOM   4680 C CG2 . ILE B 1 236 ? 31.304 16.220  14.218  1.00 50.92  ? 270  ILE B CG2 1 
ATOM   4681 C CD1 . ILE B 1 236 ? 28.697 15.689  15.629  1.00 45.88  ? 270  ILE B CD1 1 
ATOM   4682 N N   . LYS B 1 237 ? 33.386 13.331  13.274  1.00 55.47  ? 271  LYS B N   1 
ATOM   4683 C CA  . LYS B 1 237 ? 34.811 13.433  12.985  1.00 57.96  ? 271  LYS B CA  1 
ATOM   4684 C C   . LYS B 1 237 ? 35.076 13.281  11.498  1.00 59.05  ? 271  LYS B C   1 
ATOM   4685 O O   . LYS B 1 237 ? 35.964 13.941  10.960  1.00 60.65  ? 271  LYS B O   1 
ATOM   4686 C CB  . LYS B 1 237 ? 35.618 12.362  13.721  1.00 58.33  ? 271  LYS B CB  1 
ATOM   4687 C CG  . LYS B 1 237 ? 35.833 12.618  15.196  1.00 58.91  ? 271  LYS B CG  1 
ATOM   4688 C CD  . LYS B 1 237 ? 36.698 11.512  15.765  1.00 60.34  ? 271  LYS B CD  1 
ATOM   4689 C CE  . LYS B 1 237 ? 36.858 11.635  17.260  1.00 61.45  ? 271  LYS B CE  1 
ATOM   4690 N NZ  . LYS B 1 237 ? 37.585 10.456  17.809  1.00 63.66  ? 271  LYS B NZ  1 
ATOM   4691 N N   . VAL B 1 238 ? 34.307 12.414  10.838  1.00 59.22  ? 272  VAL B N   1 
ATOM   4692 C CA  . VAL B 1 238 ? 34.489 12.157  9.413   1.00 57.87  ? 272  VAL B CA  1 
ATOM   4693 C C   . VAL B 1 238 ? 33.655 13.031  8.488   1.00 59.07  ? 272  VAL B C   1 
ATOM   4694 O O   . VAL B 1 238 ? 34.161 13.513  7.481   1.00 59.55  ? 272  VAL B O   1 
ATOM   4695 C CB  . VAL B 1 238 ? 34.194 10.684  9.081   1.00 56.41  ? 272  VAL B CB  1 
ATOM   4696 C CG1 . VAL B 1 238 ? 34.369 10.435  7.590   1.00 53.43  ? 272  VAL B CG1 1 
ATOM   4697 C CG2 . VAL B 1 238 ? 35.119 9.786   9.889   1.00 54.12  ? 272  VAL B CG2 1 
ATOM   4698 N N   . LEU B 1 239 ? 32.386 13.244  8.824   1.00 60.03  ? 273  LEU B N   1 
ATOM   4699 C CA  . LEU B 1 239 ? 31.519 14.044  7.969   1.00 61.21  ? 273  LEU B CA  1 
ATOM   4700 C C   . LEU B 1 239 ? 31.528 15.529  8.279   1.00 63.59  ? 273  LEU B C   1 
ATOM   4701 O O   . LEU B 1 239 ? 31.088 16.336  7.462   1.00 64.89  ? 273  LEU B O   1 
ATOM   4702 C CB  . LEU B 1 239 ? 30.075 13.549  8.045   1.00 59.03  ? 273  LEU B CB  1 
ATOM   4703 C CG  . LEU B 1 239 ? 29.784 12.093  7.704   1.00 57.75  ? 273  LEU B CG  1 
ATOM   4704 C CD1 . LEU B 1 239 ? 28.288 11.935  7.525   1.00 56.13  ? 273  LEU B CD1 1 
ATOM   4705 C CD2 . LEU B 1 239 ? 30.519 11.684  6.448   1.00 56.66  ? 273  LEU B CD2 1 
ATOM   4706 N N   . GLY B 1 240 ? 32.017 15.894  9.457   1.00 64.72  ? 274  GLY B N   1 
ATOM   4707 C CA  . GLY B 1 240 ? 32.039 17.296  9.822   1.00 65.68  ? 274  GLY B CA  1 
ATOM   4708 C C   . GLY B 1 240 ? 30.841 17.613  10.684  1.00 67.25  ? 274  GLY B C   1 
ATOM   4709 O O   . GLY B 1 240 ? 30.185 16.707  11.178  1.00 67.30  ? 274  GLY B O   1 
ATOM   4710 N N   . THR B 1 241 ? 30.549 18.895  10.864  1.00 70.18  ? 275  THR B N   1 
ATOM   4711 C CA  . THR B 1 241 ? 29.418 19.303  11.686  1.00 73.07  ? 275  THR B CA  1 
ATOM   4712 C C   . THR B 1 241 ? 28.166 19.486  10.842  1.00 74.42  ? 275  THR B C   1 
ATOM   4713 O O   . THR B 1 241 ? 28.169 20.188  9.836   1.00 75.14  ? 275  THR B O   1 
ATOM   4714 C CB  . THR B 1 241 ? 29.713 20.620  12.436  1.00 74.57  ? 275  THR B CB  1 
ATOM   4715 O OG1 . THR B 1 241 ? 30.951 20.496  13.149  1.00 75.15  ? 275  THR B OG1 1 
ATOM   4716 C CG2 . THR B 1 241 ? 28.597 20.928  13.428  1.00 74.26  ? 275  THR B CG2 1 
ATOM   4717 N N   . PRO B 1 242 ? 27.070 18.849  11.249  1.00 76.29  ? 276  PRO B N   1 
ATOM   4718 C CA  . PRO B 1 242 ? 25.798 18.940  10.528  1.00 78.19  ? 276  PRO B CA  1 
ATOM   4719 C C   . PRO B 1 242 ? 25.254 20.375  10.502  1.00 79.77  ? 276  PRO B C   1 
ATOM   4720 O O   . PRO B 1 242 ? 25.107 21.007  11.547  1.00 80.52  ? 276  PRO B O   1 
ATOM   4721 C CB  . PRO B 1 242 ? 24.884 18.002  11.320  1.00 77.71  ? 276  PRO B CB  1 
ATOM   4722 C CG  . PRO B 1 242 ? 25.833 17.037  11.950  1.00 78.10  ? 276  PRO B CG  1 
ATOM   4723 C CD  . PRO B 1 242 ? 26.964 17.923  12.385  1.00 76.95  ? 276  PRO B CD  1 
ATOM   4724 N N   . THR B 1 243 ? 24.958 20.886  9.309   1.00 81.18  ? 277  THR B N   1 
ATOM   4725 C CA  . THR B 1 243 ? 24.417 22.233  9.180   1.00 81.08  ? 277  THR B CA  1 
ATOM   4726 C C   . THR B 1 243 ? 23.008 22.219  9.749   1.00 82.82  ? 277  THR B C   1 
ATOM   4727 O O   . THR B 1 243 ? 22.384 21.163  9.839   1.00 83.38  ? 277  THR B O   1 
ATOM   4728 C CB  . THR B 1 243 ? 24.344 22.681  7.710   1.00 80.01  ? 277  THR B CB  1 
ATOM   4729 O OG1 . THR B 1 243 ? 23.266 22.006  7.050   1.00 79.23  ? 277  THR B OG1 1 
ATOM   4730 C CG2 . THR B 1 243 ? 25.653 22.366  6.992   1.00 78.26  ? 277  THR B CG2 1 
ATOM   4731 N N   . ARG B 1 244 ? 22.508 23.386  10.140  1.00 85.21  ? 278  ARG B N   1 
ATOM   4732 C CA  . ARG B 1 244 ? 21.161 23.490  10.708  1.00 86.84  ? 278  ARG B CA  1 
ATOM   4733 C C   . ARG B 1 244 ? 20.171 22.829  9.753   1.00 86.11  ? 278  ARG B C   1 
ATOM   4734 O O   . ARG B 1 244 ? 19.191 22.208  10.173  1.00 85.41  ? 278  ARG B O   1 
ATOM   4735 C CB  . ARG B 1 244 ? 20.795 24.968  10.908  1.00 89.66  ? 278  ARG B CB  1 
ATOM   4736 C CG  . ARG B 1 244 ? 19.491 25.231  11.667  1.00 93.06  ? 278  ARG B CG  1 
ATOM   4737 C CD  . ARG B 1 244 ? 19.232 26.737  11.761  1.00 96.32  ? 278  ARG B CD  1 
ATOM   4738 N NE  . ARG B 1 244 ? 20.392 27.453  12.300  1.00 98.97  ? 278  ARG B NE  1 
ATOM   4739 C CZ  . ARG B 1 244 ? 20.489 28.778  12.398  1.00 100.30 ? 278  ARG B CZ  1 
ATOM   4740 N NH1 . ARG B 1 244 ? 19.492 29.561  11.993  1.00 100.33 ? 278  ARG B NH1 1 
ATOM   4741 N NH2 . ARG B 1 244 ? 21.590 29.325  12.903  1.00 100.51 ? 278  ARG B NH2 1 
ATOM   4742 N N   . GLU B 1 245 ? 20.454 22.963  8.462   1.00 85.95  ? 279  GLU B N   1 
ATOM   4743 C CA  . GLU B 1 245 ? 19.611 22.398  7.419   1.00 86.37  ? 279  GLU B CA  1 
ATOM   4744 C C   . GLU B 1 245 ? 19.640 20.869  7.458   1.00 84.71  ? 279  GLU B C   1 
ATOM   4745 O O   . GLU B 1 245 ? 18.593 20.218  7.525   1.00 84.58  ? 279  GLU B O   1 
ATOM   4746 C CB  . GLU B 1 245 ? 20.088 22.892  6.058   1.00 88.35  ? 279  GLU B CB  1 
ATOM   4747 C CG  . GLU B 1 245 ? 19.225 22.450  4.901   1.00 93.32  ? 279  GLU B CG  1 
ATOM   4748 C CD  . GLU B 1 245 ? 19.909 22.697  3.570   1.00 97.22  ? 279  GLU B CD  1 
ATOM   4749 O OE1 . GLU B 1 245 ? 21.043 22.188  3.387   1.00 99.11  ? 279  GLU B OE1 1 
ATOM   4750 O OE2 . GLU B 1 245 ? 19.316 23.389  2.705   1.00 98.74  ? 279  GLU B OE2 1 
ATOM   4751 N N   . GLN B 1 246 ? 20.844 20.304  7.417   1.00 82.33  ? 280  GLN B N   1 
ATOM   4752 C CA  . GLN B 1 246 ? 21.012 18.859  7.452   1.00 79.69  ? 280  GLN B CA  1 
ATOM   4753 C C   . GLN B 1 246 ? 20.347 18.249  8.682   1.00 79.33  ? 280  GLN B C   1 
ATOM   4754 O O   . GLN B 1 246 ? 19.662 17.235  8.585   1.00 79.33  ? 280  GLN B O   1 
ATOM   4755 C CB  . GLN B 1 246 ? 22.501 18.498  7.421   1.00 76.86  ? 280  GLN B CB  1 
ATOM   4756 C CG  . GLN B 1 246 ? 23.177 18.821  6.103   1.00 73.26  ? 280  GLN B CG  1 
ATOM   4757 C CD  . GLN B 1 246 ? 24.677 18.598  6.141   1.00 72.37  ? 280  GLN B CD  1 
ATOM   4758 O OE1 . GLN B 1 246 ? 25.382 19.143  6.994   1.00 71.22  ? 280  GLN B OE1 1 
ATOM   4759 N NE2 . GLN B 1 246 ? 25.178 17.807  5.202   1.00 71.72  ? 280  GLN B NE2 1 
ATOM   4760 N N   . ILE B 1 247 ? 20.543 18.873  9.837   1.00 79.53  ? 281  ILE B N   1 
ATOM   4761 C CA  . ILE B 1 247 ? 19.957 18.376  11.077  1.00 80.12  ? 281  ILE B CA  1 
ATOM   4762 C C   . ILE B 1 247 ? 18.439 18.374  10.998  1.00 80.67  ? 281  ILE B C   1 
ATOM   4763 O O   . ILE B 1 247 ? 17.772 17.612  11.697  1.00 80.58  ? 281  ILE B O   1 
ATOM   4764 C CB  . ILE B 1 247 ? 20.382 19.238  12.281  1.00 80.20  ? 281  ILE B CB  1 
ATOM   4765 C CG1 . ILE B 1 247 ? 21.909 19.268  12.375  1.00 80.23  ? 281  ILE B CG1 1 
ATOM   4766 C CG2 . ILE B 1 247 ? 19.774 18.682  13.563  1.00 79.26  ? 281  ILE B CG2 1 
ATOM   4767 C CD1 . ILE B 1 247 ? 22.444 20.147  13.475  1.00 81.18  ? 281  ILE B CD1 1 
ATOM   4768 N N   . ARG B 1 248 ? 17.898 19.235  10.143  1.00 82.23  ? 282  ARG B N   1 
ATOM   4769 C CA  . ARG B 1 248 ? 16.454 19.335  9.971   1.00 83.98  ? 282  ARG B CA  1 
ATOM   4770 C C   . ARG B 1 248 ? 15.934 18.306  8.974   1.00 83.69  ? 282  ARG B C   1 
ATOM   4771 O O   . ARG B 1 248 ? 14.791 17.865  9.067   1.00 83.31  ? 282  ARG B O   1 
ATOM   4772 C CB  . ARG B 1 248 ? 16.076 20.747  9.511   1.00 86.27  ? 282  ARG B CB  1 
ATOM   4773 C CG  . ARG B 1 248 ? 14.567 21.017  9.490   1.00 89.17  ? 282  ARG B CG  1 
ATOM   4774 C CD  . ARG B 1 248 ? 14.276 22.508  9.347   1.00 92.37  ? 282  ARG B CD  1 
ATOM   4775 N NE  . ARG B 1 248 ? 15.057 23.282  10.315  1.00 96.08  ? 282  ARG B NE  1 
ATOM   4776 C CZ  . ARG B 1 248 ? 15.017 24.607  10.443  1.00 97.07  ? 282  ARG B CZ  1 
ATOM   4777 N NH1 . ARG B 1 248 ? 14.222 25.332  9.663   1.00 97.08  ? 282  ARG B NH1 1 
ATOM   4778 N NH2 . ARG B 1 248 ? 15.787 25.209  11.346  1.00 97.63  ? 282  ARG B NH2 1 
ATOM   4779 N N   . GLU B 1 249 ? 16.771 17.932  8.013   1.00 84.44  ? 283  GLU B N   1 
ATOM   4780 C CA  . GLU B 1 249 ? 16.374 16.944  7.019   1.00 84.58  ? 283  GLU B CA  1 
ATOM   4781 C C   . GLU B 1 249 ? 16.426 15.543  7.629   1.00 83.83  ? 283  GLU B C   1 
ATOM   4782 O O   . GLU B 1 249 ? 15.704 14.645  7.195   1.00 82.29  ? 283  GLU B O   1 
ATOM   4783 C CB  . GLU B 1 249 ? 17.279 17.034  5.790   1.00 86.07  ? 283  GLU B CB  1 
ATOM   4784 C CG  . GLU B 1 249 ? 17.296 18.416  5.154   1.00 88.65  ? 283  GLU B CG  1 
ATOM   4785 C CD  . GLU B 1 249 ? 17.827 18.401  3.735   1.00 90.30  ? 283  GLU B CD  1 
ATOM   4786 O OE1 . GLU B 1 249 ? 17.147 17.815  2.859   1.00 91.23  ? 283  GLU B OE1 1 
ATOM   4787 O OE2 . GLU B 1 249 ? 18.920 18.967  3.497   1.00 91.22  ? 283  GLU B OE2 1 
ATOM   4788 N N   . MET B 1 250 ? 17.286 15.368  8.635   1.00 84.09  ? 284  MET B N   1 
ATOM   4789 C CA  . MET B 1 250 ? 17.410 14.097  9.353   1.00 85.26  ? 284  MET B CA  1 
ATOM   4790 C C   . MET B 1 250 ? 16.162 14.020  10.222  1.00 87.44  ? 284  MET B C   1 
ATOM   4791 O O   . MET B 1 250 ? 15.872 13.003  10.845  1.00 86.78  ? 284  MET B O   1 
ATOM   4792 C CB  . MET B 1 250 ? 18.671 14.082  10.225  1.00 82.47  ? 284  MET B CB  1 
ATOM   4793 C CG  . MET B 1 250 ? 19.959 14.123  9.417   1.00 80.45  ? 284  MET B CG  1 
ATOM   4794 S SD  . MET B 1 250 ? 21.490 13.893  10.349  1.00 78.19  ? 284  MET B SD  1 
ATOM   4795 C CE  . MET B 1 250 ? 22.052 15.570  10.510  1.00 78.47  ? 284  MET B CE  1 
ATOM   4796 N N   . ASN B 1 251 ? 15.451 15.146  10.230  1.00 91.82  ? 285  ASN B N   1 
ATOM   4797 C CA  . ASN B 1 251 ? 14.186 15.391  10.924  1.00 94.86  ? 285  ASN B CA  1 
ATOM   4798 C C   . ASN B 1 251 ? 14.205 15.799  12.399  1.00 96.24  ? 285  ASN B C   1 
ATOM   4799 O O   . ASN B 1 251 ? 14.217 16.999  12.691  1.00 96.58  ? 285  ASN B O   1 
ATOM   4800 C CB  . ASN B 1 251 ? 13.210 14.228  10.717  1.00 96.31  ? 285  ASN B CB  1 
ATOM   4801 C CG  . ASN B 1 251 ? 11.824 14.538  11.259  1.00 97.96  ? 285  ASN B CG  1 
ATOM   4802 O OD1 . ASN B 1 251 ? 11.207 15.546  10.885  1.00 97.73  ? 285  ASN B OD1 1 
ATOM   4803 N ND2 . ASN B 1 251 ? 11.324 13.674  12.146  1.00 98.31  ? 285  ASN B ND2 1 
ATOM   4804 N N   . PRO B 1 252 ? 14.213 14.828  13.342  1.00 97.70  ? 286  PRO B N   1 
ATOM   4805 C CA  . PRO B 1 252 ? 14.220 15.175  14.766  1.00 98.49  ? 286  PRO B CA  1 
ATOM   4806 C C   . PRO B 1 252 ? 14.498 16.643  15.063  1.00 99.83  ? 286  PRO B C   1 
ATOM   4807 O O   . PRO B 1 252 ? 15.577 17.168  14.749  1.00 100.44 ? 286  PRO B O   1 
ATOM   4808 C CB  . PRO B 1 252 ? 15.266 14.231  15.325  1.00 98.26  ? 286  PRO B CB  1 
ATOM   4809 C CG  . PRO B 1 252 ? 14.901 12.982  14.624  1.00 98.38  ? 286  PRO B CG  1 
ATOM   4810 C CD  . PRO B 1 252 ? 14.688 13.441  13.180  1.00 98.02  ? 286  PRO B CD  1 
ATOM   4811 N N   . ASN B 1 253 ? 13.499 17.291  15.660  1.00 99.85  ? 287  ASN B N   1 
ATOM   4812 C CA  . ASN B 1 253 ? 13.553 18.708  16.004  1.00 99.91  ? 287  ASN B CA  1 
ATOM   4813 C C   . ASN B 1 253 ? 14.680 19.054  16.968  1.00 100.28 ? 287  ASN B C   1 
ATOM   4814 O O   . ASN B 1 253 ? 14.514 19.862  17.884  1.00 100.48 ? 287  ASN B O   1 
ATOM   4815 C CB  . ASN B 1 253 ? 12.204 19.130  16.578  1.00 100.40 ? 287  ASN B CB  1 
ATOM   4816 C CG  . ASN B 1 253 ? 11.044 18.691  15.697  1.00 101.60 ? 287  ASN B CG  1 
ATOM   4817 O OD1 . ASN B 1 253 ? 10.819 17.490  15.501  1.00 101.38 ? 287  ASN B OD1 1 
ATOM   4818 N ND2 . ASN B 1 253 ? 10.304 19.661  15.154  1.00 101.16 ? 287  ASN B ND2 1 
ATOM   4819 N N   . TYR B 1 254 ? 15.833 18.434  16.743  1.00 100.61 ? 288  TYR B N   1 
ATOM   4820 C CA  . TYR B 1 254 ? 17.021 18.663  17.550  1.00 100.70 ? 288  TYR B CA  1 
ATOM   4821 C C   . TYR B 1 254 ? 17.818 19.816  16.947  1.00 101.31 ? 288  TYR B C   1 
ATOM   4822 O O   . TYR B 1 254 ? 19.052 19.830  17.032  1.00 101.88 ? 288  TYR B O   1 
ATOM   4823 C CB  . TYR B 1 254 ? 17.901 17.409  17.575  1.00 99.33  ? 288  TYR B CB  1 
ATOM   4824 C CG  . TYR B 1 254 ? 17.380 16.286  18.437  1.00 98.35  ? 288  TYR B CG  1 
ATOM   4825 C CD1 . TYR B 1 254 ? 16.096 15.770  18.250  1.00 97.56  ? 288  TYR B CD1 1 
ATOM   4826 C CD2 . TYR B 1 254 ? 18.189 15.708  19.413  1.00 97.76  ? 288  TYR B CD2 1 
ATOM   4827 C CE1 . TYR B 1 254 ? 15.632 14.699  19.010  1.00 97.73  ? 288  TYR B CE1 1 
ATOM   4828 C CE2 . TYR B 1 254 ? 17.739 14.640  20.178  1.00 98.07  ? 288  TYR B CE2 1 
ATOM   4829 C CZ  . TYR B 1 254 ? 16.461 14.134  19.972  1.00 98.19  ? 288  TYR B CZ  1 
ATOM   4830 O OH  . TYR B 1 254 ? 16.035 13.048  20.712  1.00 97.80  ? 288  TYR B OH  1 
ATOM   4831 N N   . THR B 1 255 ? 17.121 20.775  16.332  1.00 101.04 ? 289  THR B N   1 
ATOM   4832 C CA  . THR B 1 255 ? 17.799 21.919  15.725  1.00 100.96 ? 289  THR B CA  1 
ATOM   4833 C C   . THR B 1 255 ? 18.662 22.547  16.814  1.00 101.17 ? 289  THR B C   1 
ATOM   4834 O O   . THR B 1 255 ? 19.629 23.266  16.536  1.00 101.62 ? 289  THR B O   1 
ATOM   4835 C CB  . THR B 1 255 ? 16.798 22.961  15.181  1.00 101.18 ? 289  THR B CB  1 
ATOM   4836 O OG1 . THR B 1 255 ? 15.895 22.324  14.264  1.00 101.88 ? 289  THR B OG1 1 
ATOM   4837 C CG2 . THR B 1 255 ? 17.541 24.082  14.449  1.00 100.01 ? 289  THR B CG2 1 
ATOM   4838 N N   . GLU B 1 256 ? 18.293 22.254  18.060  1.00 100.27 ? 290  GLU B N   1 
ATOM   4839 C CA  . GLU B 1 256 ? 19.017 22.724  19.233  1.00 99.22  ? 290  GLU B CA  1 
ATOM   4840 C C   . GLU B 1 256 ? 20.088 21.657  19.468  1.00 97.99  ? 290  GLU B C   1 
ATOM   4841 O O   . GLU B 1 256 ? 20.029 20.870  20.424  1.00 96.91  ? 290  GLU B O   1 
ATOM   4842 C CB  . GLU B 1 256 ? 18.062 22.814  20.424  1.00 100.47 ? 290  GLU B CB  1 
ATOM   4843 C CG  . GLU B 1 256 ? 18.669 23.411  21.681  1.00 101.58 ? 290  GLU B CG  1 
ATOM   4844 C CD  . GLU B 1 256 ? 17.633 23.646  22.766  1.00 102.50 ? 290  GLU B CD  1 
ATOM   4845 O OE1 . GLU B 1 256 ? 16.953 22.668  23.163  1.00 102.10 ? 290  GLU B OE1 1 
ATOM   4846 O OE2 . GLU B 1 256 ? 17.501 24.809  23.222  1.00 102.40 ? 290  GLU B OE2 1 
ATOM   4847 N N   . PHE B 1 257 ? 21.057 21.637  18.557  1.00 96.18  ? 291  PHE B N   1 
ATOM   4848 C CA  . PHE B 1 257 ? 22.152 20.677  18.576  1.00 94.59  ? 291  PHE B CA  1 
ATOM   4849 C C   . PHE B 1 257 ? 23.329 21.174  19.434  1.00 94.03  ? 291  PHE B C   1 
ATOM   4850 O O   . PHE B 1 257 ? 23.860 22.266  19.214  1.00 93.51  ? 291  PHE B O   1 
ATOM   4851 C CB  . PHE B 1 257 ? 22.588 20.406  17.122  1.00 93.19  ? 291  PHE B CB  1 
ATOM   4852 C CG  . PHE B 1 257 ? 23.425 19.170  16.952  1.00 90.95  ? 291  PHE B CG  1 
ATOM   4853 C CD1 . PHE B 1 257 ? 22.987 17.947  17.445  1.00 90.41  ? 291  PHE B CD1 1 
ATOM   4854 C CD2 . PHE B 1 257 ? 24.671 19.239  16.335  1.00 89.94  ? 291  PHE B CD2 1 
ATOM   4855 C CE1 . PHE B 1 257 ? 23.784 16.808  17.338  1.00 89.51  ? 291  PHE B CE1 1 
ATOM   4856 C CE2 . PHE B 1 257 ? 25.474 18.110  16.223  1.00 89.33  ? 291  PHE B CE2 1 
ATOM   4857 C CZ  . PHE B 1 257 ? 25.028 16.891  16.727  1.00 89.10  ? 291  PHE B CZ  1 
ATOM   4858 N N   . ALA B 1 258 ? 23.720 20.368  20.420  1.00 93.53  ? 292  ALA B N   1 
ATOM   4859 C CA  . ALA B 1 258 ? 24.824 20.713  21.314  1.00 93.38  ? 292  ALA B CA  1 
ATOM   4860 C C   . ALA B 1 258 ? 26.031 19.801  21.100  1.00 92.83  ? 292  ALA B C   1 
ATOM   4861 O O   . ALA B 1 258 ? 26.201 18.803  21.805  1.00 92.94  ? 292  ALA B O   1 
ATOM   4862 C CB  . ALA B 1 258 ? 24.363 20.636  22.775  1.00 93.06  ? 292  ALA B CB  1 
ATOM   4863 N N   . PHE B 1 259 ? 26.859 20.153  20.120  1.00 91.90  ? 293  PHE B N   1 
ATOM   4864 C CA  . PHE B 1 259 ? 28.063 19.396  19.796  1.00 91.77  ? 293  PHE B CA  1 
ATOM   4865 C C   . PHE B 1 259 ? 29.142 20.333  19.246  1.00 92.19  ? 293  PHE B C   1 
ATOM   4866 O O   . PHE B 1 259 ? 28.829 21.324  18.579  1.00 92.09  ? 293  PHE B O   1 
ATOM   4867 C CB  . PHE B 1 259 ? 27.753 18.308  18.754  1.00 90.63  ? 293  PHE B CB  1 
ATOM   4868 C CG  . PHE B 1 259 ? 27.530 16.944  19.344  1.00 89.53  ? 293  PHE B CG  1 
ATOM   4869 C CD1 . PHE B 1 259 ? 26.272 16.560  19.810  1.00 89.77  ? 293  PHE B CD1 1 
ATOM   4870 C CD2 . PHE B 1 259 ? 28.589 16.051  19.464  1.00 88.55  ? 293  PHE B CD2 1 
ATOM   4871 C CE1 . PHE B 1 259 ? 26.075 15.302  20.385  1.00 88.99  ? 293  PHE B CE1 1 
ATOM   4872 C CE2 . PHE B 1 259 ? 28.403 14.794  20.037  1.00 88.46  ? 293  PHE B CE2 1 
ATOM   4873 C CZ  . PHE B 1 259 ? 27.145 14.420  20.500  1.00 88.53  ? 293  PHE B CZ  1 
ATOM   4874 N N   . PRO B 1 260 ? 30.426 20.036  19.528  1.00 92.60  ? 294  PRO B N   1 
ATOM   4875 C CA  . PRO B 1 260 ? 31.554 20.853  19.055  1.00 93.05  ? 294  PRO B CA  1 
ATOM   4876 C C   . PRO B 1 260 ? 31.518 21.134  17.540  1.00 93.94  ? 294  PRO B C   1 
ATOM   4877 O O   . PRO B 1 260 ? 30.867 20.410  16.779  1.00 94.29  ? 294  PRO B O   1 
ATOM   4878 C CB  . PRO B 1 260 ? 32.769 20.024  19.468  1.00 92.39  ? 294  PRO B CB  1 
ATOM   4879 C CG  . PRO B 1 260 ? 32.307 19.414  20.758  1.00 91.87  ? 294  PRO B CG  1 
ATOM   4880 C CD  . PRO B 1 260 ? 30.899 18.961  20.422  1.00 92.14  ? 294  PRO B CD  1 
ATOM   4881 N N   . GLN B 1 261 ? 32.215 22.186  17.109  1.00 94.27  ? 295  GLN B N   1 
ATOM   4882 C CA  . GLN B 1 261 ? 32.255 22.552  15.690  1.00 94.63  ? 295  GLN B CA  1 
ATOM   4883 C C   . GLN B 1 261 ? 33.457 21.926  14.988  1.00 94.39  ? 295  GLN B C   1 
ATOM   4884 O O   . GLN B 1 261 ? 34.401 22.622  14.606  1.00 94.03  ? 295  GLN B O   1 
ATOM   4885 C CB  . GLN B 1 261 ? 32.317 24.074  15.526  1.00 95.66  ? 295  GLN B CB  1 
ATOM   4886 C CG  . GLN B 1 261 ? 32.255 24.550  14.079  1.00 97.21  ? 295  GLN B CG  1 
ATOM   4887 C CD  . GLN B 1 261 ? 32.591 26.027  13.936  1.00 99.17  ? 295  GLN B CD  1 
ATOM   4888 O OE1 . GLN B 1 261 ? 32.031 26.875  14.642  1.00 99.93  ? 295  GLN B OE1 1 
ATOM   4889 N NE2 . GLN B 1 261 ? 33.507 26.344  13.016  1.00 98.95  ? 295  GLN B NE2 1 
ATOM   4890 N N   . ILE B 1 262 ? 33.406 20.608  14.813  1.00 94.21  ? 296  ILE B N   1 
ATOM   4891 C CA  . ILE B 1 262 ? 34.483 19.866  14.167  1.00 94.09  ? 296  ILE B CA  1 
ATOM   4892 C C   . ILE B 1 262 ? 34.237 19.716  12.666  1.00 95.13  ? 296  ILE B C   1 
ATOM   4893 O O   . ILE B 1 262 ? 33.227 19.153  12.247  1.00 96.08  ? 296  ILE B O   1 
ATOM   4894 C CB  . ILE B 1 262 ? 34.631 18.454  14.796  1.00 93.36  ? 296  ILE B CB  1 
ATOM   4895 C CG1 . ILE B 1 262 ? 34.849 18.578  16.316  1.00 93.15  ? 296  ILE B CG1 1 
ATOM   4896 C CG2 . ILE B 1 262 ? 35.788 17.710  14.142  1.00 91.90  ? 296  ILE B CG2 1 
ATOM   4897 C CD1 . ILE B 1 262 ? 34.899 17.244  17.066  1.00 92.36  ? 296  ILE B CD1 1 
ATOM   4898 N N   . LYS B 1 263 ? 35.156 20.238  11.858  1.00 95.34  ? 297  LYS B N   1 
ATOM   4899 C CA  . LYS B 1 263 ? 35.041 20.137  10.405  1.00 94.74  ? 297  LYS B CA  1 
ATOM   4900 C C   . LYS B 1 263 ? 35.636 18.791  9.992   1.00 94.17  ? 297  LYS B C   1 
ATOM   4901 O O   . LYS B 1 263 ? 36.441 18.206  10.724  1.00 93.56  ? 297  LYS B O   1 
ATOM   4902 C CB  . LYS B 1 263 ? 35.767 21.315  9.742   1.00 95.18  ? 297  LYS B CB  1 
ATOM   4903 C CG  . LYS B 1 263 ? 35.159 22.660  10.156  1.00 95.70  ? 297  LYS B CG  1 
ATOM   4904 C CD  . LYS B 1 263 ? 36.007 23.867  9.784   1.00 95.45  ? 297  LYS B CD  1 
ATOM   4905 C CE  . LYS B 1 263 ? 35.425 25.133  10.422  1.00 95.55  ? 297  LYS B CE  1 
ATOM   4906 N NZ  . LYS B 1 263 ? 36.258 26.348  10.193  1.00 93.99  ? 297  LYS B NZ  1 
ATOM   4907 N N   . ALA B 1 264 ? 35.238 18.301  8.825   1.00 93.91  ? 298  ALA B N   1 
ATOM   4908 C CA  . ALA B 1 264 ? 35.687 16.997  8.346   1.00 93.89  ? 298  ALA B CA  1 
ATOM   4909 C C   . ALA B 1 264 ? 37.119 16.877  7.849   1.00 94.08  ? 298  ALA B C   1 
ATOM   4910 O O   . ALA B 1 264 ? 37.583 17.712  7.068   1.00 93.94  ? 298  ALA B O   1 
ATOM   4911 C CB  . ALA B 1 264 ? 34.738 16.509  7.258   1.00 93.60  ? 298  ALA B CB  1 
ATOM   4912 N N   . HIS B 1 265 ? 37.818 15.840  8.318   1.00 94.70  ? 299  HIS B N   1 
ATOM   4913 C CA  . HIS B 1 265 ? 39.179 15.574  7.856   1.00 95.07  ? 299  HIS B CA  1 
ATOM   4914 C C   . HIS B 1 265 ? 38.986 14.512  6.778   1.00 93.86  ? 299  HIS B C   1 
ATOM   4915 O O   . HIS B 1 265 ? 38.928 13.314  7.055   1.00 93.72  ? 299  HIS B O   1 
ATOM   4916 C CB  . HIS B 1 265 ? 40.127 15.101  8.991   1.00 96.71  ? 299  HIS B CB  1 
ATOM   4917 C CG  . HIS B 1 265 ? 39.751 13.800  9.632   1.00 98.59  ? 299  HIS B CG  1 
ATOM   4918 N ND1 . HIS B 1 265 ? 38.645 13.655  10.445  1.00 99.73  ? 299  HIS B ND1 1 
ATOM   4919 C CD2 . HIS B 1 265 ? 40.378 12.598  9.638   1.00 99.46  ? 299  HIS B CD2 1 
ATOM   4920 C CE1 . HIS B 1 265 ? 38.610 12.426  10.927  1.00 99.95  ? 299  HIS B CE1 1 
ATOM   4921 N NE2 . HIS B 1 265 ? 39.651 11.763  10.453  1.00 100.41 ? 299  HIS B NE2 1 
ATOM   4922 N N   . PRO B 1 266 ? 38.862 14.971  5.521   1.00 92.40  ? 300  PRO B N   1 
ATOM   4923 C CA  . PRO B 1 266 ? 38.655 14.233  4.277   1.00 90.73  ? 300  PRO B CA  1 
ATOM   4924 C C   . PRO B 1 266 ? 38.739 12.724  4.315   1.00 88.19  ? 300  PRO B C   1 
ATOM   4925 O O   . PRO B 1 266 ? 39.554 12.127  5.020   1.00 87.36  ? 300  PRO B O   1 
ATOM   4926 C CB  . PRO B 1 266 ? 39.680 14.859  3.347   1.00 91.66  ? 300  PRO B CB  1 
ATOM   4927 C CG  . PRO B 1 266 ? 39.508 16.297  3.676   1.00 92.68  ? 300  PRO B CG  1 
ATOM   4928 C CD  . PRO B 1 266 ? 39.404 16.310  5.211   1.00 92.92  ? 300  PRO B CD  1 
ATOM   4929 N N   . TRP B 1 267 ? 37.870 12.126  3.516   1.00 85.46  ? 301  TRP B N   1 
ATOM   4930 C CA  . TRP B 1 267 ? 37.780 10.695  3.403   1.00 82.68  ? 301  TRP B CA  1 
ATOM   4931 C C   . TRP B 1 267 ? 39.103 10.039  3.006   1.00 82.74  ? 301  TRP B C   1 
ATOM   4932 O O   . TRP B 1 267 ? 39.431 8.951   3.491   1.00 83.30  ? 301  TRP B O   1 
ATOM   4933 C CB  . TRP B 1 267 ? 36.687 10.341  2.401   1.00 77.47  ? 301  TRP B CB  1 
ATOM   4934 C CG  . TRP B 1 267 ? 35.298 10.519  2.940   1.00 72.25  ? 301  TRP B CG  1 
ATOM   4935 C CD1 . TRP B 1 267 ? 34.448 11.569  2.720   1.00 69.97  ? 301  TRP B CD1 1 
ATOM   4936 C CD2 . TRP B 1 267 ? 34.573 9.576   3.740   1.00 69.18  ? 301  TRP B CD2 1 
ATOM   4937 N NE1 . TRP B 1 267 ? 33.232 11.327  3.321   1.00 68.11  ? 301  TRP B NE1 1 
ATOM   4938 C CE2 . TRP B 1 267 ? 33.282 10.110  3.948   1.00 68.17  ? 301  TRP B CE2 1 
ATOM   4939 C CE3 . TRP B 1 267 ? 34.886 8.327   4.284   1.00 67.08  ? 301  TRP B CE3 1 
ATOM   4940 C CZ2 . TRP B 1 267 ? 32.310 9.436   4.691   1.00 67.57  ? 301  TRP B CZ2 1 
ATOM   4941 C CZ3 . TRP B 1 267 ? 33.920 7.659   5.021   1.00 67.53  ? 301  TRP B CZ3 1 
ATOM   4942 C CH2 . TRP B 1 267 ? 32.645 8.212   5.212   1.00 68.01  ? 301  TRP B CH2 1 
ATOM   4943 N N   . THR B 1 268 ? 39.872 10.689  2.138   1.00 82.82  ? 302  THR B N   1 
ATOM   4944 C CA  . THR B 1 268 ? 41.149 10.112  1.712   1.00 83.76  ? 302  THR B CA  1 
ATOM   4945 C C   . THR B 1 268 ? 42.091 9.951   2.907   1.00 82.61  ? 302  THR B C   1 
ATOM   4946 O O   . THR B 1 268 ? 43.088 9.228   2.833   1.00 83.31  ? 302  THR B O   1 
ATOM   4947 C CB  . THR B 1 268 ? 41.839 10.986  0.643   1.00 83.37  ? 302  THR B CB  1 
ATOM   4948 O OG1 . THR B 1 268 ? 40.932 11.225  -0.442  1.00 82.60  ? 302  THR B OG1 1 
ATOM   4949 C CG2 . THR B 1 268 ? 43.081 10.279  0.100   1.00 82.51  ? 302  THR B CG2 1 
ATOM   4950 N N   . LYS B 1 269 ? 41.752 10.627  4.003   1.00 81.88  ? 303  LYS B N   1 
ATOM   4951 C CA  . LYS B 1 269 ? 42.530 10.596  5.240   1.00 80.91  ? 303  LYS B CA  1 
ATOM   4952 C C   . LYS B 1 269 ? 42.003 9.491   6.179   1.00 78.83  ? 303  LYS B C   1 
ATOM   4953 O O   . LYS B 1 269 ? 42.605 9.196   7.215   1.00 79.26  ? 303  LYS B O   1 
ATOM   4954 C CB  . LYS B 1 269 ? 42.417 11.961  5.932   1.00 83.00  ? 303  LYS B CB  1 
ATOM   4955 C CG  . LYS B 1 269 ? 43.350 12.191  7.128   1.00 85.12  ? 303  LYS B CG  1 
ATOM   4956 C CD  . LYS B 1 269 ? 44.778 12.498  6.681   1.00 85.33  ? 303  LYS B CD  1 
ATOM   4957 C CE  . LYS B 1 269 ? 45.669 12.849  7.867   1.00 85.61  ? 303  LYS B CE  1 
ATOM   4958 N NZ  . LYS B 1 269 ? 47.033 13.284  7.441   1.00 85.78  ? 303  LYS B NZ  1 
ATOM   4959 N N   . VAL B 1 270 ? 40.881 8.883   5.804   1.00 75.36  ? 304  VAL B N   1 
ATOM   4960 C CA  . VAL B 1 270 ? 40.254 7.838   6.603   1.00 71.05  ? 304  VAL B CA  1 
ATOM   4961 C C   . VAL B 1 270 ? 40.740 6.434   6.280   1.00 70.74  ? 304  VAL B C   1 
ATOM   4962 O O   . VAL B 1 270 ? 40.946 5.620   7.178   1.00 69.25  ? 304  VAL B O   1 
ATOM   4963 C CB  . VAL B 1 270 ? 38.728 7.859   6.407   1.00 69.94  ? 304  VAL B CB  1 
ATOM   4964 C CG1 . VAL B 1 270 ? 38.080 6.761   7.225   1.00 68.24  ? 304  VAL B CG1 1 
ATOM   4965 C CG2 . VAL B 1 270 ? 38.176 9.217   6.778   1.00 69.07  ? 304  VAL B CG2 1 
ATOM   4966 N N   . PHE B 1 271 ? 40.917 6.157   4.994   1.00 69.99  ? 305  PHE B N   1 
ATOM   4967 C CA  . PHE B 1 271 ? 41.335 4.839   4.541   1.00 70.82  ? 305  PHE B CA  1 
ATOM   4968 C C   . PHE B 1 271 ? 42.835 4.721   4.263   1.00 73.36  ? 305  PHE B C   1 
ATOM   4969 O O   . PHE B 1 271 ? 43.540 5.725   4.171   1.00 74.54  ? 305  PHE B O   1 
ATOM   4970 C CB  . PHE B 1 271 ? 40.534 4.480   3.285   1.00 67.44  ? 305  PHE B CB  1 
ATOM   4971 C CG  . PHE B 1 271 ? 39.040 4.515   3.485   1.00 64.33  ? 305  PHE B CG  1 
ATOM   4972 C CD1 . PHE B 1 271 ? 38.387 3.480   4.146   1.00 63.46  ? 305  PHE B CD1 1 
ATOM   4973 C CD2 . PHE B 1 271 ? 38.288 5.589   3.030   1.00 63.02  ? 305  PHE B CD2 1 
ATOM   4974 C CE1 . PHE B 1 271 ? 37.009 3.518   4.347   1.00 61.61  ? 305  PHE B CE1 1 
ATOM   4975 C CE2 . PHE B 1 271 ? 36.907 5.629   3.231   1.00 61.25  ? 305  PHE B CE2 1 
ATOM   4976 C CZ  . PHE B 1 271 ? 36.274 4.594   3.889   1.00 59.50  ? 305  PHE B CZ  1 
ATOM   4977 N N   . ARG B 1 272 ? 43.315 3.485   4.134   1.00 75.72  ? 306  ARG B N   1 
ATOM   4978 C CA  . ARG B 1 272 ? 44.724 3.224   3.850   1.00 78.35  ? 306  ARG B CA  1 
ATOM   4979 C C   . ARG B 1 272 ? 45.083 3.843   2.502   1.00 79.14  ? 306  ARG B C   1 
ATOM   4980 O O   . ARG B 1 272 ? 44.218 4.049   1.651   1.00 79.59  ? 306  ARG B O   1 
ATOM   4981 C CB  . ARG B 1 272 ? 44.986 1.718   3.800   1.00 80.89  ? 306  ARG B CB  1 
ATOM   4982 C CG  . ARG B 1 272 ? 44.474 0.972   5.020   1.00 85.77  ? 306  ARG B CG  1 
ATOM   4983 C CD  . ARG B 1 272 ? 44.750 -0.524  4.936   1.00 89.53  ? 306  ARG B CD  1 
ATOM   4984 N NE  . ARG B 1 272 ? 44.333 -1.205  6.164   1.00 93.40  ? 306  ARG B NE  1 
ATOM   4985 C CZ  . ARG B 1 272 ? 44.618 -2.474  6.456   1.00 95.01  ? 306  ARG B CZ  1 
ATOM   4986 N NH1 . ARG B 1 272 ? 45.327 -3.214  5.606   1.00 95.86  ? 306  ARG B NH1 1 
ATOM   4987 N NH2 . ARG B 1 272 ? 44.199 -3.006  7.600   1.00 94.85  ? 306  ARG B NH2 1 
ATOM   4988 N N   . PRO B 1 273 ? 46.370 4.148   2.291   1.00 79.70  ? 307  PRO B N   1 
ATOM   4989 C CA  . PRO B 1 273 ? 46.853 4.748   1.043   1.00 79.06  ? 307  PRO B CA  1 
ATOM   4990 C C   . PRO B 1 273 ? 46.489 3.985   -0.238  1.00 78.31  ? 307  PRO B C   1 
ATOM   4991 O O   . PRO B 1 273 ? 46.172 4.597   -1.255  1.00 77.87  ? 307  PRO B O   1 
ATOM   4992 C CB  . PRO B 1 273 ? 48.360 4.836   1.276   1.00 79.66  ? 307  PRO B CB  1 
ATOM   4993 C CG  . PRO B 1 273 ? 48.441 5.094   2.755   1.00 78.96  ? 307  PRO B CG  1 
ATOM   4994 C CD  . PRO B 1 273 ? 47.451 4.085   3.291   1.00 79.75  ? 307  PRO B CD  1 
ATOM   4995 N N   . ARG B 1 274 ? 46.522 2.657   -0.184  1.00 78.29  ? 308  ARG B N   1 
ATOM   4996 C CA  . ARG B 1 274 ? 46.203 1.826   -1.350  1.00 78.26  ? 308  ARG B CA  1 
ATOM   4997 C C   . ARG B 1 274 ? 44.717 1.795   -1.719  1.00 75.76  ? 308  ARG B C   1 
ATOM   4998 O O   . ARG B 1 274 ? 44.360 1.365   -2.814  1.00 75.33  ? 308  ARG B O   1 
ATOM   4999 C CB  . ARG B 1 274 ? 46.693 0.390   -1.124  1.00 81.57  ? 308  ARG B CB  1 
ATOM   5000 C CG  . ARG B 1 274 ? 48.210 0.241   -1.136  1.00 86.46  ? 308  ARG B CG  1 
ATOM   5001 C CD  . ARG B 1 274 ? 48.778 0.619   -2.497  1.00 88.77  ? 308  ARG B CD  1 
ATOM   5002 N NE  . ARG B 1 274 ? 50.224 0.426   -2.586  1.00 92.06  ? 308  ARG B NE  1 
ATOM   5003 C CZ  . ARG B 1 274 ? 51.122 1.073   -1.845  1.00 93.54  ? 308  ARG B CZ  1 
ATOM   5004 N NH1 . ARG B 1 274 ? 50.727 1.965   -0.942  1.00 93.76  ? 308  ARG B NH1 1 
ATOM   5005 N NH2 . ARG B 1 274 ? 52.420 0.838   -2.018  1.00 93.44  ? 308  ARG B NH2 1 
ATOM   5006 N N   . THR B 1 275 ? 43.860 2.245   -0.806  1.00 72.70  ? 309  THR B N   1 
ATOM   5007 C CA  . THR B 1 275 ? 42.418 2.263   -1.039  1.00 69.20  ? 309  THR B CA  1 
ATOM   5008 C C   . THR B 1 275 ? 42.068 2.997   -2.328  1.00 67.27  ? 309  THR B C   1 
ATOM   5009 O O   . THR B 1 275 ? 42.448 4.154   -2.510  1.00 66.68  ? 309  THR B O   1 
ATOM   5010 C CB  . THR B 1 275 ? 41.672 2.945   0.122   1.00 68.98  ? 309  THR B CB  1 
ATOM   5011 O OG1 . THR B 1 275 ? 41.902 2.216   1.331   1.00 68.51  ? 309  THR B OG1 1 
ATOM   5012 C CG2 . THR B 1 275 ? 40.179 2.985   -0.159  1.00 69.34  ? 309  THR B CG2 1 
ATOM   5013 N N   . PRO B 1 276 ? 41.335 2.327   -3.239  1.00 65.21  ? 310  PRO B N   1 
ATOM   5014 C CA  . PRO B 1 276 ? 40.914 2.884   -4.528  1.00 63.68  ? 310  PRO B CA  1 
ATOM   5015 C C   . PRO B 1 276 ? 40.043 4.123   -4.384  1.00 63.24  ? 310  PRO B C   1 
ATOM   5016 O O   . PRO B 1 276 ? 39.060 4.123   -3.657  1.00 63.80  ? 310  PRO B O   1 
ATOM   5017 C CB  . PRO B 1 276 ? 40.152 1.734   -5.168  1.00 63.27  ? 310  PRO B CB  1 
ATOM   5018 C CG  . PRO B 1 276 ? 40.817 0.537   -4.609  1.00 63.80  ? 310  PRO B CG  1 
ATOM   5019 C CD  . PRO B 1 276 ? 40.964 0.906   -3.152  1.00 63.76  ? 310  PRO B CD  1 
ATOM   5020 N N   . PRO B 1 277 ? 40.392 5.200   -5.091  1.00 63.18  ? 311  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 277 ? 39.638 6.454   -5.042  1.00 62.37  ? 311  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 277 ? 38.137 6.265   -5.224  1.00 61.74  ? 311  PRO B C   1 
ATOM   5023 O O   . PRO B 1 277 ? 37.342 6.905   -4.539  1.00 62.55  ? 311  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 277 ? 40.248 7.265   -6.179  1.00 61.59  ? 311  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 277 ? 41.668 6.829   -6.146  1.00 62.47  ? 311  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 277 ? 41.553 5.328   -5.988  1.00 62.97  ? 311  PRO B CD  1 
ATOM   5027 N N   . GLU B 1 278 ? 37.750 5.391   -6.146  1.00 60.13  ? 312  GLU B N   1 
ATOM   5028 C CA  . GLU B 1 278 ? 36.336 5.154   -6.402  1.00 59.30  ? 312  GLU B CA  1 
ATOM   5029 C C   . GLU B 1 278 ? 35.630 4.595   -5.176  1.00 57.60  ? 312  GLU B C   1 
ATOM   5030 O O   . GLU B 1 278 ? 34.485 4.951   -4.889  1.00 57.66  ? 312  GLU B O   1 
ATOM   5031 C CB  . GLU B 1 278 ? 36.156 4.210   -7.594  1.00 61.66  ? 312  GLU B CB  1 
ATOM   5032 C CG  . GLU B 1 278 ? 36.648 4.778   -8.918  1.00 63.20  ? 312  GLU B CG  1 
ATOM   5033 C CD  . GLU B 1 278 ? 38.159 4.682   -9.072  1.00 65.86  ? 312  GLU B CD  1 
ATOM   5034 O OE1 . GLU B 1 278 ? 38.694 5.239   -10.060 1.00 66.36  ? 312  GLU B OE1 1 
ATOM   5035 O OE2 . GLU B 1 278 ? 38.814 4.038   -8.216  1.00 65.46  ? 312  GLU B OE2 1 
ATOM   5036 N N   . ALA B 1 279 ? 36.319 3.718   -4.456  1.00 55.66  ? 313  ALA B N   1 
ATOM   5037 C CA  . ALA B 1 279 ? 35.766 3.126   -3.247  1.00 53.70  ? 313  ALA B CA  1 
ATOM   5038 C C   . ALA B 1 279 ? 35.464 4.231   -2.236  1.00 52.37  ? 313  ALA B C   1 
ATOM   5039 O O   . ALA B 1 279 ? 34.396 4.242   -1.622  1.00 52.78  ? 313  ALA B O   1 
ATOM   5040 C CB  . ALA B 1 279 ? 36.754 2.125   -2.654  1.00 52.85  ? 313  ALA B CB  1 
ATOM   5041 N N   . ILE B 1 280 ? 36.401 5.161   -2.073  1.00 50.87  ? 314  ILE B N   1 
ATOM   5042 C CA  . ILE B 1 280 ? 36.222 6.263   -1.135  1.00 51.52  ? 314  ILE B CA  1 
ATOM   5043 C C   . ILE B 1 280 ? 35.108 7.197   -1.600  1.00 51.80  ? 314  ILE B C   1 
ATOM   5044 O O   . ILE B 1 280 ? 34.337 7.725   -0.797  1.00 52.17  ? 314  ILE B O   1 
ATOM   5045 C CB  . ILE B 1 280 ? 37.530 7.066   -0.971  1.00 51.69  ? 314  ILE B CB  1 
ATOM   5046 C CG1 . ILE B 1 280 ? 38.624 6.155   -0.394  1.00 51.34  ? 314  ILE B CG1 1 
ATOM   5047 C CG2 . ILE B 1 280 ? 37.304 8.263   -0.056  1.00 50.77  ? 314  ILE B CG2 1 
ATOM   5048 C CD1 . ILE B 1 280 ? 39.968 6.810   -0.253  1.00 47.57  ? 314  ILE B CD1 1 
ATOM   5049 N N   . ALA B 1 281 ? 35.019 7.387   -2.906  1.00 51.72  ? 315  ALA B N   1 
ATOM   5050 C CA  . ALA B 1 281 ? 33.996 8.246   -3.486  1.00 50.81  ? 315  ALA B CA  1 
ATOM   5051 C C   . ALA B 1 281 ? 32.604 7.694   -3.174  1.00 51.29  ? 315  ALA B C   1 
ATOM   5052 O O   . ALA B 1 281 ? 31.693 8.440   -2.797  1.00 51.81  ? 315  ALA B O   1 
ATOM   5053 C CB  . ALA B 1 281 ? 34.198 8.334   -4.996  1.00 49.86  ? 315  ALA B CB  1 
ATOM   5054 N N   . LEU B 1 282 ? 32.447 6.383   -3.342  1.00 49.93  ? 316  LEU B N   1 
ATOM   5055 C CA  . LEU B 1 282 ? 31.176 5.717   -3.078  1.00 47.45  ? 316  LEU B CA  1 
ATOM   5056 C C   . LEU B 1 282 ? 30.770 5.935   -1.606  1.00 48.60  ? 316  LEU B C   1 
ATOM   5057 O O   . LEU B 1 282 ? 29.604 6.209   -1.320  1.00 49.29  ? 316  LEU B O   1 
ATOM   5058 C CB  . LEU B 1 282 ? 31.306 4.217   -3.368  1.00 44.81  ? 316  LEU B CB  1 
ATOM   5059 C CG  . LEU B 1 282 ? 30.180 3.433   -4.030  1.00 41.53  ? 316  LEU B CG  1 
ATOM   5060 C CD1 . LEU B 1 282 ? 30.330 1.984   -3.639  1.00 38.15  ? 316  LEU B CD1 1 
ATOM   5061 C CD2 . LEU B 1 282 ? 28.810 3.955   -3.625  1.00 40.64  ? 316  LEU B CD2 1 
ATOM   5062 N N   . CYS B 1 283 ? 31.711 5.811   -0.671  1.00 47.65  ? 317  CYS B N   1 
ATOM   5063 C CA  . CYS B 1 283 ? 31.350 6.009   0.732   1.00 49.53  ? 317  CYS B CA  1 
ATOM   5064 C C   . CYS B 1 283 ? 30.824 7.412   0.948   1.00 50.74  ? 317  CYS B C   1 
ATOM   5065 O O   . CYS B 1 283 ? 29.790 7.617   1.601   1.00 52.96  ? 317  CYS B O   1 
ATOM   5066 C CB  . CYS B 1 283 ? 32.538 5.825   1.662   1.00 48.96  ? 317  CYS B CB  1 
ATOM   5067 S SG  . CYS B 1 283 ? 33.112 4.176   1.799   1.00 53.86  ? 317  CYS B SG  1 
ATOM   5068 N N   . SER B 1 284 ? 31.538 8.387   0.407   1.00 49.23  ? 318  SER B N   1 
ATOM   5069 C CA  . SER B 1 284 ? 31.131 9.768   0.579   1.00 49.99  ? 318  SER B CA  1 
ATOM   5070 C C   . SER B 1 284 ? 29.731 10.030  0.054   1.00 49.50  ? 318  SER B C   1 
ATOM   5071 O O   . SER B 1 284 ? 29.028 10.872  0.590   1.00 51.45  ? 318  SER B O   1 
ATOM   5072 C CB  . SER B 1 284 ? 32.127 10.696  -0.107  1.00 51.00  ? 318  SER B CB  1 
ATOM   5073 O OG  . SER B 1 284 ? 32.170 10.427  -1.496  1.00 55.01  ? 318  SER B OG  1 
ATOM   5074 N N   . ARG B 1 285 ? 29.326 9.307   -0.986  1.00 49.17  ? 319  ARG B N   1 
ATOM   5075 C CA  . ARG B 1 285 ? 27.993 9.482   -1.569  1.00 48.88  ? 319  ARG B CA  1 
ATOM   5076 C C   . ARG B 1 285 ? 26.938 8.597   -0.891  1.00 47.14  ? 319  ARG B C   1 
ATOM   5077 O O   . ARG B 1 285 ? 25.733 8.751   -1.113  1.00 47.44  ? 319  ARG B O   1 
ATOM   5078 C CB  . ARG B 1 285 ? 28.027 9.187   -3.076  1.00 51.85  ? 319  ARG B CB  1 
ATOM   5079 C CG  . ARG B 1 285 ? 28.789 10.216  -3.920  1.00 53.89  ? 319  ARG B CG  1 
ATOM   5080 C CD  . ARG B 1 285 ? 28.380 11.639  -3.557  1.00 57.18  ? 319  ARG B CD  1 
ATOM   5081 N NE  . ARG B 1 285 ? 26.928 11.795  -3.474  1.00 60.70  ? 319  ARG B NE  1 
ATOM   5082 C CZ  . ARG B 1 285 ? 26.099 11.708  -4.514  1.00 62.93  ? 319  ARG B CZ  1 
ATOM   5083 N NH1 . ARG B 1 285 ? 26.570 11.466  -5.741  1.00 63.14  ? 319  ARG B NH1 1 
ATOM   5084 N NH2 . ARG B 1 285 ? 24.790 11.857  -4.331  1.00 63.86  ? 319  ARG B NH2 1 
ATOM   5085 N N   . LEU B 1 286 ? 27.408 7.660   -0.079  1.00 44.80  ? 320  LEU B N   1 
ATOM   5086 C CA  . LEU B 1 286 ? 26.536 6.762   0.660   1.00 42.76  ? 320  LEU B CA  1 
ATOM   5087 C C   . LEU B 1 286 ? 26.353 7.314   2.087   1.00 41.97  ? 320  LEU B C   1 
ATOM   5088 O O   . LEU B 1 286 ? 25.232 7.399   2.595   1.00 39.96  ? 320  LEU B O   1 
ATOM   5089 C CB  . LEU B 1 286 ? 27.156 5.359   0.700   1.00 41.44  ? 320  LEU B CB  1 
ATOM   5090 C CG  . LEU B 1 286 ? 26.613 4.225   -0.177  1.00 42.07  ? 320  LEU B CG  1 
ATOM   5091 C CD1 . LEU B 1 286 ? 26.118 4.737   -1.511  1.00 41.94  ? 320  LEU B CD1 1 
ATOM   5092 C CD2 . LEU B 1 286 ? 27.713 3.192   -0.371  1.00 39.49  ? 320  LEU B CD2 1 
ATOM   5093 N N   . LEU B 1 287 ? 27.447 7.719   2.724   1.00 40.71  ? 321  LEU B N   1 
ATOM   5094 C CA  . LEU B 1 287 ? 27.361 8.236   4.088   1.00 42.85  ? 321  LEU B CA  1 
ATOM   5095 C C   . LEU B 1 287 ? 27.144 9.754   4.144   1.00 44.75  ? 321  LEU B C   1 
ATOM   5096 O O   . LEU B 1 287 ? 28.067 10.519  4.425   1.00 46.23  ? 321  LEU B O   1 
ATOM   5097 C CB  . LEU B 1 287 ? 28.619 7.812   4.860   1.00 39.93  ? 321  LEU B CB  1 
ATOM   5098 C CG  . LEU B 1 287 ? 28.739 6.277   4.862   1.00 35.78  ? 321  LEU B CG  1 
ATOM   5099 C CD1 . LEU B 1 287 ? 30.052 5.831   5.441   1.00 33.05  ? 321  LEU B CD1 1 
ATOM   5100 C CD2 . LEU B 1 287 ? 27.579 5.696   5.634   1.00 33.19  ? 321  LEU B CD2 1 
ATOM   5101 N N   . GLU B 1 288 ? 25.908 10.167  3.869   1.00 45.38  ? 322  GLU B N   1 
ATOM   5102 C CA  . GLU B 1 288 ? 25.515 11.573  3.859   1.00 45.45  ? 322  GLU B CA  1 
ATOM   5103 C C   . GLU B 1 288 ? 24.484 11.865  4.947   1.00 46.44  ? 322  GLU B C   1 
ATOM   5104 O O   . GLU B 1 288 ? 23.577 11.057  5.185   1.00 46.12  ? 322  GLU B O   1 
ATOM   5105 C CB  . GLU B 1 288 ? 24.877 11.937  2.515   1.00 47.69  ? 322  GLU B CB  1 
ATOM   5106 C CG  . GLU B 1 288 ? 25.731 11.711  1.277   1.00 51.37  ? 322  GLU B CG  1 
ATOM   5107 C CD  . GLU B 1 288 ? 26.580 12.914  0.900   1.00 54.25  ? 322  GLU B CD  1 
ATOM   5108 O OE1 . GLU B 1 288 ? 27.091 12.952  -0.246  1.00 56.34  ? 322  GLU B OE1 1 
ATOM   5109 O OE2 . GLU B 1 288 ? 26.746 13.821  1.747   1.00 55.97  ? 322  GLU B OE2 1 
ATOM   5110 N N   . TYR B 1 289 ? 24.609 13.025  5.589   1.00 45.44  ? 323  TYR B N   1 
ATOM   5111 C CA  . TYR B 1 289 ? 23.663 13.424  6.626   1.00 45.60  ? 323  TYR B CA  1 
ATOM   5112 C C   . TYR B 1 289 ? 22.260 13.491  6.032   1.00 46.61  ? 323  TYR B C   1 
ATOM   5113 O O   . TYR B 1 289 ? 21.317 12.917  6.574   1.00 46.14  ? 323  TYR B O   1 
ATOM   5114 C CB  . TYR B 1 289 ? 24.021 14.799  7.186   1.00 46.87  ? 323  TYR B CB  1 
ATOM   5115 C CG  . TYR B 1 289 ? 25.165 14.809  8.167   1.00 47.67  ? 323  TYR B CG  1 
ATOM   5116 C CD1 . TYR B 1 289 ? 26.314 15.556  7.917   1.00 47.00  ? 323  TYR B CD1 1 
ATOM   5117 C CD2 . TYR B 1 289 ? 25.096 14.080  9.353   1.00 48.01  ? 323  TYR B CD2 1 
ATOM   5118 C CE1 . TYR B 1 289 ? 27.371 15.574  8.825   1.00 48.84  ? 323  TYR B CE1 1 
ATOM   5119 C CE2 . TYR B 1 289 ? 26.144 14.092  10.268  1.00 47.47  ? 323  TYR B CE2 1 
ATOM   5120 C CZ  . TYR B 1 289 ? 27.276 14.838  9.999   1.00 48.82  ? 323  TYR B CZ  1 
ATOM   5121 O OH  . TYR B 1 289 ? 28.307 14.847  10.908  1.00 50.53  ? 323  TYR B OH  1 
ATOM   5122 N N   . THR B 1 290 ? 22.116 14.202  4.918   1.00 46.61  ? 324  THR B N   1 
ATOM   5123 C CA  . THR B 1 290 ? 20.803 14.316  4.309   1.00 47.15  ? 324  THR B CA  1 
ATOM   5124 C C   . THR B 1 290 ? 20.384 12.994  3.696   1.00 47.33  ? 324  THR B C   1 
ATOM   5125 O O   . THR B 1 290 ? 20.946 12.546  2.699   1.00 47.13  ? 324  THR B O   1 
ATOM   5126 C CB  . THR B 1 290 ? 20.774 15.395  3.228   1.00 48.47  ? 324  THR B CB  1 
ATOM   5127 O OG1 . THR B 1 290 ? 21.152 16.655  3.797   1.00 49.81  ? 324  THR B OG1 1 
ATOM   5128 C CG2 . THR B 1 290 ? 19.371 15.507  2.648   1.00 48.61  ? 324  THR B CG2 1 
ATOM   5129 N N   . PRO B 1 291 ? 19.386 12.340  4.295   1.00 47.74  ? 325  PRO B N   1 
ATOM   5130 C CA  . PRO B 1 291 ? 18.960 11.058  3.731   1.00 47.89  ? 325  PRO B CA  1 
ATOM   5131 C C   . PRO B 1 291 ? 18.564 11.073  2.253   1.00 47.90  ? 325  PRO B C   1 
ATOM   5132 O O   . PRO B 1 291 ? 18.800 10.091  1.553   1.00 50.29  ? 325  PRO B O   1 
ATOM   5133 C CB  . PRO B 1 291 ? 17.832 10.610  4.668   1.00 46.13  ? 325  PRO B CB  1 
ATOM   5134 C CG  . PRO B 1 291 ? 17.361 11.883  5.307   1.00 47.22  ? 325  PRO B CG  1 
ATOM   5135 C CD  . PRO B 1 291 ? 18.629 12.671  5.512   1.00 46.40  ? 325  PRO B CD  1 
ATOM   5136 N N   . THR B 1 292 ? 17.996 12.170  1.760   1.00 47.26  ? 326  THR B N   1 
ATOM   5137 C CA  . THR B 1 292 ? 17.611 12.221  0.342   1.00 45.96  ? 326  THR B CA  1 
ATOM   5138 C C   . THR B 1 292 ? 18.801 12.432  -0.582  1.00 45.36  ? 326  THR B C   1 
ATOM   5139 O O   . THR B 1 292 ? 18.666 12.314  -1.793  1.00 46.01  ? 326  THR B O   1 
ATOM   5140 C CB  . THR B 1 292 ? 16.599 13.356  0.022   1.00 44.52  ? 326  THR B CB  1 
ATOM   5141 O OG1 . THR B 1 292 ? 17.137 14.608  0.461   1.00 46.98  ? 326  THR B OG1 1 
ATOM   5142 C CG2 . THR B 1 292 ? 15.260 13.104  0.679   1.00 41.44  ? 326  THR B CG2 1 
ATOM   5143 N N   . ALA B 1 293 ? 19.960 12.752  -0.018  1.00 44.91  ? 327  ALA B N   1 
ATOM   5144 C CA  . ALA B 1 293 ? 21.150 12.989  -0.830  1.00 44.66  ? 327  ALA B CA  1 
ATOM   5145 C C   . ALA B 1 293 ? 21.936 11.712  -1.095  1.00 45.94  ? 327  ALA B C   1 
ATOM   5146 O O   . ALA B 1 293 ? 22.763 11.669  -2.006  1.00 47.58  ? 327  ALA B O   1 
ATOM   5147 C CB  . ALA B 1 293 ? 22.049 14.005  -0.156  1.00 42.60  ? 327  ALA B CB  1 
ATOM   5148 N N   . ARG B 1 294 ? 21.683 10.672  -0.308  1.00 45.08  ? 328  ARG B N   1 
ATOM   5149 C CA  . ARG B 1 294 ? 22.412 9.433   -0.495  1.00 43.52  ? 328  ARG B CA  1 
ATOM   5150 C C   . ARG B 1 294 ? 22.017 8.753   -1.789  1.00 43.58  ? 328  ARG B C   1 
ATOM   5151 O O   . ARG B 1 294 ? 20.875 8.881   -2.244  1.00 42.80  ? 328  ARG B O   1 
ATOM   5152 C CB  . ARG B 1 294 ? 22.149 8.493   0.668   1.00 42.96  ? 328  ARG B CB  1 
ATOM   5153 C CG  . ARG B 1 294 ? 22.550 9.068   1.991   1.00 42.53  ? 328  ARG B CG  1 
ATOM   5154 C CD  . ARG B 1 294 ? 22.007 8.235   3.144   1.00 40.46  ? 328  ARG B CD  1 
ATOM   5155 N NE  . ARG B 1 294 ? 22.013 9.036   4.362   1.00 41.13  ? 328  ARG B NE  1 
ATOM   5156 C CZ  . ARG B 1 294 ? 21.194 8.844   5.381   1.00 39.44  ? 328  ARG B CZ  1 
ATOM   5157 N NH1 . ARG B 1 294 ? 20.301 7.864   5.333   1.00 39.55  ? 328  ARG B NH1 1 
ATOM   5158 N NH2 . ARG B 1 294 ? 21.256 9.653   6.425   1.00 37.24  ? 328  ARG B NH2 1 
ATOM   5159 N N   . LEU B 1 295 ? 22.970 8.041   -2.384  1.00 42.13  ? 329  LEU B N   1 
ATOM   5160 C CA  . LEU B 1 295 ? 22.714 7.311   -3.611  1.00 42.02  ? 329  LEU B CA  1 
ATOM   5161 C C   . LEU B 1 295 ? 21.622 6.308   -3.345  1.00 41.59  ? 329  LEU B C   1 
ATOM   5162 O O   . LEU B 1 295 ? 21.397 5.932   -2.194  1.00 43.04  ? 329  LEU B O   1 
ATOM   5163 C CB  . LEU B 1 295 ? 23.963 6.562   -4.048  1.00 43.36  ? 329  LEU B CB  1 
ATOM   5164 C CG  . LEU B 1 295 ? 24.849 7.219   -5.094  1.00 44.67  ? 329  LEU B CG  1 
ATOM   5165 C CD1 . LEU B 1 295 ? 25.098 8.663   -4.731  1.00 46.62  ? 329  LEU B CD1 1 
ATOM   5166 C CD2 . LEU B 1 295 ? 26.143 6.442   -5.173  1.00 45.18  ? 329  LEU B CD2 1 
ATOM   5167 N N   . THR B 1 296 ? 20.926 5.883   -4.396  1.00 41.53  ? 330  THR B N   1 
ATOM   5168 C CA  . THR B 1 296 ? 19.880 4.869   -4.231  1.00 41.72  ? 330  THR B CA  1 
ATOM   5169 C C   . THR B 1 296 ? 20.584 3.550   -4.458  1.00 40.39  ? 330  THR B C   1 
ATOM   5170 O O   . THR B 1 296 ? 21.620 3.507   -5.125  1.00 40.90  ? 330  THR B O   1 
ATOM   5171 C CB  . THR B 1 296 ? 18.758 4.982   -5.284  1.00 41.99  ? 330  THR B CB  1 
ATOM   5172 O OG1 . THR B 1 296 ? 19.315 4.828   -6.596  1.00 42.81  ? 330  THR B OG1 1 
ATOM   5173 C CG2 . THR B 1 296 ? 18.044 6.314   -5.169  1.00 39.49  ? 330  THR B CG2 1 
ATOM   5174 N N   . PRO B 1 297 ? 20.058 2.458   -3.897  1.00 40.02  ? 331  PRO B N   1 
ATOM   5175 C CA  . PRO B 1 297 ? 20.780 1.210   -4.155  1.00 41.33  ? 331  PRO B CA  1 
ATOM   5176 C C   . PRO B 1 297 ? 21.083 0.961   -5.639  1.00 41.32  ? 331  PRO B C   1 
ATOM   5177 O O   . PRO B 1 297 ? 22.150 0.460   -5.990  1.00 40.91  ? 331  PRO B O   1 
ATOM   5178 C CB  . PRO B 1 297 ? 19.879 0.138   -3.517  1.00 39.47  ? 331  PRO B CB  1 
ATOM   5179 C CG  . PRO B 1 297 ? 18.547 0.822   -3.356  1.00 41.98  ? 331  PRO B CG  1 
ATOM   5180 C CD  . PRO B 1 297 ? 18.909 2.234   -3.011  1.00 40.38  ? 331  PRO B CD  1 
ATOM   5181 N N   . LEU B 1 298 ? 20.165 1.339   -6.516  1.00 42.38  ? 332  LEU B N   1 
ATOM   5182 C CA  . LEU B 1 298 ? 20.394 1.131   -7.944  1.00 43.47  ? 332  LEU B CA  1 
ATOM   5183 C C   . LEU B 1 298 ? 21.514 2.031   -8.479  1.00 44.55  ? 332  LEU B C   1 
ATOM   5184 O O   . LEU B 1 298 ? 22.339 1.600   -9.289  1.00 45.68  ? 332  LEU B O   1 
ATOM   5185 C CB  . LEU B 1 298 ? 19.111 1.386   -8.724  1.00 41.10  ? 332  LEU B CB  1 
ATOM   5186 C CG  . LEU B 1 298 ? 19.053 0.686   -10.066 1.00 40.95  ? 332  LEU B CG  1 
ATOM   5187 C CD1 . LEU B 1 298 ? 19.176 -0.829  -9.895  1.00 40.05  ? 332  LEU B CD1 1 
ATOM   5188 C CD2 . LEU B 1 298 ? 17.742 1.036   -10.707 1.00 43.67  ? 332  LEU B CD2 1 
ATOM   5189 N N   . GLU B 1 299 ? 21.541 3.277   -8.019  1.00 44.53  ? 333  GLU B N   1 
ATOM   5190 C CA  . GLU B 1 299 ? 22.561 4.221   -8.448  1.00 46.33  ? 333  GLU B CA  1 
ATOM   5191 C C   . GLU B 1 299 ? 23.935 3.776   -7.986  1.00 46.54  ? 333  GLU B C   1 
ATOM   5192 O O   . GLU B 1 299 ? 24.936 4.082   -8.627  1.00 47.88  ? 333  GLU B O   1 
ATOM   5193 C CB  . GLU B 1 299 ? 22.267 5.619   -7.892  1.00 47.26  ? 333  GLU B CB  1 
ATOM   5194 C CG  . GLU B 1 299 ? 20.992 6.235   -8.429  1.00 50.02  ? 333  GLU B CG  1 
ATOM   5195 C CD  . GLU B 1 299 ? 20.614 7.524   -7.732  1.00 51.30  ? 333  GLU B CD  1 
ATOM   5196 O OE1 . GLU B 1 299 ? 19.671 8.190   -8.211  1.00 52.98  ? 333  GLU B OE1 1 
ATOM   5197 O OE2 . GLU B 1 299 ? 21.242 7.868   -6.706  1.00 52.68  ? 333  GLU B OE2 1 
ATOM   5198 N N   . ALA B 1 300 ? 23.987 3.064   -6.865  1.00 46.05  ? 334  ALA B N   1 
ATOM   5199 C CA  . ALA B 1 300 ? 25.266 2.601   -6.345  1.00 45.38  ? 334  ALA B CA  1 
ATOM   5200 C C   . ALA B 1 300 ? 25.813 1.486   -7.235  1.00 45.04  ? 334  ALA B C   1 
ATOM   5201 O O   . ALA B 1 300 ? 27.015 1.448   -7.526  1.00 45.77  ? 334  ALA B O   1 
ATOM   5202 C CB  . ALA B 1 300 ? 25.106 2.118   -4.921  1.00 46.07  ? 334  ALA B CB  1 
ATOM   5203 N N   . CYS B 1 301 ? 24.927 0.591   -7.670  1.00 42.44  ? 335  CYS B N   1 
ATOM   5204 C CA  . CYS B 1 301 ? 25.313 -0.505  -8.549  1.00 42.18  ? 335  CYS B CA  1 
ATOM   5205 C C   . CYS B 1 301 ? 25.959 0.020   -9.832  1.00 42.18  ? 335  CYS B C   1 
ATOM   5206 O O   . CYS B 1 301 ? 26.808 -0.642  -10.421 1.00 43.62  ? 335  CYS B O   1 
ATOM   5207 C CB  . CYS B 1 301 ? 24.093 -1.350  -8.931  1.00 41.65  ? 335  CYS B CB  1 
ATOM   5208 S SG  . CYS B 1 301 ? 23.382 -2.380  -7.607  1.00 41.55  ? 335  CYS B SG  1 
ATOM   5209 N N   . ALA B 1 302 ? 25.551 1.205   -10.268 1.00 42.19  ? 336  ALA B N   1 
ATOM   5210 C CA  . ALA B 1 302 ? 26.090 1.782   -11.493 1.00 41.66  ? 336  ALA B CA  1 
ATOM   5211 C C   . ALA B 1 302 ? 27.302 2.671   -11.243 1.00 42.42  ? 336  ALA B C   1 
ATOM   5212 O O   . ALA B 1 302 ? 27.814 3.294   -12.178 1.00 42.34  ? 336  ALA B O   1 
ATOM   5213 C CB  . ALA B 1 302 ? 25.007 2.572   -12.208 1.00 40.95  ? 336  ALA B CB  1 
ATOM   5214 N N   . HIS B 1 303 ? 27.759 2.717   -9.989  1.00 41.61  ? 337  HIS B N   1 
ATOM   5215 C CA  . HIS B 1 303 ? 28.899 3.541   -9.605  1.00 42.11  ? 337  HIS B CA  1 
ATOM   5216 C C   . HIS B 1 303 ? 30.205 3.040   -10.215 1.00 42.98  ? 337  HIS B C   1 
ATOM   5217 O O   . HIS B 1 303 ? 30.414 1.830   -10.343 1.00 44.40  ? 337  HIS B O   1 
ATOM   5218 C CB  . HIS B 1 303 ? 29.009 3.583   -8.086  1.00 41.09  ? 337  HIS B CB  1 
ATOM   5219 C CG  . HIS B 1 303 ? 29.967 4.616   -7.587  1.00 41.56  ? 337  HIS B CG  1 
ATOM   5220 N ND1 . HIS B 1 303 ? 31.335 4.451   -7.638  1.00 42.75  ? 337  HIS B ND1 1 
ATOM   5221 C CD2 . HIS B 1 303 ? 29.755 5.858   -7.088  1.00 40.23  ? 337  HIS B CD2 1 
ATOM   5222 C CE1 . HIS B 1 303 ? 31.927 5.549   -7.196  1.00 41.82  ? 337  HIS B CE1 1 
ATOM   5223 N NE2 . HIS B 1 303 ? 30.989 6.417   -6.857  1.00 42.17  ? 337  HIS B NE2 1 
ATOM   5224 N N   . SER B 1 304 ? 31.094 3.958   -10.587 1.00 43.44  ? 338  SER B N   1 
ATOM   5225 C CA  . SER B 1 304 ? 32.357 3.558   -11.211 1.00 44.60  ? 338  SER B CA  1 
ATOM   5226 C C   . SER B 1 304 ? 33.157 2.545   -10.390 1.00 44.38  ? 338  SER B C   1 
ATOM   5227 O O   . SER B 1 304 ? 33.966 1.804   -10.941 1.00 45.02  ? 338  SER B O   1 
ATOM   5228 C CB  . SER B 1 304 ? 33.222 4.781   -11.502 1.00 44.93  ? 338  SER B CB  1 
ATOM   5229 O OG  . SER B 1 304 ? 33.591 5.439   -10.304 1.00 54.06  ? 338  SER B OG  1 
ATOM   5230 N N   . PHE B 1 305 ? 32.924 2.498   -9.082  1.00 43.62  ? 339  PHE B N   1 
ATOM   5231 C CA  . PHE B 1 305 ? 33.630 1.555   -8.229  1.00 42.74  ? 339  PHE B CA  1 
ATOM   5232 C C   . PHE B 1 305 ? 33.385 0.107   -8.665  1.00 43.70  ? 339  PHE B C   1 
ATOM   5233 O O   . PHE B 1 305 ? 34.223 -0.767  -8.433  1.00 44.79  ? 339  PHE B O   1 
ATOM   5234 C CB  . PHE B 1 305 ? 33.195 1.742   -6.770  1.00 43.39  ? 339  PHE B CB  1 
ATOM   5235 C CG  . PHE B 1 305 ? 33.775 0.721   -5.823  1.00 42.94  ? 339  PHE B CG  1 
ATOM   5236 C CD1 . PHE B 1 305 ? 35.157 0.587   -5.673  1.00 42.32  ? 339  PHE B CD1 1 
ATOM   5237 C CD2 . PHE B 1 305 ? 32.939 -0.119  -5.090  1.00 41.30  ? 339  PHE B CD2 1 
ATOM   5238 C CE1 . PHE B 1 305 ? 35.695 -0.369  -4.807  1.00 41.52  ? 339  PHE B CE1 1 
ATOM   5239 C CE2 . PHE B 1 305 ? 33.472 -1.075  -4.225  1.00 40.99  ? 339  PHE B CE2 1 
ATOM   5240 C CZ  . PHE B 1 305 ? 34.856 -1.199  -4.083  1.00 39.50  ? 339  PHE B CZ  1 
ATOM   5241 N N   . PHE B 1 306 ? 32.247 -0.150  -9.304  1.00 43.41  ? 340  PHE B N   1 
ATOM   5242 C CA  . PHE B 1 306 ? 31.922 -1.509  -9.733  1.00 43.72  ? 340  PHE B CA  1 
ATOM   5243 C C   . PHE B 1 306 ? 32.211 -1.794  -11.202 1.00 44.40  ? 340  PHE B C   1 
ATOM   5244 O O   . PHE B 1 306 ? 31.812 -2.840  -11.714 1.00 42.59  ? 340  PHE B O   1 
ATOM   5245 C CB  . PHE B 1 306 ? 30.447 -1.816  -9.443  1.00 42.46  ? 340  PHE B CB  1 
ATOM   5246 C CG  . PHE B 1 306 ? 30.090 -1.763  -7.982  1.00 42.40  ? 340  PHE B CG  1 
ATOM   5247 C CD1 . PHE B 1 306 ? 30.667 -2.656  -7.079  1.00 41.24  ? 340  PHE B CD1 1 
ATOM   5248 C CD2 . PHE B 1 306 ? 29.192 -0.808  -7.502  1.00 41.52  ? 340  PHE B CD2 1 
ATOM   5249 C CE1 . PHE B 1 306 ? 30.360 -2.601  -5.721  1.00 39.81  ? 340  PHE B CE1 1 
ATOM   5250 C CE2 . PHE B 1 306 ? 28.877 -0.744  -6.144  1.00 41.68  ? 340  PHE B CE2 1 
ATOM   5251 C CZ  . PHE B 1 306 ? 29.466 -1.647  -5.248  1.00 41.19  ? 340  PHE B CZ  1 
ATOM   5252 N N   . ASP B 1 307 ? 32.912 -0.883  -11.876 1.00 44.55  ? 341  ASP B N   1 
ATOM   5253 C CA  . ASP B 1 307 ? 33.222 -1.070  -13.294 1.00 45.17  ? 341  ASP B CA  1 
ATOM   5254 C C   . ASP B 1 307 ? 33.986 -2.358  -13.597 1.00 45.68  ? 341  ASP B C   1 
ATOM   5255 O O   . ASP B 1 307 ? 33.806 -2.950  -14.661 1.00 46.10  ? 341  ASP B O   1 
ATOM   5256 C CB  . ASP B 1 307 ? 34.012 0.121   -13.842 1.00 45.55  ? 341  ASP B CB  1 
ATOM   5257 C CG  . ASP B 1 307 ? 33.171 1.383   -13.958 1.00 46.97  ? 341  ASP B CG  1 
ATOM   5258 O OD1 . ASP B 1 307 ? 31.925 1.283   -13.838 1.00 48.15  ? 341  ASP B OD1 1 
ATOM   5259 O OD2 . ASP B 1 307 ? 33.756 2.473   -14.173 1.00 45.08  ? 341  ASP B OD2 1 
ATOM   5260 N N   . GLU B 1 308 ? 34.834 -2.800  -12.678 1.00 46.09  ? 342  GLU B N   1 
ATOM   5261 C CA  . GLU B 1 308 ? 35.580 -4.023  -12.918 1.00 47.48  ? 342  GLU B CA  1 
ATOM   5262 C C   . GLU B 1 308 ? 34.638 -5.212  -13.086 1.00 47.55  ? 342  GLU B C   1 
ATOM   5263 O O   . GLU B 1 308 ? 34.916 -6.123  -13.849 1.00 48.03  ? 342  GLU B O   1 
ATOM   5264 C CB  . GLU B 1 308 ? 36.540 -4.309  -11.768 1.00 48.08  ? 342  GLU B CB  1 
ATOM   5265 C CG  . GLU B 1 308 ? 37.617 -5.308  -12.147 1.00 50.69  ? 342  GLU B CG  1 
ATOM   5266 C CD  . GLU B 1 308 ? 38.480 -5.740  -10.972 1.00 53.47  ? 342  GLU B CD  1 
ATOM   5267 O OE1 . GLU B 1 308 ? 38.674 -4.950  -10.023 1.00 53.91  ? 342  GLU B OE1 1 
ATOM   5268 O OE2 . GLU B 1 308 ? 38.993 -6.876  -11.009 1.00 55.92  ? 342  GLU B OE2 1 
ATOM   5269 N N   . LEU B 1 309 ? 33.523 -5.202  -12.367 1.00 47.98  ? 343  LEU B N   1 
ATOM   5270 C CA  . LEU B 1 309 ? 32.574 -6.298  -12.444 1.00 47.86  ? 343  LEU B CA  1 
ATOM   5271 C C   . LEU B 1 309 ? 31.902 -6.358  -13.809 1.00 49.43  ? 343  LEU B C   1 
ATOM   5272 O O   . LEU B 1 309 ? 31.449 -7.422  -14.248 1.00 50.68  ? 343  LEU B O   1 
ATOM   5273 C CB  . LEU B 1 309 ? 31.515 -6.153  -11.352 1.00 46.37  ? 343  LEU B CB  1 
ATOM   5274 C CG  . LEU B 1 309 ? 32.056 -6.093  -9.931  1.00 44.20  ? 343  LEU B CG  1 
ATOM   5275 C CD1 . LEU B 1 309 ? 30.905 -6.007  -8.944  1.00 45.53  ? 343  LEU B CD1 1 
ATOM   5276 C CD2 . LEU B 1 309 ? 32.894 -7.313  -9.660  1.00 44.25  ? 343  LEU B CD2 1 
ATOM   5277 N N   . ARG B 1 310 ? 31.836 -5.214  -14.482 1.00 49.79  ? 344  ARG B N   1 
ATOM   5278 C CA  . ARG B 1 310 ? 31.218 -5.143  -15.801 1.00 50.60  ? 344  ARG B CA  1 
ATOM   5279 C C   . ARG B 1 310 ? 32.211 -5.466  -16.921 1.00 53.47  ? 344  ARG B C   1 
ATOM   5280 O O   . ARG B 1 310 ? 31.859 -5.462  -18.101 1.00 55.42  ? 344  ARG B O   1 
ATOM   5281 C CB  . ARG B 1 310 ? 30.611 -3.757  -16.008 1.00 46.67  ? 344  ARG B CB  1 
ATOM   5282 C CG  . ARG B 1 310 ? 29.280 -3.582  -15.321 1.00 41.95  ? 344  ARG B CG  1 
ATOM   5283 C CD  . ARG B 1 310 ? 28.744 -2.208  -15.555 1.00 40.98  ? 344  ARG B CD  1 
ATOM   5284 N NE  . ARG B 1 310 ? 29.376 -1.204  -14.697 1.00 42.21  ? 344  ARG B NE  1 
ATOM   5285 C CZ  . ARG B 1 310 ? 28.951 -0.889  -13.477 1.00 39.09  ? 344  ARG B CZ  1 
ATOM   5286 N NH1 . ARG B 1 310 ? 27.900 -1.498  -12.970 1.00 36.52  ? 344  ARG B NH1 1 
ATOM   5287 N NH2 . ARG B 1 310 ? 29.567 0.044   -12.775 1.00 40.86  ? 344  ARG B NH2 1 
ATOM   5288 N N   . ASP B 1 311 ? 33.451 -5.751  -16.532 1.00 55.31  ? 345  ASP B N   1 
ATOM   5289 C CA  . ASP B 1 311 ? 34.510 -6.097  -17.461 1.00 56.18  ? 345  ASP B CA  1 
ATOM   5290 C C   . ASP B 1 311 ? 34.283 -7.526  -17.933 1.00 57.24  ? 345  ASP B C   1 
ATOM   5291 O O   . ASP B 1 311 ? 34.137 -8.438  -17.123 1.00 56.29  ? 345  ASP B O   1 
ATOM   5292 C CB  . ASP B 1 311 ? 35.862 -6.009  -16.759 1.00 58.41  ? 345  ASP B CB  1 
ATOM   5293 C CG  . ASP B 1 311 ? 37.036 -6.085  -17.721 1.00 60.34  ? 345  ASP B CG  1 
ATOM   5294 O OD1 . ASP B 1 311 ? 37.126 -7.052  -18.507 1.00 59.95  ? 345  ASP B OD1 1 
ATOM   5295 O OD2 . ASP B 1 311 ? 37.879 -5.168  -17.672 1.00 63.19  ? 345  ASP B OD2 1 
ATOM   5296 N N   . PRO B 1 312 ? 34.263 -7.741  -19.255 1.00 58.31  ? 346  PRO B N   1 
ATOM   5297 C CA  . PRO B 1 312 ? 34.057 -9.058  -19.871 1.00 58.84  ? 346  PRO B CA  1 
ATOM   5298 C C   . PRO B 1 312 ? 34.991 -10.167 -19.355 1.00 59.78  ? 346  PRO B C   1 
ATOM   5299 O O   . PRO B 1 312 ? 34.590 -11.325 -19.208 1.00 59.83  ? 346  PRO B O   1 
ATOM   5300 C CB  . PRO B 1 312 ? 34.286 -8.779  -21.352 1.00 58.33  ? 346  PRO B CB  1 
ATOM   5301 C CG  . PRO B 1 312 ? 33.857 -7.362  -21.501 1.00 58.96  ? 346  PRO B CG  1 
ATOM   5302 C CD  . PRO B 1 312 ? 34.456 -6.708  -20.288 1.00 57.88  ? 346  PRO B CD  1 
ATOM   5303 N N   . ASN B 1 313 ? 36.238 -9.814  -19.077 1.00 60.23  ? 347  ASN B N   1 
ATOM   5304 C CA  . ASN B 1 313 ? 37.201 -10.800 -18.609 1.00 61.56  ? 347  ASN B CA  1 
ATOM   5305 C C   . ASN B 1 313 ? 37.318 -10.903 -17.091 1.00 61.88  ? 347  ASN B C   1 
ATOM   5306 O O   . ASN B 1 313 ? 38.305 -11.422 -16.571 1.00 61.83  ? 347  ASN B O   1 
ATOM   5307 C CB  . ASN B 1 313 ? 38.576 -10.497 -19.206 1.00 61.76  ? 347  ASN B CB  1 
ATOM   5308 C CG  . ASN B 1 313 ? 38.533 -10.338 -20.712 1.00 62.59  ? 347  ASN B CG  1 
ATOM   5309 O OD1 . ASN B 1 313 ? 38.044 -11.218 -21.432 1.00 61.65  ? 347  ASN B OD1 1 
ATOM   5310 N ND2 . ASN B 1 313 ? 39.048 -9.214  -21.201 1.00 61.90  ? 347  ASN B ND2 1 
ATOM   5311 N N   . VAL B 1 314 ? 36.318 -10.406 -16.377 1.00 61.66  ? 348  VAL B N   1 
ATOM   5312 C CA  . VAL B 1 314 ? 36.353 -10.472 -14.930 1.00 59.62  ? 348  VAL B CA  1 
ATOM   5313 C C   . VAL B 1 314 ? 36.223 -11.931 -14.510 1.00 57.93  ? 348  VAL B C   1 
ATOM   5314 O O   . VAL B 1 314 ? 35.485 -12.705 -15.115 1.00 56.42  ? 348  VAL B O   1 
ATOM   5315 C CB  . VAL B 1 314 ? 35.206 -9.614  -14.291 1.00 61.80  ? 348  VAL B CB  1 
ATOM   5316 C CG1 . VAL B 1 314 ? 33.824 -10.209 -14.608 1.00 61.93  ? 348  VAL B CG1 1 
ATOM   5317 C CG2 . VAL B 1 314 ? 35.416 -9.503  -12.794 1.00 61.56  ? 348  VAL B CG2 1 
ATOM   5318 N N   . LYS B 1 315 ? 36.968 -12.313 -13.485 1.00 57.65  ? 349  LYS B N   1 
ATOM   5319 C CA  . LYS B 1 315 ? 36.931 -13.679 -12.978 1.00 57.31  ? 349  LYS B CA  1 
ATOM   5320 C C   . LYS B 1 315 ? 37.208 -13.673 -11.483 1.00 55.78  ? 349  LYS B C   1 
ATOM   5321 O O   . LYS B 1 315 ? 37.788 -12.730 -10.956 1.00 55.88  ? 349  LYS B O   1 
ATOM   5322 C CB  . LYS B 1 315 ? 37.972 -14.544 -13.703 1.00 59.21  ? 349  LYS B CB  1 
ATOM   5323 C CG  . LYS B 1 315 ? 37.594 -14.961 -15.119 1.00 63.03  ? 349  LYS B CG  1 
ATOM   5324 C CD  . LYS B 1 315 ? 36.417 -15.942 -15.125 1.00 67.34  ? 349  LYS B CD  1 
ATOM   5325 C CE  . LYS B 1 315 ? 35.990 -16.309 -16.543 1.00 67.97  ? 349  LYS B CE  1 
ATOM   5326 N NZ  . LYS B 1 315 ? 37.125 -16.843 -17.343 1.00 71.48  ? 349  LYS B NZ  1 
ATOM   5327 N N   . LEU B 1 316 ? 36.780 -14.720 -10.795 1.00 55.88  ? 350  LEU B N   1 
ATOM   5328 C CA  . LEU B 1 316 ? 37.012 -14.813 -9.360  1.00 57.11  ? 350  LEU B CA  1 
ATOM   5329 C C   . LEU B 1 316 ? 38.440 -15.272 -9.144  1.00 58.83  ? 350  LEU B C   1 
ATOM   5330 O O   . LEU B 1 316 ? 39.036 -15.884 -10.023 1.00 60.33  ? 350  LEU B O   1 
ATOM   5331 C CB  . LEU B 1 316 ? 36.070 -15.830 -8.715  1.00 55.79  ? 350  LEU B CB  1 
ATOM   5332 C CG  . LEU B 1 316 ? 34.572 -15.587 -8.862  1.00 52.67  ? 350  LEU B CG  1 
ATOM   5333 C CD1 . LEU B 1 316 ? 33.819 -16.646 -8.099  1.00 50.75  ? 350  LEU B CD1 1 
ATOM   5334 C CD2 . LEU B 1 316 ? 34.229 -14.213 -8.356  1.00 52.73  ? 350  LEU B CD2 1 
ATOM   5335 N N   . PRO B 1 317 ? 39.008 -14.988 -7.965  1.00 59.98  ? 351  PRO B N   1 
ATOM   5336 C CA  . PRO B 1 317 ? 40.384 -15.399 -7.674  1.00 59.65  ? 351  PRO B CA  1 
ATOM   5337 C C   . PRO B 1 317 ? 40.619 -16.903 -7.875  1.00 58.87  ? 351  PRO B C   1 
ATOM   5338 O O   . PRO B 1 317 ? 41.687 -17.311 -8.326  1.00 60.13  ? 351  PRO B O   1 
ATOM   5339 C CB  . PRO B 1 317 ? 40.563 -14.966 -6.223  1.00 59.54  ? 351  PRO B CB  1 
ATOM   5340 C CG  . PRO B 1 317 ? 39.704 -13.753 -6.136  1.00 60.21  ? 351  PRO B CG  1 
ATOM   5341 C CD  . PRO B 1 317 ? 38.453 -14.206 -6.849  1.00 59.87  ? 351  PRO B CD  1 
ATOM   5342 N N   . ASN B 1 318 ? 39.612 -17.710 -7.546  1.00 58.26  ? 352  ASN B N   1 
ATOM   5343 C CA  . ASN B 1 318 ? 39.681 -19.164 -7.678  1.00 57.65  ? 352  ASN B CA  1 
ATOM   5344 C C   . ASN B 1 318 ? 39.479 -19.649 -9.116  1.00 56.81  ? 352  ASN B C   1 
ATOM   5345 O O   . ASN B 1 318 ? 39.294 -20.837 -9.354  1.00 54.71  ? 352  ASN B O   1 
ATOM   5346 C CB  . ASN B 1 318 ? 38.648 -19.834 -6.748  1.00 57.07  ? 352  ASN B CB  1 
ATOM   5347 C CG  . ASN B 1 318 ? 37.212 -19.659 -7.228  1.00 57.02  ? 352  ASN B CG  1 
ATOM   5348 O OD1 . ASN B 1 318 ? 36.911 -18.773 -8.030  1.00 57.36  ? 352  ASN B OD1 1 
ATOM   5349 N ND2 . ASN B 1 318 ? 36.318 -20.497 -6.727  1.00 55.95  ? 352  ASN B ND2 1 
ATOM   5350 N N   . GLY B 1 319 ? 39.503 -18.719 -10.064 1.00 58.15  ? 353  GLY B N   1 
ATOM   5351 C CA  . GLY B 1 319 ? 39.355 -19.073 -11.463 1.00 59.34  ? 353  GLY B CA  1 
ATOM   5352 C C   . GLY B 1 319 ? 37.951 -19.178 -12.015 1.00 59.83  ? 353  GLY B C   1 
ATOM   5353 O O   . GLY B 1 319 ? 37.773 -19.144 -13.226 1.00 60.94  ? 353  GLY B O   1 
ATOM   5354 N N   . ARG B 1 320 ? 36.958 -19.308 -11.144 1.00 60.76  ? 354  ARG B N   1 
ATOM   5355 C CA  . ARG B 1 320 ? 35.569 -19.417 -11.577 1.00 61.17  ? 354  ARG B CA  1 
ATOM   5356 C C   . ARG B 1 320 ? 35.011 -18.106 -12.108 1.00 60.65  ? 354  ARG B C   1 
ATOM   5357 O O   . ARG B 1 320 ? 35.630 -17.051 -11.986 1.00 59.58  ? 354  ARG B O   1 
ATOM   5358 C CB  . ARG B 1 320 ? 34.674 -19.867 -10.424 1.00 63.29  ? 354  ARG B CB  1 
ATOM   5359 C CG  . ARG B 1 320 ? 35.063 -21.170 -9.781  1.00 66.44  ? 354  ARG B CG  1 
ATOM   5360 C CD  . ARG B 1 320 ? 33.919 -21.709 -8.938  1.00 69.26  ? 354  ARG B CD  1 
ATOM   5361 N NE  . ARG B 1 320 ? 34.308 -22.919 -8.220  1.00 72.77  ? 354  ARG B NE  1 
ATOM   5362 C CZ  . ARG B 1 320 ? 33.465 -23.695 -7.548  1.00 74.12  ? 354  ARG B CZ  1 
ATOM   5363 N NH1 . ARG B 1 320 ? 32.172 -23.391 -7.500  1.00 75.02  ? 354  ARG B NH1 1 
ATOM   5364 N NH2 . ARG B 1 320 ? 33.918 -24.775 -6.923  1.00 74.50  ? 354  ARG B NH2 1 
ATOM   5365 N N   . ASP B 1 321 ? 33.821 -18.186 -12.691 1.00 60.80  ? 355  ASP B N   1 
ATOM   5366 C CA  . ASP B 1 321 ? 33.145 -17.011 -13.230 1.00 60.58  ? 355  ASP B CA  1 
ATOM   5367 C C   . ASP B 1 321 ? 32.382 -16.299 -12.130 1.00 58.25  ? 355  ASP B C   1 
ATOM   5368 O O   . ASP B 1 321 ? 31.998 -16.912 -11.129 1.00 57.79  ? 355  ASP B O   1 
ATOM   5369 C CB  . ASP B 1 321 ? 32.158 -17.412 -14.323 1.00 64.05  ? 355  ASP B CB  1 
ATOM   5370 C CG  . ASP B 1 321 ? 32.783 -17.429 -15.686 1.00 68.65  ? 355  ASP B CG  1 
ATOM   5371 O OD1 . ASP B 1 321 ? 33.191 -16.343 -16.157 1.00 71.70  ? 355  ASP B OD1 1 
ATOM   5372 O OD2 . ASP B 1 321 ? 32.867 -18.524 -16.289 1.00 71.65  ? 355  ASP B OD2 1 
ATOM   5373 N N   . THR B 1 322 ? 32.157 -15.004 -12.315 1.00 54.49  ? 356  THR B N   1 
ATOM   5374 C CA  . THR B 1 322 ? 31.419 -14.243 -11.325 1.00 52.63  ? 356  THR B CA  1 
ATOM   5375 C C   . THR B 1 322 ? 29.954 -14.666 -11.431 1.00 51.72  ? 356  THR B C   1 
ATOM   5376 O O   . THR B 1 322 ? 29.525 -15.180 -12.465 1.00 52.61  ? 356  THR B O   1 
ATOM   5377 C CB  . THR B 1 322 ? 31.545 -12.726 -11.587 1.00 52.82  ? 356  THR B CB  1 
ATOM   5378 O OG1 . THR B 1 322 ? 31.023 -12.408 -12.887 1.00 53.82  ? 356  THR B OG1 1 
ATOM   5379 C CG2 . THR B 1 322 ? 33.015 -12.286 -11.508 1.00 51.33  ? 356  THR B CG2 1 
ATOM   5380 N N   . PRO B 1 323 ? 29.179 -14.508 -10.352 1.00 48.77  ? 357  PRO B N   1 
ATOM   5381 C CA  . PRO B 1 323 ? 27.770 -14.893 -10.423 1.00 46.98  ? 357  PRO B CA  1 
ATOM   5382 C C   . PRO B 1 323 ? 27.041 -13.982 -11.413 1.00 45.49  ? 357  PRO B C   1 
ATOM   5383 O O   . PRO B 1 323 ? 27.609 -12.987 -11.905 1.00 44.95  ? 357  PRO B O   1 
ATOM   5384 C CB  . PRO B 1 323 ? 27.279 -14.671 -8.998  1.00 47.70  ? 357  PRO B CB  1 
ATOM   5385 C CG  . PRO B 1 323 ? 28.488 -14.845 -8.179  1.00 48.87  ? 357  PRO B CG  1 
ATOM   5386 C CD  . PRO B 1 323 ? 29.558 -14.151 -8.980  1.00 49.03  ? 357  PRO B CD  1 
ATOM   5387 N N   . ALA B 1 324 ? 25.786 -14.307 -11.705 1.00 43.54  ? 358  ALA B N   1 
ATOM   5388 C CA  . ALA B 1 324 ? 24.996 -13.476 -12.618 1.00 44.43  ? 358  ALA B CA  1 
ATOM   5389 C C   . ALA B 1 324 ? 24.798 -12.104 -11.959 1.00 42.13  ? 358  ALA B C   1 
ATOM   5390 O O   . ALA B 1 324 ? 24.169 -12.003 -10.918 1.00 42.64  ? 358  ALA B O   1 
ATOM   5391 C CB  . ALA B 1 324 ? 23.648 -14.137 -12.880 1.00 45.13  ? 358  ALA B CB  1 
ATOM   5392 N N   . LEU B 1 325 ? 25.325 -11.054 -12.566 1.00 40.63  ? 359  LEU B N   1 
ATOM   5393 C CA  . LEU B 1 325 ? 25.206 -9.737  -11.983 1.00 41.91  ? 359  LEU B CA  1 
ATOM   5394 C C   . LEU B 1 325 ? 24.425 -8.741  -12.818 1.00 42.65  ? 359  LEU B C   1 
ATOM   5395 O O   . LEU B 1 325 ? 24.213 -7.606  -12.387 1.00 44.07  ? 359  LEU B O   1 
ATOM   5396 C CB  . LEU B 1 325 ? 26.600 -9.169  -11.736 1.00 42.29  ? 359  LEU B CB  1 
ATOM   5397 C CG  . LEU B 1 325 ? 27.587 -10.037 -10.946 1.00 41.90  ? 359  LEU B CG  1 
ATOM   5398 C CD1 . LEU B 1 325 ? 28.874 -9.244  -10.796 1.00 42.06  ? 359  LEU B CD1 1 
ATOM   5399 C CD2 . LEU B 1 325 ? 27.038 -10.411 -9.567  1.00 42.29  ? 359  LEU B CD2 1 
ATOM   5400 N N   . PHE B 1 326 ? 23.984 -9.165  -13.998 1.00 42.89  ? 360  PHE B N   1 
ATOM   5401 C CA  . PHE B 1 326 ? 23.291 -8.276  -14.912 1.00 43.24  ? 360  PHE B CA  1 
ATOM   5402 C C   . PHE B 1 326 ? 21.894 -8.694  -15.330 1.00 43.88  ? 360  PHE B C   1 
ATOM   5403 O O   . PHE B 1 326 ? 21.284 -8.060  -16.197 1.00 45.71  ? 360  PHE B O   1 
ATOM   5404 C CB  . PHE B 1 326 ? 24.140 -8.120  -16.163 1.00 43.56  ? 360  PHE B CB  1 
ATOM   5405 C CG  . PHE B 1 326 ? 25.583 -7.916  -15.877 1.00 45.02  ? 360  PHE B CG  1 
ATOM   5406 C CD1 . PHE B 1 326 ? 26.531 -8.818  -16.340 1.00 43.52  ? 360  PHE B CD1 1 
ATOM   5407 C CD2 . PHE B 1 326 ? 25.998 -6.820  -15.130 1.00 46.31  ? 360  PHE B CD2 1 
ATOM   5408 C CE1 . PHE B 1 326 ? 27.862 -8.629  -16.063 1.00 44.71  ? 360  PHE B CE1 1 
ATOM   5409 C CE2 . PHE B 1 326 ? 27.341 -6.623  -14.844 1.00 46.15  ? 360  PHE B CE2 1 
ATOM   5410 C CZ  . PHE B 1 326 ? 28.273 -7.520  -15.307 1.00 46.01  ? 360  PHE B CZ  1 
ATOM   5411 N N   . ASN B 1 327 ? 21.376 -9.751  -14.731 1.00 41.14  ? 361  ASN B N   1 
ATOM   5412 C CA  . ASN B 1 327 ? 20.056 -10.203 -15.106 1.00 41.02  ? 361  ASN B CA  1 
ATOM   5413 C C   . ASN B 1 327 ? 18.983 -9.423  -14.361 1.00 42.01  ? 361  ASN B C   1 
ATOM   5414 O O   . ASN B 1 327 ? 18.168 -9.993  -13.645 1.00 40.83  ? 361  ASN B O   1 
ATOM   5415 C CB  . ASN B 1 327 ? 19.936 -11.698 -14.835 1.00 41.82  ? 361  ASN B CB  1 
ATOM   5416 C CG  . ASN B 1 327 ? 20.276 -12.053 -13.406 1.00 45.17  ? 361  ASN B CG  1 
ATOM   5417 O OD1 . ASN B 1 327 ? 20.752 -11.211 -12.632 1.00 44.71  ? 361  ASN B OD1 1 
ATOM   5418 N ND2 . ASN B 1 327 ? 20.038 -13.307 -13.043 1.00 46.65  ? 361  ASN B ND2 1 
ATOM   5419 N N   . PHE B 1 328 ? 18.998 -8.107  -14.535 1.00 43.44  ? 362  PHE B N   1 
ATOM   5420 C CA  . PHE B 1 328 ? 18.027 -7.240  -13.896 1.00 45.79  ? 362  PHE B CA  1 
ATOM   5421 C C   . PHE B 1 328 ? 16.624 -7.451  -14.455 1.00 47.58  ? 362  PHE B C   1 
ATOM   5422 O O   . PHE B 1 328 ? 16.462 -7.830  -15.621 1.00 48.86  ? 362  PHE B O   1 
ATOM   5423 C CB  . PHE B 1 328 ? 18.419 -5.775  -14.087 1.00 46.72  ? 362  PHE B CB  1 
ATOM   5424 C CG  . PHE B 1 328 ? 19.613 -5.360  -13.295 1.00 50.00  ? 362  PHE B CG  1 
ATOM   5425 C CD1 . PHE B 1 328 ? 20.908 -5.581  -13.776 1.00 51.33  ? 362  PHE B CD1 1 
ATOM   5426 C CD2 . PHE B 1 328 ? 19.448 -4.740  -12.056 1.00 49.30  ? 362  PHE B CD2 1 
ATOM   5427 C CE1 . PHE B 1 328 ? 22.025 -5.184  -13.022 1.00 51.45  ? 362  PHE B CE1 1 
ATOM   5428 C CE2 . PHE B 1 328 ? 20.553 -4.344  -11.303 1.00 49.86  ? 362  PHE B CE2 1 
ATOM   5429 C CZ  . PHE B 1 328 ? 21.844 -4.563  -11.784 1.00 49.92  ? 362  PHE B CZ  1 
ATOM   5430 N N   . THR B 1 329 ? 15.609 -7.227  -13.620 1.00 48.08  ? 363  THR B N   1 
ATOM   5431 C CA  . THR B 1 329 ? 14.220 -7.350  -14.065 1.00 47.72  ? 363  THR B CA  1 
ATOM   5432 C C   . THR B 1 329 ? 13.630 -5.945  -14.107 1.00 49.31  ? 363  THR B C   1 
ATOM   5433 O O   . THR B 1 329 ? 14.242 -4.987  -13.630 1.00 50.35  ? 363  THR B O   1 
ATOM   5434 C CB  . THR B 1 329 ? 13.343 -8.226  -13.118 1.00 45.97  ? 363  THR B CB  1 
ATOM   5435 O OG1 . THR B 1 329 ? 13.286 -7.637  -11.812 1.00 47.72  ? 363  THR B OG1 1 
ATOM   5436 C CG2 . THR B 1 329 ? 13.889 -9.630  -13.025 1.00 42.48  ? 363  THR B CG2 1 
ATOM   5437 N N   . THR B 1 330 ? 12.450 -5.820  -14.695 1.00 50.18  ? 364  THR B N   1 
ATOM   5438 C CA  . THR B 1 330 ? 11.791 -4.532  -14.788 1.00 49.85  ? 364  THR B CA  1 
ATOM   5439 C C   . THR B 1 330 ? 11.548 -4.022  -13.377 1.00 50.50  ? 364  THR B C   1 
ATOM   5440 O O   . THR B 1 330 ? 11.749 -2.851  -13.094 1.00 50.86  ? 364  THR B O   1 
ATOM   5441 C CB  . THR B 1 330 ? 10.461 -4.667  -15.546 1.00 49.49  ? 364  THR B CB  1 
ATOM   5442 O OG1 . THR B 1 330 ? 10.732 -5.121  -16.876 1.00 50.08  ? 364  THR B OG1 1 
ATOM   5443 C CG2 . THR B 1 330 ? 9.731  -3.344  -15.613 1.00 47.88  ? 364  THR B CG2 1 
ATOM   5444 N N   . GLN B 1 331 ? 11.130 -4.920  -12.491 1.00 51.62  ? 365  GLN B N   1 
ATOM   5445 C CA  . GLN B 1 331 ? 10.872 -4.569  -11.104 1.00 52.36  ? 365  GLN B CA  1 
ATOM   5446 C C   . GLN B 1 331 ? 12.104 -3.945  -10.446 1.00 52.69  ? 365  GLN B C   1 
ATOM   5447 O O   . GLN B 1 331 ? 11.976 -2.945  -9.751  1.00 52.56  ? 365  GLN B O   1 
ATOM   5448 C CB  . GLN B 1 331 ? 10.427 -5.814  -10.322 1.00 53.30  ? 365  GLN B CB  1 
ATOM   5449 C CG  . GLN B 1 331 ? 10.157 -5.572  -8.845  1.00 54.23  ? 365  GLN B CG  1 
ATOM   5450 C CD  . GLN B 1 331 ? 8.970  -4.654  -8.595  1.00 57.26  ? 365  GLN B CD  1 
ATOM   5451 O OE1 . GLN B 1 331 ? 8.850  -4.061  -7.521  1.00 58.78  ? 365  GLN B OE1 1 
ATOM   5452 N NE2 . GLN B 1 331 ? 8.075  -4.548  -9.576  1.00 56.84  ? 365  GLN B NE2 1 
ATOM   5453 N N   . GLU B 1 332 ? 13.291 -4.512  -10.669 1.00 52.79  ? 366  GLU B N   1 
ATOM   5454 C CA  . GLU B 1 332 ? 14.510 -3.978  -10.053 1.00 52.47  ? 366  GLU B CA  1 
ATOM   5455 C C   . GLU B 1 332 ? 14.953 -2.630  -10.579 1.00 52.02  ? 366  GLU B C   1 
ATOM   5456 O O   . GLU B 1 332 ? 15.556 -1.847  -9.844  1.00 52.87  ? 366  GLU B O   1 
ATOM   5457 C CB  . GLU B 1 332 ? 15.681 -4.924  -10.250 1.00 53.26  ? 366  GLU B CB  1 
ATOM   5458 C CG  . GLU B 1 332 ? 15.552 -6.252  -9.601  1.00 55.71  ? 366  GLU B CG  1 
ATOM   5459 C CD  . GLU B 1 332 ? 16.797 -7.090  -9.815  1.00 58.42  ? 366  GLU B CD  1 
ATOM   5460 O OE1 . GLU B 1 332 ? 17.889 -6.673  -9.339  1.00 57.49  ? 366  GLU B OE1 1 
ATOM   5461 O OE2 . GLU B 1 332 ? 16.677 -8.159  -10.469 1.00 58.42  ? 366  GLU B OE2 1 
ATOM   5462 N N   . LEU B 1 333 ? 14.675 -2.370  -11.852 1.00 50.32  ? 367  LEU B N   1 
ATOM   5463 C CA  . LEU B 1 333 ? 15.080 -1.126  -12.489 1.00 49.03  ? 367  LEU B CA  1 
ATOM   5464 C C   . LEU B 1 333 ? 14.038 -0.027  -12.372 1.00 49.24  ? 367  LEU B C   1 
ATOM   5465 O O   . LEU B 1 333 ? 14.335 1.139   -12.619 1.00 48.27  ? 367  LEU B O   1 
ATOM   5466 C CB  . LEU B 1 333 ? 15.385 -1.395  -13.961 1.00 48.61  ? 367  LEU B CB  1 
ATOM   5467 C CG  . LEU B 1 333 ? 16.496 -2.418  -14.249 1.00 48.52  ? 367  LEU B CG  1 
ATOM   5468 C CD1 . LEU B 1 333 ? 16.389 -2.938  -15.667 1.00 47.47  ? 367  LEU B CD1 1 
ATOM   5469 C CD2 . LEU B 1 333 ? 17.840 -1.774  -14.018 1.00 48.31  ? 367  LEU B CD2 1 
ATOM   5470 N N   . SER B 1 334 ? 12.830 -0.403  -11.963 1.00 49.94  ? 368  SER B N   1 
ATOM   5471 C CA  . SER B 1 334 ? 11.719 0.533   -11.840 1.00 51.11  ? 368  SER B CA  1 
ATOM   5472 C C   . SER B 1 334 ? 12.035 1.898   -11.245 1.00 51.43  ? 368  SER B C   1 
ATOM   5473 O O   . SER B 1 334 ? 11.470 2.896   -11.674 1.00 52.58  ? 368  SER B O   1 
ATOM   5474 C CB  . SER B 1 334 ? 10.561 -0.112  -11.067 1.00 51.83  ? 368  SER B CB  1 
ATOM   5475 O OG  . SER B 1 334 ? 10.963 -0.546  -9.788  1.00 57.17  ? 368  SER B OG  1 
ATOM   5476 N N   . SER B 1 335 ? 12.936 1.967   -10.275 1.00 52.98  ? 369  SER B N   1 
ATOM   5477 C CA  . SER B 1 335 ? 13.252 3.260   -9.673  1.00 53.00  ? 369  SER B CA  1 
ATOM   5478 C C   . SER B 1 335 ? 13.986 4.193   -10.636 1.00 54.36  ? 369  SER B C   1 
ATOM   5479 O O   . SER B 1 335 ? 14.081 5.392   -10.377 1.00 54.88  ? 369  SER B O   1 
ATOM   5480 C CB  . SER B 1 335 ? 14.097 3.072   -8.414  1.00 52.55  ? 369  SER B CB  1 
ATOM   5481 O OG  . SER B 1 335 ? 15.364 2.526   -8.726  1.00 54.94  ? 369  SER B OG  1 
ATOM   5482 N N   . ASN B 1 336 ? 14.496 3.658   -11.749 1.00 54.45  ? 370  ASN B N   1 
ATOM   5483 C CA  . ASN B 1 336 ? 15.232 4.479   -12.721 1.00 53.76  ? 370  ASN B CA  1 
ATOM   5484 C C   . ASN B 1 336 ? 15.709 3.638   -13.919 1.00 53.05  ? 370  ASN B C   1 
ATOM   5485 O O   . ASN B 1 336 ? 16.902 3.381   -14.072 1.00 52.62  ? 370  ASN B O   1 
ATOM   5486 C CB  . ASN B 1 336 ? 16.425 5.134   -12.011 1.00 53.24  ? 370  ASN B CB  1 
ATOM   5487 C CG  . ASN B 1 336 ? 17.186 6.118   -12.896 1.00 55.89  ? 370  ASN B CG  1 
ATOM   5488 O OD1 . ASN B 1 336 ? 18.084 6.818   -12.420 1.00 55.17  ? 370  ASN B OD1 1 
ATOM   5489 N ND2 . ASN B 1 336 ? 16.839 6.173   -14.181 1.00 56.06  ? 370  ASN B ND2 1 
ATOM   5490 N N   . PRO B 1 337 ? 14.774 3.228   -14.798 1.00 52.63  ? 371  PRO B N   1 
ATOM   5491 C CA  . PRO B 1 337 ? 15.039 2.410   -15.994 1.00 52.07  ? 371  PRO B CA  1 
ATOM   5492 C C   . PRO B 1 337 ? 16.240 2.806   -16.855 1.00 51.98  ? 371  PRO B C   1 
ATOM   5493 O O   . PRO B 1 337 ? 17.026 1.954   -17.262 1.00 52.25  ? 371  PRO B O   1 
ATOM   5494 C CB  . PRO B 1 337 ? 13.721 2.482   -16.756 1.00 50.74  ? 371  PRO B CB  1 
ATOM   5495 C CG  . PRO B 1 337 ? 12.724 2.536   -15.655 1.00 51.99  ? 371  PRO B CG  1 
ATOM   5496 C CD  . PRO B 1 337 ? 13.342 3.563   -14.715 1.00 51.14  ? 371  PRO B CD  1 
ATOM   5497 N N   . PRO B 1 338 ? 16.397 4.103   -17.150 1.00 51.91  ? 372  PRO B N   1 
ATOM   5498 C CA  . PRO B 1 338 ? 17.523 4.556   -17.969 1.00 50.98  ? 372  PRO B CA  1 
ATOM   5499 C C   . PRO B 1 338 ? 18.864 4.046   -17.482 1.00 51.59  ? 372  PRO B C   1 
ATOM   5500 O O   . PRO B 1 338 ? 19.828 4.029   -18.238 1.00 52.23  ? 372  PRO B O   1 
ATOM   5501 C CB  . PRO B 1 338 ? 17.435 6.073   -17.870 1.00 50.18  ? 372  PRO B CB  1 
ATOM   5502 C CG  . PRO B 1 338 ? 15.978 6.306   -17.789 1.00 52.41  ? 372  PRO B CG  1 
ATOM   5503 C CD  . PRO B 1 338 ? 15.506 5.228   -16.822 1.00 52.69  ? 372  PRO B CD  1 
ATOM   5504 N N   . LEU B 1 339 ? 18.940 3.646   -16.214 1.00 53.27  ? 373  LEU B N   1 
ATOM   5505 C CA  . LEU B 1 339 ? 20.204 3.162   -15.665 1.00 52.33  ? 373  LEU B CA  1 
ATOM   5506 C C   . LEU B 1 339 ? 20.633 1.821   -16.243 1.00 52.95  ? 373  LEU B C   1 
ATOM   5507 O O   . LEU B 1 339 ? 21.802 1.447   -16.133 1.00 53.11  ? 373  LEU B O   1 
ATOM   5508 C CB  . LEU B 1 339 ? 20.130 3.068   -14.145 1.00 51.13  ? 373  LEU B CB  1 
ATOM   5509 C CG  . LEU B 1 339 ? 20.256 4.377   -13.374 1.00 51.99  ? 373  LEU B CG  1 
ATOM   5510 C CD1 . LEU B 1 339 ? 20.215 4.064   -11.880 1.00 51.23  ? 373  LEU B CD1 1 
ATOM   5511 C CD2 . LEU B 1 339 ? 21.558 5.079   -13.731 1.00 50.36  ? 373  LEU B CD2 1 
ATOM   5512 N N   . ALA B 1 340 ? 19.690 1.109   -16.865 1.00 52.80  ? 374  ALA B N   1 
ATOM   5513 C CA  . ALA B 1 340 ? 19.976 -0.190  -17.477 1.00 52.34  ? 374  ALA B CA  1 
ATOM   5514 C C   . ALA B 1 340 ? 21.116 -0.050  -18.479 1.00 53.13  ? 374  ALA B C   1 
ATOM   5515 O O   . ALA B 1 340 ? 21.864 -0.991  -18.733 1.00 52.88  ? 374  ALA B O   1 
ATOM   5516 C CB  . ALA B 1 340 ? 18.740 -0.726  -18.167 1.00 49.92  ? 374  ALA B CB  1 
ATOM   5517 N N   . THR B 1 341 ? 21.237 1.143   -19.041 1.00 54.08  ? 375  THR B N   1 
ATOM   5518 C CA  . THR B 1 341 ? 22.278 1.464   -20.006 1.00 55.06  ? 375  THR B CA  1 
ATOM   5519 C C   . THR B 1 341 ? 23.657 1.131   -19.457 1.00 54.99  ? 375  THR B C   1 
ATOM   5520 O O   . THR B 1 341 ? 24.547 0.736   -20.205 1.00 54.36  ? 375  THR B O   1 
ATOM   5521 C CB  . THR B 1 341 ? 22.253 2.963   -20.341 1.00 57.96  ? 375  THR B CB  1 
ATOM   5522 O OG1 . THR B 1 341 ? 21.117 3.252   -21.166 1.00 59.47  ? 375  THR B OG1 1 
ATOM   5523 C CG2 . THR B 1 341 ? 23.539 3.384   -21.035 1.00 56.81  ? 375  THR B CG2 1 
ATOM   5524 N N   . ILE B 1 342 ? 23.836 1.316   -18.150 1.00 53.98  ? 376  ILE B N   1 
ATOM   5525 C CA  . ILE B 1 342 ? 25.118 1.042   -17.510 1.00 52.22  ? 376  ILE B CA  1 
ATOM   5526 C C   . ILE B 1 342 ? 25.097 -0.293  -16.779 1.00 52.94  ? 376  ILE B C   1 
ATOM   5527 O O   . ILE B 1 342 ? 26.039 -1.070  -16.878 1.00 53.87  ? 376  ILE B O   1 
ATOM   5528 C CB  . ILE B 1 342 ? 25.506 2.119   -16.473 1.00 49.82  ? 376  ILE B CB  1 
ATOM   5529 C CG1 . ILE B 1 342 ? 25.417 3.517   -17.078 1.00 48.50  ? 376  ILE B CG1 1 
ATOM   5530 C CG2 . ILE B 1 342 ? 26.915 1.868   -16.007 1.00 49.32  ? 376  ILE B CG2 1 
ATOM   5531 C CD1 . ILE B 1 342 ? 25.620 4.620   -16.083 1.00 45.09  ? 376  ILE B CD1 1 
ATOM   5532 N N   . LEU B 1 343 ? 24.022 -0.562  -16.046 1.00 53.20  ? 377  LEU B N   1 
ATOM   5533 C CA  . LEU B 1 343 ? 23.925 -1.805  -15.290 1.00 51.89  ? 377  LEU B CA  1 
ATOM   5534 C C   . LEU B 1 343 ? 24.133 -3.049  -16.139 1.00 51.43  ? 377  LEU B C   1 
ATOM   5535 O O   . LEU B 1 343 ? 24.702 -4.036  -15.674 1.00 50.58  ? 377  LEU B O   1 
ATOM   5536 C CB  . LEU B 1 343 ? 22.575 -1.880  -14.575 1.00 51.82  ? 377  LEU B CB  1 
ATOM   5537 C CG  . LEU B 1 343 ? 22.306 -0.696  -13.646 1.00 51.81  ? 377  LEU B CG  1 
ATOM   5538 C CD1 . LEU B 1 343 ? 20.963 -0.869  -12.965 1.00 51.73  ? 377  LEU B CD1 1 
ATOM   5539 C CD2 . LEU B 1 343 ? 23.420 -0.603  -12.624 1.00 51.71  ? 377  LEU B CD2 1 
ATOM   5540 N N   . ILE B 1 344 ? 23.685 -3.001  -17.391 1.00 51.84  ? 378  ILE B N   1 
ATOM   5541 C CA  . ILE B 1 344 ? 23.814 -4.154  -18.295 1.00 51.16  ? 378  ILE B CA  1 
ATOM   5542 C C   . ILE B 1 344 ? 24.847 -3.932  -19.390 1.00 51.20  ? 378  ILE B C   1 
ATOM   5543 O O   . ILE B 1 344 ? 24.567 -3.292  -20.392 1.00 51.75  ? 378  ILE B O   1 
ATOM   5544 C CB  . ILE B 1 344 ? 22.474 -4.496  -18.956 1.00 49.45  ? 378  ILE B CB  1 
ATOM   5545 C CG1 . ILE B 1 344 ? 21.403 -4.756  -17.894 1.00 47.62  ? 378  ILE B CG1 1 
ATOM   5546 C CG2 . ILE B 1 344 ? 22.638 -5.721  -19.823 1.00 49.93  ? 378  ILE B CG2 1 
ATOM   5547 C CD1 . ILE B 1 344 ? 20.034 -4.995  -18.460 1.00 46.23  ? 378  ILE B CD1 1 
ATOM   5548 N N   . PRO B 1 345 ? 26.056 -4.486  -19.210 1.00 53.55  ? 379  PRO B N   1 
ATOM   5549 C CA  . PRO B 1 345 ? 27.155 -4.355  -20.166 1.00 54.20  ? 379  PRO B CA  1 
ATOM   5550 C C   . PRO B 1 345 ? 26.799 -4.950  -21.511 1.00 56.32  ? 379  PRO B C   1 
ATOM   5551 O O   . PRO B 1 345 ? 25.914 -5.803  -21.622 1.00 57.50  ? 379  PRO B O   1 
ATOM   5552 C CB  . PRO B 1 345 ? 28.294 -5.133  -19.511 1.00 53.35  ? 379  PRO B CB  1 
ATOM   5553 C CG  . PRO B 1 345 ? 27.964 -5.118  -18.077 1.00 53.80  ? 379  PRO B CG  1 
ATOM   5554 C CD  . PRO B 1 345 ? 26.471 -5.336  -18.084 1.00 54.42  ? 379  PRO B CD  1 
ATOM   5555 N N   . PRO B 1 346 ? 27.507 -4.523  -22.555 1.00 57.28  ? 380  PRO B N   1 
ATOM   5556 C CA  . PRO B 1 346 ? 27.277 -5.009  -23.917 1.00 58.16  ? 380  PRO B CA  1 
ATOM   5557 C C   . PRO B 1 346 ? 27.307 -6.537  -24.088 1.00 58.10  ? 380  PRO B C   1 
ATOM   5558 O O   . PRO B 1 346 ? 26.587 -7.072  -24.928 1.00 57.85  ? 380  PRO B O   1 
ATOM   5559 C CB  . PRO B 1 346 ? 28.369 -4.299  -24.715 1.00 57.06  ? 380  PRO B CB  1 
ATOM   5560 C CG  . PRO B 1 346 ? 28.504 -2.985  -23.987 1.00 56.67  ? 380  PRO B CG  1 
ATOM   5561 C CD  . PRO B 1 346 ? 28.497 -3.432  -22.543 1.00 56.81  ? 380  PRO B CD  1 
ATOM   5562 N N   . HIS B 1 347 ? 28.116 -7.234  -23.294 1.00 58.06  ? 381  HIS B N   1 
ATOM   5563 C CA  . HIS B 1 347 ? 28.216 -8.690  -23.411 1.00 59.53  ? 381  HIS B CA  1 
ATOM   5564 C C   . HIS B 1 347 ? 27.223 -9.463  -22.549 1.00 61.57  ? 381  HIS B C   1 
ATOM   5565 O O   . HIS B 1 347 ? 26.871 -10.599 -22.864 1.00 61.45  ? 381  HIS B O   1 
ATOM   5566 C CB  . HIS B 1 347 ? 29.625 -9.162  -23.050 1.00 58.23  ? 381  HIS B CB  1 
ATOM   5567 C CG  . HIS B 1 347 ? 29.989 -8.930  -21.616 1.00 59.00  ? 381  HIS B CG  1 
ATOM   5568 N ND1 . HIS B 1 347 ? 30.420 -7.708  -21.145 1.00 58.61  ? 381  HIS B ND1 1 
ATOM   5569 C CD2 . HIS B 1 347 ? 29.926 -9.748  -20.537 1.00 57.40  ? 381  HIS B CD2 1 
ATOM   5570 C CE1 . HIS B 1 347 ? 30.605 -7.782  -19.838 1.00 57.21  ? 381  HIS B CE1 1 
ATOM   5571 N NE2 . HIS B 1 347 ? 30.312 -9.009  -19.446 1.00 57.50  ? 381  HIS B NE2 1 
ATOM   5572 N N   . ALA B 1 348 ? 26.783 -8.850  -21.459 1.00 64.44  ? 382  ALA B N   1 
ATOM   5573 C CA  . ALA B 1 348 ? 25.856 -9.500  -20.547 1.00 67.57  ? 382  ALA B CA  1 
ATOM   5574 C C   . ALA B 1 348 ? 24.605 -10.016 -21.236 1.00 71.14  ? 382  ALA B C   1 
ATOM   5575 O O   . ALA B 1 348 ? 24.231 -9.559  -22.316 1.00 71.63  ? 382  ALA B O   1 
ATOM   5576 C CB  . ALA B 1 348 ? 25.474 -8.550  -19.437 1.00 67.20  ? 382  ALA B CB  1 
ATOM   5577 N N   . ARG B 1 349 ? 23.964 -10.977 -20.582 1.00 76.06  ? 383  ARG B N   1 
ATOM   5578 C CA  . ARG B 1 349 ? 22.744 -11.598 -21.075 1.00 79.77  ? 383  ARG B CA  1 
ATOM   5579 C C   . ARG B 1 349 ? 21.872 -12.033 -19.871 1.00 82.56  ? 383  ARG B C   1 
ATOM   5580 O O   . ARG B 1 349 ? 21.888 -11.374 -18.820 1.00 82.13  ? 383  ARG B O   1 
ATOM   5581 C CB  . ARG B 1 349 ? 23.116 -12.789 -21.960 1.00 80.01  ? 383  ARG B CB  1 
ATOM   5582 C CG  . ARG B 1 349 ? 21.993 -13.255 -22.859 1.00 82.66  ? 383  ARG B CG  1 
ATOM   5583 C CD  . ARG B 1 349 ? 22.477 -13.410 -24.287 1.00 82.65  ? 383  ARG B CD  1 
ATOM   5584 N NE  . ARG B 1 349 ? 23.013 -12.151 -24.799 1.00 83.90  ? 383  ARG B NE  1 
ATOM   5585 C CZ  . ARG B 1 349 ? 23.552 -12.002 -26.005 1.00 84.01  ? 383  ARG B CZ  1 
ATOM   5586 N NH1 . ARG B 1 349 ? 23.626 -13.038 -26.829 1.00 83.49  ? 383  ARG B NH1 1 
ATOM   5587 N NH2 . ARG B 1 349 ? 24.022 -10.820 -26.384 1.00 83.00  ? 383  ARG B NH2 1 
ATOM   5588 N N   . ILE B 1 350 ? 21.121 -13.130 -20.018 1.00 85.21  ? 384  ILE B N   1 
ATOM   5589 C CA  . ILE B 1 350 ? 20.230 -13.659 -18.954 1.00 86.86  ? 384  ILE B CA  1 
ATOM   5590 C C   . ILE B 1 350 ? 19.109 -12.684 -18.522 1.00 86.80  ? 384  ILE B C   1 
ATOM   5591 O O   . ILE B 1 350 ? 19.193 -11.471 -18.826 1.00 87.22  ? 384  ILE B O   1 
ATOM   5592 C CB  . ILE B 1 350 ? 21.025 -14.073 -17.661 1.00 87.26  ? 384  ILE B CB  1 
ATOM   5593 C CG1 . ILE B 1 350 ? 22.163 -15.039 -18.014 1.00 87.92  ? 384  ILE B CG1 1 
ATOM   5594 C CG2 . ILE B 1 350 ? 20.096 -14.789 -16.680 1.00 87.76  ? 384  ILE B CG2 1 
ATOM   5595 C CD1 . ILE B 1 350 ? 22.972 -15.508 -16.804 1.00 86.51  ? 384  ILE B CD1 1 
HETATM 5596 N N1  . EPE C 2 .   ? 24.888 16.156  25.215  1.00 71.62  ? 400  EPE A N1  1 
HETATM 5597 C C2  . EPE C 2 .   ? 25.710 16.302  23.993  1.00 71.89  ? 400  EPE A C2  1 
HETATM 5598 C C3  . EPE C 2 .   ? 27.202 16.155  24.410  1.00 71.75  ? 400  EPE A C3  1 
HETATM 5599 N N4  . EPE C 2 .   ? 27.444 14.881  25.148  1.00 72.28  ? 400  EPE A N4  1 
HETATM 5600 C C5  . EPE C 2 .   ? 26.551 14.751  26.317  1.00 70.13  ? 400  EPE A C5  1 
HETATM 5601 C C6  . EPE C 2 .   ? 25.088 14.880  25.934  1.00 70.78  ? 400  EPE A C6  1 
HETATM 5602 C C7  . EPE C 2 .   ? 28.853 14.759  25.555  1.00 73.58  ? 400  EPE A C7  1 
HETATM 5603 C C8  . EPE C 2 .   ? 29.355 13.307  25.612  1.00 75.13  ? 400  EPE A C8  1 
HETATM 5604 O O8  . EPE C 2 .   ? 29.073 12.705  26.884  1.00 75.65  ? 400  EPE A O8  1 
HETATM 5605 C C9  . EPE C 2 .   ? 23.475 16.303  24.895  1.00 72.50  ? 400  EPE A C9  1 
HETATM 5606 C C10 . EPE C 2 .   ? 22.998 17.250  25.977  1.00 78.97  ? 400  EPE A C10 1 
HETATM 5607 S S   . EPE C 2 .   ? 21.266 17.750  25.980  1.00 82.49  ? 400  EPE A S   1 
HETATM 5608 O O1S . EPE C 2 .   ? 20.411 16.559  26.248  1.00 77.20  ? 400  EPE A O1S 1 
HETATM 5609 O O2S . EPE C 2 .   ? 21.063 18.395  24.646  1.00 82.92  ? 400  EPE A O2S 1 
HETATM 5610 O O3S . EPE C 2 .   ? 21.126 18.787  27.109  1.00 84.21  ? 400  EPE A O3S 1 
HETATM 5611 N N1  . EPE D 2 .   ? 9.064  -4.096  14.958  1.00 70.38  ? 400  EPE B N1  1 
HETATM 5612 C C2  . EPE D 2 .   ? 8.868  -4.744  16.263  1.00 69.76  ? 400  EPE B C2  1 
HETATM 5613 C C3  . EPE D 2 .   ? 9.284  -6.238  16.125  1.00 70.10  ? 400  EPE B C3  1 
HETATM 5614 N N4  . EPE D 2 .   ? 10.670 -6.383  15.602  1.00 70.63  ? 400  EPE B N4  1 
HETATM 5615 C C5  . EPE D 2 .   ? 10.843 -5.660  14.330  1.00 69.00  ? 400  EPE B C5  1 
HETATM 5616 C C6  . EPE D 2 .   ? 10.452 -4.188  14.448  1.00 69.71  ? 400  EPE B C6  1 
HETATM 5617 C C7  . EPE D 2 .   ? 11.047 -7.805  15.456  1.00 71.64  ? 400  EPE B C7  1 
HETATM 5618 C C8  . EPE D 2 .   ? 12.548 -8.080  15.654  1.00 72.83  ? 400  EPE B C8  1 
HETATM 5619 O O8  . EPE D 2 .   ? 13.291 -7.855  14.449  1.00 72.87  ? 400  EPE B O8  1 
HETATM 5620 C C9  . EPE D 2 .   ? 8.660  -2.676  15.016  1.00 72.13  ? 400  EPE B C9  1 
HETATM 5621 C C10 . EPE D 2 .   ? 7.867  -2.476  13.731  1.00 80.35  ? 400  EPE B C10 1 
HETATM 5622 S S   . EPE D 2 .   ? 7.118  -0.844  13.378  1.00 84.02  ? 400  EPE B S   1 
HETATM 5623 O O1S . EPE D 2 .   ? 8.188  0.144   13.132  1.00 78.99  ? 400  EPE B O1S 1 
HETATM 5624 O O2S . EPE D 2 .   ? 6.250  -0.588  14.577  1.00 84.96  ? 400  EPE B O2S 1 
HETATM 5625 O O3S . EPE D 2 .   ? 6.249  -1.016  12.129  1.00 85.76  ? 400  EPE B O3S 1 
HETATM 5626 O O   . HOH E 3 .   ? 55.294 25.146  31.609  1.00 51.26  ? 2001 HOH A O   1 
HETATM 5627 O O   . HOH E 3 .   ? 41.707 35.615  39.650  1.00 49.94  ? 2002 HOH A O   1 
HETATM 5628 O O   . HOH E 3 .   ? 49.873 17.234  30.042  1.00 51.74  ? 2003 HOH A O   1 
HETATM 5629 O O   . HOH E 3 .   ? 50.600 21.595  29.650  1.00 49.88  ? 2004 HOH A O   1 
HETATM 5630 O O   . HOH E 3 .   ? 48.576 17.097  27.998  1.00 62.77  ? 2005 HOH A O   1 
HETATM 5631 O O   . HOH E 3 .   ? 29.251 24.231  23.431  1.00 82.88  ? 2006 HOH A O   1 
HETATM 5632 O O   . HOH E 3 .   ? 33.994 7.408   51.453  1.00 54.19  ? 2007 HOH A O   1 
HETATM 5633 O O   . HOH E 3 .   ? 25.423 16.737  28.711  1.00 44.61  ? 2008 HOH A O   1 
HETATM 5634 O O   . HOH E 3 .   ? 33.098 17.879  28.189  1.00 58.11  ? 2009 HOH A O   1 
HETATM 5635 O O   . HOH E 3 .   ? 30.533 18.857  28.737  1.00 39.41  ? 2010 HOH A O   1 
HETATM 5636 O O   . HOH E 3 .   ? 14.645 9.307   40.808  1.00 46.59  ? 2011 HOH A O   1 
HETATM 5637 O O   . HOH E 3 .   ? 29.624 25.787  38.778  1.00 49.89  ? 2012 HOH A O   1 
HETATM 5638 O O   . HOH E 3 .   ? 29.728 16.185  50.978  1.00 73.05  ? 2013 HOH A O   1 
HETATM 5639 O O   . HOH E 3 .   ? 35.887 11.905  46.174  1.00 40.92  ? 2014 HOH A O   1 
HETATM 5640 O O   . HOH E 3 .   ? 43.280 20.749  45.670  1.00 56.34  ? 2015 HOH A O   1 
HETATM 5641 O O   . HOH E 3 .   ? 35.286 26.147  29.765  1.00 70.57  ? 2016 HOH A O   1 
HETATM 5642 O O   . HOH E 3 .   ? 20.076 -12.787 29.351  1.00 58.56  ? 2017 HOH A O   1 
HETATM 5643 O O   . HOH E 3 .   ? 48.066 19.071  29.324  1.00 45.60  ? 2018 HOH A O   1 
HETATM 5644 O O   . HOH E 3 .   ? 38.262 11.681  43.917  1.00 72.43  ? 2019 HOH A O   1 
HETATM 5645 O O   . HOH E 3 .   ? 8.426  4.640   44.599  1.00 47.03  ? 2020 HOH A O   1 
HETATM 5646 O O   . HOH E 3 .   ? 30.801 0.634   60.831  1.00 57.15  ? 2021 HOH A O   1 
HETATM 5647 O O   . HOH E 3 .   ? 38.550 -6.808  46.986  1.00 72.45  ? 2022 HOH A O   1 
HETATM 5648 O O   . HOH E 3 .   ? 22.507 -11.040 51.692  1.00 57.48  ? 2023 HOH A O   1 
HETATM 5649 O O   . HOH E 3 .   ? 31.976 5.273   50.849  1.00 78.11  ? 2024 HOH A O   1 
HETATM 5650 O O   . HOH E 3 .   ? 28.797 5.673   51.356  1.00 50.31  ? 2025 HOH A O   1 
HETATM 5651 O O   . HOH E 3 .   ? 16.312 10.688  42.118  1.00 45.49  ? 2026 HOH A O   1 
HETATM 5652 O O   . HOH E 3 .   ? 15.552 17.982  42.623  1.00 57.47  ? 2027 HOH A O   1 
HETATM 5653 O O   . HOH E 3 .   ? 17.437 21.351  42.922  1.00 78.66  ? 2028 HOH A O   1 
HETATM 5654 O O   . HOH E 3 .   ? 22.671 6.046   33.362  1.00 26.15  ? 2029 HOH A O   1 
HETATM 5655 O O   . HOH E 3 .   ? 29.298 5.918   27.051  1.00 84.26  ? 2030 HOH A O   1 
HETATM 5656 O O   . HOH E 3 .   ? 30.657 1.538   27.592  1.00 76.50  ? 2031 HOH A O   1 
HETATM 5657 O O   . HOH E 3 .   ? 37.125 1.120   54.106  1.00 44.26  ? 2032 HOH A O   1 
HETATM 5658 O O   . HOH E 3 .   ? 28.174 11.505  32.429  1.00 25.15  ? 2033 HOH A O   1 
HETATM 5659 O O   . HOH E 3 .   ? 29.361 10.049  29.594  1.00 37.22  ? 2034 HOH A O   1 
HETATM 5660 O O   . HOH E 3 .   ? 27.929 17.227  31.186  1.00 41.10  ? 2035 HOH A O   1 
HETATM 5661 O O   . HOH E 3 .   ? 18.473 22.302  27.969  1.00 64.70  ? 2036 HOH A O   1 
HETATM 5662 O O   . HOH E 3 .   ? 23.522 20.636  32.927  1.00 51.98  ? 2037 HOH A O   1 
HETATM 5663 O O   . HOH E 3 .   ? 15.819 19.771  31.044  1.00 50.35  ? 2038 HOH A O   1 
HETATM 5664 O O   . HOH E 3 .   ? 22.610 5.515   23.383  1.00 41.26  ? 2039 HOH A O   1 
HETATM 5665 O O   . HOH E 3 .   ? 25.877 8.701   27.032  1.00 27.93  ? 2040 HOH A O   1 
HETATM 5666 O O   . HOH E 3 .   ? 24.812 -7.486  22.992  1.00 38.27  ? 2041 HOH A O   1 
HETATM 5667 O O   . HOH E 3 .   ? 21.864 -5.120  30.713  1.00 34.55  ? 2042 HOH A O   1 
HETATM 5668 O O   . HOH E 3 .   ? 29.954 -3.249  30.574  1.00 34.77  ? 2043 HOH A O   1 
HETATM 5669 O O   . HOH E 3 .   ? 16.431 4.715   20.668  1.00 56.57  ? 2044 HOH A O   1 
HETATM 5670 O O   . HOH E 3 .   ? 18.500 -1.839  29.838  1.00 27.16  ? 2045 HOH A O   1 
HETATM 5671 O O   . HOH E 3 .   ? 12.868 9.003   33.278  1.00 35.37  ? 2046 HOH A O   1 
HETATM 5672 O O   . HOH E 3 .   ? 14.528 14.720  37.003  1.00 40.45  ? 2047 HOH A O   1 
HETATM 5673 O O   . HOH E 3 .   ? 10.321 9.062   37.101  1.00 30.48  ? 2048 HOH A O   1 
HETATM 5674 O O   . HOH E 3 .   ? 19.045 4.864   31.566  1.00 26.65  ? 2049 HOH A O   1 
HETATM 5675 O O   . HOH E 3 .   ? 23.484 -5.376  33.083  1.00 32.89  ? 2050 HOH A O   1 
HETATM 5676 O O   . HOH E 3 .   ? 29.653 -9.257  33.093  1.00 44.86  ? 2051 HOH A O   1 
HETATM 5677 O O   . HOH E 3 .   ? 30.437 -4.727  32.713  1.00 50.92  ? 2052 HOH A O   1 
HETATM 5678 O O   . HOH E 3 .   ? 18.121 -11.838 31.226  1.00 53.34  ? 2053 HOH A O   1 
HETATM 5679 O O   . HOH E 3 .   ? 18.891 -3.103  27.153  1.00 56.39  ? 2054 HOH A O   1 
HETATM 5680 O O   . HOH E 3 .   ? 24.510 -6.996  15.703  1.00 60.69  ? 2055 HOH A O   1 
HETATM 5681 O O   . HOH E 3 .   ? 22.025 0.266   19.591  1.00 46.46  ? 2056 HOH A O   1 
HETATM 5682 O O   . HOH E 3 .   ? 21.890 -8.787  19.478  1.00 44.18  ? 2057 HOH A O   1 
HETATM 5683 O O   . HOH E 3 .   ? 18.480 -9.966  15.987  1.00 70.41  ? 2058 HOH A O   1 
HETATM 5684 O O   . HOH E 3 .   ? 17.298 -6.877  15.666  1.00 59.17  ? 2059 HOH A O   1 
HETATM 5685 O O   . HOH E 3 .   ? 19.863 0.886   22.631  1.00 38.00  ? 2060 HOH A O   1 
HETATM 5686 O O   . HOH E 3 .   ? 16.330 -11.510 29.474  1.00 37.46  ? 2061 HOH A O   1 
HETATM 5687 O O   . HOH E 3 .   ? 11.340 8.077   18.887  1.00 52.48  ? 2062 HOH A O   1 
HETATM 5688 O O   . HOH E 3 .   ? 9.234  -15.466 29.724  1.00 61.90  ? 2063 HOH A O   1 
HETATM 5689 O O   . HOH E 3 .   ? 11.046 -16.550 39.861  1.00 68.96  ? 2064 HOH A O   1 
HETATM 5690 O O   . HOH E 3 .   ? 29.637 -16.321 35.865  1.00 59.07  ? 2065 HOH A O   1 
HETATM 5691 O O   . HOH E 3 .   ? 10.957 -1.622  48.187  1.00 54.07  ? 2066 HOH A O   1 
HETATM 5692 O O   . HOH E 3 .   ? 11.161 6.563   40.244  1.00 40.61  ? 2067 HOH A O   1 
HETATM 5693 O O   . HOH E 3 .   ? 13.598 6.490   40.677  1.00 38.41  ? 2068 HOH A O   1 
HETATM 5694 O O   . HOH E 3 .   ? 12.657 9.259   48.397  1.00 51.75  ? 2069 HOH A O   1 
HETATM 5695 O O   . HOH E 3 .   ? 16.651 9.727   46.417  1.00 38.10  ? 2070 HOH A O   1 
HETATM 5696 O O   . HOH E 3 .   ? 9.158  7.141   45.057  1.00 45.85  ? 2071 HOH A O   1 
HETATM 5697 O O   . HOH E 3 .   ? 13.186 1.555   51.623  1.00 71.40  ? 2072 HOH A O   1 
HETATM 5698 O O   . HOH E 3 .   ? 13.330 -3.265  51.905  1.00 43.94  ? 2073 HOH A O   1 
HETATM 5699 O O   . HOH E 3 .   ? 21.603 -7.244  54.008  1.00 46.78  ? 2074 HOH A O   1 
HETATM 5700 O O   . HOH E 3 .   ? 28.033 -9.657  58.552  1.00 55.08  ? 2075 HOH A O   1 
HETATM 5701 O O   . HOH E 3 .   ? 22.246 2.844   55.694  1.00 47.57  ? 2076 HOH A O   1 
HETATM 5702 O O   . HOH E 3 .   ? 28.020 -0.585  60.274  1.00 85.01  ? 2077 HOH A O   1 
HETATM 5703 O O   . HOH E 3 .   ? 33.001 -1.639  59.585  1.00 60.19  ? 2078 HOH A O   1 
HETATM 5704 O O   . HOH E 3 .   ? 34.797 6.269   53.784  1.00 54.54  ? 2079 HOH A O   1 
HETATM 5705 O O   . HOH E 3 .   ? 17.631 21.346  48.471  1.00 60.12  ? 2080 HOH A O   1 
HETATM 5706 O O   . HOH E 3 .   ? 23.078 0.119   65.023  1.00 36.67  ? 2081 HOH A O   1 
HETATM 5707 O O   . HOH E 3 .   ? 30.311 10.339  26.797  1.00 39.82  ? 2082 HOH A O   1 
HETATM 5708 O O   . HOH F 3 .   ? 2.932  -33.711 -0.553  1.00 53.02  ? 2001 HOH B O   1 
HETATM 5709 O O   . HOH F 3 .   ? 12.111 -28.152 15.768  1.00 72.77  ? 2002 HOH B O   1 
HETATM 5710 O O   . HOH F 3 .   ? 13.373 -29.716 14.618  1.00 57.02  ? 2003 HOH B O   1 
HETATM 5711 O O   . HOH F 3 .   ? 8.749  -30.297 14.035  1.00 76.31  ? 2004 HOH B O   1 
HETATM 5712 O O   . HOH F 3 .   ? 12.040 -28.317 13.311  1.00 57.46  ? 2005 HOH B O   1 
HETATM 5713 O O   . HOH F 3 .   ? 9.521  -12.363 14.777  1.00 47.66  ? 2006 HOH B O   1 
HETATM 5714 O O   . HOH F 3 .   ? 1.772  -9.770  16.706  1.00 45.80  ? 2007 HOH B O   1 
HETATM 5715 O O   . HOH F 3 .   ? 8.139  -11.968 12.550  1.00 39.35  ? 2008 HOH B O   1 
HETATM 5716 O O   . HOH F 3 .   ? 23.506 -15.839 -7.901  1.00 40.04  ? 2009 HOH B O   1 
HETATM 5717 O O   . HOH F 3 .   ? 9.275  -5.055  11.507  1.00 50.20  ? 2010 HOH B O   1 
HETATM 5718 O O   . HOH F 3 .   ? 17.001 5.353   -1.098  1.00 37.27  ? 2011 HOH B O   1 
HETATM 5719 O O   . HOH F 3 .   ? 2.693  -12.177 1.543   1.00 45.09  ? 2012 HOH B O   1 
HETATM 5720 O O   . HOH F 3 .   ? 13.655 -11.364 -9.253  1.00 57.36  ? 2013 HOH B O   1 
HETATM 5721 O O   . HOH F 3 .   ? 18.057 -16.931 -3.297  1.00 41.89  ? 2014 HOH B O   1 
HETATM 5722 O O   . HOH F 3 .   ? 11.904 -16.296 -0.435  1.00 48.19  ? 2015 HOH B O   1 
HETATM 5723 O O   . HOH F 3 .   ? 18.240 1.826   20.411  1.00 38.49  ? 2016 HOH B O   1 
HETATM 5724 O O   . HOH F 3 .   ? 10.316 -24.995 -2.475  1.00 76.81  ? 2017 HOH B O   1 
HETATM 5725 O O   . HOH F 3 .   ? 1.821  -16.444 10.411  1.00 62.21  ? 2018 HOH B O   1 
HETATM 5726 O O   . HOH F 3 .   ? 10.126 -27.346 14.525  1.00 59.42  ? 2019 HOH B O   1 
HETATM 5727 O O   . HOH F 3 .   ? 18.313 -19.098 -0.768  1.00 43.88  ? 2020 HOH B O   1 
HETATM 5728 O O   . HOH F 3 .   ? 38.195 16.097  15.019  1.00 52.94  ? 2021 HOH B O   1 
HETATM 5729 O O   . HOH F 3 .   ? 28.346 8.105   -9.908  1.00 38.05  ? 2022 HOH B O   1 
HETATM 5730 O O   . HOH F 3 .   ? 37.563 -16.687 -5.350  1.00 47.72  ? 2023 HOH B O   1 
HETATM 5731 O O   . HOH F 3 .   ? 37.037 -16.888 -0.942  1.00 49.24  ? 2024 HOH B O   1 
HETATM 5732 O O   . HOH F 3 .   ? 39.421 -0.566  -7.941  1.00 36.71  ? 2025 HOH B O   1 
HETATM 5733 O O   . HOH F 3 .   ? 36.194 -0.988  -10.636 1.00 48.29  ? 2026 HOH B O   1 
HETATM 5734 O O   . HOH F 3 .   ? 36.421 -14.920 0.567   1.00 53.63  ? 2027 HOH B O   1 
HETATM 5735 O O   . HOH F 3 .   ? 24.800 -12.855 -7.821  1.00 33.51  ? 2028 HOH B O   1 
HETATM 5736 O O   . HOH F 3 .   ? 23.795 -10.074 -8.514  1.00 31.67  ? 2029 HOH B O   1 
HETATM 5737 O O   . HOH F 3 .   ? 15.866 2.945   -2.264  1.00 33.42  ? 2030 HOH B O   1 
HETATM 5738 O O   . HOH F 3 .   ? 5.347  -0.957  -4.686  1.00 50.55  ? 2031 HOH B O   1 
HETATM 5739 O O   . HOH F 3 .   ? 6.384  -0.933  -8.419  1.00 67.08  ? 2032 HOH B O   1 
HETATM 5740 O O   . HOH F 3 .   ? 19.597 -9.391  12.766  1.00 72.17  ? 2033 HOH B O   1 
HETATM 5741 O O   . HOH F 3 .   ? 16.593 -8.082  12.336  1.00 40.95  ? 2034 HOH B O   1 
HETATM 5742 O O   . HOH F 3 .   ? 29.881 -17.735 -9.201  1.00 40.85  ? 2035 HOH B O   1 
HETATM 5743 O O   . HOH F 3 .   ? 15.156 -7.372  8.944   1.00 28.21  ? 2036 HOH B O   1 
HETATM 5744 O O   . HOH F 3 .   ? 16.552 -4.186  14.342  1.00 37.09  ? 2037 HOH B O   1 
HETATM 5745 O O   . HOH F 3 .   ? 9.269  -8.162  9.221   1.00 36.49  ? 2038 HOH B O   1 
HETATM 5746 O O   . HOH F 3 .   ? 4.903  3.134   7.239   1.00 51.32  ? 2039 HOH B O   1 
HETATM 5747 O O   . HOH F 3 .   ? 2.784  1.414   9.484   1.00 49.05  ? 2040 HOH B O   1 
HETATM 5748 O O   . HOH F 3 .   ? 2.832  1.995   11.903  1.00 45.00  ? 2041 HOH B O   1 
HETATM 5749 O O   . HOH F 3 .   ? 19.237 0.406   17.798  1.00 49.22  ? 2042 HOH B O   1 
HETATM 5750 O O   . HOH F 3 .   ? 30.291 1.739   11.604  1.00 30.47  ? 2043 HOH B O   1 
HETATM 5751 O O   . HOH F 3 .   ? 29.294 -5.970  13.364  1.00 38.58  ? 2044 HOH B O   1 
HETATM 5752 O O   . HOH F 3 .   ? 21.792 4.371   18.477  1.00 33.71  ? 2045 HOH B O   1 
HETATM 5753 O O   . HOH F 3 .   ? 20.236 2.953   9.384   1.00 29.28  ? 2046 HOH B O   1 
HETATM 5754 O O   . HOH F 3 .   ? 15.514 9.684   2.218   1.00 50.80  ? 2047 HOH B O   1 
HETATM 5755 O O   . HOH F 3 .   ? 14.612 7.336   -0.135  1.00 47.21  ? 2048 HOH B O   1 
HETATM 5756 O O   . HOH F 3 .   ? 19.791 -1.140  8.184   1.00 36.27  ? 2049 HOH B O   1 
HETATM 5757 O O   . HOH F 3 .   ? 31.202 -0.017  9.744   1.00 36.94  ? 2050 HOH B O   1 
HETATM 5758 O O   . HOH F 3 .   ? 35.567 -5.636  11.112  1.00 44.73  ? 2051 HOH B O   1 
HETATM 5759 O O   . HOH F 3 .   ? 39.623 -3.987  1.722   1.00 49.20  ? 2052 HOH B O   1 
HETATM 5760 O O   . HOH F 3 .   ? 36.272 6.769   11.911  1.00 47.36  ? 2053 HOH B O   1 
HETATM 5761 O O   . HOH F 3 .   ? 23.011 2.024   22.197  1.00 47.76  ? 2054 HOH B O   1 
HETATM 5762 O O   . HOH F 3 .   ? 28.545 8.098   26.512  1.00 39.89  ? 2055 HOH B O   1 
HETATM 5763 O O   . HOH F 3 .   ? 21.637 5.618   20.601  1.00 32.04  ? 2056 HOH B O   1 
HETATM 5764 O O   . HOH F 3 .   ? 31.739 7.582   26.428  1.00 70.15  ? 2057 HOH B O   1 
HETATM 5765 O O   . HOH F 3 .   ? 23.619 2.849   19.169  1.00 64.15  ? 2058 HOH B O   1 
HETATM 5766 O O   . HOH F 3 .   ? 35.298 8.702   13.205  1.00 42.18  ? 2059 HOH B O   1 
HETATM 5767 O O   . HOH F 3 .   ? 12.838 19.553  2.807   1.00 59.28  ? 2060 HOH B O   1 
HETATM 5768 O O   . HOH F 3 .   ? 13.962 11.159  19.999  1.00 51.17  ? 2061 HOH B O   1 
HETATM 5769 O O   . HOH F 3 .   ? 37.917 15.904  11.918  1.00 63.02  ? 2062 HOH B O   1 
HETATM 5770 O O   . HOH F 3 .   ? 47.968 1.765   1.564   1.00 55.58  ? 2063 HOH B O   1 
HETATM 5771 O O   . HOH F 3 .   ? 28.650 9.463   -7.464  1.00 54.44  ? 2064 HOH B O   1 
HETATM 5772 O O   . HOH F 3 .   ? 24.446 10.867  -9.314  1.00 52.33  ? 2065 HOH B O   1 
HETATM 5773 O O   . HOH F 3 .   ? 26.461 14.790  4.359   1.00 49.25  ? 2066 HOH B O   1 
HETATM 5774 O O   . HOH F 3 .   ? 18.347 8.974   -0.756  1.00 40.21  ? 2067 HOH B O   1 
HETATM 5775 O O   . HOH F 3 .   ? 16.951 2.101   -5.742  1.00 32.63  ? 2068 HOH B O   1 
HETATM 5776 O O   . HOH F 3 .   ? 21.340 10.906  -5.509  1.00 64.22  ? 2069 HOH B O   1 
HETATM 5777 O O   . HOH F 3 .   ? 25.866 6.193   -10.320 1.00 44.72  ? 2070 HOH B O   1 
HETATM 5778 O O   . HOH F 3 .   ? 30.671 6.961   -10.447 1.00 47.94  ? 2071 HOH B O   1 
HETATM 5779 O O   . HOH F 3 .   ? 39.804 -7.559  -14.279 1.00 45.63  ? 2072 HOH B O   1 
HETATM 5780 O O   . HOH F 3 .   ? 36.669 -24.277 -7.548  1.00 58.21  ? 2073 HOH B O   1 
HETATM 5781 O O   . HOH F 3 .   ? 33.111 -14.062 -14.703 1.00 65.74  ? 2074 HOH B O   1 
HETATM 5782 O O   . HOH F 3 .   ? 24.869 -16.773 -10.185 1.00 33.01  ? 2075 HOH B O   1 
HETATM 5783 O O   . HOH F 3 .   ? 11.961 -0.587  -14.634 1.00 37.47  ? 2076 HOH B O   1 
HETATM 5784 O O   . HOH F 3 .   ? 19.769 8.609   -14.055 1.00 55.25  ? 2077 HOH B O   1 
HETATM 5785 O O   . HOH F 3 .   ? 26.340 -3.684  -13.515 1.00 29.63  ? 2078 HOH B O   1 
HETATM 5786 O O   . HOH F 3 .   ? 31.410 -9.361  -17.040 1.00 43.51  ? 2079 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   35  35  SER SER A . n 
A 1 2   LYS 2   36  36  LYS LYS A . n 
A 1 3   VAL 3   37  37  VAL VAL A . n 
A 1 4   THR 4   38  38  THR THR A . n 
A 1 5   THR 5   39  39  THR THR A . n 
A 1 6   VAL 6   40  40  VAL VAL A . n 
A 1 7   VAL 7   41  41  VAL VAL A . n 
A 1 8   ALA 8   42  42  ALA ALA A . n 
A 1 9   THR 9   43  43  THR THR A . n 
A 1 10  PRO 10  44  44  PRO PRO A . n 
A 1 11  GLY 11  45  45  GLY GLY A . n 
A 1 12  GLN 12  46  46  GLN GLN A . n 
A 1 13  GLY 13  47  47  GLY GLY A . n 
A 1 14  PRO 14  48  48  PRO PRO A . n 
A 1 15  ASP 15  49  49  ASP ASP A . n 
A 1 16  ARG 16  50  50  ARG ARG A . n 
A 1 17  PRO 17  51  51  PRO PRO A . n 
A 1 18  GLN 18  52  52  GLN GLN A . n 
A 1 19  GLU 19  53  53  GLU GLU A . n 
A 1 20  VAL 20  54  54  VAL VAL A . n 
A 1 21  SER 21  55  55  SER SER A . n 
A 1 22  TYR 22  56  56  TYR TYR A . n 
A 1 23  THR 23  57  57  THR THR A . n 
A 1 24  ASP 24  58  58  ASP ASP A . n 
A 1 25  THR 25  59  59  THR THR A . n 
A 1 26  LYS 26  60  60  LYS LYS A . n 
A 1 27  VAL 27  61  61  VAL VAL A . n 
A 1 28  ILE 28  62  62  ILE ILE A . n 
A 1 29  GLY 29  63  63  GLY GLY A . n 
A 1 30  ASN 30  64  64  ASN ASN A . n 
A 1 31  GLY 31  65  65  GLY GLY A . n 
A 1 32  SER 32  66  66  SER SER A . n 
A 1 33  PHE 33  67  67  PHE PHE A . n 
A 1 34  GLY 34  68  68  GLY GLY A . n 
A 1 35  VAL 35  69  69  VAL VAL A . n 
A 1 36  VAL 36  70  70  VAL VAL A . n 
A 1 37  TYR 37  71  71  TYR TYR A . n 
A 1 38  GLN 38  72  72  GLN GLN A . n 
A 1 39  ALA 39  73  73  ALA ALA A . n 
A 1 40  LYS 40  74  74  LYS LYS A . n 
A 1 41  LEU 41  75  75  LEU LEU A . n 
A 1 42  CYS 42  76  76  CYS CYS A . n 
A 1 43  ASP 43  77  77  ASP ASP A . n 
A 1 44  SER 44  78  78  SER SER A . n 
A 1 45  GLY 45  79  79  GLY GLY A . n 
A 1 46  GLU 46  80  80  GLU GLU A . n 
A 1 47  LEU 47  81  81  LEU LEU A . n 
A 1 48  VAL 48  82  82  VAL VAL A . n 
A 1 49  ALA 49  83  83  ALA ALA A . n 
A 1 50  ILE 50  84  84  ILE ILE A . n 
A 1 51  LYS 51  85  85  LYS LYS A . n 
A 1 52  LYS 52  86  86  LYS LYS A . n 
A 1 53  VAL 53  87  87  VAL VAL A . n 
A 1 54  LEU 54  88  88  LEU LEU A . n 
A 1 55  GLN 55  89  89  GLN GLN A . n 
A 1 56  GLY 56  90  90  GLY GLY A . n 
A 1 57  LYS 57  91  91  LYS LYS A . n 
A 1 58  ALA 58  92  92  ALA ALA A . n 
A 1 59  PHE 59  93  93  PHE PHE A . n 
A 1 60  LYS 60  94  94  LYS LYS A . n 
A 1 61  ASN 61  95  95  ASN ASN A . n 
A 1 62  ARG 62  96  96  ARG ARG A . n 
A 1 63  GLU 63  97  97  GLU GLU A . n 
A 1 64  LEU 64  98  98  LEU LEU A . n 
A 1 65  GLN 65  99  99  GLN GLN A . n 
A 1 66  ILE 66  100 100 ILE ILE A . n 
A 1 67  MET 67  101 101 MET MET A . n 
A 1 68  ARG 68  102 102 ARG ARG A . n 
A 1 69  LYS 69  103 103 LYS LYS A . n 
A 1 70  LEU 70  104 104 LEU LEU A . n 
A 1 71  ASP 71  105 105 ASP ASP A . n 
A 1 72  HIS 72  106 106 HIS HIS A . n 
A 1 73  CYS 73  107 107 CYS CYS A . n 
A 1 74  ASN 74  108 108 ASN ASN A . n 
A 1 75  ILE 75  109 109 ILE ILE A . n 
A 1 76  VAL 76  110 110 VAL VAL A . n 
A 1 77  ARG 77  111 111 ARG ARG A . n 
A 1 78  LEU 78  112 112 LEU LEU A . n 
A 1 79  ARG 79  113 113 ARG ARG A . n 
A 1 80  TYR 80  114 114 TYR TYR A . n 
A 1 81  PHE 81  115 115 PHE PHE A . n 
A 1 82  PHE 82  116 116 PHE PHE A . n 
A 1 83  TYR 83  117 117 TYR TYR A . n 
A 1 84  SER 84  118 118 SER SER A . n 
A 1 85  SER 85  119 119 SER SER A . n 
A 1 86  GLY 86  120 120 GLY GLY A . n 
A 1 87  GLU 87  121 121 GLU GLU A . n 
A 1 88  LYS 88  122 122 LYS LYS A . n 
A 1 89  LYS 89  123 123 LYS LYS A . n 
A 1 90  ASP 90  124 124 ASP ASP A . n 
A 1 91  GLU 91  125 125 GLU GLU A . n 
A 1 92  VAL 92  126 126 VAL VAL A . n 
A 1 93  TYR 93  127 127 TYR TYR A . n 
A 1 94  LEU 94  128 128 LEU LEU A . n 
A 1 95  ASN 95  129 129 ASN ASN A . n 
A 1 96  LEU 96  130 130 LEU LEU A . n 
A 1 97  VAL 97  131 131 VAL VAL A . n 
A 1 98  LEU 98  132 132 LEU LEU A . n 
A 1 99  ASP 99  133 133 ASP ASP A . n 
A 1 100 TYR 100 134 134 TYR TYR A . n 
A 1 101 VAL 101 135 135 VAL VAL A . n 
A 1 102 PRO 102 136 136 PRO PRO A . n 
A 1 103 GLU 103 137 137 GLU GLU A . n 
A 1 104 THR 104 138 138 THR THR A . n 
A 1 105 VAL 105 139 139 VAL VAL A . n 
A 1 106 TYR 106 140 140 TYR TYR A . n 
A 1 107 ARG 107 141 141 ARG ARG A . n 
A 1 108 VAL 108 142 142 VAL VAL A . n 
A 1 109 ALA 109 143 143 ALA ALA A . n 
A 1 110 ARG 110 144 144 ARG ARG A . n 
A 1 111 HIS 111 145 145 HIS HIS A . n 
A 1 112 TYR 112 146 146 TYR TYR A . n 
A 1 113 SER 113 147 147 SER SER A . n 
A 1 114 ARG 114 148 148 ARG ARG A . n 
A 1 115 ALA 115 149 149 ALA ALA A . n 
A 1 116 LYS 116 150 150 LYS LYS A . n 
A 1 117 GLN 117 151 151 GLN GLN A . n 
A 1 118 THR 118 152 152 THR THR A . n 
A 1 119 LEU 119 153 153 LEU LEU A . n 
A 1 120 PRO 120 154 154 PRO PRO A . n 
A 1 121 VAL 121 155 155 VAL VAL A . n 
A 1 122 ILE 122 156 156 ILE ILE A . n 
A 1 123 TYR 123 157 157 TYR TYR A . n 
A 1 124 VAL 124 158 158 VAL VAL A . n 
A 1 125 LYS 125 159 159 LYS LYS A . n 
A 1 126 LEU 126 160 160 LEU LEU A . n 
A 1 127 TYR 127 161 161 TYR TYR A . n 
A 1 128 MET 128 162 162 MET MET A . n 
A 1 129 TYR 129 163 163 TYR TYR A . n 
A 1 130 GLN 130 164 164 GLN GLN A . n 
A 1 131 LEU 131 165 165 LEU LEU A . n 
A 1 132 PHE 132 166 166 PHE PHE A . n 
A 1 133 ARG 133 167 167 ARG ARG A . n 
A 1 134 SER 134 168 168 SER SER A . n 
A 1 135 LEU 135 169 169 LEU LEU A . n 
A 1 136 ALA 136 170 170 ALA ALA A . n 
A 1 137 TYR 137 171 171 TYR TYR A . n 
A 1 138 ILE 138 172 172 ILE ILE A . n 
A 1 139 HIS 139 173 173 HIS HIS A . n 
A 1 140 SER 140 174 174 SER SER A . n 
A 1 141 PHE 141 175 175 PHE PHE A . n 
A 1 142 GLY 142 176 176 GLY GLY A . n 
A 1 143 ILE 143 177 177 ILE ILE A . n 
A 1 144 CYS 144 178 178 CYS CYS A . n 
A 1 145 HIS 145 179 179 HIS HIS A . n 
A 1 146 ARG 146 180 180 ARG ARG A . n 
A 1 147 ASP 147 181 181 ASP ASP A . n 
A 1 148 ILE 148 182 182 ILE ILE A . n 
A 1 149 LYS 149 183 183 LYS LYS A . n 
A 1 150 PRO 150 184 184 PRO PRO A . n 
A 1 151 GLN 151 185 185 GLN GLN A . n 
A 1 152 ASN 152 186 186 ASN ASN A . n 
A 1 153 LEU 153 187 187 LEU LEU A . n 
A 1 154 LEU 154 188 188 LEU LEU A . n 
A 1 155 LEU 155 189 189 LEU LEU A . n 
A 1 156 ASP 156 190 190 ASP ASP A . n 
A 1 157 PRO 157 191 191 PRO PRO A . n 
A 1 158 ASP 158 192 192 ASP ASP A . n 
A 1 159 THR 159 193 193 THR THR A . n 
A 1 160 ALA 160 194 194 ALA ALA A . n 
A 1 161 VAL 161 195 195 VAL VAL A . n 
A 1 162 LEU 162 196 196 LEU LEU A . n 
A 1 163 LYS 163 197 197 LYS LYS A . n 
A 1 164 LEU 164 198 198 LEU LEU A . n 
A 1 165 CYS 165 199 199 CYS CYS A . n 
A 1 166 ASP 166 200 200 ASP ASP A . n 
A 1 167 PHE 167 201 201 PHE PHE A . n 
A 1 168 GLY 168 202 202 GLY GLY A . n 
A 1 169 SER 169 203 203 SER SER A . n 
A 1 170 ALA 170 204 204 ALA ALA A . n 
A 1 171 LYS 171 205 205 LYS LYS A . n 
A 1 172 GLN 172 206 206 GLN GLN A . n 
A 1 173 LEU 173 207 207 LEU LEU A . n 
A 1 174 VAL 174 208 208 VAL VAL A . n 
A 1 175 ARG 175 209 209 ARG ARG A . n 
A 1 176 GLY 176 210 210 GLY GLY A . n 
A 1 177 GLU 177 211 211 GLU GLU A . n 
A 1 178 PRO 178 212 212 PRO PRO A . n 
A 1 179 ASN 179 213 213 ASN ASN A . n 
A 1 180 VAL 180 214 214 VAL VAL A . n 
A 1 181 SER 181 215 215 SER SER A . n 
A 1 182 TYR 182 216 216 TYR TYR A . n 
A 1 183 ILE 183 217 217 ILE ILE A . n 
A 1 184 CYS 184 218 218 CYS CYS A . n 
A 1 185 SER 185 219 219 SER SER A . n 
A 1 186 ARG 186 220 220 ARG ARG A . n 
A 1 187 TYR 187 221 221 TYR TYR A . n 
A 1 188 TYR 188 222 222 TYR TYR A . n 
A 1 189 ARG 189 223 223 ARG ARG A . n 
A 1 190 ALA 190 224 224 ALA ALA A . n 
A 1 191 PRO 191 225 225 PRO PRO A . n 
A 1 192 GLU 192 226 226 GLU GLU A . n 
A 1 193 LEU 193 227 227 LEU LEU A . n 
A 1 194 ILE 194 228 228 ILE ILE A . n 
A 1 195 PHE 195 229 229 PHE PHE A . n 
A 1 196 GLY 196 230 230 GLY GLY A . n 
A 1 197 ALA 197 231 231 ALA ALA A . n 
A 1 198 THR 198 232 232 THR THR A . n 
A 1 199 ASP 199 233 233 ASP ASP A . n 
A 1 200 TYR 200 234 234 TYR TYR A . n 
A 1 201 THR 201 235 235 THR THR A . n 
A 1 202 SER 202 236 236 SER SER A . n 
A 1 203 SER 203 237 237 SER SER A . n 
A 1 204 ILE 204 238 238 ILE ILE A . n 
A 1 205 ASP 205 239 239 ASP ASP A . n 
A 1 206 VAL 206 240 240 VAL VAL A . n 
A 1 207 TRP 207 241 241 TRP TRP A . n 
A 1 208 SER 208 242 242 SER SER A . n 
A 1 209 ALA 209 243 243 ALA ALA A . n 
A 1 210 GLY 210 244 244 GLY GLY A . n 
A 1 211 CYS 211 245 245 CYS CYS A . n 
A 1 212 VAL 212 246 246 VAL VAL A . n 
A 1 213 LEU 213 247 247 LEU LEU A . n 
A 1 214 ALA 214 248 248 ALA ALA A . n 
A 1 215 GLU 215 249 249 GLU GLU A . n 
A 1 216 LEU 216 250 250 LEU LEU A . n 
A 1 217 LEU 217 251 251 LEU LEU A . n 
A 1 218 LEU 218 252 252 LEU LEU A . n 
A 1 219 GLY 219 253 253 GLY GLY A . n 
A 1 220 GLN 220 254 254 GLN GLN A . n 
A 1 221 PRO 221 255 255 PRO PRO A . n 
A 1 222 ILE 222 256 256 ILE ILE A . n 
A 1 223 PHE 223 257 257 PHE PHE A . n 
A 1 224 PRO 224 258 258 PRO PRO A . n 
A 1 225 GLY 225 259 259 GLY GLY A . n 
A 1 226 ASP 226 260 260 ASP ASP A . n 
A 1 227 SER 227 261 261 SER SER A . n 
A 1 228 GLY 228 262 262 GLY GLY A . n 
A 1 229 VAL 229 263 263 VAL VAL A . n 
A 1 230 ASP 230 264 264 ASP ASP A . n 
A 1 231 GLN 231 265 265 GLN GLN A . n 
A 1 232 LEU 232 266 266 LEU LEU A . n 
A 1 233 VAL 233 267 267 VAL VAL A . n 
A 1 234 GLU 234 268 268 GLU GLU A . n 
A 1 235 ILE 235 269 269 ILE ILE A . n 
A 1 236 ILE 236 270 270 ILE ILE A . n 
A 1 237 LYS 237 271 271 LYS LYS A . n 
A 1 238 VAL 238 272 272 VAL VAL A . n 
A 1 239 LEU 239 273 273 LEU LEU A . n 
A 1 240 GLY 240 274 274 GLY GLY A . n 
A 1 241 THR 241 275 275 THR THR A . n 
A 1 242 PRO 242 276 276 PRO PRO A . n 
A 1 243 THR 243 277 277 THR THR A . n 
A 1 244 ARG 244 278 278 ARG ARG A . n 
A 1 245 GLU 245 279 279 GLU GLU A . n 
A 1 246 GLN 246 280 280 GLN GLN A . n 
A 1 247 ILE 247 281 281 ILE ILE A . n 
A 1 248 ARG 248 282 282 ARG ARG A . n 
A 1 249 GLU 249 283 283 GLU GLU A . n 
A 1 250 MET 250 284 284 MET MET A . n 
A 1 251 ASN 251 285 285 ASN ASN A . n 
A 1 252 PRO 252 286 286 PRO PRO A . n 
A 1 253 ASN 253 287 287 ASN ASN A . n 
A 1 254 TYR 254 288 288 TYR TYR A . n 
A 1 255 THR 255 289 289 THR THR A . n 
A 1 256 GLU 256 290 290 GLU GLU A . n 
A 1 257 PHE 257 291 291 PHE PHE A . n 
A 1 258 ALA 258 292 292 ALA ALA A . n 
A 1 259 PHE 259 293 293 PHE PHE A . n 
A 1 260 PRO 260 294 294 PRO PRO A . n 
A 1 261 GLN 261 295 295 GLN GLN A . n 
A 1 262 ILE 262 296 296 ILE ILE A . n 
A 1 263 LYS 263 297 297 LYS LYS A . n 
A 1 264 ALA 264 298 298 ALA ALA A . n 
A 1 265 HIS 265 299 299 HIS HIS A . n 
A 1 266 PRO 266 300 300 PRO PRO A . n 
A 1 267 TRP 267 301 301 TRP TRP A . n 
A 1 268 THR 268 302 302 THR THR A . n 
A 1 269 LYS 269 303 303 LYS LYS A . n 
A 1 270 VAL 270 304 304 VAL VAL A . n 
A 1 271 PHE 271 305 305 PHE PHE A . n 
A 1 272 ARG 272 306 306 ARG ARG A . n 
A 1 273 PRO 273 307 307 PRO PRO A . n 
A 1 274 ARG 274 308 308 ARG ARG A . n 
A 1 275 THR 275 309 309 THR THR A . n 
A 1 276 PRO 276 310 310 PRO PRO A . n 
A 1 277 PRO 277 311 311 PRO PRO A . n 
A 1 278 GLU 278 312 312 GLU GLU A . n 
A 1 279 ALA 279 313 313 ALA ALA A . n 
A 1 280 ILE 280 314 314 ILE ILE A . n 
A 1 281 ALA 281 315 315 ALA ALA A . n 
A 1 282 LEU 282 316 316 LEU LEU A . n 
A 1 283 CYS 283 317 317 CYS CYS A . n 
A 1 284 SER 284 318 318 SER SER A . n 
A 1 285 ARG 285 319 319 ARG ARG A . n 
A 1 286 LEU 286 320 320 LEU LEU A . n 
A 1 287 LEU 287 321 321 LEU LEU A . n 
A 1 288 GLU 288 322 322 GLU GLU A . n 
A 1 289 TYR 289 323 323 TYR TYR A . n 
A 1 290 THR 290 324 324 THR THR A . n 
A 1 291 PRO 291 325 325 PRO PRO A . n 
A 1 292 THR 292 326 326 THR THR A . n 
A 1 293 ALA 293 327 327 ALA ALA A . n 
A 1 294 ARG 294 328 328 ARG ARG A . n 
A 1 295 LEU 295 329 329 LEU LEU A . n 
A 1 296 THR 296 330 330 THR THR A . n 
A 1 297 PRO 297 331 331 PRO PRO A . n 
A 1 298 LEU 298 332 332 LEU LEU A . n 
A 1 299 GLU 299 333 333 GLU GLU A . n 
A 1 300 ALA 300 334 334 ALA ALA A . n 
A 1 301 CYS 301 335 335 CYS CYS A . n 
A 1 302 ALA 302 336 336 ALA ALA A . n 
A 1 303 HIS 303 337 337 HIS HIS A . n 
A 1 304 SER 304 338 338 SER SER A . n 
A 1 305 PHE 305 339 339 PHE PHE A . n 
A 1 306 PHE 306 340 340 PHE PHE A . n 
A 1 307 ASP 307 341 341 ASP ASP A . n 
A 1 308 GLU 308 342 342 GLU GLU A . n 
A 1 309 LEU 309 343 343 LEU LEU A . n 
A 1 310 ARG 310 344 344 ARG ARG A . n 
A 1 311 ASP 311 345 345 ASP ASP A . n 
A 1 312 PRO 312 346 346 PRO PRO A . n 
A 1 313 ASN 313 347 347 ASN ASN A . n 
A 1 314 VAL 314 348 348 VAL VAL A . n 
A 1 315 LYS 315 349 349 LYS LYS A . n 
A 1 316 LEU 316 350 350 LEU LEU A . n 
A 1 317 PRO 317 351 351 PRO PRO A . n 
A 1 318 ASN 318 352 352 ASN ASN A . n 
A 1 319 GLY 319 353 353 GLY GLY A . n 
A 1 320 ARG 320 354 354 ARG ARG A . n 
A 1 321 ASP 321 355 355 ASP ASP A . n 
A 1 322 THR 322 356 356 THR THR A . n 
A 1 323 PRO 323 357 357 PRO PRO A . n 
A 1 324 ALA 324 358 358 ALA ALA A . n 
A 1 325 LEU 325 359 359 LEU LEU A . n 
A 1 326 PHE 326 360 360 PHE PHE A . n 
A 1 327 ASN 327 361 361 ASN ASN A . n 
A 1 328 PHE 328 362 362 PHE PHE A . n 
A 1 329 THR 329 363 363 THR THR A . n 
A 1 330 THR 330 364 364 THR THR A . n 
A 1 331 GLN 331 365 365 GLN GLN A . n 
A 1 332 GLU 332 366 366 GLU GLU A . n 
A 1 333 LEU 333 367 367 LEU LEU A . n 
A 1 334 SER 334 368 368 SER SER A . n 
A 1 335 SER 335 369 369 SER SER A . n 
A 1 336 ASN 336 370 370 ASN ASN A . n 
A 1 337 PRO 337 371 371 PRO PRO A . n 
A 1 338 PRO 338 372 372 PRO PRO A . n 
A 1 339 LEU 339 373 373 LEU LEU A . n 
A 1 340 ALA 340 374 374 ALA ALA A . n 
A 1 341 THR 341 375 375 THR THR A . n 
A 1 342 ILE 342 376 376 ILE ILE A . n 
A 1 343 LEU 343 377 377 LEU LEU A . n 
A 1 344 ILE 344 378 378 ILE ILE A . n 
A 1 345 PRO 345 379 379 PRO PRO A . n 
A 1 346 PRO 346 380 380 PRO PRO A . n 
A 1 347 HIS 347 381 381 HIS HIS A . n 
A 1 348 ALA 348 382 382 ALA ALA A . n 
A 1 349 ARG 349 383 383 ARG ARG A . n 
A 1 350 ILE 350 384 384 ILE ILE A . n 
A 1 351 GLN 351 385 385 GLN GLN A . n 
A 1 352 ALA 352 386 386 ALA ALA A . n 
B 1 1   SER 1   35  35  SER SER B . n 
B 1 2   LYS 2   36  36  LYS LYS B . n 
B 1 3   VAL 3   37  37  VAL VAL B . n 
B 1 4   THR 4   38  38  THR THR B . n 
B 1 5   THR 5   39  39  THR THR B . n 
B 1 6   VAL 6   40  40  VAL VAL B . n 
B 1 7   VAL 7   41  41  VAL VAL B . n 
B 1 8   ALA 8   42  42  ALA ALA B . n 
B 1 9   THR 9   43  43  THR THR B . n 
B 1 10  PRO 10  44  44  PRO PRO B . n 
B 1 11  GLY 11  45  45  GLY GLY B . n 
B 1 12  GLN 12  46  46  GLN GLN B . n 
B 1 13  GLY 13  47  47  GLY GLY B . n 
B 1 14  PRO 14  48  48  PRO PRO B . n 
B 1 15  ASP 15  49  49  ASP ASP B . n 
B 1 16  ARG 16  50  50  ARG ARG B . n 
B 1 17  PRO 17  51  51  PRO PRO B . n 
B 1 18  GLN 18  52  52  GLN GLN B . n 
B 1 19  GLU 19  53  53  GLU GLU B . n 
B 1 20  VAL 20  54  54  VAL VAL B . n 
B 1 21  SER 21  55  55  SER SER B . n 
B 1 22  TYR 22  56  56  TYR TYR B . n 
B 1 23  THR 23  57  57  THR THR B . n 
B 1 24  ASP 24  58  58  ASP ASP B . n 
B 1 25  THR 25  59  59  THR THR B . n 
B 1 26  LYS 26  60  60  LYS LYS B . n 
B 1 27  VAL 27  61  61  VAL VAL B . n 
B 1 28  ILE 28  62  62  ILE ILE B . n 
B 1 29  GLY 29  63  63  GLY GLY B . n 
B 1 30  ASN 30  64  64  ASN ASN B . n 
B 1 31  GLY 31  65  65  GLY GLY B . n 
B 1 32  SER 32  66  66  SER SER B . n 
B 1 33  PHE 33  67  67  PHE PHE B . n 
B 1 34  GLY 34  68  68  GLY GLY B . n 
B 1 35  VAL 35  69  69  VAL VAL B . n 
B 1 36  VAL 36  70  70  VAL VAL B . n 
B 1 37  TYR 37  71  71  TYR TYR B . n 
B 1 38  GLN 38  72  72  GLN GLN B . n 
B 1 39  ALA 39  73  73  ALA ALA B . n 
B 1 40  LYS 40  74  74  LYS LYS B . n 
B 1 41  LEU 41  75  75  LEU LEU B . n 
B 1 42  CYS 42  76  76  CYS CYS B . n 
B 1 43  ASP 43  77  77  ASP ASP B . n 
B 1 44  SER 44  78  78  SER SER B . n 
B 1 45  GLY 45  79  79  GLY GLY B . n 
B 1 46  GLU 46  80  80  GLU GLU B . n 
B 1 47  LEU 47  81  81  LEU LEU B . n 
B 1 48  VAL 48  82  82  VAL VAL B . n 
B 1 49  ALA 49  83  83  ALA ALA B . n 
B 1 50  ILE 50  84  84  ILE ILE B . n 
B 1 51  LYS 51  85  85  LYS LYS B . n 
B 1 52  LYS 52  86  86  LYS LYS B . n 
B 1 53  VAL 53  87  87  VAL VAL B . n 
B 1 54  LEU 54  88  88  LEU LEU B . n 
B 1 55  GLN 55  89  89  GLN GLN B . n 
B 1 56  GLY 56  90  90  GLY GLY B . n 
B 1 57  LYS 57  91  91  LYS LYS B . n 
B 1 58  ALA 58  92  92  ALA ALA B . n 
B 1 59  PHE 59  93  93  PHE PHE B . n 
B 1 60  LYS 60  94  94  LYS LYS B . n 
B 1 61  ASN 61  95  95  ASN ASN B . n 
B 1 62  ARG 62  96  96  ARG ARG B . n 
B 1 63  GLU 63  97  97  GLU GLU B . n 
B 1 64  LEU 64  98  98  LEU LEU B . n 
B 1 65  GLN 65  99  99  GLN GLN B . n 
B 1 66  ILE 66  100 100 ILE ILE B . n 
B 1 67  MET 67  101 101 MET MET B . n 
B 1 68  ARG 68  102 102 ARG ARG B . n 
B 1 69  LYS 69  103 103 LYS LYS B . n 
B 1 70  LEU 70  104 104 LEU LEU B . n 
B 1 71  ASP 71  105 105 ASP ASP B . n 
B 1 72  HIS 72  106 106 HIS HIS B . n 
B 1 73  CYS 73  107 107 CYS CYS B . n 
B 1 74  ASN 74  108 108 ASN ASN B . n 
B 1 75  ILE 75  109 109 ILE ILE B . n 
B 1 76  VAL 76  110 110 VAL VAL B . n 
B 1 77  ARG 77  111 111 ARG ARG B . n 
B 1 78  LEU 78  112 112 LEU LEU B . n 
B 1 79  ARG 79  113 113 ARG ARG B . n 
B 1 80  TYR 80  114 114 TYR TYR B . n 
B 1 81  PHE 81  115 115 PHE PHE B . n 
B 1 82  PHE 82  116 116 PHE PHE B . n 
B 1 83  TYR 83  117 117 TYR TYR B . n 
B 1 84  SER 84  118 118 SER SER B . n 
B 1 85  SER 85  119 119 SER SER B . n 
B 1 86  GLY 86  120 120 GLY GLY B . n 
B 1 87  GLU 87  121 121 GLU GLU B . n 
B 1 88  LYS 88  122 122 LYS LYS B . n 
B 1 89  LYS 89  123 123 LYS LYS B . n 
B 1 90  ASP 90  124 124 ASP ASP B . n 
B 1 91  GLU 91  125 125 GLU GLU B . n 
B 1 92  VAL 92  126 126 VAL VAL B . n 
B 1 93  TYR 93  127 127 TYR TYR B . n 
B 1 94  LEU 94  128 128 LEU LEU B . n 
B 1 95  ASN 95  129 129 ASN ASN B . n 
B 1 96  LEU 96  130 130 LEU LEU B . n 
B 1 97  VAL 97  131 131 VAL VAL B . n 
B 1 98  LEU 98  132 132 LEU LEU B . n 
B 1 99  ASP 99  133 133 ASP ASP B . n 
B 1 100 TYR 100 134 134 TYR TYR B . n 
B 1 101 VAL 101 135 135 VAL VAL B . n 
B 1 102 PRO 102 136 136 PRO PRO B . n 
B 1 103 GLU 103 137 137 GLU GLU B . n 
B 1 104 THR 104 138 138 THR THR B . n 
B 1 105 VAL 105 139 139 VAL VAL B . n 
B 1 106 TYR 106 140 140 TYR TYR B . n 
B 1 107 ARG 107 141 141 ARG ARG B . n 
B 1 108 VAL 108 142 142 VAL VAL B . n 
B 1 109 ALA 109 143 143 ALA ALA B . n 
B 1 110 ARG 110 144 144 ARG ARG B . n 
B 1 111 HIS 111 145 145 HIS HIS B . n 
B 1 112 TYR 112 146 146 TYR TYR B . n 
B 1 113 SER 113 147 147 SER SER B . n 
B 1 114 ARG 114 148 148 ARG ARG B . n 
B 1 115 ALA 115 149 149 ALA ALA B . n 
B 1 116 LYS 116 150 150 LYS LYS B . n 
B 1 117 GLN 117 151 151 GLN GLN B . n 
B 1 118 THR 118 152 152 THR THR B . n 
B 1 119 LEU 119 153 153 LEU LEU B . n 
B 1 120 PRO 120 154 154 PRO PRO B . n 
B 1 121 VAL 121 155 155 VAL VAL B . n 
B 1 122 ILE 122 156 156 ILE ILE B . n 
B 1 123 TYR 123 157 157 TYR TYR B . n 
B 1 124 VAL 124 158 158 VAL VAL B . n 
B 1 125 LYS 125 159 159 LYS LYS B . n 
B 1 126 LEU 126 160 160 LEU LEU B . n 
B 1 127 TYR 127 161 161 TYR TYR B . n 
B 1 128 MET 128 162 162 MET MET B . n 
B 1 129 TYR 129 163 163 TYR TYR B . n 
B 1 130 GLN 130 164 164 GLN GLN B . n 
B 1 131 LEU 131 165 165 LEU LEU B . n 
B 1 132 PHE 132 166 166 PHE PHE B . n 
B 1 133 ARG 133 167 167 ARG ARG B . n 
B 1 134 SER 134 168 168 SER SER B . n 
B 1 135 LEU 135 169 169 LEU LEU B . n 
B 1 136 ALA 136 170 170 ALA ALA B . n 
B 1 137 TYR 137 171 171 TYR TYR B . n 
B 1 138 ILE 138 172 172 ILE ILE B . n 
B 1 139 HIS 139 173 173 HIS HIS B . n 
B 1 140 SER 140 174 174 SER SER B . n 
B 1 141 PHE 141 175 175 PHE PHE B . n 
B 1 142 GLY 142 176 176 GLY GLY B . n 
B 1 143 ILE 143 177 177 ILE ILE B . n 
B 1 144 CYS 144 178 178 CYS CYS B . n 
B 1 145 HIS 145 179 179 HIS HIS B . n 
B 1 146 ARG 146 180 180 ARG ARG B . n 
B 1 147 ASP 147 181 181 ASP ASP B . n 
B 1 148 ILE 148 182 182 ILE ILE B . n 
B 1 149 LYS 149 183 183 LYS LYS B . n 
B 1 150 PRO 150 184 184 PRO PRO B . n 
B 1 151 GLN 151 185 185 GLN GLN B . n 
B 1 152 ASN 152 186 186 ASN ASN B . n 
B 1 153 LEU 153 187 187 LEU LEU B . n 
B 1 154 LEU 154 188 188 LEU LEU B . n 
B 1 155 LEU 155 189 189 LEU LEU B . n 
B 1 156 ASP 156 190 190 ASP ASP B . n 
B 1 157 PRO 157 191 191 PRO PRO B . n 
B 1 158 ASP 158 192 192 ASP ASP B . n 
B 1 159 THR 159 193 193 THR THR B . n 
B 1 160 ALA 160 194 194 ALA ALA B . n 
B 1 161 VAL 161 195 195 VAL VAL B . n 
B 1 162 LEU 162 196 196 LEU LEU B . n 
B 1 163 LYS 163 197 197 LYS LYS B . n 
B 1 164 LEU 164 198 198 LEU LEU B . n 
B 1 165 CYS 165 199 199 CYS CYS B . n 
B 1 166 ASP 166 200 200 ASP ASP B . n 
B 1 167 PHE 167 201 201 PHE PHE B . n 
B 1 168 GLY 168 202 202 GLY GLY B . n 
B 1 169 SER 169 203 203 SER SER B . n 
B 1 170 ALA 170 204 204 ALA ALA B . n 
B 1 171 LYS 171 205 205 LYS LYS B . n 
B 1 172 GLN 172 206 206 GLN GLN B . n 
B 1 173 LEU 173 207 207 LEU LEU B . n 
B 1 174 VAL 174 208 208 VAL VAL B . n 
B 1 175 ARG 175 209 209 ARG ARG B . n 
B 1 176 GLY 176 210 210 GLY GLY B . n 
B 1 177 GLU 177 211 211 GLU GLU B . n 
B 1 178 PRO 178 212 212 PRO PRO B . n 
B 1 179 ASN 179 213 213 ASN ASN B . n 
B 1 180 VAL 180 214 214 VAL VAL B . n 
B 1 181 SER 181 215 215 SER SER B . n 
B 1 182 TYR 182 216 216 TYR TYR B . n 
B 1 183 ILE 183 217 217 ILE ILE B . n 
B 1 184 CYS 184 218 218 CYS CYS B . n 
B 1 185 SER 185 219 219 SER SER B . n 
B 1 186 ARG 186 220 220 ARG ARG B . n 
B 1 187 TYR 187 221 221 TYR TYR B . n 
B 1 188 TYR 188 222 222 TYR TYR B . n 
B 1 189 ARG 189 223 223 ARG ARG B . n 
B 1 190 ALA 190 224 224 ALA ALA B . n 
B 1 191 PRO 191 225 225 PRO PRO B . n 
B 1 192 GLU 192 226 226 GLU GLU B . n 
B 1 193 LEU 193 227 227 LEU LEU B . n 
B 1 194 ILE 194 228 228 ILE ILE B . n 
B 1 195 PHE 195 229 229 PHE PHE B . n 
B 1 196 GLY 196 230 230 GLY GLY B . n 
B 1 197 ALA 197 231 231 ALA ALA B . n 
B 1 198 THR 198 232 232 THR THR B . n 
B 1 199 ASP 199 233 233 ASP ASP B . n 
B 1 200 TYR 200 234 234 TYR TYR B . n 
B 1 201 THR 201 235 235 THR THR B . n 
B 1 202 SER 202 236 236 SER SER B . n 
B 1 203 SER 203 237 237 SER SER B . n 
B 1 204 ILE 204 238 238 ILE ILE B . n 
B 1 205 ASP 205 239 239 ASP ASP B . n 
B 1 206 VAL 206 240 240 VAL VAL B . n 
B 1 207 TRP 207 241 241 TRP TRP B . n 
B 1 208 SER 208 242 242 SER SER B . n 
B 1 209 ALA 209 243 243 ALA ALA B . n 
B 1 210 GLY 210 244 244 GLY GLY B . n 
B 1 211 CYS 211 245 245 CYS CYS B . n 
B 1 212 VAL 212 246 246 VAL VAL B . n 
B 1 213 LEU 213 247 247 LEU LEU B . n 
B 1 214 ALA 214 248 248 ALA ALA B . n 
B 1 215 GLU 215 249 249 GLU GLU B . n 
B 1 216 LEU 216 250 250 LEU LEU B . n 
B 1 217 LEU 217 251 251 LEU LEU B . n 
B 1 218 LEU 218 252 252 LEU LEU B . n 
B 1 219 GLY 219 253 253 GLY GLY B . n 
B 1 220 GLN 220 254 254 GLN GLN B . n 
B 1 221 PRO 221 255 255 PRO PRO B . n 
B 1 222 ILE 222 256 256 ILE ILE B . n 
B 1 223 PHE 223 257 257 PHE PHE B . n 
B 1 224 PRO 224 258 258 PRO PRO B . n 
B 1 225 GLY 225 259 259 GLY GLY B . n 
B 1 226 ASP 226 260 260 ASP ASP B . n 
B 1 227 SER 227 261 261 SER SER B . n 
B 1 228 GLY 228 262 262 GLY GLY B . n 
B 1 229 VAL 229 263 263 VAL VAL B . n 
B 1 230 ASP 230 264 264 ASP ASP B . n 
B 1 231 GLN 231 265 265 GLN GLN B . n 
B 1 232 LEU 232 266 266 LEU LEU B . n 
B 1 233 VAL 233 267 267 VAL VAL B . n 
B 1 234 GLU 234 268 268 GLU GLU B . n 
B 1 235 ILE 235 269 269 ILE ILE B . n 
B 1 236 ILE 236 270 270 ILE ILE B . n 
B 1 237 LYS 237 271 271 LYS LYS B . n 
B 1 238 VAL 238 272 272 VAL VAL B . n 
B 1 239 LEU 239 273 273 LEU LEU B . n 
B 1 240 GLY 240 274 274 GLY GLY B . n 
B 1 241 THR 241 275 275 THR THR B . n 
B 1 242 PRO 242 276 276 PRO PRO B . n 
B 1 243 THR 243 277 277 THR THR B . n 
B 1 244 ARG 244 278 278 ARG ARG B . n 
B 1 245 GLU 245 279 279 GLU GLU B . n 
B 1 246 GLN 246 280 280 GLN GLN B . n 
B 1 247 ILE 247 281 281 ILE ILE B . n 
B 1 248 ARG 248 282 282 ARG ARG B . n 
B 1 249 GLU 249 283 283 GLU GLU B . n 
B 1 250 MET 250 284 284 MET MET B . n 
B 1 251 ASN 251 285 285 ASN ASN B . n 
B 1 252 PRO 252 286 286 PRO PRO B . n 
B 1 253 ASN 253 287 287 ASN ASN B . n 
B 1 254 TYR 254 288 288 TYR TYR B . n 
B 1 255 THR 255 289 289 THR THR B . n 
B 1 256 GLU 256 290 290 GLU GLU B . n 
B 1 257 PHE 257 291 291 PHE PHE B . n 
B 1 258 ALA 258 292 292 ALA ALA B . n 
B 1 259 PHE 259 293 293 PHE PHE B . n 
B 1 260 PRO 260 294 294 PRO PRO B . n 
B 1 261 GLN 261 295 295 GLN GLN B . n 
B 1 262 ILE 262 296 296 ILE ILE B . n 
B 1 263 LYS 263 297 297 LYS LYS B . n 
B 1 264 ALA 264 298 298 ALA ALA B . n 
B 1 265 HIS 265 299 299 HIS HIS B . n 
B 1 266 PRO 266 300 300 PRO PRO B . n 
B 1 267 TRP 267 301 301 TRP TRP B . n 
B 1 268 THR 268 302 302 THR THR B . n 
B 1 269 LYS 269 303 303 LYS LYS B . n 
B 1 270 VAL 270 304 304 VAL VAL B . n 
B 1 271 PHE 271 305 305 PHE PHE B . n 
B 1 272 ARG 272 306 306 ARG ARG B . n 
B 1 273 PRO 273 307 307 PRO PRO B . n 
B 1 274 ARG 274 308 308 ARG ARG B . n 
B 1 275 THR 275 309 309 THR THR B . n 
B 1 276 PRO 276 310 310 PRO PRO B . n 
B 1 277 PRO 277 311 311 PRO PRO B . n 
B 1 278 GLU 278 312 312 GLU GLU B . n 
B 1 279 ALA 279 313 313 ALA ALA B . n 
B 1 280 ILE 280 314 314 ILE ILE B . n 
B 1 281 ALA 281 315 315 ALA ALA B . n 
B 1 282 LEU 282 316 316 LEU LEU B . n 
B 1 283 CYS 283 317 317 CYS CYS B . n 
B 1 284 SER 284 318 318 SER SER B . n 
B 1 285 ARG 285 319 319 ARG ARG B . n 
B 1 286 LEU 286 320 320 LEU LEU B . n 
B 1 287 LEU 287 321 321 LEU LEU B . n 
B 1 288 GLU 288 322 322 GLU GLU B . n 
B 1 289 TYR 289 323 323 TYR TYR B . n 
B 1 290 THR 290 324 324 THR THR B . n 
B 1 291 PRO 291 325 325 PRO PRO B . n 
B 1 292 THR 292 326 326 THR THR B . n 
B 1 293 ALA 293 327 327 ALA ALA B . n 
B 1 294 ARG 294 328 328 ARG ARG B . n 
B 1 295 LEU 295 329 329 LEU LEU B . n 
B 1 296 THR 296 330 330 THR THR B . n 
B 1 297 PRO 297 331 331 PRO PRO B . n 
B 1 298 LEU 298 332 332 LEU LEU B . n 
B 1 299 GLU 299 333 333 GLU GLU B . n 
B 1 300 ALA 300 334 334 ALA ALA B . n 
B 1 301 CYS 301 335 335 CYS CYS B . n 
B 1 302 ALA 302 336 336 ALA ALA B . n 
B 1 303 HIS 303 337 337 HIS HIS B . n 
B 1 304 SER 304 338 338 SER SER B . n 
B 1 305 PHE 305 339 339 PHE PHE B . n 
B 1 306 PHE 306 340 340 PHE PHE B . n 
B 1 307 ASP 307 341 341 ASP ASP B . n 
B 1 308 GLU 308 342 342 GLU GLU B . n 
B 1 309 LEU 309 343 343 LEU LEU B . n 
B 1 310 ARG 310 344 344 ARG ARG B . n 
B 1 311 ASP 311 345 345 ASP ASP B . n 
B 1 312 PRO 312 346 346 PRO PRO B . n 
B 1 313 ASN 313 347 347 ASN ASN B . n 
B 1 314 VAL 314 348 348 VAL VAL B . n 
B 1 315 LYS 315 349 349 LYS LYS B . n 
B 1 316 LEU 316 350 350 LEU LEU B . n 
B 1 317 PRO 317 351 351 PRO PRO B . n 
B 1 318 ASN 318 352 352 ASN ASN B . n 
B 1 319 GLY 319 353 353 GLY GLY B . n 
B 1 320 ARG 320 354 354 ARG ARG B . n 
B 1 321 ASP 321 355 355 ASP ASP B . n 
B 1 322 THR 322 356 356 THR THR B . n 
B 1 323 PRO 323 357 357 PRO PRO B . n 
B 1 324 ALA 324 358 358 ALA ALA B . n 
B 1 325 LEU 325 359 359 LEU LEU B . n 
B 1 326 PHE 326 360 360 PHE PHE B . n 
B 1 327 ASN 327 361 361 ASN ASN B . n 
B 1 328 PHE 328 362 362 PHE PHE B . n 
B 1 329 THR 329 363 363 THR THR B . n 
B 1 330 THR 330 364 364 THR THR B . n 
B 1 331 GLN 331 365 365 GLN GLN B . n 
B 1 332 GLU 332 366 366 GLU GLU B . n 
B 1 333 LEU 333 367 367 LEU LEU B . n 
B 1 334 SER 334 368 368 SER SER B . n 
B 1 335 SER 335 369 369 SER SER B . n 
B 1 336 ASN 336 370 370 ASN ASN B . n 
B 1 337 PRO 337 371 371 PRO PRO B . n 
B 1 338 PRO 338 372 372 PRO PRO B . n 
B 1 339 LEU 339 373 373 LEU LEU B . n 
B 1 340 ALA 340 374 374 ALA ALA B . n 
B 1 341 THR 341 375 375 THR THR B . n 
B 1 342 ILE 342 376 376 ILE ILE B . n 
B 1 343 LEU 343 377 377 LEU LEU B . n 
B 1 344 ILE 344 378 378 ILE ILE B . n 
B 1 345 PRO 345 379 379 PRO PRO B . n 
B 1 346 PRO 346 380 380 PRO PRO B . n 
B 1 347 HIS 347 381 381 HIS HIS B . n 
B 1 348 ALA 348 382 382 ALA ALA B . n 
B 1 349 ARG 349 383 383 ARG ARG B . n 
B 1 350 ILE 350 384 384 ILE ILE B . n 
B 1 351 GLN 351 385 ?   ?   ?   B . n 
B 1 352 ALA 352 386 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 EPE 1  400  400  EPE EPE A . 
D 2 EPE 1  400  400  EPE EPE B . 
E 3 HOH 1  2001 2001 HOH HOH A . 
E 3 HOH 2  2002 2002 HOH HOH A . 
E 3 HOH 3  2003 2003 HOH HOH A . 
E 3 HOH 4  2004 2004 HOH HOH A . 
E 3 HOH 5  2005 2005 HOH HOH A . 
E 3 HOH 6  2006 2006 HOH HOH A . 
E 3 HOH 7  2007 2007 HOH HOH A . 
E 3 HOH 8  2008 2008 HOH HOH A . 
E 3 HOH 9  2009 2009 HOH HOH A . 
E 3 HOH 10 2010 2010 HOH HOH A . 
E 3 HOH 11 2011 2011 HOH HOH A . 
E 3 HOH 12 2012 2012 HOH HOH A . 
E 3 HOH 13 2013 2013 HOH HOH A . 
E 3 HOH 14 2014 2014 HOH HOH A . 
E 3 HOH 15 2015 2015 HOH HOH A . 
E 3 HOH 16 2016 2016 HOH HOH A . 
E 3 HOH 17 2017 2017 HOH HOH A . 
E 3 HOH 18 2018 2018 HOH HOH A . 
E 3 HOH 19 2019 2019 HOH HOH A . 
E 3 HOH 20 2020 2020 HOH HOH A . 
E 3 HOH 21 2021 2021 HOH HOH A . 
E 3 HOH 22 2022 2022 HOH HOH A . 
E 3 HOH 23 2023 2023 HOH HOH A . 
E 3 HOH 24 2024 2024 HOH HOH A . 
E 3 HOH 25 2025 2025 HOH HOH A . 
E 3 HOH 26 2026 2026 HOH HOH A . 
E 3 HOH 27 2027 2027 HOH HOH A . 
E 3 HOH 28 2028 2028 HOH HOH A . 
E 3 HOH 29 2029 2029 HOH HOH A . 
E 3 HOH 30 2030 2030 HOH HOH A . 
E 3 HOH 31 2031 2031 HOH HOH A . 
E 3 HOH 32 2032 2032 HOH HOH A . 
E 3 HOH 33 2033 2033 HOH HOH A . 
E 3 HOH 34 2034 2034 HOH HOH A . 
E 3 HOH 35 2035 2035 HOH HOH A . 
E 3 HOH 36 2036 2036 HOH HOH A . 
E 3 HOH 37 2037 2037 HOH HOH A . 
E 3 HOH 38 2038 2038 HOH HOH A . 
E 3 HOH 39 2039 2039 HOH HOH A . 
E 3 HOH 40 2040 2040 HOH HOH A . 
E 3 HOH 41 2041 2041 HOH HOH A . 
E 3 HOH 42 2042 2042 HOH HOH A . 
E 3 HOH 43 2043 2043 HOH HOH A . 
E 3 HOH 44 2044 2044 HOH HOH A . 
E 3 HOH 45 2045 2045 HOH HOH A . 
E 3 HOH 46 2046 2046 HOH HOH A . 
E 3 HOH 47 2047 2047 HOH HOH A . 
E 3 HOH 48 2048 2048 HOH HOH A . 
E 3 HOH 49 2049 2049 HOH HOH A . 
E 3 HOH 50 2050 2050 HOH HOH A . 
E 3 HOH 51 2051 2051 HOH HOH A . 
E 3 HOH 52 2052 2052 HOH HOH A . 
E 3 HOH 53 2053 2053 HOH HOH A . 
E 3 HOH 54 2054 2054 HOH HOH A . 
E 3 HOH 55 2055 2055 HOH HOH A . 
E 3 HOH 56 2056 2056 HOH HOH A . 
E 3 HOH 57 2057 2057 HOH HOH A . 
E 3 HOH 58 2058 2058 HOH HOH A . 
E 3 HOH 59 2059 2059 HOH HOH A . 
E 3 HOH 60 2060 2060 HOH HOH A . 
E 3 HOH 61 2061 2061 HOH HOH A . 
E 3 HOH 62 2062 2062 HOH HOH A . 
E 3 HOH 63 2063 2063 HOH HOH A . 
E 3 HOH 64 2064 2064 HOH HOH A . 
E 3 HOH 65 2065 2065 HOH HOH A . 
E 3 HOH 66 2066 2066 HOH HOH A . 
E 3 HOH 67 2067 2067 HOH HOH A . 
E 3 HOH 68 2068 2068 HOH HOH A . 
E 3 HOH 69 2069 2069 HOH HOH A . 
E 3 HOH 70 2070 2070 HOH HOH A . 
E 3 HOH 71 2071 2071 HOH HOH A . 
E 3 HOH 72 2072 2072 HOH HOH A . 
E 3 HOH 73 2073 2073 HOH HOH A . 
E 3 HOH 74 2074 2074 HOH HOH A . 
E 3 HOH 75 2075 2075 HOH HOH A . 
E 3 HOH 76 2076 2076 HOH HOH A . 
E 3 HOH 77 2077 2077 HOH HOH A . 
E 3 HOH 78 2078 2078 HOH HOH A . 
E 3 HOH 79 2079 2079 HOH HOH A . 
E 3 HOH 80 2080 2080 HOH HOH A . 
E 3 HOH 81 2081 2081 HOH HOH A . 
E 3 HOH 82 2082 2082 HOH HOH A . 
F 3 HOH 1  2001 2001 HOH HOH B . 
F 3 HOH 2  2002 2002 HOH HOH B . 
F 3 HOH 3  2003 2003 HOH HOH B . 
F 3 HOH 4  2004 2004 HOH HOH B . 
F 3 HOH 5  2005 2005 HOH HOH B . 
F 3 HOH 6  2006 2006 HOH HOH B . 
F 3 HOH 7  2007 2007 HOH HOH B . 
F 3 HOH 8  2008 2008 HOH HOH B . 
F 3 HOH 9  2009 2009 HOH HOH B . 
F 3 HOH 10 2010 2010 HOH HOH B . 
F 3 HOH 11 2011 2011 HOH HOH B . 
F 3 HOH 12 2012 2012 HOH HOH B . 
F 3 HOH 13 2013 2013 HOH HOH B . 
F 3 HOH 14 2014 2014 HOH HOH B . 
F 3 HOH 15 2015 2015 HOH HOH B . 
F 3 HOH 16 2016 2016 HOH HOH B . 
F 3 HOH 17 2017 2017 HOH HOH B . 
F 3 HOH 18 2018 2018 HOH HOH B . 
F 3 HOH 19 2019 2019 HOH HOH B . 
F 3 HOH 20 2020 2020 HOH HOH B . 
F 3 HOH 21 2021 2021 HOH HOH B . 
F 3 HOH 22 2022 2022 HOH HOH B . 
F 3 HOH 23 2023 2023 HOH HOH B . 
F 3 HOH 24 2024 2024 HOH HOH B . 
F 3 HOH 25 2025 2025 HOH HOH B . 
F 3 HOH 26 2026 2026 HOH HOH B . 
F 3 HOH 27 2027 2027 HOH HOH B . 
F 3 HOH 28 2028 2028 HOH HOH B . 
F 3 HOH 29 2029 2029 HOH HOH B . 
F 3 HOH 30 2030 2030 HOH HOH B . 
F 3 HOH 31 2031 2031 HOH HOH B . 
F 3 HOH 32 2032 2032 HOH HOH B . 
F 3 HOH 33 2033 2033 HOH HOH B . 
F 3 HOH 34 2034 2034 HOH HOH B . 
F 3 HOH 35 2035 2035 HOH HOH B . 
F 3 HOH 36 2036 2036 HOH HOH B . 
F 3 HOH 37 2037 2037 HOH HOH B . 
F 3 HOH 38 2038 2038 HOH HOH B . 
F 3 HOH 39 2039 2039 HOH HOH B . 
F 3 HOH 40 2040 2040 HOH HOH B . 
F 3 HOH 41 2041 2041 HOH HOH B . 
F 3 HOH 42 2042 2042 HOH HOH B . 
F 3 HOH 43 2043 2043 HOH HOH B . 
F 3 HOH 44 2044 2044 HOH HOH B . 
F 3 HOH 45 2045 2045 HOH HOH B . 
F 3 HOH 46 2046 2046 HOH HOH B . 
F 3 HOH 47 2047 2047 HOH HOH B . 
F 3 HOH 48 2048 2048 HOH HOH B . 
F 3 HOH 49 2049 2049 HOH HOH B . 
F 3 HOH 50 2050 2050 HOH HOH B . 
F 3 HOH 51 2051 2051 HOH HOH B . 
F 3 HOH 52 2052 2052 HOH HOH B . 
F 3 HOH 53 2053 2053 HOH HOH B . 
F 3 HOH 54 2054 2054 HOH HOH B . 
F 3 HOH 55 2055 2055 HOH HOH B . 
F 3 HOH 56 2056 2056 HOH HOH B . 
F 3 HOH 57 2057 2057 HOH HOH B . 
F 3 HOH 58 2058 2058 HOH HOH B . 
F 3 HOH 59 2059 2059 HOH HOH B . 
F 3 HOH 60 2060 2060 HOH HOH B . 
F 3 HOH 61 2061 2061 HOH HOH B . 
F 3 HOH 62 2062 2062 HOH HOH B . 
F 3 HOH 63 2063 2063 HOH HOH B . 
F 3 HOH 64 2064 2064 HOH HOH B . 
F 3 HOH 65 2065 2065 HOH HOH B . 
F 3 HOH 66 2066 2066 HOH HOH B . 
F 3 HOH 67 2067 2067 HOH HOH B . 
F 3 HOH 68 2068 2068 HOH HOH B . 
F 3 HOH 69 2069 2069 HOH HOH B . 
F 3 HOH 70 2070 2070 HOH HOH B . 
F 3 HOH 71 2071 2071 HOH HOH B . 
F 3 HOH 72 2072 2072 HOH HOH B . 
F 3 HOH 73 2073 2073 HOH HOH B . 
F 3 HOH 74 2074 2074 HOH HOH B . 
F 3 HOH 75 2075 2075 HOH HOH B . 
F 3 HOH 76 2076 2076 HOH HOH B . 
F 3 HOH 77 2077 2077 HOH HOH B . 
F 3 HOH 78 2078 2078 HOH HOH B . 
F 3 HOH 79 2079 2079 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3120  ? 
1 MORE         -11.7 ? 
1 'SSA (A^2)'  39320 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-01-31 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
DETERMINATION METHOD: DSSP
THE SHEETS PRESENTED AS "AA" AND "BA" ON SHEET RECORDS
BELOW ARE ACTUALLY A 6-STRANDED BARREL THIS IS REPRESENTED BY
A  7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.
;
# 
_pdbx_entry_details.entry_id             1H8F 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'HIS 350 IN SWISS-PROT SHOULD BE LEU' 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A HIS 299 ? ? N A PRO 300 ? ? CA A PRO 300 ? ? 129.29 119.30 9.99  1.50 Y 
2 1 C B HIS 299 ? ? N B PRO 300 ? ? CA B PRO 300 ? ? 129.56 119.30 10.26 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 77  ? ? -72.37  -88.88  
2  1 LYS A 91  ? ? 62.49   -21.60  
3  1 ASP A 105 ? ? -151.22 89.16   
4  1 GLU A 121 ? ? -168.85 -158.51 
5  1 LYS A 122 ? ? 68.11   -16.13  
6  1 LYS A 123 ? ? 178.36  17.96   
7  1 PRO A 136 ? ? -49.60  -80.30  
8  1 ARG A 148 ? ? -87.51  43.78   
9  1 ALA A 149 ? ? -149.64 13.04   
10 1 ASP A 181 ? ? -153.60 43.00   
11 1 ASP A 200 ? ? 54.46   76.42   
12 1 CYS A 218 ? ? 81.77   142.51  
13 1 ARG A 220 ? ? -16.17  -79.65  
14 1 ASN A 285 ? ? 85.79   -87.26  
15 1 PRO A 286 ? ? -12.89  116.07  
16 1 ASN A 287 ? ? -58.58  40.16   
17 1 TYR A 288 ? ? -89.41  32.80   
18 1 PRO A 294 ? ? -49.58  156.35  
19 1 PRO A 300 ? ? -6.33   143.71  
20 1 ASN A 370 ? ? -179.07 71.94   
21 1 ASP B 77  ? ? -73.73  -86.02  
22 1 LYS B 91  ? ? 63.25   -20.58  
23 1 GLU B 121 ? ? -168.69 -159.95 
24 1 LYS B 122 ? ? 69.60   -15.39  
25 1 LYS B 123 ? ? 178.27  17.04   
26 1 PRO B 136 ? ? -49.53  -78.93  
27 1 ARG B 148 ? ? -84.17  43.40   
28 1 ALA B 149 ? ? -148.71 13.84   
29 1 ASP B 181 ? ? -153.72 43.16   
30 1 ASP B 200 ? ? 54.49   79.79   
31 1 CYS B 218 ? ? 81.11   140.51  
32 1 ARG B 220 ? ? -16.16  -82.04  
33 1 ASN B 285 ? ? 83.97   -87.71  
34 1 PRO B 286 ? ? -11.69  116.78  
35 1 ASN B 287 ? ? -60.32  40.37   
36 1 TYR B 288 ? ? -89.34  31.84   
37 1 PRO B 300 ? ? -7.95   143.15  
38 1 ASN B 370 ? ? -179.59 72.17   
39 1 ARG B 383 ? ? -149.09 -147.47 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B GLN 385 ? B GLN 351 
2 1 Y 1 B ALA 386 ? B ALA 352 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
3 water                                                 HOH 
#