data_1H9O
# 
_entry.id   1H9O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1H9O         
PDBE  EBI-5989     
WWPDB D_1290005989 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A0N unspecified 
;NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, FAMILY OF 25 STRUCTURES
;
PDB 1AZG unspecified 
;NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, MINIMIZED AVERAGE (PROBMAP) STRUCTURE
;
PDB 1PBW unspecified 'STRUCTURE OF BCR-HOMOLOGY (BH) DOMAIN' 
PDB 1PHT unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN, RESIDUES 1-85' 
PDB 1PIC unspecified 
;PHOSPHATIDYLINOSITOL 3-KINASE, P85-ALPHA SUBUNIT: C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYR751 PHOSPHOPEPTIDE FROM THE PDGF RECEPTOR, NMR, MINIMIZED MEAN STRUCTURE
;
PDB 1PKS unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE (PI3K) (SH3 DOMAIN) (NMR, MINIMIZED AVERAGE STRUCTURE)' 
PDB 1PKT unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE (PI3K) (SH3 DOMAIN) (NMR, 30 STRUCTURES)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1H9O 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pauptit, R.A.'    1 
'Rowsell, S.'      2 
'Breeze, A.L.'     3 
'Murshudov, G.N.'  4 
'Dennis, C.A.'     5 
'Derbyshire, D.J.' 6 
'Weston, S.A.'     7 
# 
_citation.id                        primary 
_citation.title                     
'NMR Trial Models: Experiences with the Colicin Immunity Protein Im7 and the P85Alpha C-Terminal Sh2-Peptide Complex' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            57 
_citation.page_first                1397 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11567151 
_citation.pdbx_database_id_DOI      10.1107/S0907444901012434 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pauptit, R.A.'    1 
primary 'Dennis, C.A.'     2 
primary 'Derbyshire, D.J.' 3 
primary 'Breeze, A.L.'     4 
primary 'Weston, S.A.'     5 
primary 'Rowsell, S.'      6 
primary 'Murshudov, G.N.'  7 
# 
_cell.entry_id           1H9O 
_cell.length_a           59.000 
_cell.length_b           32.800 
_cell.length_c           54.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1H9O 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PHOSPHATIDYLINOSITOL 3-KINASE'                12612.094 1   ? ? 
'C-TERMINAL SH2 DOMAIN, P85-ALPHA REGULATORY SUBUNIT RESIDUES 617 - 724' 
'CONTAINS AN N-TERMINAL EXTENSION (GSPI) DERIVED FROM THE RECOMBINANT EXPRESSION VECTOR' 
2 polymer syn 'BETA-PLATELET-DERIVED GROWTH FACTOR RECEPTOR' 701.767   1   ? ? 'RESIDUES 751 - 755' 
'TYROSINE-PHOSPHORYLATED PENTAPEPTIDE'                                                   
3 water   nat water                                          18.015    110 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLK
ELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
;
;GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLK
ELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
;
A ? 
2 'polypeptide(L)' no yes '(PTR)VPML' YVPML B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   ILE n 
1 5   PRO n 
1 6   HIS n 
1 7   HIS n 
1 8   ASP n 
1 9   GLU n 
1 10  LYS n 
1 11  THR n 
1 12  TRP n 
1 13  ASN n 
1 14  VAL n 
1 15  GLY n 
1 16  SER n 
1 17  SER n 
1 18  ASN n 
1 19  ARG n 
1 20  ASN n 
1 21  LYS n 
1 22  ALA n 
1 23  GLU n 
1 24  ASN n 
1 25  LEU n 
1 26  LEU n 
1 27  ARG n 
1 28  GLY n 
1 29  LYS n 
1 30  ARG n 
1 31  ASP n 
1 32  GLY n 
1 33  THR n 
1 34  PHE n 
1 35  LEU n 
1 36  VAL n 
1 37  ARG n 
1 38  GLU n 
1 39  SER n 
1 40  SER n 
1 41  LYS n 
1 42  GLN n 
1 43  GLY n 
1 44  CYS n 
1 45  TYR n 
1 46  ALA n 
1 47  CYS n 
1 48  SER n 
1 49  VAL n 
1 50  VAL n 
1 51  VAL n 
1 52  ASP n 
1 53  GLY n 
1 54  GLU n 
1 55  VAL n 
1 56  LYS n 
1 57  HIS n 
1 58  CYS n 
1 59  VAL n 
1 60  ILE n 
1 61  ASN n 
1 62  LYS n 
1 63  THR n 
1 64  ALA n 
1 65  THR n 
1 66  GLY n 
1 67  TYR n 
1 68  GLY n 
1 69  PHE n 
1 70  ALA n 
1 71  GLU n 
1 72  PRO n 
1 73  TYR n 
1 74  ASN n 
1 75  LEU n 
1 76  TYR n 
1 77  SER n 
1 78  SER n 
1 79  LEU n 
1 80  LYS n 
1 81  GLU n 
1 82  LEU n 
1 83  VAL n 
1 84  LEU n 
1 85  HIS n 
1 86  TYR n 
1 87  GLN n 
1 88  HIS n 
1 89  THR n 
1 90  SER n 
1 91  LEU n 
1 92  VAL n 
1 93  GLN n 
1 94  HIS n 
1 95  ASN n 
1 96  ASP n 
1 97  SER n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 THR n 
1 102 LEU n 
1 103 ALA n 
1 104 TYR n 
1 105 PRO n 
1 106 VAL n 
1 107 TYR n 
1 108 ALA n 
1 109 GLN n 
1 110 GLN n 
1 111 ARG n 
1 112 ARG n 
2 1   PTR n 
2 2   VAL n 
2 3   PRO n 
2 4   MET n 
2 5   LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'W3110 (CGSC 6564)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1H9O       1 ? ? 1H9O   ? 
2 UNP P85A_HUMAN 1 ? ? P27986 ? 
3 UNP PGDR_HUMAN 2 ? ? P09619 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1H9O A 1 ? 4   ? 1H9O   1   ? 4   ? 1 4   
2 2 1H9O A 5 ? 112 ? P27986 617 ? 724 ? 5 112 
3 3 1H9O B 1 ? 5   ? P09619 751 ? 755 ? 1 5   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1H9O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   43 
_exptl_crystal.description           'NMR TRIAL MODEL' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'40MG/ML PROTEIN IN 20 MM PHOSPHATE PH6.2 + PEG8000, RESERVOIR WITH SAME PHOSPHATE + PEG8000 + 250MM NACL, pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR571' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1H9O 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             54.000 
_reflns.d_resolution_high            1.790 
_reflns.number_obs                   9283 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.0 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              0.05000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.000 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1H9O 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     9283 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54 
_refine.ls_d_res_high                            1.79 
_refine.ls_percent_reflns_obs                    93 
_refine.ls_R_factor_obs                          0.168 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.163 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  927 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               18.9 
_refine.aniso_B[1][1]                            -0.10 
_refine.aniso_B[2][2]                            0.72 
_refine.aniso_B[3][3]                            -0.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.15 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS ADDED IN RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1PIC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .154 
_refine.pdbx_overall_ESU_R_Free                  .147 
_refine.overall_SU_ML                            .134 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.2 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        895 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             110 
_refine_hist.number_atoms_total               1005 
_refine_hist.d_res_high                       1.79 
_refine_hist.d_res_low                        54 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.018 0.021 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           2.0   1.9   ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.3   1.5   ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        2.3   2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.9   3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        4.7   4.5   ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      .122  0.2   ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1H9O 
_struct.title                     
;PHOSPHATIDYLINOSITOL 3-KINASE, P85-ALPHA SUBUNIT: C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYR751 PHOSPHOPEPTIDE FROM THE PDGF RECEPTOR, CRYSTAL STRUCTURE AT 1.79 A
;
_struct.pdbx_descriptor           'PHOSPHATIDYLINOSITOL 3-KINASE, BETA-PLATELET-DERIVED GROWTH FACTOR RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1H9O 
_struct_keywords.pdbx_keywords   TRANSFERASE/RECEPTOR 
_struct_keywords.text            
;TRANSFERASE/RECEPTOR, COMPLEX (PHOSPHOTRANSFERASE-RECEPTOR), PHOSPHOTRANSFERASE, SH2 DOMAIN, SIGNAL TRANSDUCTION, PHOSPHOINOSITIDE 3-KINASE, TRANSFERASE-RECEPTOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;HETERODIMER CONSISTING OF P110 AND P85-ALPHA                 
 . THEC-TERMINAL SH2-DOMAIN (CHAIN A) IS A                            
 FRAGMENT OFP85-ALPHA. THE PENTAPEPTIDE (CHAIN B)                     
 IS A FRAGMENT OFPLATELET DERIVED GROWTH FACTOR                       
 RECEPTOR. CHAINSA AND B FORM A COMPLEX                               
 REPRESENTATIVE OF THEINTERACTION BETWEEN PI3 KINASE                  
 AND PDGF-RECEPTOR.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 4  ? ASP A 8  ? ILE A 4  ASP A 8  5 ? 5  
HELX_P HELX_P2 2 ASP A 8  ? TRP A 12 ? ASP A 8  TRP A 12 5 ? 5  
HELX_P HELX_P3 3 ASN A 18 ? ARG A 27 ? ASN A 18 ARG A 27 1 ? 10 
HELX_P HELX_P4 4 SER A 78 ? THR A 89 ? SER A 78 THR A 89 1 ? 12 
HELX_P HELX_P5 5 SER A 90 ? HIS A 94 ? SER A 90 HIS A 94 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           PTR 
_struct_conn.ptnr1_label_seq_id            1 
_struct_conn.ptnr1_label_atom_id           C 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           VAL 
_struct_conn.ptnr2_label_seq_id            2 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            PTR 
_struct_conn.ptnr1_auth_seq_id             1 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            VAL 
_struct_conn.ptnr2_auth_seq_id             2 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.324 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 2  A . ? SER 2  A PRO 3  A ? PRO 3  A 1 -3.27 
2 GLU 71 A . ? GLU 71 A PRO 72 A ? PRO 72 A 1 -2.26 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 66  ? GLY A 68  ? GLY A 66  GLY A 68  
AA 2 GLU A 54  ? THR A 63  ? GLU A 54  THR A 63  
AA 3 TYR A 45  ? VAL A 51  ? TYR A 45  VAL A 51  
AA 4 THR A 33  ? GLU A 38  ? THR A 33  GLU A 38  
AA 5 TYR A 104 ? PRO A 105 ? TYR A 104 PRO A 105 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 68 ? N GLY A 68 O ASN A 61  ? O ASN A 61  
AA 2 3 N ILE A 60 ? N ILE A 60 O TYR A 45  ? O TYR A 45  
AA 3 4 N VAL A 50 ? N VAL A 50 O THR A 33  ? O THR A 33  
AA 4 5 N PHE A 34 ? N PHE A 34 O TYR A 104 ? O TYR A 104 
# 
_database_PDB_matrix.entry_id          1H9O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1H9O 
_atom_sites.fract_transf_matrix[1][1]   0.016949 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001841 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.030488 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018322 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 8.740  -16.960 1.946  1.00   42.86 ? 1    GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 10.040 -16.432 2.448  1.00   42.06 ? 1    GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 10.121 -14.920 2.160  1.00   41.56 ? 1    GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 10.259 -14.091 3.066  1.00   41.60 ? 1    GLY A O   1 
ATOM   5    N N   . SER A 1 2   ? 10.131 -14.602 0.866  1.00   40.36 ? 2    SER A N   1 
ATOM   6    C CA  . SER A 1 2   ? 10.053 -13.271 0.313  1.00   38.29 ? 2    SER A CA  1 
ATOM   7    C C   . SER A 1 2   ? 8.875  -13.221 -0.641 1.00   36.20 ? 2    SER A C   1 
ATOM   8    O O   . SER A 1 2   ? 8.340  -14.262 -1.084 1.00   36.54 ? 2    SER A O   1 
ATOM   9    C CB  . SER A 1 2   ? 11.320 -13.017 -0.530 1.00   39.54 ? 2    SER A CB  1 
ATOM   10   O OG  . SER A 1 2   ? 12.507 -12.885 0.249  1.00   41.32 ? 2    SER A OG  1 
ATOM   11   N N   . PRO A 1 3   ? 8.476  -12.005 -0.981 1.00   32.61 ? 3    PRO A N   1 
ATOM   12   C CA  . PRO A 1 3   ? 9.092  -10.811 -0.408 1.00   29.40 ? 3    PRO A CA  1 
ATOM   13   C C   . PRO A 1 3   ? 8.713  -10.714 1.069  1.00   25.59 ? 3    PRO A C   1 
ATOM   14   O O   . PRO A 1 3   ? 7.715  -11.314 1.476  1.00   24.37 ? 3    PRO A O   1 
ATOM   15   C CB  . PRO A 1 3   ? 8.445  -9.673  -1.191 1.00   29.54 ? 3    PRO A CB  1 
ATOM   16   C CG  . PRO A 1 3   ? 7.740  -10.309 -2.346 1.00   32.53 ? 3    PRO A CG  1 
ATOM   17   C CD  . PRO A 1 3   ? 7.399  -11.683 -1.929 1.00   33.34 ? 3    PRO A CD  1 
ATOM   18   N N   . ILE A 1 4   ? 9.515  -10.009 1.856  1.00   21.47 ? 4    ILE A N   1 
ATOM   19   C CA  . ILE A 1 4   ? 9.242  -9.823  3.282  1.00   20.12 ? 4    ILE A CA  1 
ATOM   20   C C   . ILE A 1 4   ? 7.986  -8.998  3.449  1.00   19.15 ? 4    ILE A C   1 
ATOM   21   O O   . ILE A 1 4   ? 7.641  -8.225  2.564  1.00   17.10 ? 4    ILE A O   1 
ATOM   22   C CB  . ILE A 1 4   ? 10.433 -9.209  3.980  1.00   20.02 ? 4    ILE A CB  1 
ATOM   23   C CG1 . ILE A 1 4   ? 10.876 -7.865  3.394  1.00   18.49 ? 4    ILE A CG1 1 
ATOM   24   C CG2 . ILE A 1 4   ? 11.580 -10.190 3.894  1.00   21.82 ? 4    ILE A CG2 1 
ATOM   25   C CD1 . ILE A 1 4   ? 11.900 -7.161  4.288  1.00   19.33 ? 4    ILE A CD1 1 
ATOM   26   N N   . PRO A 1 5   ? 7.288  -9.160  4.561  1.00   18.98 ? 5    PRO A N   1 
ATOM   27   C CA  . PRO A 1 5   ? 6.004  -8.458  4.768  1.00   18.96 ? 5    PRO A CA  1 
ATOM   28   C C   . PRO A 1 5   ? 6.072  -6.928  4.788  1.00   17.19 ? 5    PRO A C   1 
ATOM   29   O O   . PRO A 1 5   ? 5.064  -6.280  4.561  1.00   17.68 ? 5    PRO A O   1 
ATOM   30   C CB  . PRO A 1 5   ? 5.493  -9.010  6.110  1.00   18.79 ? 5    PRO A CB  1 
ATOM   31   C CG  . PRO A 1 5   ? 6.614  -9.571  6.769  1.00   21.13 ? 5    PRO A CG  1 
ATOM   32   C CD  . PRO A 1 5   ? 7.636  -10.010 5.711  1.00   19.68 ? 5    PRO A CD  1 
ATOM   33   N N   . HIS A 1 6   ? 7.252  -6.377  5.044  1.00   16.92 ? 6    HIS A N   1 
ATOM   34   C CA  . HIS A 1 6   ? 7.473  -4.967  5.138  1.00   16.38 ? 6    HIS A CA  1 
ATOM   35   C C   . HIS A 1 6   ? 7.093  -4.269  3.842  1.00   16.08 ? 6    HIS A C   1 
ATOM   36   O O   . HIS A 1 6   ? 6.774  -3.102  3.870  1.00   15.22 ? 6    HIS A O   1 
ATOM   37   C CB  . HIS A 1 6   ? 8.923  -4.645  5.470  1.00   16.14 ? 6    HIS A CB  1 
ATOM   38   C CG  . HIS A 1 6   ? 9.452  -5.421  6.631  1.00   17.40 ? 6    HIS A CG  1 
ATOM   39   N ND1 . HIS A 1 6   ? 10.009 -4.827  7.742  1.00   18.14 ? 6    HIS A ND1 1 
ATOM   40   C CD2 . HIS A 1 6   ? 9.471  -6.747  6.866  1.00   16.81 ? 6    HIS A CD2 1 
ATOM   41   C CE1 . HIS A 1 6   ? 10.378 -5.764  8.595  1.00   18.36 ? 6    HIS A CE1 1 
ATOM   42   N NE2 . HIS A 1 6   ? 10.026 -6.935  8.100  1.00   20.21 ? 6    HIS A NE2 1 
ATOM   43   N N   . HIS A 1 7   ? 7.100  -4.981  2.711  1.00   15.29 ? 7    HIS A N   1 
ATOM   44   C CA  . HIS A 1 7   ? 6.692  -4.386  1.446  1.00   14.66 ? 7    HIS A CA  1 
ATOM   45   C C   . HIS A 1 7   ? 5.214  -3.986  1.339  1.00   16.03 ? 7    HIS A C   1 
ATOM   46   O O   . HIS A 1 7   ? 4.859  -3.134  0.503  1.00   17.04 ? 7    HIS A O   1 
ATOM   47   C CB  . HIS A 1 7   ? 7.115  -5.253  0.290  1.00   14.29 ? 7    HIS A CB  1 
ATOM   48   C CG  . HIS A 1 7   ? 8.589  -5.292  0.113  1.00   15.13 ? 7    HIS A CG  1 
ATOM   49   N ND1 . HIS A 1 7   ? 9.285  -4.247  -0.467 1.00   16.35 ? 7    HIS A ND1 1 
ATOM   50   C CD2 . HIS A 1 7   ? 9.510  -6.197  0.496  1.00   14.72 ? 7    HIS A CD2 1 
ATOM   51   C CE1 . HIS A 1 7   ? 10.575 -4.554  -0.479 1.00   16.20 ? 7    HIS A CE1 1 
ATOM   52   N NE2 . HIS A 1 7   ? 10.734 -5.726  0.099  1.00   15.39 ? 7    HIS A NE2 1 
ATOM   53   N N   . ASP A 1 8   ? 4.377  -4.582  2.188  1.00   15.73 ? 8    ASP A N   1 
ATOM   54   C CA  . ASP A 1 8   ? 2.966  -4.247  2.286  1.00   16.21 ? 8    ASP A CA  1 
ATOM   55   C C   . ASP A 1 8   ? 2.875  -3.272  3.458  1.00   15.30 ? 8    ASP A C   1 
ATOM   56   O O   . ASP A 1 8   ? 2.950  -3.678  4.634  1.00   12.73 ? 8    ASP A O   1 
ATOM   57   C CB  . ASP A 1 8   ? 2.158  -5.476  2.581  1.00   18.62 ? 8    ASP A CB  1 
ATOM   58   C CG  . ASP A 1 8   ? 0.668  -5.188  2.721  1.00   19.79 ? 8    ASP A CG  1 
ATOM   59   O OD1 . ASP A 1 8   ? 0.236  -4.014  2.613  1.00   23.07 ? 8    ASP A OD1 1 
ATOM   60   O OD2 . ASP A 1 8   ? -0.116 -6.125  2.938  1.00   27.44 ? 8    ASP A OD2 1 
ATOM   61   N N   . GLU A 1 9   ? 2.831  -1.985  3.142  1.00   14.76 ? 9    GLU A N   1 
ATOM   62   C CA  . GLU A 1 9   ? 2.870  -0.969  4.179  1.00   15.23 ? 9    GLU A CA  1 
ATOM   63   C C   . GLU A 1 9   ? 1.755  -1.140  5.208  1.00   14.52 ? 9    GLU A C   1 
ATOM   64   O O   . GLU A 1 9   ? 1.922  -0.712  6.329  1.00   15.67 ? 9    GLU A O   1 
ATOM   65   C CB  . GLU A 1 9   ? 2.848  0.434   3.532  1.00   15.71 ? 9    GLU A CB  1 
ATOM   66   C CG  . GLU A 1 9   ? 3.007  1.562   4.461  1.00   19.69 ? 9    GLU A CG  1 
ATOM   67   C CD  . GLU A 1 9   ? 3.461  2.844   3.767  1.00   24.42 ? 9    GLU A CD  1 
ATOM   68   O OE1 . GLU A 1 9   ? 4.078  2.758   2.683  1.00   28.32 ? 9    GLU A OE1 1 
ATOM   69   O OE2 . GLU A 1 9   ? 3.159  3.915   4.289  1.00   26.79 ? 9    GLU A OE2 1 
ATOM   70   N N   . LYS A 1 10  ? 0.605  -1.712  4.841  1.00   12.27 ? 10   LYS A N   1 
ATOM   71   C CA  . LYS A 1 10  ? -0.442 -1.933  5.807  1.00   15.07 ? 10   LYS A CA  1 
ATOM   72   C C   . LYS A 1 10  ? -0.038 -2.814  6.983  1.00   12.54 ? 10   LYS A C   1 
ATOM   73   O O   . LYS A 1 10  ? -0.655 -2.744  8.040  1.00   15.67 ? 10   LYS A O   1 
ATOM   74   C CB  . LYS A 1 10  ? -1.695 -2.543  5.156  1.00   15.40 ? 10   LYS A CB  1 
ATOM   75   C CG  . LYS A 1 10  ? -2.127 -1.840  3.849  1.00   23.09 ? 10   LYS A CG  1 
ATOM   76   C CD  . LYS A 1 10  ? -2.115 -0.315  3.917  1.00   29.38 ? 10   LYS A CD  1 
ATOM   77   C CE  . LYS A 1 10  ? -3.551 0.293   4.061  1.00   33.85 ? 10   LYS A CE  1 
ATOM   78   N NZ  . LYS A 1 10  ? -3.530 1.815   4.413  1.00   37.67 ? 10   LYS A NZ  1 
ATOM   79   N N   . THR A 1 11  ? 0.985  -3.627  6.852  1.00   12.64 ? 11   THR A N   1 
ATOM   80   C CA  . THR A 1 11  ? 1.375  -4.474  7.975  1.00   12.38 ? 11   THR A CA  1 
ATOM   81   C C   . THR A 1 11  ? 2.033  -3.725  9.132  1.00   12.42 ? 11   THR A C   1 
ATOM   82   O O   . THR A 1 11  ? 2.057  -4.215  10.276 1.00   14.59 ? 11   THR A O   1 
ATOM   83   C CB  . THR A 1 11  ? 2.295  -5.610  7.564  1.00   13.03 ? 11   THR A CB  1 
ATOM   84   O OG1 . THR A 1 11  ? 3.539  -5.115  7.046  1.00   13.79 ? 11   THR A OG1 1 
ATOM   85   C CG2 . THR A 1 11  ? 1.630  -6.437  6.438  1.00   16.61 ? 11   THR A CG2 1 
ATOM   86   N N   . TRP A 1 12  ? 2.522  -2.516  8.866  1.00   11.69 ? 12   TRP A N   1 
ATOM   87   C CA  . TRP A 1 12  ? 3.218  -1.759  9.920  1.00   10.30 ? 12   TRP A CA  1 
ATOM   88   C C   . TRP A 1 12  ? 2.782  -0.283  10.092 1.00   12.20 ? 12   TRP A C   1 
ATOM   89   O O   . TRP A 1 12  ? 3.045  0.287   11.120 1.00   12.36 ? 12   TRP A O   1 
ATOM   90   C CB  . TRP A 1 12  ? 4.750  -1.807  9.792  1.00   10.99 ? 12   TRP A CB  1 
ATOM   91   C CG  . TRP A 1 12  ? 5.225  -1.473  8.403  1.00   10.05 ? 12   TRP A CG  1 
ATOM   92   C CD1 . TRP A 1 12  ? 5.493  -2.359  7.433  1.00   13.22 ? 12   TRP A CD1 1 
ATOM   93   C CD2 . TRP A 1 12  ? 5.477  -0.183  7.855  1.00   10.36 ? 12   TRP A CD2 1 
ATOM   94   N NE1 . TRP A 1 12  ? 5.883  -1.705  6.286  1.00   13.99 ? 12   TRP A NE1 1 
ATOM   95   C CE2 . TRP A 1 12  ? 5.880  -0.359  6.538  1.00   11.51 ? 12   TRP A CE2 1 
ATOM   96   C CE3 . TRP A 1 12  ? 5.389  1.117   8.341  1.00   11.45 ? 12   TRP A CE3 1 
ATOM   97   C CZ2 . TRP A 1 12  ? 6.208  0.701   5.719  1.00   11.69 ? 12   TRP A CZ2 1 
ATOM   98   C CZ3 . TRP A 1 12  ? 5.675  2.147   7.512  1.00   12.17 ? 12   TRP A CZ3 1 
ATOM   99   C CH2 . TRP A 1 12  ? 6.079  1.954   6.220  1.00   13.08 ? 12   TRP A CH2 1 
ATOM   100  N N   . ASN A 1 13  ? 2.170  0.325   9.104  1.00   12.17 ? 13   ASN A N   1 
ATOM   101  C CA  . ASN A 1 13  ? 1.729  1.728   9.160  1.00   14.27 ? 13   ASN A CA  1 
ATOM   102  C C   . ASN A 1 13  ? 0.334  1.827   9.687  1.00   14.69 ? 13   ASN A C   1 
ATOM   103  O O   . ASN A 1 13  ? -0.659 1.524   8.984  1.00   15.53 ? 13   ASN A O   1 
ATOM   104  C CB  . ASN A 1 13  ? 1.897  2.455   7.797  1.00   13.92 ? 13   ASN A CB  1 
ATOM   105  C CG  . ASN A 1 13  ? 1.712  3.993   7.907  1.00   17.65 ? 13   ASN A CG  1 
ATOM   106  O OD1 . ASN A 1 13  ? 1.057  4.494   8.842  1.00   20.98 ? 13   ASN A OD1 1 
ATOM   107  N ND2 . ASN A 1 13  ? 2.245  4.727   6.944  1.00   16.65 ? 13   ASN A ND2 1 
ATOM   108  N N   . VAL A 1 14  ? 0.254  2.270   10.933 1.00   15.31 ? 14   VAL A N   1 
ATOM   109  C CA  . VAL A 1 14  ? -1.017 2.311   11.621 1.00   17.35 ? 14   VAL A CA  1 
ATOM   110  C C   . VAL A 1 14  ? -1.643 3.707   11.682 1.00   18.96 ? 14   VAL A C   1 
ATOM   111  O O   . VAL A 1 14  ? -2.510 3.968   12.517 1.00   21.19 ? 14   VAL A O   1 
ATOM   112  C CB  . VAL A 1 14  ? -0.950 1.666   12.997 1.00   18.22 ? 14   VAL A CB  1 
ATOM   113  C CG1 . VAL A 1 14  ? -0.536 0.193   12.926 1.00   18.31 ? 14   VAL A CG1 1 
ATOM   114  C CG2 . VAL A 1 14  ? -0.070 2.375   13.955 1.00   20.15 ? 14   VAL A CG2 1 
ATOM   115  N N   . GLY A 1 15  ? -1.188 4.591   10.805 1.00   20.83 ? 15   GLY A N   1 
ATOM   116  C CA  . GLY A 1 15  ? -1.723 5.945   10.666 1.00   22.85 ? 15   GLY A CA  1 
ATOM   117  C C   . GLY A 1 15  ? -1.786 6.797   11.932 1.00   24.56 ? 15   GLY A C   1 
ATOM   118  O O   . GLY A 1 15  ? -0.842 6.881   12.678 1.00   22.32 ? 15   GLY A O   1 
ATOM   119  N N   . SER A 1 16  ? -2.951 7.400   12.177 1.00   26.52 ? 16   SER A N   1 
ATOM   120  C CA  . SER A 1 16  ? -3.181 8.251   13.331 1.00   29.21 ? 16   SER A CA  1 
ATOM   121  C C   . SER A 1 16  ? -3.605 7.352   14.481 1.00   29.19 ? 16   SER A C   1 
ATOM   122  O O   . SER A 1 16  ? -4.787 7.205   14.756 1.00   33.49 ? 16   SER A O   1 
ATOM   123  C CB  . SER A 1 16  ? -4.306 9.250   13.021 1.00   29.77 ? 16   SER A CB  1 
ATOM   124  O OG  . SER A 1 16  ? -4.113 9.810   11.742 1.00   33.62 ? 16   SER A OG  1 
ATOM   125  N N   . SER A 1 17  ? -2.655 6.642   15.040 1.00   28.38 ? 17   SER A N   1 
ATOM   126  C CA  . SER A 1 17  ? -2.837 5.810   16.196 1.00   26.94 ? 17   SER A CA  1 
ATOM   127  C C   . SER A 1 17  ? -1.973 6.543   17.201 1.00   26.07 ? 17   SER A C   1 
ATOM   128  O O   . SER A 1 17  ? -0.871 6.975   16.845 1.00   26.12 ? 17   SER A O   1 
ATOM   129  C CB  A SER A 1 17  ? -2.296 4.407   15.946 0.50   27.38 ? 17   SER A CB  1 
ATOM   130  C CB  B SER A 1 17  ? -2.270 4.415   15.952 0.50   27.48 ? 17   SER A CB  1 
ATOM   131  O OG  A SER A 1 17  ? -3.240 3.599   15.251 0.50   27.17 ? 17   SER A OG  1 
ATOM   132  O OG  B SER A 1 17  ? -2.062 3.705   17.169 0.50   28.47 ? 17   SER A OG  1 
ATOM   133  N N   . ASN A 1 18  ? -2.444 6.667   18.433 1.00   23.34 ? 18   ASN A N   1 
ATOM   134  C CA  . ASN A 1 18  ? -1.700 7.336   19.469 1.00   22.15 ? 18   ASN A CA  1 
ATOM   135  C C   . ASN A 1 18  ? -0.797 6.356   20.249 1.00   20.32 ? 18   ASN A C   1 
ATOM   136  O O   . ASN A 1 18  ? -0.808 5.163   20.009 1.00   18.88 ? 18   ASN A O   1 
ATOM   137  C CB  . ASN A 1 18  ? -2.637 8.153   20.384 1.00   22.67 ? 18   ASN A CB  1 
ATOM   138  C CG  . ASN A 1 18  ? -3.523 7.300   21.299 1.00   24.04 ? 18   ASN A CG  1 
ATOM   139  O OD1 . ASN A 1 18  ? -3.319 6.097   21.502 1.00   25.26 ? 18   ASN A OD1 1 
ATOM   140  N ND2 . ASN A 1 18  ? -4.535 7.963   21.890 1.00   26.15 ? 18   ASN A ND2 1 
ATOM   141  N N   . ARG A 1 19  ? 0.006  6.878   21.154 1.00   18.62 ? 19   ARG A N   1 
ATOM   142  C CA  . ARG A 1 19  ? 0.927  6.065   21.941 1.00   16.92 ? 19   ARG A CA  1 
ATOM   143  C C   . ARG A 1 19  ? 0.250  4.933   22.679 1.00   17.17 ? 19   ARG A C   1 
ATOM   144  O O   . ARG A 1 19  ? 0.704  3.807   22.666 1.00   16.33 ? 19   ARG A O   1 
ATOM   145  C CB  . ARG A 1 19  ? 1.675  6.902   22.963 1.00   16.22 ? 19   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 19  ? 2.706  6.069   23.693 1.00   18.90 ? 19   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 19  ? 3.478  6.824   24.738 1.00   19.59 ? 19   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 19  ? 4.404  7.715   24.071 1.00   19.59 ? 19   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 19  ? 5.568  8.085   24.556 1.00   23.15 ? 19   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 19  ? 5.925  7.702   25.783 1.00   24.96 ? 19   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 19  ? 6.351  8.878   23.838 1.00   18.97 ? 19   ARG A NH2 1 
ATOM   152  N N   . ASN A 1 20  ? -0.825 5.232   23.376 1.00   19.76 ? 20   ASN A N   1 
ATOM   153  C CA  . ASN A 1 20  ? -1.480 4.187   24.147 1.00   20.08 ? 20   ASN A CA  1 
ATOM   154  C C   . ASN A 1 20  ? -2.011 3.052   23.268 1.00   18.87 ? 20   ASN A C   1 
ATOM   155  O O   . ASN A 1 20  ? -1.839 1.910   23.628 1.00   19.31 ? 20   ASN A O   1 
ATOM   156  C CB  . ASN A 1 20  ? -2.485 4.785   25.109 1.00   22.58 ? 20   ASN A CB  1 
ATOM   157  C CG  . ASN A 1 20  ? -1.812 5.650   26.145 1.00   25.24 ? 20   ASN A CG  1 
ATOM   158  O OD1 . ASN A 1 20  ? -2.326 6.697   26.482 1.00   36.43 ? 20   ASN A OD1 1 
ATOM   159  N ND2 . ASN A 1 20  ? -0.632 5.258   26.608 1.00   30.77 ? 20   ASN A ND2 1 
ATOM   160  N N   . LYS A 1 21  ? -2.553 3.356   22.090 1.00   18.66 ? 21   LYS A N   1 
ATOM   161  C CA  . LYS A 1 21  ? -3.007 2.340   21.144 1.00   19.23 ? 21   LYS A CA  1 
ATOM   162  C C   . LYS A 1 21  ? -1.827 1.482   20.660 1.00   17.80 ? 21   LYS A C   1 
ATOM   163  O O   . LYS A 1 21  ? -1.878 0.304   20.587 1.00   15.64 ? 21   LYS A O   1 
ATOM   164  C CB  A LYS A 1 21  ? -3.661 3.019   19.921 0.50   19.94 ? 21   LYS A CB  1 
ATOM   165  C CB  B LYS A 1 21  ? -3.702 2.967   19.936 0.50   19.30 ? 21   LYS A CB  1 
ATOM   166  C CG  A LYS A 1 21  ? -5.153 3.346   19.982 0.50   23.75 ? 21   LYS A CG  1 
ATOM   167  C CG  B LYS A 1 21  ? -4.077 1.875   18.948 0.50   19.73 ? 21   LYS A CG  1 
ATOM   168  C CD  A LYS A 1 21  ? -5.612 4.117   21.218 0.50   27.29 ? 21   LYS A CD  1 
ATOM   169  C CD  B LYS A 1 21  ? -4.984 2.265   17.846 0.50   23.58 ? 21   LYS A CD  1 
ATOM   170  C CE  A LYS A 1 21  ? -6.228 3.174   22.234 0.50   29.19 ? 21   LYS A CE  1 
ATOM   171  C CE  B LYS A 1 21  ? -6.031 1.169   17.723 0.50   24.19 ? 21   LYS A CE  1 
ATOM   172  N NZ  A LYS A 1 21  ? -6.125 3.688   23.624 0.50   29.56 ? 21   LYS A NZ  1 
ATOM   173  N NZ  B LYS A 1 21  ? -7.000 1.445   16.661 0.50   27.24 ? 21   LYS A NZ  1 
ATOM   174  N N   . ALA A 1 22  ? -0.723 2.140   20.375 1.00   16.09 ? 22   ALA A N   1 
ATOM   175  C CA  . ALA A 1 22  ? 0.478  1.437   19.972 1.00   15.37 ? 22   ALA A CA  1 
ATOM   176  C C   . ALA A 1 22  ? 0.969  0.443   21.024 1.00   14.73 ? 22   ALA A C   1 
ATOM   177  O O   . ALA A 1 22  ? 1.403  -0.644  20.722 1.00   15.12 ? 22   ALA A O   1 
ATOM   178  C CB  . ALA A 1 22  ? 1.617  2.460   19.671 1.00   15.14 ? 22   ALA A CB  1 
ATOM   179  N N   . GLU A 1 23  ? 0.938  0.847   22.262 1.00   15.97 ? 23   GLU A N   1 
ATOM   180  C CA  . GLU A 1 23  ? 1.393  -0.013  23.333 1.00   16.47 ? 23   GLU A CA  1 
ATOM   181  C C   . GLU A 1 23  ? 0.458  -1.206  23.495 1.00   17.53 ? 23   GLU A C   1 
ATOM   182  O O   . GLU A 1 23  ? 0.924  -2.314  23.720 1.00   18.95 ? 23   GLU A O   1 
ATOM   183  C CB  . GLU A 1 23  ? 1.470  0.863   24.610 1.00   17.62 ? 23   GLU A CB  1 
ATOM   184  C CG  . GLU A 1 23  ? 2.594  1.835   24.435 1.00   16.88 ? 23   GLU A CG  1 
ATOM   185  C CD  . GLU A 1 23  ? 3.066  2.489   25.722 1.00   23.08 ? 23   GLU A CD  1 
ATOM   186  O OE1 . GLU A 1 23  ? 2.301  2.524   26.686 1.00   24.98 ? 23   GLU A OE1 1 
ATOM   187  O OE2 . GLU A 1 23  ? 4.203  2.992   25.769 1.00   24.07 ? 23   GLU A OE2 1 
ATOM   188  N N   . ASN A 1 24  ? -0.841 -0.984  23.275 1.00   18.10 ? 24   ASN A N   1 
ATOM   189  C CA  . ASN A 1 24  ? -1.859 -2.055  23.338 1.00   19.03 ? 24   ASN A CA  1 
ATOM   190  C C   . ASN A 1 24  ? -1.654 -3.053  22.239 1.00   18.73 ? 24   ASN A C   1 
ATOM   191  O O   . ASN A 1 24  ? -1.789 -4.271  22.438 1.00   20.34 ? 24   ASN A O   1 
ATOM   192  C CB  . ASN A 1 24  ? -3.268 -1.464  23.238 1.00   19.70 ? 24   ASN A CB  1 
ATOM   193  C CG  . ASN A 1 24  ? -3.759 -0.905  24.558 1.00   25.78 ? 24   ASN A CG  1 
ATOM   194  O OD1 . ASN A 1 24  ? -3.263 -1.267  25.620 1.00   33.49 ? 24   ASN A OD1 1 
ATOM   195  N ND2 . ASN A 1 24  ? -4.714 0.015   24.492 1.00   31.52 ? 24   ASN A ND2 1 
ATOM   196  N N   . LEU A 1 25  ? -1.321 -2.554  21.051 1.00   18.66 ? 25   LEU A N   1 
ATOM   197  C CA  . LEU A 1 25  ? -1.059 -3.457  19.937 1.00   19.51 ? 25   LEU A CA  1 
ATOM   198  C C   . LEU A 1 25  ? 0.231  -4.265  20.132 1.00   19.54 ? 25   LEU A C   1 
ATOM   199  O O   . LEU A 1 25  ? 0.323  -5.409  19.686 1.00   20.28 ? 25   LEU A O   1 
ATOM   200  C CB  . LEU A 1 25  ? -0.971 -2.700  18.601 1.00   19.74 ? 25   LEU A CB  1 
ATOM   201  C CG  . LEU A 1 25  ? -2.254 -2.120  18.038 1.00   21.62 ? 25   LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 25  ? -2.006 -1.215  16.820 1.00   21.16 ? 25   LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 25  ? -3.200 -3.242  17.624 1.00   22.11 ? 25   LEU A CD2 1 
ATOM   204  N N   . LEU A 1 26  ? 1.236  -3.688  20.780 1.00   18.20 ? 26   LEU A N   1 
ATOM   205  C CA  . LEU A 1 26  ? 2.530  -4.349  20.864 1.00   17.61 ? 26   LEU A CA  1 
ATOM   206  C C   . LEU A 1 26  ? 2.699  -5.208  22.105 1.00   19.85 ? 26   LEU A C   1 
ATOM   207  O O   . LEU A 1 26  ? 3.647  -5.965  22.213 1.00   18.55 ? 26   LEU A O   1 
ATOM   208  C CB  . LEU A 1 26  ? 3.653  -3.285  20.765 1.00   17.08 ? 26   LEU A CB  1 
ATOM   209  C CG  . LEU A 1 26  ? 3.751  -2.662  19.375 1.00   15.33 ? 26   LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 26  ? 4.748  -1.470  19.442 1.00   14.87 ? 26   LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 26  ? 4.301  -3.676  18.417 1.00   14.85 ? 26   LEU A CD2 1 
ATOM   212  N N   . ARG A 1 27  ? 1.746  -5.077  23.013 1.00   23.44 ? 27   ARG A N   1 
ATOM   213  C CA  . ARG A 1 27  ? 1.746  -5.814  24.276 1.00   26.08 ? 27   ARG A CA  1 
ATOM   214  C C   . ARG A 1 27  ? 1.906  -7.314  24.033 1.00   26.54 ? 27   ARG A C   1 
ATOM   215  O O   . ARG A 1 27  ? 1.125  -7.908  23.312 1.00   26.83 ? 27   ARG A O   1 
ATOM   216  C CB  . ARG A 1 27  ? 0.440  -5.565  25.004 1.00   27.13 ? 27   ARG A CB  1 
ATOM   217  C CG  . ARG A 1 27  ? 0.664  -5.125  26.415 1.00   34.07 ? 27   ARG A CG  1 
ATOM   218  C CD  . ARG A 1 27  ? -0.074 -5.948  27.426 1.00   39.24 ? 27   ARG A CD  1 
ATOM   219  N NE  . ARG A 1 27  ? -1.336 -5.418  27.916 1.00   43.44 ? 27   ARG A NE  1 
ATOM   220  C CZ  . ARG A 1 27  ? -1.647 -5.430  29.225 1.00   45.96 ? 27   ARG A CZ  1 
ATOM   221  N NH1 . ARG A 1 27  ? -2.807 -4.999  29.683 1.00   41.25 ? 27   ARG A NH1 1 
ATOM   222  N NH2 . ARG A 1 27  ? -0.755 -5.895  30.091 1.00   48.06 ? 27   ARG A NH2 1 
ATOM   223  N N   . GLY A 1 28  ? 2.929  -7.920  24.621 1.00   28.04 ? 28   GLY A N   1 
ATOM   224  C CA  . GLY A 1 28  ? 3.113  -9.362  24.494 1.00   28.23 ? 28   GLY A CA  1 
ATOM   225  C C   . GLY A 1 28  ? 3.812  -9.867  23.250 1.00   28.37 ? 28   GLY A C   1 
ATOM   226  O O   . GLY A 1 28  ? 4.072  -11.075 23.114 1.00   28.29 ? 28   GLY A O   1 
ATOM   227  N N   . LYS A 1 29  ? 4.088  -8.964  22.317 1.00   26.92 ? 29   LYS A N   1 
ATOM   228  C CA  . LYS A 1 29  ? 4.765  -9.343  21.098 1.00   26.39 ? 29   LYS A CA  1 
ATOM   229  C C   . LYS A 1 29  ? 6.259  -9.530  21.314 1.00   25.30 ? 29   LYS A C   1 
ATOM   230  O O   . LYS A 1 29  ? 6.861  -8.971  22.242 1.00   24.00 ? 29   LYS A O   1 
ATOM   231  C CB  . LYS A 1 29  ? 4.502  -8.282  20.019 1.00   26.35 ? 29   LYS A CB  1 
ATOM   232  C CG  . LYS A 1 29  ? 3.027  -8.126  19.737 1.00   28.25 ? 29   LYS A CG  1 
ATOM   233  C CD  . LYS A 1 29  ? 2.549  -9.282  18.877 1.00   31.77 ? 29   LYS A CD  1 
ATOM   234  C CE  . LYS A 1 29  ? 1.056  -9.508  18.931 1.00   35.47 ? 29   LYS A CE  1 
ATOM   235  N NZ  . LYS A 1 29  ? 0.210  -8.274  18.836 1.00   33.29 ? 29   LYS A NZ  1 
ATOM   236  N N   . ARG A 1 30  ? 6.879  -10.262 20.402 1.00   24.37 ? 30   ARG A N   1 
ATOM   237  C CA  . ARG A 1 30  ? 8.302  -10.531 20.514 1.00   24.31 ? 30   ARG A CA  1 
ATOM   238  C C   . ARG A 1 30  ? 9.157  -9.353  20.096 1.00   23.18 ? 30   ARG A C   1 
ATOM   239  O O   . ARG A 1 30  ? 8.710  -8.474  19.309 1.00   21.38 ? 30   ARG A O   1 
ATOM   240  C CB  A ARG A 1 30  ? 8.692  -11.741 19.706 0.50   24.41 ? 30   ARG A CB  1 
ATOM   241  C CB  B ARG A 1 30  ? 8.688  -11.753 19.695 0.50   24.59 ? 30   ARG A CB  1 
ATOM   242  C CG  A ARG A 1 30  ? 8.650  -11.559 18.254 0.50   25.57 ? 30   ARG A CG  1 
ATOM   243  C CG  B ARG A 1 30  ? 8.486  -11.666 18.209 0.50   26.32 ? 30   ARG A CG  1 
ATOM   244  C CD  A ARG A 1 30  ? 9.211  -12.759 17.532 0.50   28.74 ? 30   ARG A CD  1 
ATOM   245  C CD  B ARG A 1 30  ? 8.470  -13.050 17.554 0.50   30.57 ? 30   ARG A CD  1 
ATOM   246  N NE  A ARG A 1 30  ? 10.640 -13.139 17.425 0.50   31.87 ? 30   ARG A NE  1 
ATOM   247  N NE  B ARG A 1 30  ? 9.706  -13.697 17.093 0.50   34.11 ? 30   ARG A NE  1 
ATOM   248  C CZ  A ARG A 1 30  ? 11.811 -12.706 17.954 0.50   32.71 ? 30   ARG A CZ  1 
ATOM   249  C CZ  B ARG A 1 30  ? 10.983 -13.401 17.346 0.50   36.77 ? 30   ARG A CZ  1 
ATOM   250  N NH1 A ARG A 1 30  ? 12.827 -13.456 17.539 0.50   32.54 ? 30   ARG A NH1 1 
ATOM   251  N NH1 B ARG A 1 30  ? 11.396 -12.360 18.087 0.50   38.34 ? 30   ARG A NH1 1 
ATOM   252  N NH2 A ARG A 1 30  ? 12.076 -11.643 18.739 0.50   29.54 ? 30   ARG A NH2 1 
ATOM   253  N NH2 B ARG A 1 30  ? 11.879 -14.209 16.791 0.50   34.59 ? 30   ARG A NH2 1 
ATOM   254  N N   . ASP A 1 31  ? 10.383 -9.363  20.610 1.00   21.02 ? 31   ASP A N   1 
ATOM   255  C CA  . ASP A 1 31  ? 11.342 -8.307  20.374 1.00   20.57 ? 31   ASP A CA  1 
ATOM   256  C C   . ASP A 1 31  ? 11.470 -8.067  18.893 1.00   19.10 ? 31   ASP A C   1 
ATOM   257  O O   . ASP A 1 31  ? 11.550 -9.015  18.102 1.00   18.34 ? 31   ASP A O   1 
ATOM   258  C CB  . ASP A 1 31  ? 12.715 -8.647  20.955 1.00   22.41 ? 31   ASP A CB  1 
ATOM   259  C CG  . ASP A 1 31  ? 12.739 -8.543  22.480 1.00   23.79 ? 31   ASP A CG  1 
ATOM   260  O OD1 . ASP A 1 31  ? 11.682 -8.207  23.071 1.00   20.89 ? 31   ASP A OD1 1 
ATOM   261  O OD2 . ASP A 1 31  ? 13.773 -8.769  23.183 1.00   29.99 ? 31   ASP A OD2 1 
ATOM   262  N N   . GLY A 1 32  ? 11.559 -6.799  18.529 1.00   16.82 ? 32   GLY A N   1 
ATOM   263  C CA  . GLY A 1 32  ? 11.671 -6.454  17.129 1.00   16.34 ? 32   GLY A CA  1 
ATOM   264  C C   . GLY A 1 32  ? 10.336 -6.267  16.397 1.00   16.21 ? 32   GLY A C   1 
ATOM   265  O O   . GLY A 1 32  ? 10.341 -5.915  15.195 1.00   14.92 ? 32   GLY A O   1 
ATOM   266  N N   . THR A 1 33  ? 9.216  -6.481  17.086 1.00   14.20 ? 33   THR A N   1 
ATOM   267  C CA  . THR A 1 33  ? 7.876  -6.234  16.534 1.00   15.34 ? 33   THR A CA  1 
ATOM   268  C C   . THR A 1 33  ? 7.709  -4.719  16.571 1.00   14.79 ? 33   THR A C   1 
ATOM   269  O O   . THR A 1 33  ? 8.124  -4.102  17.493 1.00   13.66 ? 33   THR A O   1 
ATOM   270  C CB  . THR A 1 33  ? 6.804  -6.926  17.346 1.00   15.64 ? 33   THR A CB  1 
ATOM   271  O OG1 . THR A 1 33  ? 7.040  -8.343  17.318 1.00   15.55 ? 33   THR A OG1 1 
ATOM   272  C CG2 . THR A 1 33  ? 5.451  -6.721  16.672 1.00   15.19 ? 33   THR A CG2 1 
ATOM   273  N N   . PHE A 1 34  ? 7.214  -4.114  15.499 1.00   13.07 ? 34   PHE A N   1 
ATOM   274  C CA  . PHE A 1 34  ? 7.174  -2.692  15.431 1.00   12.66 ? 34   PHE A CA  1 
ATOM   275  C C   . PHE A 1 34  ? 5.997  -2.185  14.593 1.00   11.74 ? 34   PHE A C   1 
ATOM   276  O O   . PHE A 1 34  ? 5.347  -2.939  13.864 1.00   11.36 ? 34   PHE A O   1 
ATOM   277  C CB  . PHE A 1 34  ? 8.456  -2.157  14.803 1.00   12.91 ? 34   PHE A CB  1 
ATOM   278  C CG  . PHE A 1 34  ? 8.496  -2.349  13.307 1.00   10.71 ? 34   PHE A CG  1 
ATOM   279  C CD1 . PHE A 1 34  ? 8.774  -3.575  12.749 1.00   13.14 ? 34   PHE A CD1 1 
ATOM   280  C CD2 . PHE A 1 34  ? 8.129  -1.323  12.446 1.00   8.49  ? 34   PHE A CD2 1 
ATOM   281  C CE1 . PHE A 1 34  ? 8.719  -3.778  11.387 1.00   12.69 ? 34   PHE A CE1 1 
ATOM   282  C CE2 . PHE A 1 34  ? 8.113  -1.512  11.075 1.00   10.55 ? 34   PHE A CE2 1 
ATOM   283  C CZ  . PHE A 1 34  ? 8.402  -2.718  10.529 1.00   11.63 ? 34   PHE A CZ  1 
ATOM   284  N N   . LEU A 1 35  ? 5.790  -0.875  14.705 1.00   11.31 ? 35   LEU A N   1 
ATOM   285  C CA  . LEU A 1 35  ? 4.814  -0.147  13.898 1.00   11.13 ? 35   LEU A CA  1 
ATOM   286  C C   . LEU A 1 35  ? 5.303  1.267   13.718 1.00   11.44 ? 35   LEU A C   1 
ATOM   287  O O   . LEU A 1 35  ? 6.259  1.740   14.439 1.00   11.10 ? 35   LEU A O   1 
ATOM   288  C CB  . LEU A 1 35  ? 3.439  -0.163  14.537 1.00   11.96 ? 35   LEU A CB  1 
ATOM   289  C CG  . LEU A 1 35  ? 3.284  0.256   15.975 1.00   13.27 ? 35   LEU A CG  1 
ATOM   290  C CD1 . LEU A 1 35  ? 3.177  1.775   16.028 1.00   15.02 ? 35   LEU A CD1 1 
ATOM   291  C CD2 . LEU A 1 35  ? 2.014  -0.244  16.591 1.00   14.71 ? 35   LEU A CD2 1 
ATOM   292  N N   . VAL A 1 36  ? 4.671  1.950   12.785 1.00   12.32 ? 36   VAL A N   1 
ATOM   293  C CA  . VAL A 1 36  ? 4.962  3.328   12.487 1.00   11.96 ? 36   VAL A CA  1 
ATOM   294  C C   . VAL A 1 36  ? 3.624  4.073   12.551 1.00   12.15 ? 36   VAL A C   1 
ATOM   295  O O   . VAL A 1 36  ? 2.597  3.568   12.096 1.00   11.84 ? 36   VAL A O   1 
ATOM   296  C CB  . VAL A 1 36  ? 5.672  3.503   11.113 1.00   9.97  ? 36   VAL A CB  1 
ATOM   297  C CG1 . VAL A 1 36  ? 5.866  4.948   10.874 1.00   12.91 ? 36   VAL A CG1 1 
ATOM   298  C CG2 . VAL A 1 36  ? 7.010  2.787   11.105 1.00   14.00 ? 36   VAL A CG2 1 
ATOM   299  N N   . ARG A 1 37  ? 3.613  5.211   13.230 1.00   12.23 ? 37   ARG A N   1 
ATOM   300  C CA  . ARG A 1 37  ? 2.375  5.944   13.478 1.00   13.94 ? 37   ARG A CA  1 
ATOM   301  C C   . ARG A 1 37  ? 2.639  7.432   13.482 1.00   14.71 ? 37   ARG A C   1 
ATOM   302  O O   . ARG A 1 37  ? 3.784  7.850   13.478 1.00   14.90 ? 37   ARG A O   1 
ATOM   303  C CB  . ARG A 1 37  ? 1.792  5.514   14.837 1.00   13.07 ? 37   ARG A CB  1 
ATOM   304  C CG  . ARG A 1 37  ? 2.702  5.847   15.962 1.00   14.44 ? 37   ARG A CG  1 
ATOM   305  C CD  . ARG A 1 37  ? 2.228  5.373   17.292 1.00   14.78 ? 37   ARG A CD  1 
ATOM   306  N NE  . ARG A 1 37  ? 3.203  5.517   18.344 1.00   14.63 ? 37   ARG A NE  1 
ATOM   307  C CZ  . ARG A 1 37  ? 3.394  6.625   19.014 1.00   16.77 ? 37   ARG A CZ  1 
ATOM   308  N NH1 . ARG A 1 37  ? 4.299  6.671   19.984 1.00   16.05 ? 37   ARG A NH1 1 
ATOM   309  N NH2 . ARG A 1 37  ? 2.650  7.685   18.721 1.00   13.98 ? 37   ARG A NH2 1 
ATOM   310  N N   . GLU A 1 38  ? 1.586  8.244   13.450 1.00   17.62 ? 38   GLU A N   1 
ATOM   311  C CA  . GLU A 1 38  ? 1.757  9.676   13.622 1.00   19.28 ? 38   GLU A CA  1 
ATOM   312  C C   . GLU A 1 38  ? 2.111  9.903   15.097 1.00   20.76 ? 38   GLU A C   1 
ATOM   313  O O   . GLU A 1 38  ? 1.687  9.146   15.975 1.00   20.21 ? 38   GLU A O   1 
ATOM   314  C CB  . GLU A 1 38  ? 0.474  10.446  13.232 1.00   21.25 ? 38   GLU A CB  1 
ATOM   315  C CG  . GLU A 1 38  ? 0.163  10.327  11.741 1.00   23.21 ? 38   GLU A CG  1 
ATOM   316  C CD  . GLU A 1 38  ? -1.175 10.924  11.293 1.00   29.34 ? 38   GLU A CD  1 
ATOM   317  O OE1 . GLU A 1 38  ? -1.929 11.440  12.134 1.00   30.21 ? 38   GLU A OE1 1 
ATOM   318  O OE2 . GLU A 1 38  ? -1.468 10.839  10.064 1.00   33.18 ? 38   GLU A OE2 1 
ATOM   319  N N   . SER A 1 39  ? 2.940  10.907  15.335 1.00   21.12 ? 39   SER A N   1 
ATOM   320  C CA  . SER A 1 39  ? 3.357  11.324  16.671 1.00   22.62 ? 39   SER A CA  1 
ATOM   321  C C   . SER A 1 39  ? 2.495  12.463  17.192 1.00   24.35 ? 39   SER A C   1 
ATOM   322  O O   . SER A 1 39  ? 1.954  13.258  16.396 1.00   22.49 ? 39   SER A O   1 
ATOM   323  C CB  . SER A 1 39  ? 4.775  11.865  16.594 1.00   22.59 ? 39   SER A CB  1 
ATOM   324  O OG  . SER A 1 39  ? 5.242  12.325  17.840 1.00   24.21 ? 39   SER A OG  1 
ATOM   325  N N   . SER A 1 40  ? 2.444  12.575  18.527 1.00   26.47 ? 40   SER A N   1 
ATOM   326  C CA  . SER A 1 40  ? 1.787  13.703  19.170 1.00   29.08 ? 40   SER A CA  1 
ATOM   327  C C   . SER A 1 40  ? 2.564  14.956  18.844 1.00   31.24 ? 40   SER A C   1 
ATOM   328  O O   . SER A 1 40  ? 2.000  16.016  18.961 1.00   32.94 ? 40   SER A O   1 
ATOM   329  C CB  . SER A 1 40  ? 1.749  13.605  20.695 1.00   28.43 ? 40   SER A CB  1 
ATOM   330  O OG  . SER A 1 40  ? 3.053  13.651  21.253 1.00   29.57 ? 40   SER A OG  1 
ATOM   331  N N   . LYS A 1 41  ? 3.838  14.839  18.469 1.00   33.13 ? 41   LYS A N   1 
ATOM   332  C CA  . LYS A 1 41  ? 4.638  15.952  18.028 1.00   34.71 ? 41   LYS A CA  1 
ATOM   333  C C   . LYS A 1 41  ? 4.273  16.284  16.598 1.00   36.23 ? 41   LYS A C   1 
ATOM   334  O O   . LYS A 1 41  ? 4.732  15.660  15.651 1.00   36.75 ? 41   LYS A O   1 
ATOM   335  C CB  . LYS A 1 41  ? 6.110  15.545  18.112 1.00   34.87 ? 41   LYS A CB  1 
ATOM   336  C CG  . LYS A 1 41  ? 6.720  15.868  19.477 0.0000 20.00 ? 41   LYS A CG  1 
ATOM   337  C CD  . LYS A 1 41  ? 8.202  15.498  19.555 0.0000 20.00 ? 41   LYS A CD  1 
ATOM   338  C CE  . LYS A 1 41  ? 8.814  15.822  20.922 0.0000 42.96 ? 41   LYS A CE  1 
ATOM   339  N NZ  . LYS A 1 41  ? 10.227 15.446  20.930 0.0000 42.35 ? 41   LYS A NZ  1 
ATOM   340  N N   . GLN A 1 42  ? 3.325  17.200  16.416 1.00   37.65 ? 42   GLN A N   1 
ATOM   341  C CA  . GLN A 1 42  ? 2.829  17.562  15.091 1.00   38.73 ? 42   GLN A CA  1 
ATOM   342  C C   . GLN A 1 42  ? 3.939  17.685  14.059 1.00   37.97 ? 42   GLN A C   1 
ATOM   343  O O   . GLN A 1 42  ? 5.024  18.203  14.323 1.00   37.75 ? 42   GLN A O   1 
ATOM   344  C CB  . GLN A 1 42  ? 2.028  18.872  15.137 1.00   40.18 ? 42   GLN A CB  1 
ATOM   345  C CG  . GLN A 1 42  ? 2.901  20.103  15.403 1.00   43.61 ? 42   GLN A CG  1 
ATOM   346  C CD  . GLN A 1 42  ? 2.441  21.363  14.656 1.00   47.74 ? 42   GLN A CD  1 
ATOM   347  O OE1 . GLN A 1 42  ? 3.257  22.032  14.006 1.00   52.45 ? 42   GLN A OE1 1 
ATOM   348  N NE2 . GLN A 1 42  ? 1.157  21.692  14.756 1.00   48.69 ? 42   GLN A NE2 1 
ATOM   349  N N   . GLY A 1 43  ? 3.629  17.179  12.870 1.00   36.89 ? 43   GLY A N   1 
ATOM   350  C CA  . GLY A 1 43  ? 4.531  17.217  11.753 1.00   35.57 ? 43   GLY A CA  1 
ATOM   351  C C   . GLY A 1 43  ? 5.443  16.007  11.747 1.00   34.16 ? 43   GLY A C   1 
ATOM   352  O O   . GLY A 1 43  ? 6.165  15.855  10.782 1.00   34.17 ? 43   GLY A O   1 
ATOM   353  N N   . CYS A 1 44  ? 5.426  15.186  12.812 1.00   31.62 ? 44   CYS A N   1 
ATOM   354  C CA  . CYS A 1 44  ? 6.358  14.056  12.949 1.00   30.27 ? 44   CYS A CA  1 
ATOM   355  C C   . CYS A 1 44  ? 5.655  12.714  12.979 1.00   25.81 ? 44   CYS A C   1 
ATOM   356  O O   . CYS A 1 44  ? 4.483  12.602  13.321 1.00   25.02 ? 44   CYS A O   1 
ATOM   357  C CB  . CYS A 1 44  ? 7.105  14.089  14.306 1.00   30.61 ? 44   CYS A CB  1 
ATOM   358  S SG  . CYS A 1 44  ? 8.165  15.514  14.701 1.00   37.73 ? 44   CYS A SG  1 
ATOM   359  N N   . TYR A 1 45  ? 6.440  11.670  12.734 1.00   22.27 ? 45   TYR A N   1 
ATOM   360  C CA  . TYR A 1 45  ? 5.954  10.319  12.872 1.00   19.50 ? 45   TYR A CA  1 
ATOM   361  C C   . TYR A 1 45  ? 6.708  9.702   14.032 1.00   17.54 ? 45   TYR A C   1 
ATOM   362  O O   . TYR A 1 45  ? 7.682  10.289  14.540 1.00   17.34 ? 45   TYR A O   1 
ATOM   363  C CB  . TYR A 1 45  ? 6.241  9.559   11.600 1.00   19.30 ? 45   TYR A CB  1 
ATOM   364  C CG  . TYR A 1 45  ? 5.360  9.977   10.459 1.00   21.08 ? 45   TYR A CG  1 
ATOM   365  C CD1 . TYR A 1 45  ? 5.793  10.916  9.536  1.00   24.14 ? 45   TYR A CD1 1 
ATOM   366  C CD2 . TYR A 1 45  ? 4.106  9.454   10.313 1.00   23.40 ? 45   TYR A CD2 1 
ATOM   367  C CE1 . TYR A 1 45  ? 4.992  11.295  8.477  1.00   27.12 ? 45   TYR A CE1 1 
ATOM   368  C CE2 . TYR A 1 45  ? 3.290  9.827   9.245  1.00   26.57 ? 45   TYR A CE2 1 
ATOM   369  C CZ  . TYR A 1 45  ? 3.742  10.756  8.342  1.00   27.88 ? 45   TYR A CZ  1 
ATOM   370  O OH  . TYR A 1 45  ? 2.941  11.119  7.273  1.00   30.96 ? 45   TYR A OH  1 
ATOM   371  N N   . ALA A 1 46  ? 6.286  8.525   14.449 1.00   15.15 ? 46   ALA A N   1 
ATOM   372  C CA  . ALA A 1 46  ? 6.975  7.784   15.506 1.00   13.58 ? 46   ALA A CA  1 
ATOM   373  C C   . ALA A 1 46  ? 7.070  6.295   15.157 1.00   14.14 ? 46   ALA A C   1 
ATOM   374  O O   . ALA A 1 46  ? 6.215  5.751   14.456 1.00   14.71 ? 46   ALA A O   1 
ATOM   375  C CB  . ALA A 1 46  ? 6.295  7.989   16.832 1.00   15.07 ? 46   ALA A CB  1 
ATOM   376  N N   . CYS A 1 47  ? 8.135  5.671   15.599 1.00   13.86 ? 47   CYS A N   1 
ATOM   377  C CA  . CYS A 1 47  ? 8.333  4.259   15.446 1.00   13.96 ? 47   CYS A CA  1 
ATOM   378  C C   . CYS A 1 47  ? 8.197  3.662   16.852 1.00   13.69 ? 47   CYS A C   1 
ATOM   379  O O   . CYS A 1 47  ? 8.825  4.166   17.791 1.00   13.18 ? 47   CYS A O   1 
ATOM   380  C CB  . CYS A 1 47  ? 9.690  4.038   14.846 1.00   15.37 ? 47   CYS A CB  1 
ATOM   381  S SG  . CYS A 1 47  ? 10.103 2.280   14.773 1.00   20.31 ? 47   CYS A SG  1 
ATOM   382  N N   . SER A 1 48  ? 7.334  2.664   17.033 1.00   11.05 ? 48   SER A N   1 
ATOM   383  C CA  . SER A 1 48  ? 7.190  2.025   18.362 1.00   11.23 ? 48   SER A CA  1 
ATOM   384  C C   . SER A 1 48  ? 7.657  0.582   18.172 1.00   12.65 ? 48   SER A C   1 
ATOM   385  O O   . SER A 1 48  ? 7.249  -0.070  17.187 1.00   12.64 ? 48   SER A O   1 
ATOM   386  C CB  . SER A 1 48  ? 5.744  2.111   18.800 1.00   12.77 ? 48   SER A CB  1 
ATOM   387  O OG  . SER A 1 48  ? 5.246  3.436   18.961 1.00   12.92 ? 48   SER A OG  1 
ATOM   388  N N   . VAL A 1 49  ? 8.587  0.116   18.999 1.00   10.91 ? 49   VAL A N   1 
ATOM   389  C CA  . VAL A 1 49  ? 9.244  -1.133  18.754 1.00   12.44 ? 49   VAL A CA  1 
ATOM   390  C C   . VAL A 1 49  ? 9.493  -1.832  20.087 1.00   13.58 ? 49   VAL A C   1 
ATOM   391  O O   . VAL A 1 49  ? 9.796  -1.181  21.086 1.00   13.66 ? 49   VAL A O   1 
ATOM   392  C CB  . VAL A 1 49  ? 10.556 -0.902  17.989 1.00   12.74 ? 49   VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 49  ? 11.484 0.092   18.695 1.00   14.78 ? 49   VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 49  ? 11.237 -2.200  17.644 1.00   13.08 ? 49   VAL A CG2 1 
ATOM   395  N N   . VAL A 1 50  ? 9.328  -3.151  20.077 1.00   14.55 ? 50   VAL A N   1 
ATOM   396  C CA  . VAL A 1 50  ? 9.519  -3.947  21.302 1.00   14.25 ? 50   VAL A CA  1 
ATOM   397  C C   . VAL A 1 50  ? 10.999 -4.258  21.452 1.00   14.67 ? 50   VAL A C   1 
ATOM   398  O O   . VAL A 1 50  ? 11.616 -4.814  20.566 1.00   15.03 ? 50   VAL A O   1 
ATOM   399  C CB  . VAL A 1 50  ? 8.709  -5.271  21.217 1.00   14.44 ? 50   VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 50  ? 8.957  -6.172  22.489 1.00   15.87 ? 50   VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 50  ? 7.246  -4.982  21.064 1.00   16.33 ? 50   VAL A CG2 1 
ATOM   402  N N   . VAL A 1 51  ? 11.589 -3.874  22.572 1.00   16.43 ? 51   VAL A N   1 
ATOM   403  C CA  . VAL A 1 51  ? 13.024 -4.071  22.824 1.00   18.17 ? 51   VAL A CA  1 
ATOM   404  C C   . VAL A 1 51  ? 13.145 -4.636  24.242 1.00   18.46 ? 51   VAL A C   1 
ATOM   405  O O   . VAL A 1 51  ? 12.740 -3.984  25.197 1.00   19.95 ? 51   VAL A O   1 
ATOM   406  C CB  . VAL A 1 51  ? 13.760 -2.727  22.702 1.00   18.89 ? 51   VAL A CB  1 
ATOM   407  C CG1 . VAL A 1 51  ? 15.180 -2.780  23.180 1.00   21.21 ? 51   VAL A CG1 1 
ATOM   408  C CG2 . VAL A 1 51  ? 13.777 -2.319  21.247 1.00   22.36 ? 51   VAL A CG2 1 
ATOM   409  N N   . ASP A 1 52  ? 13.669 -5.846  24.346 1.00   20.21 ? 52   ASP A N   1 
ATOM   410  C CA  . ASP A 1 52  ? 13.798 -6.525  25.650 1.00   21.55 ? 52   ASP A CA  1 
ATOM   411  C C   . ASP A 1 52  ? 12.463 -6.637  26.412 1.00   20.71 ? 52   ASP A C   1 
ATOM   412  O O   . ASP A 1 52  ? 12.405 -6.429  27.647 1.00   21.76 ? 52   ASP A O   1 
ATOM   413  C CB  . ASP A 1 52  ? 14.786 -5.778  26.549 1.00   22.47 ? 52   ASP A CB  1 
ATOM   414  C CG  . ASP A 1 52  ? 15.222 -6.643  27.716 1.00   24.53 ? 52   ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 52  ? 15.227 -7.890  27.537 1.00   27.37 ? 52   ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 52  ? 15.543 -6.190  28.833 1.00   24.86 ? 52   ASP A OD2 1 
ATOM   417  N N   . GLY A 1 53  ? 11.396 -6.930  25.672 1.00   21.13 ? 53   GLY A N   1 
ATOM   418  C CA  . GLY A 1 53  ? 10.061 -7.031  26.239 1.00   20.69 ? 53   GLY A CA  1 
ATOM   419  C C   . GLY A 1 53  ? 9.330  -5.760  26.584 1.00   19.88 ? 53   GLY A C   1 
ATOM   420  O O   . GLY A 1 53  ? 8.250  -5.804  27.175 1.00   20.24 ? 53   GLY A O   1 
ATOM   421  N N   . GLU A 1 54  ? 9.904  -4.631  26.210 1.00   19.76 ? 54   GLU A N   1 
ATOM   422  C CA  . GLU A 1 54  ? 9.325  -3.355  26.573 1.00   19.87 ? 54   GLU A CA  1 
ATOM   423  C C   . GLU A 1 54  ? 9.097  -2.522  25.335 1.00   18.59 ? 54   GLU A C   1 
ATOM   424  O O   . GLU A 1 54  ? 9.848  -2.624  24.396 1.00   17.40 ? 54   GLU A O   1 
ATOM   425  C CB  . GLU A 1 54  ? 10.285 -2.569  27.455 1.00   21.40 ? 54   GLU A CB  1 
ATOM   426  C CG  . GLU A 1 54  ? 10.763 -3.301  28.692 1.00   26.18 ? 54   GLU A CG  1 
ATOM   427  C CD  . GLU A 1 54  ? 11.713 -2.485  29.574 1.00   31.02 ? 54   GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 54  ? 11.884 -1.258  29.374 1.00   35.27 ? 54   GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 54  ? 12.326 -3.107  30.459 1.00   32.33 ? 54   GLU A OE2 1 
ATOM   430  N N   . VAL A 1 55  ? 8.037  -1.756  25.296 1.00   16.98 ? 55   VAL A N   1 
ATOM   431  C CA  . VAL A 1 55  ? 7.829  -0.889  24.127 1.00   16.34 ? 55   VAL A CA  1 
ATOM   432  C C   . VAL A 1 55  ? 8.576  0.444   24.188 1.00   16.64 ? 55   VAL A C   1 
ATOM   433  O O   . VAL A 1 55  ? 8.427  1.219   25.108 1.00   18.73 ? 55   VAL A O   1 
ATOM   434  C CB  . VAL A 1 55  ? 6.349  -0.632  23.958 1.00   16.56 ? 55   VAL A CB  1 
ATOM   435  C CG1 . VAL A 1 55  ? 6.148  0.199   22.737 1.00   15.78 ? 55   VAL A CG1 1 
ATOM   436  C CG2 . VAL A 1 55  ? 5.666  -1.947  23.818 1.00   19.36 ? 55   VAL A CG2 1 
ATOM   437  N N   . LYS A 1 56  ? 9.395  0.759   23.187 1.00   17.53 ? 56   LYS A N   1 
ATOM   438  C CA  . LYS A 1 56  ? 10.073 2.035   23.122 1.00   17.65 ? 56   LYS A CA  1 
ATOM   439  C C   . LYS A 1 56  ? 9.554  2.838   21.961 1.00   15.53 ? 56   LYS A C   1 
ATOM   440  O O   . LYS A 1 56  ? 9.114  2.254   20.958 1.00   14.94 ? 56   LYS A O   1 
ATOM   441  C CB  . LYS A 1 56  ? 11.536 1.809   22.915 1.00   17.68 ? 56   LYS A CB  1 
ATOM   442  C CG  . LYS A 1 56  ? 12.235 1.013   24.047 1.00   22.73 ? 56   LYS A CG  1 
ATOM   443  C CD  . LYS A 1 56  ? 12.330 1.868   25.287 1.00   26.32 ? 56   LYS A CD  1 
ATOM   444  C CE  . LYS A 1 56  ? 13.183 1.260   26.369 1.00   32.09 ? 56   LYS A CE  1 
ATOM   445  N NZ  . LYS A 1 56  ? 13.897 2.456   26.972 1.00   33.05 ? 56   LYS A NZ  1 
ATOM   446  N N   . HIS A 1 57  ? 9.585  4.164   22.105 1.00   15.32 ? 57   HIS A N   1 
ATOM   447  C CA  . HIS A 1 57  ? 9.091  5.083   21.073 1.00   14.47 ? 57   HIS A CA  1 
ATOM   448  C C   . HIS A 1 57  ? 10.201 6.031   20.592 1.00   14.87 ? 57   HIS A C   1 
ATOM   449  O O   . HIS A 1 57  ? 10.866 6.660   21.435 1.00   13.87 ? 57   HIS A O   1 
ATOM   450  C CB  . HIS A 1 57  ? 7.950  5.891   21.645 1.00   14.43 ? 57   HIS A CB  1 
ATOM   451  C CG  . HIS A 1 57  ? 6.880  5.039   22.261 1.00   15.77 ? 57   HIS A CG  1 
ATOM   452  N ND1 . HIS A 1 57  ? 5.924  4.402   21.490 1.00   16.19 ? 57   HIS A ND1 1 
ATOM   453  C CD2 . HIS A 1 57  ? 6.575  4.766   23.555 1.00   16.21 ? 57   HIS A CD2 1 
ATOM   454  C CE1 . HIS A 1 57  ? 5.107  3.731   22.285 1.00   17.97 ? 57   HIS A CE1 1 
ATOM   455  N NE2 . HIS A 1 57  ? 5.489  3.916   23.546 1.00   17.00 ? 57   HIS A NE2 1 
ATOM   456  N N   . CYS A 1 58  ? 10.365 6.155   19.285 1.00   15.22 ? 58   CYS A N   1 
ATOM   457  C CA  . CYS A 1 58  ? 11.401 6.984   18.640 1.00   17.10 ? 58   CYS A CA  1 
ATOM   458  C C   . CYS A 1 58  ? 10.735 7.867   17.625 1.00   17.14 ? 58   CYS A C   1 
ATOM   459  O O   . CYS A 1 58  ? 9.894  7.403   16.866 1.00   18.46 ? 58   CYS A O   1 
ATOM   460  C CB  . CYS A 1 58  ? 12.381 6.138   17.778 1.00   18.24 ? 58   CYS A CB  1 
ATOM   461  S SG  . CYS A 1 58  ? 13.119 4.856   18.678 1.00   25.65 ? 58   CYS A SG  1 
ATOM   462  N N   . VAL A 1 59  ? 11.141 9.133   17.573 1.00   16.34 ? 59   VAL A N   1 
ATOM   463  C CA  . VAL A 1 59  ? 10.582 10.058  16.627 1.00   17.43 ? 59   VAL A CA  1 
ATOM   464  C C   . VAL A 1 59  ? 11.213 9.856   15.280 1.00   17.33 ? 59   VAL A C   1 
ATOM   465  O O   . VAL A 1 59  ? 12.417 9.677   15.197 1.00   17.03 ? 59   VAL A O   1 
ATOM   466  C CB  . VAL A 1 59  ? 10.903 11.526  17.052 1.00   19.30 ? 59   VAL A CB  1 
ATOM   467  C CG1 . VAL A 1 59  ? 10.600 12.504  15.941 1.00   21.55 ? 59   VAL A CG1 1 
ATOM   468  C CG2 . VAL A 1 59  ? 10.118 11.867  18.338 1.00   20.26 ? 59   VAL A CG2 1 
ATOM   469  N N   . ILE A 1 60  ? 10.408 9.964   14.238 1.00   15.72 ? 60   ILE A N   1 
ATOM   470  C CA  . ILE A 1 60  ? 10.920 10.001  12.865 1.00   16.24 ? 60   ILE A CA  1 
ATOM   471  C C   . ILE A 1 60  ? 10.755 11.405  12.349 1.00   15.74 ? 60   ILE A C   1 
ATOM   472  O O   . ILE A 1 60  ? 9.661  11.932  12.298 1.00   16.01 ? 60   ILE A O   1 
ATOM   473  C CB  . ILE A 1 60  ? 10.166 9.026   11.951 1.00   16.14 ? 60   ILE A CB  1 
ATOM   474  C CG1 . ILE A 1 60  ? 10.525 7.590   12.327 1.00   14.83 ? 60   ILE A CG1 1 
ATOM   475  C CG2 . ILE A 1 60  ? 10.581 9.271   10.507 1.00   17.83 ? 60   ILE A CG2 1 
ATOM   476  C CD1 . ILE A 1 60  ? 9.648  6.537   11.663 1.00   16.04 ? 60   ILE A CD1 1 
ATOM   477  N N   . ASN A 1 61  ? 11.839 12.060  11.998 1.00   17.71 ? 61   ASN A N   1 
ATOM   478  C CA  . ASN A 1 61  ? 11.771 13.410  11.456 1.00   19.95 ? 61   ASN A CA  1 
ATOM   479  C C   . ASN A 1 61  ? 11.493 13.423  9.926  1.00   20.47 ? 61   ASN A C   1 
ATOM   480  O O   . ASN A 1 61  ? 11.910 12.495  9.232  1.00   18.45 ? 61   ASN A O   1 
ATOM   481  C CB  . ASN A 1 61  ? 13.142 14.053  11.676 1.00   21.05 ? 61   ASN A CB  1 
ATOM   482  C CG  . ASN A 1 61  ? 13.607 14.009  13.113 1.00   24.50 ? 61   ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 61  ? 13.007 14.614  13.977 1.00   30.77 ? 61   ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 61  ? 14.734 13.344  13.349 1.00   30.70 ? 61   ASN A ND2 1 
ATOM   485  N N   . LYS A 1 62  ? 10.792 14.457  9.412  1.00   22.24 ? 62   LYS A N   1 
ATOM   486  C CA  . LYS A 1 62  ? 10.729 14.642  7.996  1.00   22.99 ? 62   LYS A CA  1 
ATOM   487  C C   . LYS A 1 62  ? 11.420 15.939  7.693  1.00   23.44 ? 62   LYS A C   1 
ATOM   488  O O   . LYS A 1 62  ? 11.174 16.964  8.315  1.00   25.10 ? 62   LYS A O   1 
ATOM   489  C CB  . LYS A 1 62  ? 9.258  14.724  7.585  1.00   24.59 ? 62   LYS A CB  1 
ATOM   490  C CG  . LYS A 1 62  ? 9.081  14.729  6.065  1.00   27.85 ? 62   LYS A CG  1 
ATOM   491  C CD  . LYS A 1 62  ? 7.608  14.694  5.652  1.00   33.58 ? 62   LYS A CD  1 
ATOM   492  C CE  . LYS A 1 62  ? 7.426  14.699  4.130  1.00   34.53 ? 62   LYS A CE  1 
ATOM   493  N NZ  . LYS A 1 62  ? 6.002  14.665  3.803  0.0000 20.00 ? 62   LYS A NZ  1 
ATOM   494  N N   . THR A 1 63  ? 12.400 15.892  6.799  1.00   22.18 ? 63   THR A N   1 
ATOM   495  C CA  . THR A 1 63  ? 13.150 17.067  6.432  1.00   21.41 ? 63   THR A CA  1 
ATOM   496  C C   . THR A 1 63  ? 13.096 17.217  4.931  1.00   21.77 ? 63   THR A C   1 
ATOM   497  O O   . THR A 1 63  ? 12.548 16.367  4.219  1.00   20.78 ? 63   THR A O   1 
ATOM   498  C CB  . THR A 1 63  ? 14.589 16.948  6.852  1.00   22.10 ? 63   THR A CB  1 
ATOM   499  O OG1 . THR A 1 63  ? 15.226 15.941  6.042  1.00   19.70 ? 63   THR A OG1 1 
ATOM   500  C CG2 . THR A 1 63  ? 14.701 16.451  8.282  1.00   24.71 ? 63   THR A CG2 1 
ATOM   501  N N   . ALA A 1 64  ? 13.768 18.251  4.439  1.00   21.71 ? 64   ALA A N   1 
ATOM   502  C CA  . ALA A 1 64  ? 13.830 18.474  2.997  1.00   21.24 ? 64   ALA A CA  1 
ATOM   503  C C   . ALA A 1 64  ? 14.635 17.415  2.234  1.00   20.36 ? 64   ALA A C   1 
ATOM   504  O O   . ALA A 1 64  ? 14.474 17.293  1.021  1.00   21.15 ? 64   ALA A O   1 
ATOM   505  C CB  . ALA A 1 64  ? 14.433 19.832  2.740  1.00   22.52 ? 64   ALA A CB  1 
ATOM   506  N N   . THR A 1 65  ? 15.527 16.698  2.925  1.00   18.60 ? 65   THR A N   1 
ATOM   507  C CA  . THR A 1 65  ? 16.315 15.626  2.330  1.00   19.52 ? 65   THR A CA  1 
ATOM   508  C C   . THR A 1 65  ? 15.708 14.234  2.504  1.00   18.50 ? 65   THR A C   1 
ATOM   509  O O   . THR A 1 65  ? 16.155 13.290  1.867  1.00   17.89 ? 65   THR A O   1 
ATOM   510  C CB  . THR A 1 65  ? 17.735 15.516  2.878  1.00   19.94 ? 65   THR A CB  1 
ATOM   511  O OG1 . THR A 1 65  ? 17.721 15.502  4.316  1.00   21.65 ? 65   THR A OG1 1 
ATOM   512  C CG2 . THR A 1 65  ? 18.606 16.688  2.460  1.00   24.08 ? 65   THR A CG2 1 
ATOM   513  N N   . GLY A 1 66  ? 14.726 14.116  3.364  1.00   16.78 ? 66   GLY A N   1 
ATOM   514  C CA  . GLY A 1 66  ? 14.034 12.837  3.552  1.00   16.39 ? 66   GLY A CA  1 
ATOM   515  C C   . GLY A 1 66  ? 13.680 12.558  5.002  1.00   15.83 ? 66   GLY A C   1 
ATOM   516  O O   . GLY A 1 66  ? 13.889 13.414  5.879  1.00   14.59 ? 66   GLY A O   1 
ATOM   517  N N   . TYR A 1 67  ? 13.182 11.336  5.265  1.00   14.54 ? 67   TYR A N   1 
ATOM   518  C CA  . TYR A 1 67  ? 12.842 10.924  6.609  1.00   13.43 ? 67   TYR A CA  1 
ATOM   519  C C   . TYR A 1 67  ? 14.020 10.281  7.292  1.00   13.18 ? 67   TYR A C   1 
ATOM   520  O O   . TYR A 1 67  ? 14.878 9.699   6.648  1.00   12.44 ? 67   TYR A O   1 
ATOM   521  C CB  . TYR A 1 67  ? 11.727 9.877   6.563  1.00   13.45 ? 67   TYR A CB  1 
ATOM   522  C CG  . TYR A 1 67  ? 10.424 10.388  6.036  1.00   16.28 ? 67   TYR A CG  1 
ATOM   523  C CD1 . TYR A 1 67  ? 9.538  11.028  6.865  1.00   18.93 ? 67   TYR A CD1 1 
ATOM   524  C CD2 . TYR A 1 67  ? 10.086 10.241  4.679  1.00   19.47 ? 67   TYR A CD2 1 
ATOM   525  C CE1 . TYR A 1 67  ? 8.357  11.484  6.389  1.00   23.75 ? 67   TYR A CE1 1 
ATOM   526  C CE2 . TYR A 1 67  ? 8.907  10.715  4.194  1.00   22.45 ? 67   TYR A CE2 1 
ATOM   527  C CZ  . TYR A 1 67  ? 8.033  11.315  5.052  1.00   21.32 ? 67   TYR A CZ  1 
ATOM   528  O OH  . TYR A 1 67  ? 6.798  11.799  4.625  1.00   25.82 ? 67   TYR A OH  1 
ATOM   529  N N   . GLY A 1 68  ? 14.069 10.367  8.624  1.00   13.22 ? 68   GLY A N   1 
ATOM   530  C CA  . GLY A 1 68  ? 15.176 9.743   9.324  1.00   11.92 ? 68   GLY A CA  1 
ATOM   531  C C   . GLY A 1 68  ? 15.032 9.896   10.839 1.00   12.73 ? 68   GLY A C   1 
ATOM   532  O O   . GLY A 1 68  ? 14.156 10.601  11.300 1.00   12.86 ? 68   GLY A O   1 
ATOM   533  N N   . PHE A 1 69  ? 15.880 9.218   11.574 1.00   12.95 ? 69   PHE A N   1 
ATOM   534  C CA  . PHE A 1 69  ? 15.904 9.312   13.024 1.00   15.37 ? 69   PHE A CA  1 
ATOM   535  C C   . PHE A 1 69  ? 16.777 10.440  13.542 1.00   17.69 ? 69   PHE A C   1 
ATOM   536  O O   . PHE A 1 69  ? 16.654 10.826  14.712 1.00   18.09 ? 69   PHE A O   1 
ATOM   537  C CB  . PHE A 1 69  ? 16.414 8.042   13.640 1.00   14.88 ? 69   PHE A CB  1 
ATOM   538  C CG  . PHE A 1 69  ? 15.465 6.887   13.506 1.00   16.89 ? 69   PHE A CG  1 
ATOM   539  C CD1 . PHE A 1 69  ? 14.210 6.944   14.068 1.00   18.62 ? 69   PHE A CD1 1 
ATOM   540  C CD2 . PHE A 1 69  ? 15.820 5.772   12.791 1.00   17.42 ? 69   PHE A CD2 1 
ATOM   541  C CE1 . PHE A 1 69  ? 13.333 5.880   13.920 1.00   19.47 ? 69   PHE A CE1 1 
ATOM   542  C CE2 . PHE A 1 69  ? 14.941 4.718   12.621 1.00   20.23 ? 69   PHE A CE2 1 
ATOM   543  C CZ  . PHE A 1 69  ? 13.722 4.769   13.185 1.00   22.02 ? 69   PHE A CZ  1 
ATOM   544  N N   . ALA A 1 70  ? 17.725 10.883  12.729 1.00   19.84 ? 70   ALA A N   1 
ATOM   545  C CA  . ALA A 1 70  ? 18.668 11.930  13.163 1.00   20.70 ? 70   ALA A CA  1 
ATOM   546  C C   . ALA A 1 70  ? 19.616 12.289  12.035 1.00   22.14 ? 70   ALA A C   1 
ATOM   547  O O   . ALA A 1 70  ? 19.973 11.424  11.247 1.00   20.47 ? 70   ALA A O   1 
ATOM   548  C CB  . ALA A 1 70  ? 19.505 11.413  14.282 1.00   20.91 ? 70   ALA A CB  1 
ATOM   549  N N   . GLU A 1 71  ? 20.068 13.542  12.003 1.00   22.90 ? 71   GLU A N   1 
ATOM   550  C CA  . GLU A 1 71  ? 21.122 13.950  11.064 1.00   24.27 ? 71   GLU A CA  1 
ATOM   551  C C   . GLU A 1 71  ? 22.401 13.129  11.275 1.00   23.55 ? 71   GLU A C   1 
ATOM   552  O O   . GLU A 1 71  ? 22.670 12.690  12.413 1.00   25.83 ? 71   GLU A O   1 
ATOM   553  C CB  . GLU A 1 71  ? 21.376 15.436  11.335 1.00   25.76 ? 71   GLU A CB  1 
ATOM   554  C CG  . GLU A 1 71  ? 20.349 16.463  10.895 1.00   29.34 ? 71   GLU A CG  1 
ATOM   555  C CD  . GLU A 1 71  ? 19.988 16.417  9.422  1.00   35.92 ? 71   GLU A CD  1 
ATOM   556  O OE1 . GLU A 1 71  ? 20.820 15.939  8.611  1.00   39.01 ? 71   GLU A OE1 1 
ATOM   557  O OE2 . GLU A 1 71  ? 18.870 16.881  9.078  1.00   41.13 ? 71   GLU A OE2 1 
ATOM   558  N N   . PRO A 1 72  ? 23.189 12.827  10.250 1.00   22.07 ? 72   PRO A N   1 
ATOM   559  C CA  . PRO A 1 72  ? 22.948 13.165  8.861  1.00   20.84 ? 72   PRO A CA  1 
ATOM   560  C C   . PRO A 1 72  ? 22.308 11.976  8.152  1.00   19.54 ? 72   PRO A C   1 
ATOM   561  O O   . PRO A 1 72  ? 22.595 11.685  7.010  1.00   17.99 ? 72   PRO A O   1 
ATOM   562  C CB  . PRO A 1 72  ? 24.365 13.381  8.363  1.00   21.44 ? 72   PRO A CB  1 
ATOM   563  C CG  . PRO A 1 72  ? 25.117 12.309  9.028  1.00   21.29 ? 72   PRO A CG  1 
ATOM   564  C CD  . PRO A 1 72  ? 24.476 12.124  10.363 1.00   23.26 ? 72   PRO A CD  1 
ATOM   565  N N   . TYR A 1 73  ? 21.404 11.301  8.842  1.00   18.64 ? 73   TYR A N   1 
ATOM   566  C CA  . TYR A 1 73  ? 20.768 10.117  8.254  1.00   19.49 ? 73   TYR A CA  1 
ATOM   567  C C   . TYR A 1 73  ? 19.326 10.328  7.847  1.00   17.84 ? 73   TYR A C   1 
ATOM   568  O O   . TYR A 1 73  ? 18.583 9.347   7.787  1.00   15.81 ? 73   TYR A O   1 
ATOM   569  C CB  . TYR A 1 73  ? 20.802 8.982   9.263  1.00   20.53 ? 73   TYR A CB  1 
ATOM   570  C CG  . TYR A 1 73  ? 22.156 8.819   9.954  1.00   28.98 ? 73   TYR A CG  1 
ATOM   571  C CD1 . TYR A 1 73  ? 23.237 8.314   9.274  1.00   33.38 ? 73   TYR A CD1 1 
ATOM   572  C CD2 . TYR A 1 73  ? 22.332 9.210   11.290 1.00   34.97 ? 73   TYR A CD2 1 
ATOM   573  C CE1 . TYR A 1 73  ? 24.489 8.186   9.894  1.00   36.87 ? 73   TYR A CE1 1 
ATOM   574  C CE2 . TYR A 1 73  ? 23.561 9.076   11.935 1.00   38.53 ? 73   TYR A CE2 1 
ATOM   575  C CZ  . TYR A 1 73  ? 24.640 8.550   11.224 1.00   40.06 ? 73   TYR A CZ  1 
ATOM   576  O OH  . TYR A 1 73  ? 25.878 8.413   11.845 1.00   42.33 ? 73   TYR A OH  1 
ATOM   577  N N   . ASN A 1 74  ? 18.888 11.559  7.580  1.00   16.20 ? 74   ASN A N   1 
ATOM   578  C CA  . ASN A 1 74  ? 17.508 11.805  7.196  1.00   17.83 ? 74   ASN A CA  1 
ATOM   579  C C   . ASN A 1 74  ? 17.491 11.708  5.672  1.00   18.26 ? 74   ASN A C   1 
ATOM   580  O O   . ASN A 1 74  ? 17.437 12.711  4.988  1.00   19.18 ? 74   ASN A O   1 
ATOM   581  C CB  . ASN A 1 74  ? 17.002 13.164  7.700  1.00   17.18 ? 74   ASN A CB  1 
ATOM   582  C CG  . ASN A 1 74  ? 16.987 13.251  9.231  1.00   22.05 ? 74   ASN A CG  1 
ATOM   583  O OD1 . ASN A 1 74  ? 16.505 12.332  9.896  1.00   20.89 ? 74   ASN A OD1 1 
ATOM   584  N ND2 . ASN A 1 74  ? 17.516 14.367  9.800  1.00   22.81 ? 74   ASN A ND2 1 
ATOM   585  N N   . LEU A 1 75  ? 17.676 10.484  5.200  1.00   17.11 ? 75   LEU A N   1 
ATOM   586  C CA  . LEU A 1 75  ? 17.987 10.185  3.802  1.00   17.73 ? 75   LEU A CA  1 
ATOM   587  C C   . LEU A 1 75  ? 16.941 9.401   3.045  1.00   17.13 ? 75   LEU A C   1 
ATOM   588  O O   . LEU A 1 75  ? 17.162 9.099   1.878  1.00   19.03 ? 75   LEU A O   1 
ATOM   589  C CB  . LEU A 1 75  ? 19.215 9.285   3.771  1.00   19.40 ? 75   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 75  ? 20.454 9.767   4.531  1.00   23.56 ? 75   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 75  ? 21.530 8.705   4.590  1.00   28.51 ? 75   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 75  ? 20.967 11.016  3.893  1.00   27.60 ? 75   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 76  ? 15.846 9.038   3.679  1.00   14.67 ? 76   TYR A N   1 
ATOM   594  C CA  . TYR A 1 76  ? 14.917 8.096   3.053  1.00   15.07 ? 76   TYR A CA  1 
ATOM   595  C C   . TYR A 1 76  ? 13.748 8.845   2.424  1.00   15.06 ? 76   TYR A C   1 
ATOM   596  O O   . TYR A 1 76  ? 13.186 9.704   3.053  1.00   14.60 ? 76   TYR A O   1 
ATOM   597  C CB  . TYR A 1 76  ? 14.530 7.114   4.156  1.00   14.18 ? 76   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 76  ? 15.794 6.477   4.647  1.00   12.23 ? 76   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 76  ? 16.350 6.796   5.852  1.00   15.20 ? 76   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 76  ? 16.493 5.638   3.818  1.00   17.79 ? 76   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 76  ? 17.570 6.274   6.233  1.00   17.01 ? 76   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 76  ? 17.670 5.115   4.163  1.00   17.47 ? 76   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 76  ? 18.211 5.412   5.403  1.00   17.15 ? 76   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 76  ? 19.433 4.845   5.707  1.00   19.43 ? 76   TYR A OH  1 
ATOM   605  N N   . SER A 1 77  ? 13.347 8.532   1.185  1.00   16.14 ? 77   SER A N   1 
ATOM   606  C CA  . SER A 1 77  ? 12.271 9.331   0.542  1.00   16.21 ? 77   SER A CA  1 
ATOM   607  C C   . SER A 1 77  ? 10.856 9.009   0.958  1.00   16.62 ? 77   SER A C   1 
ATOM   608  O O   . SER A 1 77  ? 9.909  9.680   0.552  1.00   17.31 ? 77   SER A O   1 
ATOM   609  C CB  A SER A 1 77  ? 12.335 9.244   -0.995 0.50   16.75 ? 77   SER A CB  1 
ATOM   610  C CB  B SER A 1 77  ? 12.366 9.295   -0.987 0.50   16.87 ? 77   SER A CB  1 
ATOM   611  O OG  A SER A 1 77  ? 11.918 7.955   -1.426 0.50   15.67 ? 77   SER A OG  1 
ATOM   612  O OG  B SER A 1 77  ? 13.646 9.743   -1.374 0.50   17.01 ? 77   SER A OG  1 
ATOM   613  N N   . SER A 1 78  ? 10.706 7.889   1.660  1.00   14.85 ? 78   SER A N   1 
ATOM   614  C CA  . SER A 1 78  ? 9.399  7.466   2.094  1.00   13.43 ? 78   SER A CA  1 
ATOM   615  C C   . SER A 1 78  ? 9.569  6.715   3.390  1.00   12.77 ? 78   SER A C   1 
ATOM   616  O O   . SER A 1 78  ? 10.681 6.219   3.688  1.00   13.44 ? 78   SER A O   1 
ATOM   617  C CB  . SER A 1 78  ? 8.729  6.553   1.066  1.00   13.34 ? 78   SER A CB  1 
ATOM   618  O OG  . SER A 1 78  ? 9.425  5.336   0.973  1.00   14.12 ? 78   SER A OG  1 
ATOM   619  N N   . LEU A 1 79  ? 8.472  6.516   4.111  1.00   13.46 ? 79   LEU A N   1 
ATOM   620  C CA  . LEU A 1 79  ? 8.567  5.765   5.335  1.00   13.71 ? 79   LEU A CA  1 
ATOM   621  C C   . LEU A 1 79  ? 8.925  4.294   5.019  1.00   13.33 ? 79   LEU A C   1 
ATOM   622  O O   . LEU A 1 79  ? 9.690  3.652   5.743  1.00   12.69 ? 79   LEU A O   1 
ATOM   623  C CB  . LEU A 1 79  ? 7.276  5.842   6.144  1.00   13.80 ? 79   LEU A CB  1 
ATOM   624  C CG  . LEU A 1 79  ? 6.993  7.199   6.800  1.00   16.23 ? 79   LEU A CG  1 
ATOM   625  C CD1 . LEU A 1 79  ? 5.575  7.225   7.257  1.00   18.42 ? 79   LEU A CD1 1 
ATOM   626  C CD2 . LEU A 1 79  ? 7.935  7.453   7.948  1.00   16.04 ? 79   LEU A CD2 1 
ATOM   627  N N   . LYS A 1 80  ? 8.398  3.775   3.913  1.00   11.77 ? 80   LYS A N   1 
ATOM   628  C CA  . LYS A 1 80  ? 8.735  2.430   3.513  1.00   12.39 ? 80   LYS A CA  1 
ATOM   629  C C   . LYS A 1 80  ? 10.224 2.216   3.294  1.00   12.43 ? 80   LYS A C   1 
ATOM   630  O O   . LYS A 1 80  ? 10.814 1.214   3.764  1.00   12.72 ? 80   LYS A O   1 
ATOM   631  C CB  . LYS A 1 80  ? 7.911  1.992   2.294  1.00   12.70 ? 80   LYS A CB  1 
ATOM   632  C CG  . LYS A 1 80  ? 8.238  0.584   1.928  1.00   17.62 ? 80   LYS A CG  1 
ATOM   633  C CD  . LYS A 1 80  ? 7.600  0.220   0.603  1.00   22.16 ? 80   LYS A CD  1 
ATOM   634  C CE  . LYS A 1 80  ? 6.147  -0.107  0.787  1.00   23.25 ? 80   LYS A CE  1 
ATOM   635  N NZ  . LYS A 1 80  ? 5.588  -0.555  -0.504 1.00   22.33 ? 80   LYS A NZ  1 
ATOM   636  N N   . GLU A 1 81  ? 10.882 3.144   2.595  1.00   13.54 ? 81   GLU A N   1 
ATOM   637  C CA  . GLU A 1 81  ? 12.322 3.029   2.380  1.00   14.85 ? 81   GLU A CA  1 
ATOM   638  C C   . GLU A 1 81  ? 13.077 3.001   3.749  1.00   13.47 ? 81   GLU A C   1 
ATOM   639  O O   . GLU A 1 81  ? 14.011 2.271   3.894  1.00   13.83 ? 81   GLU A O   1 
ATOM   640  C CB  A GLU A 1 81  ? 12.797 4.173   1.459  0.50   15.58 ? 81   GLU A CB  1 
ATOM   641  C CB  B GLU A 1 81  ? 12.792 4.157   1.430  0.50   15.27 ? 81   GLU A CB  1 
ATOM   642  C CG  A GLU A 1 81  ? 11.977 4.213   0.162  0.50   19.55 ? 81   GLU A CG  1 
ATOM   643  C CG  B GLU A 1 81  ? 12.592 3.735   -0.038 0.50   17.86 ? 81   GLU A CG  1 
ATOM   644  C CD  A GLU A 1 81  ? 12.146 5.452   -0.712 0.50   26.11 ? 81   GLU A CD  1 
ATOM   645  C CD  B GLU A 1 81  ? 12.296 4.823   -1.066 0.50   22.56 ? 81   GLU A CD  1 
ATOM   646  O OE1 A GLU A 1 81  ? 12.289 6.569   -0.173 0.50   31.21 ? 81   GLU A OE1 1 
ATOM   647  O OE1 B GLU A 1 81  ? 11.157 4.849   -1.598 0.50   26.95 ? 81   GLU A OE1 1 
ATOM   648  O OE2 A GLU A 1 81  ? 12.095 5.305   -1.966 0.50   28.07 ? 81   GLU A OE2 1 
ATOM   649  O OE2 B GLU A 1 81  ? 13.207 5.609   -1.413 0.50   22.51 ? 81   GLU A OE2 1 
ATOM   650  N N   . LEU A 1 82  ? 12.660 3.806   4.707  1.00   12.24 ? 82   LEU A N   1 
ATOM   651  C CA  . LEU A 1 82  ? 13.234 3.843   6.042  1.00   12.35 ? 82   LEU A CA  1 
ATOM   652  C C   . LEU A 1 82  ? 13.105 2.501   6.736  1.00   11.74 ? 82   LEU A C   1 
ATOM   653  O O   . LEU A 1 82  ? 14.079 1.962   7.253  1.00   12.82 ? 82   LEU A O   1 
ATOM   654  C CB  A LEU A 1 82  ? 12.545 4.910   6.888  0.50   12.15 ? 82   LEU A CB  1 
ATOM   655  C CB  B LEU A 1 82  ? 12.516 4.906   6.877  0.50   12.68 ? 82   LEU A CB  1 
ATOM   656  C CG  A LEU A 1 82  ? 13.217 5.118   8.251  0.50   11.30 ? 82   LEU A CG  1 
ATOM   657  C CG  B LEU A 1 82  ? 13.002 5.071   8.318  0.50   13.82 ? 82   LEU A CG  1 
ATOM   658  C CD1 A LEU A 1 82  ? 13.227 6.567   8.656  0.50   11.81 ? 82   LEU A CD1 1 
ATOM   659  C CD1 B LEU A 1 82  ? 14.393 5.604   8.343  0.50   14.87 ? 82   LEU A CD1 1 
ATOM   660  C CD2 A LEU A 1 82  ? 12.526 4.238   9.314  0.50   12.24 ? 82   LEU A CD2 1 
ATOM   661  C CD2 B LEU A 1 82  ? 12.058 5.957   9.125  0.50   17.60 ? 82   LEU A CD2 1 
ATOM   662  N N   . VAL A 1 83  ? 11.903 1.960   6.642  1.00   11.20 ? 83   VAL A N   1 
ATOM   663  C CA  . VAL A 1 83  ? 11.574 0.711   7.298  1.00   10.48 ? 83   VAL A CA  1 
ATOM   664  C C   . VAL A 1 83  ? 12.447 -0.366  6.692  1.00   11.04 ? 83   VAL A C   1 
ATOM   665  O O   . VAL A 1 83  ? 13.009 -1.195  7.401  1.00   11.62 ? 83   VAL A O   1 
ATOM   666  C CB  . VAL A 1 83  ? 10.152 0.402   7.202  1.00   12.50 ? 83   VAL A CB  1 
ATOM   667  C CG1 . VAL A 1 83  ? 9.846  -1.023  7.601  1.00   12.47 ? 83   VAL A CG1 1 
ATOM   668  C CG2 . VAL A 1 83  ? 9.354  1.289   8.187  1.00   12.52 ? 83   VAL A CG2 1 
ATOM   669  N N   . LEU A 1 84  ? 12.550 -0.377  5.375  1.00   12.40 ? 84   LEU A N   1 
ATOM   670  C CA  . LEU A 1 84  ? 13.362 -1.425  4.729  1.00   13.37 ? 84   LEU A CA  1 
ATOM   671  C C   . LEU A 1 84  ? 14.838 -1.358  5.082  1.00   13.45 ? 84   LEU A C   1 
ATOM   672  O O   . LEU A 1 84  ? 15.504 -2.388  5.244  1.00   15.13 ? 84   LEU A O   1 
ATOM   673  C CB  . LEU A 1 84  ? 13.173 -1.378  3.216  1.00   13.38 ? 84   LEU A CB  1 
ATOM   674  C CG  . LEU A 1 84  ? 11.782 -1.712  2.675  1.00   18.00 ? 84   LEU A CG  1 
ATOM   675  C CD1 . LEU A 1 84  ? 11.654 -1.362  1.212  1.00   17.56 ? 84   LEU A CD1 1 
ATOM   676  C CD2 . LEU A 1 84  ? 11.397 -3.191  2.924  1.00   18.65 ? 84   LEU A CD2 1 
ATOM   677  N N   . HIS A 1 85  ? 15.347 -0.158  5.329  1.00   14.08 ? 85   HIS A N   1 
ATOM   678  C CA  . HIS A 1 85  ? 16.708 0.002   5.687  1.00   14.44 ? 85   HIS A CA  1 
ATOM   679  C C   . HIS A 1 85  ? 16.947 -0.528  7.020  1.00   13.89 ? 85   HIS A C   1 
ATOM   680  O O   . HIS A 1 85  ? 17.890 -1.307  7.237  1.00   15.13 ? 85   HIS A O   1 
ATOM   681  C CB  . HIS A 1 85  ? 17.125 1.473   5.603  1.00   15.57 ? 85   HIS A CB  1 
ATOM   682  C CG  . HIS A 1 85  ? 18.545 1.680   5.980  1.00   17.21 ? 85   HIS A CG  1 
ATOM   683  N ND1 . HIS A 1 85  ? 19.581 1.520   5.080  1.00   20.02 ? 85   HIS A ND1 1 
ATOM   684  C CD2 . HIS A 1 85  ? 19.105 2.074   7.149  1.00   17.51 ? 85   HIS A CD2 1 
ATOM   685  C CE1 . HIS A 1 85  ? 20.729 1.752   5.705  1.00   20.35 ? 85   HIS A CE1 1 
ATOM   686  N NE2 . HIS A 1 85  ? 20.467 2.080   6.960  1.00   20.61 ? 85   HIS A NE2 1 
ATOM   687  N N   . TYR A 1 86  ? 16.057 -0.187  7.948  1.00   14.53 ? 86   TYR A N   1 
ATOM   688  C CA  . TYR A 1 86  ? 16.233 -0.618  9.342  1.00   14.06 ? 86   TYR A CA  1 
ATOM   689  C C   . TYR A 1 86  ? 15.705 -1.994  9.658  1.00   14.97 ? 86   TYR A C   1 
ATOM   690  O O   . TYR A 1 86  ? 15.823 -2.394  10.774 1.00   15.82 ? 86   TYR A O   1 
ATOM   691  C CB  . TYR A 1 86  ? 15.757 0.463   10.344 1.00   13.77 ? 86   TYR A CB  1 
ATOM   692  C CG  . TYR A 1 86  ? 16.611 1.680   10.341 1.00   14.76 ? 86   TYR A CG  1 
ATOM   693  C CD1 . TYR A 1 86  ? 17.775 1.727   11.102 1.00   14.57 ? 86   TYR A CD1 1 
ATOM   694  C CD2 . TYR A 1 86  ? 16.241 2.843   9.676  1.00   14.59 ? 86   TYR A CD2 1 
ATOM   695  C CE1 . TYR A 1 86  ? 18.577 2.893   11.160 1.00   14.63 ? 86   TYR A CE1 1 
ATOM   696  C CE2 . TYR A 1 86  ? 17.065 4.000   9.701  1.00   13.04 ? 86   TYR A CE2 1 
ATOM   697  C CZ  . TYR A 1 86  ? 18.210 4.012   10.465 1.00   14.11 ? 86   TYR A CZ  1 
ATOM   698  O OH  . TYR A 1 86  ? 18.998 5.151   10.506 1.00   14.67 ? 86   TYR A OH  1 
ATOM   699  N N   . GLN A 1 87  ? 15.211 -2.743  8.660  1.00   15.81 ? 87   GLN A N   1 
ATOM   700  C CA  . GLN A 1 87  ? 14.860 -4.142  8.802  1.00   18.09 ? 87   GLN A CA  1 
ATOM   701  C C   . GLN A 1 87  ? 16.201 -4.888  8.836  1.00   21.18 ? 87   GLN A C   1 
ATOM   702  O O   . GLN A 1 87  ? 16.321 -5.873  9.486  1.00   23.29 ? 87   GLN A O   1 
ATOM   703  C CB  . GLN A 1 87  ? 14.017 -4.650  7.628  1.00   17.59 ? 87   GLN A CB  1 
ATOM   704  C CG  . GLN A 1 87  ? 13.583 -6.091  7.658  1.00   17.19 ? 87   GLN A CG  1 
ATOM   705  C CD  . GLN A 1 87  ? 14.597 -6.988  6.964  1.00   18.66 ? 87   GLN A CD  1 
ATOM   706  O OE1 . GLN A 1 87  ? 15.372 -6.489  6.172  1.00   19.89 ? 87   GLN A OE1 1 
ATOM   707  N NE2 . GLN A 1 87  ? 14.685 -8.264  7.366  1.00   19.85 ? 87   GLN A NE2 1 
ATOM   708  N N   . HIS A 1 88  ? 17.219 -4.382  8.165  1.00   24.18 ? 88   HIS A N   1 
ATOM   709  C CA  . HIS A 1 88  ? 18.529 -5.093  8.158  1.00   26.73 ? 88   HIS A CA  1 
ATOM   710  C C   . HIS A 1 88  ? 19.618 -4.382  8.967  1.00   27.18 ? 88   HIS A C   1 
ATOM   711  O O   . HIS A 1 88  ? 20.696 -4.957  9.265  1.00   27.94 ? 88   HIS A O   1 
ATOM   712  C CB  . HIS A 1 88  ? 19.007 -5.403  6.730  1.00   27.96 ? 88   HIS A CB  1 
ATOM   713  C CG  . HIS A 1 88  ? 19.211 -4.204  5.862  1.00   33.60 ? 88   HIS A CG  1 
ATOM   714  N ND1 . HIS A 1 88  ? 20.253 -3.323  6.047  1.00   39.73 ? 88   HIS A ND1 1 
ATOM   715  C CD2 . HIS A 1 88  ? 18.537 -3.764  4.771  1.00   37.82 ? 88   HIS A CD2 1 
ATOM   716  C CE1 . HIS A 1 88  ? 20.198 -2.374  5.129  1.00   42.30 ? 88   HIS A CE1 1 
ATOM   717  N NE2 . HIS A 1 88  ? 19.166 -2.617  4.340  1.00   41.26 ? 88   HIS A NE2 1 
ATOM   718  N N   . THR A 1 89  ? 19.350 -3.142  9.342  1.00   26.16 ? 89   THR A N   1 
ATOM   719  C CA  . THR A 1 89  ? 20.289 -2.351  10.102 1.00   25.79 ? 89   THR A CA  1 
ATOM   720  C C   . THR A 1 89  ? 19.804 -2.093  11.521 1.00   25.16 ? 89   THR A C   1 
ATOM   721  O O   . THR A 1 89  ? 18.768 -1.498  11.717 1.00   22.41 ? 89   THR A O   1 
ATOM   722  C CB  . THR A 1 89  ? 20.453 -0.993  9.463  1.00   26.36 ? 89   THR A CB  1 
ATOM   723  O OG1 . THR A 1 89  ? 20.963 -1.113  8.119  1.00   27.56 ? 89   THR A OG1 1 
ATOM   724  C CG2 . THR A 1 89  ? 21.503 -0.177  10.232 1.00   27.71 ? 89   THR A CG2 1 
ATOM   725  N N   . SER A 1 90  ? 20.576 -2.459  12.526 1.00   23.75 ? 90   SER A N   1 
ATOM   726  C CA  . SER A 1 90  ? 20.129 -2.192  13.893 1.00   23.73 ? 90   SER A CA  1 
ATOM   727  C C   . SER A 1 90  ? 20.040 -0.708  14.289 1.00   22.90 ? 90   SER A C   1 
ATOM   728  O O   . SER A 1 90  ? 20.841 0.122   13.871 1.00   22.48 ? 90   SER A O   1 
ATOM   729  C CB  . SER A 1 90  ? 21.036 -2.919  14.878 1.00   24.05 ? 90   SER A CB  1 
ATOM   730  O OG  . SER A 1 90  ? 20.732 -2.520  16.196 1.00   25.52 ? 90   SER A OG  1 
ATOM   731  N N   . LEU A 1 91  ? 19.064 -0.373  15.135 1.00   22.20 ? 91   LEU A N   1 
ATOM   732  C CA  . LEU A 1 91  ? 18.916 0.988   15.612 1.00   22.31 ? 91   LEU A CA  1 
ATOM   733  C C   . LEU A 1 91  ? 20.016 1.361   16.634 1.00   21.81 ? 91   LEU A C   1 
ATOM   734  O O   . LEU A 1 91  ? 20.080 2.473   17.085 1.00   20.58 ? 91   LEU A O   1 
ATOM   735  C CB  . LEU A 1 91  ? 17.526 1.193   16.241 1.00   22.22 ? 91   LEU A CB  1 
ATOM   736  C CG  . LEU A 1 91  ? 16.367 1.003   15.268 1.00   23.49 ? 91   LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 91  ? 15.078 1.213   16.048 1.00   26.97 ? 91   LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 91  ? 16.399 1.959   14.226 1.00   27.25 ? 91   LEU A CD2 1 
ATOM   739  N N   . VAL A 1 92  ? 20.865 0.389   16.976 1.00   22.88 ? 92   VAL A N   1 
ATOM   740  C CA  . VAL A 1 92  ? 21.874 0.642   18.006 1.00   23.72 ? 92   VAL A CA  1 
ATOM   741  C C   . VAL A 1 92  ? 22.859 1.778   17.619 1.00   23.62 ? 92   VAL A C   1 
ATOM   742  O O   . VAL A 1 92  ? 23.401 2.468   18.461 1.00   22.96 ? 92   VAL A O   1 
ATOM   743  C CB  . VAL A 1 92  ? 22.562 -0.703  18.481 1.00   24.81 ? 92   VAL A CB  1 
ATOM   744  C CG1 . VAL A 1 92  ? 23.121 -1.543  17.326 1.00   25.57 ? 92   VAL A CG1 1 
ATOM   745  C CG2 . VAL A 1 92  ? 23.608 -0.409  19.458 1.00   27.97 ? 92   VAL A CG2 1 
ATOM   746  N N   . GLN A 1 93  ? 23.043 2.020   16.347 1.00   23.40 ? 93   GLN A N   1 
ATOM   747  C CA  . GLN A 1 93  ? 23.929 3.079   15.911 1.00   24.55 ? 93   GLN A CA  1 
ATOM   748  C C   . GLN A 1 93  ? 23.412 4.443   16.375 1.00   24.53 ? 93   GLN A C   1 
ATOM   749  O O   . GLN A 1 93  ? 24.170 5.375   16.395 1.00   24.84 ? 93   GLN A O   1 
ATOM   750  C CB  . GLN A 1 93  ? 24.044 3.098   14.391 1.00   25.84 ? 93   GLN A CB  1 
ATOM   751  C CG  . GLN A 1 93  ? 23.017 4.013   13.692 1.00   28.43 ? 93   GLN A CG  1 
ATOM   752  C CD  . GLN A 1 93  ? 23.209 4.090   12.155 1.00   33.48 ? 93   GLN A CD  1 
ATOM   753  O OE1 . GLN A 1 93  ? 23.408 5.171   11.584 1.00   37.79 ? 93   GLN A OE1 1 
ATOM   754  N NE2 . GLN A 1 93  ? 23.145 2.961   11.511 1.00   32.26 ? 93   GLN A NE2 1 
ATOM   755  N N   . HIS A 1 94  ? 22.136 4.544   16.763 1.00   22.64 ? 94   HIS A N   1 
ATOM   756  C CA  . HIS A 1 94  ? 21.547 5.805   17.191 1.00   21.38 ? 94   HIS A CA  1 
ATOM   757  C C   . HIS A 1 94  ? 21.416 5.906   18.713 1.00   21.52 ? 94   HIS A C   1 
ATOM   758  O O   . HIS A 1 94  ? 21.285 7.002   19.243 1.00   20.77 ? 94   HIS A O   1 
ATOM   759  C CB  . HIS A 1 94  ? 20.170 6.005   16.550 1.00   21.22 ? 94   HIS A CB  1 
ATOM   760  C CG  . HIS A 1 94  ? 20.212 6.036   15.053 1.00   19.42 ? 94   HIS A CG  1 
ATOM   761  N ND1 . HIS A 1 94  ? 20.821 7.054   14.354 1.00   18.51 ? 94   HIS A ND1 1 
ATOM   762  C CD2 . HIS A 1 94  ? 19.742 5.168   14.123 1.00   19.88 ? 94   HIS A CD2 1 
ATOM   763  C CE1 . HIS A 1 94  ? 20.714 6.817   13.052 1.00   18.82 ? 94   HIS A CE1 1 
ATOM   764  N NE2 . HIS A 1 94  ? 20.029 5.696   12.885 1.00   18.37 ? 94   HIS A NE2 1 
ATOM   765  N N   . ASN A 1 95  ? 21.399 4.755   19.378 1.00   23.26 ? 95   ASN A N   1 
ATOM   766  C CA  . ASN A 1 95  ? 21.211 4.665   20.837 1.00   24.94 ? 95   ASN A CA  1 
ATOM   767  C C   . ASN A 1 95  ? 21.569 3.250   21.297 1.00   27.12 ? 95   ASN A C   1 
ATOM   768  O O   . ASN A 1 95  ? 20.938 2.293   20.873 1.00   25.52 ? 95   ASN A O   1 
ATOM   769  C CB  . ASN A 1 95  ? 19.755 4.994   21.229 1.00   24.23 ? 95   ASN A CB  1 
ATOM   770  C CG  . ASN A 1 95  ? 19.559 5.099   22.761 1.00   24.32 ? 95   ASN A CG  1 
ATOM   771  O OD1 . ASN A 1 95  ? 19.793 4.153   23.491 1.00   25.43 ? 95   ASN A OD1 1 
ATOM   772  N ND2 . ASN A 1 95  ? 19.143 6.244   23.224 1.00   26.07 ? 95   ASN A ND2 1 
ATOM   773  N N   . ASP A 1 96  ? 22.572 3.094   22.169 1.00   29.74 ? 96   ASP A N   1 
ATOM   774  C CA  . ASP A 1 96  ? 22.974 1.743   22.587 1.00   31.79 ? 96   ASP A CA  1 
ATOM   775  C C   . ASP A 1 96  ? 21.858 0.954   23.224 1.00   32.10 ? 96   ASP A C   1 
ATOM   776  O O   . ASP A 1 96  ? 22.050 -0.239  23.360 1.00   33.95 ? 96   ASP A O   1 
ATOM   777  C CB  A ASP A 1 96  ? 24.108 1.740   23.643 0.50   32.42 ? 96   ASP A CB  1 
ATOM   778  C CB  B ASP A 1 96  ? 24.114 1.790   23.589 0.50   32.23 ? 96   ASP A CB  1 
ATOM   779  C CG  A ASP A 1 96  ? 25.488 2.002   23.074 0.50   33.85 ? 96   ASP A CG  1 
ATOM   780  C CG  B ASP A 1 96  ? 23.830 2.746   24.705 0.50   32.64 ? 96   ASP A CG  1 
ATOM   781  O OD1 A ASP A 1 96  ? 25.927 3.168   23.179 0.50   36.61 ? 96   ASP A OD1 1 
ATOM   782  O OD1 B ASP A 1 96  ? 23.475 2.310   25.821 0.50   34.83 ? 96   ASP A OD1 1 
ATOM   783  O OD2 A ASP A 1 96  ? 26.238 1.109   22.587 0.50   35.19 ? 96   ASP A OD2 1 
ATOM   784  O OD2 B ASP A 1 96  ? 23.894 3.974   24.534 0.50   34.12 ? 96   ASP A OD2 1 
ATOM   785  N N   . SER A 1 97  ? 20.784 1.575   23.712 1.00   32.49 ? 97   SER A N   1 
ATOM   786  C CA  . SER A 1 97  ? 19.647 0.803   24.301 1.00   33.15 ? 97   SER A CA  1 
ATOM   787  C C   . SER A 1 97  ? 18.772 0.073   23.303 1.00   32.06 ? 97   SER A C   1 
ATOM   788  O O   . SER A 1 97  ? 17.934 -0.760  23.702 1.00   31.79 ? 97   SER A O   1 
ATOM   789  C CB  . SER A 1 97  ? 18.693 1.726   25.044 1.00   33.94 ? 97   SER A CB  1 
ATOM   790  O OG  . SER A 1 97  ? 19.388 2.455   26.027 1.00   37.92 ? 97   SER A OG  1 
ATOM   791  N N   . LEU A 1 98  ? 18.893 0.446   22.022 1.00   29.51 ? 98   LEU A N   1 
ATOM   792  C CA  . LEU A 1 98  ? 17.989 -0.065  20.986 1.00   28.60 ? 98   LEU A CA  1 
ATOM   793  C C   . LEU A 1 98  ? 18.648 -1.140  20.149 1.00   28.17 ? 98   LEU A C   1 
ATOM   794  O O   . LEU A 1 98  ? 18.822 -0.944  18.960 1.00   27.02 ? 98   LEU A O   1 
ATOM   795  C CB  . LEU A 1 98  ? 17.569 1.104   20.076 1.00   27.21 ? 98   LEU A CB  1 
ATOM   796  C CG  . LEU A 1 98  ? 16.788 2.159   20.839 1.00   27.22 ? 98   LEU A CG  1 
ATOM   797  C CD1 . LEU A 1 98  ? 16.342 3.314   19.929 1.00   29.23 ? 98   LEU A CD1 1 
ATOM   798  C CD2 . LEU A 1 98  ? 15.592 1.469   21.468 1.00   27.71 ? 98   LEU A CD2 1 
ATOM   799  N N   . ASN A 1 99  ? 19.027 -2.283  20.728 1.00   28.44 ? 99   ASN A N   1 
ATOM   800  C CA  . ASN A 1 99  ? 19.685 -3.297  19.881 1.00   28.45 ? 99   ASN A CA  1 
ATOM   801  C C   . ASN A 1 99  ? 18.647 -4.207  19.249 1.00   27.48 ? 99   ASN A C   1 
ATOM   802  O O   . ASN A 1 99  ? 18.466 -5.347  19.637 1.00   27.12 ? 99   ASN A O   1 
ATOM   803  C CB  . ASN A 1 99  ? 20.769 -4.129  20.553 1.00   30.12 ? 99   ASN A CB  1 
ATOM   804  C CG  . ASN A 1 99  ? 21.598 -4.912  19.526 1.00   32.28 ? 99   ASN A CG  1 
ATOM   805  O OD1 . ASN A 1 99  ? 21.695 -4.521  18.340 1.00   36.41 ? 99   ASN A OD1 1 
ATOM   806  N ND2 . ASN A 1 99  ? 22.158 -6.028  19.949 1.00   36.81 ? 99   ASN A ND2 1 
ATOM   807  N N   . VAL A 1 100 ? 17.967 -3.682  18.230 1.00   25.46 ? 100  VAL A N   1 
ATOM   808  C CA  . VAL A 1 100 ? 16.934 -4.422  17.592 1.00   23.25 ? 100  VAL A CA  1 
ATOM   809  C C   . VAL A 1 100 ? 16.857 -3.888  16.150 1.00   21.79 ? 100  VAL A C   1 
ATOM   810  O O   . VAL A 1 100 ? 17.311 -2.798  15.882 1.00   20.05 ? 100  VAL A O   1 
ATOM   811  C CB  . VAL A 1 100 ? 15.655 -4.098  18.363 1.00   24.04 ? 100  VAL A CB  1 
ATOM   812  C CG1 . VAL A 1 100 ? 15.333 -2.598  18.204 1.00   25.03 ? 100  VAL A CG1 1 
ATOM   813  C CG2 . VAL A 1 100 ? 14.501 -4.906  17.973 1.00   25.63 ? 100  VAL A CG2 1 
ATOM   814  N N   . THR A 1 101 ? 16.322 -4.681  15.247 1.00   20.35 ? 101  THR A N   1 
ATOM   815  C CA  . THR A 1 101 ? 15.974 -4.190  13.923 1.00   19.11 ? 101  THR A CA  1 
ATOM   816  C C   . THR A 1 101 ? 14.457 -4.123  13.867 1.00   17.38 ? 101  THR A C   1 
ATOM   817  O O   . THR A 1 101 ? 13.768 -4.600  14.760 1.00   17.49 ? 101  THR A O   1 
ATOM   818  C CB  . THR A 1 101 ? 16.423 -5.147  12.860 1.00   19.51 ? 101  THR A CB  1 
ATOM   819  O OG1 . THR A 1 101 ? 15.994 -6.471  13.206 1.00   22.37 ? 101  THR A OG1 1 
ATOM   820  C CG2 . THR A 1 101 ? 17.961 -5.170  12.744 1.00   21.29 ? 101  THR A CG2 1 
ATOM   821  N N   . LEU A 1 102 ? 13.938 -3.525  12.810 1.00   15.25 ? 102  LEU A N   1 
ATOM   822  C CA  . LEU A 1 102 ? 12.532 -3.486  12.573 1.00   14.97 ? 102  LEU A CA  1 
ATOM   823  C C   . LEU A 1 102 ? 12.175 -4.796  11.887 1.00   14.74 ? 102  LEU A C   1 
ATOM   824  O O   . LEU A 1 102 ? 11.956 -4.849  10.658 1.00   14.35 ? 102  LEU A O   1 
ATOM   825  C CB  . LEU A 1 102 ? 12.230 -2.269  11.703 1.00   14.75 ? 102  LEU A CB  1 
ATOM   826  C CG  . LEU A 1 102 ? 12.618 -0.951  12.375 1.00   14.89 ? 102  LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 102 ? 12.196 0.271   11.459 1.00   16.69 ? 102  LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 102 ? 12.064 -0.703  13.835 1.00   14.17 ? 102  LEU A CD2 1 
ATOM   829  N N   . ALA A 1 103 ? 12.093 -5.859  12.678 1.00   14.34 ? 103  ALA A N   1 
ATOM   830  C CA  . ALA A 1 103 ? 11.984 -7.200  12.141 1.00   14.67 ? 103  ALA A CA  1 
ATOM   831  C C   . ALA A 1 103 ? 10.622 -7.711  11.831 1.00   14.90 ? 103  ALA A C   1 
ATOM   832  O O   . ALA A 1 103 ? 10.452 -8.424  10.859 1.00   14.57 ? 103  ALA A O   1 
ATOM   833  C CB  . ALA A 1 103 ? 12.699 -8.206  13.104 1.00   15.42 ? 103  ALA A CB  1 
ATOM   834  N N   . TYR A 1 104 ? 9.650  -7.401  12.672 1.00   14.99 ? 104  TYR A N   1 
ATOM   835  C CA  . TYR A 1 104 ? 8.348  -8.001  12.546 1.00   15.50 ? 104  TYR A CA  1 
ATOM   836  C C   . TYR A 1 104 ? 7.254  -6.960  12.547 1.00   15.22 ? 104  TYR A C   1 
ATOM   837  O O   . TYR A 1 104 ? 6.967  -6.429  13.614 1.00   15.35 ? 104  TYR A O   1 
ATOM   838  C CB  . TYR A 1 104 ? 8.115  -8.946  13.735 1.00   16.57 ? 104  TYR A CB  1 
ATOM   839  C CG  . TYR A 1 104 ? 9.208  -9.967  13.901 1.00   17.09 ? 104  TYR A CG  1 
ATOM   840  C CD1 . TYR A 1 104 ? 10.092 -9.907  14.970 1.00   21.63 ? 104  TYR A CD1 1 
ATOM   841  C CD2 . TYR A 1 104 ? 9.385  -10.939 12.960 1.00   22.42 ? 104  TYR A CD2 1 
ATOM   842  C CE1 . TYR A 1 104 ? 11.156 -10.837 15.081 1.00   23.50 ? 104  TYR A CE1 1 
ATOM   843  C CE2 . TYR A 1 104 ? 10.415 -11.858 13.060 1.00   26.28 ? 104  TYR A CE2 1 
ATOM   844  C CZ  . TYR A 1 104 ? 11.290 -11.799 14.114 1.00   27.34 ? 104  TYR A CZ  1 
ATOM   845  O OH  . TYR A 1 104 ? 12.288 -12.749 14.188 1.00   32.94 ? 104  TYR A OH  1 
ATOM   846  N N   . PRO A 1 105 ? 6.652  -6.655  11.396 1.00   14.52 ? 105  PRO A N   1 
ATOM   847  C CA  . PRO A 1 105 ? 5.500  -5.729  11.335 1.00   13.98 ? 105  PRO A CA  1 
ATOM   848  C C   . PRO A 1 105 ? 4.394  -6.227  12.246 1.00   14.82 ? 105  PRO A C   1 
ATOM   849  O O   . PRO A 1 105 ? 4.131  -7.438  12.238 1.00   16.01 ? 105  PRO A O   1 
ATOM   850  C CB  . PRO A 1 105 ? 5.060  -5.813  9.885  1.00   14.39 ? 105  PRO A CB  1 
ATOM   851  C CG  . PRO A 1 105 ? 6.255  -6.298  9.171  1.00   16.17 ? 105  PRO A CG  1 
ATOM   852  C CD  . PRO A 1 105 ? 7.005  -7.161  10.061 1.00   14.66 ? 105  PRO A CD  1 
ATOM   853  N N   . VAL A 1 106 ? 3.770  -5.347  13.001 1.00   14.21 ? 106  VAL A N   1 
ATOM   854  C CA  . VAL A 1 106 ? 2.770  -5.717  13.998 1.00   15.82 ? 106  VAL A CA  1 
ATOM   855  C C   . VAL A 1 106 ? 1.619  -6.538  13.408 1.00   18.16 ? 106  VAL A C   1 
ATOM   856  O O   . VAL A 1 106 ? 1.128  -7.441  14.092 1.00   18.24 ? 106  VAL A O   1 
ATOM   857  C CB  . VAL A 1 106 ? 2.237  -4.456  14.753 1.00   16.27 ? 106  VAL A CB  1 
ATOM   858  C CG1 . VAL A 1 106 ? 1.437  -3.514  13.848 1.00   15.01 ? 106  VAL A CG1 1 
ATOM   859  C CG2 . VAL A 1 106 ? 1.415  -4.823  15.979 1.00   18.22 ? 106  VAL A CG2 1 
ATOM   860  N N   . TYR A 1 107 ? 1.224  -6.254  12.167 1.00   18.11 ? 107  TYR A N   1 
ATOM   861  C CA  . TYR A 1 107 ? 0.112  -6.954  11.518 1.00   21.38 ? 107  TYR A CA  1 
ATOM   862  C C   . TYR A 1 107 ? 0.492  -7.946  10.423 1.00   23.72 ? 107  TYR A C   1 
ATOM   863  O O   . TYR A 1 107 ? -0.383 -8.357  9.633  1.00   27.00 ? 107  TYR A O   1 
ATOM   864  C CB  . TYR A 1 107 ? -0.821 -5.942  10.881 1.00   20.24 ? 107  TYR A CB  1 
ATOM   865  C CG  . TYR A 1 107 ? -1.586 -5.030  11.808 1.00   19.82 ? 107  TYR A CG  1 
ATOM   866  C CD1 . TYR A 1 107 ? -1.607 -3.669  11.582 1.00   17.01 ? 107  TYR A CD1 1 
ATOM   867  C CD2 . TYR A 1 107 ? -2.345 -5.526  12.878 1.00   21.35 ? 107  TYR A CD2 1 
ATOM   868  C CE1 . TYR A 1 107 ? -2.279 -2.840  12.379 1.00   18.10 ? 107  TYR A CE1 1 
ATOM   869  C CE2 . TYR A 1 107 ? -3.053 -4.678  13.688 1.00   19.01 ? 107  TYR A CE2 1 
ATOM   870  C CZ  . TYR A 1 107 ? -3.042 -3.336  13.427 1.00   18.51 ? 107  TYR A CZ  1 
ATOM   871  O OH  . TYR A 1 107 ? -3.761 -2.429  14.184 1.00   20.62 ? 107  TYR A OH  1 
ATOM   872  N N   . ALA A 1 108 ? 1.741  -8.328  10.316 1.00   24.54 ? 108  ALA A N   1 
ATOM   873  C CA  . ALA A 1 108 ? 2.140  -9.289  9.279  1.00   27.64 ? 108  ALA A CA  1 
ATOM   874  C C   . ALA A 1 108 ? 1.575  -10.573 9.810  1.00   29.61 ? 108  ALA A C   1 
ATOM   875  O O   . ALA A 1 108 ? 2.146  -11.293 10.604 1.00   30.89 ? 108  ALA A O   1 
ATOM   876  C CB  . ALA A 1 108 ? 3.638  -9.396  9.182  1.00   26.73 ? 108  ALA A CB  1 
ATOM   877  N N   . GLN A 1 109 ? 0.412  -10.917 9.715  1.00   34.44 ? 109  GLN A N   1 
HETATM 878  N N   . PTR B 2 1   ? 10.534 10.629  24.353 1.00   19.88 ? 1    PTR B N   1 
HETATM 879  C CA  . PTR B 2 1   ? 11.003 9.683   23.281 1.00   20.73 ? 1    PTR B CA  1 
HETATM 880  C C   . PTR B 2 1   ? 12.461 9.346   23.468 1.00   21.06 ? 1    PTR B C   1 
HETATM 881  O O   . PTR B 2 1   ? 13.168 10.131  24.082 1.00   21.69 ? 1    PTR B O   1 
HETATM 882  C CB  . PTR B 2 1   ? 10.795 10.399  21.969 1.00   20.68 ? 1    PTR B CB  1 
HETATM 883  C CG  . PTR B 2 1   ? 9.349  10.531  21.547 1.00   18.73 ? 1    PTR B CG  1 
HETATM 884  C CD1 . PTR B 2 1   ? 8.610  11.695  21.788 1.00   18.99 ? 1    PTR B CD1 1 
HETATM 885  C CD2 . PTR B 2 1   ? 8.728  9.507   20.871 1.00   17.63 ? 1    PTR B CD2 1 
HETATM 886  C CE1 . PTR B 2 1   ? 7.305  11.806  21.384 1.00   19.04 ? 1    PTR B CE1 1 
HETATM 887  C CE2 . PTR B 2 1   ? 7.441  9.607   20.448 1.00   16.63 ? 1    PTR B CE2 1 
HETATM 888  C CZ  . PTR B 2 1   ? 6.712  10.756  20.697 1.00   18.99 ? 1    PTR B CZ  1 
HETATM 889  O OH  . PTR B 2 1   ? 5.563  10.847  20.255 1.00   19.81 ? 1    PTR B OH  1 
HETATM 890  P P   . PTR B 2 1   ? 4.215  10.314  20.964 1.00   19.71 ? 1    PTR B P   1 
HETATM 891  O O1P . PTR B 2 1   ? 4.533  8.999   21.583 1.00   16.47 ? 1    PTR B O1P 1 
HETATM 892  O O2P . PTR B 2 1   ? 3.190  10.228  19.806 1.00   19.63 ? 1    PTR B O2P 1 
HETATM 893  O O3P . PTR B 2 1   ? 3.889  11.310  22.068 1.00   22.24 ? 1    PTR B O3P 1 
ATOM   894  N N   . VAL B 2 2   ? 12.895 8.196   22.975 1.00   20.22 ? 2    VAL B N   1 
ATOM   895  C CA  . VAL B 2 2   ? 14.280 7.814   23.083 1.00   20.46 ? 2    VAL B CA  1 
ATOM   896  C C   . VAL B 2 2   ? 15.179 8.766   22.270 1.00   20.42 ? 2    VAL B C   1 
ATOM   897  O O   . VAL B 2 2   ? 14.971 8.953   21.082 1.00   19.60 ? 2    VAL B O   1 
ATOM   898  C CB  . VAL B 2 2   ? 14.512 6.376   22.596 1.00   21.41 ? 2    VAL B CB  1 
ATOM   899  C CG1 . VAL B 2 2   ? 15.980 5.991   22.715 1.00   22.46 ? 2    VAL B CG1 1 
ATOM   900  C CG2 . VAL B 2 2   ? 13.685 5.403   23.419 1.00   23.72 ? 2    VAL B CG2 1 
ATOM   901  N N   . PRO B 2 3   ? 16.175 9.341   22.917 1.00   19.27 ? 3    PRO B N   1 
ATOM   902  C CA  . PRO B 2 3   ? 17.128 10.224  22.237 1.00   19.46 ? 3    PRO B CA  1 
ATOM   903  C C   . PRO B 2 3   ? 17.869 9.467   21.147 1.00   19.04 ? 3    PRO B C   1 
ATOM   904  O O   . PRO B 2 3   ? 18.407 8.397   21.400 1.00   21.29 ? 3    PRO B O   1 
ATOM   905  C CB  . PRO B 2 3   ? 18.104 10.627  23.380 1.00   20.75 ? 3    PRO B CB  1 
ATOM   906  C CG  . PRO B 2 3   ? 17.368 10.399  24.582 1.00   21.15 ? 3    PRO B CG  1 
ATOM   907  C CD  . PRO B 2 3   ? 16.528 9.149   24.333 1.00   19.61 ? 3    PRO B CD  1 
ATOM   908  N N   . MET B 2 4   ? 17.913 10.001  19.935 1.00   19.11 ? 4    MET B N   1 
ATOM   909  C CA  . MET B 2 4   ? 18.599 9.308   18.827 1.00   19.01 ? 4    MET B CA  1 
ATOM   910  C C   . MET B 2 4   ? 19.718 10.223  18.329 1.00   19.56 ? 4    MET B C   1 
ATOM   911  O O   . MET B 2 4   ? 19.478 11.412  18.097 1.00   21.42 ? 4    MET B O   1 
ATOM   912  C CB  . MET B 2 4   ? 17.624 8.993   17.676 1.00   19.03 ? 4    MET B CB  1 
ATOM   913  C CG  . MET B 2 4   ? 16.478 8.108   18.105 1.00   19.63 ? 4    MET B CG  1 
ATOM   914  S SD  . MET B 2 4   ? 16.877 6.481   18.458 1.00   23.52 ? 4    MET B SD  1 
ATOM   915  C CE  . MET B 2 4   ? 16.615 5.769   16.839 1.00   19.21 ? 4    MET B CE  1 
ATOM   916  N N   . LEU B 2 5   ? 20.918 9.697   18.265 1.00   19.79 ? 5    LEU B N   1 
ATOM   917  C CA  . LEU B 2 5   ? 22.051 10.443  17.728 1.00   21.92 ? 5    LEU B CA  1 
ATOM   918  C C   . LEU B 2 5   ? 22.548 9.825   16.429 1.00   22.50 ? 5    LEU B C   1 
ATOM   919  O O   . LEU B 2 5   ? 22.215 8.691   15.990 1.00   24.40 ? 5    LEU B O   1 
ATOM   920  C CB  . LEU B 2 5   ? 23.206 10.459  18.737 1.00   22.38 ? 5    LEU B CB  1 
ATOM   921  C CG  . LEU B 2 5   ? 22.992 11.257  20.020 1.00   24.06 ? 5    LEU B CG  1 
ATOM   922  C CD1 . LEU B 2 5   ? 24.208 11.067  20.955 1.00   26.92 ? 5    LEU B CD1 1 
ATOM   923  C CD2 . LEU B 2 5   ? 22.802 12.724  19.741 1.00   28.14 ? 5    LEU B CD2 1 
ATOM   924  O OXT . LEU B 2 5   ? 23.429 10.441  15.804 1.00   21.52 ? 5    LEU B OXT 1 
HETATM 925  O O   . HOH C 3 .   ? 9.961  -13.452 5.805  1.00   42.61 ? 2001 HOH A O   1 
HETATM 926  O O   . HOH C 3 .   ? 4.284  -6.888  -1.048 1.00   40.90 ? 2002 HOH A O   1 
HETATM 927  O O   . HOH C 3 .   ? 5.242  -8.316  1.128  1.00   44.74 ? 2003 HOH A O   1 
HETATM 928  O O   . HOH C 3 .   ? -4.337 0.045   10.697 1.00   35.66 ? 2004 HOH A O   1 
HETATM 929  O O   . HOH C 3 .   ? -1.992 -6.736  4.757  1.00   33.08 ? 2005 HOH A O   1 
HETATM 930  O O   . HOH C 3 .   ? -2.579 -4.148  1.406  1.00   46.62 ? 2006 HOH A O   1 
HETATM 931  O O   . HOH C 3 .   ? -0.154 -1.173  1.718  1.00   53.75 ? 2007 HOH A O   1 
HETATM 932  O O   . HOH C 3 .   ? 2.378  -1.107  0.419  1.00   23.29 ? 2008 HOH A O   1 
HETATM 933  O O   . HOH C 3 .   ? 2.472  6.442   3.419  1.00   40.31 ? 2009 HOH A O   1 
HETATM 934  O O   . HOH C 3 .   ? 5.894  4.786   2.609  1.00   19.83 ? 2010 HOH A O   1 
HETATM 935  O O   . HOH C 3 .   ? 3.263  2.074   0.408  1.00   42.89 ? 2011 HOH A O   1 
HETATM 936  O O   . HOH C 3 .   ? 2.273  -1.237  31.177 1.00   42.12 ? 2012 HOH A O   1 
HETATM 937  O O   . HOH C 3 .   ? -2.341 -0.762  8.810  1.00   20.05 ? 2013 HOH A O   1 
HETATM 938  O O   . HOH C 3 .   ? -3.904 0.316   6.841  1.00   41.01 ? 2014 HOH A O   1 
HETATM 939  O O   . HOH C 3 .   ? 17.302 -12.036 13.901 1.00   55.11 ? 2015 HOH A O   1 
HETATM 940  O O   . HOH C 3 .   ? -2.149 4.011   7.607  1.00   44.62 ? 2016 HOH A O   1 
HETATM 941  O O   . HOH C 3 .   ? -4.685 13.137  14.249 1.00   47.04 ? 2017 HOH A O   1 
HETATM 942  O O   . HOH C 3 .   ? -4.509 7.787   9.532  1.00   51.12 ? 2018 HOH A O   1 
HETATM 943  O O   . HOH C 3 .   ? -5.564 6.288   18.715 1.00   33.71 ? 2019 HOH A O   1 
HETATM 944  O O   . HOH C 3 .   ? 3.998  6.794   27.880 1.00   60.28 ? 2020 HOH A O   1 
HETATM 945  O O   B HOH C 3 .   ? -2.448 9.415   26.946 0.50   36.02 ? 2021 HOH A O   1 
HETATM 946  O O   . HOH C 3 .   ? -0.027 8.384   26.360 1.00   45.78 ? 2022 HOH A O   1 
HETATM 947  O O   . HOH C 3 .   ? -1.747 8.117   23.962 1.00   29.28 ? 2023 HOH A O   1 
HETATM 948  O O   . HOH C 3 .   ? -7.529 -1.194  16.083 1.00   34.04 ? 2024 HOH A O   1 
HETATM 949  O O   . HOH C 3 .   ? 21.196 17.596  4.782  1.00   38.79 ? 2025 HOH A O   1 
HETATM 950  O O   . HOH C 3 .   ? 6.219  8.371   0.635  1.00   50.93 ? 2026 HOH A O   1 
HETATM 951  O O   . HOH C 3 .   ? 0.398  0.906   27.843 1.00   39.82 ? 2027 HOH A O   1 
HETATM 952  O O   . HOH C 3 .   ? 5.441  4.425   27.501 1.00   49.24 ? 2028 HOH A O   1 
HETATM 953  O O   . HOH C 3 .   ? 2.644  -2.694  25.829 1.00   35.71 ? 2029 HOH A O   1 
HETATM 954  O O   . HOH C 3 .   ? 25.178 8.913   3.485  1.00   45.78 ? 2030 HOH A O   1 
HETATM 955  O O   . HOH C 3 .   ? -6.110 -1.628  26.970 1.00   49.74 ? 2031 HOH A O   1 
HETATM 956  O O   . HOH C 3 .   ? 5.369  -5.483  24.560 1.00   67.17 ? 2032 HOH A O   1 
HETATM 957  O O   . HOH C 3 .   ? 1.973  -4.574  30.541 1.00   54.41 ? 2033 HOH A O   1 
HETATM 958  O O   . HOH C 3 .   ? 4.070  -6.737  26.801 1.00   40.46 ? 2034 HOH A O   1 
HETATM 959  O O   . HOH C 3 .   ? 24.882 -7.457  3.541  1.00   51.52 ? 2035 HOH A O   1 
HETATM 960  O O   . HOH C 3 .   ? -2.020 -9.986  19.192 1.00   47.28 ? 2036 HOH A O   1 
HETATM 961  O O   . HOH C 3 .   ? 13.606 -15.651 15.181 1.00   44.06 ? 2037 HOH A O   1 
HETATM 962  O O   B HOH C 3 .   ? 10.374 -14.837 15.899 0.50   26.63 ? 2038 HOH A O   1 
HETATM 963  O O   . HOH C 3 .   ? 14.842 -12.433 16.425 1.00   45.23 ? 2039 HOH A O   1 
HETATM 964  O O   . HOH C 3 .   ? 5.193  -11.716 18.640 1.00   31.45 ? 2040 HOH A O   1 
HETATM 965  O O   . HOH C 3 .   ? 25.207 5.368   20.056 1.00   56.86 ? 2041 HOH A O   1 
HETATM 966  O O   . HOH C 3 .   ? 15.422 -6.822  22.095 1.00   52.43 ? 2042 HOH A O   1 
HETATM 967  O O   . HOH C 3 .   ? 13.645 -10.390 25.469 1.00   37.70 ? 2043 HOH A O   1 
HETATM 968  O O   . HOH C 3 .   ? 11.194 -11.718 22.143 1.00   36.22 ? 2044 HOH A O   1 
HETATM 969  O O   . HOH C 3 .   ? 6.940  -11.737 10.061 1.00   34.61 ? 2045 HOH A O   1 
HETATM 970  O O   . HOH C 3 .   ? 5.488  -10.246 16.251 1.00   35.66 ? 2046 HOH A O   1 
HETATM 971  O O   . HOH C 3 .   ? 1.510  -10.760 6.117  1.00   53.59 ? 2047 HOH A O   1 
HETATM 972  O O   . HOH C 3 .   ? -2.416 11.385  14.679 1.00   38.19 ? 2048 HOH A O   1 
HETATM 973  O O   . HOH C 3 .   ? 0.885  19.912  18.527 1.00   41.16 ? 2049 HOH A O   1 
HETATM 974  O O   . HOH C 3 .   ? 10.850 17.542  23.217 1.00   56.22 ? 2050 HOH A O   1 
HETATM 975  O O   . HOH C 3 .   ? 5.506  22.039  12.955 1.00   60.24 ? 2051 HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? 9.025  16.235  11.160 1.00   41.85 ? 2052 HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? 2.823  13.612  11.047 1.00   39.29 ? 2053 HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? 8.548  3.714   26.257 1.00   38.11 ? 2054 HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? 6.330  -2.236  27.482 1.00   34.84 ? 2055 HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? 10.123 5.118   24.809 1.00   19.06 ? 2056 HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? 14.494 10.576  16.612 1.00   23.90 ? 2057 HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? 8.141  12.711  10.493 1.00   47.02 ? 2058 HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? 14.878 13.221  16.867 1.00   46.51 ? 2059 HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? 10.524 19.275  9.218  1.00   50.85 ? 2060 HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? 14.312 20.937  6.036  1.00   41.82 ? 2061 HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? 18.124 16.817  6.344  1.00   44.88 ? 2062 HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? 5.754  11.626  2.016  1.00   52.09 ? 2063 HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? 17.541 13.221  16.328 1.00   35.09 ? 2064 HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? 19.549 15.086  14.266 1.00   34.20 ? 2065 HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? 20.190 14.086  7.120  1.00   25.07 ? 2066 HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? 24.823 11.486  5.338  1.00   48.46 ? 2067 HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? 22.599 14.395  5.248  1.00   40.44 ? 2068 HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? 17.598 7.196   -0.051 1.00   25.60 ? 2069 HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? 11.095 13.096  1.018  1.00   33.46 ? 2070 HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? 15.333 11.360  0.078  1.00   31.91 ? 2071 HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? 6.062  7.820   3.204  1.00   17.18 ? 2072 HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? 7.374  -2.465  -2.060 1.00   25.03 ? 2073 HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? 15.120 7.396   -1.959 1.00   33.89 ? 2074 HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? 15.759 1.333   1.945  1.00   24.22 ? 2075 HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 13.925 6.696   -4.401 1.00   49.06 ? 2076 HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? 8.936  3.634   -1.296 1.00   44.75 ? 2077 HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? 15.158 -4.774  3.773  1.00   31.36 ? 2078 HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 22.431 3.225   8.572  1.00   32.53 ? 2079 HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? 19.933 0.306   2.758  1.00   54.93 ? 2080 HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 20.442 5.561   8.187  1.00   22.07 ? 2081 HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? 17.757 7.631   9.928  1.00   18.46 ? 2082 HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? 17.132 -7.324  4.378  1.00   39.95 ? 2083 HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 17.178 -3.045  1.725  1.00   49.14 ? 2084 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 21.511 -4.711  3.619  1.00   41.12 ? 2085 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? 22.925 -4.158  12.183 1.00   38.13 ? 2086 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 23.587 0.113   13.324 1.00   32.38 ? 2087 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? 27.056 0.926   18.139 1.00   42.80 ? 2088 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? 24.214 6.848   13.742 1.00   45.61 ? 2089 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 26.581 6.248   16.746 1.00   49.05 ? 2090 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 22.796 7.595   21.604 1.00   40.87 ? 2091 HOH A O   1 
HETATM 1016 O O   B HOH C 3 .   ? 25.846 4.613   26.960 0.50   35.66 ? 2092 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 16.629 -1.203  25.989 1.00   53.89 ? 2093 HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 17.802 2.534   28.102 1.00   50.96 ? 2094 HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? 23.738 -7.694  17.725 1.00   36.18 ? 2095 HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? 15.659 -7.943  11.154 1.00   34.95 ? 2096 HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 15.841 -7.351  15.866 1.00   38.14 ? 2097 HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? 12.631 -9.484  9.358  1.00   20.64 ? 2098 HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? 9.195  -10.298 9.319  1.00   32.95 ? 2099 HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? -1.157 -8.402  15.430 1.00   32.05 ? 2100 HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? -4.679 -0.196  13.134 1.00   33.20 ? 2101 HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? -0.947 -9.901  7.457  1.00   43.55 ? 2102 HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 0.379  -14.462 9.171  1.00   52.32 ? 2103 HOH A O   1 
HETATM 1028 O O   . HOH D 3 .   ? 14.443 12.292  22.727 1.00   39.37 ? 2001 HOH B O   1 
HETATM 1029 O O   . HOH D 3 .   ? 5.016  12.086  24.394 1.00   40.35 ? 2002 HOH B O   1 
HETATM 1030 O O   . HOH D 3 .   ? 0.466  9.846   20.788 1.00   26.59 ? 2003 HOH B O   1 
HETATM 1031 O O   . HOH D 3 .   ? 2.156  10.739  24.117 1.00   38.56 ? 2004 HOH B O   1 
HETATM 1032 O O   . HOH D 3 .   ? 16.343 14.342  22.066 1.00   50.62 ? 2005 HOH B O   1 
HETATM 1033 O O   . HOH D 3 .   ? 13.351 10.047  19.173 1.00   20.21 ? 2006 HOH B O   1 
HETATM 1034 O O   . HOH D 3 .   ? 23.334 12.846  14.949 1.00   21.89 ? 2007 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   HIS 6   6   6   HIS HIS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  TRP 12  12  12  TRP TRP A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  HIS 94  94  94  HIS HIS A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 GLN 110 110 ?   ?   ?   A . n 
A 1 111 ARG 111 111 ?   ?   ?   A . n 
A 1 112 ARG 112 112 ?   ?   ?   A . n 
B 2 1   PTR 1   1   1   PTR PTR B . n 
B 2 2   VAL 2   2   2   VAL VAL B . n 
B 2 3   PRO 3   3   3   PRO PRO B . n 
B 2 4   MET 4   4   4   MET MET B . n 
B 2 5   LEU 5   5   5   LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
D 3 HOH 1   2001 2001 HOH HOH B . 
D 3 HOH 2   2002 2002 HOH HOH B . 
D 3 HOH 3   2003 2003 HOH HOH B . 
D 3 HOH 4   2004 2004 HOH HOH B . 
D 3 HOH 5   2005 2005 HOH HOH B . 
D 3 HOH 6   2006 2006 HOH HOH B . 
D 3 HOH 7   2007 2007 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     1 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      1 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 970    ? 
1 MORE         -10.74 ? 
1 'SSA (A^2)'  6130   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-19 
2 'Structure model' 1 1 2011-05-07 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       . ? 1 
XDS    'data reduction' . ? 2 
XDS    'data scaling'   . ? 3 
AMoRE  phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1H9O 
_pdbx_entry_details.compound_details     
;PHOSPHATIDYLINOSITOL 3-KINASE ACTIVATES (PHOSPHORYLATED)
 PROTEIN-TYROSINE KINASES, THROUGH ITS SH2 DOMAIN
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OD1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     20 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASN 
_pdbx_validate_symm_contact.auth_seq_id_2     20 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_556 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG A ARG 30  ? A CD A ARG 30  ? A NE  A ARG 30  ? A 126.64 111.80 14.84  2.10 N 
2 1 CD A ARG 30  ? A NE A ARG 30  ? A CZ  A ARG 30  ? A 136.25 123.60 12.65  1.40 N 
3 1 NE A ARG 30  ? A CZ A ARG 30  ? A NH1 A ARG 30  ? A 110.98 120.30 -9.32  0.50 N 
4 1 NE A ARG 30  ? B CZ A ARG 30  ? B NH1 A ARG 30  ? B 124.79 120.30 4.49   0.50 N 
5 1 NE A ARG 30  ? A CZ A ARG 30  ? A NH2 A ARG 30  ? A 130.46 120.30 10.16  0.50 N 
6 1 NE A ARG 30  ? B CZ A ARG 30  ? B NH2 A ARG 30  ? B 115.55 120.30 -4.75  0.50 N 
7 1 CB A ASP 52  ? ? CG A ASP 52  ? ? OD2 A ASP 52  ? ? 123.77 118.30 5.47   0.90 N 
8 1 CB A ASP 96  ? A CG A ASP 96  ? A OD2 A ASP 96  ? A 124.26 118.30 5.96   0.90 N 
9 1 O  A ALA 108 ? ? C  A ALA 108 ? ? N   A GLN 109 ? ? 109.44 122.70 -13.26 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 70 ? ? -178.02 149.46 
2 1 PRO A 72 ? ? -96.86  39.48  
3 1 ASN A 95 ? ? -166.91 118.90 
4 1 LEU A 98 ? ? -102.92 63.22  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2035 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.69 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 109 ? CA  ? A GLN 109 CA  
2 1 Y 1 A GLN 109 ? C   ? A GLN 109 C   
3 1 Y 1 A GLN 109 ? O   ? A GLN 109 O   
4 1 Y 1 A GLN 109 ? CB  ? A GLN 109 CB  
5 1 Y 1 A GLN 109 ? CG  ? A GLN 109 CG  
6 1 Y 1 A GLN 109 ? CD  ? A GLN 109 CD  
7 1 Y 1 A GLN 109 ? OE1 ? A GLN 109 OE1 
8 1 Y 1 A GLN 109 ? NE2 ? A GLN 109 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLN 110 ? A GLN 110 
2 1 Y 1 A ARG 111 ? A ARG 111 
3 1 Y 1 A ARG 112 ? A ARG 112 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#