data_1HBJ
# 
_entry.id   1HBJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HBJ         
PDBE  EBI-6052     
WWPDB D_1290006052 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI-ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL-PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HBJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Greenblatt, H.M.' 1 ? 
'Kryger, G.'       2 ? 
'Lewis, T.L.'      3 ? 
'Doucet, C.'       4 ? 
'Viner, R.'        5 ? 
'Silman, I.'       6 ? 
'Sussman, J.L.'    7 ? 
# 
_citation.id                        primary 
_citation.title                     'A Structure-Based Design Approach to the Development of Novel, Reversible Ache Inhibitors' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            44 
_citation.page_first                3203 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11563919 
_citation.pdbx_database_id_DOI      10.1021/JM010826R 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Doucet-Personeni, C.' 1  ? 
primary 'Bentley, P.D.'        2  ? 
primary 'Fletcher, R.J.'       3  ? 
primary 'Kinkaid, A.'          4  ? 
primary 'Kryger, G.'           5  ? 
primary 'Pirard, B.'           6  ? 
primary 'Taylor, A.'           7  ? 
primary 'Taylor, R.'           8  ? 
primary 'Taylor, J.'           9  ? 
primary 'Viner, R.'            10 ? 
primary 'Silman, I.'           11 ? 
primary 'Sussman, J.L.'        12 ? 
primary 'Greenblatt, H.M.'     13 ? 
primary 'Lewis, T.L.'          14 ? 
# 
_cell.entry_id           1HBJ 
_cell.length_a           112.332 
_cell.length_b           112.332 
_cell.length_c           137.073 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HBJ 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                                        
61325.090 1   3.1.1.7 ? 'GPI-ANCHOR REMOVED, RESIDUES 22-564' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                                                                                      
221.208   3   ?       ? ?                                     ? 
3 non-polymer syn '1-[3-({[(4-AMINO-5-FLUORO-2-METHYLQUINOLIN-3-YL)METHYL]THIO}METHYL)PHENYL]-2,2,2-TRIFLUOROETHANE-1,1-DIOL' 
426.428   1   ?       ? ?                                     ? 
4 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                                      
195.237   1   ?       ? ?                                     ? 
5 non-polymer syn 'TETRAETHYLENE GLYCOL'                                                                                      
194.226   1   ?       ? ?                                     ? 
6 water       nat water                                                                                                       
18.015    171 ?       ? ?                                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HBJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                          'C3 H7 N O2'         
89.093  
ARG 'L-peptide linking' y ARGININE ?                                                                          'C6 H15 N4 O2 1'     
175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                                                          'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                          'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE ?                                                                          'C3 H7 N O2 S'       
121.158 
FBQ non-polymer         . 
'1-[3-({[(4-AMINO-5-FLUORO-2-METHYLQUINOLIN-3-YL)METHYL]THIO}METHYL)PHENYL]-2,2,2-TRIFLUOROETHANE-1,1-DIOL' 
'4-AMINO-5-FLUORO-2-METHYL-3-(3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE' 'C20 H18 F4 N2 O2 S' 426.428 
GLN 'L-peptide linking' y GLUTAMINE ?                                                                          'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                          'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE ?                                                                          'C2 H5 N O2'         
75.067  
HIS 'L-peptide linking' y HISTIDINE ?                                                                          'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER ?                                                                          'H2 O'               
18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                          'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE ?                                                                          'C6 H13 N O2'        
131.173 
LYS 'L-peptide linking' y LYSINE ?                                                                          'C6 H15 N2 O2 1'     
147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'      195.237 
MET 'L-peptide linking' y METHIONINE ?                                                                          'C5 H11 N O2 S' 
149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ?                                                                          
'C8 H15 N O6'        221.208 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL' ?                                                                          
'C8 H18 O5'          194.226 
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                          'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE ?                                                                          'C5 H9 N O2'         
115.130 
SER 'L-peptide linking' y SERINE ?                                                                          'C3 H7 N O3'         
105.093 
THR 'L-peptide linking' y THREONINE ?                                                                          'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                          'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE ?                                                                          'C9 H11 N O3'        
181.189 
VAL 'L-peptide linking' y VALINE ?                                                                          'C5 H11 N O2'        
117.146 
# 
_exptl.entry_id          1HBJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   68.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLISED FROM 35-40% W/V PEG 200 0.1M MES PH 5.8 4 DEG. CELSIUS' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1997-02-05 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1HBJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.300 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   34410 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.04100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.2000 
_reflns.B_iso_Wilson_estimate        38.3 
_reflns.pdbx_redundancy              3.700 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           0.19000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.70 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1HBJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34410 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1804041.21 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.31 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.214 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1690 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.9 
_refine.aniso_B[1][1]                            5.73 
_refine.aniso_B[2][2]                            5.73 
_refine.aniso_B[3][3]                            -11.46 
_refine.aniso_B[1][2]                            6.58 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.341126 
_refine.solvent_model_param_bsol                 30.2696 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE C-TERMINAL RESIDUE WAS NOT SEEN IN THE DENSITY MAPS STRUCTURE WAS NOT SEARCHED EXHAUSTIVELY FOR WATER MOLECULES. ATTENTION WAS FOCUSED ON ACTIVE SITE.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1HBJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         95 
_refine_hist.number_atoms_solvent             171 
_refine_hist.number_atoms_total               4510 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        29.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.021 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.42  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.32  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.65  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.65  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             5021 
_refine_ls_shell.R_factor_R_work                  0.217 
_refine_ls_shell.percent_reflns_obs               92.1 
_refine_ls_shell.R_factor_R_free                  0.273 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             271 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 3 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 4 Z435_MES_PEG.PARAM Z435_MES_PEG.TOP 
# 
_struct.entry_id                  1HBJ 
_struct.title                     
;X-ray Crystal structure of complex between Torpedo californica AChE and a reversible inhibitor, 4-Amino-5-fluoro-2-methyl-3-(3-trifluoroacetylbenzylthiomethyl)quinoline
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HBJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SERINE HYDROLASE, CHOLINESTERASE, INSECTICIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  2A  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  3A  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  4A  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  5A  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  6A  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  7A  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  8A  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  9A  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 10A ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 11A ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 12A GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 13A GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 14A ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 15A VAL A 518 ? THR A 535 ? VAL A 518 THR A 535 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG  ? ? A CYS 67   A CYS 94   1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG  ? ? A CYS 254  A CYS 265  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG  ? ? A CYS 402  A CYS 521  1_555 ? ? ? ? ? ? ? 2.027 ? 
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 B NAG .   C1  ? ? A ASN 59   A NAG 1536 1_555 ? ? ? ? ? ? ? 1.483 ? 
covale2 covale one  ? A SER 200 OG  ? ? ? 1_555 E FBQ .   C21 ? ? A SER 200  A FBQ 1539 1_555 ? ? ? ? ? ? ? 1.430 ? 
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 C NAG .   C1  ? ? A ASN 416  A NAG 1537 1_555 ? ? ? ? ? ? ? 1.454 ? 
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 D NAG .   C1  ? ? A NAG 1537 A NAG 1538 1_555 ? ? ? ? ? ? ? 1.395 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.70 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MES A 1540'                                                      
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PG4 A 1541'                                                      
AC3 Software ? ? ? ? 2  'Binding site for Mono-Saccharide NAG A1536 bound to ASN A 59'                             
AC4 Software ? ? ? ? 19 'Binding site for Ligand FBQ A1539 bound to SER A 200'                                     
AC5 Software ? ? ? ? 2  'Binding site for Poly-Saccharide residues NAG A1537 through NAG A1538 bound to ASN A 416' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 MET A 405 ? MET A 405  . ? 1_555 ? 
2  AC1 10 HIS A 406 ? HIS A 406  . ? 1_555 ? 
3  AC1 10 ASN A 409 ? ASN A 409  . ? 1_555 ? 
4  AC1 10 GLN A 500 ? GLN A 500  . ? 1_555 ? 
5  AC1 10 ARG A 515 ? ARG A 515  . ? 1_555 ? 
6  AC1 10 CYS A 521 ? CYS A 521  . ? 1_555 ? 
7  AC1 10 ASN A 525 ? ASN A 525  . ? 1_555 ? 
8  AC1 10 GLN A 526 ? GLN A 526  . ? 1_555 ? 
9  AC1 10 HOH H .   ? HOH A 2169 . ? 1_555 ? 
10 AC1 10 HOH H .   ? HOH A 2170 . ? 1_555 ? 
11 AC2 5  TYR A 121 ? TYR A 121  . ? 1_555 ? 
12 AC2 5  TRP A 279 ? TRP A 279  . ? 1_555 ? 
13 AC2 5  PHE A 330 ? PHE A 330  . ? 1_555 ? 
14 AC2 5  TYR A 334 ? TYR A 334  . ? 1_555 ? 
15 AC2 5  HOH H .   ? HOH A 2100 . ? 1_555 ? 
16 AC3 2  ASN A 59  ? ASN A 59   . ? 1_555 ? 
17 AC3 2  SER A 61  ? SER A 61   . ? 1_555 ? 
18 AC4 19 TRP A 84  ? TRP A 84   . ? 1_555 ? 
19 AC4 19 GLY A 117 ? GLY A 117  . ? 1_555 ? 
20 AC4 19 GLY A 118 ? GLY A 118  . ? 1_555 ? 
21 AC4 19 GLY A 119 ? GLY A 119  . ? 1_555 ? 
22 AC4 19 TYR A 121 ? TYR A 121  . ? 1_555 ? 
23 AC4 19 SER A 122 ? SER A 122  . ? 1_555 ? 
24 AC4 19 SER A 200 ? SER A 200  . ? 1_555 ? 
25 AC4 19 ALA A 201 ? ALA A 201  . ? 1_555 ? 
26 AC4 19 TRP A 233 ? TRP A 233  . ? 1_555 ? 
27 AC4 19 PHE A 288 ? PHE A 288  . ? 1_555 ? 
28 AC4 19 PHE A 290 ? PHE A 290  . ? 1_555 ? 
29 AC4 19 PHE A 330 ? PHE A 330  . ? 1_555 ? 
30 AC4 19 PHE A 331 ? PHE A 331  . ? 1_555 ? 
31 AC4 19 TRP A 432 ? TRP A 432  . ? 1_555 ? 
32 AC4 19 HIS A 440 ? HIS A 440  . ? 1_555 ? 
33 AC4 19 HOH H .   ? HOH A 2018 . ? 1_555 ? 
34 AC4 19 HOH H .   ? HOH A 2038 . ? 1_555 ? 
35 AC4 19 HOH H .   ? HOH A 2069 . ? 1_555 ? 
36 AC4 19 HOH H .   ? HOH A 2148 . ? 1_555 ? 
37 AC5 2  ASN A 416 ? ASN A 416  . ? 1_555 ? 
38 AC5 2  HOH H .   ? HOH A 2138 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HBJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HBJ 
_atom_sites.fract_transf_matrix[1][1]   0.008902 
_atom_sites.fract_transf_matrix[1][2]   0.005140 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010279 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007295 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.350 88.081 34.574 1.00 53.61 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.589 88.407 35.852 1.00 54.06 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.359 87.495 36.189 1.00 52.58 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.372 86.279 35.959 1.00 51.48 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.572 88.381 37.053 1.00 55.05 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.930 88.600 38.320 1.00 55.50 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.318 88.090 36.774 1.00 51.11 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.124  87.327 37.144 1.00 50.59 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.371  86.369 38.338 1.00 48.84 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.596  85.453 38.579 1.00 48.05 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.969  88.281 37.468 1.00 51.23 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.707  87.603 37.967 1.00 53.75 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.637  88.615 38.376 1.00 56.04 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.995  89.600 39.061 1.00 57.59 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.441  88.431 38.028 1.00 57.44 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.447 86.594 39.077 1.00 46.41 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.749 85.752 40.194 1.00 45.11 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.795 84.706 39.812 1.00 44.53 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.250 83.920 40.659 1.00 44.87 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.203 86.599 41.380 1.00 43.57 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.242 87.704 41.861 1.00 44.82 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -10.812 88.322 43.146 1.00 44.27 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.864  87.180 42.159 1.00 43.69 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.165 84.676 38.539 1.00 42.83 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.141 83.684 38.108 1.00 43.16 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.431 82.703 37.209 1.00 42.59 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.842 83.100 36.187 1.00 40.91 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.311 84.311 37.335 1.00 44.04 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.330 83.262 36.846 1.00 45.45 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.157 82.759 38.029 1.00 45.71 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.280 83.865 35.789 1.00 45.91 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.453 81.425 37.601 1.00 42.10 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.801 80.378 36.805 1.00 40.01 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.818 79.296 36.477 1.00 39.90 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.576 78.802 37.347 1.00 38.25 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.632 79.749 37.569 1.00 39.93 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.025 78.615 36.778 1.00 38.03 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.606  80.800 37.894 1.00 40.12 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.882 78.947 35.202 1.00 40.30 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.825 77.907 34.843 1.00 41.63 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.098 76.554 34.788 1.00 40.61 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.176 76.379 33.994 1.00 40.41 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.529 78.214 33.518 1.00 41.58 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.626 77.185 33.236 1.00 47.09 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.177 76.510 34.193 1.00 45.83 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.969 77.028 31.935 1.00 48.74 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.490 75.614 35.650 1.00 39.17 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.814 74.336 35.678 1.00 38.40 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.736 73.235 35.201 1.00 39.83 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.928 73.470 35.020 1.00 39.72 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.351 73.951 37.107 1.00 37.84 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.467 73.423 37.831 1.00 36.83 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.762 75.126 37.827 1.00 34.31 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.180 72.029 35.025 1.00 39.16 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.968 70.875 34.602 1.00 39.07 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.996 70.412 35.638 1.00 38.76 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.842 69.568 35.335 1.00 40.18 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -13.036 69.699 34.259 1.00 38.97 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.991 70.068 33.205 1.00 39.80 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.978 68.947 32.980 1.00 38.03 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.984  69.352 31.939 1.00 36.07 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.004  68.277 31.836 1.00 39.92 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.924 70.920 36.859 1.00 38.57 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.882 70.511 37.883 1.00 39.07 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.908 71.626 38.064 1.00 39.61 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.952 71.457 38.728 1.00 38.36 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.151 70.206 39.211 1.00 40.25 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.173 69.173 39.028 1.00 41.15 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.595 72.757 37.428 1.00 40.36 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.436 73.935 37.474 1.00 40.36 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.669 75.231 37.677 1.00 41.41 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.440 75.268 37.773 1.00 40.99 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.422 76.323 37.737 1.00 43.02 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.851 77.656 37.933 1.00 43.46 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.468 77.895 39.379 1.00 41.99 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.152 77.459 40.315 1.00 42.39 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.823 78.727 37.439 1.00 44.95 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.725 78.905 35.952 1.00 48.25 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.597 80.036 35.450 1.00 52.02 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.982 79.533 34.996 1.00 54.30 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -19.978 79.198 33.521 1.00 55.97 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.345 78.574 39.553 1.00 41.64 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.816 78.853 40.875 1.00 40.77 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.512 80.340 41.025 1.00 40.41 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.991 80.973 40.088 1.00 40.21 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.562 77.951 41.068 1.00 40.78 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.478 78.668 41.783 1.00 41.91 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.962 76.692 41.795 1.00 39.34 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.863 80.916 42.177 1.00 40.61 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.571 82.344 42.416 1.00 41.04 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.672 82.615 43.620 1.00 40.74 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.022 82.330 44.789 1.00 38.36 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.842 83.199 42.567 1.00 43.43 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.558 84.715 42.851 1.00 46.01 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.097 85.705 41.396 1.00 54.54 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -16.812 86.005 40.720 1.00 51.20 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.531 83.213 43.306 1.00 40.36 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.559 83.512 44.329 1.00 43.06 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.632 84.871 45.005 1.00 44.05 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.661 85.565 44.979 1.00 44.10 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.509 85.240 45.609 1.00 44.61 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.404 86.474 46.355 1.00 45.91 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.012  87.022 46.245 1.00 45.93 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.063  86.271 46.224 1.00 47.13 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.765 86.224 47.819 1.00 46.23 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.585 87.424 48.559 1.00 47.06 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.899  85.121 48.416 1.00 47.78 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.894  88.338 46.126 1.00 47.18 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.583  88.995 45.990 1.00 47.89 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.999  89.108 47.399 1.00 46.98 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.696  89.532 48.340 1.00 47.20 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.754  90.392 45.367 1.00 48.94 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.473  91.126 45.007 1.00 53.70 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.616  91.861 43.633 1.00 57.06 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.327  91.968 42.925 1.00 62.51 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.512  93.028 42.966 1.00 65.01 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.863  94.110 43.683 1.00 66.29 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.322  92.992 42.334 1.00 64.04 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.755  88.679 47.587 1.00 45.02 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.207  88.811 48.917 1.00 43.72 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.912  89.563 48.830 1.00 42.86 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.159  89.436 47.863 1.00 42.63 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.991  87.428 49.645 1.00 42.99 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.272  86.591 49.573 1.00 41.94 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.831  86.704 49.056 1.00 41.65 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.648  90.382 49.844 1.00 43.34 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.415  91.193 49.903 1.00 42.76 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.212  90.364 50.372 1.00 42.64 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.348  89.460 51.225 1.00 41.83 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.795  92.343 50.880 1.00 41.87 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.761  91.634 51.881 1.00 42.13 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.602  90.714 50.937 1.00 42.90 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.046  90.677 49.806 1.00 42.02 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.179   89.981 50.139 1.00 42.88 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.358   90.903 49.962 1.00 44.05 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.550   91.397 48.847 1.00 44.13 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.551   88.832 49.143 1.00 43.07 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.088   87.688 49.886 1.00 39.42 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.432   88.523 48.209 1.00 42.21 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.181   91.092 51.002 1.00 45.37 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.388   91.924 50.837 1.00 46.56 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.218   93.200 49.947 1.00 47.43 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 5.026   93.446 48.989 1.00 46.33 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.504   91.051 50.242 1.00 44.90 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.859   89.830 51.080 1.00 44.50 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.909   89.003 50.375 1.00 44.21 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.348   90.290 52.448 1.00 44.90 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.172   93.975 50.265 1.00 47.92 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.845   95.224 49.557 1.00 50.53 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.456   95.031 48.072 1.00 50.94 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.749   95.875 47.223 1.00 52.59 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.014   96.226 49.659 1.00 49.69 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.991   95.959 48.640 1.00 52.41 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.824   93.906 47.757 1.00 50.13 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.344   93.637 46.405 1.00 48.68 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.118   92.767 46.639 1.00 47.93 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.430  92.756 47.772 1.00 47.28 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.403   92.924 45.546 1.00 48.58 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.880   92.622 44.250 1.00 49.07 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.347  92.069 45.604 1.00 47.72 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.527  91.211 45.766 1.00 48.48 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.477  90.004 44.827 1.00 47.94 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.903  90.095 43.721 1.00 47.82 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.827  91.950 45.412 1.00 52.44 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.044  93.242 46.149 1.00 59.01 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.931  93.363 47.204 1.00 61.32 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -2.503  94.478 45.971 1.00 61.37 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.927  94.611 47.647 1.00 63.04 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -3.067  95.308 46.917 1.00 64.20 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.058  88.878 45.272 1.00 45.19 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.224  87.731 44.393 1.00 42.80 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.646  87.156 44.569 1.00 41.38 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.436  87.669 45.379 1.00 41.69 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.093  86.696 44.547 1.00 42.65 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -0.937  86.258 45.959 1.00 41.36 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.221   87.340 44.093 1.00 44.67 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -2.102  85.555 46.398 1.00 44.76 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.019  86.155 43.782 1.00 39.30 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.356  85.580 43.931 1.00 38.28 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.234  84.296 44.757 1.00 38.96 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.187  83.604 44.708 1.00 39.22 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.923  85.190 42.580 1.00 38.65 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.589  86.135 41.590 1.00 40.28 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.297  83.969 45.483 1.00 37.17 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.334  82.772 46.295 1.00 38.07 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.679  82.118 46.059 1.00 38.48 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.692  82.798 46.118 1.00 39.97 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.182  83.125 47.812 1.00 37.62 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.697  80.825 45.754 1.00 37.30 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.961  80.104 45.573 1.00 37.39 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.945  79.096 46.740 1.00 38.12 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.247  78.074 46.726 1.00 39.11 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -8.988  79.411 44.206 1.00 37.76 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.853  80.381 43.059 1.00 36.82 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.599  80.898 42.722 1.00 35.67 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -9.983  80.833 42.386 1.00 34.51 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.462  81.838 41.752 1.00 35.25 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.875  81.777 41.409 1.00 36.16 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.602  82.299 41.075 1.00 36.94 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.702  79.404 47.769 1.00 36.27 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.651  78.596 48.933 1.00 35.69 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.858 77.729 49.042 1.00 35.97 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.968 78.124 48.625 1.00 35.74 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.533  79.511 50.171 1.00 34.95 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.467  80.613 50.074 1.00 34.57 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.583  81.531 51.328 1.00 31.25 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.049  79.987 49.947 1.00 31.34 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.624 76.534 49.599 1.00 35.80 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.687 75.573 49.829 1.00 34.33 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.353 75.010 48.585 1.00 34.93 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.556 74.867 48.602 1.00 35.01 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.604 74.722 47.508 1.00 35.25 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.189 74.092 46.315 1.00 35.37 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.375 72.599 46.661 1.00 36.17 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.436 71.948 47.117 1.00 36.38 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.260 74.215 45.098 1.00 33.59 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.107 75.674 44.683 1.00 32.32 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.829 73.438 43.941 1.00 33.99 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -9.944  75.853 43.631 1.00 28.90 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.596 72.040 46.476 1.00 37.26 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.782 70.603 46.818 1.00 36.85 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.226 69.677 45.713 1.00 36.66 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.363 70.003 44.516 1.00 37.13 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.312 70.474 46.969 1.00 35.31 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.814 71.435 45.884 1.00 35.40 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.842 72.639 45.955 1.00 35.74 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.617 68.539 46.080 1.00 35.28 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.090 67.653 45.023 1.00 33.85 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.605 66.235 45.103 1.00 33.09 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.240 65.370 44.274 1.00 31.33 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.545 67.668 44.971 1.00 33.63 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.902  67.153 46.209 1.00 33.11 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.789  65.783 46.430 1.00 32.34 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.497  68.034 47.216 1.00 31.42 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.284  65.302 47.645 1.00 31.04 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.997  67.553 48.440 1.00 29.48 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.891  66.196 48.655 1.00 30.07 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.512 66.030 46.060 1.00 31.86 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -14.144 64.735 46.273 1.00 31.41 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.507 64.889 46.950 1.00 33.88 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.804 65.899 47.597 1.00 34.99 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.248 63.852 47.166 1.00 27.82 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.337 63.865 46.823 1.00 33.68 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.588 63.882 47.525 1.00 33.96 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.252 63.818 49.028 1.00 33.72 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.289 63.186 49.424 1.00 33.91 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.416 62.649 47.102 1.00 33.68 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.045 62.808 45.694 1.00 37.66 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.965 64.049 45.605 1.00 38.36 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.901 64.082 46.419 1.00 38.57 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.747 64.977 44.766 1.00 39.40 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.016 64.513 49.876 1.00 34.73 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.793 64.497 51.336 1.00 35.32 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.781 63.024 51.782 1.00 37.70 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.764 62.310 51.552 1.00 38.69 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.042 65.213 51.869 1.00 33.75 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.233 66.315 50.811 1.00 33.77 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.031 65.523 49.492 1.00 32.82 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.708 62.549 52.443 1.00 37.64 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.738 61.137 52.832 1.00 38.55 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.457 60.900 54.160 1.00 40.04 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.851 60.397 55.147 1.00 38.75 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.265 60.785 52.908 1.00 38.01 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.702 62.012 53.543 1.00 38.84 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.420 63.155 52.804 1.00 38.29 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.750 61.229 54.169 1.00 39.92 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.575 61.098 55.376 1.00 40.77 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.588 59.954 55.289 1.00 42.80 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.888 59.441 54.183 1.00 42.48 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.356 62.385 55.600 1.00 39.18 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.377 63.542 55.763 1.00 38.10 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.241 62.650 54.354 1.00 35.15 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.118 59.590 56.463 1.00 43.41 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.110 58.534 56.579 1.00 44.00 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.576 57.197 56.151 1.00 45.18 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.518 56.779 56.575 1.00 45.79 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.317 56.525 55.288 1.00 46.98 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.925 55.209 54.793 1.00 47.69 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.613 55.294 53.952 1.00 45.17 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -20.036 54.287 53.589 1.00 42.60 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -23.099 54.622 53.990 1.00 51.67 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.300 55.332 52.626 1.00 58.74 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -23.465 56.573 52.561 1.00 61.97 ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -23.275 54.546 51.523 1.00 60.56 ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -20.146 56.509 53.680 1.00 44.46 ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.893 56.748 52.925 1.00 44.57 ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.647 56.772 53.836 1.00 42.51 ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.501 56.711 53.351 1.00 43.57 ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.970 58.099 52.234 1.00 48.33 ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -20.185 58.245 51.362 1.00 53.07 ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.736 57.621 49.793 1.00 61.10 ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -19.134 59.298 49.017 1.00 54.72 ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.872 56.921 55.142 1.00 38.77 ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.783 56.946 56.124 1.00 37.57 ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.955 55.636 55.998 1.00 36.37 ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.519 54.557 55.940 1.00 35.85 ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.341 57.106 57.558 1.00 35.04 ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.228 56.987 58.576 1.00 34.89 ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.655 56.898 60.023 1.00 31.89 ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.228 58.158 60.447 1.00 31.62 ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.870 58.296 61.598 1.00 33.54 ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.985 57.233 62.411 1.00 32.76 ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.411 59.477 61.927 1.00 33.07 ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.637 55.776 55.913 1.00 35.78 ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.680 54.684 55.745 1.00 36.63 ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.540 54.261 54.294 1.00 37.67 ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.570 53.590 53.944 1.00 37.42 ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -14.038 53.451 56.599 1.00 36.68 ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.232 53.757 58.077 1.00 39.04 ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.266 54.456 58.801 1.00 37.95 ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.379 53.314 58.759 1.00 38.84 ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.433 54.708 60.182 1.00 37.64 ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.543 53.565 60.139 1.00 38.72 ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.554 54.269 60.845 1.00 37.43 ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.486 54.659 53.439 1.00 38.67 ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.439 54.284 52.005 1.00 40.99 ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.470 55.058 51.085 1.00 39.29 ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -13.050 56.150 51.421 1.00 38.66 ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.841 54.390 51.395 1.00 44.26 ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.504 53.066 51.146 1.00 49.61 ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.872 53.230 50.474 1.00 55.29 ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.315 51.945 49.922 1.00 61.86 ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -17.848 51.406 48.787 1.00 63.95 ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -16.931 52.050 48.056 1.00 64.67 ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -18.255 50.190 48.408 1.00 65.56 ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -13.126 54.490 49.924 1.00 38.94 ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.262 55.181 48.957 1.00 39.39 ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.998 56.484 48.612 1.00 37.68 ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -14.221 56.523 48.526 1.00 37.62 ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -12.066 54.364 47.650 1.00 42.30 ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.114 53.135 47.740 1.00 49.88 ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -11.774 51.734 47.338 1.00 56.47 ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -10.970 50.529 47.684 1.00 61.13 ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.710  50.282 47.254 1.00 63.08 ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -9.073  51.146 46.455 1.00 64.17 ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -9.079  49.151 47.587 1.00 63.25 ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.271 57.570 48.421 1.00 35.91 ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -13.055 58.768 48.084 1.00 36.74 ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.678 58.704 46.664 1.00 37.69 ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -13.208 57.983 45.795 1.00 37.03 ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -12.007 59.874 48.108 1.00 34.52 ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.731 59.109 47.483 1.00 31.76 ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.814 57.781 48.255 1.00 34.06 ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.723 59.477 46.423 1.00 39.69 ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.256 59.574 45.074 1.00 41.98 ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -15.081 61.011 44.573 1.00 39.43 ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -15.087 61.985 45.339 1.00 38.23 ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.711 59.151 45.035 1.00 47.43 ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -16.872 57.665 45.286 1.00 55.87 ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -18.307 57.312 45.654 1.00 63.03 ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -18.581 56.090 45.917 1.00 65.78 ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -19.158 58.273 45.682 1.00 66.16 ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.918 61.161 43.278 1.00 38.15 ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.732 62.481 42.651 1.00 38.44 ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.897 63.404 42.948 1.00 38.34 ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -17.048 62.972 43.034 1.00 38.60 ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.631 62.150 41.161 1.00 37.69 ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.089 60.754 41.164 1.00 38.56 ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.896 60.084 42.285 1.00 38.49 ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.612 64.678 43.120 1.00 39.03 ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.676 65.630 43.402 1.00 39.85 ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.558 65.770 42.149 1.00 41.24 ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.041 65.994 41.065 1.00 41.21 ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.064 66.980 43.749 1.00 38.20 ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -17.056 68.092 43.887 1.00 36.53 ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -17.991 67.895 45.067 1.00 35.09 ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.877 69.139 45.238 1.00 33.72 ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.634 69.082 46.537 1.00 36.56 ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.874 65.634 42.290 1.00 42.13 ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.754 65.781 41.131 1.00 43.11 ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.765 67.252 40.739 1.00 42.18 ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.891 68.137 41.605 1.00 41.72 ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.160 65.345 41.485 1.00 45.09 ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.306 63.856 41.754 1.00 50.02 ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -22.400 63.683 42.845 1.00 54.10 ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -22.907 62.236 42.973 1.00 54.84 ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.670 62.026 44.264 1.00 56.81 ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.607 67.544 39.436 1.00 41.80 ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.603 68.939 38.969 1.00 41.35 ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.797 69.673 39.547 1.00 41.66 ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.816 69.061 39.922 1.00 40.16 ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.665 68.789 37.455 1.00 39.34 ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -18.916 67.541 37.236 1.00 38.97 ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.482 66.634 38.288 1.00 40.38 ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.647 70.983 39.650 1.00 42.72 ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.698 71.829 40.209 1.00 44.05 ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -22.046 72.928 39.226 1.00 45.25 ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.243 73.248 38.321 1.00 42.38 ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -21.232 72.499 41.512 1.00 43.29 ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.993 73.324 41.329 1.00 41.70 ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.910 74.614 40.887 1.00 43.25 ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.644 72.888 41.543 1.00 41.53 ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.576 75.022 40.809 1.00 42.68 ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.786 73.974 41.212 1.00 41.49 ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -18.074 71.686 41.979 1.00 39.13 ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.409 73.883 41.315 1.00 39.79 ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.695 71.601 42.078 1.00 38.71 ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.883 72.682 41.754 1.00 38.44 ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.248 73.493 39.423 1.00 47.26 ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.723 74.627 38.609 1.00 49.14 ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.440 75.835 39.440 1.00 49.03 ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -23.242 75.716 40.667 1.00 49.90 ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.230 74.591 38.370 1.00 50.15 ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.506 73.831 37.208 1.00 53.28 ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.431 76.994 38.788 1.00 48.54 ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.181 78.229 39.506 1.00 46.43 ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.704 78.413 39.733 1.00 46.06 ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -20.871 77.749 39.109 1.00 44.34 ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.393 79.300 40.670 1.00 45.21 ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.025 79.665 40.995 1.00 42.84 ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.721 79.265 42.426 1.00 42.51 ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.430 79.667 43.360 1.00 41.47 ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.864 81.184 40.822 1.00 43.06 ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.431 81.611 41.098 1.00 43.40 ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -20.252 81.555 39.398 1.00 41.51 ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.683 78.440 42.592 1.00 42.08 ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.278 77.984 43.910 1.00 40.80 ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.564 79.185 44.568 1.00 40.37 ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.654 79.750 43.963 1.00 39.55 ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.332 76.763 43.793 1.00 38.00 ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.054 76.143 45.161 1.00 36.74 ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.186 76.623 46.130 1.00 33.78 ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.781 75.067 45.782 1.00 34.16 ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.354 75.926 47.291 1.00 32.58 ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.317 74.966 47.116 1.00 33.79 ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.782 74.183 45.338 1.00 35.04 ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.821 74.006 48.028 1.00 34.06 ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.298 73.216 46.244 1.00 35.04 ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.810 73.137 47.575 1.00 34.64 ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -18.003 79.586 45.767 1.00 41.35 ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.385 80.728 46.490 1.00 43.67 ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -16.057 80.159 47.048 1.00 41.85 ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -16.079 79.361 47.979 1.00 42.08 ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.318 81.228 47.657 1.00 46.60 ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.812 82.536 48.350 1.00 53.91 ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.630 82.834 48.211 1.00 55.81 ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -18.682 83.275 49.090 1.00 59.14 ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.912 80.523 46.474 1.00 39.11 ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.639 79.999 47.003 1.00 38.46 ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.894 81.117 47.698 1.00 38.29 ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.724 81.366 47.403 1.00 39.37 ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.765 79.431 45.880 1.00 35.80 ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.535 81.773 48.651 1.00 38.33 ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.878 82.923 49.289 1.00 39.72 ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.428 82.681 50.718 1.00 38.87 ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.715 83.497 51.297 1.00 40.49 ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.832 84.123 49.230 1.00 38.44 ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -14.986 83.814 50.012 1.00 39.71 ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -12.868 81.573 51.296 1.00 39.51 ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.468 81.253 52.654 1.00 40.39 ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -11.993 79.809 52.821 1.00 39.46 ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.411 78.901 52.098 1.00 38.96 ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.609 81.489 53.624 1.00 41.35 ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.662 80.579 53.329 1.00 42.01 ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -14.146 82.914 53.474 1.00 44.63 ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.114 79.608 53.789 1.00 37.93 ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.607 78.276 54.069 1.00 36.22 ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.696 77.265 54.377 1.00 34.86 ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.732 77.574 54.917 1.00 35.59 ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.658  78.305 55.243 1.00 33.67 ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.293  78.793 54.900 1.00 32.27 ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.611  78.291 53.783 1.00 31.49 ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.593  79.649 55.796 1.00 32.60 ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.252  78.611 53.575 1.00 32.10 ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -6.221  79.980 55.599 1.00 29.74 ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.567  79.452 54.509 1.00 32.18 ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.213  79.660 54.416 1.00 35.80 ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.451 76.018 54.035 1.00 33.32 ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.454 74.994 54.307 1.00 29.79 ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.307 74.454 55.745 1.00 30.13 ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.393 74.857 56.484 1.00 27.99 ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.085 73.922 53.300 1.00 30.93 ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.495 74.007 53.351 1.00 30.44 ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.298 75.504 53.255 1.00 31.56 ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.201 73.537 56.123 1.00 29.30 ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.113 72.869 57.411 1.00 31.51 ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.823 72.012 57.406 1.00 32.11 ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.220 71.724 56.337 1.00 30.05 ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.281 71.887 57.627 1.00 33.76 ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.651 72.573 57.650 1.00 37.10 ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.833 73.634 58.269 1.00 37.80 ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.620 71.959 56.982 1.00 36.69 ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.417 71.599 58.599 1.00 30.83 ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.265 70.720 58.710 1.00 31.73 ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.814 69.338 59.032 1.00 31.16 ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.852 69.222 59.720 1.00 30.44 ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.357  71.158 59.844 1.00 31.50 ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.834  72.571 59.663 1.00 34.18 ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.802  73.340 60.619 1.00 35.55 ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.412  72.917 58.450 1.00 32.39 ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -10.134 68.299 58.558 1.00 29.80 ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.570 66.949 58.873 1.00 30.16 ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.625 66.660 60.377 1.00 30.80 ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -9.879  67.252 61.175 1.00 31.23 ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.661  65.941 58.200 1.00 29.08 ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.786  65.996 56.389 1.00 31.83 ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.519 65.759 60.774 1.00 31.37 ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.632 65.390 62.196 1.00 31.69 ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.307 64.827 62.694 1.00 31.68 ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.741  63.972 62.042 1.00 31.58 ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.726 64.365 62.398 1.00 29.34 ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -14.047 64.940 62.176 1.00 30.76 ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.580 65.761 63.361 1.00 32.69 ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -15.723 66.244 63.331 1.00 33.84 ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -13.770 65.923 64.397 1.00 32.47 ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.845  65.271 63.863 1.00 31.31 ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.538  64.820 64.368 1.00 32.65 ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.275  65.174 65.840 1.00 34.02 ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -8.922  66.093 66.445 1.00 33.39 ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.422  65.474 63.547 1.00 30.13 ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.480  67.021 63.628 1.00 30.28 ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.490  67.733 62.673 1.00 32.92 ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.318  67.999 63.019 1.00 31.95 ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -6.959  68.027 61.457 1.00 32.66 ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.308  64.449 66.394 1.00 32.85 ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.835  64.673 67.750 1.00 32.60 ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.310  66.119 67.849 1.00 33.23 ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.592  66.589 66.967 1.00 33.10 ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -5.705  63.713 68.047 1.00 32.30 ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.035  63.986 69.360 1.00 34.91 ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -5.605  63.542 70.570 1.00 33.50 ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -3.824  64.703 69.404 1.00 35.00 ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -4.992  63.791 71.783 1.00 35.59 ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -3.197  64.966 70.618 1.00 36.48 ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -3.768  64.509 71.809 1.00 36.98 ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.085  64.711 73.004 1.00 40.14 ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.669  66.831 68.910 1.00 32.44 ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.227  68.215 69.055 1.00 32.60 ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.204  68.268 70.210 1.00 34.43 ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.505  67.776 71.305 1.00 35.31 ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.486  69.152 69.378 1.00 31.35 ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -7.010  70.526 69.792 1.00 30.15 ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -8.436  69.244 68.152 1.00 27.51 ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -4.010  68.821 69.990 1.00 34.81 ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -3.012  68.882 71.062 1.00 35.51 ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.442  69.878 72.124 1.00 37.59 ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -3.697  71.031 71.811 1.00 38.14 ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -1.679  69.346 70.516 1.00 36.01 ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -0.549  69.336 71.566 1.00 36.22 ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -0.653  68.764 72.669 1.00 37.19 ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? 0.500   69.885 71.256 1.00 37.19 ? 72   ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -3.478  69.446 73.383 1.00 39.19 ? 73   GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -3.854  70.311 74.489 1.00 40.58 ? 73   GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -2.777  70.279 75.570 1.00 41.16 ? 73   GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -2.961  70.796 76.679 1.00 39.97 ? 73   GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -5.209  69.885 75.063 1.00 41.77 ? 73   GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -6.369  70.406 74.259 1.00 47.16 ? 73   GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -7.730  69.996 74.814 1.00 51.61 ? 73   GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -8.741  70.533 74.326 1.00 56.32 ? 73   GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -7.823  69.145 75.722 1.00 54.85 ? 73   GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -1.654  69.643 75.262 1.00 41.81 ? 74   GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -0.558  69.619 76.218 1.00 43.33 ? 74   GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? -0.133  71.001 76.778 1.00 42.14 ? 74   GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? 0.223   71.089 77.932 1.00 43.25 ? 74   GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? 0.659   68.946 75.596 1.00 44.64 ? 74   GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? 0.814   67.516 75.992 1.00 48.31 ? 74   GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? 0.908   67.338 77.494 1.00 52.48 ? 74   GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? 1.787   67.919 78.165 1.00 54.22 ? 74   GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? 0.008   66.532 78.041 1.00 53.30 ? 74   GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? -0.168  72.069 75.980 1.00 40.93 ? 75   PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? 0.269   73.419 76.443 1.00 40.41 ? 75   PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -0.711  74.530 76.032 1.00 40.90 ? 75   PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -0.427  75.355 75.174 1.00 38.14 ? 75   PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? 1.672   73.733 75.864 1.00 37.01 ? 75   PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? 2.686   72.674 76.168 1.00 35.19 ? 75   PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? 3.159   72.496 77.492 1.00 33.38 ? 75   PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? 3.134   71.816 75.162 1.00 31.91 ? 75   PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? 4.078   71.470 77.808 1.00 33.33 ? 75   PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? 4.044   70.794 75.454 1.00 33.16 ? 75   PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? 4.530   70.613 76.786 1.00 33.72 ? 75   PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -1.876  74.570 76.668 1.00 43.38 ? 76   PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -2.878  75.584 76.329 1.00 43.98 ? 76   PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -2.272  76.955 76.260 1.00 44.48 ? 76   PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -1.629  77.414 77.208 1.00 45.45 ? 76   PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -3.894  75.460 77.467 1.00 43.18 ? 76   PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -3.836  73.968 77.802 1.00 43.81 ? 76   PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -2.294  73.790 77.852 1.00 44.83 ? 76   PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -2.451  77.605 75.125 1.00 44.53 ? 77   GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -1.934  78.955 74.989 1.00 44.54 ? 77   GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -0.561  79.069 74.359 1.00 43.97 ? 77   GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -0.216  80.103 73.760 1.00 46.37 ? 77   GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? 0.234   78.015 74.467 1.00 40.88 ? 78   PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? 1.575   78.052 73.940 1.00 37.33 ? 78   PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? 1.466   78.094 72.428 1.00 36.63 ? 78   PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? 0.843   77.253 71.831 1.00 35.72 ? 78   PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? 2.333   76.836 74.460 1.00 36.66 ? 78   PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? 3.710   76.768 73.972 1.00 37.86 ? 78   PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? 4.538   77.895 74.068 1.00 37.43 ? 78   PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? 4.197   75.582 73.406 1.00 38.31 ? 78   PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? 5.823   77.855 73.610 1.00 38.29 ? 78   PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? 5.477   75.499 72.940 1.00 38.70 ? 78   PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? 6.318   76.632 73.028 1.00 41.59 ? 78   PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? 2.061   79.081 71.786 1.00 36.19 ? 79   SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? 1.889   79.165 70.352 1.00 36.54 ? 79   SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? 2.670   78.044 69.657 1.00 36.19 ? 79   SER A C   1 
ATOM   596  O O   . SER A 1 79  ? 2.299   77.573 68.575 1.00 34.15 ? 79   SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? 2.347   80.543 69.859 1.00 35.72 ? 79   SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? 3.751   80.695 70.086 1.00 38.66 ? 79   SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? 3.752   77.617 70.299 1.00 35.92 ? 80   GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? 4.546   76.554 69.708 1.00 36.09 ? 80   GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? 3.746   75.306 69.361 1.00 35.50 ? 80   GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? 4.024   74.682 68.346 1.00 34.00 ? 80   GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? 2.795   74.922 70.214 1.00 34.94 ? 81   SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? 1.975   73.769 69.929 1.00 36.70 ? 81   SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? 0.626   74.124 69.237 1.00 38.57 ? 81   SER A C   1 
ATOM   606  O O   . SER A 1 81  ? 0.201   73.397 68.308 1.00 38.37 ? 81   SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? 1.719   72.949 71.207 1.00 34.50 ? 81   SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? 1.095   73.715 72.190 1.00 35.63 ? 81   SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? -0.023  75.220 69.678 1.00 39.54 ? 82   GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -1.325  75.663 69.139 1.00 40.40 ? 82   GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -1.234  75.951 67.630 1.00 39.63 ? 82   GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -2.208  75.735 66.908 1.00 38.66 ? 82   GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -1.839  76.959 69.811 1.00 43.22 ? 82   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -2.002  77.014 71.341 1.00 47.47 ? 82   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -3.231  76.318 71.819 1.00 50.71 ? 82   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -3.547  76.389 73.044 1.00 50.14 ? 82   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -3.888  75.689 70.939 1.00 54.45 ? 82   GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? -0.079  76.430 67.154 1.00 36.94 ? 83   MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? 0.060   76.735 65.734 1.00 34.90 ? 83   MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? -0.157  75.527 64.763 1.00 35.55 ? 83   MET A C   1 
ATOM   621  O O   . MET A 1 83  ? -0.334  75.719 63.531 1.00 34.79 ? 83   MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? 1.445   77.330 65.477 1.00 36.51 ? 83   MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? 2.565   76.280 65.387 1.00 38.24 ? 83   MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? 4.152   77.020 64.829 1.00 40.31 ? 83   MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? 5.039   76.926 66.281 1.00 39.86 ? 83   MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? -0.123  74.297 65.306 1.00 33.46 ? 84   TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -0.302  73.083 64.501 1.00 33.55 ? 84   TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -1.738  72.542 64.598 1.00 33.60 ? 84   TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -2.152  71.727 63.763 1.00 34.10 ? 84   TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? 0.690   71.967 64.925 1.00 31.27 ? 84   TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? 2.107   72.393 64.844 1.00 29.83 ? 84   TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? 2.895   72.877 65.865 1.00 30.02 ? 84   TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? 2.900   72.478 63.655 1.00 29.62 ? 84   TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? 4.151   73.265 65.376 1.00 28.25 ? 84   TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? 4.173   73.046 64.023 1.00 29.81 ? 84   TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? 2.671   72.143 62.314 1.00 27.53 ? 84   TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? 5.197   73.284 63.084 1.00 27.74 ? 84   TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? 3.690   72.376 61.391 1.00 29.32 ? 84   TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? 4.946   72.949 61.792 1.00 27.75 ? 84   TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -2.476  72.974 65.616 1.00 32.94 ? 85   ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -3.838  72.519 65.814 1.00 32.55 ? 85   ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -4.742  73.067 64.731 1.00 32.96 ? 85   ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -4.424  74.090 64.099 1.00 34.81 ? 85   ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -4.349  72.978 67.165 1.00 32.03 ? 85   ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -3.937  72.038 68.310 1.00 34.83 ? 85   ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -3.718  70.832 68.097 1.00 34.70 ? 85   ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -3.859  72.583 69.542 1.00 33.51 ? 85   ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -5.867  72.385 64.470 1.00 31.68 ? 86   PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -6.821  72.840 63.440 1.00 31.12 ? 86   PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -7.215  74.282 63.786 1.00 31.97 ? 86   PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -7.473  74.552 64.953 1.00 30.41 ? 86   PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -8.048  71.948 63.645 1.00 26.82 ? 86   PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -7.556  70.767 64.308 1.00 30.20 ? 86   PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -6.368  71.194 65.184 1.00 30.05 ? 86   PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -7.320  75.166 62.787 1.00 32.34 ? 87   ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -7.725  76.549 63.029 1.00 34.70 ? 87   ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -9.106  76.853 62.355 1.00 35.87 ? 87   ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -9.489  78.001 62.142 1.00 36.81 ? 87   ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -6.642  77.468 62.503 1.00 33.41 ? 87   ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -6.426  77.278 61.015 1.00 38.00 ? 87   ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -6.859  76.248 60.421 1.00 37.94 ? 87   ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -5.761  78.255 60.386 1.00 36.85 ? 87   ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -9.848  75.803 62.039 1.00 36.39 ? 88   ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -11.169 75.904 61.423 1.00 37.22 ? 88   ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -12.026 74.871 62.124 1.00 37.87 ? 88   ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -11.522 74.008 62.827 1.00 37.68 ? 88   ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -11.098 75.485 59.954 1.00 38.07 ? 88   ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -10.165 76.287 59.154 1.00 42.03 ? 88   ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -11.020 77.339 58.619 1.00 46.11 ? 88   ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -10.564 78.643 59.002 1.00 49.57 ? 88   ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -11.140 79.764 58.578 1.00 51.66 ? 88   ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -12.221 79.707 57.773 1.00 48.72 ? 88   ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -10.551 80.933 58.877 1.00 51.58 ? 88   ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -13.322 74.928 61.917 1.00 39.31 ? 89   GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -14.171 73.903 62.481 1.00 41.56 ? 89   GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -13.626 72.589 61.909 1.00 38.64 ? 89   GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -13.138 72.543 60.775 1.00 36.82 ? 89   GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -15.595 74.016 61.931 1.00 47.25 ? 89   GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -16.668 73.897 62.964 1.00 57.09 ? 89   GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -16.744 75.191 63.775 1.00 63.71 ? 89   GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -17.110 76.246 63.148 1.00 65.21 ? 89   GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -16.427 75.153 65.015 1.00 66.95 ? 89   GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -13.765 71.526 62.675 1.00 36.51 ? 90   MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -13.398 70.208 62.193 1.00 35.49 ? 90   MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -14.683 69.584 61.648 1.00 35.06 ? 90   MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -15.810 69.819 62.168 1.00 33.94 ? 90   MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -12.863 69.329 63.327 1.00 35.43 ? 90   MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -11.402 69.641 63.658 1.00 35.29 ? 90   MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -10.715 68.433 64.860 1.00 35.43 ? 90   MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -11.887 68.569 66.300 1.00 31.62 ? 90   MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -14.518 68.760 60.628 1.00 34.01 ? 91   SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.653 68.105 60.007 1.00 33.23 ? 91   SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.213 66.938 59.153 1.00 32.99 ? 91   SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -14.140 67.005 58.534 1.00 31.83 ? 91   SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.372 69.099 59.089 1.00 32.89 ? 91   SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -17.425 68.455 58.417 1.00 33.55 ? 91   SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -16.046 65.883 59.080 1.00 33.40 ? 92   GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -15.704 64.780 58.198 1.00 33.36 ? 92   GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -15.792 65.274 56.771 1.00 34.11 ? 92   GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -15.204 64.676 55.870 1.00 35.07 ? 92   GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -16.630 63.611 58.386 1.00 33.77 ? 92   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -16.261 62.820 59.577 1.00 32.40 ? 92   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -17.011 61.530 59.646 1.00 34.57 ? 92   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -18.140 61.534 60.234 1.00 35.25 ? 92   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -16.478 60.515 59.117 1.00 32.58 ? 92   GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -16.518 66.374 56.558 1.00 33.57 ? 93   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -16.631 66.968 55.232 1.00 33.34 ? 93   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.424 67.882 55.121 1.00 32.61 ? 93   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -15.515 69.085 55.376 1.00 32.86 ? 93   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -17.923 67.796 55.116 1.00 33.22 ? 93   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -18.077 68.440 53.738 1.00 34.20 ? 93   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -17.121 68.452 52.939 1.00 36.99 ? 93   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -19.141 68.974 53.431 1.00 35.45 ? 93   ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -14.318 67.335 54.645 1.00 32.78 ? 94   CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -13.079 68.105 54.630 1.00 31.96 ? 94   CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -12.187 67.955 53.457 1.00 32.23 ? 94   CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -11.055 68.455 53.498 1.00 32.36 ? 94   CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -12.245 67.746 55.883 1.00 31.25 ? 94   CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -11.827 65.958 56.022 1.00 29.56 ? 94   CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -12.655 67.299 52.407 1.00 31.62 ? 95   LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -11.773 67.094 51.254 1.00 31.89 ? 95   LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -11.741 68.242 50.249 1.00 31.61 ? 95   LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -12.364 68.181 49.184 1.00 33.41 ? 95   LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -12.104 65.739 50.569 1.00 30.06 ? 95   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -11.866 64.596 51.591 1.00 30.43 ? 95   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -12.057 63.204 50.956 1.00 27.36 ? 95   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -10.413 64.745 52.200 1.00 28.01 ? 95   LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -10.966 69.265 50.601 1.00 30.98 ? 96   TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -10.802 70.474 49.797 1.00 30.41 ? 96   TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -9.344  70.795 49.543 1.00 29.64 ? 96   TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -8.479  70.250 50.222 1.00 29.78 ? 96   TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -11.432 71.674 50.534 1.00 31.50 ? 96   TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -12.880 71.438 50.830 1.00 31.58 ? 96   TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -13.250 70.641 51.897 1.00 29.37 ? 96   TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -13.874 71.922 49.968 1.00 29.61 ? 96   TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -14.557 70.312 52.107 1.00 31.04 ? 96   TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -15.183 71.610 50.168 1.00 29.29 ? 96   TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -15.523 70.800 51.234 1.00 31.20 ? 96   TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -16.824 70.441 51.431 1.00 32.12 ? 96   TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -9.077  71.669 48.571 1.00 28.11 ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -7.725  72.098 48.300 1.00 28.82 ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -7.687  73.651 48.145 1.00 30.17 ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -8.696  74.293 47.885 1.00 31.76 ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -7.156  71.348 47.077 1.00 25.25 ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -7.844  71.292 45.691 1.00 27.82 ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -7.783  72.637 45.058 1.00 23.84 ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -7.111  70.321 44.684 1.00 25.57 ? 97   LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -6.516  74.246 48.309 1.00 31.04 ? 98   ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -6.337  75.682 48.219 1.00 31.34 ? 98   ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -5.308  75.987 47.149 1.00 32.02 ? 98   ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -4.342  75.220 47.002 1.00 32.22 ? 98   ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -5.845  76.229 49.570 1.00 30.75 ? 98   ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -6.667  75.714 50.705 1.00 32.80 ? 98   ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -7.864  75.991 50.774 1.00 34.49 ? 98   ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -6.058  74.919 51.585 1.00 31.88 ? 98   ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -5.503  77.111 46.432 1.00 32.02 ? 99   ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -4.578  77.517 45.374 1.00 33.54 ? 99   ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -4.202  79.013 45.409 1.00 35.20 ? 99   ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -5.075  79.875 45.416 1.00 35.92 ? 99   ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -5.143  77.197 43.925 1.00 32.35 ? 99   ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -5.801  75.787 43.868 1.00 31.04 ? 99   ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -3.998  77.232 42.925 1.00 28.23 ? 99   ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -6.576  75.522 42.547 1.00 32.85 ? 99   ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -2.904  79.310 45.460 1.00 35.89 ? 100  TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -2.467  80.693 45.428 1.00 37.64 ? 100  TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -1.894  80.867 44.010 1.00 39.33 ? 100  TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -1.036  80.085 43.576 1.00 39.19 ? 100  TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -1.424  80.994 46.493 1.00 36.62 ? 100  TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -2.045  81.154 47.838 1.00 38.00 ? 100  TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -2.524  82.311 48.407 1.00 37.35 ? 100  TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -2.268  80.112 48.799 1.00 38.18 ? 100  TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -3.024  82.043 49.663 1.00 37.20 ? 100  TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -2.882  80.708 49.931 1.00 37.66 ? 100  TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -1.998  78.733 48.818 1.00 37.10 ? 100  TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -3.230  79.964 51.082 1.00 39.49 ? 100  TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -2.340  77.989 49.968 1.00 37.51 ? 100  TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -2.948  78.606 51.082 1.00 37.99 ? 100  TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -2.411  81.876 43.302 1.00 38.29 ? 101  VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -2.028  82.141 41.927 1.00 38.08 ? 101  VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -1.471  83.546 41.745 1.00 37.77 ? 101  VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -2.094  84.539 42.153 1.00 35.93 ? 101  VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -3.274  81.984 40.938 1.00 39.24 ? 101  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -2.828  82.247 39.538 1.00 35.97 ? 101  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -3.986  80.573 41.110 1.00 37.56 ? 101  VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -0.275  83.632 41.134 1.00 38.23 ? 102  PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? 0.373   84.922 40.882 1.00 38.99 ? 102  PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -0.609  85.868 40.108 1.00 41.26 ? 102  PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -1.547  85.411 39.435 1.00 40.82 ? 102  PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? 1.591   84.544 40.045 1.00 36.56 ? 102  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 1.894   83.137 40.491 1.00 37.79 ? 102  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 0.543   82.505 40.628 1.00 36.73 ? 102  PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -0.411  87.174 40.244 1.00 42.30 ? 103  SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -1.252  88.133 39.546 1.00 44.70 ? 103  SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -0.316  89.141 38.882 1.00 44.78 ? 103  SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 0.602   89.692 39.524 1.00 44.55 ? 103  SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -2.221  88.837 40.516 1.00 46.10 ? 103  SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -3.030  89.802 39.837 1.00 48.07 ? 103  SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -0.518  89.386 37.584 1.00 44.69 ? 104  PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -1.577  88.764 36.782 1.00 44.39 ? 104  PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -1.376  87.233 36.604 1.00 43.54 ? 104  PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -0.248  86.737 36.707 1.00 42.16 ? 104  PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -1.470  89.530 35.454 1.00 44.48 ? 104  PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? 0.064   89.701 35.309 1.00 43.72 ? 104  PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? 0.439   90.134 36.724 1.00 44.07 ? 104  PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -2.483  86.526 36.330 1.00 43.62 ? 105  ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -2.527  85.071 36.122 1.00 43.79 ? 105  ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -1.492  84.560 35.112 1.00 44.14 ? 105  ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -1.422  85.052 33.999 1.00 44.85 ? 105  ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -3.928  84.641 35.671 1.00 41.28 ? 105  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -4.140  83.139 35.765 1.00 41.67 ? 105  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -5.488  82.664 35.246 1.00 37.91 ? 105  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -6.599  83.268 35.975 1.00 39.07 ? 105  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -7.878  83.097 35.624 1.00 40.36 ? 105  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -8.159  82.326 34.570 1.00 40.90 ? 105  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -8.875  83.736 36.248 1.00 37.28 ? 105  ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -0.659  83.574 35.505 1.00 44.99 ? 106  PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? 0.368   83.008 34.626 1.00 44.78 ? 106  PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -0.352  82.315 33.487 1.00 45.68 ? 106  PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -1.566  82.110 33.563 1.00 45.15 ? 106  PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? 1.057   81.977 35.512 1.00 44.65 ? 106  PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? 0.776   82.459 36.896 1.00 45.57 ? 106  PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -0.647  82.894 36.812 1.00 45.02 ? 106  PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? 0.376   81.947 32.444 1.00 46.73 ? 107  LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -0.248  81.232 31.338 1.00 48.09 ? 107  LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? 0.050   79.734 31.570 1.00 48.81 ? 107  LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -0.835  78.854 31.390 1.00 48.99 ? 107  LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? 0.340   81.657 29.983 1.00 49.10 ? 107  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? 0.277   83.141 29.682 1.00 51.58 ? 107  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? -1.166  83.639 29.772 1.00 53.51 ? 107  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? -1.245  85.163 29.643 1.00 53.38 ? 107  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? -2.675  85.575 29.709 1.00 51.90 ? 107  LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? 1.290   79.453 31.989 1.00 47.67 ? 108  SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? 1.712   78.061 32.219 1.00 46.76 ? 108  SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? 2.958   77.971 33.099 1.00 44.95 ? 108  SER A C   1 
ATOM   835  O O   . SER A 1 108 ? 4.064   77.790 32.573 1.00 46.32 ? 108  SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? 2.007   77.378 30.863 1.00 46.14 ? 108  SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? 2.086   75.960 30.985 1.00 46.03 ? 108  SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? 2.820   78.105 34.410 1.00 41.99 ? 109  THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? 4.039   78.002 35.245 1.00 41.92 ? 109  THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? 4.131   76.813 36.214 1.00 40.11 ? 109  THR A C   1 
ATOM   841  O O   . THR A 1 109 ? 3.155   76.058 36.436 1.00 37.99 ? 109  THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? 4.308   79.235 36.141 1.00 41.07 ? 109  THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? 3.156   79.475 36.973 1.00 41.14 ? 109  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? 4.681   80.418 35.293 1.00 43.99 ? 109  THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? 5.318   76.709 36.818 1.00 38.23 ? 110  THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? 5.590   75.661 37.773 1.00 36.79 ? 110  THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? 4.514   75.655 38.858 1.00 35.48 ? 110  THR A C   1 
ATOM   848  O O   . THR A 1 110 ? 4.087   76.712 39.357 1.00 33.92 ? 110  THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? 6.951   75.851 38.384 1.00 37.84 ? 110  THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? 7.923   75.948 37.330 1.00 37.92 ? 110  THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? 7.292   74.666 39.297 1.00 36.38 ? 110  THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? 4.046   74.440 39.150 1.00 33.64 ? 111  VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? 3.024   74.170 40.161 1.00 32.55 ? 111  VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? 3.690   73.382 41.318 1.00 32.45 ? 111  VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? 4.425   72.417 41.043 1.00 33.15 ? 111  VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? 1.857   73.260 39.572 1.00 31.50 ? 111  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? 0.779   72.947 40.675 1.00 27.39 ? 111  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? 1.213   73.946 38.387 1.00 30.11 ? 111  VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? 3.422   73.774 42.571 1.00 31.41 ? 112  MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? 3.927   73.092 43.760 1.00 30.77 ? 112  MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? 2.716   72.678 44.580 1.00 31.96 ? 112  MET A C   1 
ATOM   862  O O   . MET A 1 112 ? 1.838   73.506 44.829 1.00 33.93 ? 112  MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? 4.866   74.012 44.570 1.00 30.27 ? 112  MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? 6.149   74.233 43.844 1.00 30.62 ? 112  MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? 7.398   75.217 44.663 1.00 34.35 ? 112  MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? 8.035   74.084 46.016 1.00 31.90 ? 112  MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? 2.655   71.399 44.982 1.00 32.04 ? 113  VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? 1.524   70.861 45.762 1.00 30.90 ? 113  VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? 2.045   70.385 47.117 1.00 31.12 ? 113  VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? 2.842   69.446 47.203 1.00 30.87 ? 113  VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? 0.814   69.666 45.032 1.00 29.01 ? 113  VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -0.440  69.188 45.859 1.00 28.78 ? 113  VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? 0.373   70.097 43.694 1.00 28.36 ? 113  VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? 1.547   71.038 48.161 1.00 30.45 ? 114  TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? 1.956   70.790 49.522 1.00 29.03 ? 114  TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? 1.095   69.741 50.200 1.00 28.64 ? 114  TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -0.136  69.799 50.115 1.00 30.20 ? 114  TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? 1.893   72.106 50.333 1.00 29.88 ? 114  TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? 2.178   71.919 51.850 1.00 30.39 ? 114  TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? 1.287   72.009 52.891 1.00 30.80 ? 114  TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? 3.443   71.604 52.438 1.00 30.16 ? 114  TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? 1.919   71.762 54.105 1.00 29.95 ? 114  TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? 3.243   71.522 53.853 1.00 31.73 ? 114  TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? 4.737   71.386 51.909 1.00 30.23 ? 114  TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? 4.291   71.243 54.738 1.00 32.17 ? 114  TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? 5.785   71.105 52.773 1.00 30.85 ? 114  TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? 5.561   71.037 54.179 1.00 33.43 ? 114  TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? 1.746   68.797 50.891 1.00 28.05 ? 115  ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? 1.040   67.731 51.621 1.00 27.30 ? 115  ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? 1.440   67.829 53.093 1.00 27.82 ? 115  ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? 2.577   67.491 53.460 1.00 28.38 ? 115  ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? 1.410   66.282 51.105 1.00 25.48 ? 115  ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? 1.230   66.181 49.579 1.00 23.33 ? 115  ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? 0.547   65.240 51.856 1.00 20.91 ? 115  ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? 1.347   64.682 49.024 1.00 23.67 ? 115  ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? 0.507   68.246 53.952 1.00 27.38 ? 116  TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? 0.853   68.424 55.365 1.00 25.85 ? 116  TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? 1.191   67.172 56.115 1.00 26.43 ? 116  TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? 0.742   66.068 55.760 1.00 26.62 ? 116  TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -0.257  69.163 56.115 1.00 24.61 ? 116  TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -1.617  68.511 56.119 1.00 24.30 ? 116  TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -1.881  67.356 56.866 1.00 25.19 ? 116  TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -2.647  69.065 55.393 1.00 24.19 ? 116  TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -3.154  66.777 56.869 1.00 25.04 ? 116  TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -3.925  68.504 55.391 1.00 25.46 ? 116  TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -4.176  67.366 56.107 1.00 26.80 ? 116  TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -5.425  66.773 55.949 1.00 27.62 ? 116  TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? 1.994   67.348 57.160 1.00 27.47 ? 117  GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? 2.366   66.230 58.026 1.00 26.87 ? 117  GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? 1.375   66.185 59.184 1.00 27.30 ? 117  GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? 0.303   66.865 59.140 1.00 26.80 ? 117  GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? 1.720   65.414 60.220 1.00 27.11 ? 118  GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? 0.852   65.269 61.375 1.00 26.14 ? 118  GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? 0.703   63.800 61.774 1.00 28.58 ? 118  GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -0.368  63.371 62.349 1.00 28.20 ? 118  GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? 1.758   63.015 61.469 1.00 27.00 ? 119  GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? 1.767   61.598 61.828 1.00 27.16 ? 119  GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? 0.626   60.722 61.292 1.00 26.83 ? 119  GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? 0.418   59.612 61.766 1.00 25.85 ? 119  GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? -0.061  61.185 60.245 1.00 26.50 ? 120  PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -1.221  60.460 59.687 1.00 26.66 ? 120  PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -2.420  60.488 60.674 1.00 27.49 ? 120  PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -3.471  59.904 60.381 1.00 28.57 ? 120  PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -0.877  58.990 59.300 1.00 24.60 ? 120  PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? 0.065   58.879 58.136 1.00 22.81 ? 120  PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? -0.291  59.408 56.892 1.00 20.91 ? 120  PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? 1.333   58.300 58.302 1.00 19.92 ? 120  PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? 0.617   59.364 55.795 1.00 22.15 ? 120  PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? 2.264   58.238 57.229 1.00 22.36 ? 120  PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? 1.909   58.770 55.954 1.00 22.02 ? 120  PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -2.265  61.145 61.825 1.00 25.89 ? 121  TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -3.374  61.226 62.758 1.00 27.42 ? 121  TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -3.883  62.658 62.891 1.00 27.68 ? 121  TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -4.846  62.903 63.634 1.00 28.69 ? 121  TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -2.984  60.725 64.173 1.00 26.38 ? 121  TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -1.951  61.586 64.880 1.00 24.74 ? 121  TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -2.339  62.673 65.681 1.00 25.80 ? 121  TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -0.595  61.281 64.788 1.00 24.57 ? 121  TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -1.387  63.445 66.409 1.00 26.88 ? 121  TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? 0.384   62.031 65.489 1.00 26.72 ? 121  TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -0.013  63.112 66.309 1.00 28.42 ? 121  TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? 0.944   63.796 67.055 1.00 27.13 ? 121  TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -3.242  63.606 62.216 1.00 27.37 ? 122  SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -3.680  65.003 62.312 1.00 27.44 ? 122  SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -3.058  65.785 61.215 1.00 26.97 ? 122  SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -2.303  65.230 60.432 1.00 25.97 ? 122  SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -3.260  65.644 63.657 1.00 27.28 ? 122  SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -1.843  65.608 63.832 1.00 28.92 ? 122  SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -3.351  67.085 61.211 1.00 27.58 ? 123  GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -2.847  67.980 60.192 1.00 29.03 ? 123  GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -3.950  68.795 59.494 1.00 30.68 ? 123  GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -5.112  68.351 59.407 1.00 30.51 ? 123  GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -3.577  69.979 58.994 1.00 29.27 ? 124  SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -4.487  70.889 58.321 1.00 30.01 ? 124  SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -3.742  71.646 57.232 1.00 30.36 ? 124  SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -2.537  71.921 57.351 1.00 30.20 ? 124  SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -5.038  71.923 59.285 1.00 29.17 ? 124  SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -5.785  71.322 60.306 1.00 29.86 ? 124  SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -4.464  72.006 56.180 1.00 29.26 ? 125  SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -3.837  72.700 55.072 1.00 29.85 ? 125  SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -4.021  74.194 55.319 1.00 30.18 ? 125  SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -3.421  75.001 54.634 1.00 29.76 ? 125  SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -4.540  72.344 53.756 1.00 27.03 ? 125  SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -5.875  72.844 53.779 1.00 27.79 ? 125  SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -4.832  74.536 56.317 1.00 30.14 ? 126  THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -5.170  75.928 56.553 1.00 32.10 ? 126  THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -4.361  76.688 57.587 1.00 32.92 ? 126  THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -4.677  77.825 57.852 1.00 34.01 ? 126  THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -6.643  76.018 56.948 1.00 31.60 ? 126  THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -6.838  75.293 58.171 1.00 28.68 ? 126  THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -7.520  75.400 55.839 1.00 30.52 ? 126  THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -3.345  76.055 58.163 1.00 32.99 ? 127  LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -2.504  76.673 59.189 1.00 34.21 ? 127  LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -1.781  77.908 58.663 1.00 35.20 ? 127  LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -1.498  78.027 57.441 1.00 36.68 ? 127  LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -1.444  75.662 59.719 1.00 30.11 ? 127  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -1.946  74.285 60.201 1.00 32.34 ? 127  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -0.708  73.354 60.651 1.00 30.85 ? 127  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -2.977  74.453 61.319 1.00 27.75 ? 127  LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -1.453  78.820 59.576 1.00 35.91 ? 128  ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -0.718  80.019 59.167 1.00 36.28 ? 128  ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? 0.661   79.647 58.621 1.00 36.34 ? 128  ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? 1.120   80.294 57.691 1.00 36.08 ? 128  ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -0.549  81.009 60.316 1.00 36.40 ? 128  ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -1.874  81.560 60.812 1.00 39.06 ? 128  ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -2.888  81.428 60.056 1.00 39.49 ? 128  ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -1.884  82.122 61.956 1.00 39.98 ? 128  ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? 1.335   78.630 59.184 1.00 35.87 ? 129  VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? 2.655   78.296 58.643 1.00 35.24 ? 129  VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? 2.558   77.767 57.237 1.00 35.71 ? 129  VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? 3.608   77.671 56.586 1.00 34.92 ? 129  VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? 3.432   77.161 59.338 1.00 33.48 ? 129  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? 4.549   77.700 60.079 1.00 32.19 ? 129  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? 2.536   76.310 60.111 1.00 31.29 ? 129  VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? 1.364   77.350 56.784 1.00 34.78 ? 130  TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? 1.289   76.829 55.404 1.00 35.65 ? 130  TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? 0.712   77.812 54.398 1.00 35.93 ? 130  TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? 0.418   77.430 53.293 1.00 34.17 ? 130  TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? 0.480   75.524 55.309 1.00 32.61 ? 130  TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? 0.947   74.401 56.193 1.00 31.48 ? 130  TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? 2.302   74.263 56.558 1.00 31.10 ? 130  TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? 0.014   73.485 56.706 1.00 30.63 ? 130  TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? 2.718   73.230 57.422 1.00 32.05 ? 130  TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? 0.385   72.480 57.550 1.00 29.80 ? 130  TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? 1.722   72.338 57.913 1.00 31.60 ? 130  TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? 2.028   71.316 58.737 1.00 29.41 ? 130  TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? 0.542   79.076 54.782 1.00 38.24 ? 131  ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? -0.020  80.046 53.845 1.00 39.13 ? 131  ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? 0.873   80.165 52.614 1.00 37.47 ? 131  ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? 2.001   80.679 52.705 1.00 35.38 ? 131  ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? -0.152  81.407 54.491 1.00 41.64 ? 131  ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -1.007  82.342 53.660 1.00 43.69 ? 131  ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -0.926  82.375 52.421 1.00 43.99 ? 131  ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -1.838  83.109 54.341 1.00 45.80 ? 131  ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? 0.356   79.707 51.473 1.00 36.48 ? 132  GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? 1.152   79.724 50.260 1.00 35.37 ? 132  GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? 1.369   81.050 49.533 1.00 36.16 ? 132  GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? 2.109   81.085 48.514 1.00 34.03 ? 132  GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? 0.789   82.144 50.044 1.00 36.45 ? 133  LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.938   83.413 49.322 1.00 38.80 ? 133  LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 2.349   83.930 49.210 1.00 39.46 ? 133  LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 2.704   84.454 48.136 1.00 39.15 ? 133  LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? 0.033   84.513 49.882 1.00 39.40 ? 133  LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 0.529   85.155 51.128 1.00 40.02 ? 133  LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -0.592  85.944 51.729 1.00 40.97 ? 133  LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? -0.094  86.746 52.933 1.00 41.94 ? 133  LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -1.252  87.476 53.557 1.00 43.68 ? 133  LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? 3.172   83.773 50.261 1.00 39.63 ? 134  TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? 4.534   84.300 50.144 1.00 39.83 ? 134  TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? 5.347   83.570 49.112 1.00 38.47 ? 134  TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? 6.191   84.178 48.459 1.00 40.04 ? 134  TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? 5.309   84.275 51.481 1.00 41.05 ? 134  TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? 4.591   84.994 52.579 1.00 42.52 ? 134  TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? 3.985   84.278 53.593 1.00 43.69 ? 134  TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? 4.382   86.379 52.525 1.00 44.27 ? 134  TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? 3.172   84.899 54.528 1.00 45.86 ? 134  TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? 3.553   87.038 53.471 1.00 45.71 ? 134  TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? 2.954   86.274 54.464 1.00 47.05 ? 134  TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? 2.115   86.823 55.411 1.00 49.76 ? 134  TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? 5.116   82.277 48.947 1.00 37.12 ? 135  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? 5.931   81.513 48.002 1.00 36.64 ? 135  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? 5.393   81.604 46.581 1.00 37.40 ? 135  LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? 6.167   81.617 45.619 1.00 35.65 ? 135  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? 6.038   80.059 48.483 1.00 35.51 ? 135  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? 6.754   78.954 47.678 1.00 33.91 ? 135  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? 8.177   79.320 47.415 1.00 30.14 ? 135  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? 6.690   77.647 48.494 1.00 32.76 ? 135  LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? 4.060   81.682 46.448 1.00 39.60 ? 136  ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? 3.438   81.790 45.129 1.00 40.63 ? 136  ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? 3.956   83.115 44.595 1.00 42.52 ? 136  ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? 4.567   83.195 43.499 1.00 41.55 ? 136  ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? 1.932   81.821 45.248 1.00 39.04 ? 136  ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? 3.747   84.148 45.412 1.00 42.97 ? 137  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? 4.167   85.490 45.067 1.00 43.46 ? 137  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? 5.657   85.674 44.789 1.00 42.13 ? 137  TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? 6.017   86.277 43.786 1.00 41.73 ? 137  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? 3.745   86.471 46.169 1.00 45.30 ? 137  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? 4.272   87.856 45.931 1.00 47.49 ? 137  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? 5.429   88.329 46.592 1.00 48.86 ? 137  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? 3.648   88.694 44.997 1.00 48.46 ? 137  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? 5.950   89.646 46.309 1.00 50.05 ? 137  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? 4.138   89.967 44.704 1.00 49.04 ? 137  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? 5.279   90.453 45.354 1.00 51.08 ? 137  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? 5.694   91.745 45.048 1.00 51.64 ? 137  TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? 6.525   85.148 45.643 1.00 40.95 ? 138  THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? 7.956   85.399 45.446 1.00 41.11 ? 138  THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? 8.576   84.617 44.338 1.00 42.32 ? 138  THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? 9.386   85.143 43.573 1.00 43.67 ? 138  THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? 8.810   85.114 46.718 1.00 40.04 ? 138  THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? 8.305   85.863 47.817 1.00 40.29 ? 138  THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? 10.251  85.544 46.509 1.00 38.74 ? 138  THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? 8.212   83.344 44.249 1.00 42.57 ? 139  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? 8.805   82.491 43.241 1.00 42.06 ? 139  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? 7.982   82.352 41.970 1.00 42.85 ? 139  GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? 8.407   81.653 41.026 1.00 42.42 ? 139  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? 9.122   81.130 43.859 1.00 40.61 ? 139  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? 10.248  81.220 44.890 1.00 38.08 ? 139  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? 11.552  81.743 44.299 1.00 37.45 ? 139  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? 11.894  81.424 43.136 1.00 37.11 ? 139  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? 12.255  82.473 45.018 1.00 37.38 ? 139  GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? 6.822   83.025 41.934 1.00 43.89 ? 140  GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? 5.968   83.006 40.743 1.00 44.60 ? 140  GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? 5.540   81.556 40.403 1.00 42.70 ? 140  GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? 5.678   81.083 39.265 1.00 42.23 ? 140  GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? 6.778   83.622 39.594 1.00 49.18 ? 140  GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? 6.046   83.766 38.266 1.00 58.39 ? 140  GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? 5.187   85.042 38.228 1.00 63.02 ? 140  GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? 5.643   86.075 38.839 1.00 64.66 ? 140  GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? 4.088   84.995 37.580 1.00 63.90 ? 140  GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? 5.073   80.827 41.407 1.00 39.40 ? 141  VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? 4.614   79.488 41.164 1.00 36.43 ? 141  VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? 3.146   79.435 41.573 1.00 37.24 ? 141  VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? 2.676   80.232 42.411 1.00 38.02 ? 141  VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? 5.405   78.407 42.014 1.00 35.01 ? 141  VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? 6.911   78.317 41.583 1.00 31.43 ? 141  VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? 5.289   78.715 43.484 1.00 32.80 ? 141  VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? 2.392   78.537 40.954 1.00 36.84 ? 142  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? 1.018   78.335 41.401 1.00 35.95 ? 142  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? 1.184   77.319 42.571 1.00 36.20 ? 142  VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? 1.685   76.200 42.370 1.00 36.44 ? 142  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? 0.184   77.721 40.288 1.00 35.50 ? 142  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -1.041  77.091 40.853 1.00 33.67 ? 142  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? -0.194  78.812 39.273 1.00 34.59 ? 142  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? 0.813   77.738 43.783 1.00 35.25 ? 143  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 0.935   76.922 44.980 1.00 33.70 ? 143  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -0.353  76.265 45.432 1.00 33.14 ? 143  LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -1.343  76.953 45.738 1.00 35.23 ? 143  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 1.459   77.747 46.158 1.00 34.30 ? 143  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 1.812   76.721 47.240 1.00 35.84 ? 143  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 3.233   76.277 47.057 1.00 34.46 ? 143  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 1.643   77.268 48.549 1.00 36.40 ? 143  LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -0.345  74.937 45.528 1.00 31.20 ? 144  VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -1.540  74.222 45.975 1.00 28.23 ? 144  VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -1.274  73.501 47.282 1.00 28.51 ? 144  VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -0.183  72.909 47.504 1.00 27.90 ? 144  VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -2.046  73.141 44.883 1.00 27.60 ? 144  VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -3.277  72.362 45.384 1.00 22.70 ? 144  VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -2.429  73.863 43.549 1.00 27.84 ? 144  VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -2.247  73.552 48.176 1.00 27.07 ? 145  SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -2.086  72.744 49.379 1.00 29.15 ? 145  SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -3.331  71.865 49.349 1.00 29.09 ? 145  SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -4.466  72.379 49.162 1.00 27.41 ? 145  SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -2.048  73.576 50.660 1.00 29.61 ? 145  SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -3.042  74.567 50.660 1.00 32.07 ? 145  SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -3.143  70.549 49.490 1.00 27.92 ? 146  LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -4.329  69.671 49.479 1.00 27.65 ? 146  LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -4.692  69.241 50.896 1.00 28.84 ? 146  LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -4.066  69.666 51.879 1.00 28.19 ? 146  LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -4.098  68.434 48.597 1.00 23.60 ? 146  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -2.821  67.644 48.854 1.00 24.84 ? 146  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -2.919  66.830 50.188 1.00 22.79 ? 146  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -2.565  66.745 47.662 1.00 22.93 ? 146  LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -5.708  68.397 51.020 1.00 29.59 ? 147  SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -6.037  67.908 52.346 1.00 28.67 ? 147  SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -6.361  66.442 52.197 1.00 26.63 ? 147  SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -6.550  65.954 51.062 1.00 26.35 ? 147  SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -7.203  68.678 52.945 1.00 28.45 ? 147  SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -8.412  68.208 52.402 1.00 34.47 ? 147  SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -6.373  65.728 53.317 1.00 25.33 ? 148  TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -6.669  64.289 53.303 1.00 26.06 ? 148  TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -7.127  63.796 54.696 1.00 26.14 ? 148  TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -6.694  64.351 55.738 1.00 26.18 ? 148  TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -5.443  63.460 52.794 1.00 22.55 ? 148  TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -4.185  63.611 53.631 1.00 24.59 ? 148  TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -3.298  64.658 53.428 1.00 24.34 ? 148  TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -3.916  62.709 54.687 1.00 25.84 ? 148  TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -2.174  64.810 54.254 1.00 25.88 ? 148  TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -2.824  62.830 55.497 1.00 25.23 ? 148  TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -1.936  63.870 55.292 1.00 28.14 ? 148  TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -0.765  63.906 56.077 1.00 27.11 ? 148  TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -8.000  62.784 54.705 1.00 25.25 ? 149  ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -8.503  62.211 55.957 1.00 26.95 ? 149  ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -7.327  61.606 56.772 1.00 27.22 ? 149  ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -6.428  60.945 56.203 1.00 27.34 ? 149  ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -9.521  61.121 55.669 1.00 26.55 ? 149  ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -10.888 61.629 55.365 1.00 28.65 ? 149  ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.770 60.507 54.780 1.00 29.20 ? 149  ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.363 60.122 53.429 1.00 28.73 ? 149  ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -11.893 59.082 52.779 1.00 30.14 ? 149  ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -12.830 58.335 53.381 1.00 29.91 ? 149  ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -11.529 58.802 51.528 1.00 28.20 ? 149  ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -7.342  61.835 58.083 1.00 25.25 ? 150  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -6.296  61.322 58.973 1.00 25.55 ? 150  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -6.944  60.471 60.027 1.00 27.37 ? 150  VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -8.194  60.410 60.115 1.00 28.37 ? 150  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -5.494  62.483 59.699 1.00 23.57 ? 150  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -4.663  63.276 58.678 1.00 22.22 ? 150  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -6.430  63.425 60.424 1.00 19.29 ? 150  VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -6.112  59.850 60.862 1.00 27.56 ? 151  GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -6.633  58.988 61.906 1.00 27.65 ? 151  GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -7.369  57.776 61.348 1.00 28.57 ? 151  GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -7.055  57.269 60.273 1.00 28.98 ? 151  GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -8.354  57.300 62.091 1.00 28.71 ? 152  ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -9.105  56.124 61.687 1.00 28.66 ? 152  ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -9.872  56.460 60.412 1.00 29.07 ? 152  ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -10.001 55.613 59.519 1.00 27.02 ? 152  ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -10.104 55.684 62.839 1.00 29.14 ? 152  ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -10.377 57.695 60.339 1.00 29.40 ? 153  PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -11.123 58.151 59.167 1.00 30.73 ? 153  PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.352 57.967 57.871 1.00 29.60 ? 153  PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -10.952 57.628 56.840 1.00 28.04 ? 153  PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -11.500 59.629 59.318 1.00 31.20 ? 153  PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -12.162 59.920 60.614 1.00 32.43 ? 153  PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -13.547 59.694 60.777 1.00 33.30 ? 153  PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -11.404 60.359 61.707 1.00 30.91 ? 153  PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -14.150 59.903 62.021 1.00 31.74 ? 153  PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -11.988 60.569 62.957 1.00 28.67 ? 153  PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -13.337 60.347 63.129 1.00 31.92 ? 153  PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -9.034  58.188 57.920 1.00 28.93 ? 154  GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -8.227  58.027 56.711 1.00 28.97 ? 154  GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -7.428  56.721 56.562 1.00 29.19 ? 154  GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -7.002  56.357 55.441 1.00 29.36 ? 154  GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -7.281  55.968 57.655 1.00 28.31 ? 155  PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -6.430  54.794 57.613 1.00 27.96 ? 155  PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -6.904  53.523 58.312 1.00 28.91 ? 155  PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -6.127  52.567 58.461 1.00 28.75 ? 155  PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -5.025  55.223 58.113 1.00 24.67 ? 155  PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -4.374  56.237 57.214 1.00 24.08 ? 155  PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -3.787  55.857 56.011 1.00 24.98 ? 155  PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -4.509  57.597 57.455 1.00 23.63 ? 155  PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -3.354  56.826 55.061 1.00 22.54 ? 155  PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -4.085  58.554 56.501 1.00 22.86 ? 155  PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -3.509  58.147 55.310 1.00 21.90 ? 155  PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -8.149  53.497 58.779 1.00 30.07 ? 156  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -8.649  52.259 59.397 1.00 31.16 ? 156  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -8.489  51.192 58.271 1.00 32.52 ? 156  LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -8.925  51.407 57.127 1.00 31.47 ? 156  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -10.120 52.374 59.756 1.00 30.76 ? 156  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -10.580 51.083 60.422 1.00 33.68 ? 156  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -10.263 51.129 61.927 1.00 31.18 ? 156  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -12.091 50.916 60.188 1.00 32.34 ? 156  LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -7.887  50.046 58.581 1.00 32.80 ? 157  ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -7.642  49.039 57.545 1.00 33.92 ? 157  ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -8.112  47.596 57.864 1.00 35.38 ? 157  ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -7.519  46.938 58.746 1.00 35.31 ? 157  ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -6.129  49.016 57.225 1.00 29.94 ? 157  ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -9.161  47.125 57.174 1.00 35.63 ? 158  LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -9.646  45.737 57.325 1.00 36.46 ? 158  LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -9.448  45.149 55.954 1.00 37.26 ? 158  LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? -10.386 45.056 55.165 1.00 39.19 ? 158  LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -11.131 45.717 57.746 1.00 35.77 ? 158  LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -11.233 46.249 59.201 1.00 36.67 ? 158  LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -12.664 46.671 59.561 1.00 33.75 ? 158  LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -10.659 45.202 60.171 1.00 35.89 ? 158  LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -8.211  44.793 55.635 1.00 39.60 ? 159  HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? -7.867  44.260 54.306 1.00 41.73 ? 159  HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? -8.802  43.151 53.840 1.00 44.74 ? 159  HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? -9.056  42.219 54.589 1.00 45.76 ? 159  HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -6.446  43.739 54.287 1.00 41.06 ? 159  HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -5.978  43.371 52.916 1.00 43.20 ? 159  HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -5.951  44.278 51.871 1.00 44.01 ? 159  HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? -5.519  42.200 52.412 1.00 42.29 ? 159  HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -5.488  43.678 50.787 1.00 42.97 ? 159  HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? -5.219  42.419 51.089 1.00 43.22 ? 159  HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? -9.297  43.234 52.605 1.00 46.82 ? 160  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? -10.240 42.237 52.107 1.00 47.61 ? 160  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? -11.612 42.888 51.938 1.00 49.13 ? 160  GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? -12.328 42.637 50.969 1.00 49.58 ? 160  GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? -11.963 43.762 52.877 1.00 50.11 ? 161  SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? -13.229 44.476 52.865 1.00 50.48 ? 161  SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? -13.152 45.621 51.896 1.00 51.43 ? 161  SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? -12.099 46.227 51.772 1.00 53.04 ? 161  SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? -13.509 45.049 54.242 1.00 50.88 ? 161  SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? -14.540 46.026 54.175 1.00 54.30 ? 161  SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? -14.235 45.943 51.195 1.00 51.49 ? 162  GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? -14.149 47.094 50.289 1.00 51.99 ? 162  GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? -14.715 48.306 51.000 1.00 50.09 ? 162  GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -14.594 49.415 50.515 1.00 49.47 ? 162  GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? -14.889 46.865 48.946 1.00 54.88 ? 162  GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? -14.169 45.901 47.946 1.00 59.25 ? 162  GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? -12.663 46.268 47.677 1.00 63.08 ? 162  GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? -11.786 45.372 47.613 1.00 62.65 ? 162  GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? -12.371 47.583 47.515 1.00 64.28 ? 162  GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? -15.325 48.085 52.160 1.00 48.11 ? 163  GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? -15.894 49.193 52.917 1.00 47.50 ? 163  GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -14.815 50.031 53.675 1.00 45.40 ? 163  GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -14.983 51.238 53.794 1.00 45.95 ? 163  GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? -16.997 48.693 53.902 1.00 49.43 ? 163  GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? -18.375 48.281 53.281 1.00 51.24 ? 163  GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? -18.915 49.254 52.190 1.00 54.17 ? 163  GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? -19.154 48.768 51.051 1.00 56.90 ? 163  GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? -19.115 50.474 52.432 1.00 53.74 ? 163  GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -13.739 49.404 54.169 1.00 41.77 ? 164  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -12.632 50.093 54.869 1.00 39.62 ? 164  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -11.340 49.333 54.531 1.00 38.66 ? 164  ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -10.700 48.708 55.395 1.00 39.75 ? 164  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -12.851 50.084 56.386 1.00 39.58 ? 164  ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -10.924 49.411 53.268 1.00 37.06 ? 165  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -9.741  48.759 52.708 1.00 35.53 ? 165  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -8.396  49.232 53.173 1.00 35.74 ? 165  PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -7.371  48.521 52.948 1.00 35.48 ? 165  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -9.891  49.004 51.215 1.00 35.65 ? 165  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -10.466 50.392 51.196 1.00 36.63 ? 165  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -11.500 50.379 52.309 1.00 35.34 ? 165  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -8.391  50.417 53.797 1.00 32.61 ? 166  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -7.138  51.008 54.208 1.00 30.38 ? 166  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -6.640  51.968 53.106 1.00 29.74 ? 166  GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -7.172  51.994 51.963 1.00 27.89 ? 166  GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -5.673  52.793 53.496 1.00 27.56 ? 167  ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -5.045  53.753 52.646 1.00 27.68 ? 167  ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -5.932  54.802 52.046 1.00 28.00 ? 167  ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -5.466  55.563 51.137 1.00 27.90 ? 167  ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -4.308  53.030 51.525 1.00 27.97 ? 167  ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -3.182  52.159 52.064 1.00 29.76 ? 167  ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -2.622  52.446 53.130 1.00 29.97 ? 167  ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -2.829  51.123 51.335 1.00 28.42 ? 167  ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -7.182  54.911 52.522 1.00 27.16 ? 168  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -8.052  55.897 51.852 1.00 27.56 ? 168  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -7.548  57.365 51.956 1.00 26.97 ? 168  VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -7.761  58.192 51.039 1.00 25.90 ? 168  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -9.573  55.713 52.238 1.00 27.87 ? 168  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -9.976  54.235 51.955 1.00 27.62 ? 168  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -9.878  56.179 53.662 1.00 26.22 ? 168  VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -6.809  57.652 53.027 1.00 26.04 ? 169  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -6.218  58.971 53.160 1.00 24.85 ? 169  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -5.184  59.156 52.065 1.00 25.14 ? 169  GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -5.007  60.253 51.569 1.00 25.40 ? 169  GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -4.472  58.087 51.693 1.00 25.73 ? 170  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -3.512  58.217 50.607 1.00 26.26 ? 170  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -4.329  58.422 49.310 1.00 27.65 ? 170  LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -3.908  59.220 48.441 1.00 26.10 ? 170  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -2.632  56.975 50.486 1.00 25.95 ? 170  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -1.484  56.925 51.519 1.00 26.82 ? 170  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -0.800  55.561 51.444 1.00 25.36 ? 170  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -0.444  58.071 51.238 1.00 24.39 ? 170  LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -5.473  57.719 49.163 1.00 27.48 ? 171  LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -6.301  57.929 47.941 1.00 28.57 ? 171  LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -6.872  59.409 47.896 1.00 28.80 ? 171  LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -6.970  59.996 46.815 1.00 26.70 ? 171  LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -7.422  56.858 47.813 1.00 26.54 ? 171  LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -6.877  55.401 47.672 1.00 27.97 ? 171  LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -8.056  54.378 47.671 1.00 22.15 ? 171  LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -6.010  55.274 46.407 1.00 21.14 ? 171  LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -7.208  60.002 49.059 1.00 28.51 ? 172  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -7.632  61.403 49.070 1.00 28.61 ? 172  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -6.489  62.248 48.439 1.00 29.06 ? 172  ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -6.706  63.057 47.513 1.00 29.60 ? 172  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -7.886  61.888 50.508 1.00 27.30 ? 172  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -9.036  61.168 51.168 1.00 29.23 ? 172  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -9.785  60.439 50.451 1.00 27.16 ? 172  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -9.216  61.345 52.397 1.00 28.09 ? 172  ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -5.258  62.072 48.907 1.00 28.77 ? 173  GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -4.176  62.888 48.319 1.00 29.18 ? 173  GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -4.116  62.672 46.801 1.00 28.58 ? 173  GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -4.009  63.633 46.002 1.00 28.06 ? 173  GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -2.808  62.550 48.963 1.00 27.19 ? 173  GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -2.736  62.785 50.475 1.00 25.78 ? 173  GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -1.469  62.161 51.096 1.00 29.24 ? 173  GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -0.554  61.724 50.363 1.00 28.50 ? 173  GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -1.406  62.111 52.457 1.00 28.50 ? 173  GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -4.210  61.408 46.409 1.00 29.39 ? 174  ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -4.118  61.062 44.999 1.00 31.18 ? 174  ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -5.205  61.770 44.163 1.00 31.89 ? 174  ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -4.914  62.278 43.054 1.00 30.14 ? 174  ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -4.198  59.545 44.774 1.00 31.50 ? 174  ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -4.193  59.195 43.272 1.00 34.07 ? 174  ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -4.387  57.720 43.020 1.00 34.49 ? 174  ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -3.195  56.961 43.385 1.00 35.55 ? 174  ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -3.178  55.639 43.569 1.00 35.85 ? 174  ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -4.280  54.925 43.438 1.00 35.07 ? 174  ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -2.048  55.020 43.854 1.00 35.20 ? 174  ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -6.428  61.800 44.708 1.00 30.34 ? 175  MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -7.531  62.425 44.034 1.00 31.41 ? 175  MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -7.315  63.913 43.822 1.00 31.28 ? 175  MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -7.599  64.442 42.745 1.00 30.66 ? 175  MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -8.841  62.199 44.775 1.00 34.00 ? 175  MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -9.994  62.441 43.800 1.00 36.90 ? 175  MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -11.533 61.790 44.334 1.00 43.87 ? 175  MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -11.379 60.141 43.580 1.00 37.18 ? 175  MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -6.810  64.578 44.857 1.00 31.81 ? 176  ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -6.511  65.997 44.776 1.00 30.21 ? 176  ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -5.398  66.166 43.684 1.00 29.25 ? 176  ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -5.474  67.100 42.856 1.00 27.53 ? 176  ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -6.068  66.530 46.177 1.00 28.32 ? 176  ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -4.411  65.255 43.639 1.00 28.02 ? 177  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -3.364  65.375 42.591 1.00 28.41 ? 177  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -3.959  65.143 41.183 1.00 29.40 ? 177  LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -3.483  65.740 40.180 1.00 28.49 ? 177  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -2.194  64.383 42.791 1.00 26.96 ? 177  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -1.309  64.390 44.052 1.00 28.75 ? 177  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? -0.208  63.246 43.914 1.00 30.01 ? 177  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -0.625  65.780 44.286 1.00 27.48 ? 177  LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -4.984  64.274 41.104 1.00 30.01 ? 178  GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -5.665  63.977 39.830 1.00 30.11 ? 178  GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -6.414  65.272 39.432 1.00 31.27 ? 178  GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -6.467  65.662 38.263 1.00 30.86 ? 178  GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -6.667  62.810 40.007 1.00 30.20 ? 178  GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -7.454  62.364 38.742 1.00 29.07 ? 178  GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -6.538  61.843 37.647 1.00 32.61 ? 178  GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -5.940  60.754 37.790 1.00 34.85 ? 178  GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -6.384  62.621 36.557 1.00 30.69 ? 178  GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -6.941  65.971 40.417 1.00 31.04 ? 179  TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -7.704  67.179 40.111 1.00 31.19 ? 179  TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -6.783  68.305 39.669 1.00 31.37 ? 179  TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -7.100  69.068 38.760 1.00 31.38 ? 179  TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -8.563  67.566 41.321 1.00 31.61 ? 179  TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -9.609  68.589 41.046 1.00 33.59 ? 179  TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -10.946 68.369 40.791 1.00 32.05 ? 179  TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -9.404  70.019 40.965 1.00 31.79 ? 179  TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -11.573 69.580 40.564 1.00 32.52 ? 179  TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -10.655 70.602 40.657 1.00 31.19 ? 179  TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -8.284  70.850 41.115 1.00 31.46 ? 179  TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -10.822 71.984 40.493 1.00 30.10 ? 179  TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -8.450  72.252 40.951 1.00 32.91 ? 179  TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -9.716  72.791 40.642 1.00 30.96 ? 179  TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -5.631  68.401 40.306 1.00 32.74 ? 180  VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -4.636  69.392 39.922 1.00 33.20 ? 180  VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -4.139  69.027 38.505 1.00 33.86 ? 180  VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -3.983  69.888 37.652 1.00 34.47 ? 180  VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -3.436  69.348 40.897 1.00 33.43 ? 180  VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -2.256  70.193 40.348 1.00 30.87 ? 180  VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -3.893  69.838 42.254 1.00 32.20 ? 180  VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -3.855  67.753 38.269 1.00 33.72 ? 181  HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -3.445  67.330 36.938 1.00 33.86 ? 181  HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -4.504  67.743 35.877 1.00 34.38 ? 181  HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -4.157  68.250 34.806 1.00 33.86 ? 181  HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -3.307  65.816 36.887 1.00 32.90 ? 181  HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -3.054  65.284 35.513 1.00 35.56 ? 181  HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -1.786  65.214 34.964 1.00 37.97 ? 181  HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -3.908  64.840 34.552 1.00 34.13 ? 181  HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -1.870  64.747 33.727 1.00 36.40 ? 181  HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -3.145  64.519 33.455 1.00 35.50 ? 181  HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -5.779  67.508 36.181 1.00 32.76 ? 182  ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -6.853  67.819 35.260 1.00 34.35 ? 182  ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -7.282  69.288 35.150 1.00 35.11 ? 182  ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -7.783  69.710 34.102 1.00 35.33 ? 182  ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -8.130  66.995 35.586 1.00 34.86 ? 182  ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -7.932  65.467 35.433 1.00 35.22 ? 182  ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -7.123  64.986 34.581 1.00 36.62 ? 182  ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -8.619  64.743 36.169 1.00 35.95 ? 182  ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -7.080  70.082 36.190 1.00 33.84 ? 183  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -7.571  71.452 36.137 1.00 32.47 ? 183  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -6.607  72.578 36.365 1.00 33.30 ? 183  ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -6.976  73.735 36.137 1.00 34.62 ? 183  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -8.694  71.603 37.160 1.00 31.02 ? 183  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -9.874  70.728 36.844 1.00 33.13 ? 183  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -10.661 71.039 35.938 1.00 31.67 ? 183  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -10.004 69.590 37.578 1.00 32.26 ? 183  ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -5.378  72.287 36.801 1.00 33.55 ? 184  ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -4.473  73.384 37.137 1.00 32.85 ? 184  ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -4.151  74.347 35.951 1.00 34.11 ? 184  ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -3.808  75.521 36.173 1.00 33.45 ? 184  ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -3.212  72.839 37.891 1.00 30.47 ? 184  ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -2.696  73.921 38.838 1.00 30.69 ? 184  ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -2.146  72.409 36.946 1.00 29.66 ? 184  ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -3.723  74.299 39.964 1.00 30.10 ? 184  ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -4.347  73.870 34.708 1.00 33.28 ? 185  GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -4.076  74.692 33.523 1.00 32.88 ? 185  GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -4.993  75.922 33.560 1.00 33.16 ? 185  GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -4.585  77.034 33.185 1.00 32.25 ? 185  GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -4.309  73.893 32.217 1.00 30.78 ? 185  GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -5.752  73.536 31.993 1.00 33.94 ? 185  GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -5.971  72.431 30.928 1.00 35.97 ? 185  GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -5.757  71.253 31.202 1.00 36.11 ? 185  GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -6.404  72.823 29.713 1.00 34.35 ? 185  GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -6.215  75.742 34.046 1.00 31.83 ? 186  PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -7.120  76.867 34.059 1.00 33.43 ? 186  PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -6.678  77.963 35.036 1.00 35.70 ? 186  PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -7.161  79.096 34.936 1.00 37.00 ? 186  PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -8.553  76.386 34.338 1.00 32.99 ? 186  PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -8.990  75.295 33.398 1.00 31.99 ? 186  PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -9.061  75.540 32.026 1.00 31.60 ? 186  PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -9.171  73.986 33.866 1.00 30.55 ? 186  PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -9.300  74.476 31.081 1.00 34.14 ? 186  PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -9.402  72.907 32.977 1.00 32.04 ? 186  PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -9.470  73.136 31.564 1.00 32.95 ? 186  PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -5.753  77.648 35.952 1.00 35.21 ? 187  PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -5.278  78.636 36.893 1.00 34.23 ? 187  PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -3.902  79.144 36.467 1.00 35.44 ? 187  PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -3.226  79.880 37.217 1.00 32.86 ? 187  PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -5.219  78.056 38.311 1.00 34.20 ? 187  PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -6.565  77.580 38.841 1.00 33.86 ? 187  PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -7.010  76.275 38.584 1.00 33.53 ? 187  PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -7.357  78.425 39.636 1.00 33.57 ? 187  PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -8.208  75.804 39.102 1.00 33.01 ? 187  PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -8.565  77.983 40.173 1.00 33.21 ? 187  PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -9.006  76.666 39.911 1.00 33.36 ? 187  PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -3.488  78.759 35.253 1.00 35.65 ? 188  GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -2.180  79.200 34.762 1.00 36.72 ? 188  GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -1.028  78.291 35.149 1.00 38.04 ? 188  GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? 0.185   78.591 34.927 1.00 37.24 ? 188  GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -1.419  77.162 35.749 1.00 38.84 ? 189  GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -0.452  76.173 36.171 1.00 38.23 ? 189  GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? -0.159  75.210 35.048 1.00 37.34 ? 189  GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -1.036  74.898 34.245 1.00 38.62 ? 189  GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? 1.089   74.772 34.985 1.00 37.40 ? 190  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 1.553   73.787 34.007 1.00 37.86 ? 190  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 1.359   72.351 34.595 1.00 38.02 ? 190  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 2.061   71.923 35.495 1.00 38.51 ? 190  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 3.033   74.035 33.708 1.00 36.46 ? 190  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 3.557   73.098 32.650 1.00 37.82 ? 190  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 2.749   72.244 32.194 1.00 36.82 ? 190  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 4.758   73.226 32.274 1.00 38.51 ? 190  ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? 0.434   71.579 34.064 1.00 38.58 ? 191  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? 0.310   70.257 34.683 1.00 39.05 ? 191  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? 1.449   69.282 34.438 1.00 40.32 ? 191  PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? 1.494   68.202 35.060 1.00 39.81 ? 191  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -1.017  69.742 34.137 1.00 38.00 ? 191  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -0.972  70.269 32.740 1.00 39.33 ? 191  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -0.425  71.700 32.877 1.00 39.32 ? 191  PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? 2.367   69.620 33.544 1.00 40.76 ? 192  LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? 3.452   68.684 33.317 1.00 42.39 ? 192  LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? 4.649   69.093 34.168 1.00 40.52 ? 192  LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? 5.773   68.582 34.055 1.00 38.89 ? 192  LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? 3.778   68.568 31.815 1.00 44.29 ? 192  LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? 3.993   69.869 31.116 1.00 49.15 ? 192  LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? 3.805   69.751 29.573 1.00 52.79 ? 192  LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? 3.809   71.153 28.931 1.00 53.96 ? 192  LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? 2.667   72.053 29.417 1.00 54.28 ? 192  LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? 4.394   70.023 35.070 1.00 39.41 ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.489   70.425 35.924 1.00 38.44 ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 5.003   70.586 37.341 1.00 35.78 ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.163   71.646 37.942 1.00 35.60 ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 6.179   71.716 35.399 1.00 38.50 ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 6.400   71.586 33.990 1.00 40.36 ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 7.547   71.888 36.037 1.00 38.25 ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.353   69.554 37.870 1.00 33.28 ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 3.953   69.696 39.235 1.00 31.47 ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 4.882   68.923 40.138 1.00 31.23 ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.239   67.756 39.884 1.00 31.50 ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.414   69.400 39.483 1.00 31.66 ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 1.735   69.004 38.227 1.00 31.75 ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.188   68.454 40.592 1.00 28.44 ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.361   69.631 41.156 1.00 30.37 ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.230   69.060 42.178 1.00 30.32 ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.400   68.834 43.455 1.00 30.71 ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.749   69.791 43.960 1.00 31.32 ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.391   70.034 42.530 1.00 30.43 ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 8.275   70.107 41.413 1.00 33.29 ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.183   69.563 43.761 1.00 28.51 ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.331   67.594 43.947 1.00 28.11 ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.654   67.419 45.242 1.00 26.83 ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.754   67.558 46.360 1.00 27.32 ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 6.951   67.200 46.184 1.00 26.46 ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 3.944   66.064 45.355 1.00 27.79 ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 4.871   64.916 44.972 1.00 26.52 ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 2.755   65.995 44.413 1.00 28.53 ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.246   63.596 45.317 1.00 28.68 ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.393   68.152 47.487 1.00 27.52 ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.341   68.281 48.588 1.00 26.09 ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.579   68.247 49.894 1.00 26.26 ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.404   68.617 49.939 1.00 27.19 ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.218   69.534 48.420 1.00 27.57 ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.536   70.863 48.674 1.00 26.59 ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.366   71.226 48.028 1.00 27.84 ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.163   71.815 49.502 1.00 25.86 ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.823   72.566 48.211 1.00 29.04 ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.637   73.127 49.692 1.00 25.45 ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.474   73.507 49.053 1.00 25.74 ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.199   67.749 50.960 1.00 25.91 ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.487   67.638 52.234 1.00 23.98 ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.474   67.345 53.322 1.00 24.61 ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.636   67.007 53.055 1.00 24.90 ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.046   67.499 54.563 1.00 24.97 ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 6.956   67.265 55.677 1.00 25.55 ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.442   66.247 56.698 1.00 25.63 ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.233   66.132 56.921 1.00 25.39 ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 7.279   68.611 56.345 1.00 23.89 ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.211   68.530 57.491 1.00 22.51 ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 7.476   68.411 58.793 1.00 26.91 ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 6.237   68.539 58.772 1.00 29.96 ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 8.123   68.202 59.850 1.00 28.93 ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.373   65.517 57.323 1.00 26.55 ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 7.032   64.480 58.317 1.00 26.49 ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.090   63.450 57.600 1.00 25.71 ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.484   62.895 56.572 1.00 24.24 ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.332   65.107 59.508 1.00 26.37 ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.416   64.220 60.606 1.00 27.76 ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 4.875   63.210 58.091 1.00 24.14 ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 3.997   62.239 57.375 1.00 26.37 ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.763   62.693 55.938 1.00 27.50 ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.438   61.888 55.056 1.00 25.57 ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.601   62.075 58.077 1.00 25.97 ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 3.900   64.010 55.728 1.00 28.38 ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.698   64.566 54.413 1.00 28.07 ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 4.871   64.219 53.531 1.00 29.26 ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.722   64.058 52.305 1.00 29.99 ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 6.046   64.133 54.149 1.00 27.62 ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.236   63.775 53.407 1.00 27.32 ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 7.184   62.304 53.079 1.00 27.69 ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.553   61.893 51.964 1.00 29.79 ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.747   61.498 54.040 1.00 26.31 ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.597   60.062 53.821 1.00 26.67 ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.496   59.819 52.692 1.00 26.51 ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.672   58.950 51.781 1.00 25.54 ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.184   59.318 55.216 1.00 25.19 ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.385   60.560 52.761 1.00 23.55 ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.340   60.413 51.735 1.00 24.80 ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 3.937   60.696 50.326 1.00 25.73 ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 3.602   59.986 49.343 1.00 26.23 ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 2.172   61.420 51.912 1.00 22.97 ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.520   61.286 53.153 1.00 24.71 ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.751   61.773 50.214 1.00 25.24 ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.344   62.136 48.940 1.00 23.34 ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.111   60.915 48.439 1.00 23.84 ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 5.991   60.525 47.306 1.00 24.60 ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.274   63.355 49.085 1.00 23.83 ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 7.208   63.470 47.873 1.00 18.57 ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.412   64.665 49.313 1.00 21.64 ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 6.868   60.290 49.299 1.00 23.89 ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.610   59.104 48.887 1.00 24.84 ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 6.730   57.913 48.501 1.00 25.09 ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.093   57.089 47.615 1.00 23.56 ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.561   57.845 49.138 1.00 24.22 ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.634   56.775 48.851 1.00 25.89 ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.003   56.972 47.453 1.00 28.61 ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 3.713   55.978 46.754 1.00 28.80 ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.578   56.685 49.962 1.00 25.16 ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.193   56.341 51.345 1.00 25.19 ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 3.004   56.282 52.706 1.00 28.08 ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 3.870   55.401 53.941 1.00 23.30 ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 3.809   58.231 47.022 1.00 27.73 ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.267   58.436 45.708 1.00 28.08 ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.331   58.132 44.646 1.00 29.86 ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 3.971   57.810 43.486 1.00 29.46 ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 2.752   59.831 45.563 1.00 27.48 ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.507   60.067 46.344 1.00 29.80 ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 0.336   59.380 46.088 1.00 29.82 ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 1.249   60.884 47.401 1.00 28.87 ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -0.594  59.766 46.947 1.00 28.87 ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? -0.067  60.676 47.755 1.00 31.14 ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.620   58.256 45.035 1.00 29.47 ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 6.740   57.936 44.155 1.00 29.68 ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 6.757   56.409 43.955 1.00 31.03 ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 7.036   55.935 42.865 1.00 30.78 ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 8.098   58.372 44.774 1.00 30.97 ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.324   59.840 44.489 1.00 28.85 ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.308   57.582 44.137 1.00 28.76 ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.424   60.376 45.273 1.00 27.74 ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.429   55.653 45.005 1.00 31.85 ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.412   54.192 44.918 1.00 33.21 ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 5.140   53.638 44.222 1.00 34.67 ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 5.212   52.777 43.328 1.00 34.83 ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.565   53.564 46.322 1.00 31.95 ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 7.979   53.680 46.952 1.00 33.16 ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 7.925   53.280 48.390 1.00 32.06 ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 8.981   52.786 46.237 1.00 34.42 ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 3.982   54.145 44.621 1.00 34.13 ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 2.721   53.696 44.066 1.00 32.57 ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.485   53.877 42.577 1.00 32.47 ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.319   55.009 42.081 1.00 31.41 ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.564   54.354 44.780 1.00 31.67 ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.382   53.632 44.493 1.00 34.86 ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.411   52.746 41.843 1.00 32.47 ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 2.177   52.781 40.375 1.00 31.87 ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 0.946   53.669 40.103 1.00 29.70 ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 0.942   54.511 39.185 1.00 29.53 ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 1.902   51.303 40.025 1.00 31.85 ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 2.712   50.544 41.138 1.00 30.08 ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.425   51.365 42.375 1.00 29.69 ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? -0.096  53.506 40.914 1.00 28.25 ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -1.288  54.321 40.694 1.00 26.81 ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -1.121  55.817 40.839 1.00 28.62 ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -1.976  56.547 40.429 1.00 30.05 ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? -0.032  56.297 41.429 1.00 29.76 ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.151   57.718 41.608 1.00 31.38 ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.264   58.320 40.758 1.00 33.25 ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.260   59.524 40.531 1.00 32.99 ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.451   58.041 43.119 1.00 32.57 ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.654  57.787 43.983 1.00 31.14 ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.209   57.505 40.282 1.00 34.13 ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.366   58.039 39.547 1.00 34.69 ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 3.068   59.002 38.406 1.00 33.23 ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 3.831   59.949 38.201 1.00 32.13 ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.300   56.912 39.000 1.00 35.37 ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.043   55.572 39.632 1.00 41.44 ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.196   54.913 40.392 1.00 41.35 ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 5.848   54.023 39.462 1.00 41.99 ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.252   52.785 39.716 1.00 40.42 ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 6.105   52.203 40.907 1.00 35.88 ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 6.802   52.128 38.704 1.00 41.21 ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 1.969   58.813 37.685 1.00 32.52 ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 1.786   59.690 36.523 1.00 33.72 ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.198   61.085 36.789 1.00 34.22 ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.169   61.921 35.862 1.00 35.42 ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 0.940   59.001 35.435 1.00 32.38 ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 1.479   57.619 35.013 1.00 34.04 ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 2.647   57.253 35.331 1.00 33.76 ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 0.700   56.877 34.348 1.00 35.03 ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 0.738   61.334 38.021 1.00 31.82 ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.114   62.592 38.353 1.00 31.42 ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.041   63.745 38.742 1.00 32.69 ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.553   64.812 39.066 1.00 33.53 ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.921  62.383 39.456 1.00 30.69 ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -1.916  61.262 39.113 1.00 31.88 ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.826  61.030 40.329 1.00 30.42 ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.725  61.587 37.811 1.00 28.13 ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.367   63.557 38.699 1.00 31.53 ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.258   64.650 39.068 1.00 29.92 ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 4.595   64.422 38.385 1.00 30.10 ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 4.870   63.352 37.853 1.00 31.16 ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.427   64.755 40.615 1.00 28.53 ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 4.034   63.514 41.264 1.00 25.87 ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.236   62.370 41.531 1.00 24.71 ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.412   63.473 41.583 1.00 24.94 ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 3.835   61.149 42.130 1.00 25.82 ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 6.026   62.246 42.186 1.00 27.94 ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.221   61.100 42.446 1.00 23.14 ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.434   65.436 38.432 1.00 30.14 ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 6.721   65.402 37.784 1.00 30.55 ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 7.947   65.133 38.707 1.00 30.98 ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 8.810   64.296 38.367 1.00 29.57 ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 6.887   66.755 37.087 1.00 30.79 ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.201   66.957 36.422 1.00 34.18 ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.266   65.995 35.251 1.00 38.05 ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.370   66.305 34.352 1.00 43.45 ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.321   67.199 33.354 1.00 44.44 ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.194   67.887 33.115 1.00 41.84 ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.413  67.384 32.580 1.00 43.67 ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 8.001   65.845 39.846 1.00 29.83 ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.131   65.837 40.796 1.00 29.87 ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 8.647   65.884 42.239 1.00 27.83 ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.531   66.311 42.505 1.00 25.48 ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 10.010  67.105 40.574 1.00 32.53 ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 10.774  67.068 39.292 1.00 36.16 ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 11.832  68.095 39.253 1.00 35.83 ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.340  69.155 38.451 1.00 40.78 ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.434  69.221 37.131 1.00 41.41 ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 12.045  68.282 36.409 1.00 37.61 ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 10.808  70.228 36.530 1.00 43.14 ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.538   65.527 43.163 1.00 26.94 ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.211   65.463 44.588 1.00 27.11 ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.278  66.024 45.548 1.00 28.31 ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.505  65.971 45.289 1.00 27.31 ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 8.882   63.980 44.970 1.00 24.54 ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 9.771   66.593 46.643 1.00 29.06 ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.580  67.150 47.713 1.00 27.91 ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 10.050  66.496 48.978 1.00 27.75 ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 8.854   66.524 49.248 1.00 27.35 ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.397  68.655 47.855 1.00 28.04 ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 10.984  69.371 46.619 1.00 28.75 ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 11.132  69.145 49.189 1.00 24.99 ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.755  70.980 46.642 1.00 29.88 ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 10.948  65.913 49.748 1.00 27.67 ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.593  65.215 50.994 1.00 27.14 ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.409  65.852 52.132 1.00 27.27 ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.630  65.952 52.053 1.00 28.13 ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 10.939  63.726 50.880 1.00 25.11 ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.192  62.840 49.857 1.00 24.29 ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 10.851  62.971 48.486 1.00 22.10 ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.250  61.384 50.313 1.00 20.29 ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.714  66.313 53.165 1.00 27.70 ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.322  66.977 54.340 1.00 26.26 ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 11.017  66.150 55.614 1.00 26.89 ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.820   65.959 55.994 1.00 25.32 ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 10.730  68.385 54.523 1.00 25.47 ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 10.970  69.337 53.341 1.00 25.61 ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 10.137  70.627 53.414 1.00 25.70 ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.707   71.173 52.398 1.00 26.58 ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 9.911   71.112 54.614 1.00 27.20 ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 12.090  65.630 56.222 1.00 26.29 ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 11.993  64.885 57.477 1.00 27.99 ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 10.941  63.807 57.378 1.00 27.69 ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.145  63.637 58.300 1.00 28.71 ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.593  65.822 58.660 1.00 28.05 ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.478  66.947 58.792 1.00 28.02 ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 10.918  63.089 56.279 1.00 26.90 ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 9.904   62.065 56.141 1.00 26.79 ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.299  61.217 54.976 1.00 27.92 ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 10.736  61.701 53.915 1.00 28.02 ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.095  59.934 55.141 1.00 28.95 ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.530  58.978 54.121 1.00 29.06 ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.446   57.880 54.130 1.00 28.09 ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 8.924   57.575 55.159 1.00 25.58 ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 11.883  58.436 54.600 1.00 29.07 ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.514  57.723 53.616 1.00 33.19 ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.155   57.252 52.986 1.00 28.69 ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 8.102   56.219 52.999 1.00 28.30 ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.360   54.958 53.821 1.00 28.24 ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.408   54.292 54.239 1.00 27.97 ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 7.903   55.899 51.504 1.00 28.70 ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.352   56.085 50.943 1.00 28.29 ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 9.840   57.351 51.671 1.00 26.40 ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 9.634   54.636 54.018 1.00 26.88 ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.069  53.454 54.759 1.00 27.74 ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.290  53.773 56.244 1.00 28.65 ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 10.926  52.965 56.973 1.00 30.55 ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.388  52.953 54.187 1.00 26.48 ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.412  54.059 54.093 1.00 29.80 ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 12.093  55.167 53.618 1.00 31.37 ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 13.638  53.796 54.533 1.00 30.11 ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 9.809   54.926 56.697 1.00 25.35 ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 10.002  55.230 58.100 1.00 27.22 ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.251   54.183 58.929 1.00 27.72 ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.086   53.858 58.665 1.00 28.02 ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.520   56.657 58.464 1.00 27.40 ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.619  58.000 57.912 1.00 26.15 ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 9.894   53.679 59.983 1.00 27.28 ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.217   52.657 60.805 1.00 25.61 ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 7.811   53.010 61.341 1.00 26.78 ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.090   52.105 61.754 1.00 26.26 ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.220  52.383 61.938 1.00 24.60 ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 10.851  53.783 62.194 1.00 27.84 ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 10.894  54.456 60.744 1.00 25.74 ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.401   54.295 61.332 1.00 26.87 ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.074   54.686 61.872 1.00 25.76 ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.047   54.913 60.755 1.00 26.76 ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 3.834   55.091 61.026 1.00 28.32 ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.189   55.998 62.700 1.00 22.66 ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 7.000   57.061 61.972 1.00 24.91 ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.346   57.321 62.141 1.00 25.61 ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.568   57.941 60.898 1.00 25.25 ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 8.779   58.299 61.247 1.00 25.27 ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.715   58.700 60.478 1.00 26.43 ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.338   58.165 60.251 1.00 25.50 ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.658   59.681 59.427 1.00 24.56 ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.282   59.147 59.190 1.00 26.73 ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.448   59.885 58.801 1.00 24.16 ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.531   54.911 59.514 1.00 26.05 ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 4.721   55.235 58.318 1.00 26.35 ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 3.807   54.195 57.685 1.00 27.34 ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.021   54.541 56.803 1.00 27.46 ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.639   55.770 57.231 1.00 27.67 ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 3.920   52.940 58.094 1.00 28.08 ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.083   51.902 57.537 1.00 29.32 ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.024   50.700 58.468 1.00 30.30 ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 3.818   50.591 59.384 1.00 30.37 ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 3.612   51.456 56.178 1.00 29.38 ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 4.878   50.837 56.278 1.00 26.59 ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.041   49.839 58.239 1.00 30.66 ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 1.877   48.608 59.005 1.00 30.90 ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.428   47.494 58.038 1.00 31.49 ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 0.907   47.768 56.927 1.00 32.98 ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 0.811   48.734 60.161 1.00 29.85 ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 1.369   49.638 61.273 1.00 26.24 ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.536  49.177 59.621 1.00 25.00 ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 1.640   46.249 58.433 1.00 29.94 ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.213   45.122 57.581 1.00 29.76 ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -0.341  45.070 57.666 1.00 29.72 ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.957  45.703 58.605 1.00 26.31 ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 1.780   43.820 58.145 1.00 27.73 ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 1.278   43.681 59.486 1.00 30.87 ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.960  44.321 56.737 1.00 28.20 ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.410  44.203 56.762 1.00 29.31 ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.831  43.540 58.041 1.00 29.01 ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -3.853  43.927 58.645 1.00 28.88 ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -2.939  43.381 55.586 1.00 31.95 ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.808  44.184 54.302 1.00 31.25 ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -2.149  42.123 55.447 1.00 30.76 ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -2.042  42.575 58.511 1.00 27.93 ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -2.442  41.898 59.768 1.00 29.22 ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -2.460  42.866 60.954 1.00 30.03 ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -3.406  42.870 61.758 1.00 29.87 ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -1.486  40.697 60.094 1.00 27.55 ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -1.411  43.694 61.074 1.00 30.58 ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -1.376  44.637 62.202 1.00 30.85 ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.512  45.687 62.097 1.00 29.88 ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -3.094  46.090 63.116 1.00 29.70 ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? 0.014   45.286 62.329 1.00 30.59 ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? 0.098   46.402 63.405 1.00 34.65 ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? -0.221  45.941 64.835 1.00 35.41 ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? -0.440  44.734 65.070 1.00 39.30 ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -0.267  46.789 65.744 1.00 35.72 ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.852  46.086 60.868 1.00 30.10 ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.942  47.041 60.648 1.00 31.34 ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -5.290  46.426 61.054 1.00 32.05 ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -6.161  47.075 61.708 1.00 32.23 ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -5.469  45.163 60.681 1.00 31.24 ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.696  44.448 61.036 1.00 32.14 ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.757  44.382 62.568 1.00 31.67 ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.778  44.707 63.216 1.00 32.45 ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.647  43.042 60.408 1.00 33.23 ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.735  42.022 60.854 1.00 34.09 ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -7.879  40.890 59.786 1.00 31.95 ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -8.445  41.388 58.510 1.00 32.08 ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.728  41.727 58.374 1.00 32.05 ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.188 42.188 57.215 1.00 33.08 ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -10.572 41.566 59.393 1.00 30.53 ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.636  44.021 63.163 1.00 30.75 ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.624  43.916 64.597 1.00 32.44 ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -6.046  45.215 65.316 1.00 32.86 ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.852  45.172 66.284 1.00 32.30 ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -4.241  43.432 65.016 1.00 35.78 ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -4.054  43.035 66.455 1.00 39.55 ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.748  43.726 67.007 1.00 44.74 ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -3.123  44.461 68.211 1.00 47.55 ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.702  45.668 68.556 1.00 48.70 ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -1.849  46.355 67.804 1.00 49.72 ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -3.169  46.194 69.680 1.00 52.12 ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.535  46.367 64.849 1.00 32.71 ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.869  47.647 65.487 1.00 31.48 ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -7.284  48.048 65.182 1.00 31.86 ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -7.931  48.682 66.038 1.00 31.72 ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.926  48.764 65.037 1.00 31.38 ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.459  48.510 65.446 1.00 31.04 ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.544  49.463 64.700 1.00 29.64 ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -1.143  49.262 65.022 1.00 28.20 ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? -0.179  50.141 64.782 1.00 26.44 ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? -0.457  51.338 64.216 1.00 27.76 ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 1.064   49.795 65.058 1.00 22.30 ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.777  47.717 63.978 1.00 31.23 ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -9.183  48.063 63.677 1.00 32.20 ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -10.113 47.317 64.661 1.00 32.24 ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -11.063 47.923 65.218 1.00 30.21 ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -9.548  47.690 62.241 1.00 32.46 ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.836  46.011 64.847 1.00 31.72 ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.625 45.185 65.759 1.00 33.60 ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.534 45.789 67.192 1.00 34.25 ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.564 46.012 67.883 1.00 35.86 ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -10.115 43.660 65.782 1.00 35.31 ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -10.941 42.872 66.810 1.00 34.71 ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -10.250 42.945 64.345 1.00 30.93 ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -9.313  46.073 67.633 1.00 34.12 ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -9.090  46.661 68.961 1.00 33.95 ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.830  48.009 69.090 1.00 33.20 ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -10.407 48.338 70.148 1.00 29.57 ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.583  46.835 69.183 1.00 35.04 ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.186  47.087 70.605 1.00 39.57 ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.701  45.981 71.595 1.00 45.20 ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.854  46.371 72.811 1.00 44.35 ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -7.927  44.778 71.162 1.00 41.04 ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.811  48.804 68.017 1.00 33.86 ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.532 50.088 68.077 1.00 34.77 ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -11.999 49.714 68.327 1.00 36.19 ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.659 50.288 69.191 1.00 34.86 ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.430 50.848 66.767 1.00 33.54 ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.183 52.176 66.757 1.00 34.78 ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -10.553 53.091 67.853 1.00 35.71 ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.111 52.849 65.354 1.00 34.02 ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.486 48.727 67.562 1.00 37.59 ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -13.851 48.250 67.726 1.00 38.78 ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -14.147 47.794 69.145 1.00 40.56 ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -15.174 48.161 69.721 1.00 40.15 ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.236 47.019 69.731 1.00 39.87 ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.453 46.568 71.075 1.00 40.35 ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.581 47.730 72.095 1.00 41.67 ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -14.327 47.632 73.094 1.00 40.85 ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -12.333 45.608 71.449 1.00 42.31 ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.537 44.876 72.764 1.00 44.39 ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -11.340 44.031 73.078 1.00 47.15 ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -10.791 43.400 71.875 1.00 51.18 ? 250  ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? -11.111 42.187 71.424 1.00 53.71 ? 250  ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? -12.005 41.426 72.071 1.00 54.31 ? 250  ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? -10.514 41.719 70.327 1.00 55.03 ? 250  ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -12.859 48.827 71.851 1.00 42.13 ? 251  ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -12.882 50.013 72.719 1.00 41.47 ? 251  ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -14.222 50.756 72.649 1.00 42.88 ? 251  ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -14.569 51.519 73.560 1.00 41.49 ? 251  ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -11.772 50.978 72.287 1.00 41.21 ? 251  ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -10.492 50.825 73.091 1.00 39.72 ? 251  ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -10.307 51.527 74.075 1.00 39.84 ? 251  ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -9.603  49.929 72.670 1.00 37.93 ? 251  ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -14.958 50.578 71.544 1.00 44.00 ? 252  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -16.268 51.239 71.396 1.00 44.91 ? 252  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? -17.481 50.246 71.502 1.00 46.42 ? 252  LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? -18.585 50.509 71.001 1.00 45.92 ? 252  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -16.302 52.028 70.082 1.00 41.51 ? 252  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -15.166 53.043 70.103 1.00 41.37 ? 252  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -14.846 53.493 68.707 1.00 41.18 ? 252  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -15.525 54.240 70.995 1.00 41.46 ? 252  LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? -17.247 49.117 72.173 1.00 47.49 ? 253  ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? -18.265 48.093 72.390 1.00 49.61 ? 253  ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? -18.886 47.522 71.127 1.00 49.52 ? 253  ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? -20.026 47.097 71.132 1.00 50.79 ? 253  ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? -19.347 48.670 73.278 1.00 51.22 ? 253  ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? -18.755 49.385 74.479 1.00 56.09 ? 253  ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? -18.047 48.762 75.313 1.00 55.61 ? 253  ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? -19.009 50.715 74.574 1.00 57.44 ? 253  ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? -18.141 47.499 70.042 1.00 48.40 ? 254  CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? -18.676 46.977 68.809 1.00 47.52 ? 254  CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? -18.857 45.469 68.744 1.00 48.14 ? 254  CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? -18.162 44.670 69.407 1.00 46.23 ? 254  CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? -17.779 47.361 67.645 1.00 47.98 ? 254  CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? -17.774 49.119 67.187 1.00 47.73 ? 254  CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? -19.801 45.094 67.886 1.00 48.55 ? 255  ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? -20.075 43.695 67.606 1.00 48.07 ? 255  ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? -18.838 43.345 66.797 1.00 47.16 ? 255  ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? -18.601 43.977 65.772 1.00 44.92 ? 255  ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? -21.298 43.597 66.709 1.00 50.13 ? 255  ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? -21.633 42.171 66.359 1.00 52.46 ? 255  ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? -20.756 41.383 65.969 1.00 52.52 ? 255  ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? -22.904 41.824 66.492 1.00 53.19 ? 255  ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? -18.052 42.370 67.235 1.00 47.24 ? 256  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? -16.838 42.030 66.501 1.00 48.16 ? 256  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? -16.812 40.794 65.642 1.00 49.95 ? 256  LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? -15.713 40.404 65.212 1.00 50.87 ? 256  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? -15.644 41.905 67.442 1.00 46.71 ? 256  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? -15.329 43.063 68.390 1.00 47.72 ? 256  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? -14.108 42.661 69.236 1.00 45.49 ? 256  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? -15.096 44.401 67.578 1.00 45.53 ? 256  LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? -17.935 40.160 65.321 1.00 51.37 ? 257  ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? -17.720 38.939 64.532 1.00 53.68 ? 257  ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? -17.757 38.954 63.015 1.00 52.20 ? 257  ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? -17.736 37.899 62.384 1.00 52.32 ? 257  ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? -18.543 37.779 65.088 1.00 57.79 ? 257  ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? -19.900 38.215 65.521 1.00 61.75 ? 257  ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? -20.412 37.778 66.560 1.00 61.83 ? 257  ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? -20.509 39.104 64.721 1.00 65.02 ? 257  ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? -17.784 40.144 62.424 1.00 50.55 ? 258  SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? -17.666 40.252 60.971 1.00 48.45 ? 258  SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? -17.183 41.669 60.658 1.00 48.05 ? 258  SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? -17.482 42.614 61.398 1.00 47.36 ? 258  SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? -18.989 39.961 60.248 1.00 47.55 ? 258  SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? -19.872 41.072 60.226 1.00 47.09 ? 258  SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? -16.410 41.798 59.586 1.00 47.38 ? 259  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? -15.929 43.090 59.166 1.00 47.12 ? 259  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? -17.161 43.970 59.001 1.00 47.67 ? 259  ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? -17.155 45.129 59.431 1.00 47.92 ? 259  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? -15.116 42.998 57.855 1.00 45.36 ? 259  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? -13.670 42.467 58.085 1.00 47.71 ? 259  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? -13.314 42.139 59.252 1.00 47.95 ? 259  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? -12.877 42.369 57.112 1.00 46.84 ? 259  ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? -18.232 43.414 58.439 1.00 48.22 ? 260  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? -19.463 44.184 58.230 1.00 49.06 ? 260  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? -20.054 44.737 59.520 1.00 47.24 ? 260  GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? -20.447 45.909 59.567 1.00 45.75 ? 260  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? -20.542 43.356 57.507 1.00 51.61 ? 260  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? -20.056 42.672 56.207 1.00 58.39 ? 260  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? -19.183 41.389 56.462 1.00 62.51 ? 260  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? -17.923 41.479 56.452 1.00 62.61 ? 260  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? -19.770 40.280 56.683 1.00 65.62 ? 260  GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? -20.126 43.909 60.559 1.00 45.79 ? 261  GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? -20.690 44.376 61.819 1.00 45.63 ? 261  GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? -19.771 45.432 62.414 1.00 43.38 ? 261  GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? -20.247 46.465 62.887 1.00 41.83 ? 261  GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? -20.862 43.218 62.825 1.00 49.29 ? 261  GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? -21.386 41.911 62.200 1.00 55.21 ? 261  GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? -22.706 41.413 62.796 1.00 58.85 ? 261  GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? -23.621 42.241 63.132 1.00 57.56 ? 261  GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? -22.797 40.161 62.906 1.00 60.82 ? 261  GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? -18.455 45.165 62.383 1.00 41.40 ? 262  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? -17.461 46.088 62.918 1.00 38.77 ? 262  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? -17.558 47.427 62.210 1.00 38.30 ? 262  LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? -17.750 48.477 62.848 1.00 37.18 ? 262  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? -16.045 45.510 62.770 1.00 38.22 ? 262  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? -14.860 46.416 63.199 1.00 36.68 ? 262  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? -15.070 46.947 64.626 1.00 32.22 ? 262  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? -13.529 45.621 63.091 1.00 34.94 ? 262  LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? -17.482 47.394 60.889 1.00 37.39 ? 263  ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? -17.540 48.639 60.154 1.00 38.82 ? 263  ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? -18.833 49.346 60.455 1.00 40.27 ? 263  ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? -18.827 50.515 60.849 1.00 40.49 ? 263  ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? -17.361 48.434 58.632 1.00 38.71 ? 263  ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? -15.941 47.932 58.331 1.00 38.32 ? 263  ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? -17.664 49.741 57.900 1.00 38.98 ? 263  ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? -15.761 47.340 56.957 1.00 37.28 ? 263  ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? -19.945 48.630 60.329 1.00 42.91 ? 264  HIS A N   1 
ATOM   2018 C CA  . HIS A 1 264 ? -21.256 49.235 60.595 1.00 44.83 ? 264  HIS A CA  1 
ATOM   2019 C C   . HIS A 1 264 ? -21.265 49.993 61.902 1.00 43.47 ? 264  HIS A C   1 
ATOM   2020 O O   . HIS A 1 264 ? -21.724 51.158 61.963 1.00 44.10 ? 264  HIS A O   1 
ATOM   2021 C CB  . HIS A 1 264 ? -22.399 48.196 60.619 1.00 47.88 ? 264  HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 264 ? -23.744 48.807 60.888 1.00 53.09 ? 264  HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 264 ? -24.319 48.826 62.150 1.00 55.40 ? 264  HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 264 ? -24.557 49.552 60.090 1.00 54.89 ? 264  HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 264 ? -25.418 49.568 62.119 1.00 56.74 ? 264  HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 264 ? -25.584 50.019 60.881 1.00 57.11 ? 264  HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 265 ? -20.755 49.330 62.933 1.00 41.56 ? 265  CYS A N   1 
ATOM   2028 C CA  . CYS A 1 265 ? -20.689 49.902 64.278 1.00 41.58 ? 265  CYS A CA  1 
ATOM   2029 C C   . CYS A 1 265 ? -19.862 51.195 64.337 1.00 39.55 ? 265  CYS A C   1 
ATOM   2030 O O   . CYS A 1 265 ? -20.324 52.206 64.890 1.00 36.65 ? 265  CYS A O   1 
ATOM   2031 C CB  . CYS A 1 265 ? -20.106 48.875 65.260 1.00 43.02 ? 265  CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 265 ? -19.752 49.541 66.944 1.00 49.78 ? 265  CYS A SG  1 
ATOM   2033 N N   . LEU A 1 266 ? -18.660 51.134 63.748 1.00 38.43 ? 266  LEU A N   1 
ATOM   2034 C CA  . LEU A 1 266 ? -17.745 52.274 63.718 1.00 39.11 ? 266  LEU A CA  1 
ATOM   2035 C C   . LEU A 1 266 ? -18.363 53.450 62.957 1.00 40.66 ? 266  LEU A C   1 
ATOM   2036 O O   . LEU A 1 266 ? -18.082 54.640 63.274 1.00 40.46 ? 266  LEU A O   1 
ATOM   2037 C CB  . LEU A 1 266 ? -16.365 51.867 63.111 1.00 35.94 ? 266  LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 266 ? -15.579 50.887 64.020 1.00 34.25 ? 266  LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 266 ? -14.355 50.400 63.314 1.00 35.74 ? 266  LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 266 ? -15.188 51.547 65.337 1.00 33.64 ? 266  LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 267 ? -19.226 53.136 61.990 1.00 40.47 ? 267  ARG A N   1 
ATOM   2042 C CA  . ARG A 1 267 ? -19.811 54.199 61.229 1.00 43.14 ? 267  ARG A CA  1 
ATOM   2043 C C   . ARG A 1 267 ? -20.920 54.903 61.970 1.00 45.44 ? 267  ARG A C   1 
ATOM   2044 O O   . ARG A 1 267 ? -21.290 56.017 61.569 1.00 46.08 ? 267  ARG A O   1 
ATOM   2045 C CB  . ARG A 1 267 ? -20.355 53.700 59.905 1.00 42.22 ? 267  ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 267 ? -19.297 53.376 58.922 1.00 43.28 ? 267  ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 267 ? -19.875 52.865 57.629 1.00 43.38 ? 267  ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 267 ? -18.841 52.880 56.622 1.00 45.09 ? 267  ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 267 ? -18.829 52.109 55.542 1.00 46.66 ? 267  ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 267 ? -19.838 51.264 55.356 1.00 45.74 ? 267  ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 267 ? -17.792 52.157 54.682 1.00 44.10 ? 267  ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 268 ? -21.470 54.296 63.030 1.00 46.88 ? 268  GLU A N   1 
ATOM   2053 C CA  . GLU A 1 268 ? -22.579 54.978 63.738 1.00 48.19 ? 268  GLU A CA  1 
ATOM   2054 C C   . GLU A 1 268 ? -22.020 55.880 64.798 1.00 46.42 ? 268  GLU A C   1 
ATOM   2055 O O   . GLU A 1 268 ? -22.732 56.740 65.296 1.00 46.30 ? 268  GLU A O   1 
ATOM   2056 C CB  . GLU A 1 268 ? -23.573 54.006 64.406 1.00 51.36 ? 268  GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 268 ? -24.276 52.966 63.469 1.00 59.44 ? 268  GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 268 ? -24.657 53.515 62.044 1.00 64.40 ? 268  GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 268 ? -24.182 52.903 61.015 1.00 64.53 ? 268  GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 268 ? -25.424 54.541 61.962 1.00 66.81 ? 268  GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 269 ? -20.740 55.686 65.130 1.00 44.34 ? 269  LYS A N   1 
ATOM   2062 C CA  . LYS A 1 269 ? -20.089 56.492 66.160 1.00 41.99 ? 269  LYS A CA  1 
ATOM   2063 C C   . LYS A 1 269 ? -19.735 57.894 65.688 1.00 40.61 ? 269  LYS A C   1 
ATOM   2064 O O   . LYS A 1 269 ? -19.349 58.120 64.522 1.00 38.29 ? 269  LYS A O   1 
ATOM   2065 C CB  . LYS A 1 269 ? -18.838 55.789 66.655 1.00 41.67 ? 269  LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 269 ? -19.049 54.357 67.092 1.00 42.58 ? 269  LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 269 ? -19.803 54.289 68.390 1.00 44.47 ? 269  LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 269 ? -19.819 52.862 68.985 1.00 47.49 ? 269  LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 269 ? -20.073 52.920 70.517 1.00 50.61 ? 269  LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 270 ? -19.893 58.851 66.598 1.00 40.77 ? 270  LYS A N   1 
ATOM   2071 C CA  . LYS A 1 270 ? -19.563 60.247 66.301 1.00 41.67 ? 270  LYS A CA  1 
ATOM   2072 C C   . LYS A 1 270 ? -18.030 60.363 66.123 1.00 39.87 ? 270  LYS A C   1 
ATOM   2073 O O   . LYS A 1 270 ? -17.291 59.562 66.704 1.00 39.74 ? 270  LYS A O   1 
ATOM   2074 C CB  . LYS A 1 270 ? -19.963 61.134 67.460 1.00 44.17 ? 270  LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 270 ? -21.421 61.178 67.733 1.00 50.53 ? 270  LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 270 ? -22.153 61.963 66.642 1.00 57.20 ? 270  LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 270 ? -23.553 62.394 67.169 1.00 62.83 ? 270  LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 270 ? -23.483 62.866 68.631 1.00 63.83 ? 270  LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 271 ? -17.544 61.348 65.328 1.00 37.69 ? 271  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 271 ? -16.097 61.492 65.151 1.00 36.12 ? 271  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 271 ? -15.338 61.468 66.497 1.00 36.16 ? 271  PRO A C   1 
ATOM   2082 O O   . PRO A 1 271 ? -14.437 60.643 66.707 1.00 33.50 ? 271  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 271 ? -15.964 62.850 64.448 1.00 36.69 ? 271  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 271 ? -17.223 62.931 63.629 1.00 34.51 ? 271  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 271 ? -18.285 62.350 64.529 1.00 35.43 ? 271  PRO A CD  1 
ATOM   2086 N N   . GLN A 1 272 ? -15.709 62.350 67.423 1.00 37.07 ? 272  GLN A N   1 
ATOM   2087 C CA  . GLN A 1 272 ? -14.987 62.369 68.700 1.00 38.18 ? 272  GLN A CA  1 
ATOM   2088 C C   . GLN A 1 272 ? -14.895 61.031 69.479 1.00 38.24 ? 272  GLN A C   1 
ATOM   2089 O O   . GLN A 1 272 ? -13.983 60.855 70.290 1.00 38.62 ? 272  GLN A O   1 
ATOM   2090 C CB  . GLN A 1 272 ? -15.558 63.458 69.609 1.00 39.06 ? 272  GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 272 ? -14.566 63.966 70.661 1.00 41.40 ? 272  GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 272 ? -13.166 64.229 70.069 1.00 43.15 ? 272  GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 272 ? -13.040 64.886 69.020 1.00 42.59 ? 272  GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 272 ? -12.114 63.710 70.741 1.00 39.85 ? 272  GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 273 ? -15.800 60.085 69.248 1.00 36.90 ? 273  GLU A N   1 
ATOM   2096 C CA  . GLU A 1 273 ? -15.722 58.798 69.959 1.00 37.14 ? 273  GLU A CA  1 
ATOM   2097 C C   . GLU A 1 273 ? -14.537 57.984 69.418 1.00 36.65 ? 273  GLU A C   1 
ATOM   2098 O O   . GLU A 1 273 ? -13.872 57.261 70.168 1.00 36.17 ? 273  GLU A O   1 
ATOM   2099 C CB  . GLU A 1 273 ? -17.020 57.988 69.776 1.00 38.49 ? 273  GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 273 ? -18.223 58.667 70.423 1.00 43.05 ? 273  GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 273 ? -19.546 57.956 70.108 1.00 47.13 ? 273  GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 273 ? -19.846 56.945 70.827 1.00 48.20 ? 273  GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 273 ? -20.257 58.393 69.143 1.00 44.21 ? 273  GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 274 ? -14.311 58.060 68.107 1.00 34.50 ? 274  LEU A N   1 
ATOM   2105 C CA  . LEU A 1 274 ? -13.175 57.378 67.517 1.00 34.46 ? 274  LEU A CA  1 
ATOM   2106 C C   . LEU A 1 274 ? -11.863 58.078 68.009 1.00 34.07 ? 274  LEU A C   1 
ATOM   2107 O O   . LEU A 1 274 ? -10.928 57.418 68.507 1.00 33.48 ? 274  LEU A O   1 
ATOM   2108 C CB  . LEU A 1 274 ? -13.272 57.436 65.988 1.00 36.95 ? 274  LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 274 ? -13.968 56.291 65.220 1.00 38.27 ? 274  LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 274 ? -15.215 55.827 65.901 1.00 36.88 ? 274  LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 274 ? -14.304 56.797 63.839 1.00 38.00 ? 274  LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 275 ? -11.801 59.402 67.899 1.00 31.94 ? 275  ILE A N   1 
ATOM   2113 C CA  . ILE A 1 275 ? -10.642 60.128 68.331 1.00 32.06 ? 275  ILE A CA  1 
ATOM   2114 C C   . ILE A 1 275 ? -10.331 59.894 69.825 1.00 33.38 ? 275  ILE A C   1 
ATOM   2115 O O   . ILE A 1 275 ? -9.170  59.757 70.209 1.00 34.04 ? 275  ILE A O   1 
ATOM   2116 C CB  . ILE A 1 275 ? -10.838 61.611 68.036 1.00 32.63 ? 275  ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 275 ? -10.922 61.815 66.517 1.00 32.33 ? 275  ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 275 ? -9.720  62.456 68.682 1.00 30.34 ? 275  ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 275 ? -11.627 63.171 66.149 1.00 30.67 ? 275  ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 276 ? -11.348 59.752 70.665 1.00 33.17 ? 276  ASP A N   1 
ATOM   2121 C CA  . ASP A 1 276 ? -11.075 59.547 72.085 1.00 33.47 ? 276  ASP A CA  1 
ATOM   2122 C C   . ASP A 1 276 ? -10.328 58.273 72.499 1.00 32.91 ? 276  ASP A C   1 
ATOM   2123 O O   . ASP A 1 276 ? -9.612  58.270 73.537 1.00 31.97 ? 276  ASP A O   1 
ATOM   2124 C CB  . ASP A 1 276 ? -12.384 59.610 72.894 1.00 36.15 ? 276  ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 276 ? -12.833 61.030 73.175 1.00 38.20 ? 276  ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 276 ? -12.035 61.982 72.968 1.00 39.79 ? 276  ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 276 ? -13.982 61.182 73.609 1.00 39.80 ? 276  ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 277 ? -10.487 57.185 71.740 1.00 30.58 ? 277  VAL A N   1 
ATOM   2129 C CA  . VAL A 1 277 ? -9.811  55.920 72.113 1.00 29.54 ? 277  VAL A CA  1 
ATOM   2130 C C   . VAL A 1 277 ? -8.751  55.491 71.084 1.00 30.39 ? 277  VAL A C   1 
ATOM   2131 O O   . VAL A 1 277 ? -8.169  54.409 71.196 1.00 30.98 ? 277  VAL A O   1 
ATOM   2132 C CB  . VAL A 1 277 ? -10.859 54.761 72.237 1.00 30.85 ? 277  VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 277 ? -11.882 55.086 73.339 1.00 28.24 ? 277  VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 277 ? -11.621 54.552 70.850 1.00 28.63 ? 277  VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 278 ? -8.506  56.333 70.080 1.00 30.39 ? 278  GLU A N   1 
ATOM   2136 C CA  . GLU A 1 278 ? -7.561  56.001 69.012 1.00 31.36 ? 278  GLU A CA  1 
ATOM   2137 C C   . GLU A 1 278 ? -6.160  55.624 69.489 1.00 31.99 ? 278  GLU A C   1 
ATOM   2138 O O   . GLU A 1 278 ? -5.503  54.800 68.884 1.00 32.58 ? 278  GLU A O   1 
ATOM   2139 C CB  . GLU A 1 278 ? -7.527  57.160 67.982 1.00 31.81 ? 278  GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 278 ? -6.157  57.586 67.514 1.00 32.55 ? 278  GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 278 ? -6.182  58.603 66.371 1.00 34.72 ? 278  GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 278 ? -7.107  59.445 66.253 1.00 32.58 ? 278  GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 278 ? -5.229  58.570 65.579 1.00 39.55 ? 278  GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 279 ? -5.702  56.180 70.595 1.00 33.22 ? 279  TRP A N   1 
ATOM   2145 C CA  . TRP A 1 279 ? -4.374  55.818 71.067 1.00 33.44 ? 279  TRP A CA  1 
ATOM   2146 C C   . TRP A 1 279 ? -4.376  54.523 71.848 1.00 33.97 ? 279  TRP A C   1 
ATOM   2147 O O   . TRP A 1 279 ? -3.307  53.966 72.087 1.00 36.11 ? 279  TRP A O   1 
ATOM   2148 C CB  . TRP A 1 279 ? -3.785  56.934 71.925 1.00 33.59 ? 279  TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 279 ? -3.636  58.182 71.129 1.00 37.02 ? 279  TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 279 ? -4.543  59.214 71.023 1.00 36.91 ? 279  TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 279 ? -2.561  58.500 70.254 1.00 36.68 ? 279  TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 279 ? -4.093  60.144 70.132 1.00 38.75 ? 279  TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 279 ? -2.877  59.737 69.642 1.00 38.50 ? 279  TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 279 ? -1.353  57.863 69.929 1.00 37.44 ? 279  TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 279 ? -2.019  60.360 68.707 1.00 39.38 ? 279  TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 279 ? -0.487  58.474 69.000 1.00 38.93 ? 279  TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 279 ? -0.830  59.718 68.397 1.00 38.60 ? 279  TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 280 ? -5.548  53.988 72.213 1.00 32.79 ? 280  ASN A N   1 
ATOM   2159 C CA  . ASN A 1 280 ? -5.532  52.751 72.991 1.00 31.87 ? 280  ASN A CA  1 
ATOM   2160 C C   . ASN A 1 280 ? -5.214  51.487 72.177 1.00 32.52 ? 280  ASN A C   1 
ATOM   2161 O O   . ASN A 1 280 ? -5.250  50.389 72.735 1.00 32.99 ? 280  ASN A O   1 
ATOM   2162 C CB  . ASN A 1 280 ? -6.867  52.531 73.675 1.00 30.84 ? 280  ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 280 ? -7.322  53.723 74.533 1.00 33.43 ? 280  ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 280 ? -6.518  54.621 74.922 1.00 32.46 ? 280  ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 280 ? -8.640  53.745 74.833 1.00 29.92 ? 280  ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 281 ? -4.890  51.605 70.887 1.00 31.43 ? 281  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? -4.689  50.382 70.103 1.00 31.92 ? 281  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? -3.274  50.055 69.716 1.00 32.44 ? 281  VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? -3.042  49.057 69.041 1.00 33.31 ? 281  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? -5.577  50.374 68.771 1.00 31.76 ? 281  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? -7.048  50.645 69.112 1.00 29.43 ? 281  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? -5.093  51.414 67.758 1.00 28.13 ? 281  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 282 ? -2.345  50.919 70.104 1.00 31.96 ? 282  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 282 ? -0.937  50.713 69.811 1.00 32.17 ? 282  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 282 ? -0.528  49.409 70.439 1.00 33.55 ? 282  LEU A C   1 
ATOM   2176 O O   . LEU A 1 282 ? -0.976  49.081 71.525 1.00 33.59 ? 282  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 282 ? -0.064  51.872 70.360 1.00 29.05 ? 282  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 282 ? -0.241  53.084 69.409 1.00 30.73 ? 282  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 282 ? 0.337   54.330 70.027 1.00 25.91 ? 282  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 282 ? 0.362   52.773 68.007 1.00 25.17 ? 282  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 283 ? 0.346   48.652 69.768 1.00 34.48 ? 283  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 283 ? 0.752   47.371 70.359 1.00 35.27 ? 283  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 283 ? 1.789   47.479 71.480 1.00 36.33 ? 283  PRO A C   1 
ATOM   2184 O O   . PRO A 1 283 ? 1.842   46.621 72.357 1.00 35.38 ? 283  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 283 ? 1.268   46.571 69.140 1.00 34.04 ? 283  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 283 ? 1.864   47.701 68.250 1.00 34.49 ? 283  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 283 ? 0.835   48.811 68.382 1.00 33.27 ? 283  PRO A CD  1 
ATOM   2188 N N   . PHE A 1 284 ? 2.625   48.515 71.446 1.00 37.41 ? 284  PHE A N   1 
ATOM   2189 C CA  . PHE A 1 284 ? 3.671   48.680 72.471 1.00 36.93 ? 284  PHE A CA  1 
ATOM   2190 C C   . PHE A 1 284 ? 3.598   50.007 73.199 1.00 36.19 ? 284  PHE A C   1 
ATOM   2191 O O   . PHE A 1 284 ? 2.906   50.921 72.770 1.00 34.24 ? 284  PHE A O   1 
ATOM   2192 C CB  . PHE A 1 284 ? 5.039   48.626 71.831 1.00 37.03 ? 284  PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 284 ? 5.203   47.495 70.922 1.00 37.43 ? 284  PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 284 ? 5.176   46.196 71.416 1.00 38.13 ? 284  PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 284 ? 5.351   47.718 69.550 1.00 39.98 ? 284  PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 284 ? 5.292   45.085 70.531 1.00 41.70 ? 284  PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 284 ? 5.471   46.653 68.633 1.00 40.82 ? 284  PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 284 ? 5.439   45.309 69.128 1.00 40.58 ? 284  PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 285 ? 4.319   50.086 74.313 1.00 35.48 ? 285  ASP A N   1 
ATOM   2200 C CA  . ASP A 1 285 ? 4.426   51.317 75.054 1.00 34.52 ? 285  ASP A CA  1 
ATOM   2201 C C   . ASP A 1 285 ? 5.570   51.971 74.203 1.00 33.94 ? 285  ASP A C   1 
ATOM   2202 O O   . ASP A 1 285 ? 6.771   51.636 74.276 1.00 35.21 ? 285  ASP A O   1 
ATOM   2203 C CB  . ASP A 1 285 ? 4.870   51.033 76.476 1.00 34.33 ? 285  ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 285 ? 5.032   52.298 77.276 1.00 35.12 ? 285  ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 285 ? 4.555   53.364 76.770 1.00 34.31 ? 285  ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 285 ? 5.616   52.210 78.379 1.00 33.52 ? 285  ASP A OD2 1 
ATOM   2207 N N   . SER A 1 286 ? 5.186   52.904 73.376 1.00 32.19 ? 286  SER A N   1 
ATOM   2208 C CA  . SER A 1 286 ? 6.136   53.458 72.457 1.00 32.28 ? 286  SER A CA  1 
ATOM   2209 C C   . SER A 1 286 ? 6.103   54.976 72.342 1.00 30.97 ? 286  SER A C   1 
ATOM   2210 O O   . SER A 1 286 ? 5.289   55.673 72.937 1.00 31.79 ? 286  SER A O   1 
ATOM   2211 C CB  . SER A 1 286 ? 5.826   52.842 71.096 1.00 32.59 ? 286  SER A CB  1 
ATOM   2212 O OG  . SER A 1 286 ? 4.476   53.173 70.771 1.00 33.89 ? 286  SER A OG  1 
ATOM   2213 N N   . ILE A 1 287 ? 6.999   55.471 71.531 1.00 31.23 ? 287  ILE A N   1 
ATOM   2214 C CA  . ILE A 1 287 ? 7.113   56.888 71.270 1.00 30.75 ? 287  ILE A CA  1 
ATOM   2215 C C   . ILE A 1 287 ? 7.297   56.928 69.750 1.00 29.85 ? 287  ILE A C   1 
ATOM   2216 O O   . ILE A 1 287 ? 7.907   56.015 69.133 1.00 29.07 ? 287  ILE A O   1 
ATOM   2217 C CB  . ILE A 1 287 ? 8.304   57.411 72.164 1.00 33.06 ? 287  ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 287 ? 7.754   58.493 73.050 1.00 34.88 ? 287  ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 287 ? 9.537   57.855 71.426 1.00 31.44 ? 287  ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 287 ? 6.502   58.073 73.713 1.00 39.03 ? 287  ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 288 ? 6.715   57.922 69.122 1.00 27.86 ? 288  PHE A N   1 
ATOM   2222 C CA  . PHE A 1 288 ? 6.854   58.011 67.674 1.00 27.59 ? 288  PHE A CA  1 
ATOM   2223 C C   . PHE A 1 288 ? 6.126   56.828 66.944 1.00 29.00 ? 288  PHE A C   1 
ATOM   2224 O O   . PHE A 1 288 ? 6.657   56.232 65.963 1.00 28.42 ? 288  PHE A O   1 
ATOM   2225 C CB  . PHE A 1 288 ? 8.336   58.068 67.268 1.00 25.12 ? 288  PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 288 ? 8.635   59.090 66.184 1.00 26.90 ? 288  PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 288 ? 7.890   59.131 65.010 1.00 25.03 ? 288  PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 288 ? 9.690   60.017 66.328 1.00 24.01 ? 288  PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 288 ? 8.184   60.057 64.005 1.00 24.27 ? 288  PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 288 ? 9.974   60.913 65.331 1.00 23.12 ? 288  PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 288 ? 9.209   60.927 64.156 1.00 24.48 ? 288  PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 289 ? 4.936   56.459 67.431 1.00 26.51 ? 289  ARG A N   1 
ATOM   2233 C CA  . ARG A 1 289 ? 4.182   55.428 66.719 1.00 27.78 ? 289  ARG A CA  1 
ATOM   2234 C C   . ARG A 1 289 ? 2.760   55.936 66.737 1.00 29.20 ? 289  ARG A C   1 
ATOM   2235 O O   . ARG A 1 289 ? 2.281   56.503 67.745 1.00 28.90 ? 289  ARG A O   1 
ATOM   2236 C CB  . ARG A 1 289 ? 4.290   54.028 67.341 1.00 25.37 ? 289  ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 289 ? 5.686   53.437 67.299 1.00 25.12 ? 289  ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 289 ? 6.134   53.040 65.870 1.00 25.65 ? 289  ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 289 ? 7.453   52.379 65.821 1.00 27.13 ? 289  ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 289 ? 8.647   53.000 65.801 1.00 28.22 ? 289  ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 289 ? 8.724   54.328 65.840 1.00 28.34 ? 289  ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 289 ? 9.772   52.285 65.662 1.00 26.56 ? 289  ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 290 ? 2.104   55.771 65.594 1.00 28.64 ? 290  PHE A N   1 
ATOM   2244 C CA  . PHE A 1 290 ? 0.755   56.265 65.438 1.00 28.71 ? 290  PHE A CA  1 
ATOM   2245 C C   . PHE A 1 290 ? -0.143  55.110 65.033 1.00 28.26 ? 290  PHE A C   1 
ATOM   2246 O O   . PHE A 1 290 ? 0.257   54.200 64.331 1.00 27.98 ? 290  PHE A O   1 
ATOM   2247 C CB  . PHE A 1 290 ? 0.814   57.427 64.423 1.00 27.82 ? 290  PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 290 ? 2.051   58.283 64.597 1.00 26.46 ? 290  PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 290 ? 2.246   59.009 65.771 1.00 27.06 ? 290  PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 290 ? 3.033   58.345 63.612 1.00 25.03 ? 290  PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 290 ? 3.408   59.797 65.963 1.00 26.94 ? 290  PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 290 ? 4.205   59.133 63.780 1.00 25.17 ? 290  PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 290 ? 4.398   59.859 64.947 1.00 25.53 ? 290  PHE A CZ  1 
ATOM   2254 N N   . SER A 1 291 ? -1.356  55.149 65.535 1.00 28.75 ? 291  SER A N   1 
ATOM   2255 C CA  . SER A 1 291 ? -2.338  54.090 65.328 1.00 31.00 ? 291  SER A CA  1 
ATOM   2256 C C   . SER A 1 291 ? -2.791  53.686 63.908 1.00 31.78 ? 291  SER A C   1 
ATOM   2257 O O   . SER A 1 291 ? -2.728  52.505 63.502 1.00 28.50 ? 291  SER A O   1 
ATOM   2258 C CB  . SER A 1 291 ? -3.569  54.452 66.146 1.00 31.38 ? 291  SER A CB  1 
ATOM   2259 O OG  . SER A 1 291 ? -3.169  54.474 67.496 1.00 32.67 ? 291  SER A OG  1 
ATOM   2260 N N   . PHE A 1 292 ? -3.246  54.694 63.177 1.00 30.86 ? 292  PHE A N   1 
ATOM   2261 C CA  . PHE A 1 292 ? -3.777  54.487 61.856 1.00 31.00 ? 292  PHE A CA  1 
ATOM   2262 C C   . PHE A 1 292 ? -2.938  55.140 60.812 1.00 30.11 ? 292  PHE A C   1 
ATOM   2263 O O   . PHE A 1 292 ? -2.993  56.393 60.623 1.00 29.80 ? 292  PHE A O   1 
ATOM   2264 C CB  . PHE A 1 292 ? -5.207  55.004 61.842 1.00 30.41 ? 292  PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 292 ? -6.051  54.273 62.778 1.00 32.21 ? 292  PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 292 ? -6.409  52.952 62.486 1.00 32.05 ? 292  PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 292 ? -6.372  54.831 64.029 1.00 31.34 ? 292  PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 292 ? -7.078  52.177 63.432 1.00 32.38 ? 292  PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 292 ? -7.018  54.101 64.980 1.00 32.02 ? 292  PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 292 ? -7.386  52.752 64.698 1.00 33.94 ? 292  PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 293 ? -2.201  54.272 60.122 1.00 27.34 ? 293  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 293 ? -1.271  54.704 59.101 1.00 26.72 ? 293  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 293 ? -1.404  53.837 57.829 1.00 27.42 ? 293  VAL A C   1 
ATOM   2274 O O   . VAL A 1 293 ? -2.155  52.914 57.803 1.00 26.32 ? 293  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 293 ? 0.196   54.606 59.639 1.00 24.38 ? 293  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 293 ? 0.394   55.508 60.841 1.00 21.97 ? 293  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 293 ? 0.524   53.122 59.953 1.00 23.70 ? 293  VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 294 ? -0.702  54.205 56.740 1.00 27.64 ? 294  PRO A N   1 
ATOM   2279 C CA  . PRO A 1 294 ? -0.800  53.394 55.533 1.00 27.82 ? 294  PRO A CA  1 
ATOM   2280 C C   . PRO A 1 294 ? -0.518  51.906 55.823 1.00 28.24 ? 294  PRO A C   1 
ATOM   2281 O O   . PRO A 1 294 ? 0.237   51.613 56.772 1.00 28.69 ? 294  PRO A O   1 
ATOM   2282 C CB  . PRO A 1 294 ? 0.263   54.023 54.640 1.00 25.92 ? 294  PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 294 ? 0.091   55.490 54.976 1.00 26.19 ? 294  PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 294 ? -0.047  55.503 56.457 1.00 25.67 ? 294  PRO A CD  1 
ATOM   2285 N N   . VAL A 1 295 ? -1.182  51.008 55.069 1.00 27.01 ? 295  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 295 ? -0.954  49.550 55.113 1.00 29.56 ? 295  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 295 ? -0.328  49.052 53.814 1.00 29.83 ? 295  VAL A C   1 
ATOM   2288 O O   . VAL A 1 295 ? -0.666  49.523 52.704 1.00 29.51 ? 295  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 295 ? -2.218  48.657 55.210 1.00 31.90 ? 295  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 295 ? -2.516  48.349 56.645 1.00 33.81 ? 295  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 295 ? -3.415  49.297 54.496 1.00 29.47 ? 295  VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 296 ? 0.565   48.081 53.957 1.00 29.65 ? 296  ILE A N   1 
ATOM   2293 C CA  . ILE A 1 296 ? 1.235   47.466 52.815 1.00 29.37 ? 296  ILE A CA  1 
ATOM   2294 C C   . ILE A 1 296 ? 0.176   46.460 52.314 1.00 31.66 ? 296  ILE A C   1 
ATOM   2295 O O   . ILE A 1 296 ? 0.082   45.316 52.773 1.00 30.78 ? 296  ILE A O   1 
ATOM   2296 C CB  . ILE A 1 296 ? 2.503   46.785 53.319 1.00 28.38 ? 296  ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 296 ? 3.415   47.853 53.974 1.00 24.85 ? 296  ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 296 ? 3.183   46.044 52.158 1.00 26.35 ? 296  ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 296 ? 3.578   49.191 53.105 1.00 24.45 ? 296  ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 297 ? -0.624  46.886 51.350 1.00 31.81 ? 297  ASP A N   1 
ATOM   2301 C CA  . ASP A 1 297 ? -1.761  46.070 50.956 1.00 32.68 ? 297  ASP A CA  1 
ATOM   2302 C C   . ASP A 1 297 ? -1.681  45.274 49.651 1.00 33.59 ? 297  ASP A C   1 
ATOM   2303 O O   . ASP A 1 297 ? -2.616  44.553 49.331 1.00 33.90 ? 297  ASP A O   1 
ATOM   2304 C CB  . ASP A 1 297 ? -2.981  47.021 50.890 1.00 31.99 ? 297  ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 297 ? -2.842  48.099 49.731 1.00 34.55 ? 297  ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 297 ? -1.732  48.254 49.159 1.00 33.98 ? 297  ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 297 ? -3.838  48.798 49.389 1.00 36.69 ? 297  ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 298 ? -0.620  45.414 48.873 1.00 33.61 ? 298  GLY A N   1 
ATOM   2309 C CA  . GLY A 1 298 ? -0.623  44.692 47.608 1.00 35.81 ? 298  GLY A CA  1 
ATOM   2310 C C   . GLY A 1 298 ? -1.335  45.491 46.489 1.00 38.40 ? 298  GLY A C   1 
ATOM   2311 O O   . GLY A 1 298 ? -1.372  45.054 45.333 1.00 38.30 ? 298  GLY A O   1 
ATOM   2312 N N   . GLU A 1 299 ? -1.882  46.667 46.802 1.00 38.00 ? 299  GLU A N   1 
ATOM   2313 C CA  . GLU A 1 299 ? -2.565  47.472 45.788 1.00 38.55 ? 299  GLU A CA  1 
ATOM   2314 C C   . GLU A 1 299 ? -1.902  48.811 45.628 1.00 35.82 ? 299  GLU A C   1 
ATOM   2315 O O   . GLU A 1 299 ? -1.236  49.077 44.634 1.00 34.34 ? 299  GLU A O   1 
ATOM   2316 C CB  . GLU A 1 299 ? -4.018  47.678 46.178 1.00 42.28 ? 299  GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 299 ? -4.885  46.494 45.795 1.00 52.24 ? 299  GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 299 ? -5.943  46.183 46.861 1.00 57.85 ? 299  GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 299 ? -6.774  47.100 47.182 1.00 60.63 ? 299  GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 299 ? -5.929  45.019 47.377 1.00 59.81 ? 299  GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 300 ? -2.124  49.679 46.617 1.00 34.30 ? 300  PHE A N   1 
ATOM   2322 C CA  . PHE A 1 300 ? -1.500  50.977 46.614 1.00 31.02 ? 300  PHE A CA  1 
ATOM   2323 C C   . PHE A 1 300 ? 0.002   50.721 46.563 1.00 31.38 ? 300  PHE A C   1 
ATOM   2324 O O   . PHE A 1 300 ? 0.730   51.402 45.833 1.00 31.11 ? 300  PHE A O   1 
ATOM   2325 C CB  . PHE A 1 300 ? -1.892  51.748 47.855 1.00 30.08 ? 300  PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 300 ? -1.510  53.186 47.787 1.00 29.47 ? 300  PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 300 ? -0.169  53.580 48.016 1.00 26.53 ? 300  PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 300 ? -2.460  54.155 47.390 1.00 26.93 ? 300  PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 300 ? 0.211   54.891 47.841 1.00 24.06 ? 300  PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 300 ? -2.069  55.495 47.214 1.00 26.80 ? 300  PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 300 ? -0.737  55.861 47.434 1.00 24.37 ? 300  PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 301 ? 0.459   49.747 47.357 1.00 29.82 ? 301  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 301 ? 1.850   49.333 47.323 1.00 31.55 ? 301  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 301 ? 1.761   47.854 46.844 1.00 33.54 ? 301  PHE A C   1 
ATOM   2335 O O   . PHE A 1 301 ? 1.235   46.989 47.559 1.00 33.85 ? 301  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 301 ? 2.491   49.404 48.709 1.00 29.23 ? 301  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 301 ? 2.410   50.757 49.353 1.00 27.80 ? 301  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 301 ? 3.245   51.799 48.935 1.00 26.83 ? 301  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 301 ? 1.537   50.986 50.409 1.00 26.16 ? 301  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 301 ? 3.228   53.040 49.568 1.00 26.05 ? 301  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 301 ? 1.502   52.228 51.053 1.00 26.61 ? 301  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 301 ? 2.361   53.265 50.635 1.00 25.14 ? 301  PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 302 ? 2.271   47.560 45.639 1.00 33.48 ? 302  PRO A N   1 
ATOM   2344 C CA  . PRO A 1 302 ? 2.238   46.198 45.077 1.00 33.86 ? 302  PRO A CA  1 
ATOM   2345 C C   . PRO A 1 302 ? 2.977   45.133 45.930 1.00 33.08 ? 302  PRO A C   1 
ATOM   2346 O O   . PRO A 1 302 ? 2.485   44.007 46.067 1.00 32.78 ? 302  PRO A O   1 
ATOM   2347 C CB  . PRO A 1 302 ? 2.871   46.364 43.662 1.00 34.32 ? 302  PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 302 ? 3.235   47.924 43.533 1.00 34.69 ? 302  PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 302 ? 3.284   48.400 44.960 1.00 35.14 ? 302  PRO A CD  1 
ATOM   2350 N N   . THR A 1 303 ? 4.142   45.476 46.485 1.00 31.35 ? 303  THR A N   1 
ATOM   2351 C CA  . THR A 1 303 ? 4.882   44.541 47.339 1.00 32.25 ? 303  THR A CA  1 
ATOM   2352 C C   . THR A 1 303 ? 5.503   45.326 48.506 1.00 33.05 ? 303  THR A C   1 
ATOM   2353 O O   . THR A 1 303 ? 5.276   46.529 48.630 1.00 33.33 ? 303  THR A O   1 
ATOM   2354 C CB  . THR A 1 303 ? 6.052   43.829 46.571 1.00 33.01 ? 303  THR A CB  1 
ATOM   2355 O OG1 . THR A 1 303 ? 7.041   44.796 46.190 1.00 33.60 ? 303  THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 303 ? 5.566   43.187 45.308 1.00 33.23 ? 303  THR A CG2 1 
ATOM   2357 N N   . SER A 1 304 ? 6.317   44.669 49.334 1.00 32.42 ? 304  SER A N   1 
ATOM   2358 C CA  . SER A 1 304 ? 6.954   45.368 50.457 1.00 32.63 ? 304  SER A CA  1 
ATOM   2359 C C   . SER A 1 304 ? 7.723   46.595 49.940 1.00 32.45 ? 304  SER A C   1 
ATOM   2360 O O   . SER A 1 304 ? 8.272   46.581 48.805 1.00 32.03 ? 304  SER A O   1 
ATOM   2361 C CB  . SER A 1 304 ? 7.963   44.454 51.185 1.00 31.79 ? 304  SER A CB  1 
ATOM   2362 O OG  . SER A 1 304 ? 9.134   44.281 50.357 1.00 33.55 ? 304  SER A OG  1 
ATOM   2363 N N   . LEU A 1 305 ? 7.824   47.624 50.782 1.00 31.19 ? 305  LEU A N   1 
ATOM   2364 C CA  . LEU A 1 305 ? 8.526   48.827 50.354 1.00 32.01 ? 305  LEU A CA  1 
ATOM   2365 C C   . LEU A 1 305 ? 9.999   48.523 50.029 1.00 33.31 ? 305  LEU A C   1 
ATOM   2366 O O   . LEU A 1 305 ? 10.516  48.968 48.975 1.00 35.00 ? 305  LEU A O   1 
ATOM   2367 C CB  . LEU A 1 305 ? 8.442   49.880 51.428 1.00 31.50 ? 305  LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 305 ? 7.033   50.269 51.855 1.00 31.31 ? 305  LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 305 ? 7.163   51.396 52.883 1.00 30.01 ? 305  LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 305 ? 6.216   50.700 50.604 1.00 30.99 ? 305  LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 306 ? 10.667  47.755 50.893 1.00 31.83 ? 306  GLU A N   1 
ATOM   2372 C CA  . GLU A 1 306 ? 12.068  47.401 50.675 1.00 32.95 ? 306  GLU A CA  1 
ATOM   2373 C C   . GLU A 1 306 ? 12.279  46.676 49.337 1.00 33.05 ? 306  GLU A C   1 
ATOM   2374 O O   . GLU A 1 306 ? 13.233  46.988 48.614 1.00 31.52 ? 306  GLU A O   1 
ATOM   2375 C CB  . GLU A 1 306 ? 12.624  46.516 51.821 1.00 33.89 ? 306  GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 306 ? 14.124  46.185 51.676 1.00 35.71 ? 306  GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 306 ? 15.009  47.448 51.582 1.00 41.19 ? 306  GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 306 ? 14.605  48.549 52.091 1.00 42.04 ? 306  GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 306 ? 16.119  47.358 50.989 1.00 43.71 ? 306  GLU A OE2 1 
ATOM   2380 N N   . SER A 1 307 ? 11.416  45.721 48.978 1.00 31.94 ? 307  SER A N   1 
ATOM   2381 C CA  . SER A 1 307 ? 11.661  45.072 47.675 1.00 34.08 ? 307  SER A CA  1 
ATOM   2382 C C   . SER A 1 307 ? 11.353  46.071 46.531 1.00 32.90 ? 307  SER A C   1 
ATOM   2383 O O   . SER A 1 307 ? 12.044  46.088 45.505 1.00 32.51 ? 307  SER A O   1 
ATOM   2384 C CB  . SER A 1 307 ? 10.865  43.757 47.517 1.00 31.87 ? 307  SER A CB  1 
ATOM   2385 O OG  . SER A 1 307 ? 9.483   44.010 47.557 1.00 38.04 ? 307  SER A OG  1 
ATOM   2386 N N   . MET A 1 308 ? 10.331  46.906 46.698 1.00 32.60 ? 308  MET A N   1 
ATOM   2387 C CA  . MET A 1 308 ? 10.094  47.906 45.662 1.00 32.63 ? 308  MET A CA  1 
ATOM   2388 C C   . MET A 1 308 ? 11.368  48.778 45.563 1.00 32.52 ? 308  MET A C   1 
ATOM   2389 O O   . MET A 1 308 ? 11.852  49.069 44.468 1.00 32.50 ? 308  MET A O   1 
ATOM   2390 C CB  . MET A 1 308 ? 8.885   48.763 46.018 1.00 32.07 ? 308  MET A CB  1 
ATOM   2391 C CG  . MET A 1 308 ? 7.581   48.083 45.761 1.00 30.67 ? 308  MET A CG  1 
ATOM   2392 S SD  . MET A 1 308 ? 6.157   49.192 46.161 1.00 32.23 ? 308  MET A SD  1 
ATOM   2393 C CE  . MET A 1 308 ? 6.101   50.154 44.521 1.00 31.75 ? 308  MET A CE  1 
ATOM   2394 N N   . LEU A 1 309 ? 11.942  49.174 46.694 1.00 31.77 ? 309  LEU A N   1 
ATOM   2395 C CA  . LEU A 1 309 ? 13.124  49.999 46.586 1.00 33.65 ? 309  LEU A CA  1 
ATOM   2396 C C   . LEU A 1 309 ? 14.337  49.273 45.902 1.00 35.64 ? 309  LEU A C   1 
ATOM   2397 O O   . LEU A 1 309 ? 15.070  49.855 45.071 1.00 35.88 ? 309  LEU A O   1 
ATOM   2398 C CB  . LEU A 1 309 ? 13.488  50.540 47.975 1.00 32.20 ? 309  LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 309 ? 12.581  51.652 48.584 1.00 32.83 ? 309  LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 309 ? 13.064  51.950 49.968 1.00 31.76 ? 309  LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 309 ? 12.626  52.953 47.803 1.00 31.61 ? 309  LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 310 ? 14.545  48.003 46.246 1.00 36.41 ? 310  ASN A N   1 
ATOM   2403 C CA  . ASN A 1 310 ? 15.643  47.259 45.683 1.00 37.58 ? 310  ASN A CA  1 
ATOM   2404 C C   . ASN A 1 310 ? 15.521  47.034 44.214 1.00 36.97 ? 310  ASN A C   1 
ATOM   2405 O O   . ASN A 1 310 ? 16.510  47.107 43.510 1.00 35.90 ? 310  ASN A O   1 
ATOM   2406 C CB  . ASN A 1 310 ? 15.783  45.902 46.353 1.00 41.46 ? 310  ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 310 ? 16.461  46.017 47.676 1.00 46.98 ? 310  ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 310 ? 17.301  46.935 47.868 1.00 48.96 ? 310  ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 310 ? 16.127  45.111 48.619 1.00 47.50 ? 310  ASN A ND2 1 
ATOM   2410 N N   . SER A 1 311 ? 14.306  46.772 43.741 1.00 35.25 ? 311  SER A N   1 
ATOM   2411 C CA  . SER A 1 311 ? 14.152  46.483 42.344 1.00 35.10 ? 311  SER A CA  1 
ATOM   2412 C C   . SER A 1 311 ? 13.953  47.683 41.453 1.00 34.83 ? 311  SER A C   1 
ATOM   2413 O O   . SER A 1 311 ? 13.765  47.521 40.247 1.00 34.72 ? 311  SER A O   1 
ATOM   2414 C CB  . SER A 1 311 ? 12.999  45.473 42.140 1.00 34.09 ? 311  SER A CB  1 
ATOM   2415 O OG  . SER A 1 311 ? 11.740  46.019 42.491 1.00 37.52 ? 311  SER A OG  1 
ATOM   2416 N N   . GLY A 1 312 ? 13.980  48.886 42.017 1.00 33.77 ? 312  GLY A N   1 
ATOM   2417 C CA  . GLY A 1 312 ? 13.749  50.057 41.174 1.00 33.17 ? 312  GLY A CA  1 
ATOM   2418 C C   . GLY A 1 312 ? 12.262  50.205 40.775 1.00 32.67 ? 312  GLY A C   1 
ATOM   2419 O O   . GLY A 1 312 ? 11.929  50.897 39.808 1.00 30.53 ? 312  GLY A O   1 
ATOM   2420 N N   . ASN A 1 313 ? 11.366  49.539 41.500 1.00 32.04 ? 313  ASN A N   1 
ATOM   2421 C CA  . ASN A 1 313 ? 9.965   49.650 41.174 1.00 32.52 ? 313  ASN A CA  1 
ATOM   2422 C C   . ASN A 1 313 ? 9.411   50.961 41.742 1.00 32.85 ? 313  ASN A C   1 
ATOM   2423 O O   . ASN A 1 313 ? 8.709   50.968 42.788 1.00 33.54 ? 313  ASN A O   1 
ATOM   2424 C CB  . ASN A 1 313 ? 9.177   48.466 41.743 1.00 33.33 ? 313  ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 313 ? 7.736   48.471 41.274 1.00 34.09 ? 313  ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 313 ? 7.339   49.381 40.533 1.00 38.12 ? 313  ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 313 ? 6.938   47.475 41.695 1.00 32.48 ? 313  ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 314 ? 9.723   52.069 41.077 1.00 31.32 ? 314  PHE A N   1 
ATOM   2429 C CA  . PHE A 1 314 ? 9.248   53.366 41.533 1.00 32.04 ? 314  PHE A CA  1 
ATOM   2430 C C   . PHE A 1 314 ? 9.444   54.401 40.437 1.00 32.46 ? 314  PHE A C   1 
ATOM   2431 O O   . PHE A 1 314 ? 10.124  54.127 39.434 1.00 32.07 ? 314  PHE A O   1 
ATOM   2432 C CB  . PHE A 1 314 ? 9.946   53.794 42.866 1.00 31.25 ? 314  PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 314 ? 11.495  53.679 42.862 1.00 30.10 ? 314  PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 314 ? 12.300  54.672 42.240 1.00 27.51 ? 314  PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 314 ? 12.131  52.604 43.519 1.00 28.40 ? 314  PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 314 ? 13.705  54.605 42.266 1.00 25.25 ? 314  PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 314 ? 13.557  52.521 43.559 1.00 27.22 ? 314  PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 314 ? 14.339  53.524 42.928 1.00 25.74 ? 314  PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 315 ? 8.812   55.562 40.607 1.00 31.37 ? 315  LYS A N   1 
ATOM   2440 C CA  . LYS A 1 315 ? 8.923   56.626 39.611 1.00 32.45 ? 315  LYS A CA  1 
ATOM   2441 C C   . LYS A 1 315 ? 10.375  57.116 39.624 1.00 32.43 ? 315  LYS A C   1 
ATOM   2442 O O   . LYS A 1 315 ? 10.933  57.360 40.716 1.00 32.94 ? 315  LYS A O   1 
ATOM   2443 C CB  . LYS A 1 315 ? 7.964   57.793 39.946 1.00 31.01 ? 315  LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 315 ? 7.956   58.938 38.935 1.00 30.15 ? 315  LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 315 ? 7.205   60.179 39.497 1.00 31.12 ? 315  LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 315 ? 7.132   61.305 38.460 1.00 30.21 ? 315  LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 315 ? 6.324   60.940 37.261 1.00 23.30 ? 315  LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 316 ? 10.972  57.207 38.432 1.00 30.88 ? 316  LYS A N   1 
ATOM   2449 C CA  . LYS A 1 316 ? 12.342  57.675 38.239 1.00 31.77 ? 316  LYS A CA  1 
ATOM   2450 C C   . LYS A 1 316 ? 12.298  59.162 37.881 1.00 32.44 ? 316  LYS A C   1 
ATOM   2451 O O   . LYS A 1 316 ? 11.876  59.504 36.790 1.00 32.76 ? 316  LYS A O   1 
ATOM   2452 C CB  . LYS A 1 316 ? 12.993  56.977 37.047 1.00 34.32 ? 316  LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 316 ? 13.614  55.558 37.242 1.00 36.81 ? 316  LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 316 ? 12.747  54.606 37.980 1.00 38.55 ? 316  LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 316 ? 13.388  53.231 37.980 1.00 38.89 ? 316  LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 316 ? 12.487  52.259 37.337 1.00 39.58 ? 316  LYS A NZ  1 
ATOM   2457 N N   . THR A 1 317 ? 12.737  60.063 38.761 1.00 32.08 ? 317  THR A N   1 
ATOM   2458 C CA  . THR A 1 317 ? 12.711  61.481 38.416 1.00 30.14 ? 317  THR A CA  1 
ATOM   2459 C C   . THR A 1 317 ? 13.732  62.186 39.325 1.00 31.44 ? 317  THR A C   1 
ATOM   2460 O O   . THR A 1 317 ? 14.630  61.515 39.853 1.00 32.34 ? 317  THR A O   1 
ATOM   2461 C CB  . THR A 1 317 ? 11.303  62.022 38.611 1.00 27.85 ? 317  THR A CB  1 
ATOM   2462 O OG1 . THR A 1 317 ? 11.307  63.414 38.318 1.00 28.83 ? 317  THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 317 ? 10.814  61.773 40.061 1.00 26.27 ? 317  THR A CG2 1 
ATOM   2464 N N   . GLN A 1 318 ? 13.656  63.498 39.496 1.00 29.56 ? 318  GLN A N   1 
ATOM   2465 C CA  . GLN A 1 318 ? 14.606  64.126 40.427 1.00 32.08 ? 318  GLN A CA  1 
ATOM   2466 C C   . GLN A 1 318 ? 13.876  64.294 41.776 1.00 32.00 ? 318  GLN A C   1 
ATOM   2467 O O   . GLN A 1 318 ? 12.643  64.364 41.820 1.00 33.44 ? 318  GLN A O   1 
ATOM   2468 C CB  . GLN A 1 318 ? 15.085  65.541 39.968 1.00 31.71 ? 318  GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 318 ? 15.605  65.649 38.535 1.00 33.11 ? 318  GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 318 ? 14.481  65.555 37.466 1.00 34.05 ? 318  GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 318 ? 13.357  66.085 37.641 1.00 32.97 ? 318  GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 318 ? 14.786  64.877 36.364 1.00 33.51 ? 318  GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 319 ? 14.634  64.341 42.861 1.00 29.99 ? 319  ILE A N   1 
ATOM   2474 C CA  . ILE A 1 319 ? 14.047  64.545 44.171 1.00 30.05 ? 319  ILE A CA  1 
ATOM   2475 C C   . ILE A 1 319 ? 15.001  65.418 44.952 1.00 30.79 ? 319  ILE A C   1 
ATOM   2476 O O   . ILE A 1 319 ? 16.236  65.383 44.749 1.00 31.01 ? 319  ILE A O   1 
ATOM   2477 C CB  . ILE A 1 319 ? 13.851  63.222 45.007 1.00 28.45 ? 319  ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 319 ? 15.196  62.498 45.172 1.00 27.81 ? 319  ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 319 ? 12.833  62.310 44.329 1.00 28.75 ? 319  ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 319 ? 15.184  61.381 46.183 1.00 25.68 ? 319  ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 320 ? 14.420  66.228 45.823 1.00 29.53 ? 320  LEU A N   1 
ATOM   2482 C CA  . LEU A 1 320 ? 15.197  67.066 46.689 1.00 29.50 ? 320  LEU A CA  1 
ATOM   2483 C C   . LEU A 1 320 ? 14.592  66.721 48.081 1.00 30.10 ? 320  LEU A C   1 
ATOM   2484 O O   . LEU A 1 320 ? 13.341  66.699 48.261 1.00 29.91 ? 320  LEU A O   1 
ATOM   2485 C CB  . LEU A 1 320 ? 15.010  68.512 46.262 1.00 29.77 ? 320  LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 320 ? 15.841  69.530 47.044 1.00 30.96 ? 320  LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 320 ? 15.980  70.843 46.245 1.00 29.34 ? 320  LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 320 ? 15.152  69.764 48.367 1.00 29.94 ? 320  LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 321 ? 15.460  66.403 49.042 1.00 27.97 ? 321  LEU A N   1 
ATOM   2490 C CA  . LEU A 1 321 ? 15.002  66.009 50.385 1.00 26.71 ? 321  LEU A CA  1 
ATOM   2491 C C   . LEU A 1 321 ? 16.075  66.241 51.477 1.00 26.91 ? 321  LEU A C   1 
ATOM   2492 O O   . LEU A 1 321 ? 17.280  66.412 51.167 1.00 26.56 ? 321  LEU A O   1 
ATOM   2493 C CB  . LEU A 1 321 ? 14.599  64.521 50.357 1.00 24.48 ? 321  LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 321 ? 15.726  63.490 50.232 1.00 23.96 ? 321  LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 321 ? 15.116  62.146 50.237 1.00 23.96 ? 321  LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 321 ? 16.575  63.673 48.946 1.00 25.75 ? 321  LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 322 ? 15.659  66.241 52.749 1.00 25.99 ? 322  GLY A N   1 
ATOM   2498 C CA  . GLY A 1 322 ? 16.624  66.449 53.814 1.00 25.96 ? 322  GLY A CA  1 
ATOM   2499 C C   . GLY A 1 322 ? 15.950  66.314 55.164 1.00 29.15 ? 322  GLY A C   1 
ATOM   2500 O O   . GLY A 1 322 ? 14.742  66.005 55.244 1.00 28.27 ? 322  GLY A O   1 
ATOM   2501 N N   . VAL A 1 323 ? 16.731  66.549 56.229 1.00 29.90 ? 323  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 323 ? 16.257  66.480 57.611 1.00 29.43 ? 323  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 323 ? 16.718  67.732 58.403 1.00 30.36 ? 323  VAL A C   1 
ATOM   2504 O O   . VAL A 1 323 ? 17.494  68.557 57.917 1.00 31.37 ? 323  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 323 ? 16.843  65.228 58.299 1.00 28.62 ? 323  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 323 ? 16.449  63.988 57.551 1.00 29.90 ? 323  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 323 ? 18.362  65.306 58.292 1.00 29.42 ? 323  VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 324 ? 16.210  67.882 59.615 1.00 30.81 ? 324  ASN A N   1 
ATOM   2509 C CA  . ASN A 1 324 ? 16.647  68.953 60.515 1.00 30.18 ? 324  ASN A CA  1 
ATOM   2510 C C   . ASN A 1 324 ? 17.567  68.281 61.528 1.00 31.02 ? 324  ASN A C   1 
ATOM   2511 O O   . ASN A 1 324 ? 17.489  67.061 61.755 1.00 30.63 ? 324  ASN A O   1 
ATOM   2512 C CB  . ASN A 1 324 ? 15.461  69.586 61.228 1.00 28.92 ? 324  ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 324 ? 14.566  70.338 60.276 1.00 30.88 ? 324  ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 324 ? 14.852  70.438 59.046 1.00 29.45 ? 324  ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 324 ? 13.481  70.885 60.813 1.00 29.45 ? 324  ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 325 ? 18.437  69.065 62.155 1.00 32.65 ? 325  LYS A N   1 
ATOM   2517 C CA  . LYS A 1 325 ? 19.381  68.491 63.109 1.00 32.75 ? 325  LYS A CA  1 
ATOM   2518 C C   . LYS A 1 325 ? 18.726  67.747 64.269 1.00 31.37 ? 325  LYS A C   1 
ATOM   2519 O O   . LYS A 1 325 ? 19.207  66.685 64.667 1.00 27.84 ? 325  LYS A O   1 
ATOM   2520 C CB  . LYS A 1 325 ? 20.352  69.583 63.651 1.00 34.25 ? 325  LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 325 ? 21.203  69.167 64.860 1.00 35.17 ? 325  LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 325 ? 22.281  70.174 65.279 1.00 38.39 ? 325  LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 325 ? 22.465  70.261 66.833 1.00 42.09 ? 325  LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 325 ? 21.378  71.117 67.662 1.00 40.81 ? 325  LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 326 ? 17.639  68.293 64.810 1.00 32.02 ? 326  ASP A N   1 
ATOM   2526 C CA  . ASP A 1 326 ? 17.018  67.675 65.991 1.00 32.62 ? 326  ASP A CA  1 
ATOM   2527 C C   . ASP A 1 326 ? 15.655  67.038 65.775 1.00 34.02 ? 326  ASP A C   1 
ATOM   2528 O O   . ASP A 1 326 ? 14.619  67.579 66.222 1.00 35.59 ? 326  ASP A O   1 
ATOM   2529 C CB  . ASP A 1 326 ? 16.962  68.717 67.128 1.00 32.27 ? 326  ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 326 ? 18.374  69.259 67.490 1.00 33.87 ? 326  ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 326 ? 19.184  68.463 68.016 1.00 33.67 ? 326  ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 326 ? 18.702  70.451 67.223 1.00 33.58 ? 326  ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 327 ? 15.653  65.870 65.130 1.00 32.83 ? 327  GLU A N   1 
ATOM   2534 C CA  . GLU A 1 327 ? 14.416  65.154 64.842 1.00 31.88 ? 327  GLU A CA  1 
ATOM   2535 C C   . GLU A 1 327 ? 13.881  64.296 66.006 1.00 31.27 ? 327  GLU A C   1 
ATOM   2536 O O   . GLU A 1 327 ? 12.840  63.647 65.839 1.00 33.01 ? 327  GLU A O   1 
ATOM   2537 C CB  . GLU A 1 327 ? 14.585  64.298 63.575 1.00 31.42 ? 327  GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 327 ? 15.164  65.068 62.405 1.00 34.37 ? 327  GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 327 ? 14.091  65.606 61.459 1.00 35.22 ? 327  GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 327 ? 12.910  65.413 61.795 1.00 36.09 ? 327  GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 327 ? 14.416  66.217 60.393 1.00 35.01 ? 327  GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 328 ? 14.534  64.278 67.170 1.00 29.98 ? 328  GLY A N   1 
ATOM   2543 C CA  . GLY A 1 328 ? 13.990  63.498 68.280 1.00 29.21 ? 328  GLY A CA  1 
ATOM   2544 C C   . GLY A 1 328 ? 13.235  64.298 69.373 1.00 31.37 ? 328  GLY A C   1 
ATOM   2545 O O   . GLY A 1 328 ? 12.312  63.791 70.066 1.00 31.86 ? 328  GLY A O   1 
ATOM   2546 N N   . SER A 1 329 ? 13.618  65.569 69.526 1.00 31.50 ? 329  SER A N   1 
ATOM   2547 C CA  . SER A 1 329 ? 13.076  66.475 70.539 1.00 31.34 ? 329  SER A CA  1 
ATOM   2548 C C   . SER A 1 329 ? 11.586  66.476 70.827 1.00 31.18 ? 329  SER A C   1 
ATOM   2549 O O   . SER A 1 329 ? 11.159  66.336 71.978 1.00 30.41 ? 329  SER A O   1 
ATOM   2550 C CB  . SER A 1 329 ? 13.430  67.921 70.187 1.00 31.63 ? 329  SER A CB  1 
ATOM   2551 O OG  . SER A 1 329 ? 14.768  68.092 70.484 1.00 38.58 ? 329  SER A OG  1 
ATOM   2552 N N   . PHE A 1 330 ? 10.802  66.719 69.776 1.00 30.28 ? 330  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 330 ? 9.384   66.846 69.941 1.00 28.59 ? 330  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 330 ? 8.716   65.622 70.567 1.00 28.44 ? 330  PHE A C   1 
ATOM   2555 O O   . PHE A 1 330 ? 7.972   65.740 71.573 1.00 29.89 ? 330  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 330 ? 8.748   67.213 68.602 1.00 28.16 ? 330  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 330 ? 7.261   67.241 68.667 1.00 29.62 ? 330  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 330 ? 6.516   66.106 68.325 1.00 28.47 ? 330  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 330 ? 6.605   68.375 69.156 1.00 28.22 ? 330  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 330 ? 5.159   66.109 68.470 1.00 29.55 ? 330  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 330 ? 5.248   68.405 69.314 1.00 26.19 ? 330  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 330 ? 4.508   67.297 68.979 1.00 30.67 ? 330  PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 331 ? 8.994   64.438 70.034 1.00 27.48 ? 331  PHE A N   1 
ATOM   2564 C CA  . PHE A 1 331 ? 8.358   63.258 70.598 1.00 26.75 ? 331  PHE A CA  1 
ATOM   2565 C C   . PHE A 1 331 ? 8.904   62.863 71.939 1.00 27.20 ? 331  PHE A C   1 
ATOM   2566 O O   . PHE A 1 331 ? 8.188   62.247 72.716 1.00 28.79 ? 331  PHE A O   1 
ATOM   2567 C CB  . PHE A 1 331 ? 8.369   62.078 69.601 1.00 25.50 ? 331  PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 331 ? 7.473   62.305 68.435 1.00 25.27 ? 331  PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 331 ? 7.997   62.663 67.197 1.00 25.32 ? 331  PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 331 ? 6.099   62.325 68.614 1.00 25.11 ? 331  PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 331 ? 7.177   63.053 66.144 1.00 26.59 ? 331  PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 331 ? 5.249   62.713 67.575 1.00 27.80 ? 331  PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 331 ? 5.795   63.084 66.322 1.00 28.09 ? 331  PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 332 ? 10.155  63.196 72.238 1.00 27.61 ? 332  LEU A N   1 
ATOM   2575 C CA  . LEU A 1 332 ? 10.655  62.863 73.580 1.00 28.67 ? 332  LEU A CA  1 
ATOM   2576 C C   . LEU A 1 332 ? 9.934   63.766 74.614 1.00 29.84 ? 332  LEU A C   1 
ATOM   2577 O O   . LEU A 1 332 ? 9.529   63.284 75.703 1.00 29.78 ? 332  LEU A O   1 
ATOM   2578 C CB  . LEU A 1 332 ? 12.165  63.076 73.690 1.00 27.07 ? 332  LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 332 ? 13.062  61.973 73.112 1.00 25.82 ? 332  LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 332 ? 14.436  62.596 72.801 1.00 23.80 ? 332  LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 332 ? 13.158  60.785 74.108 1.00 23.19 ? 332  LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 333 ? 9.758   65.049 74.257 1.00 28.13 ? 333  LEU A N   1 
ATOM   2583 C CA  . LEU A 1 333 ? 9.096   66.007 75.149 1.00 28.88 ? 333  LEU A CA  1 
ATOM   2584 C C   . LEU A 1 333 ? 7.715   65.495 75.496 1.00 30.47 ? 333  LEU A C   1 
ATOM   2585 O O   . LEU A 1 333 ? 7.353   65.390 76.660 1.00 28.96 ? 333  LEU A O   1 
ATOM   2586 C CB  . LEU A 1 333 ? 8.962   67.387 74.481 1.00 27.96 ? 333  LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 333 ? 8.038   68.380 75.214 1.00 28.28 ? 333  LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 333 ? 8.577   68.653 76.643 1.00 25.57 ? 333  LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 333 ? 7.961   69.728 74.374 1.00 29.38 ? 333  LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 334 ? 6.943   65.142 74.463 1.00 33.17 ? 334  TYR A N   1 
ATOM   2591 C CA  . TYR A 1 334 ? 5.612   64.652 74.704 1.00 32.27 ? 334  TYR A CA  1 
ATOM   2592 C C   . TYR A 1 334 ? 5.535   63.284 75.366 1.00 32.92 ? 334  TYR A C   1 
ATOM   2593 O O   . TYR A 1 334 ? 4.620   63.057 76.163 1.00 32.29 ? 334  TYR A O   1 
ATOM   2594 C CB  . TYR A 1 334 ? 4.823   64.641 73.421 1.00 31.03 ? 334  TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 334 ? 4.273   66.015 73.100 1.00 32.12 ? 334  TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 334 ? 5.147   67.082 72.825 1.00 30.09 ? 334  TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 334 ? 2.875   66.274 73.116 1.00 27.85 ? 334  TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 334 ? 4.668   68.346 72.577 1.00 29.62 ? 334  TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 334 ? 2.388   67.568 72.859 1.00 28.10 ? 334  TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 334 ? 3.296   68.604 72.586 1.00 28.46 ? 334  TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 334 ? 2.869   69.893 72.283 1.00 26.48 ? 334  TYR A OH  1 
ATOM   2602 N N   . GLY A 1 335 ? 6.502   62.400 75.141 1.00 31.69 ? 335  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 335 ? 6.287   61.096 75.727 1.00 32.81 ? 335  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 335 ? 7.307   60.368 76.563 1.00 33.68 ? 335  GLY A C   1 
ATOM   2605 O O   . GLY A 1 335 ? 7.021   59.281 77.069 1.00 35.40 ? 335  GLY A O   1 
ATOM   2606 N N   . ALA A 1 336 ? 8.494   60.915 76.718 1.00 32.67 ? 336  ALA A N   1 
ATOM   2607 C CA  . ALA A 1 336 ? 9.474   60.185 77.491 1.00 33.05 ? 336  ALA A CA  1 
ATOM   2608 C C   . ALA A 1 336 ? 9.644   60.763 78.892 1.00 34.53 ? 336  ALA A C   1 
ATOM   2609 O O   . ALA A 1 336 ? 9.584   61.986 79.101 1.00 34.72 ? 336  ALA A O   1 
ATOM   2610 C CB  . ALA A 1 336 ? 10.777  60.184 76.777 1.00 29.23 ? 336  ALA A CB  1 
ATOM   2611 N N   . PRO A 1 337 ? 9.860   59.899 79.880 1.00 35.58 ? 337  PRO A N   1 
ATOM   2612 C CA  . PRO A 1 337 ? 10.033  60.445 81.240 1.00 36.29 ? 337  PRO A CA  1 
ATOM   2613 C C   . PRO A 1 337 ? 11.333  61.287 81.381 1.00 35.37 ? 337  PRO A C   1 
ATOM   2614 O O   . PRO A 1 337 ? 12.340  60.973 80.765 1.00 34.73 ? 337  PRO A O   1 
ATOM   2615 C CB  . PRO A 1 337 ? 10.093  59.191 82.097 1.00 37.29 ? 337  PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 337 ? 10.993  58.260 81.176 1.00 37.52 ? 337  PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 337 ? 10.342  58.501 79.780 1.00 35.18 ? 337  PRO A CD  1 
ATOM   2618 N N   . GLY A 1 338 ? 11.289  62.341 82.207 1.00 35.96 ? 338  GLY A N   1 
ATOM   2619 C CA  . GLY A 1 338 ? 12.454  63.205 82.419 1.00 33.88 ? 338  GLY A CA  1 
ATOM   2620 C C   . GLY A 1 338 ? 12.448  64.496 81.583 1.00 34.06 ? 338  GLY A C   1 
ATOM   2621 O O   . GLY A 1 338 ? 13.195  65.426 81.880 1.00 32.98 ? 338  GLY A O   1 
ATOM   2622 N N   . PHE A 1 339 ? 11.614  64.566 80.541 1.00 32.97 ? 339  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 339 ? 11.570  65.764 79.695 1.00 34.44 ? 339  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 339 ? 10.376  66.632 80.064 1.00 34.96 ? 339  PHE A C   1 
ATOM   2625 O O   . PHE A 1 339 ? 9.288   66.106 80.363 1.00 35.42 ? 339  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 339 ? 11.457  65.409 78.188 1.00 31.17 ? 339  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 339 ? 12.637  64.685 77.639 1.00 28.60 ? 339  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 339 ? 13.557  65.337 76.846 1.00 29.47 ? 339  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 339 ? 12.791  63.311 77.842 1.00 29.21 ? 339  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 339 ? 14.638  64.619 76.238 1.00 27.40 ? 339  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 339 ? 13.834  62.592 77.254 1.00 27.82 ? 339  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 339 ? 14.758  63.248 76.448 1.00 27.25 ? 339  PHE A CZ  1 
ATOM   2633 N N   . SER A 1 340 ? 10.587  67.948 80.054 1.00 35.17 ? 340  SER A N   1 
ATOM   2634 C CA  . SER A 1 340 ? 9.509   68.910 80.330 1.00 35.65 ? 340  SER A CA  1 
ATOM   2635 C C   . SER A 1 340 ? 9.845   70.111 79.487 1.00 35.63 ? 340  SER A C   1 
ATOM   2636 O O   . SER A 1 340 ? 11.032  70.358 79.160 1.00 35.34 ? 340  SER A O   1 
ATOM   2637 C CB  . SER A 1 340 ? 9.481   69.368 81.788 1.00 36.31 ? 340  SER A CB  1 
ATOM   2638 O OG  . SER A 1 340 ? 10.023  68.398 82.652 1.00 41.80 ? 340  SER A OG  1 
ATOM   2639 N N   . LYS A 1 341 ? 8.817   70.881 79.164 1.00 35.07 ? 341  LYS A N   1 
ATOM   2640 C CA  . LYS A 1 341 ? 9.023   72.037 78.345 1.00 35.89 ? 341  LYS A CA  1 
ATOM   2641 C C   . LYS A 1 341 ? 9.772   73.194 79.020 1.00 36.39 ? 341  LYS A C   1 
ATOM   2642 O O   . LYS A 1 341 ? 10.495  73.935 78.325 1.00 35.13 ? 341  LYS A O   1 
ATOM   2643 C CB  . LYS A 1 341 ? 7.687   72.562 77.818 1.00 36.20 ? 341  LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 341 ? 7.846   73.538 76.642 1.00 35.55 ? 341  LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 341 ? 6.480   73.945 76.006 1.00 38.92 ? 341  LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 341 ? 5.735   74.964 76.855 1.00 39.12 ? 341  LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 341 ? 6.688   76.035 77.316 1.00 41.33 ? 341  LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 342 ? 9.621   73.338 80.340 1.00 34.58 ? 342  ASP A N   1 
ATOM   2649 C CA  . ASP A 1 342 ? 10.224  74.468 81.024 1.00 34.50 ? 342  ASP A CA  1 
ATOM   2650 C C   . ASP A 1 342 ? 11.479  74.207 81.887 1.00 34.98 ? 342  ASP A C   1 
ATOM   2651 O O   . ASP A 1 342 ? 11.776  74.984 82.795 1.00 33.55 ? 342  ASP A O   1 
ATOM   2652 C CB  . ASP A 1 342 ? 9.161   75.166 81.885 1.00 35.14 ? 342  ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 342 ? 7.896   75.554 81.102 1.00 37.72 ? 342  ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 342 ? 7.952   75.681 79.828 1.00 34.81 ? 342  ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 342 ? 6.843   75.748 81.805 1.00 38.90 ? 342  ASP A OD2 1 
ATOM   2656 N N   . SER A 1 343 ? 12.189  73.109 81.629 1.00 35.87 ? 343  SER A N   1 
ATOM   2657 C CA  . SER A 1 343 ? 13.412  72.785 82.343 1.00 35.79 ? 343  SER A CA  1 
ATOM   2658 C C   . SER A 1 343 ? 14.397  72.425 81.232 1.00 36.31 ? 343  SER A C   1 
ATOM   2659 O O   . SER A 1 343 ? 13.990  72.282 80.103 1.00 34.54 ? 343  SER A O   1 
ATOM   2660 C CB  . SER A 1 343 ? 13.196  71.591 83.283 1.00 37.29 ? 343  SER A CB  1 
ATOM   2661 O OG  . SER A 1 343 ? 13.283  70.334 82.616 1.00 42.65 ? 343  SER A OG  1 
ATOM   2662 N N   . GLU A 1 344 ? 15.678  72.295 81.549 1.00 38.15 ? 344  GLU A N   1 
ATOM   2663 C CA  . GLU A 1 344 ? 16.716  71.948 80.575 1.00 38.91 ? 344  GLU A CA  1 
ATOM   2664 C C   . GLU A 1 344 ? 16.660  70.433 80.214 1.00 38.23 ? 344  GLU A C   1 
ATOM   2665 O O   . GLU A 1 344 ? 17.373  69.928 79.318 1.00 36.95 ? 344  GLU A O   1 
ATOM   2666 C CB  . GLU A 1 344 ? 18.078  72.303 81.177 1.00 41.77 ? 344  GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 344 ? 18.776  73.549 80.622 1.00 48.21 ? 344  GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 344 ? 20.323  73.279 80.415 1.00 54.51 ? 344  GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 344 ? 20.763  72.783 79.293 1.00 51.71 ? 344  GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 344 ? 21.083  73.532 81.409 1.00 55.67 ? 344  GLU A OE2 1 
ATOM   2671 N N   . SER A 1 345 ? 15.813  69.720 80.953 1.00 36.44 ? 345  SER A N   1 
ATOM   2672 C CA  . SER A 1 345 ? 15.587  68.306 80.771 1.00 36.03 ? 345  SER A CA  1 
ATOM   2673 C C   . SER A 1 345 ? 16.855  67.454 80.777 1.00 36.46 ? 345  SER A C   1 
ATOM   2674 O O   . SER A 1 345 ? 17.091  66.648 79.848 1.00 36.81 ? 345  SER A O   1 
ATOM   2675 C CB  . SER A 1 345 ? 14.801  68.067 79.464 1.00 36.26 ? 345  SER A CB  1 
ATOM   2676 O OG  . SER A 1 345 ? 13.445  68.436 79.593 1.00 39.39 ? 345  SER A OG  1 
ATOM   2677 N N   . LYS A 1 346 ? 17.675  67.610 81.810 1.00 36.30 ? 346  LYS A N   1 
ATOM   2678 C CA  . LYS A 1 346 ? 18.873  66.810 81.902 1.00 36.79 ? 346  LYS A CA  1 
ATOM   2679 C C   . LYS A 1 346 ? 18.370  65.397 82.228 1.00 35.37 ? 346  LYS A C   1 
ATOM   2680 O O   . LYS A 1 346 ? 17.504  65.188 83.063 1.00 32.09 ? 346  LYS A O   1 
ATOM   2681 C CB  . LYS A 1 346 ? 19.807  67.392 82.959 1.00 39.87 ? 346  LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 346 ? 20.590  68.653 82.500 1.00 43.75 ? 346  LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 346 ? 20.754  69.615 83.700 1.00 48.27 ? 346  LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 346 ? 21.618  70.853 83.401 1.00 51.65 ? 346  LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 346 ? 23.051  70.616 83.882 1.00 54.53 ? 346  LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 347 ? 18.918  64.400 81.554 1.00 35.17 ? 347  ILE A N   1 
ATOM   2687 C CA  . ILE A 1 347 ? 18.365  63.058 81.734 1.00 34.86 ? 347  ILE A CA  1 
ATOM   2688 C C   . ILE A 1 347 ? 19.241  62.073 82.507 1.00 36.64 ? 347  ILE A C   1 
ATOM   2689 O O   . ILE A 1 347 ? 20.416  61.829 82.184 1.00 36.13 ? 347  ILE A O   1 
ATOM   2690 C CB  . ILE A 1 347 ? 17.966  62.488 80.273 1.00 34.69 ? 347  ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 347 ? 16.864  63.400 79.675 1.00 30.43 ? 347  ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 347 ? 17.510  60.977 80.320 1.00 31.57 ? 347  ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 347 ? 15.605  63.431 80.583 1.00 27.13 ? 347  ILE A CD1 1 
ATOM   2694 N N   . SER A 1 348 ? 18.645  61.473 83.522 1.00 39.29 ? 348  SER A N   1 
ATOM   2695 C CA  . SER A 1 348 ? 19.373  60.512 84.336 1.00 40.59 ? 348  SER A CA  1 
ATOM   2696 C C   . SER A 1 348 ? 19.678  59.245 83.526 1.00 42.75 ? 348  SER A C   1 
ATOM   2697 O O   . SER A 1 348 ? 19.062  58.975 82.474 1.00 41.68 ? 348  SER A O   1 
ATOM   2698 C CB  . SER A 1 348 ? 18.543  60.161 85.563 1.00 38.82 ? 348  SER A CB  1 
ATOM   2699 O OG  . SER A 1 348 ? 17.433  59.354 85.244 1.00 39.17 ? 348  SER A OG  1 
ATOM   2700 N N   . ARG A 1 349 ? 20.648  58.485 84.003 1.00 43.88 ? 349  ARG A N   1 
ATOM   2701 C CA  . ARG A 1 349 ? 20.996  57.249 83.347 1.00 45.59 ? 349  ARG A CA  1 
ATOM   2702 C C   . ARG A 1 349 ? 19.732  56.360 83.305 1.00 45.83 ? 349  ARG A C   1 
ATOM   2703 O O   . ARG A 1 349 ? 19.459  55.668 82.309 1.00 45.21 ? 349  ARG A O   1 
ATOM   2704 C CB  . ARG A 1 349 ? 22.093  56.541 84.142 1.00 47.51 ? 349  ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 349 ? 22.723  55.386 83.417 1.00 49.21 ? 349  ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 349 ? 23.414  55.994 82.258 1.00 52.63 ? 349  ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 349 ? 23.619  55.023 81.204 1.00 55.10 ? 349  ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 349 ? 23.908  55.354 79.945 1.00 55.87 ? 349  ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 349 ? 24.025  56.639 79.586 1.00 55.33 ? 349  ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 349 ? 24.068  54.395 79.041 1.00 55.65 ? 349  ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 350 ? 18.966  56.400 84.392 1.00 46.68 ? 350  GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? 17.751  55.606 84.540 1.00 47.81 ? 350  GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? 16.705  56.021 83.487 1.00 46.78 ? 350  GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? 16.121  55.157 82.801 1.00 45.65 ? 350  GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? 17.237  55.766 85.977 1.00 52.82 ? 350  GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? 16.017  54.952 86.384 1.00 60.07 ? 350  GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? 15.352  55.550 87.657 1.00 65.72 ? 350  GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? 15.267  54.863 88.731 1.00 67.37 ? 350  GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? 14.927  56.738 87.569 1.00 67.47 ? 350  GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 351 ? 16.488  57.330 83.312 1.00 44.77 ? 351  ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? 15.535  57.775 82.278 1.00 42.57 ? 351  ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? 16.092  57.566 80.855 1.00 39.98 ? 351  ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? 15.352  57.348 79.897 1.00 38.31 ? 351  ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? 15.092  59.221 82.518 1.00 42.53 ? 351  ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? 14.087  59.317 83.657 1.00 42.93 ? 351  ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? 13.672  58.236 84.111 1.00 45.07 ? 351  ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? 13.704  60.425 84.109 1.00 43.47 ? 351  ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? 17.403  57.571 80.736 1.00 38.25 ? 352  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? 18.008  57.333 79.461 1.00 38.02 ? 352  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? 17.563  55.957 78.963 1.00 39.56 ? 352  PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? 17.162  55.787 77.817 1.00 39.07 ? 352  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? 19.509  57.309 79.573 1.00 35.59 ? 352  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? 20.172  57.176 78.267 1.00 34.16 ? 352  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? 20.124  58.223 77.352 1.00 32.98 ? 352  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? 20.779  55.971 77.894 1.00 33.29 ? 352  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? 20.667  58.079 76.094 1.00 32.27 ? 352  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? 21.329  55.811 76.629 1.00 30.98 ? 352  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? 21.273  56.872 75.729 1.00 32.45 ? 352  PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? 17.618  54.971 79.838 1.00 41.09 ? 353  MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? 17.254  53.635 79.421 1.00 42.24 ? 353  MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? 15.767  53.420 79.244 1.00 40.92 ? 353  MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? 15.366  52.618 78.393 1.00 41.63 ? 353  MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? 17.892  52.628 80.359 1.00 44.81 ? 353  MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? 19.383  52.577 80.072 1.00 49.90 ? 353  MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? 20.217  51.387 81.052 1.00 57.78 ? 353  MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? 19.751  51.988 82.776 1.00 52.94 ? 353  MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? 14.951  54.123 80.023 1.00 38.57 ? 354  SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? 13.504  54.034 79.846 1.00 38.17 ? 354  SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? 13.177  54.620 78.454 1.00 36.67 ? 354  SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? 12.250  54.182 77.776 1.00 35.03 ? 354  SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? 12.789  54.887 80.871 1.00 38.03 ? 354  SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? 12.918  54.266 82.109 1.00 43.81 ? 354  SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? 13.959  55.631 78.077 1.00 34.56 ? 355  GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? 13.760  56.293 76.824 1.00 33.00 ? 355  GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? 14.107  55.416 75.647 1.00 33.20 ? 355  GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? 13.325  55.407 74.628 1.00 29.15 ? 355  GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? 15.224  54.667 75.767 1.00 31.42 ? 356  VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? 15.599  53.865 74.629 1.00 33.82 ? 356  VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? 14.576  52.763 74.460 1.00 34.93 ? 356  VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? 14.213  52.414 73.339 1.00 36.22 ? 356  VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? 17.092  53.336 74.664 1.00 34.40 ? 356  VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? 17.822  53.939 75.758 1.00 35.02 ? 356  VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? 17.164  51.844 74.664 1.00 33.14 ? 356  VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? 14.086  52.264 75.578 1.00 35.81 ? 357  LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? 13.051  51.241 75.612 1.00 37.74 ? 357  LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? 11.796  51.763 74.836 1.00 36.33 ? 357  LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? 11.257  51.054 73.959 1.00 34.68 ? 357  LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? 12.713  50.932 77.089 1.00 41.33 ? 357  LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? 11.591  49.944 77.299 1.00 45.77 ? 357  LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? 11.910  48.641 76.639 1.00 49.00 ? 357  LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 357 ? 10.851  47.556 76.911 1.00 52.65 ? 357  LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 357 ? 11.155  46.326 76.025 1.00 54.94 ? 357  LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 358 ? 11.349  52.990 75.155 1.00 35.96 ? 358  LEU A N   1 
ATOM   2774 C CA  . LEU A 1 358 ? 10.209  53.638 74.473 1.00 35.60 ? 358  LEU A CA  1 
ATOM   2775 C C   . LEU A 1 358 ? 10.489  53.903 72.954 1.00 35.44 ? 358  LEU A C   1 
ATOM   2776 O O   . LEU A 1 358 ? 9.585   53.824 72.121 1.00 34.04 ? 358  LEU A O   1 
ATOM   2777 C CB  . LEU A 1 358 ? 9.915   54.974 75.136 1.00 34.88 ? 358  LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 358 ? 8.733   55.229 76.083 1.00 37.81 ? 358  LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 358 ? 7.962   53.974 76.468 1.00 31.84 ? 358  LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 358 ? 9.288   55.967 77.303 1.00 31.94 ? 358  LEU A CD2 1 
ATOM   2781 N N   . SER A 1 359 ? 11.752  54.191 72.613 1.00 35.31 ? 359  SER A N   1 
ATOM   2782 C CA  . SER A 1 359 ? 12.142  54.497 71.245 1.00 34.21 ? 359  SER A CA  1 
ATOM   2783 C C   . SER A 1 359 ? 12.317  53.332 70.316 1.00 34.98 ? 359  SER A C   1 
ATOM   2784 O O   . SER A 1 359 ? 12.199  53.491 69.096 1.00 36.44 ? 359  SER A O   1 
ATOM   2785 C CB  . SER A 1 359 ? 13.426  55.293 71.243 1.00 34.22 ? 359  SER A CB  1 
ATOM   2786 O OG  . SER A 1 359 ? 13.314  56.376 72.130 1.00 32.89 ? 359  SER A OG  1 
ATOM   2787 N N   . VAL A 1 360 ? 12.620  52.168 70.842 1.00 33.78 ? 360  VAL A N   1 
ATOM   2788 C CA  . VAL A 1 360 ? 12.795  51.036 69.940 1.00 36.26 ? 360  VAL A CA  1 
ATOM   2789 C C   . VAL A 1 360 ? 11.918  49.927 70.468 1.00 38.09 ? 360  VAL A C   1 
ATOM   2790 O O   . VAL A 1 360 ? 12.413  48.888 70.901 1.00 37.14 ? 360  VAL A O   1 
ATOM   2791 C CB  . VAL A 1 360 ? 14.263  50.520 69.924 1.00 35.58 ? 360  VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 360 ? 14.479  49.693 68.697 1.00 34.74 ? 360  VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 360 ? 15.230  51.665 69.961 1.00 34.61 ? 360  VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 361 ? 10.589  50.116 70.392 1.00 41.15 ? 361  PRO A N   1 
ATOM   2795 C CA  . PRO A 1 361 ? 9.529   49.188 70.862 1.00 42.15 ? 361  PRO A CA  1 
ATOM   2796 C C   . PRO A 1 361 ? 9.678   47.725 70.448 1.00 43.98 ? 361  PRO A C   1 
ATOM   2797 O O   . PRO A 1 361 ? 9.477   46.803 71.236 1.00 43.19 ? 361  PRO A O   1 
ATOM   2798 C CB  . PRO A 1 361 ? 8.258   49.794 70.286 1.00 41.32 ? 361  PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 361 ? 8.663   51.199 69.816 1.00 40.32 ? 361  PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 361 ? 10.056  51.042 69.373 1.00 40.36 ? 361  PRO A CD  1 
ATOM   2801 N N   . HIS A 1 362 ? 10.046  47.533 69.196 1.00 47.56 ? 362  HIS A N   1 
ATOM   2802 C CA  . HIS A 1 362 ? 10.184  46.193 68.632 1.00 53.03 ? 362  HIS A CA  1 
ATOM   2803 C C   . HIS A 1 362 ? 11.513  45.479 68.948 1.00 53.06 ? 362  HIS A C   1 
ATOM   2804 O O   . HIS A 1 362 ? 11.817  44.420 68.350 1.00 53.31 ? 362  HIS A O   1 
ATOM   2805 C CB  . HIS A 1 362 ? 10.056  46.290 67.115 1.00 56.72 ? 362  HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 362 ? 11.025  47.266 66.516 1.00 60.29 ? 362  HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 362 ? 10.909  48.632 66.701 1.00 61.38 ? 362  HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 362 ? 12.138  47.073 65.763 1.00 60.64 ? 362  HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 362 ? 11.913  49.234 66.082 1.00 62.98 ? 362  HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 362 ? 12.672  48.314 65.506 1.00 61.83 ? 362  HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 363 ? 12.292  46.056 69.868 1.00 51.65 ? 363  ALA A N   1 
ATOM   2812 C CA  . ALA A 1 363 ? 13.586  45.500 70.220 1.00 48.89 ? 363  ALA A CA  1 
ATOM   2813 C C   . ALA A 1 363 ? 13.567  44.564 71.411 1.00 46.93 ? 363  ALA A C   1 
ATOM   2814 O O   . ALA A 1 363 ? 12.850  44.803 72.366 1.00 47.91 ? 363  ALA A O   1 
ATOM   2815 C CB  . ALA A 1 363 ? 14.558  46.647 70.490 1.00 48.52 ? 363  ALA A CB  1 
ATOM   2816 N N   . ASN A 1 364 ? 14.363  43.499 71.342 1.00 44.82 ? 364  ASN A N   1 
ATOM   2817 C CA  . ASN A 1 364 ? 14.519  42.553 72.448 1.00 42.80 ? 364  ASN A CA  1 
ATOM   2818 C C   . ASN A 1 364 ? 15.647  43.150 73.311 1.00 42.24 ? 364  ASN A C   1 
ATOM   2819 O O   . ASN A 1 364 ? 16.193  44.211 72.970 1.00 41.78 ? 364  ASN A O   1 
ATOM   2820 C CB  . ASN A 1 364 ? 14.913  41.154 71.931 1.00 41.95 ? 364  ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 364 ? 16.221  41.151 71.072 1.00 43.03 ? 364  ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 364 ? 16.867  42.179 70.868 1.00 41.67 ? 364  ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 364 ? 16.587  39.972 70.561 1.00 42.10 ? 364  ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 365 ? 16.012  42.497 74.408 1.00 41.57 ? 365  ASP A N   1 
ATOM   2825 C CA  . ASP A 1 365 ? 17.061  43.061 75.274 1.00 42.45 ? 365  ASP A CA  1 
ATOM   2826 C C   . ASP A 1 365 ? 18.464  43.204 74.696 1.00 39.70 ? 365  ASP A C   1 
ATOM   2827 O O   . ASP A 1 365 ? 19.147  44.187 74.985 1.00 38.02 ? 365  ASP A O   1 
ATOM   2828 C CB  . ASP A 1 365 ? 17.089  42.342 76.625 1.00 45.82 ? 365  ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 365 ? 15.856  42.711 77.486 1.00 53.76 ? 365  ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 365 ? 14.844  43.309 76.938 1.00 54.80 ? 365  ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 365 ? 15.882  42.407 78.713 1.00 56.70 ? 365  ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 366 ? 18.889  42.255 73.873 1.00 36.78 ? 366  LEU A N   1 
ATOM   2833 C CA  . LEU A 1 366 ? 20.184  42.373 73.285 1.00 34.40 ? 366  LEU A CA  1 
ATOM   2834 C C   . LEU A 1 366 ? 20.108  43.639 72.399 1.00 33.28 ? 366  LEU A C   1 
ATOM   2835 O O   . LEU A 1 366 ? 21.031  44.452 72.359 1.00 32.60 ? 366  LEU A O   1 
ATOM   2836 C CB  . LEU A 1 366 ? 20.514  41.126 72.474 1.00 33.14 ? 366  LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 366 ? 21.855  41.195 71.720 1.00 34.07 ? 366  LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 366 ? 23.028  41.244 72.719 1.00 32.82 ? 366  LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 366 ? 21.992  40.014 70.794 1.00 32.46 ? 366  LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 367 ? 18.990  43.819 71.709 1.00 33.02 ? 367  GLY A N   1 
ATOM   2841 C CA  . GLY A 1 367 ? 18.814  44.986 70.850 1.00 30.55 ? 367  GLY A CA  1 
ATOM   2842 C C   . GLY A 1 367 ? 18.861  46.291 71.656 1.00 30.88 ? 367  GLY A C   1 
ATOM   2843 O O   . GLY A 1 367 ? 19.561  47.245 71.240 1.00 29.75 ? 367  GLY A O   1 
ATOM   2844 N N   . LEU A 1 368 ? 18.133  46.362 72.780 1.00 29.71 ? 368  LEU A N   1 
ATOM   2845 C CA  . LEU A 1 368 ? 18.139  47.583 73.579 1.00 32.36 ? 368  LEU A CA  1 
ATOM   2846 C C   . LEU A 1 368 ? 19.560  47.835 74.071 1.00 34.93 ? 368  LEU A C   1 
ATOM   2847 O O   . LEU A 1 368 ? 20.007  49.009 74.136 1.00 37.34 ? 368  LEU A O   1 
ATOM   2848 C CB  . LEU A 1 368 ? 17.151  47.527 74.756 1.00 31.24 ? 368  LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 368 ? 15.649  47.425 74.365 1.00 33.50 ? 368  LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 368 ? 14.891  47.098 75.642 1.00 30.23 ? 368  LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 368 ? 15.078  48.753 73.696 1.00 28.85 ? 368  LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 369 ? 20.296  46.761 74.351 1.00 34.54 ? 369  ASP A N   1 
ATOM   2853 C CA  . ASP A 1 369 ? 21.688  46.914 74.785 1.00 35.56 ? 369  ASP A CA  1 
ATOM   2854 C C   . ASP A 1 369 ? 22.566  47.474 73.684 1.00 34.68 ? 369  ASP A C   1 
ATOM   2855 O O   . ASP A 1 369 ? 23.482  48.253 73.975 1.00 34.95 ? 369  ASP A O   1 
ATOM   2856 C CB  . ASP A 1 369 ? 22.319  45.591 75.248 1.00 36.77 ? 369  ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 369 ? 21.832  45.171 76.623 1.00 41.32 ? 369  ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 369 ? 21.083  45.943 77.258 1.00 43.33 ? 369  ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 369 ? 22.189  44.061 77.088 1.00 46.03 ? 369  ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 370 ? 22.297  47.079 72.440 1.00 33.34 ? 370  ALA A N   1 
ATOM   2861 C CA  . ALA A 1 370 ? 23.129  47.538 71.326 1.00 33.68 ? 370  ALA A CA  1 
ATOM   2862 C C   . ALA A 1 370 ? 22.935  49.034 71.117 1.00 33.29 ? 370  ALA A C   1 
ATOM   2863 O O   . ALA A 1 370 ? 23.929  49.739 70.955 1.00 32.83 ? 370  ALA A O   1 
ATOM   2864 C CB  . ALA A 1 370 ? 22.834  46.780 70.048 1.00 30.56 ? 370  ALA A CB  1 
ATOM   2865 N N   . VAL A 1 371 ? 21.684  49.511 71.219 1.00 32.49 ? 371  VAL A N   1 
ATOM   2866 C CA  . VAL A 1 371 ? 21.375  50.929 71.017 1.00 30.65 ? 371  VAL A CA  1 
ATOM   2867 C C   . VAL A 1 371 ? 22.056  51.721 72.133 1.00 30.95 ? 371  VAL A C   1 
ATOM   2868 O O   . VAL A 1 371 ? 22.733  52.722 71.878 1.00 32.03 ? 371  VAL A O   1 
ATOM   2869 C CB  . VAL A 1 371 ? 19.806  51.227 71.057 1.00 29.75 ? 371  VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 371 ? 19.562  52.714 71.002 1.00 26.60 ? 371  VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 371 ? 19.054  50.510 69.898 1.00 26.91 ? 371  VAL A CG2 1 
ATOM   2872 N N   . THR A 1 372 ? 21.893  51.249 73.362 1.00 30.45 ? 372  THR A N   1 
ATOM   2873 C CA  . THR A 1 372 ? 22.451  51.919 74.528 1.00 31.00 ? 372  THR A CA  1 
ATOM   2874 C C   . THR A 1 372 ? 23.995  52.009 74.445 1.00 31.80 ? 372  THR A C   1 
ATOM   2875 O O   . THR A 1 372 ? 24.590  53.067 74.709 1.00 32.16 ? 372  THR A O   1 
ATOM   2876 C CB  . THR A 1 372 ? 22.032  51.171 75.841 1.00 32.03 ? 372  THR A CB  1 
ATOM   2877 O OG1 . THR A 1 372 ? 20.596  51.052 75.896 1.00 30.20 ? 372  THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 372 ? 22.577  51.908 77.092 1.00 27.21 ? 372  THR A CG2 1 
ATOM   2879 N N   . LEU A 1 373 ? 24.641  50.914 74.043 1.00 31.18 ? 373  LEU A N   1 
ATOM   2880 C CA  . LEU A 1 373 ? 26.081  50.941 73.905 1.00 31.97 ? 373  LEU A CA  1 
ATOM   2881 C C   . LEU A 1 373 ? 26.452  51.969 72.846 1.00 33.10 ? 373  LEU A C   1 
ATOM   2882 O O   . LEU A 1 373 ? 27.344  52.811 73.051 1.00 32.90 ? 373  LEU A O   1 
ATOM   2883 C CB  . LEU A 1 373 ? 26.615  49.586 73.471 1.00 33.09 ? 373  LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 373 ? 28.121  49.546 73.365 1.00 33.87 ? 373  LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 373 ? 28.717  50.301 74.577 1.00 35.45 ? 373  LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 373 ? 28.601  48.115 73.420 1.00 35.18 ? 373  LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 374 ? 25.754  51.888 71.713 1.00 32.52 ? 374  GLN A N   1 
ATOM   2888 C CA  . GLN A 1 374 ? 25.999  52.767 70.590 1.00 33.10 ? 374  GLN A CA  1 
ATOM   2889 C C   . GLN A 1 374 ? 25.876  54.266 70.901 1.00 33.94 ? 374  GLN A C   1 
ATOM   2890 O O   . GLN A 1 374 ? 26.540  55.074 70.266 1.00 33.23 ? 374  GLN A O   1 
ATOM   2891 C CB  . GLN A 1 374 ? 25.039  52.420 69.447 1.00 34.18 ? 374  GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 374 ? 25.330  53.141 68.153 1.00 35.55 ? 374  GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 374 ? 26.514  52.549 67.418 1.00 38.11 ? 374  GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 374 ? 27.009  53.144 66.471 1.00 39.59 ? 374  GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 374 ? 26.963  51.357 67.837 1.00 38.30 ? 374  GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 375 ? 25.050  54.652 71.872 1.00 32.75 ? 375  TYR A N   1 
ATOM   2897 C CA  . TYR A 1 375 ? 24.902  56.081 72.127 1.00 31.67 ? 375  TYR A CA  1 
ATOM   2898 C C   . TYR A 1 375 ? 25.402  56.538 73.495 1.00 32.84 ? 375  TYR A C   1 
ATOM   2899 O O   . TYR A 1 375 ? 25.152  57.668 73.920 1.00 33.32 ? 375  TYR A O   1 
ATOM   2900 C CB  . TYR A 1 375 ? 23.425  56.478 71.964 1.00 27.55 ? 375  TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 375 ? 23.001  56.572 70.515 1.00 29.14 ? 375  TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 375 ? 23.098  57.789 69.811 1.00 25.98 ? 375  TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 375 ? 22.557  55.410 69.804 1.00 27.48 ? 375  TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 375 ? 22.772  57.881 68.464 1.00 24.78 ? 375  TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 375 ? 22.235  55.488 68.461 1.00 26.63 ? 375  TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 375 ? 22.340  56.742 67.797 1.00 27.01 ? 375  TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 375 ? 21.962  56.833 66.494 1.00 26.73 ? 375  TYR A OH  1 
ATOM   2908 N N   . THR A 1 376 ? 26.070  55.667 74.217 1.00 32.56 ? 376  THR A N   1 
ATOM   2909 C CA  . THR A 1 376 ? 26.524  56.091 75.523 1.00 34.10 ? 376  THR A CA  1 
ATOM   2910 C C   . THR A 1 376 ? 28.001  56.358 75.496 1.00 34.43 ? 376  THR A C   1 
ATOM   2911 O O   . THR A 1 376 ? 28.747  55.556 74.949 1.00 35.18 ? 376  THR A O   1 
ATOM   2912 C CB  . THR A 1 376 ? 26.311  55.005 76.573 1.00 33.94 ? 376  THR A CB  1 
ATOM   2913 O OG1 . THR A 1 376 ? 24.921  54.661 76.639 1.00 33.67 ? 376  THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 376 ? 26.806  55.476 77.882 1.00 31.40 ? 376  THR A CG2 1 
ATOM   2915 N N   . ASP A 1 377 ? 28.404  57.477 76.086 1.00 34.96 ? 377  ASP A N   1 
ATOM   2916 C CA  . ASP A 1 377 ? 29.823  57.863 76.225 1.00 35.49 ? 377  ASP A CA  1 
ATOM   2917 C C   . ASP A 1 377 ? 30.163  57.273 77.608 1.00 36.58 ? 377  ASP A C   1 
ATOM   2918 O O   . ASP A 1 377 ? 29.750  57.856 78.641 1.00 34.34 ? 377  ASP A O   1 
ATOM   2919 C CB  . ASP A 1 377 ? 29.928  59.395 76.305 1.00 35.75 ? 377  ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 377 ? 31.320  59.878 76.649 1.00 36.71 ? 377  ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 377 ? 32.161  59.058 77.100 1.00 36.04 ? 377  ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 377 ? 31.572  61.092 76.470 1.00 37.66 ? 377  ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 378 ? 30.891  56.153 77.643 1.00 37.91 ? 378  TRP A N   1 
ATOM   2924 C CA  . TRP A 1 378 ? 31.207  55.488 78.922 1.00 41.15 ? 378  TRP A CA  1 
ATOM   2925 C C   . TRP A 1 378 ? 32.234  56.134 79.810 1.00 42.54 ? 378  TRP A C   1 
ATOM   2926 O O   . TRP A 1 378 ? 32.607  55.598 80.854 1.00 43.64 ? 378  TRP A O   1 
ATOM   2927 C CB  . TRP A 1 378 ? 31.563  54.001 78.711 1.00 42.88 ? 378  TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 378 ? 30.315  53.200 78.567 1.00 45.00 ? 378  TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 378 ? 29.774  52.723 77.416 1.00 45.90 ? 378  TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 378 ? 29.335  52.985 79.586 1.00 46.30 ? 378  TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 378 ? 28.507  52.238 77.649 1.00 46.35 ? 378  TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 378 ? 28.217  52.391 78.977 1.00 45.77 ? 378  TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 378 ? 29.294  53.256 80.965 1.00 50.12 ? 378  TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 378 ? 27.058  52.064 79.684 1.00 47.15 ? 378  TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 378 ? 28.120  52.925 81.689 1.00 50.60 ? 378  TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 378 ? 27.025  52.337 81.033 1.00 48.51 ? 378  TRP A CH2 1 
ATOM   2937 N N   . MET A 1 379 ? 32.682  57.307 79.423 1.00 45.06 ? 379  MET A N   1 
ATOM   2938 C CA  . MET A 1 379 ? 33.615  58.016 80.254 1.00 47.84 ? 379  MET A CA  1 
ATOM   2939 C C   . MET A 1 379 ? 32.805  59.038 81.007 1.00 47.64 ? 379  MET A C   1 
ATOM   2940 O O   . MET A 1 379 ? 33.302  59.666 81.925 1.00 48.82 ? 379  MET A O   1 
ATOM   2941 C CB  . MET A 1 379 ? 34.589  58.767 79.389 1.00 52.47 ? 379  MET A CB  1 
ATOM   2942 C CG  . MET A 1 379 ? 35.962  58.881 79.991 1.00 62.10 ? 379  MET A CG  1 
ATOM   2943 S SD  . MET A 1 379 ? 37.047  58.135 78.763 1.00 70.02 ? 379  MET A SD  1 
ATOM   2944 C CE  . MET A 1 379 ? 37.934  56.941 79.844 1.00 66.16 ? 379  MET A CE  1 
ATOM   2945 N N   . ASP A 1 380 ? 31.539  59.203 80.654 1.00 46.70 ? 380  ASP A N   1 
ATOM   2946 C CA  . ASP A 1 380 ? 30.745  60.280 81.273 1.00 46.20 ? 380  ASP A CA  1 
ATOM   2947 C C   . ASP A 1 380 ? 29.269  59.860 81.182 1.00 45.72 ? 380  ASP A C   1 
ATOM   2948 O O   . ASP A 1 380 ? 28.406  60.630 80.747 1.00 42.78 ? 380  ASP A O   1 
ATOM   2949 C CB  . ASP A 1 380 ? 31.057  61.564 80.437 1.00 42.93 ? 380  ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 380 ? 30.569  62.864 81.079 1.00 42.42 ? 380  ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 380 ? 30.248  62.915 82.300 1.00 41.23 ? 380  ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 380 ? 30.525  63.866 80.326 1.00 40.21 ? 380  ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 381 ? 28.996  58.628 81.594 1.00 46.26 ? 381  ASP A N   1 
ATOM   2954 C CA  . ASP A 1 381 ? 27.646  58.064 81.455 1.00 47.74 ? 381  ASP A CA  1 
ATOM   2955 C C   . ASP A 1 381 ? 26.510  58.714 82.228 1.00 47.94 ? 381  ASP A C   1 
ATOM   2956 O O   . ASP A 1 381 ? 25.315  58.450 81.933 1.00 48.99 ? 381  ASP A O   1 
ATOM   2957 C CB  . ASP A 1 381 ? 27.688  56.562 81.749 1.00 48.93 ? 381  ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 381 ? 28.289  56.268 83.093 1.00 50.87 ? 381  ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 381 ? 29.496  56.599 83.338 1.00 52.70 ? 381  ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 381 ? 27.530  55.717 83.906 1.00 52.11 ? 381  ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 382 ? 26.865  59.571 83.188 1.00 47.61 ? 382  ASN A N   1 
ATOM   2962 C CA  . ASN A 1 382 ? 25.866  60.273 83.999 1.00 47.39 ? 382  ASN A CA  1 
ATOM   2963 C C   . ASN A 1 382 ? 25.713  61.726 83.659 1.00 46.36 ? 382  ASN A C   1 
ATOM   2964 O O   . ASN A 1 382 ? 25.087  62.466 84.415 1.00 46.85 ? 382  ASN A O   1 
ATOM   2965 C CB  . ASN A 1 382 ? 26.168  60.163 85.484 1.00 48.85 ? 382  ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 382 ? 25.782  58.838 86.019 1.00 51.69 ? 382  ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 382 ? 24.664  58.373 85.785 1.00 54.64 ? 382  ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 382 ? 26.692  58.193 86.723 1.00 52.77 ? 382  ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 383 ? 26.292  62.143 82.538 1.00 42.99 ? 383  ASN A N   1 
ATOM   2970 C CA  . ASN A 1 383 ? 26.158  63.513 82.111 1.00 40.66 ? 383  ASN A CA  1 
ATOM   2971 C C   . ASN A 1 383 ? 24.700  63.686 81.581 1.00 40.32 ? 383  ASN A C   1 
ATOM   2972 O O   . ASN A 1 383 ? 24.314  63.095 80.568 1.00 38.92 ? 383  ASN A O   1 
ATOM   2973 C CB  . ASN A 1 383 ? 27.227  63.778 81.055 1.00 40.37 ? 383  ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 383 ? 27.127  65.142 80.456 1.00 41.07 ? 383  ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 383 ? 28.114  65.669 79.947 1.00 42.29 ? 383  ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 383 ? 25.939  65.724 80.479 1.00 37.82 ? 383  ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 384 ? 23.891  64.450 82.327 1.00 39.62 ? 384  GLY A N   1 
ATOM   2978 C CA  . GLY A 1 384 ? 22.504  64.734 81.976 1.00 37.29 ? 384  GLY A CA  1 
ATOM   2979 C C   . GLY A 1 384 ? 22.256  65.347 80.595 1.00 37.03 ? 384  GLY A C   1 
ATOM   2980 O O   . GLY A 1 384 ? 21.237  65.020 79.958 1.00 38.43 ? 384  GLY A O   1 
ATOM   2981 N N   . ILE A 1 385 ? 23.138  66.226 80.139 1.00 34.44 ? 385  ILE A N   1 
ATOM   2982 C CA  . ILE A 1 385 ? 23.021  66.858 78.833 1.00 35.06 ? 385  ILE A CA  1 
ATOM   2983 C C   . ILE A 1 385 ? 23.327  65.825 77.732 1.00 35.79 ? 385  ILE A C   1 
ATOM   2984 O O   . ILE A 1 385 ? 22.706  65.802 76.683 1.00 35.61 ? 385  ILE A O   1 
ATOM   2985 C CB  . ILE A 1 385 ? 24.057  68.023 78.637 1.00 35.49 ? 385  ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 385 ? 23.839  69.156 79.652 1.00 37.66 ? 385  ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 385 ? 23.979  68.552 77.225 1.00 33.02 ? 385  ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 385 ? 22.421  69.380 79.995 1.00 39.16 ? 385  ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 386 ? 24.345  65.007 77.963 1.00 37.24 ? 386  LYS A N   1 
ATOM   2990 C CA  . LYS A 1 386 ? 24.744  63.975 77.009 1.00 37.33 ? 386  LYS A CA  1 
ATOM   2991 C C   . LYS A 1 386 ? 23.654  62.905 76.868 1.00 37.10 ? 386  LYS A C   1 
ATOM   2992 O O   . LYS A 1 386 ? 23.370  62.435 75.760 1.00 36.72 ? 386  LYS A O   1 
ATOM   2993 C CB  . LYS A 1 386 ? 26.082  63.357 77.448 1.00 37.82 ? 386  LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 386 ? 27.313  63.986 76.735 1.00 38.85 ? 386  LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 386 ? 28.578  63.673 77.515 1.00 39.96 ? 386  LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 386 ? 29.857  64.036 76.734 1.00 39.99 ? 386  LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 386 ? 31.072  63.646 77.537 1.00 39.01 ? 386  LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 387 ? 23.040  62.545 77.996 1.00 36.05 ? 387  ASN A N   1 
ATOM   2999 C CA  . ASN A 1 387 ? 21.999  61.587 77.982 1.00 36.60 ? 387  ASN A CA  1 
ATOM   3000 C C   . ASN A 1 387 ? 20.794  62.158 77.218 1.00 36.31 ? 387  ASN A C   1 
ATOM   3001 O O   . ASN A 1 387 ? 20.207  61.451 76.385 1.00 34.82 ? 387  ASN A O   1 
ATOM   3002 C CB  . ASN A 1 387 ? 21.623  61.198 79.412 1.00 39.79 ? 387  ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 387 ? 22.703  60.336 80.070 1.00 42.93 ? 387  ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 387 ? 23.402  59.616 79.383 1.00 45.95 ? 387  ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 387 ? 22.839  60.406 81.392 1.00 44.67 ? 387  ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 388 ? 20.446  63.426 77.479 1.00 33.39 ? 388  ARG A N   1 
ATOM   3007 C CA  . ARG A 1 388 ? 19.316  64.054 76.810 1.00 31.96 ? 388  ARG A CA  1 
ATOM   3008 C C   . ARG A 1 388 ? 19.593  64.114 75.288 1.00 32.67 ? 388  ARG A C   1 
ATOM   3009 O O   . ARG A 1 388 ? 18.802  63.598 74.463 1.00 31.75 ? 388  ARG A O   1 
ATOM   3010 C CB  . ARG A 1 388 ? 19.093  65.444 77.404 1.00 31.63 ? 388  ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 388 ? 17.927  66.266 76.835 1.00 31.98 ? 388  ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 388 ? 18.477  67.482 76.080 1.00 33.16 ? 388  ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 388 ? 18.739  68.550 77.009 1.00 33.90 ? 388  ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 388 ? 19.685  69.490 76.888 1.00 33.94 ? 388  ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 388 ? 20.519  69.538 75.849 1.00 32.73 ? 388  ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 388 ? 19.797  70.399 77.849 1.00 36.25 ? 388  ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 389 ? 20.723  64.717 74.921 1.00 30.86 ? 389  ASP A N   1 
ATOM   3018 C CA  . ASP A 1 389 ? 21.105  64.822 73.518 1.00 30.11 ? 389  ASP A CA  1 
ATOM   3019 C C   . ASP A 1 389 ? 21.239  63.443 72.842 1.00 30.25 ? 389  ASP A C   1 
ATOM   3020 O O   . ASP A 1 389 ? 20.986  63.319 71.630 1.00 30.10 ? 389  ASP A O   1 
ATOM   3021 C CB  . ASP A 1 389 ? 22.432  65.593 73.390 1.00 28.02 ? 389  ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 389 ? 22.269  67.073 73.717 1.00 30.88 ? 389  ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 389 ? 21.096  67.524 73.879 1.00 28.27 ? 389  ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 389 ? 23.317  67.783 73.827 1.00 31.78 ? 389  ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 390 ? 21.626  62.429 73.625 1.00 29.20 ? 390  GLY A N   1 
ATOM   3026 C CA  . GLY A 1 390 ? 21.794  61.095 73.094 1.00 30.77 ? 390  GLY A CA  1 
ATOM   3027 C C   . GLY A 1 390 ? 20.446  60.525 72.685 1.00 32.43 ? 390  GLY A C   1 
ATOM   3028 O O   . GLY A 1 390 ? 20.304  59.899 71.619 1.00 32.29 ? 390  GLY A O   1 
ATOM   3029 N N   . LEU A 1 391 ? 19.446  60.787 73.512 1.00 31.55 ? 391  LEU A N   1 
ATOM   3030 C CA  . LEU A 1 391 ? 18.096  60.317 73.262 1.00 32.83 ? 391  LEU A CA  1 
ATOM   3031 C C   . LEU A 1 391 ? 17.532  61.009 72.006 1.00 33.28 ? 391  LEU A C   1 
ATOM   3032 O O   . LEU A 1 391 ? 16.932  60.370 71.130 1.00 34.32 ? 391  LEU A O   1 
ATOM   3033 C CB  . LEU A 1 391 ? 17.251  60.585 74.498 1.00 32.14 ? 391  LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 391 ? 16.547  59.401 75.173 1.00 36.00 ? 391  LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 391 ? 16.997  58.062 74.605 1.00 35.34 ? 391  LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 391 ? 16.693  59.488 76.708 1.00 35.20 ? 391  LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 392 ? 17.762  62.307 71.897 1.00 32.80 ? 392  ASP A N   1 
ATOM   3038 C CA  . ASP A 1 392 ? 17.312  63.066 70.737 1.00 31.94 ? 392  ASP A CA  1 
ATOM   3039 C C   . ASP A 1 392 ? 17.904  62.431 69.462 1.00 30.72 ? 392  ASP A C   1 
ATOM   3040 O O   . ASP A 1 392 ? 17.196  62.216 68.477 1.00 30.89 ? 392  ASP A O   1 
ATOM   3041 C CB  . ASP A 1 392 ? 17.724  64.541 70.925 1.00 32.34 ? 392  ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 392 ? 17.508  65.399 69.688 1.00 34.95 ? 392  ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 392 ? 16.494  65.255 68.955 1.00 34.46 ? 392  ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 392 ? 18.390  66.270 69.455 1.00 37.89 ? 392  ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 393 ? 19.185  62.099 69.481 1.00 29.33 ? 393  ASP A N   1 
ATOM   3046 C CA  . ASP A 1 393 ? 19.786  61.462 68.322 1.00 27.65 ? 393  ASP A CA  1 
ATOM   3047 C C   . ASP A 1 393 ? 19.196  60.060 68.033 1.00 28.48 ? 393  ASP A C   1 
ATOM   3048 O O   . ASP A 1 393 ? 18.932  59.700 66.864 1.00 28.68 ? 393  ASP A O   1 
ATOM   3049 C CB  . ASP A 1 393 ? 21.261  61.348 68.540 1.00 27.70 ? 393  ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 393 ? 21.954  62.659 68.357 1.00 30.59 ? 393  ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 393 ? 21.487  63.487 67.525 1.00 32.58 ? 393  ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 393 ? 22.999  62.865 69.017 1.00 33.14 ? 393  ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 394 ? 18.952  59.284 69.094 1.00 26.28 ? 394  ILE A N   1 
ATOM   3054 C CA  . ILE A 1 394 ? 18.410  57.959 68.930 1.00 26.00 ? 394  ILE A CA  1 
ATOM   3055 C C   . ILE A 1 394 ? 17.043  58.074 68.273 1.00 27.15 ? 394  ILE A C   1 
ATOM   3056 O O   . ILE A 1 394 ? 16.781  57.411 67.273 1.00 27.78 ? 394  ILE A O   1 
ATOM   3057 C CB  . ILE A 1 394 ? 18.247  57.239 70.285 1.00 25.90 ? 394  ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 394 ? 19.621  56.804 70.820 1.00 25.91 ? 394  ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 394 ? 17.254  56.058 70.140 1.00 21.58 ? 394  ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 394 ? 19.561  56.534 72.372 1.00 28.22 ? 394  ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 395 ? 16.182  58.925 68.809 1.00 26.01 ? 395  VAL A N   1 
ATOM   3062 C CA  . VAL A 1 395 ? 14.855  59.018 68.261 1.00 26.77 ? 395  VAL A CA  1 
ATOM   3063 C C   . VAL A 1 395 ? 14.853  59.504 66.827 1.00 27.15 ? 395  VAL A C   1 
ATOM   3064 O O   . VAL A 1 395 ? 14.177  58.907 65.959 1.00 26.12 ? 395  VAL A O   1 
ATOM   3065 C CB  . VAL A 1 395 ? 13.949  59.892 69.197 1.00 27.32 ? 395  VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 395 ? 12.578  60.148 68.580 1.00 21.78 ? 395  VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 395 ? 13.844  59.196 70.550 1.00 24.89 ? 395  VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 396 ? 15.629  60.566 66.587 1.00 27.59 ? 396  GLY A N   1 
ATOM   3069 C CA  . GLY A 1 396 ? 15.732  61.144 65.247 1.00 26.67 ? 396  GLY A CA  1 
ATOM   3070 C C   . GLY A 1 396 ? 16.390  60.230 64.197 1.00 26.87 ? 396  GLY A C   1 
ATOM   3071 O O   . GLY A 1 396 ? 15.910  60.127 63.042 1.00 27.64 ? 396  GLY A O   1 
ATOM   3072 N N   . ASP A 1 397 ? 17.473  59.555 64.589 1.00 26.44 ? 397  ASP A N   1 
ATOM   3073 C CA  . ASP A 1 397 ? 18.186  58.652 63.694 1.00 26.52 ? 397  ASP A CA  1 
ATOM   3074 C C   . ASP A 1 397 ? 17.283  57.495 63.324 1.00 27.46 ? 397  ASP A C   1 
ATOM   3075 O O   . ASP A 1 397 ? 17.055  57.225 62.141 1.00 28.32 ? 397  ASP A O   1 
ATOM   3076 C CB  . ASP A 1 397 ? 19.462  58.113 64.361 1.00 24.85 ? 397  ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 397 ? 20.534  59.201 64.543 1.00 26.75 ? 397  ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 397 ? 20.401  60.284 63.926 1.00 25.68 ? 397  ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 397 ? 21.516  58.986 65.291 1.00 26.29 ? 397  ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 398 ? 16.762  56.817 64.344 1.00 27.39 ? 398  HIS A N   1 
ATOM   3081 C CA  . HIS A 1 398 ? 15.917  55.653 64.127 1.00 27.88 ? 398  HIS A CA  1 
ATOM   3082 C C   . HIS A 1 398 ? 14.613  55.917 63.331 1.00 28.61 ? 398  HIS A C   1 
ATOM   3083 O O   . HIS A 1 398 ? 14.275  55.150 62.410 1.00 29.89 ? 398  HIS A O   1 
ATOM   3084 C CB  . HIS A 1 398 ? 15.546  55.003 65.457 1.00 25.42 ? 398  HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 398 ? 14.457  53.979 65.330 1.00 26.02 ? 398  HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 398 ? 14.553  52.877 64.493 1.00 24.46 ? 398  HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 398 ? 13.236  53.904 65.911 1.00 26.76 ? 398  HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 398 ? 13.443  52.174 64.565 1.00 24.08 ? 398  HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 398 ? 12.627  52.771 65.421 1.00 27.36 ? 398  HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 399 ? 13.916  56.993 63.687 1.00 26.77 ? 399  ASN A N   1 
ATOM   3091 C CA  . ASN A 1 399 ? 12.673  57.358 63.069 1.00 25.68 ? 399  ASN A CA  1 
ATOM   3092 C C   . ASN A 1 399 ? 12.690  58.198 61.796 1.00 26.42 ? 399  ASN A C   1 
ATOM   3093 O O   . ASN A 1 399 ? 11.764  58.106 61.002 1.00 26.72 ? 399  ASN A O   1 
ATOM   3094 C CB  . ASN A 1 399 ? 11.815  58.057 64.117 1.00 25.44 ? 399  ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 399 ? 11.313  57.087 65.176 1.00 26.95 ? 399  ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 399 ? 10.526  56.200 64.872 1.00 26.08 ? 399  ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 399 ? 11.789  57.237 66.424 1.00 25.56 ? 399  ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 400 ? 13.717  59.012 61.567 1.00 26.98 ? 400  VAL A N   1 
ATOM   3099 C CA  . VAL A 1 400 ? 13.660  59.902 60.413 1.00 26.49 ? 400  VAL A CA  1 
ATOM   3100 C C   . VAL A 1 400 ? 14.906  59.924 59.549 1.00 29.99 ? 400  VAL A C   1 
ATOM   3101 O O   . VAL A 1 400 ? 14.858  59.654 58.336 1.00 30.49 ? 400  VAL A O   1 
ATOM   3102 C CB  . VAL A 1 400 ? 13.462  61.356 60.882 1.00 24.07 ? 400  VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 400 ? 13.526  62.292 59.702 1.00 19.35 ? 400  VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 400 ? 12.193  61.499 61.720 1.00 20.09 ? 400  VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 401 ? 16.038  60.253 60.182 1.00 31.90 ? 401  ILE A N   1 
ATOM   3106 C CA  . ILE A 1 401 ? 17.315  60.390 59.459 1.00 31.64 ? 401  ILE A CA  1 
ATOM   3107 C C   . ILE A 1 401 ? 17.814  59.104 58.770 1.00 31.91 ? 401  ILE A C   1 
ATOM   3108 O O   . ILE A 1 401 ? 17.995  59.078 57.537 1.00 32.35 ? 401  ILE A O   1 
ATOM   3109 C CB  . ILE A 1 401 ? 18.401  61.008 60.397 1.00 30.77 ? 401  ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 401 ? 17.867  62.364 60.933 1.00 29.73 ? 401  ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 401 ? 19.736  61.138 59.659 1.00 28.79 ? 401  ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 401 ? 18.805  63.147 61.863 1.00 28.35 ? 401  ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 402 ? 18.000  58.032 59.531 1.00 31.63 ? 402  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 402 ? 18.487  56.792 58.925 1.00 30.24 ? 402  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 402 ? 17.497  56.169 57.916 1.00 29.89 ? 402  CYS A C   1 
ATOM   3116 O O   . CYS A 1 402 ? 17.927  55.612 56.893 1.00 29.10 ? 402  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 402 ? 18.923  55.839 60.041 1.00 30.93 ? 402  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 402 ? 20.396  56.563 60.870 1.00 31.77 ? 402  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 403 ? 16.165  56.233 58.185 1.00 28.53 ? 403  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 403 ? 15.240  55.663 57.177 1.00 27.74 ? 403  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 403 ? 15.375  56.552 55.891 1.00 27.96 ? 403  PRO A C   1 
ATOM   3122 O O   . PRO A 1 403 ? 15.412  56.060 54.751 1.00 28.37 ? 403  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 403 ? 13.862  55.844 57.796 1.00 26.24 ? 403  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 403 ? 14.138  55.777 59.292 1.00 28.51 ? 403  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 403 ? 15.495  56.479 59.477 1.00 27.21 ? 403  PRO A CD  1 
ATOM   3126 N N   . LEU A 1 404 ? 15.465  57.864 56.055 1.00 27.34 ? 404  LEU A N   1 
ATOM   3127 C CA  . LEU A 1 404 ? 15.588  58.694 54.861 1.00 27.92 ? 404  LEU A CA  1 
ATOM   3128 C C   . LEU A 1 404 ? 16.951  58.440 54.125 1.00 29.08 ? 404  LEU A C   1 
ATOM   3129 O O   . LEU A 1 404 ? 16.992  58.385 52.874 1.00 29.03 ? 404  LEU A O   1 
ATOM   3130 C CB  . LEU A 1 404 ? 15.402  60.171 55.238 1.00 26.55 ? 404  LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 404 ? 15.512  61.257 54.135 1.00 28.76 ? 404  LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 404 ? 14.610  62.519 54.462 1.00 29.06 ? 404  LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 404 ? 16.982  61.680 53.991 1.00 25.92 ? 404  LEU A CD2 1 
ATOM   3134 N N   . MET A 1 405 ? 18.046  58.290 54.887 1.00 26.88 ? 405  MET A N   1 
ATOM   3135 C CA  . MET A 1 405 ? 19.318  58.024 54.265 1.00 27.81 ? 405  MET A CA  1 
ATOM   3136 C C   . MET A 1 405 ? 19.219  56.677 53.523 1.00 28.30 ? 405  MET A C   1 
ATOM   3137 O O   . MET A 1 405 ? 19.767  56.528 52.412 1.00 28.43 ? 405  MET A O   1 
ATOM   3138 C CB  . MET A 1 405 ? 20.482  58.023 55.291 1.00 26.35 ? 405  MET A CB  1 
ATOM   3139 C CG  . MET A 1 405 ? 20.768  59.424 55.818 1.00 24.78 ? 405  MET A CG  1 
ATOM   3140 S SD  . MET A 1 405 ? 20.830  60.677 54.476 1.00 31.03 ? 405  MET A SD  1 
ATOM   3141 C CE  . MET A 1 405 ? 22.234  59.947 53.462 1.00 22.69 ? 405  MET A CE  1 
ATOM   3142 N N   . HIS A 1 406 ? 18.505  55.711 54.095 1.00 28.06 ? 406  HIS A N   1 
ATOM   3143 C CA  . HIS A 1 406 ? 18.343  54.422 53.395 1.00 29.03 ? 406  HIS A CA  1 
ATOM   3144 C C   . HIS A 1 406 ? 17.555  54.661 52.099 1.00 29.63 ? 406  HIS A C   1 
ATOM   3145 O O   . HIS A 1 406 ? 17.929  54.175 51.018 1.00 30.16 ? 406  HIS A O   1 
ATOM   3146 C CB  . HIS A 1 406 ? 17.608  53.387 54.256 1.00 30.22 ? 406  HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 406 ? 17.376  52.070 53.562 1.00 33.10 ? 406  HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 406 ? 18.389  51.150 53.326 1.00 33.68 ? 406  HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 406 ? 16.238  51.504 53.088 1.00 31.51 ? 406  HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 406 ? 17.883  50.080 52.740 1.00 31.97 ? 406  HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 406 ? 16.581  50.269 52.586 1.00 33.92 ? 406  HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 407 ? 16.477  55.420 52.197 1.00 28.93 ? 407  PHE A N   1 
ATOM   3153 C CA  . PHE A 1 407 ? 15.680  55.702 51.004 1.00 29.39 ? 407  PHE A CA  1 
ATOM   3154 C C   . PHE A 1 407 ? 16.502  56.474 49.937 1.00 30.95 ? 407  PHE A C   1 
ATOM   3155 O O   . PHE A 1 407 ? 16.451  56.111 48.763 1.00 30.09 ? 407  PHE A O   1 
ATOM   3156 C CB  . PHE A 1 407 ? 14.443  56.529 51.374 1.00 26.73 ? 407  PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 407 ? 13.709  57.044 50.202 1.00 26.77 ? 407  PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 407 ? 12.890  56.204 49.452 1.00 27.55 ? 407  PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 407 ? 13.836  58.380 49.821 1.00 26.67 ? 407  PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 407 ? 12.188  56.689 48.328 1.00 25.67 ? 407  PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 407 ? 13.150  58.878 48.708 1.00 27.58 ? 407  PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 407 ? 12.306  58.012 47.955 1.00 26.49 ? 407  PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 408 ? 17.251  57.516 50.319 1.00 30.38 ? 408  VAL A N   1 
ATOM   3164 C CA  . VAL A 1 408 ? 17.962  58.255 49.282 1.00 33.96 ? 408  VAL A CA  1 
ATOM   3165 C C   . VAL A 1 408 ? 19.043  57.429 48.602 1.00 35.16 ? 408  VAL A C   1 
ATOM   3166 O O   . VAL A 1 408 ? 19.276  57.558 47.396 1.00 35.24 ? 408  VAL A O   1 
ATOM   3167 C CB  . VAL A 1 408 ? 18.615  59.615 49.797 1.00 35.50 ? 408  VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 408 ? 19.486  59.368 50.979 1.00 35.48 ? 408  VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 408 ? 19.474  60.256 48.678 1.00 36.04 ? 408  VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 409 ? 19.719  56.591 49.371 1.00 35.96 ? 409  ASN A N   1 
ATOM   3171 C CA  . ASN A 1 409 ? 20.745  55.764 48.784 1.00 35.34 ? 409  ASN A CA  1 
ATOM   3172 C C   . ASN A 1 409 ? 20.098  54.766 47.845 1.00 35.99 ? 409  ASN A C   1 
ATOM   3173 O O   . ASN A 1 409 ? 20.619  54.520 46.763 1.00 35.16 ? 409  ASN A O   1 
ATOM   3174 C CB  . ASN A 1 409 ? 21.565  55.113 49.881 1.00 35.55 ? 409  ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 409 ? 22.777  55.986 50.267 1.00 38.38 ? 409  ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 409 ? 23.686  56.157 49.437 1.00 41.55 ? 409  ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 409 ? 22.794  56.557 51.495 1.00 33.77 ? 409  ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 410 ? 18.940  54.228 48.205 1.00 34.84 ? 410  LYS A N   1 
ATOM   3179 C CA  . LYS A 1 410 ? 18.283  53.280 47.317 1.00 36.25 ? 410  LYS A CA  1 
ATOM   3180 C C   . LYS A 1 410 ? 17.705  53.946 46.062 1.00 37.58 ? 410  LYS A C   1 
ATOM   3181 O O   . LYS A 1 410 ? 17.801  53.406 44.956 1.00 37.98 ? 410  LYS A O   1 
ATOM   3182 C CB  . LYS A 1 410 ? 17.140  52.579 48.035 1.00 38.04 ? 410  LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 410 ? 17.573  51.625 49.111 1.00 40.59 ? 410  LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 410 ? 18.440  50.552 48.494 1.00 41.09 ? 410  LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 410 ? 18.357  49.269 49.286 1.00 43.08 ? 410  LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 410 ? 19.249  48.239 48.669 1.00 42.96 ? 410  LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 411 ? 17.092  55.114 46.238 1.00 36.77 ? 411  TYR A N   1 
ATOM   3188 C CA  . TYR A 1 411 ? 16.477  55.821 45.137 1.00 36.04 ? 411  TYR A CA  1 
ATOM   3189 C C   . TYR A 1 411 ? 17.515  56.255 44.115 1.00 36.76 ? 411  TYR A C   1 
ATOM   3190 O O   . TYR A 1 411 ? 17.301  56.103 42.888 1.00 36.64 ? 411  TYR A O   1 
ATOM   3191 C CB  . TYR A 1 411 ? 15.739  57.081 45.623 1.00 34.04 ? 411  TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 411 ? 14.918  57.738 44.531 1.00 33.12 ? 411  TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 411 ? 13.628  57.292 44.245 1.00 32.95 ? 411  TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 411 ? 15.446  58.781 43.739 1.00 33.56 ? 411  TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 411 ? 12.870  57.857 43.193 1.00 32.78 ? 411  TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 411 ? 14.699  59.342 42.690 1.00 32.05 ? 411  TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 411 ? 13.403  58.854 42.423 1.00 33.22 ? 411  TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 411 ? 12.670  59.281 41.320 1.00 33.78 ? 411  TYR A OH  1 
ATOM   3199 N N   . THR A 1 412 ? 18.620  56.804 44.620 1.00 35.70 ? 412  THR A N   1 
ATOM   3200 C CA  . THR A 1 412 ? 19.676  57.328 43.762 1.00 35.45 ? 412  THR A CA  1 
ATOM   3201 C C   . THR A 1 412 ? 20.248  56.310 42.776 1.00 36.24 ? 412  THR A C   1 
ATOM   3202 O O   . THR A 1 412 ? 20.655  56.669 41.678 1.00 34.63 ? 412  THR A O   1 
ATOM   3203 C CB  . THR A 1 412 ? 20.773  58.001 44.631 1.00 35.04 ? 412  THR A CB  1 
ATOM   3204 O OG1 . THR A 1 412 ? 20.195  59.156 45.266 1.00 36.26 ? 412  THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 412 ? 21.961  58.447 43.802 1.00 31.84 ? 412  THR A CG2 1 
ATOM   3206 N N   . LYS A 1 413 ? 20.222  55.038 43.144 1.00 36.59 ? 413  LYS A N   1 
ATOM   3207 C CA  . LYS A 1 413 ? 20.701  54.033 42.229 1.00 38.54 ? 413  LYS A CA  1 
ATOM   3208 C C   . LYS A 1 413 ? 19.884  53.989 40.929 1.00 38.69 ? 413  LYS A C   1 
ATOM   3209 O O   . LYS A 1 413 ? 20.410  53.522 39.927 1.00 38.82 ? 413  LYS A O   1 
ATOM   3210 C CB  . LYS A 1 413 ? 20.703  52.639 42.897 1.00 41.34 ? 413  LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 413 ? 20.886  51.501 41.910 1.00 45.20 ? 413  LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 413 ? 21.033  50.098 42.578 1.00 49.90 ? 413  LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 413 ? 21.264  48.970 41.492 1.00 50.54 ? 413  LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 413 ? 20.962  47.554 41.940 1.00 51.39 ? 413  LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 414 ? 18.625  54.456 40.925 1.00 37.05 ? 414  PHE A N   1 
ATOM   3216 C CA  . PHE A 1 414 ? 17.790  54.429 39.708 1.00 35.33 ? 414  PHE A CA  1 
ATOM   3217 C C   . PHE A 1 414 ? 17.198  55.787 39.280 1.00 35.23 ? 414  PHE A C   1 
ATOM   3218 O O   . PHE A 1 414 ? 16.629  55.931 38.166 1.00 32.71 ? 414  PHE A O   1 
ATOM   3219 C CB  . PHE A 1 414 ? 16.586  53.517 39.890 1.00 36.52 ? 414  PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 414 ? 16.912  52.073 40.095 1.00 37.15 ? 414  PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 414 ? 16.922  51.181 39.012 1.00 37.10 ? 414  PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 414 ? 17.124  51.578 41.372 1.00 36.66 ? 414  PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 414 ? 17.127  49.817 39.214 1.00 36.43 ? 414  PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 414 ? 17.329  50.221 41.594 1.00 37.65 ? 414  PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 414 ? 17.327  49.339 40.517 1.00 39.31 ? 414  PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 415 ? 17.318  56.774 40.159 1.00 34.71 ? 415  GLY A N   1 
ATOM   3227 C CA  . GLY A 1 415 ? 16.717  58.076 39.897 1.00 34.03 ? 415  GLY A CA  1 
ATOM   3228 C C   . GLY A 1 415 ? 17.418  58.943 38.874 1.00 32.92 ? 415  GLY A C   1 
ATOM   3229 O O   . GLY A 1 415 ? 18.427  58.571 38.322 1.00 31.75 ? 415  GLY A O   1 
ATOM   3230 N N   . ASN A 1 416 ? 16.887  60.127 38.642 1.00 33.74 ? 416  ASN A N   1 
ATOM   3231 C CA  . ASN A 1 416 ? 17.476  60.992 37.650 1.00 35.96 ? 416  ASN A CA  1 
ATOM   3232 C C   . ASN A 1 416 ? 18.100  62.238 38.263 1.00 35.38 ? 416  ASN A C   1 
ATOM   3233 O O   . ASN A 1 416 ? 18.400  63.200 37.566 1.00 35.32 ? 416  ASN A O   1 
ATOM   3234 C CB  . ASN A 1 416 ? 16.404  61.330 36.559 1.00 38.48 ? 416  ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 416 ? 16.994  62.069 35.374 1.00 43.45 ? 416  ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 416 ? 16.487  63.132 34.997 1.00 45.14 ? 416  ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 416 ? 18.072  61.536 34.798 1.00 46.44 ? 416  ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 417 ? 18.348  62.197 39.568 1.00 35.86 ? 417  GLY A N   1 
ATOM   3239 C CA  . GLY A 1 417 ? 18.958  63.341 40.236 1.00 35.28 ? 417  GLY A CA  1 
ATOM   3240 C C   . GLY A 1 417 ? 18.412  63.517 41.642 1.00 35.59 ? 417  GLY A C   1 
ATOM   3241 O O   . GLY A 1 417 ? 17.189  63.576 41.839 1.00 35.07 ? 417  GLY A O   1 
ATOM   3242 N N   . THR A 1 418 ? 19.331  63.626 42.598 1.00 34.63 ? 418  THR A N   1 
ATOM   3243 C CA  . THR A 1 418 ? 18.997  63.745 43.993 1.00 34.03 ? 418  THR A CA  1 
ATOM   3244 C C   . THR A 1 418 ? 19.748  64.925 44.557 1.00 35.22 ? 418  THR A C   1 
ATOM   3245 O O   . THR A 1 418 ? 20.913  65.125 44.208 1.00 35.46 ? 418  THR A O   1 
ATOM   3246 C CB  . THR A 1 418 ? 19.509  62.476 44.780 1.00 34.61 ? 418  THR A CB  1 
ATOM   3247 O OG1 . THR A 1 418 ? 18.995  61.269 44.172 1.00 32.75 ? 418  THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 418 ? 19.151  62.544 46.231 1.00 29.43 ? 418  THR A CG2 1 
ATOM   3249 N N   . TYR A 1 419 ? 19.090  65.700 45.423 1.00 34.97 ? 419  TYR A N   1 
ATOM   3250 C CA  . TYR A 1 419 ? 19.718  66.814 46.134 1.00 33.70 ? 419  TYR A CA  1 
ATOM   3251 C C   . TYR A 1 419 ? 19.349  66.634 47.616 1.00 34.86 ? 419  TYR A C   1 
ATOM   3252 O O   . TYR A 1 419 ? 18.151  66.516 47.962 1.00 37.38 ? 419  TYR A O   1 
ATOM   3253 C CB  . TYR A 1 419 ? 19.245  68.159 45.608 1.00 33.33 ? 419  TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 419 ? 19.694  68.384 44.172 1.00 34.81 ? 419  TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 419 ? 18.948  67.854 43.086 1.00 33.18 ? 419  TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 419 ? 20.851  69.093 43.892 1.00 32.18 ? 419  TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 419 ? 19.340  68.028 41.777 1.00 32.78 ? 419  TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 419 ? 21.249  69.274 42.577 1.00 34.74 ? 419  TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 419 ? 20.490  68.742 41.518 1.00 34.95 ? 419  TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 419 ? 20.888  68.918 40.204 1.00 34.57 ? 419  TYR A OH  1 
ATOM   3261 N N   . LEU A 1 420 ? 20.374  66.595 48.478 1.00 32.72 ? 420  LEU A N   1 
ATOM   3262 C CA  . LEU A 1 420 ? 20.213  66.359 49.903 1.00 29.63 ? 420  LEU A CA  1 
ATOM   3263 C C   . LEU A 1 420 ? 20.632  67.542 50.797 1.00 29.23 ? 420  LEU A C   1 
ATOM   3264 O O   . LEU A 1 420 ? 21.672  68.184 50.584 1.00 27.83 ? 420  LEU A O   1 
ATOM   3265 C CB  . LEU A 1 420 ? 21.032  65.120 50.250 1.00 28.79 ? 420  LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 420 ? 20.924  64.615 51.687 1.00 31.19 ? 420  LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 420 ? 19.426  64.410 52.008 1.00 30.74 ? 420  LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 420 ? 21.734  63.308 51.899 1.00 29.78 ? 420  LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 421 ? 19.838  67.815 51.819 1.00 29.16 ? 421  TYR A N   1 
ATOM   3270 C CA  . TYR A 1 421 ? 20.155  68.922 52.715 1.00 30.94 ? 421  TYR A CA  1 
ATOM   3271 C C   . TYR A 1 421 ? 20.080  68.525 54.175 1.00 31.96 ? 421  TYR A C   1 
ATOM   3272 O O   . TYR A 1 421 ? 19.425  67.534 54.537 1.00 31.52 ? 421  TYR A O   1 
ATOM   3273 C CB  . TYR A 1 421 ? 19.209  70.114 52.494 1.00 29.47 ? 421  TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 421 ? 17.802  69.883 52.979 1.00 29.61 ? 421  TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 421 ? 17.475  70.032 54.344 1.00 28.72 ? 421  TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 421 ? 16.778  69.512 52.079 1.00 28.49 ? 421  TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 421 ? 16.177  69.815 54.792 1.00 28.62 ? 421  TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 421 ? 15.465  69.303 52.521 1.00 25.84 ? 421  TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 421 ? 15.175  69.450 53.856 1.00 27.83 ? 421  TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 421 ? 13.887  69.266 54.289 1.00 28.67 ? 421  TYR A OH  1 
ATOM   3281 N N   . PHE A 1 422 ? 20.737  69.326 55.012 1.00 31.33 ? 422  PHE A N   1 
ATOM   3282 C CA  . PHE A 1 422 ? 20.739  69.067 56.420 1.00 31.86 ? 422  PHE A CA  1 
ATOM   3283 C C   . PHE A 1 422 ? 20.565  70.457 56.967 1.00 33.01 ? 422  PHE A C   1 
ATOM   3284 O O   . PHE A 1 422 ? 21.507  71.259 56.983 1.00 34.34 ? 422  PHE A O   1 
ATOM   3285 C CB  . PHE A 1 422 ? 22.071  68.440 56.865 1.00 31.49 ? 422  PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 422 ? 22.157  68.201 58.364 1.00 31.11 ? 422  PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 422 ? 21.624  67.036 58.936 1.00 29.95 ? 422  PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 422 ? 22.786  69.155 59.211 1.00 28.62 ? 422  PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 422 ? 21.725  66.806 60.365 1.00 32.65 ? 422  PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 422 ? 22.892  68.942 60.615 1.00 29.11 ? 422  PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 422 ? 22.368  67.772 61.204 1.00 29.79 ? 422  PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 423 ? 19.350  70.727 57.427 1.00 32.42 ? 423  PHE A N   1 
ATOM   3293 C CA  . PHE A 1 423 ? 18.957  72.020 57.932 1.00 32.63 ? 423  PHE A CA  1 
ATOM   3294 C C   . PHE A 1 423 ? 19.235  72.139 59.429 1.00 35.12 ? 423  PHE A C   1 
ATOM   3295 O O   . PHE A 1 423 ? 18.642  71.405 60.257 1.00 34.99 ? 423  PHE A O   1 
ATOM   3296 C CB  . PHE A 1 423 ? 17.475  72.226 57.610 1.00 31.09 ? 423  PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 423 ? 16.900  73.484 58.143 1.00 30.53 ? 423  PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 423 ? 16.871  74.624 57.370 1.00 28.74 ? 423  PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 423 ? 16.398  73.531 59.452 1.00 29.49 ? 423  PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 423 ? 16.347  75.818 57.891 1.00 30.85 ? 423  PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 423 ? 15.883  74.720 59.981 1.00 29.46 ? 423  PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 423 ? 15.854  75.869 59.210 1.00 28.80 ? 423  PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 424 ? 20.130  73.069 59.778 1.00 35.94 ? 424  ASN A N   1 
ATOM   3304 C CA  . ASN A 1 424 ? 20.492  73.254 61.164 1.00 38.37 ? 424  ASN A CA  1 
ATOM   3305 C C   . ASN A 1 424 ? 20.573  74.686 61.632 1.00 39.54 ? 424  ASN A C   1 
ATOM   3306 O O   . ASN A 1 424 ? 21.351  74.985 62.535 1.00 39.69 ? 424  ASN A O   1 
ATOM   3307 C CB  . ASN A 1 424 ? 21.799  72.525 61.503 1.00 36.77 ? 424  ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 424 ? 22.996  73.050 60.721 1.00 38.91 ? 424  ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 424 ? 22.869  73.819 59.792 1.00 38.98 ? 424  ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 424 ? 24.181  72.596 61.099 1.00 40.37 ? 424  ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 425 ? 19.760  75.560 61.052 1.00 40.90 ? 425  HIS A N   1 
ATOM   3312 C CA  . HIS A 1 425 ? 19.761  76.924 61.510 1.00 43.09 ? 425  HIS A CA  1 
ATOM   3313 C C   . HIS A 1 425 ? 19.120  76.991 62.884 1.00 46.26 ? 425  HIS A C   1 
ATOM   3314 O O   . HIS A 1 425 ? 18.026  76.484 63.145 1.00 44.02 ? 425  HIS A O   1 
ATOM   3315 C CB  . HIS A 1 425 ? 19.009  77.901 60.595 1.00 41.99 ? 425  HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 425 ? 18.919  79.298 61.169 1.00 41.53 ? 425  HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 425 ? 20.037  80.059 61.470 1.00 40.29 ? 425  HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 425 ? 17.856  80.016 61.600 1.00 39.91 ? 425  HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 425 ? 19.662  81.173 62.070 1.00 39.14 ? 425  HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 425 ? 18.346  81.172 62.160 1.00 38.99 ? 425  HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 426 ? 19.856  77.675 63.743 1.00 51.42 ? 426  ARG A N   1 
ATOM   3322 C CA  . ARG A 1 426 ? 19.520  77.918 65.141 1.00 56.84 ? 426  ARG A CA  1 
ATOM   3323 C C   . ARG A 1 426 ? 18.580  79.168 65.178 1.00 56.73 ? 426  ARG A C   1 
ATOM   3324 O O   . ARG A 1 426 ? 19.038  80.292 64.991 1.00 57.02 ? 426  ARG A O   1 
ATOM   3325 C CB  . ARG A 1 426 ? 20.888  78.136 65.883 1.00 59.69 ? 426  ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 426 ? 20.961  77.815 67.405 1.00 64.30 ? 426  ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 426 ? 20.513  79.011 68.283 1.00 67.79 ? 426  ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 426 ? 20.223  78.646 69.679 1.00 70.83 ? 426  ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 426 ? 19.545  79.423 70.538 1.00 72.72 ? 426  ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 426 ? 19.084  80.618 70.144 1.00 72.31 ? 426  ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 426 ? 19.318  79.005 71.791 1.00 72.07 ? 426  ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 427 ? 17.280  78.969 65.375 1.00 57.61 ? 427  ALA A N   1 
ATOM   3333 C CA  . ALA A 1 427 ? 16.342  80.097 65.424 1.00 59.57 ? 427  ALA A CA  1 
ATOM   3334 C C   . ALA A 1 427 ? 16.821  81.201 66.367 1.00 62.26 ? 427  ALA A C   1 
ATOM   3335 O O   . ALA A 1 427 ? 17.360  80.916 67.461 1.00 63.18 ? 427  ALA A O   1 
ATOM   3336 C CB  . ALA A 1 427 ? 14.967  79.647 65.881 1.00 56.77 ? 427  ALA A CB  1 
ATOM   3337 N N   . SER A 1 428 ? 16.620  82.458 65.946 1.00 63.61 ? 428  SER A N   1 
ATOM   3338 C CA  . SER A 1 428 ? 16.995  83.624 66.757 1.00 63.76 ? 428  SER A CA  1 
ATOM   3339 C C   . SER A 1 428 ? 15.807  83.847 67.680 1.00 62.95 ? 428  SER A C   1 
ATOM   3340 O O   . SER A 1 428 ? 15.949  84.292 68.799 1.00 62.54 ? 428  SER A O   1 
ATOM   3341 C CB  . SER A 1 428 ? 17.210  84.852 65.875 1.00 63.89 ? 428  SER A CB  1 
ATOM   3342 O OG  . SER A 1 428 ? 15.969  85.263 65.317 1.00 67.02 ? 428  SER A OG  1 
ATOM   3343 N N   . ASN A 1 429 ? 14.634  83.483 67.193 1.00 63.74 ? 429  ASN A N   1 
ATOM   3344 C CA  . ASN A 1 429 ? 13.393  83.621 67.951 1.00 64.96 ? 429  ASN A CA  1 
ATOM   3345 C C   . ASN A 1 429 ? 12.931  82.250 68.497 1.00 63.57 ? 429  ASN A C   1 
ATOM   3346 O O   . ASN A 1 429 ? 11.987  81.612 67.963 1.00 62.66 ? 429  ASN A O   1 
ATOM   3347 C CB  . ASN A 1 429 ? 12.321  84.257 67.029 1.00 68.80 ? 429  ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 429 ? 10.895  84.099 67.563 1.00 72.19 ? 429  ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 429 ? 10.633  84.276 68.774 1.00 74.68 ? 429  ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 429 ? 9.959   83.779 66.653 1.00 73.04 ? 429  ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 430 ? 13.607  81.782 69.552 1.00 61.31 ? 430  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 430 ? 13.245  80.485 70.131 1.00 58.43 ? 430  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 430 ? 11.841  80.588 70.722 1.00 55.39 ? 430  LEU A C   1 
ATOM   3354 O O   . LEU A 1 430 ? 11.560  81.551 71.435 1.00 56.28 ? 430  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 430 ? 14.209  80.067 71.257 1.00 58.54 ? 430  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 430 ? 15.692  79.679 71.134 1.00 59.62 ? 430  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 430 ? 16.078  79.164 72.549 1.00 60.74 ? 430  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 430 ? 15.987  78.585 70.078 1.00 58.16 ? 430  LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 431 ? 10.951  79.648 70.401 1.00 50.89 ? 431  VAL A N   1 
ATOM   3360 C CA  . VAL A 1 431 ? 9.630   79.655 71.029 1.00 47.19 ? 431  VAL A CA  1 
ATOM   3361 C C   . VAL A 1 431 ? 9.585   78.386 71.910 1.00 44.75 ? 431  VAL A C   1 
ATOM   3362 O O   . VAL A 1 431 ? 9.061   78.395 73.027 1.00 43.47 ? 431  VAL A O   1 
ATOM   3363 C CB  . VAL A 1 431 ? 8.499   79.729 69.957 1.00 48.42 ? 431  VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 431 ? 9.134   79.627 68.544 1.00 48.45 ? 431  VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 431 ? 7.402   78.674 70.220 1.00 46.93 ? 431  VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 432 ? 10.188  77.302 71.410 1.00 42.16 ? 432  TRP A N   1 
ATOM   3367 C CA  . TRP A 1 432 ? 10.280  76.039 72.172 1.00 38.45 ? 432  TRP A CA  1 
ATOM   3368 C C   . TRP A 1 432 ? 11.582  76.140 73.003 1.00 36.76 ? 432  TRP A C   1 
ATOM   3369 O O   . TRP A 1 432 ? 12.481  76.915 72.669 1.00 35.87 ? 432  TRP A O   1 
ATOM   3370 C CB  . TRP A 1 432 ? 10.326  74.805 71.233 1.00 34.21 ? 432  TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 432 ? 8.990   74.447 70.598 1.00 30.49 ? 432  TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 432 ? 8.522   74.849 69.375 1.00 28.63 ? 432  TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 432 ? 7.954   73.638 71.172 1.00 28.36 ? 432  TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 432 ? 7.253   74.345 69.153 1.00 26.83 ? 432  TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 432 ? 6.882   73.597 70.235 1.00 27.65 ? 432  TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 432 ? 7.823   72.955 72.378 1.00 28.28 ? 432  TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 432 ? 5.698   72.899 70.473 1.00 28.46 ? 432  TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 432 ? 6.615   72.240 72.631 1.00 30.26 ? 432  TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 432 ? 5.574   72.229 71.672 1.00 30.43 ? 432  TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 433 ? 11.692  75.383 74.100 1.00 35.82 ? 433  PRO A N   1 
ATOM   3381 C CA  . PRO A 1 433 ? 12.960  75.541 74.837 1.00 35.84 ? 433  PRO A CA  1 
ATOM   3382 C C   . PRO A 1 433 ? 14.174  75.303 73.951 1.00 37.56 ? 433  PRO A C   1 
ATOM   3383 O O   . PRO A 1 433 ? 14.099  74.629 72.888 1.00 36.48 ? 433  PRO A O   1 
ATOM   3384 C CB  . PRO A 1 433 ? 12.857  74.498 75.963 1.00 36.07 ? 433  PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 433 ? 11.883  73.453 75.403 1.00 34.41 ? 433  PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 433 ? 10.862  74.299 74.656 1.00 33.07 ? 433  PRO A CD  1 
ATOM   3387 N N   . GLU A 1 434 ? 15.300  75.820 74.413 1.00 39.56 ? 434  GLU A N   1 
ATOM   3388 C CA  . GLU A 1 434 ? 16.546  75.702 73.685 1.00 40.90 ? 434  GLU A CA  1 
ATOM   3389 C C   . GLU A 1 434 ? 17.081  74.267 73.573 1.00 39.46 ? 434  GLU A C   1 
ATOM   3390 O O   . GLU A 1 434 ? 17.701  73.888 72.552 1.00 38.22 ? 434  GLU A O   1 
ATOM   3391 C CB  . GLU A 1 434 ? 17.611  76.590 74.325 1.00 45.10 ? 434  GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 434 ? 18.840  76.562 73.470 1.00 52.79 ? 434  GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 434 ? 20.041  77.306 74.034 1.00 58.21 ? 434  GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 434 ? 21.083  77.335 73.313 1.00 60.41 ? 434  GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 434 ? 19.955  77.847 75.172 1.00 60.82 ? 434  GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 435 ? 16.847  73.452 74.598 1.00 37.71 ? 435  TRP A N   1 
ATOM   3397 C CA  . TRP A 1 435 ? 17.359  72.093 74.522 1.00 37.52 ? 435  TRP A CA  1 
ATOM   3398 C C   . TRP A 1 435 ? 16.780  71.279 73.327 1.00 37.12 ? 435  TRP A C   1 
ATOM   3399 O O   . TRP A 1 435 ? 17.388  70.289 72.883 1.00 36.55 ? 435  TRP A O   1 
ATOM   3400 C CB  . TRP A 1 435 ? 17.134  71.335 75.851 1.00 36.84 ? 435  TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 435 ? 15.697  71.001 76.185 1.00 37.37 ? 435  TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 435 ? 14.859  71.718 76.986 1.00 38.51 ? 435  TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 435 ? 14.933  69.866 75.729 1.00 36.54 ? 435  TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 435 ? 13.618  71.100 77.062 1.00 37.19 ? 435  TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 435 ? 13.639  69.971 76.297 1.00 35.44 ? 435  TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 435 ? 15.218  68.772 74.896 1.00 37.20 ? 435  TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 435 ? 12.633  69.036 76.057 1.00 36.76 ? 435  TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 435 ? 14.208  67.824 74.655 1.00 36.65 ? 435  TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 435 ? 12.936  67.966 75.232 1.00 37.69 ? 435  TRP A CH2 1 
ATOM   3410 N N   . MET A 1 436 ? 15.619  71.682 72.814 1.00 35.65 ? 436  MET A N   1 
ATOM   3411 C CA  . MET A 1 436 ? 15.009  70.960 71.700 1.00 34.88 ? 436  MET A CA  1 
ATOM   3412 C C   . MET A 1 436 ? 15.736  71.240 70.381 1.00 34.25 ? 436  MET A C   1 
ATOM   3413 O O   . MET A 1 436 ? 15.551  70.534 69.385 1.00 34.34 ? 436  MET A O   1 
ATOM   3414 C CB  . MET A 1 436 ? 13.505  71.294 71.598 1.00 34.84 ? 436  MET A CB  1 
ATOM   3415 C CG  . MET A 1 436 ? 12.699  70.805 72.807 1.00 31.42 ? 436  MET A CG  1 
ATOM   3416 S SD  . MET A 1 436 ? 10.945  71.291 72.797 1.00 33.95 ? 436  MET A SD  1 
ATOM   3417 C CE  . MET A 1 436 ? 10.272  69.886 71.657 1.00 30.37 ? 436  MET A CE  1 
ATOM   3418 N N   . GLY A 1 437 ? 16.597  72.259 70.366 1.00 33.93 ? 437  GLY A N   1 
ATOM   3419 C CA  . GLY A 1 437 ? 17.372  72.534 69.146 1.00 29.73 ? 437  GLY A CA  1 
ATOM   3420 C C   . GLY A 1 437 ? 16.576  72.879 67.896 1.00 28.84 ? 437  GLY A C   1 
ATOM   3421 O O   . GLY A 1 437 ? 15.539  73.550 67.990 1.00 28.15 ? 437  GLY A O   1 
ATOM   3422 N N   . VAL A 1 438 ? 17.074  72.446 66.735 1.00 27.38 ? 438  VAL A N   1 
ATOM   3423 C CA  . VAL A 1 438 ? 16.439  72.706 65.447 1.00 28.17 ? 438  VAL A CA  1 
ATOM   3424 C C   . VAL A 1 438 ? 15.340  71.601 65.252 1.00 30.60 ? 438  VAL A C   1 
ATOM   3425 O O   . VAL A 1 438 ? 15.539  70.555 64.601 1.00 28.81 ? 438  VAL A O   1 
ATOM   3426 C CB  . VAL A 1 438 ? 17.498  72.630 64.347 1.00 27.48 ? 438  VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 438 ? 16.913  73.071 62.990 1.00 24.89 ? 438  VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 438 ? 18.735  73.430 64.773 1.00 24.88 ? 438  VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 439 ? 14.201  71.864 65.882 1.00 31.02 ? 439  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 439 ? 13.045  70.992 65.911 1.00 33.08 ? 439  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 439 ? 12.366  70.757 64.578 1.00 33.36 ? 439  ILE A C   1 
ATOM   3432 O O   . ILE A 1 439 ? 12.453  71.546 63.605 1.00 30.86 ? 439  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 439 ? 11.933  71.591 66.814 1.00 35.75 ? 439  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 439 ? 12.463  71.895 68.197 1.00 39.45 ? 439  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 439 ? 10.817  70.625 67.034 1.00 35.47 ? 439  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 439 ? 11.257  72.082 69.176 1.00 44.19 ? 439  ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 440 ? 11.626  69.665 64.567 1.00 33.87 ? 440  HIS A N   1 
ATOM   3438 C CA  . HIS A 1 440 ? 10.802  69.347 63.412 1.00 36.04 ? 440  HIS A CA  1 
ATOM   3439 C C   . HIS A 1 440 ? 10.050  70.566 62.929 1.00 35.97 ? 440  HIS A C   1 
ATOM   3440 O O   . HIS A 1 440 ? 9.553   71.366 63.735 1.00 36.73 ? 440  HIS A O   1 
ATOM   3441 C CB  . HIS A 1 440 ? 9.730   68.377 63.811 1.00 35.89 ? 440  HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 440 ? 10.036  66.973 63.451 1.00 37.66 ? 440  HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 440 ? 10.557  66.081 64.358 1.00 36.05 ? 440  HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 440 ? 9.790   66.278 62.315 1.00 37.68 ? 440  HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 440 ? 10.601  64.884 63.797 1.00 39.62 ? 440  HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 440 ? 10.136  64.979 62.560 1.00 38.71 ? 440  HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 441 ? 9.937   70.705 61.627 1.00 36.27 ? 441  GLY A N   1 
ATOM   3448 C CA  . GLY A 1 441 ? 9.117   71.787 61.119 1.00 37.35 ? 441  GLY A CA  1 
ATOM   3449 C C   . GLY A 1 441 ? 9.599   73.205 61.154 1.00 37.63 ? 441  GLY A C   1 
ATOM   3450 O O   . GLY A 1 441 ? 8.952   74.045 60.567 1.00 38.67 ? 441  GLY A O   1 
ATOM   3451 N N   . TYR A 1 442 ? 10.701  73.504 61.819 1.00 39.20 ? 442  TYR A N   1 
ATOM   3452 C CA  . TYR A 1 442 ? 11.173  74.887 61.835 1.00 39.86 ? 442  TYR A CA  1 
ATOM   3453 C C   . TYR A 1 442 ? 11.551  75.334 60.434 1.00 38.38 ? 442  TYR A C   1 
ATOM   3454 O O   . TYR A 1 442 ? 11.353  76.495 60.104 1.00 39.64 ? 442  TYR A O   1 
ATOM   3455 C CB  . TYR A 1 442 ? 12.353  75.044 62.817 1.00 45.43 ? 442  TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 442 ? 13.054  76.407 62.856 1.00 50.38 ? 442  TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 442 ? 12.310  77.606 62.859 1.00 52.24 ? 442  TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 442 ? 14.453  76.493 62.944 1.00 51.37 ? 442  TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 442 ? 12.930  78.841 62.952 1.00 54.85 ? 442  TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 442 ? 15.099  77.737 63.044 1.00 54.21 ? 442  TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 442 ? 14.333  78.914 63.052 1.00 56.18 ? 442  TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 442 ? 14.937  80.167 63.218 1.00 56.78 ? 442  TYR A OH  1 
ATOM   3463 N N   . GLU A 1 443 ? 12.062  74.430 59.593 1.00 37.23 ? 443  GLU A N   1 
ATOM   3464 C CA  . GLU A 1 443 ? 12.417  74.773 58.197 1.00 34.90 ? 443  GLU A CA  1 
ATOM   3465 C C   . GLU A 1 443 ? 11.144  75.118 57.348 1.00 35.01 ? 443  GLU A C   1 
ATOM   3466 O O   . GLU A 1 443 ? 11.239  75.828 56.335 1.00 35.32 ? 443  GLU A O   1 
ATOM   3467 C CB  . GLU A 1 443 ? 13.165  73.605 57.504 1.00 33.54 ? 443  GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 443 ? 12.203  72.566 56.772 1.00 31.46 ? 443  GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 443 ? 11.447  71.616 57.749 1.00 33.23 ? 443  GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 443 ? 11.453  71.908 58.988 1.00 31.52 ? 443  GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 443 ? 10.861  70.590 57.278 1.00 28.80 ? 443  GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 444 ? 9.966   74.607 57.721 1.00 33.98 ? 444  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 444 ? 8.758   74.921 56.960 1.00 33.66 ? 444  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 444 ? 8.600   76.485 56.936 1.00 34.93 ? 444  ILE A C   1 
ATOM   3475 O O   . ILE A 1 444 ? 8.212   77.088 55.917 1.00 34.75 ? 444  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 444 ? 7.479   74.267 57.608 1.00 32.52 ? 444  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 444 ? 7.558   72.718 57.532 1.00 30.54 ? 444  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 444 ? 6.173   74.825 56.923 1.00 31.71 ? 444  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 444 ? 6.403   71.976 58.220 1.00 23.46 ? 444  ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 445 ? 8.893   77.130 58.062 1.00 35.88 ? 445  GLU A N   1 
ATOM   3481 C CA  . GLU A 1 445 ? 8.812   78.596 58.186 1.00 35.95 ? 445  GLU A CA  1 
ATOM   3482 C C   . GLU A 1 445 ? 9.642   79.271 57.058 1.00 36.10 ? 445  GLU A C   1 
ATOM   3483 O O   . GLU A 1 445 ? 9.205   80.270 56.475 1.00 33.94 ? 445  GLU A O   1 
ATOM   3484 C CB  . GLU A 1 445 ? 9.351   79.014 59.562 1.00 36.38 ? 445  GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 445 ? 8.377   78.746 60.673 1.00 38.96 ? 445  GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 445 ? 8.950   78.906 62.062 1.00 40.40 ? 445  GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 445 ? 8.414   78.228 62.936 1.00 42.26 ? 445  GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 445 ? 9.904   79.689 62.314 1.00 43.22 ? 445  GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 446 ? 10.818  78.714 56.745 1.00 33.59 ? 446  PHE A N   1 
ATOM   3490 C CA  . PHE A 1 446 ? 11.608  79.302 55.706 1.00 33.97 ? 446  PHE A CA  1 
ATOM   3491 C C   . PHE A 1 446 ? 11.104  78.881 54.346 1.00 34.46 ? 446  PHE A C   1 
ATOM   3492 O O   . PHE A 1 446 ? 11.120  79.688 53.405 1.00 35.12 ? 446  PHE A O   1 
ATOM   3493 C CB  . PHE A 1 446 ? 13.083  78.950 55.875 1.00 33.30 ? 446  PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 446 ? 13.647  79.430 57.187 1.00 36.64 ? 446  PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 446 ? 13.225  78.843 58.410 1.00 34.31 ? 446  PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 446 ? 14.570  80.506 57.224 1.00 34.69 ? 446  PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 446 ? 13.712  79.322 59.658 1.00 34.87 ? 446  PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 446 ? 15.066  80.993 58.476 1.00 33.36 ? 446  PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 446 ? 14.642  80.410 59.688 1.00 34.26 ? 446  PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 447 ? 10.648  77.631 54.210 1.00 33.95 ? 447  VAL A N   1 
ATOM   3501 C CA  . VAL A 1 447 ? 10.148  77.202 52.904 1.00 32.63 ? 447  VAL A CA  1 
ATOM   3502 C C   . VAL A 1 447 ? 8.942   78.057 52.507 1.00 32.08 ? 447  VAL A C   1 
ATOM   3503 O O   . VAL A 1 447 ? 8.793   78.415 51.339 1.00 31.44 ? 447  VAL A O   1 
ATOM   3504 C CB  . VAL A 1 447 ? 9.747   75.690 52.897 1.00 33.55 ? 447  VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 447 ? 8.868   75.360 51.645 1.00 31.08 ? 447  VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 447 ? 11.019  74.834 52.938 1.00 31.11 ? 447  VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 448 ? 8.102   78.401 53.476 1.00 30.57 ? 448  PHE A N   1 
ATOM   3508 C CA  . PHE A 1 448 ? 6.951   79.203 53.164 1.00 32.82 ? 448  PHE A CA  1 
ATOM   3509 C C   . PHE A 1 448 ? 7.187   80.729 53.250 1.00 35.00 ? 448  PHE A C   1 
ATOM   3510 O O   . PHE A 1 448 ? 6.256   81.535 53.105 1.00 33.30 ? 448  PHE A O   1 
ATOM   3511 C CB  . PHE A 1 448 ? 5.765   78.756 54.016 1.00 32.40 ? 448  PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 448 ? 5.084   77.529 53.469 1.00 34.59 ? 448  PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 448 ? 5.643   76.244 53.663 1.00 34.68 ? 448  PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 448 ? 3.952   77.646 52.667 1.00 35.45 ? 448  PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 448 ? 5.090   75.115 53.055 1.00 35.42 ? 448  PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 448 ? 3.378   76.502 52.034 1.00 36.12 ? 448  PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 448 ? 3.950   75.243 52.226 1.00 36.70 ? 448  PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 449 ? 8.443   81.106 53.507 1.00 36.71 ? 449  GLY A N   1 
ATOM   3519 C CA  . GLY A 1 449 ? 8.812   82.500 53.529 1.00 37.85 ? 449  GLY A CA  1 
ATOM   3520 C C   . GLY A 1 449 ? 8.279   83.408 54.597 1.00 39.65 ? 449  GLY A C   1 
ATOM   3521 O O   . GLY A 1 449 ? 8.168   84.590 54.336 1.00 40.60 ? 449  GLY A O   1 
ATOM   3522 N N   . LEU A 1 450 ? 7.962   82.899 55.783 1.00 40.51 ? 450  LEU A N   1 
ATOM   3523 C CA  . LEU A 1 450 ? 7.490   83.742 56.883 1.00 41.61 ? 450  LEU A CA  1 
ATOM   3524 C C   . LEU A 1 450 ? 8.512   84.806 57.282 1.00 43.25 ? 450  LEU A C   1 
ATOM   3525 O O   . LEU A 1 450 ? 8.114   85.877 57.755 1.00 44.30 ? 450  LEU A O   1 
ATOM   3526 C CB  . LEU A 1 450 ? 7.126   82.915 58.121 1.00 40.35 ? 450  LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 450 ? 5.885   82.013 57.994 1.00 42.08 ? 450  LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 450 ? 4.708   82.628 58.696 1.00 44.11 ? 450  LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 450 ? 5.500   81.831 56.544 1.00 42.55 ? 450  LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 451 ? 9.831   84.538 57.134 1.00 44.02 ? 451  PRO A N   1 
ATOM   3531 C CA  . PRO A 1 451 ? 10.792  85.581 57.518 1.00 45.16 ? 451  PRO A CA  1 
ATOM   3532 C C   . PRO A 1 451 ? 10.728  86.849 56.685 1.00 46.68 ? 451  PRO A C   1 
ATOM   3533 O O   . PRO A 1 451 ? 11.291  87.856 57.084 1.00 48.38 ? 451  PRO A O   1 
ATOM   3534 C CB  . PRO A 1 451 ? 12.142  84.883 57.383 1.00 45.17 ? 451  PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 451 ? 11.803  83.505 57.772 1.00 44.76 ? 451  PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 451 ? 10.536  83.260 56.972 1.00 43.39 ? 451  PRO A CD  1 
ATOM   3537 N N   . LEU A 1 452 ? 10.058  86.827 55.531 1.00 48.29 ? 452  LEU A N   1 
ATOM   3538 C CA  . LEU A 1 452 ? 9.964   88.056 54.743 1.00 49.01 ? 452  LEU A CA  1 
ATOM   3539 C C   . LEU A 1 452 ? 8.960   89.017 55.327 1.00 50.15 ? 452  LEU A C   1 
ATOM   3540 O O   . LEU A 1 452 ? 8.911   90.160 54.877 1.00 51.63 ? 452  LEU A O   1 
ATOM   3541 C CB  . LEU A 1 452 ? 9.539   87.835 53.301 1.00 48.22 ? 452  LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 452 ? 10.227  86.826 52.395 1.00 50.27 ? 452  LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 452 ? 10.087  87.362 50.952 1.00 49.13 ? 452  LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 452 ? 11.681  86.558 52.803 1.00 48.39 ? 452  LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 453 ? 8.138   88.593 56.286 1.00 50.62 ? 453  VAL A N   1 
ATOM   3546 C CA  . VAL A 1 453 ? 7.182   89.544 56.838 1.00 53.01 ? 453  VAL A CA  1 
ATOM   3547 C C   . VAL A 1 453 ? 7.745   90.132 58.141 1.00 55.87 ? 453  VAL A C   1 
ATOM   3548 O O   . VAL A 1 453 ? 8.030   89.413 59.119 1.00 55.64 ? 453  VAL A O   1 
ATOM   3549 C CB  . VAL A 1 453 ? 5.704   88.943 56.984 1.00 52.45 ? 453  VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 453 ? 5.623   87.546 56.405 1.00 52.21 ? 453  VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 453 ? 5.230   88.975 58.403 1.00 52.16 ? 453  VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 454 ? 7.933   91.454 58.124 1.00 57.82 ? 454  LYS A N   1 
ATOM   3553 C CA  . LYS A 1 454 ? 8.531   92.176 59.247 1.00 59.61 ? 454  LYS A CA  1 
ATOM   3554 C C   . LYS A 1 454 ? 7.897   91.970 60.613 1.00 59.71 ? 454  LYS A C   1 
ATOM   3555 O O   . LYS A 1 454 ? 8.597   91.684 61.594 1.00 60.10 ? 454  LYS A O   1 
ATOM   3556 C CB  . LYS A 1 454 ? 8.624   93.669 58.889 1.00 61.64 ? 454  LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 454 ? 9.555   93.906 57.652 1.00 65.69 ? 454  LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 454 ? 10.986  93.284 57.874 1.00 68.17 ? 454  LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 454 ? 11.617  92.659 56.605 1.00 68.90 ? 454  LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 454 ? 11.830  93.633 55.478 1.00 69.23 ? 454  LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 455 ? 6.580   92.074 60.687 1.00 58.85 ? 455  GLU A N   1 
ATOM   3562 C CA  . GLU A 1 455 ? 5.913   91.901 61.954 1.00 59.19 ? 455  GLU A CA  1 
ATOM   3563 C C   . GLU A 1 455 ? 6.258   90.561 62.638 1.00 58.94 ? 455  GLU A C   1 
ATOM   3564 O O   . GLU A 1 455 ? 5.943   90.361 63.806 1.00 59.35 ? 455  GLU A O   1 
ATOM   3565 C CB  . GLU A 1 455 ? 4.402   92.027 61.756 1.00 61.08 ? 455  GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 455 ? 4.003   93.229 60.910 1.00 65.34 ? 455  GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 455 ? 4.401   93.087 59.431 1.00 67.88 ? 455  GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 455 ? 3.663   92.396 58.683 1.00 69.62 ? 455  GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 455 ? 5.448   93.650 59.016 1.00 69.33 ? 455  GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 456 ? 6.901   89.639 61.930 1.00 57.57 ? 456  LEU A N   1 
ATOM   3571 C CA  . LEU A 1 456 ? 7.233   88.358 62.541 1.00 56.00 ? 456  LEU A CA  1 
ATOM   3572 C C   . LEU A 1 456 ? 8.606   88.348 63.222 1.00 56.29 ? 456  LEU A C   1 
ATOM   3573 O O   . LEU A 1 456 ? 8.952   87.400 63.923 1.00 56.23 ? 456  LEU A O   1 
ATOM   3574 C CB  . LEU A 1 456 ? 7.095   87.219 61.530 1.00 53.76 ? 456  LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 456 ? 5.645   86.982 61.088 1.00 52.91 ? 456  LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 456 ? 5.588   85.879 60.049 1.00 51.14 ? 456  LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 456 ? 4.781   86.663 62.297 1.00 48.34 ? 456  LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 457 ? 9.409   89.377 63.017 1.00 56.08 ? 457  ASN A N   1 
ATOM   3579 C CA  . ASN A 1 457 ? 10.647  89.419 63.787 1.00 56.94 ? 457  ASN A CA  1 
ATOM   3580 C C   . ASN A 1 457 ? 11.628  88.319 63.489 1.00 55.15 ? 457  ASN A C   1 
ATOM   3581 O O   . ASN A 1 457 ? 11.894  87.487 64.349 1.00 56.40 ? 457  ASN A O   1 
ATOM   3582 C CB  . ASN A 1 457 ? 10.375  89.276 65.305 1.00 59.48 ? 457  ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 457 ? 9.342   90.276 65.865 1.00 63.04 ? 457  ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 457 ? 8.798   90.066 66.976 1.00 63.48 ? 457  ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 457 ? 9.081   91.362 65.124 1.00 64.09 ? 457  ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 458 ? 12.158  88.258 62.300 1.00 52.31 ? 458  TYR A N   1 
ATOM   3587 C CA  . TYR A 1 458 ? 13.150  87.234 62.094 1.00 49.05 ? 458  TYR A CA  1 
ATOM   3588 C C   . TYR A 1 458 ? 14.312  88.153 61.845 1.00 48.95 ? 458  TYR A C   1 
ATOM   3589 O O   . TYR A 1 458 ? 14.109  89.349 61.620 1.00 49.04 ? 458  TYR A O   1 
ATOM   3590 C CB  . TYR A 1 458 ? 12.864  86.360 60.843 1.00 46.14 ? 458  TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 458 ? 11.775  85.280 60.996 1.00 42.87 ? 458  TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 458 ? 10.422  85.554 60.723 1.00 40.91 ? 458  TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 458 ? 12.105  83.997 61.434 1.00 39.71 ? 458  TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 458 ? 9.423   84.569 60.892 1.00 39.49 ? 458  TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 458 ? 11.139  83.022 61.600 1.00 38.50 ? 458  TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 458 ? 9.792   83.294 61.338 1.00 38.93 ? 458  TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 458 ? 8.839   82.292 61.561 1.00 35.21 ? 458  TYR A OH  1 
ATOM   3598 N N   . THR A 1 459 ? 15.522  87.624 61.894 1.00 48.34 ? 459  THR A N   1 
ATOM   3599 C CA  . THR A 1 459 ? 16.680  88.445 61.631 1.00 47.17 ? 459  THR A CA  1 
ATOM   3600 C C   . THR A 1 459 ? 16.783  88.627 60.140 1.00 48.57 ? 459  THR A C   1 
ATOM   3601 O O   . THR A 1 459 ? 16.148  87.916 59.372 1.00 49.34 ? 459  THR A O   1 
ATOM   3602 C CB  . THR A 1 459 ? 17.959  87.771 62.083 1.00 46.76 ? 459  THR A CB  1 
ATOM   3603 O OG1 . THR A 1 459 ? 18.135  86.541 61.350 1.00 42.61 ? 459  THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 459 ? 17.918  87.541 63.605 1.00 43.39 ? 459  THR A CG2 1 
ATOM   3605 N N   . ALA A 1 460 ? 17.622  89.568 59.729 1.00 48.92 ? 460  ALA A N   1 
ATOM   3606 C CA  . ALA A 1 460 ? 17.830  89.823 58.316 1.00 47.24 ? 460  ALA A CA  1 
ATOM   3607 C C   . ALA A 1 460 ? 18.442  88.588 57.678 1.00 46.22 ? 460  ALA A C   1 
ATOM   3608 O O   . ALA A 1 460 ? 18.079  88.231 56.562 1.00 45.53 ? 460  ALA A O   1 
ATOM   3609 C CB  . ALA A 1 460 ? 18.769  91.040 58.118 1.00 45.76 ? 460  ALA A CB  1 
ATOM   3610 N N   . GLU A 1 461 ? 19.389  87.947 58.360 1.00 46.13 ? 461  GLU A N   1 
ATOM   3611 C CA  . GLU A 1 461 ? 20.022  86.769 57.758 1.00 46.61 ? 461  GLU A CA  1 
ATOM   3612 C C   . GLU A 1 461 ? 18.994  85.636 57.621 1.00 44.13 ? 461  GLU A C   1 
ATOM   3613 O O   . GLU A 1 461 ? 19.115  84.825 56.700 1.00 42.21 ? 461  GLU A O   1 
ATOM   3614 C CB  . GLU A 1 461 ? 21.287  86.314 58.527 1.00 49.14 ? 461  GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 461 ? 21.320  86.680 60.032 1.00 55.77 ? 461  GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 461 ? 21.469  88.208 60.282 1.00 56.84 ? 461  GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 461 ? 22.395  88.775 59.682 1.00 58.36 ? 461  GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 461 ? 20.677  88.835 61.053 1.00 57.85 ? 461  GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 462 ? 17.970  85.623 58.481 1.00 41.42 ? 462  GLU A N   1 
ATOM   3620 C CA  . GLU A 1 462 ? 16.920  84.603 58.372 1.00 41.72 ? 462  GLU A CA  1 
ATOM   3621 C C   . GLU A 1 462 ? 16.065  84.900 57.138 1.00 42.46 ? 462  GLU A C   1 
ATOM   3622 O O   . GLU A 1 462 ? 15.642  83.968 56.441 1.00 41.51 ? 462  GLU A O   1 
ATOM   3623 C CB  . GLU A 1 462 ? 16.054  84.528 59.650 1.00 39.33 ? 462  GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 462 ? 16.865  83.851 60.759 1.00 39.34 ? 462  GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 462 ? 16.185  83.776 62.135 1.00 41.02 ? 462  GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 462 ? 15.327  84.628 62.512 1.00 40.67 ? 462  GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 462 ? 16.558  82.844 62.880 1.00 40.24 ? 462  GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 463 ? 15.838  86.191 56.849 1.00 42.41 ? 463  GLU A N   1 
ATOM   3629 C CA  . GLU A 1 463 ? 15.063  86.568 55.664 1.00 42.33 ? 463  GLU A CA  1 
ATOM   3630 C C   . GLU A 1 463 ? 15.863  86.129 54.456 1.00 40.82 ? 463  GLU A C   1 
ATOM   3631 O O   . GLU A 1 463 ? 15.331  85.610 53.469 1.00 41.69 ? 463  GLU A O   1 
ATOM   3632 C CB  . GLU A 1 463 ? 14.827  88.080 55.553 1.00 43.99 ? 463  GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 463 ? 13.909  88.429 54.365 1.00 47.78 ? 463  GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 463 ? 13.742  89.936 54.092 1.00 50.21 ? 463  GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 463 ? 13.803  90.757 55.047 1.00 52.80 ? 463  GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 463 ? 13.510  90.301 52.910 1.00 50.13 ? 463  GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 464 ? 17.163  86.303 54.547 1.00 38.87 ? 464  ALA A N   1 
ATOM   3638 C CA  . ALA A 1 464 ? 18.006  85.940 53.422 1.00 38.33 ? 464  ALA A CA  1 
ATOM   3639 C C   . ALA A 1 464 ? 17.992  84.419 53.222 1.00 36.98 ? 464  ALA A C   1 
ATOM   3640 O O   . ALA A 1 464 ? 18.016  83.922 52.084 1.00 36.89 ? 464  ALA A O   1 
ATOM   3641 C CB  . ALA A 1 464 ? 19.475  86.471 53.652 1.00 36.25 ? 464  ALA A CB  1 
ATOM   3642 N N   . LEU A 1 465 ? 17.971  83.692 54.338 1.00 35.14 ? 465  LEU A N   1 
ATOM   3643 C CA  . LEU A 1 465 ? 17.956  82.230 54.286 1.00 34.47 ? 465  LEU A CA  1 
ATOM   3644 C C   . LEU A 1 465 ? 16.622  81.755 53.664 1.00 33.20 ? 465  LEU A C   1 
ATOM   3645 O O   . LEU A 1 465 ? 16.606  80.870 52.790 1.00 29.89 ? 465  LEU A O   1 
ATOM   3646 C CB  . LEU A 1 465 ? 18.157  81.652 55.694 1.00 34.10 ? 465  LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 465 ? 17.994  80.141 55.792 1.00 34.36 ? 465  LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 465 ? 19.036  79.387 54.961 1.00 32.93 ? 465  LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 465 ? 18.100  79.819 57.226 1.00 34.07 ? 465  LEU A CD2 1 
ATOM   3650 N N   . SER A 1 466 ? 15.531  82.384 54.099 1.00 32.84 ? 466  SER A N   1 
ATOM   3651 C CA  . SER A 1 466 ? 14.221  82.069 53.572 1.00 35.50 ? 466  SER A CA  1 
ATOM   3652 C C   . SER A 1 466 ? 14.155  82.278 52.050 1.00 38.35 ? 466  SER A C   1 
ATOM   3653 O O   . SER A 1 466 ? 13.619  81.440 51.290 1.00 39.38 ? 466  SER A O   1 
ATOM   3654 C CB  . SER A 1 466 ? 13.170  82.916 54.260 1.00 35.15 ? 466  SER A CB  1 
ATOM   3655 O OG  . SER A 1 466 ? 11.883  82.636 53.743 1.00 35.03 ? 466  SER A OG  1 
ATOM   3656 N N   . ARG A 1 467 ? 14.724  83.384 51.580 1.00 39.39 ? 467  ARG A N   1 
ATOM   3657 C CA  . ARG A 1 467 ? 14.697  83.638 50.151 1.00 38.91 ? 467  ARG A CA  1 
ATOM   3658 C C   . ARG A 1 467 ? 15.537  82.598 49.399 1.00 37.96 ? 467  ARG A C   1 
ATOM   3659 O O   . ARG A 1 467 ? 15.160  82.163 48.309 1.00 38.15 ? 467  ARG A O   1 
ATOM   3660 C CB  . ARG A 1 467 ? 15.165  85.075 49.869 1.00 38.63 ? 467  ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 467 ? 14.086  86.101 50.138 1.00 37.70 ? 467  ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 467 ? 14.642  87.519 50.026 1.00 37.12 ? 467  ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 467 ? 13.673  88.511 50.470 1.00 36.63 ? 467  ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 467 ? 12.599  88.868 49.770 1.00 37.30 ? 467  ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 467 ? 12.377  88.319 48.582 1.00 36.34 ? 467  ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 467 ? 11.705  89.720 50.288 1.00 37.14 ? 467  ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 468 ? 16.667  82.170 49.952 1.00 37.68 ? 468  ARG A N   1 
ATOM   3668 C CA  . ARG A 1 468 ? 17.442  81.132 49.231 1.00 37.94 ? 468  ARG A CA  1 
ATOM   3669 C C   . ARG A 1 468 ? 16.715  79.784 49.273 1.00 36.75 ? 468  ARG A C   1 
ATOM   3670 O O   . ARG A 1 468 ? 16.737  79.033 48.307 1.00 37.35 ? 468  ARG A O   1 
ATOM   3671 C CB  . ARG A 1 468 ? 18.793  80.858 49.867 1.00 39.88 ? 468  ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 468 ? 19.738  81.945 49.823 1.00 43.23 ? 468  ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 468 ? 20.936  81.619 50.725 1.00 46.74 ? 468  ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 468 ? 21.479  80.282 50.512 1.00 46.63 ? 468  ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 468 ? 21.921  79.530 51.519 1.00 46.51 ? 468  ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 468 ? 21.848  80.024 52.756 1.00 44.77 ? 468  ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 468 ? 22.451  78.322 51.291 1.00 44.12 ? 468  ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 469 ? 16.129  79.437 50.411 1.00 33.70 ? 469  ILE A N   1 
ATOM   3679 C CA  . ILE A 1 469 ? 15.479  78.171 50.442 1.00 32.76 ? 469  ILE A CA  1 
ATOM   3680 C C   . ILE A 1 469 ? 14.313  78.192 49.444 1.00 33.30 ? 469  ILE A C   1 
ATOM   3681 O O   . ILE A 1 469 ? 14.224  77.288 48.588 1.00 32.02 ? 469  ILE A O   1 
ATOM   3682 C CB  . ILE A 1 469 ? 15.071  77.801 51.908 1.00 31.75 ? 469  ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 469 ? 16.342  77.423 52.681 1.00 28.54 ? 469  ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 469 ? 14.034  76.645 51.926 1.00 28.85 ? 469  ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 469 ? 16.110  77.255 54.124 1.00 26.02 ? 469  ILE A CD1 1 
ATOM   3686 N N   . MET A 1 470 ? 13.465  79.222 49.518 1.00 33.73 ? 470  MET A N   1 
ATOM   3687 C CA  . MET A 1 470 ? 12.334  79.322 48.596 1.00 35.86 ? 470  MET A CA  1 
ATOM   3688 C C   . MET A 1 470 ? 12.781  79.274 47.142 1.00 36.57 ? 470  MET A C   1 
ATOM   3689 O O   . MET A 1 470 ? 12.108  78.673 46.288 1.00 36.39 ? 470  MET A O   1 
ATOM   3690 C CB  . MET A 1 470 ? 11.521  80.605 48.795 1.00 35.30 ? 470  MET A CB  1 
ATOM   3691 C CG  . MET A 1 470 ? 10.663  80.549 50.003 1.00 37.68 ? 470  MET A CG  1 
ATOM   3692 S SD  . MET A 1 470 ? 9.411   81.834 49.968 1.00 42.60 ? 470  MET A SD  1 
ATOM   3693 C CE  . MET A 1 470 ? 10.531  83.326 50.060 1.00 38.92 ? 470  MET A CE  1 
ATOM   3694 N N   . HIS A 1 471 ? 13.924  79.889 46.847 1.00 36.80 ? 471  HIS A N   1 
ATOM   3695 C CA  . HIS A 1 471 ? 14.360  79.886 45.468 1.00 37.12 ? 471  HIS A CA  1 
ATOM   3696 C C   . HIS A 1 471 ? 14.926  78.511 45.099 1.00 36.77 ? 471  HIS A C   1 
ATOM   3697 O O   . HIS A 1 471 ? 14.750  78.070 43.953 1.00 38.09 ? 471  HIS A O   1 
ATOM   3698 C CB  . HIS A 1 471 ? 15.348  81.038 45.181 1.00 37.53 ? 471  HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 471 ? 15.523  81.311 43.721 1.00 37.49 ? 471  HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 471 ? 14.459  81.602 42.887 1.00 38.60 ? 471  HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 471 ? 16.617  81.269 42.928 1.00 37.30 ? 471  HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 471 ? 14.891  81.728 41.645 1.00 36.37 ? 471  HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 471 ? 16.197  81.532 41.641 1.00 37.50 ? 471  HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 472 ? 15.589  77.822 46.039 1.00 36.86 ? 472  TYR A N   1 
ATOM   3705 C CA  . TYR A 1 472 ? 16.083  76.447 45.755 1.00 37.31 ? 472  TYR A CA  1 
ATOM   3706 C C   . TYR A 1 472 ? 14.849  75.529 45.448 1.00 36.49 ? 472  TYR A C   1 
ATOM   3707 O O   . TYR A 1 472 ? 14.825  74.822 44.413 1.00 35.23 ? 472  TYR A O   1 
ATOM   3708 C CB  . TYR A 1 472 ? 16.793  75.809 46.948 1.00 38.68 ? 472  TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 472 ? 18.190  76.277 47.300 1.00 40.61 ? 472  TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 472 ? 19.124  76.599 46.321 1.00 40.48 ? 472  TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 472 ? 18.596  76.334 48.647 1.00 40.94 ? 472  TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 472 ? 20.441  76.968 46.677 1.00 41.84 ? 472  TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 472 ? 19.885  76.698 49.013 1.00 41.14 ? 472  TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 472 ? 20.803  77.020 48.033 1.00 43.51 ? 472  TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 472 ? 22.046  77.499 48.418 1.00 45.87 ? 472  TYR A OH  1 
ATOM   3716 N N   . TRP A 1 473 ? 13.835  75.573 46.327 1.00 33.56 ? 473  TRP A N   1 
ATOM   3717 C CA  . TRP A 1 473 ? 12.656  74.726 46.151 1.00 32.95 ? 473  TRP A CA  1 
ATOM   3718 C C   . TRP A 1 473 ? 11.959  75.016 44.852 1.00 33.79 ? 473  TRP A C   1 
ATOM   3719 O O   . TRP A 1 473 ? 11.584  74.095 44.120 1.00 34.35 ? 473  TRP A O   1 
ATOM   3720 C CB  . TRP A 1 473 ? 11.630  74.901 47.273 1.00 30.88 ? 473  TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 473 ? 11.758  73.944 48.502 1.00 32.11 ? 473  TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 473 ? 10.715  73.352 49.180 1.00 30.92 ? 473  TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 473 ? 12.947  73.611 49.259 1.00 32.08 ? 473  TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 473 ? 11.161  72.695 50.296 1.00 29.91 ? 473  TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 473 ? 12.519  72.827 50.386 1.00 32.44 ? 473  TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 473 ? 14.315  73.898 49.111 1.00 30.70 ? 473  TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 473 ? 13.422  72.331 51.366 1.00 31.65 ? 473  TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 473 ? 15.221  73.407 50.089 1.00 32.12 ? 473  TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 473 ? 14.767  72.630 51.205 1.00 32.41 ? 473  TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 474 ? 11.800  76.299 44.543 1.00 34.38 ? 474  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? 11.085  76.693 43.332 1.00 32.76 ? 474  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? 11.899  76.422 42.099 1.00 31.82 ? 474  ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? 11.373  75.959 41.113 1.00 33.47 ? 474  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? 10.698  78.169 43.400 1.00 31.33 ? 474  ALA A CB  1 
ATOM   3735 N N   . THR A 1 475 ? 13.187  76.687 42.137 1.00 31.21 ? 475  THR A N   1 
ATOM   3736 C CA  . THR A 1 475 ? 13.985  76.447 40.950 1.00 32.50 ? 475  THR A CA  1 
ATOM   3737 C C   . THR A 1 475 ? 14.059  74.943 40.708 1.00 35.12 ? 475  THR A C   1 
ATOM   3738 O O   . THR A 1 475 ? 14.018  74.466 39.550 1.00 37.04 ? 475  THR A O   1 
ATOM   3739 C CB  . THR A 1 475 ? 15.384  77.024 41.120 1.00 33.55 ? 475  THR A CB  1 
ATOM   3740 O OG1 . THR A 1 475 ? 15.267  78.441 41.378 1.00 30.70 ? 475  THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 475 ? 16.264  76.727 39.878 1.00 30.65 ? 475  THR A CG2 1 
ATOM   3742 N N   . PHE A 1 476 ? 14.168  74.176 41.789 1.00 35.27 ? 476  PHE A N   1 
ATOM   3743 C CA  . PHE A 1 476 ? 14.189  72.747 41.617 1.00 35.00 ? 476  PHE A CA  1 
ATOM   3744 C C   . PHE A 1 476 ? 12.837  72.251 41.028 1.00 35.51 ? 476  PHE A C   1 
ATOM   3745 O O   . PHE A 1 476 ? 12.803  71.331 40.178 1.00 34.00 ? 476  PHE A O   1 
ATOM   3746 C CB  . PHE A 1 476 ? 14.426  72.055 42.952 1.00 34.88 ? 476  PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 476 ? 14.078  70.604 42.923 1.00 34.55 ? 476  PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 476 ? 15.000  69.664 42.456 1.00 34.69 ? 476  PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 476 ? 12.808  70.172 43.334 1.00 33.78 ? 476  PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 476 ? 14.684  68.312 42.405 1.00 32.59 ? 476  PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 476 ? 12.471  68.820 43.288 1.00 32.85 ? 476  PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 476 ? 13.406  67.890 42.829 1.00 33.88 ? 476  PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 477 ? 11.727  72.832 41.494 1.00 34.77 ? 477  ALA A N   1 
ATOM   3754 C CA  . ALA A 1 477 ? 10.427  72.398 41.024 1.00 35.17 ? 477  ALA A CA  1 
ATOM   3755 C C   . ALA A 1 477 ? 10.338  72.659 39.527 1.00 38.41 ? 477  ALA A C   1 
ATOM   3756 O O   . ALA A 1 477 ? 9.890   71.777 38.789 1.00 37.99 ? 477  ALA A O   1 
ATOM   3757 C CB  . ALA A 1 477 ? 9.326   73.124 41.763 1.00 33.16 ? 477  ALA A CB  1 
ATOM   3758 N N   . LYS A 1 478 ? 10.805  73.847 39.082 1.00 40.14 ? 478  LYS A N   1 
ATOM   3759 C CA  . LYS A 1 478 ? 10.777  74.225 37.671 1.00 41.88 ? 478  LYS A CA  1 
ATOM   3760 C C   . LYS A 1 478 ? 11.683  73.419 36.759 1.00 41.63 ? 478  LYS A C   1 
ATOM   3761 O O   . LYS A 1 478 ? 11.315  73.163 35.585 1.00 41.06 ? 478  LYS A O   1 
ATOM   3762 C CB  . LYS A 1 478 ? 11.206  75.683 37.455 1.00 46.71 ? 478  LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 478 ? 10.377  76.747 38.172 1.00 53.27 ? 478  LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 478 ? 10.677  78.208 37.646 1.00 57.02 ? 478  LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 478 ? 9.992   79.306 38.546 1.00 58.09 ? 478  LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 478 ? 10.724  79.477 39.872 1.00 58.07 ? 478  LYS A NZ  1 
ATOM   3767 N N   . THR A 1 479 ? 12.855  73.030 37.278 1.00 39.10 ? 479  THR A N   1 
ATOM   3768 C CA  . THR A 1 479 ? 13.857  72.363 36.453 1.00 38.20 ? 479  THR A CA  1 
ATOM   3769 C C   . THR A 1 479 ? 14.466  71.021 36.828 1.00 39.32 ? 479  THR A C   1 
ATOM   3770 O O   . THR A 1 479 ? 15.142  70.427 36.004 1.00 40.48 ? 479  THR A O   1 
ATOM   3771 C CB  . THR A 1 479 ? 15.067  73.264 36.275 1.00 37.52 ? 479  THR A CB  1 
ATOM   3772 O OG1 . THR A 1 479 ? 15.794  73.326 37.515 1.00 37.56 ? 479  THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 479 ? 14.640  74.662 35.859 1.00 34.89 ? 479  THR A CG2 1 
ATOM   3774 N N   . GLY A 1 480 ? 14.279  70.547 38.054 1.00 38.81 ? 480  GLY A N   1 
ATOM   3775 C CA  . GLY A 1 480 ? 14.910  69.303 38.429 1.00 36.42 ? 480  GLY A CA  1 
ATOM   3776 C C   . GLY A 1 480 ? 16.263  69.614 39.050 1.00 36.93 ? 480  GLY A C   1 
ATOM   3777 O O   . GLY A 1 480 ? 17.047  68.684 39.337 1.00 36.83 ? 480  GLY A O   1 
ATOM   3778 N N   . ASN A 1 481 ? 16.554  70.911 39.265 1.00 35.95 ? 481  ASN A N   1 
ATOM   3779 C CA  . ASN A 1 481 ? 17.853  71.335 39.838 1.00 34.62 ? 481  ASN A CA  1 
ATOM   3780 C C   . ASN A 1 481 ? 17.654  72.604 40.681 1.00 34.94 ? 481  ASN A C   1 
ATOM   3781 O O   . ASN A 1 481 ? 17.187  73.613 40.179 1.00 35.89 ? 481  ASN A O   1 
ATOM   3782 C CB  . ASN A 1 481 ? 18.821  71.613 38.695 1.00 34.10 ? 481  ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 481 ? 20.235  71.923 39.155 1.00 36.36 ? 481  ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 481 ? 20.494  72.371 40.307 1.00 36.55 ? 481  ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 481 ? 21.176  71.708 38.245 1.00 32.84 ? 481  ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 482 ? 18.021  72.569 41.974 1.00 35.65 ? 482  PRO A N   1 
ATOM   3787 C CA  . PRO A 1 482 ? 17.830  73.766 42.807 1.00 36.35 ? 482  PRO A CA  1 
ATOM   3788 C C   . PRO A 1 482 ? 18.709  74.966 42.430 1.00 38.58 ? 482  PRO A C   1 
ATOM   3789 O O   . PRO A 1 482 ? 18.452  76.087 42.852 1.00 38.24 ? 482  PRO A O   1 
ATOM   3790 C CB  . PRO A 1 482 ? 18.149  73.262 44.209 1.00 33.83 ? 482  PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 482 ? 19.287  72.295 43.956 1.00 32.04 ? 482  PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 482 ? 18.834  71.545 42.683 1.00 33.71 ? 482  PRO A CD  1 
ATOM   3793 N N   . ASN A 1 483 ? 19.742  74.721 41.639 1.00 41.13 ? 483  ASN A N   1 
ATOM   3794 C CA  . ASN A 1 483 ? 20.660  75.785 41.241 1.00 45.18 ? 483  ASN A CA  1 
ATOM   3795 C C   . ASN A 1 483 ? 20.297  76.570 40.000 1.00 48.58 ? 483  ASN A C   1 
ATOM   3796 O O   . ASN A 1 483 ? 19.761  76.024 39.024 1.00 48.15 ? 483  ASN A O   1 
ATOM   3797 C CB  . ASN A 1 483 ? 22.042  75.205 41.033 1.00 43.20 ? 483  ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 483 ? 22.528  74.475 42.251 1.00 42.58 ? 483  ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 483 ? 22.860  75.097 43.270 1.00 43.46 ? 483  ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 483 ? 22.559  73.157 42.169 1.00 39.15 ? 483  ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 484 ? 20.590  77.865 40.069 1.00 54.26 ? 484  GLU A N   1 
ATOM   3802 C CA  . GLU A 1 484 ? 20.408  78.776 38.948 1.00 59.55 ? 484  GLU A CA  1 
ATOM   3803 C C   . GLU A 1 484 ? 21.508  78.395 37.957 1.00 62.71 ? 484  GLU A C   1 
ATOM   3804 O O   . GLU A 1 484 ? 22.693  78.460 38.285 1.00 61.00 ? 484  GLU A O   1 
ATOM   3805 C CB  . GLU A 1 484 ? 20.596  80.222 39.400 1.00 60.75 ? 484  GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 484 ? 19.310  80.868 39.857 1.00 63.64 ? 484  GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 484 ? 18.336  81.010 38.704 1.00 65.30 ? 484  GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 484 ? 18.291  80.100 37.827 1.00 66.69 ? 484  GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 484 ? 17.609  82.020 38.675 1.00 65.43 ? 484  GLU A OE2 1 
ATOM   3810 N N   . PRO A 1 485 ? 21.117  77.981 36.739 1.00 67.52 ? 485  PRO A N   1 
ATOM   3811 C CA  . PRO A 1 485 ? 21.978  77.554 35.621 1.00 71.16 ? 485  PRO A CA  1 
ATOM   3812 C C   . PRO A 1 485 ? 23.440  77.995 35.780 1.00 73.93 ? 485  PRO A C   1 
ATOM   3813 O O   . PRO A 1 485 ? 24.280  77.274 36.359 1.00 74.21 ? 485  PRO A O   1 
ATOM   3814 C CB  . PRO A 1 485 ? 21.317  78.221 34.414 1.00 71.07 ? 485  PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 485 ? 19.845  78.079 34.730 1.00 70.52 ? 485  PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 485 ? 19.778  78.385 36.242 1.00 69.74 ? 485  PRO A CD  1 
ATOM   3817 N N   . HIS A 1 486 ? 23.723  79.185 35.247 1.00 75.87 ? 486  HIS A N   1 
ATOM   3818 C CA  . HIS A 1 486 ? 25.050  79.779 35.332 1.00 77.41 ? 486  HIS A CA  1 
ATOM   3819 C C   . HIS A 1 486 ? 24.884  80.932 36.308 1.00 76.94 ? 486  HIS A C   1 
ATOM   3820 O O   . HIS A 1 486 ? 24.683  82.080 35.905 1.00 77.17 ? 486  HIS A O   1 
ATOM   3821 C CB  . HIS A 1 486 ? 25.525  80.358 33.983 1.00 79.32 ? 486  HIS A CB  1 
ATOM   3822 C CG  . HIS A 1 486 ? 25.218  79.501 32.794 1.00 82.31 ? 486  HIS A CG  1 
ATOM   3823 N ND1 . HIS A 1 486 ? 24.020  79.580 32.107 1.00 83.27 ? 486  HIS A ND1 1 
ATOM   3824 C CD2 . HIS A 1 486 ? 25.965  78.569 32.148 1.00 83.39 ? 486  HIS A CD2 1 
ATOM   3825 C CE1 . HIS A 1 486 ? 24.046  78.736 31.087 1.00 84.11 ? 486  HIS A CE1 1 
ATOM   3826 N NE2 . HIS A 1 486 ? 25.214  78.112 31.088 1.00 84.20 ? 486  HIS A NE2 1 
ATOM   3827 N N   . SER A 1 487 ? 24.934  80.624 37.594 1.00 76.42 ? 487  SER A N   1 
ATOM   3828 C CA  . SER A 1 487 ? 24.802  81.651 38.619 1.00 75.38 ? 487  SER A CA  1 
ATOM   3829 C C   . SER A 1 487 ? 26.186  81.814 39.213 1.00 74.76 ? 487  SER A C   1 
ATOM   3830 O O   . SER A 1 487 ? 27.138  81.168 38.787 1.00 73.74 ? 487  SER A O   1 
ATOM   3831 C CB  . SER A 1 487 ? 23.806  81.205 39.693 1.00 74.76 ? 487  SER A CB  1 
ATOM   3832 O OG  . SER A 1 487 ? 23.851  82.041 40.830 1.00 73.56 ? 487  SER A OG  1 
ATOM   3833 N N   . GLN A 1 488 ? 26.295  82.673 40.203 1.00 74.91 ? 488  GLN A N   1 
ATOM   3834 C CA  . GLN A 1 488 ? 27.580  82.895 40.839 1.00 75.47 ? 488  GLN A CA  1 
ATOM   3835 C C   . GLN A 1 488 ? 27.576  82.371 42.278 1.00 73.17 ? 488  GLN A C   1 
ATOM   3836 O O   . GLN A 1 488 ? 28.624  82.325 42.943 1.00 71.80 ? 488  GLN A O   1 
ATOM   3837 C CB  . GLN A 1 488 ? 27.877  84.393 40.824 1.00 78.93 ? 488  GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 488 ? 27.575  85.029 39.475 1.00 82.64 ? 488  GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 488 ? 28.834  85.542 38.799 1.00 85.34 ? 488  GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 488 ? 29.755  84.759 38.467 1.00 84.38 ? 488  GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 488 ? 28.892  86.877 38.598 1.00 86.32 ? 488  GLN A NE2 1 
ATOM   3842 N N   . GLU A 1 489 ? 26.390  81.993 42.756 1.00 70.55 ? 489  GLU A N   1 
ATOM   3843 C CA  . GLU A 1 489 ? 26.262  81.484 44.115 1.00 67.87 ? 489  GLU A CA  1 
ATOM   3844 C C   . GLU A 1 489 ? 26.888  80.101 44.156 1.00 64.18 ? 489  GLU A C   1 
ATOM   3845 O O   . GLU A 1 489 ? 27.100  79.454 43.115 1.00 62.12 ? 489  GLU A O   1 
ATOM   3846 C CB  . GLU A 1 489 ? 24.790  81.376 44.541 1.00 70.48 ? 489  GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 489 ? 23.858  82.487 44.066 1.00 74.48 ? 489  GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 489 ? 24.375  83.875 44.434 1.00 78.43 ? 489  GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 489 ? 25.113  83.989 45.457 1.00 79.41 ? 489  GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 489 ? 24.037  84.851 43.700 1.00 80.13 ? 489  GLU A OE2 1 
ATOM   3851 N N   . SER A 1 490 ? 27.180  79.665 45.374 1.00 60.80 ? 490  SER A N   1 
ATOM   3852 C CA  . SER A 1 490 ? 27.767  78.347 45.615 1.00 58.05 ? 490  SER A CA  1 
ATOM   3853 C C   . SER A 1 490 ? 26.792  77.317 45.052 1.00 55.20 ? 490  SER A C   1 
ATOM   3854 O O   . SER A 1 490 ? 25.578  77.457 45.211 1.00 53.98 ? 490  SER A O   1 
ATOM   3855 C CB  . SER A 1 490 ? 27.946  78.119 47.125 1.00 57.65 ? 490  SER A CB  1 
ATOM   3856 O OG  . SER A 1 490 ? 28.588  79.224 47.750 1.00 58.06 ? 490  SER A OG  1 
ATOM   3857 N N   . LYS A 1 491 ? 27.331  76.300 44.399 1.00 52.19 ? 491  LYS A N   1 
ATOM   3858 C CA  . LYS A 1 491 ? 26.527  75.254 43.798 1.00 51.67 ? 491  LYS A CA  1 
ATOM   3859 C C   . LYS A 1 491 ? 26.156  74.050 44.744 1.00 49.93 ? 491  LYS A C   1 
ATOM   3860 O O   . LYS A 1 491 ? 27.048  73.369 45.291 1.00 48.97 ? 491  LYS A O   1 
ATOM   3861 C CB  . LYS A 1 491 ? 27.274  74.754 42.552 1.00 54.43 ? 491  LYS A CB  1 
ATOM   3862 C CG  . LYS A 1 491 ? 26.628  75.107 41.189 1.00 58.75 ? 491  LYS A CG  1 
ATOM   3863 C CD  . LYS A 1 491 ? 25.991  73.831 40.521 1.00 60.29 ? 491  LYS A CD  1 
ATOM   3864 C CE  . LYS A 1 491 ? 25.172  74.128 39.208 1.00 60.72 ? 491  LYS A CE  1 
ATOM   3865 N NZ  . LYS A 1 491 ? 24.279  72.964 38.844 1.00 58.61 ? 491  LYS A NZ  1 
ATOM   3866 N N   . TRP A 1 492 ? 24.851  73.814 44.965 1.00 45.08 ? 492  TRP A N   1 
ATOM   3867 C CA  . TRP A 1 492 ? 24.394  72.687 45.775 1.00 40.51 ? 492  TRP A CA  1 
ATOM   3868 C C   . TRP A 1 492 ? 24.757  71.452 44.950 1.00 39.99 ? 492  TRP A C   1 
ATOM   3869 O O   . TRP A 1 492 ? 24.219  71.231 43.868 1.00 38.94 ? 492  TRP A O   1 
ATOM   3870 C CB  . TRP A 1 492 ? 22.876  72.760 45.936 1.00 39.97 ? 492  TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 492 ? 22.218  71.736 46.865 1.00 38.36 ? 492  TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 492 ? 22.674  70.467 47.174 1.00 38.38 ? 492  TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 492 ? 20.943  71.860 47.495 1.00 37.91 ? 492  TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 492 ? 21.757  69.810 47.953 1.00 38.54 ? 492  TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 492 ? 20.683  70.637 48.168 1.00 38.49 ? 492  TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 492 ? 19.988  72.880 47.561 1.00 35.97 ? 492  TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 492 ? 19.503  70.418 48.900 1.00 36.39 ? 492  TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 492 ? 18.825  72.661 48.293 1.00 36.18 ? 492  TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 492 ? 18.592  71.441 48.955 1.00 35.57 ? 492  TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 493 ? 25.670  70.610 45.440 1.00 40.59 ? 493  PRO A N   1 
ATOM   3881 C CA  . PRO A 1 493 ? 25.936  69.469 44.542 1.00 40.06 ? 493  PRO A CA  1 
ATOM   3882 C C   . PRO A 1 493 ? 24.936  68.330 44.476 1.00 40.44 ? 493  PRO A C   1 
ATOM   3883 O O   . PRO A 1 493 ? 24.229  68.020 45.433 1.00 41.45 ? 493  PRO A O   1 
ATOM   3884 C CB  . PRO A 1 493 ? 27.302  68.958 45.009 1.00 39.34 ? 493  PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 493 ? 27.330  69.348 46.480 1.00 39.37 ? 493  PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 493 ? 26.707  70.733 46.486 1.00 39.51 ? 493  PRO A CD  1 
ATOM   3887 N N   . LEU A 1 494 ? 24.904  67.690 43.328 1.00 39.41 ? 494  LEU A N   1 
ATOM   3888 C CA  . LEU A 1 494 ? 24.058  66.531 43.140 1.00 40.85 ? 494  LEU A CA  1 
ATOM   3889 C C   . LEU A 1 494 ? 24.590  65.446 44.118 1.00 40.19 ? 494  LEU A C   1 
ATOM   3890 O O   . LEU A 1 494 ? 25.791  65.366 44.367 1.00 39.85 ? 494  LEU A O   1 
ATOM   3891 C CB  . LEU A 1 494 ? 24.220  66.055 41.695 1.00 41.23 ? 494  LEU A CB  1 
ATOM   3892 C CG  . LEU A 1 494 ? 23.140  65.397 40.864 1.00 42.70 ? 494  LEU A CG  1 
ATOM   3893 C CD1 . LEU A 1 494 ? 21.754  65.979 41.083 1.00 40.51 ? 494  LEU A CD1 1 
ATOM   3894 C CD2 . LEU A 1 494 ? 23.597  65.598 39.401 1.00 42.96 ? 494  LEU A CD2 1 
ATOM   3895 N N   . PHE A 1 495 ? 23.691  64.645 44.697 1.00 40.32 ? 495  PHE A N   1 
ATOM   3896 C CA  . PHE A 1 495 ? 24.069  63.565 45.604 1.00 38.09 ? 495  PHE A CA  1 
ATOM   3897 C C   . PHE A 1 495 ? 24.253  62.341 44.698 1.00 38.56 ? 495  PHE A C   1 
ATOM   3898 O O   . PHE A 1 495 ? 23.380  61.981 43.909 1.00 38.97 ? 495  PHE A O   1 
ATOM   3899 C CB  . PHE A 1 495 ? 22.962  63.349 46.657 1.00 36.76 ? 495  PHE A CB  1 
ATOM   3900 C CG  . PHE A 1 495 ? 23.081  62.029 47.456 1.00 36.40 ? 495  PHE A CG  1 
ATOM   3901 C CD1 . PHE A 1 495 ? 22.752  60.797 46.871 1.00 34.00 ? 495  PHE A CD1 1 
ATOM   3902 C CD2 . PHE A 1 495 ? 23.535  62.028 48.782 1.00 34.59 ? 495  PHE A CD2 1 
ATOM   3903 C CE1 . PHE A 1 495 ? 22.883  59.601 47.591 1.00 34.99 ? 495  PHE A CE1 1 
ATOM   3904 C CE2 . PHE A 1 495 ? 23.661  60.820 49.501 1.00 35.45 ? 495  PHE A CE2 1 
ATOM   3905 C CZ  . PHE A 1 495 ? 23.334  59.609 48.896 1.00 34.14 ? 495  PHE A CZ  1 
ATOM   3906 N N   . THR A 1 496 ? 25.405  61.709 44.769 1.00 38.90 ? 496  THR A N   1 
ATOM   3907 C CA  . THR A 1 496 ? 25.623  60.536 43.930 1.00 39.73 ? 496  THR A CA  1 
ATOM   3908 C C   . THR A 1 496 ? 25.886  59.337 44.806 1.00 41.23 ? 496  THR A C   1 
ATOM   3909 O O   . THR A 1 496 ? 26.428  59.471 45.904 1.00 40.67 ? 496  THR A O   1 
ATOM   3910 C CB  . THR A 1 496 ? 26.833  60.711 42.992 1.00 39.09 ? 496  THR A CB  1 
ATOM   3911 O OG1 . THR A 1 496 ? 28.028  60.961 43.789 1.00 39.84 ? 496  THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 496 ? 26.552  61.856 41.978 1.00 32.29 ? 496  THR A CG2 1 
ATOM   3913 N N   . THR A 1 497 ? 25.550  58.159 44.298 1.00 44.09 ? 497  THR A N   1 
ATOM   3914 C CA  . THR A 1 497 ? 25.743  56.942 45.089 1.00 46.15 ? 497  THR A CA  1 
ATOM   3915 C C   . THR A 1 497 ? 27.220  56.793 45.475 1.00 46.35 ? 497  THR A C   1 
ATOM   3916 O O   . THR A 1 497 ? 27.553  56.213 46.496 1.00 46.47 ? 497  THR A O   1 
ATOM   3917 C CB  . THR A 1 497 ? 25.173  55.661 44.343 1.00 46.73 ? 497  THR A CB  1 
ATOM   3918 O OG1 . THR A 1 497 ? 26.216  54.707 44.176 1.00 46.01 ? 497  THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 497 ? 24.592  56.006 42.971 1.00 45.75 ? 497  THR A CG2 1 
ATOM   3920 N N   . LYS A 1 498 ? 28.112  57.382 44.696 1.00 47.61 ? 498  LYS A N   1 
ATOM   3921 C CA  . LYS A 1 498 ? 29.514  57.290 45.052 1.00 47.78 ? 498  LYS A CA  1 
ATOM   3922 C C   . LYS A 1 498 ? 30.002  58.282 46.074 1.00 46.63 ? 498  LYS A C   1 
ATOM   3923 O O   . LYS A 1 498 ? 30.562  57.871 47.085 1.00 47.96 ? 498  LYS A O   1 
ATOM   3924 C CB  . LYS A 1 498 ? 30.398  57.450 43.848 1.00 50.60 ? 498  LYS A CB  1 
ATOM   3925 C CG  . LYS A 1 498 ? 31.816  57.109 44.146 1.00 54.51 ? 498  LYS A CG  1 
ATOM   3926 C CD  . LYS A 1 498 ? 32.716  57.709 43.066 1.00 61.35 ? 498  LYS A CD  1 
ATOM   3927 C CE  . LYS A 1 498 ? 34.180  57.439 43.386 1.00 63.80 ? 498  LYS A CE  1 
ATOM   3928 N NZ  . LYS A 1 498 ? 34.337  57.612 44.882 1.00 67.54 ? 498  LYS A NZ  1 
ATOM   3929 N N   . GLU A 1 499 ? 29.802  59.573 45.834 1.00 44.84 ? 499  GLU A N   1 
ATOM   3930 C CA  . GLU A 1 499 ? 30.322  60.602 46.741 1.00 44.03 ? 499  GLU A CA  1 
ATOM   3931 C C   . GLU A 1 499 ? 29.382  61.089 47.851 1.00 42.04 ? 499  GLU A C   1 
ATOM   3932 O O   . GLU A 1 499 ? 29.821  61.702 48.822 1.00 38.88 ? 499  GLU A O   1 
ATOM   3933 C CB  . GLU A 1 499 ? 30.853  61.759 45.902 1.00 47.54 ? 499  GLU A CB  1 
ATOM   3934 C CG  . GLU A 1 499 ? 31.671  61.224 44.721 1.00 54.88 ? 499  GLU A CG  1 
ATOM   3935 C CD  . GLU A 1 499 ? 32.895  62.056 44.411 1.00 61.07 ? 499  GLU A CD  1 
ATOM   3936 O OE1 . GLU A 1 499 ? 32.746  63.271 44.032 1.00 64.86 ? 499  GLU A OE1 1 
ATOM   3937 O OE2 . GLU A 1 499 ? 34.018  61.487 44.547 1.00 64.31 ? 499  GLU A OE2 1 
ATOM   3938 N N   . GLN A 1 500 ? 28.093  60.781 47.707 1.00 40.61 ? 500  GLN A N   1 
ATOM   3939 C CA  . GLN A 1 500 ? 27.081  61.107 48.710 1.00 39.19 ? 500  GLN A CA  1 
ATOM   3940 C C   . GLN A 1 500 ? 27.119  62.508 49.325 1.00 36.01 ? 500  GLN A C   1 
ATOM   3941 O O   . GLN A 1 500 ? 26.996  62.679 50.507 1.00 34.79 ? 500  GLN A O   1 
ATOM   3942 C CB  . GLN A 1 500 ? 27.142  60.022 49.795 1.00 40.99 ? 500  GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 500 ? 26.847  58.664 49.199 1.00 44.19 ? 500  GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 500 ? 27.206  57.494 50.116 1.00 47.14 ? 500  GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 500 ? 26.743  57.418 51.260 1.00 47.23 ? 500  GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 500 ? 28.032  56.563 49.603 1.00 46.50 ? 500  GLN A NE2 1 
ATOM   3947 N N   . LYS A 1 501 ? 27.242  63.526 48.506 1.00 35.52 ? 501  LYS A N   1 
ATOM   3948 C CA  . LYS A 1 501 ? 27.325  64.867 49.039 1.00 34.70 ? 501  LYS A CA  1 
ATOM   3949 C C   . LYS A 1 501 ? 25.965  65.434 49.414 1.00 34.19 ? 501  LYS A C   1 
ATOM   3950 O O   . LYS A 1 501 ? 24.916  65.034 48.859 1.00 32.16 ? 501  LYS A O   1 
ATOM   3951 C CB  . LYS A 1 501 ? 27.994  65.793 48.017 1.00 35.05 ? 501  LYS A CB  1 
ATOM   3952 C CG  . LYS A 1 501 ? 29.338  65.281 47.482 1.00 37.27 ? 501  LYS A CG  1 
ATOM   3953 C CD  . LYS A 1 501 ? 29.902  66.273 46.406 1.00 39.07 ? 501  LYS A CD  1 
ATOM   3954 C CE  . LYS A 1 501 ? 31.382  65.969 46.001 1.00 39.81 ? 501  LYS A CE  1 
ATOM   3955 N NZ  . LYS A 1 501 ? 31.835  66.881 44.891 1.00 41.91 ? 501  LYS A NZ  1 
ATOM   3956 N N   . PHE A 1 502 ? 26.002  66.365 50.366 1.00 32.18 ? 502  PHE A N   1 
ATOM   3957 C CA  . PHE A 1 502 ? 24.816  67.073 50.785 1.00 32.96 ? 502  PHE A CA  1 
ATOM   3958 C C   . PHE A 1 502 ? 25.327  68.431 51.296 1.00 34.50 ? 502  PHE A C   1 
ATOM   3959 O O   . PHE A 1 502 ? 26.549  68.631 51.419 1.00 34.68 ? 502  PHE A O   1 
ATOM   3960 C CB  . PHE A 1 502 ? 24.097  66.303 51.885 1.00 31.14 ? 502  PHE A CB  1 
ATOM   3961 C CG  . PHE A 1 502 ? 24.851  66.239 53.205 1.00 29.78 ? 502  PHE A CG  1 
ATOM   3962 C CD1 . PHE A 1 502 ? 24.564  67.157 54.232 1.00 28.37 ? 502  PHE A CD1 1 
ATOM   3963 C CD2 . PHE A 1 502 ? 25.769  65.194 53.452 1.00 28.63 ? 502  PHE A CD2 1 
ATOM   3964 C CE1 . PHE A 1 502 ? 25.167  67.027 55.508 1.00 28.23 ? 502  PHE A CE1 1 
ATOM   3965 C CE2 . PHE A 1 502 ? 26.382  65.053 54.708 1.00 28.20 ? 502  PHE A CE2 1 
ATOM   3966 C CZ  . PHE A 1 502 ? 26.076  65.969 55.749 1.00 26.56 ? 502  PHE A CZ  1 
ATOM   3967 N N   . ILE A 1 503 ? 24.424  69.365 51.559 1.00 33.49 ? 503  ILE A N   1 
ATOM   3968 C CA  . ILE A 1 503 ? 24.850  70.645 52.085 1.00 35.15 ? 503  ILE A CA  1 
ATOM   3969 C C   . ILE A 1 503 ? 24.116  70.931 53.418 1.00 36.74 ? 503  ILE A C   1 
ATOM   3970 O O   . ILE A 1 503 ? 23.087  70.305 53.741 1.00 36.49 ? 503  ILE A O   1 
ATOM   3971 C CB  . ILE A 1 503 ? 24.539  71.841 51.081 1.00 33.87 ? 503  ILE A CB  1 
ATOM   3972 C CG1 . ILE A 1 503 ? 23.031  71.899 50.788 1.00 34.50 ? 503  ILE A CG1 1 
ATOM   3973 C CG2 . ILE A 1 503 ? 25.302  71.684 49.772 1.00 31.25 ? 503  ILE A CG2 1 
ATOM   3974 C CD1 . ILE A 1 503 ? 22.603  73.187 50.188 1.00 35.29 ? 503  ILE A CD1 1 
ATOM   3975 N N   . ASP A 1 504 ? 24.665  71.870 54.178 1.00 37.55 ? 504  ASP A N   1 
ATOM   3976 C CA  . ASP A 1 504 ? 24.049  72.312 55.400 1.00 40.09 ? 504  ASP A CA  1 
ATOM   3977 C C   . ASP A 1 504 ? 23.141  73.405 54.861 1.00 41.00 ? 504  ASP A C   1 
ATOM   3978 O O   . ASP A 1 504 ? 23.416  73.966 53.811 1.00 41.77 ? 504  ASP A O   1 
ATOM   3979 C CB  . ASP A 1 504 ? 25.056  72.966 56.351 1.00 41.54 ? 504  ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 504 ? 25.926  71.951 57.110 1.00 45.33 ? 504  ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 504 ? 25.448  70.822 57.360 1.00 46.95 ? 504  ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 504 ? 27.085  72.284 57.496 1.00 47.26 ? 504  ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 505 ? 22.054  73.704 55.548 1.00 40.98 ? 505  LEU A N   1 
ATOM   3984 C CA  . LEU A 1 505 ? 21.193  74.790 55.116 1.00 41.12 ? 505  LEU A CA  1 
ATOM   3985 C C   . LEU A 1 505 ? 21.112  75.680 56.365 1.00 42.34 ? 505  LEU A C   1 
ATOM   3986 O O   . LEU A 1 505 ? 20.461  75.318 57.347 1.00 42.33 ? 505  LEU A O   1 
ATOM   3987 C CB  . LEU A 1 505 ? 19.830  74.236 54.769 1.00 40.35 ? 505  LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 505 ? 19.095  74.687 53.513 1.00 40.46 ? 505  LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 505 ? 20.035  74.923 52.332 1.00 37.84 ? 505  LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 505 ? 18.076  73.603 53.207 1.00 36.73 ? 505  LEU A CD2 1 
ATOM   3991 N N   . ASN A 1 506 ? 21.832  76.796 56.382 1.00 42.73 ? 506  ASN A N   1 
ATOM   3992 C CA  . ASN A 1 506 ? 21.756  77.688 57.540 1.00 44.75 ? 506  ASN A CA  1 
ATOM   3993 C C   . ASN A 1 506 ? 22.200  79.050 57.048 1.00 46.11 ? 506  ASN A C   1 
ATOM   3994 O O   . ASN A 1 506 ? 22.413  79.219 55.837 1.00 47.64 ? 506  ASN A O   1 
ATOM   3995 C CB  . ASN A 1 506 ? 22.639  77.201 58.694 1.00 43.00 ? 506  ASN A CB  1 
ATOM   3996 C CG  . ASN A 1 506 ? 24.064  76.992 58.258 1.00 43.58 ? 506  ASN A CG  1 
ATOM   3997 O OD1 . ASN A 1 506 ? 24.613  77.845 57.591 1.00 41.59 ? 506  ASN A OD1 1 
ATOM   3998 N ND2 . ASN A 1 506 ? 24.669  75.848 58.617 1.00 42.54 ? 506  ASN A ND2 1 
ATOM   3999 N N   . THR A 1 507 ? 22.350  80.008 57.955 1.00 47.03 ? 507  THR A N   1 
ATOM   4000 C CA  . THR A 1 507 ? 22.723  81.370 57.571 1.00 48.53 ? 507  THR A CA  1 
ATOM   4001 C C   . THR A 1 507 ? 24.202  81.609 57.221 1.00 49.99 ? 507  THR A C   1 
ATOM   4002 O O   . THR A 1 507 ? 24.582  82.734 56.931 1.00 50.31 ? 507  THR A O   1 
ATOM   4003 C CB  . THR A 1 507 ? 22.313  82.393 58.673 1.00 48.78 ? 507  THR A CB  1 
ATOM   4004 O OG1 . THR A 1 507 ? 22.945  82.024 59.909 1.00 49.76 ? 507  THR A OG1 1 
ATOM   4005 C CG2 . THR A 1 507 ? 20.781  82.432 58.881 1.00 47.58 ? 507  THR A CG2 1 
ATOM   4006 N N   . GLU A 1 508 ? 25.024  80.568 57.218 1.00 51.57 ? 508  GLU A N   1 
ATOM   4007 C CA  . GLU A 1 508 ? 26.444  80.712 56.911 1.00 53.59 ? 508  GLU A CA  1 
ATOM   4008 C C   . GLU A 1 508 ? 26.770  80.235 55.506 1.00 53.75 ? 508  GLU A C   1 
ATOM   4009 O O   . GLU A 1 508 ? 25.938  79.608 54.829 1.00 54.34 ? 508  GLU A O   1 
ATOM   4010 C CB  . GLU A 1 508 ? 27.269  79.948 57.946 1.00 56.51 ? 508  GLU A CB  1 
ATOM   4011 C CG  . GLU A 1 508 ? 26.798  80.253 59.365 1.00 63.42 ? 508  GLU A CG  1 
ATOM   4012 C CD  . GLU A 1 508 ? 27.194  79.162 60.358 1.00 69.18 ? 508  GLU A CD  1 
ATOM   4013 O OE1 . GLU A 1 508 ? 26.271  78.515 60.968 1.00 71.08 ? 508  GLU A OE1 1 
ATOM   4014 O OE2 . GLU A 1 508 ? 28.434  78.949 60.516 1.00 70.99 ? 508  GLU A OE2 1 
ATOM   4015 N N   . PRO A 1 509 ? 27.988  80.525 55.035 1.00 53.82 ? 509  PRO A N   1 
ATOM   4016 C CA  . PRO A 1 509 ? 28.390  80.116 53.689 1.00 53.54 ? 509  PRO A CA  1 
ATOM   4017 C C   . PRO A 1 509 ? 28.188  78.638 53.466 1.00 53.46 ? 509  PRO A C   1 
ATOM   4018 O O   . PRO A 1 509 ? 28.647  77.811 54.248 1.00 52.65 ? 509  PRO A O   1 
ATOM   4019 C CB  . PRO A 1 509 ? 29.868  80.508 53.631 1.00 53.30 ? 509  PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 509 ? 29.939  81.666 54.521 1.00 53.52 ? 509  PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 509 ? 29.095  81.225 55.705 1.00 54.00 ? 509  PRO A CD  1 
ATOM   4022 N N   . MET A 1 510 ? 27.511  78.303 52.383 1.00 54.22 ? 510  MET A N   1 
ATOM   4023 C CA  . MET A 1 510 ? 27.265  76.913 52.079 1.00 54.89 ? 510  MET A CA  1 
ATOM   4024 C C   . MET A 1 510 ? 28.509  76.049 52.302 1.00 55.53 ? 510  MET A C   1 
ATOM   4025 O O   . MET A 1 510 ? 29.625  76.386 51.896 1.00 55.11 ? 510  MET A O   1 
ATOM   4026 C CB  . MET A 1 510 ? 26.802  76.760 50.639 1.00 55.71 ? 510  MET A CB  1 
ATOM   4027 C CG  . MET A 1 510 ? 26.403  75.354 50.274 1.00 54.11 ? 510  MET A CG  1 
ATOM   4028 S SD  . MET A 1 510 ? 26.205  75.204 48.523 1.00 55.24 ? 510  MET A SD  1 
ATOM   4029 C CE  . MET A 1 510 ? 24.682  76.106 48.292 1.00 52.70 ? 510  MET A CE  1 
ATOM   4030 N N   . LYS A 1 511 ? 28.296  74.926 52.974 1.00 55.48 ? 511  LYS A N   1 
ATOM   4031 C CA  . LYS A 1 511 ? 29.362  73.979 53.255 1.00 54.31 ? 511  LYS A CA  1 
ATOM   4032 C C   . LYS A 1 511 ? 28.838  72.582 52.761 1.00 52.17 ? 511  LYS A C   1 
ATOM   4033 O O   . LYS A 1 511 ? 27.705  72.164 53.060 1.00 51.87 ? 511  LYS A O   1 
ATOM   4034 C CB  . LYS A 1 511 ? 29.666  74.032 54.769 1.00 55.99 ? 511  LYS A CB  1 
ATOM   4035 C CG  . LYS A 1 511 ? 30.910  73.298 55.198 1.00 60.42 ? 511  LYS A CG  1 
ATOM   4036 C CD  . LYS A 1 511 ? 31.922  74.214 55.963 1.00 64.18 ? 511  LYS A CD  1 
ATOM   4037 C CE  . LYS A 1 511 ? 31.364  74.789 57.299 1.00 65.77 ? 511  LYS A CE  1 
ATOM   4038 N NZ  . LYS A 1 511 ? 32.474  75.225 58.249 1.00 66.16 ? 511  LYS A NZ  1 
ATOM   4039 N N   . VAL A 1 512 ? 29.648  71.910 51.955 1.00 48.17 ? 512  VAL A N   1 
ATOM   4040 C CA  . VAL A 1 512 ? 29.321  70.612 51.403 1.00 45.34 ? 512  VAL A CA  1 
ATOM   4041 C C   . VAL A 1 512 ? 29.966  69.537 52.259 1.00 45.75 ? 512  VAL A C   1 
ATOM   4042 O O   . VAL A 1 512 ? 31.151  69.637 52.567 1.00 46.61 ? 512  VAL A O   1 
ATOM   4043 C CB  . VAL A 1 512 ? 29.913  70.450 49.956 1.00 43.93 ? 512  VAL A CB  1 
ATOM   4044 C CG1 . VAL A 1 512 ? 29.812  69.006 49.485 1.00 38.74 ? 512  VAL A CG1 1 
ATOM   4045 C CG2 . VAL A 1 512 ? 29.230  71.437 48.980 1.00 41.80 ? 512  VAL A CG2 1 
ATOM   4046 N N   . HIS A 1 513 ? 29.202  68.508 52.626 1.00 44.34 ? 513  HIS A N   1 
ATOM   4047 C CA  . HIS A 1 513 ? 29.724  67.371 53.389 1.00 43.20 ? 513  HIS A CA  1 
ATOM   4048 C C   . HIS A 1 513 ? 29.360  66.095 52.662 1.00 43.55 ? 513  HIS A C   1 
ATOM   4049 O O   . HIS A 1 513 ? 28.686  66.119 51.600 1.00 43.84 ? 513  HIS A O   1 
ATOM   4050 C CB  . HIS A 1 513 ? 29.102  67.277 54.757 1.00 41.83 ? 513  HIS A CB  1 
ATOM   4051 C CG  . HIS A 1 513 ? 29.021  68.578 55.462 1.00 40.93 ? 513  HIS A CG  1 
ATOM   4052 N ND1 . HIS A 1 513 ? 29.993  69.004 56.336 1.00 40.35 ? 513  HIS A ND1 1 
ATOM   4053 C CD2 . HIS A 1 513 ? 28.046  69.516 55.485 1.00 40.57 ? 513  HIS A CD2 1 
ATOM   4054 C CE1 . HIS A 1 513 ? 29.616  70.144 56.883 1.00 40.52 ? 513  HIS A CE1 1 
ATOM   4055 N NE2 . HIS A 1 513 ? 28.440  70.479 56.382 1.00 42.53 ? 513  HIS A NE2 1 
ATOM   4056 N N   . GLN A 1 514 ? 29.768  64.976 53.265 1.00 43.04 ? 514  GLN A N   1 
ATOM   4057 C CA  . GLN A 1 514 ? 29.500  63.650 52.697 1.00 41.89 ? 514  GLN A CA  1 
ATOM   4058 C C   . GLN A 1 514 ? 29.092  62.679 53.758 1.00 39.04 ? 514  GLN A C   1 
ATOM   4059 O O   . GLN A 1 514 ? 29.372  62.902 54.913 1.00 36.15 ? 514  GLN A O   1 
ATOM   4060 C CB  . GLN A 1 514 ? 30.733  63.101 51.997 1.00 42.61 ? 514  GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 514 ? 31.038  63.872 50.762 1.00 45.75 ? 514  GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 514 ? 32.407  63.544 50.216 1.00 46.60 ? 514  GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 514 ? 33.414  64.175 50.590 1.00 47.99 ? 514  GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 514 ? 32.463  62.540 49.342 1.00 44.62 ? 514  GLN A NE2 1 
ATOM   4065 N N   . ARG A 1 515 ? 28.428  61.612 53.308 1.00 38.16 ? 515  ARG A N   1 
ATOM   4066 C CA  . ARG A 1 515 ? 27.931  60.529 54.139 1.00 36.33 ? 515  ARG A CA  1 
ATOM   4067 C C   . ARG A 1 515 ? 27.181  60.963 55.402 1.00 34.38 ? 515  ARG A C   1 
ATOM   4068 O O   . ARG A 1 515 ? 27.591  60.669 56.528 1.00 30.95 ? 515  ARG A O   1 
ATOM   4069 C CB  . ARG A 1 515 ? 29.097  59.628 54.472 1.00 39.16 ? 515  ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 515 ? 29.626  58.807 53.265 1.00 44.01 ? 515  ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 515 ? 30.975  58.296 53.676 1.00 49.09 ? 515  ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 515 ? 31.264  56.918 53.320 1.00 53.12 ? 515  ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 515 ? 31.649  56.558 52.113 1.00 54.46 ? 515  ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 515 ? 31.925  55.286 51.818 1.00 54.74 ? 515  ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 515 ? 31.751  57.506 51.203 1.00 57.23 ? 515  ARG A NH2 1 
ATOM   4076 N N   . LEU A 1 516 ? 26.071  61.675 55.191 1.00 32.69 ? 516  LEU A N   1 
ATOM   4077 C CA  . LEU A 1 516 ? 25.246  62.152 56.292 1.00 32.29 ? 516  LEU A CA  1 
ATOM   4078 C C   . LEU A 1 516 ? 24.952  61.053 57.336 1.00 31.81 ? 516  LEU A C   1 
ATOM   4079 O O   . LEU A 1 516 ? 24.253  60.065 57.074 1.00 30.51 ? 516  LEU A O   1 
ATOM   4080 C CB  . LEU A 1 516 ? 23.951  62.751 55.727 1.00 30.53 ? 516  LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 516 ? 22.674  63.212 56.453 1.00 31.24 ? 516  LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 516 ? 22.791  63.308 57.909 1.00 30.27 ? 516  LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 516 ? 22.279  64.567 55.839 1.00 30.28 ? 516  LEU A CD2 1 
ATOM   4084 N N   . ARG A 1 517 ? 25.494  61.271 58.524 1.00 31.14 ? 517  ARG A N   1 
ATOM   4085 C CA  . ARG A 1 517 ? 25.354  60.365 59.662 1.00 32.17 ? 517  ARG A CA  1 
ATOM   4086 C C   . ARG A 1 517 ? 25.562  58.898 59.367 1.00 32.12 ? 517  ARG A C   1 
ATOM   4087 O O   . ARG A 1 517 ? 24.862  58.037 59.957 1.00 31.24 ? 517  ARG A O   1 
ATOM   4088 C CB  . ARG A 1 517 ? 24.001  60.629 60.378 1.00 32.81 ? 517  ARG A CB  1 
ATOM   4089 C CG  . ARG A 1 517 ? 24.025  62.090 61.022 1.00 32.40 ? 517  ARG A CG  1 
ATOM   4090 C CD  . ARG A 1 517 ? 22.896  62.394 61.991 1.00 34.64 ? 517  ARG A CD  1 
ATOM   4091 N NE  . ARG A 1 517 ? 22.817  61.514 63.169 1.00 35.05 ? 517  ARG A NE  1 
ATOM   4092 C CZ  . ARG A 1 517 ? 23.543  61.664 64.281 1.00 34.60 ? 517  ARG A CZ  1 
ATOM   4093 N NH1 . ARG A 1 517 ? 24.397  62.658 64.318 1.00 34.31 ? 517  ARG A NH1 1 
ATOM   4094 N NH2 . ARG A 1 517 ? 23.389  60.866 65.372 1.00 31.79 ? 517  ARG A NH2 1 
ATOM   4095 N N   . VAL A 1 518 ? 26.542  58.601 58.482 1.00 31.51 ? 518  VAL A N   1 
ATOM   4096 C CA  . VAL A 1 518 ? 26.787  57.206 58.119 1.00 30.91 ? 518  VAL A CA  1 
ATOM   4097 C C   . VAL A 1 518 ? 27.032  56.328 59.327 1.00 31.21 ? 518  VAL A C   1 
ATOM   4098 O O   . VAL A 1 518 ? 26.536  55.236 59.346 1.00 31.41 ? 518  VAL A O   1 
ATOM   4099 C CB  . VAL A 1 518 ? 28.072  56.930 57.399 1.00 32.29 ? 518  VAL A CB  1 
ATOM   4100 C CG1 . VAL A 1 518 ? 27.805  56.420 56.038 1.00 31.33 ? 518  VAL A CG1 1 
ATOM   4101 C CG2 . VAL A 1 518 ? 29.028  58.075 57.601 1.00 27.98 ? 518  VAL A CG2 1 
ATOM   4102 N N   . GLN A 1 519 ? 27.884  56.776 60.268 1.00 31.19 ? 519  GLN A N   1 
ATOM   4103 C CA  . GLN A 1 519 ? 28.227  55.977 61.434 1.00 32.03 ? 519  GLN A CA  1 
ATOM   4104 C C   . GLN A 1 519 ? 26.974  55.439 62.125 1.00 32.29 ? 519  GLN A C   1 
ATOM   4105 O O   . GLN A 1 519 ? 26.842  54.257 62.312 1.00 32.32 ? 519  GLN A O   1 
ATOM   4106 C CB  . GLN A 1 519 ? 29.080  56.777 62.432 1.00 31.78 ? 519  GLN A CB  1 
ATOM   4107 C CG  . GLN A 1 519 ? 29.912  55.873 63.331 1.00 33.19 ? 519  GLN A CG  1 
ATOM   4108 C CD  . GLN A 1 519 ? 30.943  55.060 62.501 1.00 37.58 ? 519  GLN A CD  1 
ATOM   4109 O OE1 . GLN A 1 519 ? 31.566  55.593 61.533 1.00 35.50 ? 519  GLN A OE1 1 
ATOM   4110 N NE2 . GLN A 1 519 ? 31.120  53.777 62.855 1.00 36.73 ? 519  GLN A NE2 1 
ATOM   4111 N N   . MET A 1 520 ? 26.046  56.311 62.486 1.00 31.70 ? 520  MET A N   1 
ATOM   4112 C CA  . MET A 1 520 ? 24.834  55.840 63.125 1.00 33.12 ? 520  MET A CA  1 
ATOM   4113 C C   . MET A 1 520 ? 23.906  55.091 62.158 1.00 32.83 ? 520  MET A C   1 
ATOM   4114 O O   . MET A 1 520 ? 23.293  54.109 62.533 1.00 34.03 ? 520  MET A O   1 
ATOM   4115 C CB  . MET A 1 520 ? 24.066  57.024 63.761 1.00 33.07 ? 520  MET A CB  1 
ATOM   4116 C CG  . MET A 1 520 ? 24.853  57.707 64.854 1.00 35.01 ? 520  MET A CG  1 
ATOM   4117 S SD  . MET A 1 520 ? 25.314  56.551 66.221 1.00 37.80 ? 520  MET A SD  1 
ATOM   4118 C CE  . MET A 1 520 ? 27.180  56.526 65.947 1.00 35.52 ? 520  MET A CE  1 
ATOM   4119 N N   . CYS A 1 521 ? 23.790  55.538 60.920 1.00 31.16 ? 521  CYS A N   1 
ATOM   4120 C CA  . CYS A 1 521 ? 22.877  54.861 60.045 1.00 31.30 ? 521  CYS A CA  1 
ATOM   4121 C C   . CYS A 1 521 ? 23.361  53.482 59.631 1.00 32.59 ? 521  CYS A C   1 
ATOM   4122 O O   . CYS A 1 521 ? 22.541  52.649 59.239 1.00 33.59 ? 521  CYS A O   1 
ATOM   4123 C CB  . CYS A 1 521 ? 22.542  55.750 58.843 1.00 30.78 ? 521  CYS A CB  1 
ATOM   4124 S SG  . CYS A 1 521 ? 21.566  57.239 59.359 1.00 34.48 ? 521  CYS A SG  1 
ATOM   4125 N N   . VAL A 1 522 ? 24.667  53.183 59.712 1.00 32.13 ? 522  VAL A N   1 
ATOM   4126 C CA  . VAL A 1 522 ? 25.063  51.818 59.351 1.00 30.12 ? 522  VAL A CA  1 
ATOM   4127 C C   . VAL A 1 522 ? 24.531  50.972 60.505 1.00 30.39 ? 522  VAL A C   1 
ATOM   4128 O O   . VAL A 1 522 ? 24.085  49.830 60.318 1.00 31.27 ? 522  VAL A O   1 
ATOM   4129 C CB  . VAL A 1 522 ? 26.612  51.645 59.220 1.00 31.83 ? 522  VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 522 ? 26.994  50.109 59.251 1.00 26.65 ? 522  VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 522 ? 27.099  52.276 57.878 1.00 27.19 ? 522  VAL A CG2 1 
ATOM   4132 N N   . PHE A 1 523 ? 24.564  51.535 61.713 1.00 28.58 ? 523  PHE A N   1 
ATOM   4133 C CA  . PHE A 1 523 ? 24.009  50.812 62.862 1.00 27.54 ? 523  PHE A CA  1 
ATOM   4134 C C   . PHE A 1 523 ? 22.496  50.538 62.683 1.00 27.11 ? 523  PHE A C   1 
ATOM   4135 O O   . PHE A 1 523 ? 22.073  49.394 62.788 1.00 27.08 ? 523  PHE A O   1 
ATOM   4136 C CB  . PHE A 1 523 ? 24.229  51.598 64.173 1.00 26.41 ? 523  PHE A CB  1 
ATOM   4137 C CG  . PHE A 1 523 ? 23.473  51.054 65.323 1.00 24.48 ? 523  PHE A CG  1 
ATOM   4138 C CD1 . PHE A 1 523 ? 23.955  49.966 66.029 1.00 26.75 ? 523  PHE A CD1 1 
ATOM   4139 C CD2 . PHE A 1 523 ? 22.255  51.622 65.698 1.00 25.34 ? 523  PHE A CD2 1 
ATOM   4140 C CE1 . PHE A 1 523 ? 23.264  49.421 67.120 1.00 23.14 ? 523  PHE A CE1 1 
ATOM   4141 C CE2 . PHE A 1 523 ? 21.540  51.096 66.779 1.00 25.70 ? 523  PHE A CE2 1 
ATOM   4142 C CZ  . PHE A 1 523 ? 22.065  49.978 67.495 1.00 27.59 ? 523  PHE A CZ  1 
ATOM   4143 N N   . TRP A 1 524 ? 21.695  51.574 62.434 1.00 25.71 ? 524  TRP A N   1 
ATOM   4144 C CA  . TRP A 1 524 ? 20.257  51.391 62.263 1.00 27.37 ? 524  TRP A CA  1 
ATOM   4145 C C   . TRP A 1 524 ? 19.799  50.714 60.983 1.00 28.16 ? 524  TRP A C   1 
ATOM   4146 O O   . TRP A 1 524 ? 18.806  50.062 60.983 1.00 29.28 ? 524  TRP A O   1 
ATOM   4147 C CB  . TRP A 1 524 ? 19.492  52.708 62.327 1.00 25.09 ? 524  TRP A CB  1 
ATOM   4148 C CG  . TRP A 1 524 ? 19.587  53.387 63.635 1.00 25.09 ? 524  TRP A CG  1 
ATOM   4149 C CD1 . TRP A 1 524 ? 20.386  54.439 63.956 1.00 24.07 ? 524  TRP A CD1 1 
ATOM   4150 C CD2 . TRP A 1 524 ? 18.871  53.037 64.815 1.00 23.49 ? 524  TRP A CD2 1 
ATOM   4151 N NE1 . TRP A 1 524 ? 20.216  54.764 65.279 1.00 25.61 ? 524  TRP A NE1 1 
ATOM   4152 C CE2 . TRP A 1 524 ? 19.288  53.915 65.828 1.00 24.04 ? 524  TRP A CE2 1 
ATOM   4153 C CE3 . TRP A 1 524 ? 17.911  52.070 65.109 1.00 23.13 ? 524  TRP A CE3 1 
ATOM   4154 C CZ2 . TRP A 1 524 ? 18.780  53.854 67.129 1.00 24.72 ? 524  TRP A CZ2 1 
ATOM   4155 C CZ3 . TRP A 1 524 ? 17.400  52.013 66.377 1.00 26.48 ? 524  TRP A CZ3 1 
ATOM   4156 C CH2 . TRP A 1 524 ? 17.835  52.900 67.384 1.00 26.24 ? 524  TRP A CH2 1 
ATOM   4157 N N   . ASN A 1 525 ? 20.500  50.875 59.892 1.00 29.61 ? 525  ASN A N   1 
ATOM   4158 C CA  . ASN A 1 525 ? 20.037  50.273 58.658 1.00 32.29 ? 525  ASN A CA  1 
ATOM   4159 C C   . ASN A 1 525 ? 20.654  48.921 58.371 1.00 34.10 ? 525  ASN A C   1 
ATOM   4160 O O   . ASN A 1 525 ? 20.078  48.153 57.643 1.00 32.96 ? 525  ASN A O   1 
ATOM   4161 C CB  . ASN A 1 525 ? 20.289  51.207 57.468 1.00 30.81 ? 525  ASN A CB  1 
ATOM   4162 C CG  . ASN A 1 525 ? 19.529  52.517 57.601 1.00 32.89 ? 525  ASN A CG  1 
ATOM   4163 O OD1 . ASN A 1 525 ? 18.521  52.594 58.337 1.00 34.58 ? 525  ASN A OD1 1 
ATOM   4164 N ND2 . ASN A 1 525 ? 19.986  53.550 56.892 1.00 30.38 ? 525  ASN A ND2 1 
ATOM   4165 N N   . GLN A 1 526 ? 21.804  48.624 58.960 1.00 35.40 ? 526  GLN A N   1 
ATOM   4166 C CA  . GLN A 1 526 ? 22.433  47.342 58.675 1.00 37.65 ? 526  GLN A CA  1 
ATOM   4167 C C   . GLN A 1 526 ? 22.585  46.436 59.906 1.00 36.44 ? 526  GLN A C   1 
ATOM   4168 O O   . GLN A 1 526 ? 22.032  45.325 59.949 1.00 36.82 ? 526  GLN A O   1 
ATOM   4169 C CB  . GLN A 1 526 ? 23.811  47.560 58.025 1.00 40.67 ? 526  GLN A CB  1 
ATOM   4170 C CG  . GLN A 1 526 ? 23.811  47.598 56.496 1.00 50.08 ? 526  GLN A CG  1 
ATOM   4171 C CD  . GLN A 1 526 ? 23.073  48.827 55.867 1.00 57.05 ? 526  GLN A CD  1 
ATOM   4172 O OE1 . GLN A 1 526 ? 23.357  50.006 56.216 1.00 61.48 ? 526  GLN A OE1 1 
ATOM   4173 N NE2 . GLN A 1 526 ? 22.144  48.557 54.911 1.00 57.58 ? 526  GLN A NE2 1 
ATOM   4174 N N   . PHE A 1 527 ? 23.305  46.917 60.919 1.00 33.88 ? 527  PHE A N   1 
ATOM   4175 C CA  . PHE A 1 527 ? 23.548  46.093 62.069 1.00 32.35 ? 527  PHE A CA  1 
ATOM   4176 C C   . PHE A 1 527 ? 22.349  45.740 62.977 1.00 32.67 ? 527  PHE A C   1 
ATOM   4177 O O   . PHE A 1 527 ? 22.090  44.548 63.194 1.00 31.92 ? 527  PHE A O   1 
ATOM   4178 C CB  . PHE A 1 527 ? 24.696  46.675 62.912 1.00 29.49 ? 527  PHE A CB  1 
ATOM   4179 C CG  . PHE A 1 527 ? 25.039  45.818 64.079 1.00 28.28 ? 527  PHE A CG  1 
ATOM   4180 C CD1 . PHE A 1 527 ? 25.752  44.608 63.897 1.00 29.34 ? 527  PHE A CD1 1 
ATOM   4181 C CD2 . PHE A 1 527 ? 24.585  46.143 65.339 1.00 26.12 ? 527  PHE A CD2 1 
ATOM   4182 C CE1 . PHE A 1 527 ? 25.991  43.750 64.956 1.00 27.65 ? 527  PHE A CE1 1 
ATOM   4183 C CE2 . PHE A 1 527 ? 24.811  45.307 66.405 1.00 27.12 ? 527  PHE A CE2 1 
ATOM   4184 C CZ  . PHE A 1 527 ? 25.519  44.093 66.220 1.00 28.68 ? 527  PHE A CZ  1 
ATOM   4185 N N   . LEU A 1 528 ? 21.628  46.738 63.510 1.00 32.80 ? 528  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 528 ? 20.510  46.444 64.402 1.00 33.55 ? 528  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 528 ? 19.499  45.449 63.767 1.00 35.82 ? 528  LEU A C   1 
ATOM   4188 O O   . LEU A 1 528 ? 19.067  44.495 64.395 1.00 36.41 ? 528  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 528 ? 19.808  47.735 64.826 1.00 30.31 ? 528  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 528 ? 18.694  47.467 65.855 1.00 31.27 ? 528  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 528 ? 19.302  46.624 67.094 1.00 27.86 ? 528  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 528 ? 18.078  48.796 66.331 1.00 26.68 ? 528  LEU A CD2 1 
ATOM   4193 N N   . PRO A 1 529 ? 19.114  45.674 62.507 1.00 37.48 ? 529  PRO A N   1 
ATOM   4194 C CA  . PRO A 1 529 ? 18.167  44.751 61.865 1.00 38.98 ? 529  PRO A CA  1 
ATOM   4195 C C   . PRO A 1 529 ? 18.699  43.329 61.771 1.00 39.89 ? 529  PRO A C   1 
ATOM   4196 O O   . PRO A 1 529 ? 17.962  42.358 62.040 1.00 41.34 ? 529  PRO A O   1 
ATOM   4197 C CB  . PRO A 1 529 ? 17.945  45.376 60.491 1.00 37.75 ? 529  PRO A CB  1 
ATOM   4198 C CG  . PRO A 1 529 ? 18.039  46.846 60.816 1.00 37.74 ? 529  PRO A CG  1 
ATOM   4199 C CD  . PRO A 1 529 ? 19.237  46.929 61.743 1.00 36.50 ? 529  PRO A CD  1 
ATOM   4200 N N   . LYS A 1 530 ? 19.959  43.170 61.381 1.00 40.17 ? 530  LYS A N   1 
ATOM   4201 C CA  . LYS A 1 530 ? 20.503  41.812 61.337 1.00 40.46 ? 530  LYS A CA  1 
ATOM   4202 C C   . LYS A 1 530 ? 20.483  41.216 62.750 1.00 40.42 ? 530  LYS A C   1 
ATOM   4203 O O   . LYS A 1 530 ? 20.143  40.065 62.918 1.00 40.88 ? 530  LYS A O   1 
ATOM   4204 C CB  . LYS A 1 530 ? 21.916  41.801 60.795 1.00 42.00 ? 530  LYS A CB  1 
ATOM   4205 C CG  . LYS A 1 530 ? 22.487  40.406 60.610 1.00 44.66 ? 530  LYS A CG  1 
ATOM   4206 C CD  . LYS A 1 530 ? 23.712  40.456 59.642 1.00 47.28 ? 530  LYS A CD  1 
ATOM   4207 C CE  . LYS A 1 530 ? 24.220  39.040 59.308 1.00 49.55 ? 530  LYS A CE  1 
ATOM   4208 N NZ  . LYS A 1 530 ? 25.678  38.932 58.990 1.00 49.96 ? 530  LYS A NZ  1 
ATOM   4209 N N   . LEU A 1 531 ? 20.801  42.013 63.765 1.00 38.84 ? 531  LEU A N   1 
ATOM   4210 C CA  . LEU A 1 531 ? 20.792  41.526 65.128 1.00 38.99 ? 531  LEU A CA  1 
ATOM   4211 C C   . LEU A 1 531 ? 19.416  41.088 65.593 1.00 39.80 ? 531  LEU A C   1 
ATOM   4212 O O   . LEU A 1 531 ? 19.277  39.997 66.145 1.00 38.62 ? 531  LEU A O   1 
ATOM   4213 C CB  . LEU A 1 531 ? 21.379  42.608 66.039 1.00 37.51 ? 531  LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 531 ? 21.140  42.917 67.521 1.00 36.04 ? 531  LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 531 ? 20.080  42.107 68.144 1.00 33.44 ? 531  LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 531 ? 22.451  42.847 68.226 1.00 35.99 ? 531  LEU A CD2 1 
ATOM   4217 N N   . LEU A 1 532 ? 18.410  41.935 65.396 1.00 41.18 ? 532  LEU A N   1 
ATOM   4218 C CA  . LEU A 1 532 ? 17.042  41.591 65.796 1.00 44.90 ? 532  LEU A CA  1 
ATOM   4219 C C   . LEU A 1 532 ? 16.523  40.328 65.043 1.00 47.62 ? 532  LEU A C   1 
ATOM   4220 O O   . LEU A 1 532 ? 15.815  39.508 65.626 1.00 47.91 ? 532  LEU A O   1 
ATOM   4221 C CB  . LEU A 1 532 ? 16.085  42.796 65.591 1.00 42.79 ? 532  LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 532 ? 16.333  44.012 66.494 1.00 41.47 ? 532  LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 532 ? 15.559  45.227 65.993 1.00 40.21 ? 532  LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 532 ? 15.998  43.659 67.927 1.00 40.53 ? 532  LEU A CD2 1 
ATOM   4225 N N   . ASN A 1 533 ? 16.912  40.151 63.779 1.00 50.94 ? 533  ASN A N   1 
ATOM   4226 C CA  . ASN A 1 533 ? 16.491  38.971 62.994 1.00 54.66 ? 533  ASN A CA  1 
ATOM   4227 C C   . ASN A 1 533 ? 17.184  37.672 63.440 1.00 55.47 ? 533  ASN A C   1 
ATOM   4228 O O   . ASN A 1 533 ? 16.610  36.606 63.322 1.00 55.53 ? 533  ASN A O   1 
ATOM   4229 C CB  . ASN A 1 533 ? 16.760  39.191 61.483 1.00 56.44 ? 533  ASN A CB  1 
ATOM   4230 C CG  . ASN A 1 533 ? 16.447  37.950 60.620 1.00 59.18 ? 533  ASN A CG  1 
ATOM   4231 O OD1 . ASN A 1 533 ? 15.284  37.550 60.468 1.00 61.59 ? 533  ASN A OD1 1 
ATOM   4232 N ND2 . ASN A 1 533 ? 17.486  37.352 60.043 1.00 60.36 ? 533  ASN A ND2 1 
ATOM   4233 N N   . ALA A 1 534 ? 18.410  37.753 63.934 1.00 56.64 ? 534  ALA A N   1 
ATOM   4234 C CA  . ALA A 1 534 ? 19.111  36.553 64.355 1.00 58.86 ? 534  ALA A CA  1 
ATOM   4235 C C   . ALA A 1 534 ? 18.474  36.018 65.615 1.00 61.43 ? 534  ALA A C   1 
ATOM   4236 O O   . ALA A 1 534 ? 18.101  34.841 65.706 1.00 61.87 ? 534  ALA A O   1 
ATOM   4237 C CB  . ALA A 1 534 ? 20.547  36.859 64.618 1.00 57.32 ? 534  ALA A CB  1 
ATOM   4238 N N   . THR A 1 535 ? 18.356  36.920 66.583 1.00 64.30 ? 535  THR A N   1 
ATOM   4239 C CA  . THR A 1 535 ? 17.790  36.641 67.897 1.00 65.59 ? 535  THR A CA  1 
ATOM   4240 C C   . THR A 1 535 ? 16.259  36.650 67.823 1.00 66.73 ? 535  THR A C   1 
ATOM   4241 O O   . THR A 1 535 ? 15.626  37.551 68.433 1.00 67.73 ? 535  THR A O   1 
ATOM   4242 C CB  . THR A 1 535 ? 18.286  37.710 68.946 1.00 66.53 ? 535  THR A CB  1 
ATOM   4243 O OG1 . THR A 1 535 ? 18.034  39.032 68.449 1.00 65.80 ? 535  THR A OG1 1 
ATOM   4244 C CG2 . THR A 1 535 ? 19.788  37.577 69.194 1.00 66.94 ? 535  THR A CG2 1 
HETATM 4245 C C1  . NAG B 2 .   ? -18.288 84.472 49.872 1.00 63.83 ? 1536 NAG A C1  1 
HETATM 4246 C C2  . NAG B 2 .   ? -19.238 85.652 49.553 1.00 66.43 ? 1536 NAG A C2  1 
HETATM 4247 C C3  . NAG B 2 .   ? -18.787 86.914 50.338 1.00 68.14 ? 1536 NAG A C3  1 
HETATM 4248 C C4  . NAG B 2 .   ? -18.847 86.632 51.835 1.00 68.73 ? 1536 NAG A C4  1 
HETATM 4249 C C5  . NAG B 2 .   ? -17.944 85.399 52.153 1.00 66.98 ? 1536 NAG A C5  1 
HETATM 4250 C C6  . NAG B 2 .   ? -17.961 84.993 53.656 1.00 65.81 ? 1536 NAG A C6  1 
HETATM 4251 C C7  . NAG B 2 .   ? -20.377 85.462 47.449 1.00 66.84 ? 1536 NAG A C7  1 
HETATM 4252 C C8  . NAG B 2 .   ? -20.705 86.148 46.128 1.00 64.59 ? 1536 NAG A C8  1 
HETATM 4253 N N2  . NAG B 2 .   ? -19.315 85.902 48.127 1.00 65.65 ? 1536 NAG A N2  1 
HETATM 4254 O O3  . NAG B 2 .   ? -19.632 88.025 50.064 1.00 69.35 ? 1536 NAG A O3  1 
HETATM 4255 O O4  . NAG B 2 .   ? -18.450 87.818 52.565 1.00 69.50 ? 1536 NAG A O4  1 
HETATM 4256 O O5  . NAG B 2 .   ? -18.330 84.232 51.323 1.00 66.57 ? 1536 NAG A O5  1 
HETATM 4257 O O6  . NAG B 2 .   ? -18.782 83.867 53.953 1.00 65.97 ? 1536 NAG A O6  1 
HETATM 4258 O O7  . NAG B 2 .   ? -21.095 84.528 47.854 1.00 67.14 ? 1536 NAG A O7  1 
HETATM 4259 C C1  . NAG C 2 .   ? 18.699  62.192 33.662 1.00 51.31 ? 1537 NAG A C1  1 
HETATM 4260 C C2  . NAG C 2 .   ? 20.230  62.034 33.734 1.00 53.94 ? 1537 NAG A C2  1 
HETATM 4261 C C3  . NAG C 2 .   ? 20.936  62.514 32.469 1.00 57.03 ? 1537 NAG A C3  1 
HETATM 4262 C C4  . NAG C 2 .   ? 20.258  61.946 31.199 1.00 59.90 ? 1537 NAG A C4  1 
HETATM 4263 C C5  . NAG C 2 .   ? 18.745  62.212 31.252 1.00 57.94 ? 1537 NAG A C5  1 
HETATM 4264 C C6  . NAG C 2 .   ? 17.971  61.649 30.049 1.00 55.73 ? 1537 NAG A C6  1 
HETATM 4265 C C7  . NAG C 2 .   ? 21.069  62.049 35.993 1.00 51.79 ? 1537 NAG A C7  1 
HETATM 4266 C C8  . NAG C 2 .   ? 21.589  62.835 37.190 1.00 48.72 ? 1537 NAG A C8  1 
HETATM 4267 N N2  . NAG C 2 .   ? 20.789  62.738 34.878 1.00 52.01 ? 1537 NAG A N2  1 
HETATM 4268 O O3  . NAG C 2 .   ? 22.298  62.086 32.523 1.00 56.98 ? 1537 NAG A O3  1 
HETATM 4269 O O4  . NAG C 2 .   ? 20.826  62.565 30.016 1.00 66.68 ? 1537 NAG A O4  1 
HETATM 4270 O O5  . NAG C 2 .   ? 18.194  61.614 32.449 1.00 55.91 ? 1537 NAG A O5  1 
HETATM 4271 O O6  . NAG C 2 .   ? 17.372  60.390 30.326 1.00 53.96 ? 1537 NAG A O6  1 
HETATM 4272 O O7  . NAG C 2 .   ? 20.911  60.806 36.081 1.00 49.85 ? 1537 NAG A O7  1 
HETATM 4273 C C1  . NAG D 2 .   ? 21.474  61.710 29.124 1.00 72.44 ? 1538 NAG A C1  1 
HETATM 4274 C C2  . NAG D 2 .   ? 21.477  62.299 27.702 1.00 74.56 ? 1538 NAG A C2  1 
HETATM 4275 C C3  . NAG D 2 .   ? 22.197  61.335 26.728 1.00 75.78 ? 1538 NAG A C3  1 
HETATM 4276 C C4  . NAG D 2 .   ? 23.570  60.878 27.264 1.00 76.34 ? 1538 NAG A C4  1 
HETATM 4277 C C5  . NAG D 2 .   ? 23.533  60.512 28.793 1.00 76.18 ? 1538 NAG A C5  1 
HETATM 4278 C C6  . NAG D 2 .   ? 24.929  60.452 29.394 1.00 76.52 ? 1538 NAG A C6  1 
HETATM 4279 C C7  . NAG D 2 .   ? 19.634  63.803 27.324 1.00 74.56 ? 1538 NAG A C7  1 
HETATM 4280 C C8  . NAG D 2 .   ? 18.222  64.051 26.784 1.00 72.65 ? 1538 NAG A C8  1 
HETATM 4281 N N2  . NAG D 2 .   ? 20.115  62.559 27.251 1.00 74.59 ? 1538 NAG A N2  1 
HETATM 4282 O O3  . NAG D 2 .   ? 22.395  61.988 25.476 1.00 77.13 ? 1538 NAG A O3  1 
HETATM 4283 O O4  . NAG D 2 .   ? 24.036  59.765 26.483 1.00 76.12 ? 1538 NAG A O4  1 
HETATM 4284 O O5  . NAG D 2 .   ? 22.829  61.529 29.563 1.00 74.63 ? 1538 NAG A O5  1 
HETATM 4285 O O6  . NAG D 2 .   ? 25.366  61.758 29.759 1.00 76.04 ? 1538 NAG A O6  1 
HETATM 4286 O O7  . NAG D 2 .   ? 20.296  64.744 27.807 1.00 73.65 ? 1538 NAG A O7  1 
HETATM 4287 N N1  . FBQ E 3 .   ? 4.933   69.410 63.417 1.00 32.36 ? 1539 FBQ A N1  1 
HETATM 4288 C C2  . FBQ E 3 .   ? 5.328   69.958 64.584 1.00 33.11 ? 1539 FBQ A C2  1 
HETATM 4289 C C3  . FBQ E 3 .   ? 4.425   69.998 65.689 1.00 33.64 ? 1539 FBQ A C3  1 
HETATM 4290 C C4  . FBQ E 3 .   ? 3.135   69.457 65.532 1.00 32.45 ? 1539 FBQ A C4  1 
HETATM 4291 C C5  . FBQ E 3 .   ? 2.732   68.866 64.281 1.00 34.45 ? 1539 FBQ A C5  1 
HETATM 4292 C C6  . FBQ E 3 .   ? 3.680   68.860 63.206 1.00 34.20 ? 1539 FBQ A C6  1 
HETATM 4293 C C7  . FBQ E 3 .   ? 4.892   70.609 66.936 1.00 35.00 ? 1539 FBQ A C7  1 
HETATM 4294 C C8  . FBQ E 3 .   ? 6.206   71.125 67.049 1.00 34.31 ? 1539 FBQ A C8  1 
HETATM 4295 C C9  . FBQ E 3 .   ? 7.057   71.051 65.935 1.00 34.94 ? 1539 FBQ A C9  1 
HETATM 4296 C C10 . FBQ E 3 .   ? 6.617   70.476 64.688 1.00 34.02 ? 1539 FBQ A C10 1 
HETATM 4297 N N11 . FBQ E 3 .   ? 2.214   69.459 66.574 1.00 32.93 ? 1539 FBQ A N11 1 
HETATM 4298 C C12 . FBQ E 3 .   ? 1.329   68.254 64.125 1.00 35.79 ? 1539 FBQ A C12 1 
HETATM 4299 S S13 . FBQ E 3 .   ? 1.447   66.484 64.783 1.00 39.06 ? 1539 FBQ A S13 1 
HETATM 4300 C C14 . FBQ E 3 .   ? 3.071   66.107 65.503 1.00 33.12 ? 1539 FBQ A C14 1 
HETATM 4301 C C15 . FBQ E 3 .   ? 4.221   65.875 64.546 1.00 30.70 ? 1539 FBQ A C15 1 
HETATM 4302 C C16 . FBQ E 3 .   ? 4.120   65.072 63.407 1.00 28.62 ? 1539 FBQ A C16 1 
HETATM 4303 C C17 . FBQ E 3 .   ? 5.269   64.868 62.583 1.00 27.46 ? 1539 FBQ A C17 1 
HETATM 4304 C C18 . FBQ E 3 .   ? 6.541   65.525 62.885 1.00 27.53 ? 1539 FBQ A C18 1 
HETATM 4305 C C19 . FBQ E 3 .   ? 6.654   66.346 64.027 1.00 28.36 ? 1539 FBQ A C19 1 
HETATM 4306 C C20 . FBQ E 3 .   ? 5.483   66.515 64.872 1.00 29.55 ? 1539 FBQ A C20 1 
HETATM 4307 C C21 . FBQ E 3 .   ? 5.257   63.971 61.406 1.00 27.17 ? 1539 FBQ A C21 1 
HETATM 4308 C C22 . FBQ E 3 .   ? 5.525   62.537 61.930 1.00 28.92 ? 1539 FBQ A C22 1 
HETATM 4309 F F23 . FBQ E 3 .   ? 5.435   61.532 60.975 1.00 30.36 ? 1539 FBQ A F23 1 
HETATM 4310 F F24 . FBQ E 3 .   ? 4.553   62.290 62.930 1.00 27.95 ? 1539 FBQ A F24 1 
HETATM 4311 F F25 . FBQ E 3 .   ? 6.742   62.501 62.665 1.00 27.18 ? 1539 FBQ A F25 1 
HETATM 4312 O O26 . FBQ E 3 .   ? 4.088   64.087 60.533 1.00 26.49 ? 1539 FBQ A O26 1 
HETATM 4313 F F27 . FBQ E 3 .   ? 4.082   70.713 68.041 1.00 34.43 ? 1539 FBQ A F27 1 
HETATM 4314 C C28 . FBQ E 3 .   ? 3.362   68.252 61.825 1.00 30.91 ? 1539 FBQ A C28 1 
HETATM 4315 O O1  . MES F 4 .   ? 28.415  53.400 50.775 1.00 87.99 ? 1540 MES A O1  1 
HETATM 4316 C C2  . MES F 4 .   ? 27.062  52.804 50.689 1.00 87.37 ? 1540 MES A C2  1 
HETATM 4317 C C3  . MES F 4 .   ? 26.214  53.675 51.353 1.00 87.89 ? 1540 MES A C3  1 
HETATM 4318 N N4  . MES F 4 .   ? 26.581  53.708 52.743 1.00 88.27 ? 1540 MES A N4  1 
HETATM 4319 C C5  . MES F 4 .   ? 27.865  54.320 52.903 1.00 88.39 ? 1540 MES A C5  1 
HETATM 4320 C C6  . MES F 4 .   ? 28.870  53.648 52.169 1.00 87.86 ? 1540 MES A C6  1 
HETATM 4321 C C7  . MES F 4 .   ? 25.647  54.434 53.518 1.00 88.08 ? 1540 MES A C7  1 
HETATM 4322 C C8  . MES F 4 .   ? 24.319  54.026 53.541 1.00 88.67 ? 1540 MES A C8  1 
HETATM 4323 S S   . MES F 4 .   ? 23.321  54.477 54.492 1.00 88.88 ? 1540 MES A S   1 
HETATM 4324 O O1S . MES F 4 .   ? 23.683  56.090 55.197 1.00 87.03 ? 1540 MES A O1S 1 
HETATM 4325 O O2S . MES F 4 .   ? 21.731  54.572 53.695 1.00 87.67 ? 1540 MES A O2S 1 
HETATM 4326 O O3S . MES F 4 .   ? 23.065  53.359 55.895 1.00 88.11 ? 1540 MES A O3S 1 
HETATM 4327 O O1  . PG4 G 5 .   ? -5.922  59.485 74.965 1.00 63.83 ? 1541 PG4 A O1  1 
HETATM 4328 C C1  . PG4 G 5 .   ? -4.827  60.416 74.702 1.00 65.68 ? 1541 PG4 A C1  1 
HETATM 4329 C C2  . PG4 G 5 .   ? -3.406  59.727 74.921 1.00 65.31 ? 1541 PG4 A C2  1 
HETATM 4330 O O2  . PG4 G 5 .   ? -2.412  60.500 74.100 1.00 66.13 ? 1541 PG4 A O2  1 
HETATM 4331 C C3  . PG4 G 5 .   ? -1.025  59.962 74.022 1.00 64.90 ? 1541 PG4 A C3  1 
HETATM 4332 C C4  . PG4 G 5 .   ? -0.136  61.024 73.293 1.00 63.68 ? 1541 PG4 A C4  1 
HETATM 4333 O O3  . PG4 G 5 .   ? -0.860  61.457 72.056 1.00 61.90 ? 1541 PG4 A O3  1 
HETATM 4334 C C5  . PG4 G 5 .   ? -0.060  62.024 70.923 1.00 60.99 ? 1541 PG4 A C5  1 
HETATM 4335 C C6  . PG4 G 5 .   ? 1.416   62.459 71.283 1.00 59.14 ? 1541 PG4 A C6  1 
HETATM 4336 O O4  . PG4 G 5 .   ? 1.802   63.606 70.427 1.00 57.41 ? 1541 PG4 A O4  1 
HETATM 4337 C C7  . PG4 G 5 .   ? 0.902   64.818 70.564 1.00 55.05 ? 1541 PG4 A C7  1 
HETATM 4338 C C8  . PG4 G 5 .   ? 1.226   65.948 69.511 1.00 51.52 ? 1541 PG4 A C8  1 
HETATM 4339 O O5  . PG4 G 5 .   ? 0.162   66.103 68.521 1.00 45.13 ? 1541 PG4 A O5  1 
HETATM 4340 O O   . HOH H 6 .   ? -6.156  84.130 38.661 1.00 33.65 ? 2001 HOH A O   1 
HETATM 4341 O O   . HOH H 6 .   ? -16.021 66.187 36.350 1.00 45.79 ? 2002 HOH A O   1 
HETATM 4342 O O   . HOH H 6 .   ? 1.633   90.372 54.081 1.00 43.08 ? 2003 HOH A O   1 
HETATM 4343 O O   . HOH H 6 .   ? -1.233  97.902 48.678 1.00 52.04 ? 2004 HOH A O   1 
HETATM 4344 O O   . HOH H 6 .   ? -12.711 65.150 41.696 1.00 40.84 ? 2005 HOH A O   1 
HETATM 4345 O O   . HOH H 6 .   ? -15.305 67.965 49.264 1.00 36.13 ? 2006 HOH A O   1 
HETATM 4346 O O   . HOH H 6 .   ? -15.613 60.697 48.759 1.00 35.60 ? 2007 HOH A O   1 
HETATM 4347 O O   . HOH H 6 .   ? -20.351 60.056 59.074 1.00 36.42 ? 2008 HOH A O   1 
HETATM 4348 O O   . HOH H 6 .   ? -24.587 57.925 54.579 1.00 41.17 ? 2009 HOH A O   1 
HETATM 4349 O O   . HOH H 6 .   ? -18.717 60.503 42.069 1.00 48.51 ? 2010 HOH A O   1 
HETATM 4350 O O   . HOH H 6 .   ? -18.229 69.222 48.812 1.00 38.85 ? 2011 HOH A O   1 
HETATM 4351 O O   . HOH H 6 .   ? -20.224 75.717 37.540 1.00 41.58 ? 2012 HOH A O   1 
HETATM 4352 O O   . HOH H 6 .   ? -10.582 81.770 55.268 1.00 37.84 ? 2013 HOH A O   1 
HETATM 4353 O O   . HOH H 6 .   ? -9.357  70.610 54.459 1.00 33.80 ? 2014 HOH A O   1 
HETATM 4354 O O   . HOH H 6 .   ? -7.344  70.842 56.392 1.00 32.60 ? 2015 HOH A O   1 
HETATM 4355 O O   . HOH H 6 .   ? -8.895  61.536 63.368 1.00 27.85 ? 2016 HOH A O   1 
HETATM 4356 O O   . HOH H 6 .   ? -12.225 63.472 59.408 1.00 34.21 ? 2017 HOH A O   1 
HETATM 4357 O O   . HOH H 6 .   ? 0.609   70.532 68.596 1.00 39.98 ? 2018 HOH A O   1 
HETATM 4358 O O   . HOH H 6 .   ? -3.296  67.016 74.320 1.00 42.40 ? 2019 HOH A O   1 
HETATM 4359 O O   . HOH H 6 .   ? -2.045  66.647 76.783 1.00 47.02 ? 2020 HOH A O   1 
HETATM 4360 O O   . HOH H 6 .   ? -1.028  72.417 73.155 1.00 39.59 ? 2021 HOH A O   1 
HETATM 4361 O O   . HOH H 6 .   ? 0.490   77.811 61.821 1.00 32.44 ? 2022 HOH A O   1 
HETATM 4362 O O   . HOH H 6 .   ? -0.386  69.971 62.186 1.00 32.84 ? 2023 HOH A O   1 
HETATM 4363 O O   . HOH H 6 .   ? -10.573 76.741 66.041 1.00 46.14 ? 2024 HOH A O   1 
HETATM 4364 O O   . HOH H 6 .   ? 5.172   46.323 57.229 1.00 45.30 ? 2025 HOH A O   1 
HETATM 4365 O O   . HOH H 6 .   ? 4.660   48.039 62.972 1.00 32.20 ? 2026 HOH A O   1 
HETATM 4366 O O   . HOH H 6 .   ? 0.682   41.087 54.142 1.00 38.40 ? 2027 HOH A O   1 
HETATM 4367 O O   . HOH H 6 .   ? 4.367   50.050 66.819 1.00 30.23 ? 2028 HOH A O   1 
HETATM 4368 O O   . HOH H 6 .   ? -19.258 68.695 62.069 1.00 41.38 ? 2029 HOH A O   1 
HETATM 4369 O O   . HOH H 6 .   ? -13.549 63.009 56.891 1.00 35.95 ? 2030 HOH A O   1 
HETATM 4370 O O   . HOH H 6 .   ? -17.995 66.078 61.055 1.00 42.74 ? 2031 HOH A O   1 
HETATM 4371 O O   . HOH H 6 .   ? -14.853 60.244 57.060 1.00 28.51 ? 2032 HOH A O   1 
HETATM 4372 O O   . HOH H 6 .   ? -15.261 66.912 51.774 1.00 29.19 ? 2033 HOH A O   1 
HETATM 4373 O O   . HOH H 6 .   ? -4.088  85.731 39.363 1.00 32.47 ? 2034 HOH A O   1 
HETATM 4374 O O   . HOH H 6 .   ? 5.889   44.557 53.755 1.00 35.69 ? 2035 HOH A O   1 
HETATM 4375 O O   . HOH H 6 .   ? -0.597  63.561 58.937 1.00 25.30 ? 2036 HOH A O   1 
HETATM 4376 O O   . HOH H 6 .   ? -6.879  61.970 65.124 1.00 23.27 ? 2037 HOH A O   1 
HETATM 4377 O O   . HOH H 6 .   ? -1.464  68.354 64.109 1.00 43.97 ? 2038 HOH A O   1 
HETATM 4378 O O   . HOH H 6 .   ? -7.095  68.322 57.652 1.00 27.84 ? 2039 HOH A O   1 
HETATM 4379 O O   . HOH H 6 .   ? -4.228  70.469 62.198 1.00 22.28 ? 2040 HOH A O   1 
HETATM 4380 O O   . HOH H 6 .   ? -1.942  75.899 52.795 1.00 37.39 ? 2041 HOH A O   1 
HETATM 4381 O O   . HOH H 6 .   ? -8.087  71.860 52.492 1.00 25.14 ? 2042 HOH A O   1 
HETATM 4382 O O   . HOH H 6 .   ? -2.351  78.441 61.906 1.00 37.57 ? 2043 HOH A O   1 
HETATM 4383 O O   . HOH H 6 .   ? 0.750   83.693 57.628 1.00 45.58 ? 2044 HOH A O   1 
HETATM 4384 O O   . HOH H 6 .   ? 0.155   69.571 59.442 1.00 30.62 ? 2045 HOH A O   1 
HETATM 4385 O O   . HOH H 6 .   ? 4.075   81.206 51.290 1.00 28.72 ? 2046 HOH A O   1 
HETATM 4386 O O   . HOH H 6 .   ? 26.127  45.864 77.162 1.00 40.21 ? 2047 HOH A O   1 
HETATM 4387 O O   . HOH H 6 .   ? 9.396   88.482 47.930 1.00 45.31 ? 2048 HOH A O   1 
HETATM 4388 O O   . HOH H 6 .   ? 11.234  87.031 43.722 1.00 42.41 ? 2049 HOH A O   1 
HETATM 4389 O O   . HOH H 6 .   ? 13.014  83.750 47.212 1.00 34.57 ? 2050 HOH A O   1 
HETATM 4390 O O   . HOH H 6 .   ? -1.469  70.076 52.605 1.00 24.26 ? 2051 HOH A O   1 
HETATM 4391 O O   . HOH H 6 .   ? -9.648  62.521 59.577 1.00 28.98 ? 2052 HOH A O   1 
HETATM 4392 O O   . HOH H 6 .   ? -13.435 58.318 56.326 1.00 26.15 ? 2053 HOH A O   1 
HETATM 4393 O O   . HOH H 6 .   ? -10.171 52.408 54.842 1.00 27.77 ? 2054 HOH A O   1 
HETATM 4394 O O   . HOH H 6 .   ? -5.970  45.463 57.331 1.00 32.20 ? 2055 HOH A O   1 
HETATM 4395 O O   . HOH H 6 .   ? -9.444  45.429 51.099 1.00 40.27 ? 2056 HOH A O   1 
HETATM 4396 O O   . HOH H 6 .   ? -6.957  50.975 49.302 1.00 39.17 ? 2057 HOH A O   1 
HETATM 4397 O O   . HOH H 6 .   ? -7.901  59.756 42.092 1.00 36.60 ? 2058 HOH A O   1 
HETATM 4398 O O   . HOH H 6 .   ? -6.306  59.185 40.085 1.00 33.39 ? 2059 HOH A O   1 
HETATM 4399 O O   . HOH H 6 .   ? -10.136 65.937 38.105 1.00 29.46 ? 2060 HOH A O   1 
HETATM 4400 O O   . HOH H 6 .   ? -12.173 67.499 37.016 1.00 31.50 ? 2061 HOH A O   1 
HETATM 4401 O O   . HOH H 6 .   ? -4.331  71.070 33.846 1.00 34.29 ? 2062 HOH A O   1 
HETATM 4402 O O   . HOH H 6 .   ? -0.177  66.721 36.571 1.00 36.79 ? 2063 HOH A O   1 
HETATM 4403 O O   . HOH H 6 .   ? 3.462   67.169 36.559 1.00 33.90 ? 2064 HOH A O   1 
HETATM 4404 O O   . HOH H 6 .   ? 27.758  60.155 64.917 1.00 41.49 ? 2065 HOH A O   1 
HETATM 4405 O O   . HOH H 6 .   ? 3.229   73.416 26.619 1.00 37.86 ? 2066 HOH A O   1 
HETATM 4406 O O   . HOH H 6 .   ? 7.399   70.965 39.266 1.00 40.59 ? 2067 HOH A O   1 
HETATM 4407 O O   . HOH H 6 .   ? 3.819   69.335 57.785 1.00 25.08 ? 2068 HOH A O   1 
HETATM 4408 O O   . HOH H 6 .   ? 6.739   69.701 61.498 1.00 34.26 ? 2069 HOH A O   1 
HETATM 4409 O O   . HOH H 6 .   ? -1.024  51.294 42.390 1.00 34.86 ? 2070 HOH A O   1 
HETATM 4410 O O   . HOH H 6 .   ? 8.415   50.393 36.987 1.00 36.97 ? 2071 HOH A O   1 
HETATM 4411 O O   . HOH H 6 .   ? -0.252  57.414 37.949 1.00 42.67 ? 2072 HOH A O   1 
HETATM 4412 O O   . HOH H 6 .   ? -0.970  66.756 39.912 1.00 31.95 ? 2073 HOH A O   1 
HETATM 4413 O O   . HOH H 6 .   ? 3.842   64.790 35.323 1.00 38.91 ? 2074 HOH A O   1 
HETATM 4414 O O   . HOH H 6 .   ? 11.307  70.441 33.798 1.00 39.06 ? 2075 HOH A O   1 
HETATM 4415 O O   . HOH H 6 .   ? 10.764  68.944 59.483 1.00 26.62 ? 2076 HOH A O   1 
HETATM 4416 O O   . HOH H 6 .   ? 12.422  51.507 59.354 1.00 52.16 ? 2077 HOH A O   1 
HETATM 4417 O O   . HOH H 6 .   ? 14.115  51.467 56.337 1.00 33.17 ? 2078 HOH A O   1 
HETATM 4418 O O   . HOH H 6 .   ? 7.031   52.598 56.486 1.00 24.27 ? 2079 HOH A O   1 
HETATM 4419 O O   . HOH H 6 .   ? 2.957   54.325 63.432 1.00 28.25 ? 2080 HOH A O   1 
HETATM 4420 O O   . HOH H 6 .   ? 4.659   50.689 62.040 1.00 30.40 ? 2081 HOH A O   1 
HETATM 4421 O O   . HOH H 6 .   ? 6.732   48.609 59.600 1.00 44.59 ? 2082 HOH A O   1 
HETATM 4422 O O   . HOH H 6 .   ? 6.322   48.424 55.857 1.00 29.88 ? 2083 HOH A O   1 
HETATM 4423 O O   . HOH H 6 .   ? 3.295   46.162 60.949 1.00 38.88 ? 2084 HOH A O   1 
HETATM 4424 O O   . HOH H 6 .   ? 0.957   43.633 54.874 1.00 39.41 ? 2085 HOH A O   1 
HETATM 4425 O O   . HOH H 6 .   ? -0.105  41.028 57.320 1.00 42.71 ? 2086 HOH A O   1 
HETATM 4426 O O   . HOH H 6 .   ? -0.327  41.784 64.006 1.00 40.37 ? 2087 HOH A O   1 
HETATM 4427 O O   . HOH H 6 .   ? -6.605  49.699 61.112 1.00 23.39 ? 2088 HOH A O   1 
HETATM 4428 O O   . HOH H 6 .   ? 3.304   51.619 64.264 1.00 28.41 ? 2089 HOH A O   1 
HETATM 4429 O O   . HOH H 6 .   ? 3.268   47.770 65.232 1.00 32.36 ? 2090 HOH A O   1 
HETATM 4430 O O   . HOH H 6 .   ? -22.119 46.663 66.615 1.00 39.62 ? 2091 HOH A O   1 
HETATM 4431 O O   . HOH H 6 .   ? -13.740 41.128 62.571 1.00 45.24 ? 2092 HOH A O   1 
HETATM 4432 O O   . HOH H 6 .   ? -24.845 45.206 60.923 1.00 44.94 ? 2093 HOH A O   1 
HETATM 4433 O O   . HOH H 6 .   ? -20.012 57.555 59.461 1.00 36.89 ? 2094 HOH A O   1 
HETATM 4434 O O   . HOH H 6 .   ? -22.362 59.452 63.215 1.00 47.70 ? 2095 HOH A O   1 
HETATM 4435 O O   . HOH H 6 .   ? -10.668 66.239 68.765 1.00 39.26 ? 2096 HOH A O   1 
HETATM 4436 O O   . HOH H 6 .   ? -14.507 65.921 67.116 1.00 38.55 ? 2097 HOH A O   1 
HETATM 4437 O O   . HOH H 6 .   ? -3.756  57.376 63.930 1.00 32.27 ? 2098 HOH A O   1 
HETATM 4438 O O   . HOH H 6 .   ? -8.993  58.907 64.296 1.00 25.37 ? 2099 HOH A O   1 
HETATM 4439 O O   . HOH H 6 .   ? -6.872  57.083 73.368 1.00 45.59 ? 2100 HOH A O   1 
HETATM 4440 O O   . HOH H 6 .   ? 3.224   50.703 69.326 1.00 35.31 ? 2101 HOH A O   1 
HETATM 4441 O O   . HOH H 6 .   ? 4.454   55.882 78.185 1.00 34.90 ? 2102 HOH A O   1 
HETATM 4442 O O   . HOH H 6 .   ? 5.375   53.888 80.512 1.00 37.71 ? 2103 HOH A O   1 
HETATM 4443 O O   . HOH H 6 .   ? 4.564   59.421 70.019 1.00 35.15 ? 2104 HOH A O   1 
HETATM 4444 O O   . HOH H 6 .   ? 4.047   56.132 70.061 1.00 36.43 ? 2105 HOH A O   1 
HETATM 4445 O O   . HOH H 6 .   ? 7.046   49.502 66.139 1.00 35.84 ? 2106 HOH A O   1 
HETATM 4446 O O   . HOH H 6 .   ? -3.947  50.405 61.877 1.00 29.33 ? 2107 HOH A O   1 
HETATM 4447 O O   . HOH H 6 .   ? -1.857  57.968 62.368 1.00 25.60 ? 2108 HOH A O   1 
HETATM 4448 O O   . HOH H 6 .   ? -3.612  51.274 59.514 1.00 26.79 ? 2109 HOH A O   1 
HETATM 4449 O O   . HOH H 6 .   ? -4.415  52.240 56.212 1.00 31.75 ? 2110 HOH A O   1 
HETATM 4450 O O   . HOH H 6 .   ? 7.144   47.069 53.550 1.00 32.61 ? 2111 HOH A O   1 
HETATM 4451 O O   . HOH H 6 .   ? 9.649   46.882 53.390 1.00 31.26 ? 2112 HOH A O   1 
HETATM 4452 O O   . HOH H 6 .   ? 17.592  50.672 44.879 1.00 32.48 ? 2113 HOH A O   1 
HETATM 4453 O O   . HOH H 6 .   ? 6.266   62.845 35.348 1.00 37.62 ? 2114 HOH A O   1 
HETATM 4454 O O   . HOH H 6 .   ? 9.430   56.317 36.212 1.00 33.52 ? 2115 HOH A O   1 
HETATM 4455 O O   . HOH H 6 .   ? 10.046  52.227 37.242 1.00 42.52 ? 2116 HOH A O   1 
HETATM 4456 O O   . HOH H 6 .   ? 21.094  65.260 63.655 1.00 29.15 ? 2117 HOH A O   1 
HETATM 4457 O O   . HOH H 6 .   ? 11.951  67.295 66.743 1.00 40.10 ? 2118 HOH A O   1 
HETATM 4458 O O   . HOH H 6 .   ? 21.137  66.665 67.398 1.00 56.89 ? 2119 HOH A O   1 
HETATM 4459 O O   . HOH H 6 .   ? 17.572  63.837 65.870 1.00 24.82 ? 2120 HOH A O   1 
HETATM 4460 O O   . HOH H 6 .   ? 2.307   64.166 77.036 1.00 45.44 ? 2121 HOH A O   1 
HETATM 4461 O O   . HOH H 6 .   ? 4.716   57.697 75.940 1.00 39.92 ? 2122 HOH A O   1 
HETATM 4462 O O   . HOH H 6 .   ? 7.715   63.847 78.819 1.00 31.02 ? 2123 HOH A O   1 
HETATM 4463 O O   . HOH H 6 .   ? 12.234  67.434 83.341 1.00 34.29 ? 2124 HOH A O   1 
HETATM 4464 O O   . HOH H 6 .   ? 7.638   72.249 82.232 1.00 32.94 ? 2125 HOH A O   1 
HETATM 4465 O O   . HOH H 6 .   ? 15.034  65.353 83.697 1.00 32.65 ? 2126 HOH A O   1 
HETATM 4466 O O   . HOH H 6 .   ? 10.322  52.653 79.355 1.00 42.12 ? 2127 HOH A O   1 
HETATM 4467 O O   . HOH H 6 .   ? 10.669  55.623 68.501 1.00 32.69 ? 2128 HOH A O   1 
HETATM 4468 O O   . HOH H 6 .   ? 24.712  48.319 76.534 1.00 32.72 ? 2129 HOH A O   1 
HETATM 4469 O O   . HOH H 6 .   ? 18.522  67.648 73.202 1.00 47.98 ? 2130 HOH A O   1 
HETATM 4470 O O   . HOH H 6 .   ? 25.549  66.303 74.366 1.00 34.39 ? 2131 HOH A O   1 
HETATM 4471 O O   . HOH H 6 .   ? 23.823  70.306 73.888 1.00 36.09 ? 2132 HOH A O   1 
HETATM 4472 O O   . HOH H 6 .   ? 25.113  64.089 67.190 1.00 41.78 ? 2133 HOH A O   1 
HETATM 4473 O O   . HOH H 6 .   ? 20.403  62.853 65.007 1.00 24.10 ? 2134 HOH A O   1 
HETATM 4474 O O   . HOH H 6 .   ? 15.584  53.052 61.338 1.00 40.10 ? 2135 HOH A O   1 
HETATM 4475 O O   . HOH H 6 .   ? 20.454  59.300 40.872 1.00 38.69 ? 2136 HOH A O   1 
HETATM 4476 O O   . HOH H 6 .   ? 16.476  57.867 35.890 1.00 34.13 ? 2137 HOH A O   1 
HETATM 4477 O O   . HOH H 6 .   ? 18.785  58.987 35.254 1.00 39.79 ? 2138 HOH A O   1 
HETATM 4478 O O   . HOH H 6 .   ? 18.218  60.304 41.668 1.00 30.87 ? 2139 HOH A O   1 
HETATM 4479 O O   . HOH H 6 .   ? 19.430  67.883 38.564 1.00 41.67 ? 2140 HOH A O   1 
HETATM 4480 O O   . HOH H 6 .   ? 22.932  66.893 47.789 1.00 30.67 ? 2141 HOH A O   1 
HETATM 4481 O O   . HOH H 6 .   ? 13.672  68.894 57.024 1.00 35.42 ? 2142 HOH A O   1 
HETATM 4482 O O   . HOH H 6 .   ? 24.957  70.374 62.991 1.00 41.39 ? 2143 HOH A O   1 
HETATM 4483 O O   . HOH H 6 .   ? 22.492  79.573 61.277 1.00 37.01 ? 2144 HOH A O   1 
HETATM 4484 O O   . HOH H 6 .   ? 6.737   74.862 66.424 1.00 37.07 ? 2145 HOH A O   1 
HETATM 4485 O O   . HOH H 6 .   ? 15.245  77.544 76.816 1.00 38.91 ? 2146 HOH A O   1 
HETATM 4486 O O   . HOH H 6 .   ? 8.703   73.941 64.775 1.00 37.12 ? 2147 HOH A O   1 
HETATM 4487 O O   . HOH H 6 .   ? 9.254   63.032 61.118 1.00 30.19 ? 2148 HOH A O   1 
HETATM 4488 O O   . HOH H 6 .   ? 10.135  80.466 64.905 1.00 40.51 ? 2149 HOH A O   1 
HETATM 4489 O O   . HOH H 6 .   ? 19.819  84.787 62.391 1.00 49.30 ? 2150 HOH A O   1 
HETATM 4490 O O   . HOH H 6 .   ? 21.282  84.343 55.745 1.00 44.45 ? 2151 HOH A O   1 
HETATM 4491 O O   . HOH H 6 .   ? 19.123  85.246 50.170 1.00 41.36 ? 2152 HOH A O   1 
HETATM 4492 O O   . HOH H 6 .   ? 13.774  86.622 46.919 1.00 41.34 ? 2153 HOH A O   1 
HETATM 4493 O O   . HOH H 6 .   ? 21.419  82.795 53.268 1.00 49.22 ? 2154 HOH A O   1 
HETATM 4494 O O   . HOH H 6 .   ? 23.378  77.294 53.815 1.00 45.35 ? 2155 HOH A O   1 
HETATM 4495 O O   . HOH H 6 .   ? 18.376  79.813 46.124 1.00 39.12 ? 2156 HOH A O   1 
HETATM 4496 O O   . HOH H 6 .   ? 23.581  78.755 46.518 1.00 44.38 ? 2157 HOH A O   1 
HETATM 4497 O O   . HOH H 6 .   ? 27.922  65.846 42.536 1.00 39.56 ? 2158 HOH A O   1 
HETATM 4498 O O   . HOH H 6 .   ? 21.671  61.758 41.734 1.00 40.57 ? 2159 HOH A O   1 
HETATM 4499 O O   . HOH H 6 .   ? 27.601  63.387 45.564 1.00 39.45 ? 2160 HOH A O   1 
HETATM 4500 O O   . HOH H 6 .   ? 24.951  58.750 52.296 1.00 39.13 ? 2161 HOH A O   1 
HETATM 4501 O O   . HOH H 6 .   ? 31.756  65.308 55.051 1.00 45.26 ? 2162 HOH A O   1 
HETATM 4502 O O   . HOH H 6 .   ? 30.887  58.322 49.296 1.00 40.69 ? 2163 HOH A O   1 
HETATM 4503 O O   . HOH H 6 .   ? 25.160  61.468 52.662 1.00 32.52 ? 2164 HOH A O   1 
HETATM 4504 O O   . HOH H 6 .   ? 26.726  63.772 59.010 1.00 31.14 ? 2165 HOH A O   1 
HETATM 4505 O O   . HOH H 6 .   ? 25.397  60.775 67.672 1.00 45.68 ? 2166 HOH A O   1 
HETATM 4506 O O   . HOH H 6 .   ? 28.710  59.485 60.975 1.00 30.03 ? 2167 HOH A O   1 
HETATM 4507 O O   . HOH H 6 .   ? 26.665  59.264 62.819 1.00 40.54 ? 2168 HOH A O   1 
HETATM 4508 O O   . HOH H 6 .   ? 21.201  51.854 53.578 1.00 39.19 ? 2169 HOH A O   1 
HETATM 4509 O O   . HOH H 6 .   ? 24.999  58.414 55.052 1.00 44.84 ? 2170 HOH A O   1 
HETATM 4510 O O   . HOH H 6 .   ? -0.893  68.607 66.946 1.00 42.91 ? 2171 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1536 1536 NAG NAG A . 
C 2 NAG 1   1537 1537 NAG NAG A . 
D 2 NAG 2   1538 1538 NAG NAG A . 
E 3 FBQ 1   1539 1539 FBQ FBQ A . 
F 4 MES 1   1540 1540 MES MES A . 
G 5 PG4 1   1541 1541 PG4 PG4 A . 
H 6 HOH 1   2001 2001 HOH HOH A . 
H 6 HOH 2   2002 2002 HOH HOH A . 
H 6 HOH 3   2003 2003 HOH HOH A . 
H 6 HOH 4   2004 2004 HOH HOH A . 
H 6 HOH 5   2005 2005 HOH HOH A . 
H 6 HOH 6   2006 2006 HOH HOH A . 
H 6 HOH 7   2007 2007 HOH HOH A . 
H 6 HOH 8   2008 2008 HOH HOH A . 
H 6 HOH 9   2009 2009 HOH HOH A . 
H 6 HOH 10  2010 2010 HOH HOH A . 
H 6 HOH 11  2011 2011 HOH HOH A . 
H 6 HOH 12  2012 2012 HOH HOH A . 
H 6 HOH 13  2013 2013 HOH HOH A . 
H 6 HOH 14  2014 2014 HOH HOH A . 
H 6 HOH 15  2015 2015 HOH HOH A . 
H 6 HOH 16  2016 2016 HOH HOH A . 
H 6 HOH 17  2017 2017 HOH HOH A . 
H 6 HOH 18  2018 2018 HOH HOH A . 
H 6 HOH 19  2019 2019 HOH HOH A . 
H 6 HOH 20  2020 2020 HOH HOH A . 
H 6 HOH 21  2021 2021 HOH HOH A . 
H 6 HOH 22  2022 2022 HOH HOH A . 
H 6 HOH 23  2023 2023 HOH HOH A . 
H 6 HOH 24  2024 2024 HOH HOH A . 
H 6 HOH 25  2025 2025 HOH HOH A . 
H 6 HOH 26  2026 2026 HOH HOH A . 
H 6 HOH 27  2027 2027 HOH HOH A . 
H 6 HOH 28  2028 2028 HOH HOH A . 
H 6 HOH 29  2029 2029 HOH HOH A . 
H 6 HOH 30  2030 2030 HOH HOH A . 
H 6 HOH 31  2031 2031 HOH HOH A . 
H 6 HOH 32  2032 2032 HOH HOH A . 
H 6 HOH 33  2033 2033 HOH HOH A . 
H 6 HOH 34  2034 2034 HOH HOH A . 
H 6 HOH 35  2035 2035 HOH HOH A . 
H 6 HOH 36  2036 2036 HOH HOH A . 
H 6 HOH 37  2037 2037 HOH HOH A . 
H 6 HOH 38  2038 2038 HOH HOH A . 
H 6 HOH 39  2039 2039 HOH HOH A . 
H 6 HOH 40  2040 2040 HOH HOH A . 
H 6 HOH 41  2041 2041 HOH HOH A . 
H 6 HOH 42  2042 2042 HOH HOH A . 
H 6 HOH 43  2043 2043 HOH HOH A . 
H 6 HOH 44  2044 2044 HOH HOH A . 
H 6 HOH 45  2045 2045 HOH HOH A . 
H 6 HOH 46  2046 2046 HOH HOH A . 
H 6 HOH 47  2047 2047 HOH HOH A . 
H 6 HOH 48  2048 2048 HOH HOH A . 
H 6 HOH 49  2049 2049 HOH HOH A . 
H 6 HOH 50  2050 2050 HOH HOH A . 
H 6 HOH 51  2051 2051 HOH HOH A . 
H 6 HOH 52  2052 2052 HOH HOH A . 
H 6 HOH 53  2053 2053 HOH HOH A . 
H 6 HOH 54  2054 2054 HOH HOH A . 
H 6 HOH 55  2055 2055 HOH HOH A . 
H 6 HOH 56  2056 2056 HOH HOH A . 
H 6 HOH 57  2057 2057 HOH HOH A . 
H 6 HOH 58  2058 2058 HOH HOH A . 
H 6 HOH 59  2059 2059 HOH HOH A . 
H 6 HOH 60  2060 2060 HOH HOH A . 
H 6 HOH 61  2061 2061 HOH HOH A . 
H 6 HOH 62  2062 2062 HOH HOH A . 
H 6 HOH 63  2063 2063 HOH HOH A . 
H 6 HOH 64  2064 2064 HOH HOH A . 
H 6 HOH 65  2065 2065 HOH HOH A . 
H 6 HOH 66  2066 2066 HOH HOH A . 
H 6 HOH 67  2067 2067 HOH HOH A . 
H 6 HOH 68  2068 2068 HOH HOH A . 
H 6 HOH 69  2069 2069 HOH HOH A . 
H 6 HOH 70  2070 2070 HOH HOH A . 
H 6 HOH 71  2071 2071 HOH HOH A . 
H 6 HOH 72  2072 2072 HOH HOH A . 
H 6 HOH 73  2073 2073 HOH HOH A . 
H 6 HOH 74  2074 2074 HOH HOH A . 
H 6 HOH 75  2075 2075 HOH HOH A . 
H 6 HOH 76  2076 2076 HOH HOH A . 
H 6 HOH 77  2077 2077 HOH HOH A . 
H 6 HOH 78  2078 2078 HOH HOH A . 
H 6 HOH 79  2079 2079 HOH HOH A . 
H 6 HOH 80  2080 2080 HOH HOH A . 
H 6 HOH 81  2081 2081 HOH HOH A . 
H 6 HOH 82  2082 2082 HOH HOH A . 
H 6 HOH 83  2083 2083 HOH HOH A . 
H 6 HOH 84  2084 2084 HOH HOH A . 
H 6 HOH 85  2085 2085 HOH HOH A . 
H 6 HOH 86  2086 2086 HOH HOH A . 
H 6 HOH 87  2087 2087 HOH HOH A . 
H 6 HOH 88  2088 2088 HOH HOH A . 
H 6 HOH 89  2089 2089 HOH HOH A . 
H 6 HOH 90  2090 2090 HOH HOH A . 
H 6 HOH 91  2091 2091 HOH HOH A . 
H 6 HOH 92  2092 2092 HOH HOH A . 
H 6 HOH 93  2093 2093 HOH HOH A . 
H 6 HOH 94  2094 2094 HOH HOH A . 
H 6 HOH 95  2095 2095 HOH HOH A . 
H 6 HOH 96  2096 2096 HOH HOH A . 
H 6 HOH 97  2097 2097 HOH HOH A . 
H 6 HOH 98  2098 2098 HOH HOH A . 
H 6 HOH 99  2099 2099 HOH HOH A . 
H 6 HOH 100 2100 2100 HOH HOH A . 
H 6 HOH 101 2101 2101 HOH HOH A . 
H 6 HOH 102 2102 2102 HOH HOH A . 
H 6 HOH 103 2103 2103 HOH HOH A . 
H 6 HOH 104 2104 2104 HOH HOH A . 
H 6 HOH 105 2105 2105 HOH HOH A . 
H 6 HOH 106 2106 2106 HOH HOH A . 
H 6 HOH 107 2107 2107 HOH HOH A . 
H 6 HOH 108 2108 2108 HOH HOH A . 
H 6 HOH 109 2109 2109 HOH HOH A . 
H 6 HOH 110 2110 2110 HOH HOH A . 
H 6 HOH 111 2111 2111 HOH HOH A . 
H 6 HOH 112 2112 2112 HOH HOH A . 
H 6 HOH 113 2113 2113 HOH HOH A . 
H 6 HOH 114 2114 2114 HOH HOH A . 
H 6 HOH 115 2115 2115 HOH HOH A . 
H 6 HOH 116 2116 2116 HOH HOH A . 
H 6 HOH 117 2117 2117 HOH HOH A . 
H 6 HOH 118 2118 2118 HOH HOH A . 
H 6 HOH 119 2119 2119 HOH HOH A . 
H 6 HOH 120 2120 2120 HOH HOH A . 
H 6 HOH 121 2121 2121 HOH HOH A . 
H 6 HOH 122 2122 2122 HOH HOH A . 
H 6 HOH 123 2123 2123 HOH HOH A . 
H 6 HOH 124 2124 2124 HOH HOH A . 
H 6 HOH 125 2125 2125 HOH HOH A . 
H 6 HOH 126 2126 2126 HOH HOH A . 
H 6 HOH 127 2127 2127 HOH HOH A . 
H 6 HOH 128 2128 2128 HOH HOH A . 
H 6 HOH 129 2129 2129 HOH HOH A . 
H 6 HOH 130 2130 2130 HOH HOH A . 
H 6 HOH 131 2131 2131 HOH HOH A . 
H 6 HOH 132 2132 2132 HOH HOH A . 
H 6 HOH 133 2133 2133 HOH HOH A . 
H 6 HOH 134 2134 2134 HOH HOH A . 
H 6 HOH 135 2135 2135 HOH HOH A . 
H 6 HOH 136 2136 2136 HOH HOH A . 
H 6 HOH 137 2137 2137 HOH HOH A . 
H 6 HOH 138 2138 2138 HOH HOH A . 
H 6 HOH 139 2139 2139 HOH HOH A . 
H 6 HOH 140 2140 2140 HOH HOH A . 
H 6 HOH 141 2141 2141 HOH HOH A . 
H 6 HOH 142 2142 2142 HOH HOH A . 
H 6 HOH 143 2143 2143 HOH HOH A . 
H 6 HOH 144 2144 2144 HOH HOH A . 
H 6 HOH 145 2145 2145 HOH HOH A . 
H 6 HOH 146 2146 2146 HOH HOH A . 
H 6 HOH 147 2147 2147 HOH HOH A . 
H 6 HOH 148 2148 2148 HOH HOH A . 
H 6 HOH 149 2149 2149 HOH HOH A . 
H 6 HOH 150 2150 2150 HOH HOH A . 
H 6 HOH 151 2151 2151 HOH HOH A . 
H 6 HOH 152 2152 2152 HOH HOH A . 
H 6 HOH 153 2153 2153 HOH HOH A . 
H 6 HOH 154 2154 2154 HOH HOH A . 
H 6 HOH 155 2155 2155 HOH HOH A . 
H 6 HOH 156 2156 2156 HOH HOH A . 
H 6 HOH 157 2157 2157 HOH HOH A . 
H 6 HOH 158 2158 2158 HOH HOH A . 
H 6 HOH 159 2159 2159 HOH HOH A . 
H 6 HOH 160 2160 2160 HOH HOH A . 
H 6 HOH 161 2161 2161 HOH HOH A . 
H 6 HOH 162 2162 2162 HOH HOH A . 
H 6 HOH 163 2163 2163 HOH HOH A . 
H 6 HOH 164 2164 2164 HOH HOH A . 
H 6 HOH 165 2165 2165 HOH HOH A . 
H 6 HOH 166 2166 2166 HOH HOH A . 
H 6 HOH 167 2167 2167 HOH HOH A . 
H 6 HOH 168 2168 2168 HOH HOH A . 
H 6 HOH 169 2169 2169 HOH HOH A . 
H 6 HOH 170 2170 2170 HOH HOH A . 
H 6 HOH 171 2171 2171 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.0730000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-09-25 
2 'Structure model' 1 1 2013-06-19 
3 'Structure model' 1 2 2019-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Derived calculations'      
2  2 'Structure model' 'Non-polymer description'   
3  2 'Structure model' Other                       
4  2 'Structure model' 'Refinement description'    
5  2 'Structure model' 'Structure summary'         
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' 'Data collection'           
8  3 'Structure model' 'Derived calculations'      
9  3 'Structure model' 'Experimental preparation'  
10 3 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' diffrn_source        
2 3 'Structure model' exptl_crystal_grow   
3 3 'Structure model' pdbx_database_proc   
4 3 'Structure model' pdbx_database_status 
5 3 'Structure model' struct_biol          
6 3 'Structure model' struct_conn          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_y_n'         
2 3 'Structure model' '_exptl_crystal_grow.temp'                    
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
DENZO     'data reduction' .   ? 1 ? ? ? ? 
SCALEPACK 'data scaling'   .   ? 2 ? ? ? ? 
X-PLOR    phasing          .   ? 3 ? ? ? ? 
CNS       phasing          .   ? 4 ? ? ? ? 
CNS       refinement       1.0 ? 5 ? ? ? ? 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 116.26 120.30 -4.04  0.50 N 
2 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 117.05 120.30 -3.25  0.50 N 
3 1 CA A LEU 516 ? ? CB A LEU 516 ? ? CG  A LEU 516 ? ? 130.03 115.30 14.73  2.30 N 
4 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 97.92  111.40 -13.48 1.90 N 
5 1 CA A LEU 531 ? ? CB A LEU 531 ? ? CG  A LEU 531 ? ? 131.14 115.30 15.84  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 38.95   50.27   
2  1 PHE A 45  ? ? 82.73   -16.07  
3  1 PRO A 53  ? ? -49.06  154.85  
4  1 ALA A 60  ? ? -108.92 54.60   
5  1 CYS A 94  ? ? -141.28 10.17   
6  1 SER A 108 ? ? -161.52 79.18   
7  1 LEU A 158 ? ? -117.50 77.96   
8  1 SER A 200 ? ? 57.81   -122.03 
9  1 GLU A 299 ? ? -119.60 -74.12  
10 1 ASP A 326 ? ? -111.31 74.76   
11 1 ASP A 380 ? ? -155.21 49.18   
12 1 VAL A 400 ? ? -132.53 -57.32  
13 1 ASN A 429 ? ? -103.91 75.70   
14 1 ASN A 457 ? ? 65.16   64.32   
15 1 PRO A 485 ? ? -17.15  -90.28  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     63 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.081 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A ALA 536 ? A ALA 536 
5  1 Y 1 A CYS 537 ? A CYS 537 
6  1 Y 1 A ASP 538 ? A ASP 538 
7  1 Y 1 A GLY 539 ? A GLY 539 
8  1 Y 1 A GLU 540 ? A GLU 540 
9  1 Y 1 A LEU 541 ? A LEU 541 
10 1 Y 1 A SER 542 ? A SER 542 
11 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                                                                                      NAG 
3 '1-[3-({[(4-AMINO-5-FLUORO-2-METHYLQUINOLIN-3-YL)METHYL]THIO}METHYL)PHENYL]-2,2,2-TRIFLUOROETHANE-1,1-DIOL' FBQ 
4 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                                      MES 
5 'TETRAETHYLENE GLYCOL'                                                                                      PG4 
6 water                                                                                                       HOH 
#