data_1HC9
# 
_entry.id   1HC9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HC9         
PDBE  EBI-6056     
WWPDB D_1290006056 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ABT unspecified 
;ALPHA-BUNGAROTOXIN COMPLEXED WITH THE 185 - 196 FRAGMENT OF THE ALPHA-SUBUNIT OF THE TORPEDO NICOTINIC ACETYLCHOLINE RECEPTOR (NMR, 4 STRUCTURES)
;
PDB 1BXP unspecified 'SOLUTION NMR STRUCTURE OF THE COMPLEX OF ALPHA-BUNGAROTOXIN WITH A LIBRARY DERIVED PEPTIDE, 20 STRUCTURES' 
PDB 1HAA unspecified 
'A BETA-HAIRPIN STRUCTURE IN A 13-MER PEPTIDE THAT BINDS A-BUNGAROTOXIN WITH HIGH AFFINITY AND NEUTRALIZES ITS TOXICITY' 
PDB 1HAJ unspecified 
'A BETA-HAIRPIN STRUCTURE IN A 13-MER PEPTIDE THAT BINDS A-BUNGAROTOXIN WITH HIGH AFFINITY AND NEUTRALIZES ITS TOXICITY' 
PDB 1HN7 unspecified 'NMR STRUCTURE OF THE COMPLEX BETWEEN A-BUNGAROTOXIN AND AMIMOTOPE OF THE NICOTINIC ACETILCHOLINE RECEPTOR' 
PDB 1HOY unspecified 'NMR STRUCTURE OF THE COMPLEX BETWEEN A-BUNGAROTOXIN AND AMIMOTOPE OF THE NICOTINIC ACETILCHOLINE RECEPTOR' 
PDB 1IDG unspecified 'THE NMR SOLUTION STRUCTURE OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND AN 18MER COGNATE PEPTIDE' 
PDB 1IDH unspecified 'THE NMR SOLUTION STRUCTURE OF THE COMPLEX FORMED BETWEEN ALPHA-BUNGAROTOXIN AND AN 18MER COGNATE PEPTIDE' 
PDB 1IDI unspecified 'THE NMR SOLUTION STRUCTURE OF ALPHA-BUNGAROTOXIN' 
PDB 1IDL unspecified 'THE NMR SOLUTION STRUCTURE OF ALPHA-BUNGAROTOXIN' 
PDB 2BTX unspecified 
'SOLUTION NMR STRUCTURE OF THE COMPLEX OF ALPHA-BUNGAROTOXIN WITH A LIBRARY DERIVED PEPTIDE, NMR, MINIMIZED AVERAGE STRUCTURE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HC9 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Kasher, R.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     
;The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
;
_citation.journal_abbrev            Neuron 
_citation.journal_volume            32 
_citation.page_first                265 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           NERNET 
_citation.country                   US 
_citation.journal_id_ISSN           0896-6273 
_citation.journal_id_CSD            2038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11683996 
_citation.pdbx_database_id_DOI      '10.1016/S0896-6273(01)00461-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Harel, M.'             1  
primary 'Kasher, R.'            2  
primary 'Nicolas, A.'           3  
primary 'Guss, J.M.'            4  
primary 'Balass, M.'            5  
primary 'Fridkin, M.'           6  
primary 'Smit, A.B.'            7  
primary 'Brejc, K.'             8  
primary 'Sixma, T.K.'           9  
primary 'Katchalski-Katzir, E.' 10 
primary 'Sussman, J.L.'         11 
primary 'Fuchs, S.'             12 
# 
_cell.entry_id           1HC9 
_cell.length_a           42.042 
_cell.length_b           153.356 
_cell.length_c           73.263 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HC9 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'ALPHA-BUNGAROTOXIN ISOFORM V31' 8033.334 1   ? ? ? ALPHA-NEUROTOXIN 
2 polymer     nat 'ALPHA-BUNGAROTOXIN ISOFORM A31' 8005.281 1   ? ? ? ? 
3 polymer     syn 'PEPTIDE INHIBITOR'              1689.843 2   ? ? ? 
'A SYNTHESIZED PEPTIDE MIMICKING ACHR LOOP THAT INHIBITS A-BTX BINDING TO ACHR' 
4 non-polymer syn 'IODIDE ION'                     126.904  2   ? ? ? ? 
5 water       nat water                            18.015   217 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ALPHA-BTX V31, ALPHA-BGT(V31), BGTX V31, LONG NEUROTOXIN 1' 
2 'ALPHA-BTX A31, ALPHA-BGT(A31), BGTX A31, LONG NEUROTOXIN 1' 
3 'HIGH AFFINITY PEPTIDE'                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG A   ? 
2 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG B   ? 
3 'polypeptide(L)' no no WRYYESSLLPYPD                                                              WRYYESSLLPYPD C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ILE n 
1 2  VAL n 
1 3  CYS n 
1 4  HIS n 
1 5  THR n 
1 6  THR n 
1 7  ALA n 
1 8  THR n 
1 9  SER n 
1 10 PRO n 
1 11 ILE n 
1 12 SER n 
1 13 ALA n 
1 14 VAL n 
1 15 THR n 
1 16 CYS n 
1 17 PRO n 
1 18 PRO n 
1 19 GLY n 
1 20 GLU n 
1 21 ASN n 
1 22 LEU n 
1 23 CYS n 
1 24 TYR n 
1 25 ARG n 
1 26 LYS n 
1 27 MET n 
1 28 TRP n 
1 29 CYS n 
1 30 ASP n 
1 31 VAL n 
1 32 PHE n 
1 33 CYS n 
1 34 SER n 
1 35 SER n 
1 36 ARG n 
1 37 GLY n 
1 38 LYS n 
1 39 VAL n 
1 40 VAL n 
1 41 GLU n 
1 42 LEU n 
1 43 GLY n 
1 44 CYS n 
1 45 ALA n 
1 46 ALA n 
1 47 THR n 
1 48 CYS n 
1 49 PRO n 
1 50 SER n 
1 51 LYS n 
1 52 LYS n 
1 53 PRO n 
1 54 TYR n 
1 55 GLU n 
1 56 GLU n 
1 57 VAL n 
1 58 THR n 
1 59 CYS n 
1 60 CYS n 
1 61 SER n 
1 62 THR n 
1 63 ASP n 
1 64 LYS n 
1 65 CYS n 
1 66 ASN n 
1 67 PRO n 
1 68 HIS n 
1 69 PRO n 
1 70 LYS n 
1 71 GLN n 
1 72 ARG n 
1 73 PRO n 
1 74 GLY n 
2 1  ILE n 
2 2  VAL n 
2 3  CYS n 
2 4  HIS n 
2 5  THR n 
2 6  THR n 
2 7  ALA n 
2 8  THR n 
2 9  SER n 
2 10 PRO n 
2 11 ILE n 
2 12 SER n 
2 13 ALA n 
2 14 VAL n 
2 15 THR n 
2 16 CYS n 
2 17 PRO n 
2 18 PRO n 
2 19 GLY n 
2 20 GLU n 
2 21 ASN n 
2 22 LEU n 
2 23 CYS n 
2 24 TYR n 
2 25 ARG n 
2 26 LYS n 
2 27 MET n 
2 28 TRP n 
2 29 CYS n 
2 30 ASP n 
2 31 ALA n 
2 32 PHE n 
2 33 CYS n 
2 34 SER n 
2 35 SER n 
2 36 ARG n 
2 37 GLY n 
2 38 LYS n 
2 39 VAL n 
2 40 VAL n 
2 41 GLU n 
2 42 LEU n 
2 43 GLY n 
2 44 CYS n 
2 45 ALA n 
2 46 ALA n 
2 47 THR n 
2 48 CYS n 
2 49 PRO n 
2 50 SER n 
2 51 LYS n 
2 52 LYS n 
2 53 PRO n 
2 54 TYR n 
2 55 GLU n 
2 56 GLU n 
2 57 VAL n 
2 58 THR n 
2 59 CYS n 
2 60 CYS n 
2 61 SER n 
2 62 THR n 
2 63 ASP n 
2 64 LYS n 
2 65 CYS n 
2 66 ASN n 
2 67 PRO n 
2 68 HIS n 
2 69 PRO n 
2 70 LYS n 
2 71 GLN n 
2 72 ARG n 
2 73 PRO n 
2 74 GLY n 
3 1  TRP n 
3 2  ARG n 
3 3  TYR n 
3 4  TYR n 
3 5  GLU n 
3 6  SER n 
3 7  SER n 
3 8  LEU n 
3 9  LEU n 
3 10 PRO n 
3 11 TYR n 
3 12 PRO n 
3 13 ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'MANY-BANDED KRAIT' 'BUNGARUS MULTICINCTUS' 8616 ? ? ? ? ? VENOM ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'MANY-BANDED KRAIT' 'BUNGARUS MULTICINCTUS' 8616 ? ? ? ? ? VENOM ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'SYNTHETIC CONSTRUCT' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                'MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP NXL1V_BUNMU 1 ? ? P60616 ? 
2 UNP NXL1A_BUNMU 2 ? ? P60615 ? 
3 PDB 1HC9        3 ? ? 1HC9   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HC9 A 1 ? 74 ? P60616 22 ? 95 ? 1 74 
2 2 1HC9 B 1 ? 74 ? P60615 22 ? 95 ? 1 74 
3 3 1HC9 C 1 ? 13 ? 1HC9   1  ? 13 ? 1 13 
4 3 1HC9 D 1 ? 13 ? 1HC9   1  ? 13 ? 1 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'    ? 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HC9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.35 
_exptl_crystal.density_percent_sol   63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '40% PEG 3350, 0.1M PIPES BUFFER PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2000-07-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1HC9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             23.500 
_reflns.d_resolution_high            1.800 
_reflns.number_obs                   19144 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.05600 
_reflns.pdbx_Rsym_value              0.08100 
_reflns.pdbx_netI_over_sigmaI        14.0000 
_reflns.B_iso_Wilson_estimate        16.7 
_reflns.pdbx_redundancy              6.100 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.55500 
_reflns_shell.pdbx_Rsym_value        0.59400 
_reflns_shell.meanI_over_sigI_obs    2.300 
_reflns_shell.pdbx_redundancy        5.60 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1HC9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22236 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             23.47 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    98.9 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2203 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.2 
_refine.aniso_B[1][1]                            2.13 
_refine.aniso_B[2][2]                            2.34 
_refine.aniso_B[3][3]                            -4.46 
_refine.aniso_B[1][2]                            0. 
_refine.aniso_B[1][3]                            0. 
_refine.aniso_B[2][3]                            0. 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 70.3 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;RESIDUES WITH ALTERNATE CONFORMATIONS: A12, A48, A50, A52, A56, A59, B34, B56, B71 THE 2 IODIDE IONS I1 A AND I1 B HAVE OCCUPANCY OF 0.4
;
_refine.pdbx_starting_model                      'PDB ENTRY 1NTN 1-66 RESIDUES' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1HC9 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1337 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               1556 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        23.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.9  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.79  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.30  1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.11  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.87  2   ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.74  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.8 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             3256 
_refine_ls_shell.R_factor_R_work                  0.293 
_refine_ls_shell.percent_reflns_obs               98.5 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            10.4 
_refine_ls_shell.number_reflns_R_free             376 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 ION.PARAM         ION.TOP     
# 
_struct.entry_id                  1HC9 
_struct.title                     'alpha-bungarotoxin complexed with high affinity peptide' 
_struct.pdbx_descriptor           'ALPHA-BUNGAROTOXIN ISOFORM V31, ALPHA-BUNGAROTOXIN ISOFORM A31, PEPTIDE INHIBITOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HC9 
_struct_keywords.pdbx_keywords   TOXIN/PEPTIDE 
_struct_keywords.text            
;TOXIN/PEPTIDE, COMPLEX (TOXIN-PEPTIDE), ACETYLCHOLINE RECEPTOR MIMITOPE, ALPHA-BUNGAROTOXIN, 3- FINGER, PROTEIN-PEPTIDE COMPLEX, TOXIN, TOXIN-PEPTIDE complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;COMPLEX OF THE ALPHA-BUNGAROTOXIN AND THE                    
 PEPTIDE INHIBITOR
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 32 ? GLY A 37 ? PHE A 32 GLY A 37 1 ? 6 
HELX_P HELX_P2 2 PHE B 32 ? GLY B 37 ? PHE B 32 GLY B 37 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 3  A CYS 23 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf2  disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 16 A CYS 44 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf3  disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 29 A CYS 33 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4  disulf ? ? A CYS 48 SG A ? ? 1_555 A CYS 59 SG A ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 2.477 ? 
disulf5  disulf ? ? A CYS 48 SG B ? ? 1_555 A CYS 59 SG B ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 2.179 ? 
disulf6  disulf ? ? A CYS 59 SG A ? ? 1_555 A CYS 59 SG A ? A CYS 59 A CYS 59 3_655 ? ? ? ? ? ? ? 1.900 ? 
disulf7  disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 60 A CYS 65 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf8  disulf ? ? B CYS 3  SG ? ? ? 1_555 B CYS 23 SG ? ? B CYS 3  B CYS 23 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf9  disulf ? ? B CYS 16 SG ? ? ? 1_555 B CYS 44 SG ? ? B CYS 16 B CYS 44 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf10 disulf ? ? B CYS 29 SG ? ? ? 1_555 B CYS 33 SG ? ? B CYS 29 B CYS 33 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf11 disulf ? ? B CYS 48 SG ? ? ? 1_555 B CYS 59 SG ? ? B CYS 48 B CYS 59 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf12 disulf ? ? B CYS 60 SG ? ? ? 1_555 B CYS 65 SG ? ? B CYS 60 B CYS 65 1_555 ? ? ? ? ? ? ? 2.024 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 9 A . ? SER 9 A PRO 10 A ? PRO 10 A 1 0.06  
2 SER 9 B . ? SER 9 B PRO 10 B ? PRO 10 B 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 5 ? 
CB ? 5 ? 
BA ? 2 ? 
BB ? 4 ? 
DB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
CB 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 2  ? THR A 5  ? VAL A 2  THR A 5  
AA 2 SER A 12 ? THR A 15 ? SER A 12 THR A 15 
AB 1 GLU A 56 ? CYS A 60 ? GLU A 56 CYS A 60 
AB 2 LEU A 22 ? TRP A 28 ? LEU A 22 TRP A 28 
AB 3 VAL A 39 ? ALA A 45 ? VAL A 39 ALA A 45 
CB 1 ARG C 2  ? TYR C 4  ? ARG C 2  TYR C 4  
CB 2 SER C 7  ? TYR C 11 ? SER C 7  TYR C 11 
BA 1 VAL B 2  ? THR B 5  ? VAL B 2  THR B 5  
BA 2 SER B 12 ? THR B 15 ? SER B 12 THR B 15 
BB 1 GLU B 56 ? CYS B 60 ? GLU B 56 CYS B 60 
BB 2 LEU B 22 ? TRP B 28 ? LEU B 22 TRP B 28 
BB 3 VAL B 39 ? ALA B 45 ? VAL B 39 ALA B 45 
DB 1 TYR D 3  ? TYR D 4  ? TYR D 3  TYR D 4  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 5  ? N THR A 5  O SER A 12 ? O SER A 12 
AB 1 2 N CYS A 60 ? N CYS A 60 O CYS A 23 ? O CYS A 23 
AB 2 3 N TRP A 28 ? N TRP A 28 O VAL A 39 ? O VAL A 39 
CB 1 2 N TYR C 4  ? N TYR C 4  O SER C 7  ? O SER C 7  
BA 1 2 N THR B 5  ? N THR B 5  O SER B 12 ? O SER B 12 
BB 1 2 N CYS B 60 ? N CYS B 60 O CYS B 23 ? O CYS B 23 
BB 2 3 N TRP B 28 ? N TRP B 28 O VAL B 39 ? O VAL B 39 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD A 1075' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IOD B 1075' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 ARG A 25 ? ARG A 25   . ? 1_555 ? 
2 AC1 3 THR A 58 ? THR A 58   . ? 1_555 ? 
3 AC1 3 HOH G .  ? HOH A 2081 . ? 1_555 ? 
4 AC2 4 ARG B 25 ? ARG B 25   . ? 1_555 ? 
5 AC2 4 MET B 27 ? MET B 27   . ? 1_555 ? 
6 AC2 4 GLU B 56 ? GLU B 56   . ? 1_555 ? 
7 AC2 4 THR B 58 ? THR B 58   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HC9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HC9 
_atom_sites.fract_transf_matrix[1][1]   0.023786 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006521 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1  ? 9.976   41.740 28.580  1.00   16.44 ? 1    ILE A N   1 
ATOM   2    C CA  . ILE A 1 1  ? 10.472  42.939 27.840  1.00   16.05 ? 1    ILE A CA  1 
ATOM   3    C C   . ILE A 1 1  ? 9.363   43.515 26.956  1.00   16.01 ? 1    ILE A C   1 
ATOM   4    O O   . ILE A 1 1  ? 8.461   42.796 26.532  1.00   16.78 ? 1    ILE A O   1 
ATOM   5    C CB  . ILE A 1 1  ? 11.697  42.570 26.953  1.00   14.29 ? 1    ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 1  ? 12.355  43.840 26.404  1.00   15.22 ? 1    ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 1  ? 11.264  41.665 25.807  1.00   15.32 ? 1    ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 1  ? 13.690  43.590 25.707  1.00   17.90 ? 1    ILE A CD1 1 
ATOM   9    N N   . VAL A 1 2  ? 9.428   44.818 26.704  1.00   15.75 ? 2    VAL A N   1 
ATOM   10   C CA  . VAL A 1 2  ? 8.451   45.504 25.860  1.00   16.51 ? 2    VAL A CA  1 
ATOM   11   C C   . VAL A 1 2  ? 9.159   45.901 24.565  1.00   16.70 ? 2    VAL A C   1 
ATOM   12   O O   . VAL A 1 2  ? 10.224  46.513 24.606  1.00   14.73 ? 2    VAL A O   1 
ATOM   13   C CB  . VAL A 1 2  ? 7.910   46.779 26.552  1.00   15.61 ? 2    VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 2  ? 7.049   47.580 25.582  1.00   15.47 ? 2    VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 2  ? 7.109   46.395 27.793  1.00   18.67 ? 2    VAL A CG2 1 
ATOM   16   N N   . CYS A 1 3  ? 8.559   45.565 23.423  1.00   15.25 ? 3    CYS A N   1 
ATOM   17   C CA  . CYS A 1 3  ? 9.166   45.852 22.120  1.00   13.36 ? 3    CYS A CA  1 
ATOM   18   C C   . CYS A 1 3  ? 8.255   46.532 21.115  1.00   15.54 ? 3    CYS A C   1 
ATOM   19   O O   . CYS A 1 3  ? 7.029   46.407 21.185  1.00   14.66 ? 3    CYS A O   1 
ATOM   20   C CB  . CYS A 1 3  ? 9.644   44.551 21.474  1.00   12.84 ? 3    CYS A CB  1 
ATOM   21   S SG  . CYS A 1 3  ? 10.774  43.560 22.488  1.00   15.27 ? 3    CYS A SG  1 
ATOM   22   N N   . HIS A 1 4  ? 8.868   47.237 20.164  1.00   13.67 ? 4    HIS A N   1 
ATOM   23   C CA  . HIS A 1 4  ? 8.118   47.883 19.095  1.00   14.61 ? 4    HIS A CA  1 
ATOM   24   C C   . HIS A 1 4  ? 7.691   46.746 18.162  1.00   14.68 ? 4    HIS A C   1 
ATOM   25   O O   . HIS A 1 4  ? 8.413   45.757 18.022  1.00   12.64 ? 4    HIS A O   1 
ATOM   26   C CB  . HIS A 1 4  ? 9.011   48.858 18.320  1.00   14.70 ? 4    HIS A CB  1 
ATOM   27   C CG  . HIS A 1 4  ? 9.354   50.106 19.075  1.00   17.51 ? 4    HIS A CG  1 
ATOM   28   N ND1 . HIS A 1 4  ? 8.440   51.113 19.302  1.00   18.48 ? 4    HIS A ND1 1 
ATOM   29   C CD2 . HIS A 1 4  ? 10.517  50.521 19.633  1.00   16.56 ? 4    HIS A CD2 1 
ATOM   30   C CE1 . HIS A 1 4  ? 9.027   52.097 19.962  1.00   20.19 ? 4    HIS A CE1 1 
ATOM   31   N NE2 . HIS A 1 4  ? 10.288  51.763 20.174  1.00   17.34 ? 4    HIS A NE2 1 
ATOM   32   N N   . THR A 1 5  ? 6.524   46.877 17.536  1.00   13.94 ? 5    THR A N   1 
ATOM   33   C CA  . THR A 1 5  ? 6.037   45.851 16.613  1.00   13.99 ? 5    THR A CA  1 
ATOM   34   C C   . THR A 1 5  ? 5.466   46.485 15.349  1.00   14.10 ? 5    THR A C   1 
ATOM   35   O O   . THR A 1 5  ? 4.780   47.502 15.416  1.00   14.98 ? 5    THR A O   1 
ATOM   36   C CB  . THR A 1 5  ? 4.930   44.963 17.252  1.00   14.54 ? 5    THR A CB  1 
ATOM   37   O OG1 . THR A 1 5  ? 4.354   44.126 16.242  1.00   13.67 ? 5    THR A OG1 1 
ATOM   38   C CG2 . THR A 1 5  ? 3.826   45.816 17.873  1.00   15.08 ? 5    THR A CG2 1 
ATOM   39   N N   . THR A 1 6  ? 5.759   45.891 14.196  1.00   12.22 ? 6    THR A N   1 
ATOM   40   C CA  . THR A 1 6  ? 5.242   46.408 12.936  1.00   14.12 ? 6    THR A CA  1 
ATOM   41   C C   . THR A 1 6  ? 3.936   45.701 12.582  1.00   14.25 ? 6    THR A C   1 
ATOM   42   O O   . THR A 1 6  ? 3.393   45.881 11.492  1.00   16.03 ? 6    THR A O   1 
ATOM   43   C CB  . THR A 1 6  ? 6.260   46.228 11.779  1.00   14.99 ? 6    THR A CB  1 
ATOM   44   O OG1 . THR A 1 6  ? 6.851   44.923 11.851  1.00   13.68 ? 6    THR A OG1 1 
ATOM   45   C CG2 . THR A 1 6  ? 7.357   47.285 11.865  1.00   13.41 ? 6    THR A CG2 1 
ATOM   46   N N   . ALA A 1 7  ? 3.432   44.900 13.514  1.00   15.17 ? 7    ALA A N   1 
ATOM   47   C CA  . ALA A 1 7  ? 2.182   44.182 13.295  1.00   15.65 ? 7    ALA A CA  1 
ATOM   48   C C   . ALA A 1 7  ? 1.010   45.152 13.384  1.00   17.09 ? 7    ALA A C   1 
ATOM   49   O O   . ALA A 1 7  ? -0.096  44.857 12.918  1.00   17.93 ? 7    ALA A O   1 
ATOM   50   C CB  . ALA A 1 7  ? 2.024   43.072 14.329  1.00   15.59 ? 7    ALA A CB  1 
ATOM   51   N N   . THR A 1 8  ? 1.250   46.317 13.975  1.00   16.47 ? 8    THR A N   1 
ATOM   52   C CA  . THR A 1 8  ? 0.186   47.299 14.117  1.00   15.68 ? 8    THR A CA  1 
ATOM   53   C C   . THR A 1 8  ? 0.415   48.564 13.304  1.00   17.62 ? 8    THR A C   1 
ATOM   54   O O   . THR A 1 8  ? 1.519   48.827 12.824  1.00   16.19 ? 8    THR A O   1 
ATOM   55   C CB  . THR A 1 8  ? -0.013  47.710 15.594  1.00   17.30 ? 8    THR A CB  1 
ATOM   56   O OG1 . THR A 1 8  ? 1.174   48.351 16.089  1.00   16.00 ? 8    THR A OG1 1 
ATOM   57   C CG2 . THR A 1 8  ? -0.336  46.485 16.450  1.00   15.54 ? 8    THR A CG2 1 
ATOM   58   N N   . SER A 1 9  ? -0.654  49.337 13.156  1.00   16.51 ? 9    SER A N   1 
ATOM   59   C CA  . SER A 1 9  ? -0.622  50.601 12.435  1.00   18.43 ? 9    SER A CA  1 
ATOM   60   C C   . SER A 1 9  ? -1.434  51.609 13.239  1.00   19.98 ? 9    SER A C   1 
ATOM   61   O O   . SER A 1 9  ? -2.656  51.476 13.367  1.00   20.77 ? 9    SER A O   1 
ATOM   62   C CB  . SER A 1 9  ? -1.233  50.451 11.041  1.00   20.81 ? 9    SER A CB  1 
ATOM   63   O OG  . SER A 1 9  ? -1.271  51.706 10.383  1.00   23.01 ? 9    SER A OG  1 
ATOM   64   N N   . PRO A 1 10 ? -0.765  52.625 13.803  1.00   19.92 ? 10   PRO A N   1 
ATOM   65   C CA  . PRO A 1 10 ? 0.686   52.825 13.694  1.00   19.64 ? 10   PRO A CA  1 
ATOM   66   C C   . PRO A 1 10 ? 1.508   51.830 14.510  1.00   18.65 ? 10   PRO A C   1 
ATOM   67   O O   . PRO A 1 10 ? 0.967   51.043 15.296  1.00   17.24 ? 10   PRO A O   1 
ATOM   68   C CB  . PRO A 1 10 ? 0.868   54.260 14.186  1.00   20.77 ? 10   PRO A CB  1 
ATOM   69   C CG  . PRO A 1 10 ? -0.197  54.381 15.232  1.00   23.22 ? 10   PRO A CG  1 
ATOM   70   C CD  . PRO A 1 10 ? -1.391  53.727 14.554  1.00   20.73 ? 10   PRO A CD  1 
ATOM   71   N N   . ILE A 1 11 ? 2.821   51.856 14.299  1.00   17.73 ? 11   ILE A N   1 
ATOM   72   C CA  . ILE A 1 11 ? 3.728   50.983 15.038  1.00   16.29 ? 11   ILE A CA  1 
ATOM   73   C C   . ILE A 1 11 ? 3.533   51.291 16.519  1.00   16.13 ? 11   ILE A C   1 
ATOM   74   O O   . ILE A 1 11 ? 3.466   52.451 16.911  1.00   15.96 ? 11   ILE A O   1 
ATOM   75   C CB  . ILE A 1 11 ? 5.203   51.265 14.654  1.00   16.99 ? 11   ILE A CB  1 
ATOM   76   C CG1 . ILE A 1 11 ? 5.464   50.787 13.221  1.00   18.25 ? 11   ILE A CG1 1 
ATOM   77   C CG2 . ILE A 1 11 ? 6.142   50.589 15.646  1.00   14.92 ? 11   ILE A CG2 1 
ATOM   78   C CD1 . ILE A 1 11 ? 6.820   51.199 12.653  1.00   19.24 ? 11   ILE A CD1 1 
ATOM   79   N N   A SER A 1 12 ? 3.442   50.248 17.337  0.50   15.97 ? 12   SER A N   1 
ATOM   80   N N   B SER A 1 12 ? 3.434   50.252 17.341  0.50   14.89 ? 12   SER A N   1 
ATOM   81   C CA  A SER A 1 12 ? 3.244   50.426 18.768  0.50   16.41 ? 12   SER A CA  1 
ATOM   82   C CA  B SER A 1 12 ? 3.252   50.452 18.771  0.50   14.48 ? 12   SER A CA  1 
ATOM   83   C C   A SER A 1 12 ? 4.118   49.462 19.555  0.50   15.46 ? 12   SER A C   1 
ATOM   84   C C   B SER A 1 12 ? 4.102   49.459 19.554  0.50   14.37 ? 12   SER A C   1 
ATOM   85   O O   A SER A 1 12 ? 4.910   48.717 18.979  0.50   16.21 ? 12   SER A O   1 
ATOM   86   O O   B SER A 1 12 ? 4.863   48.688 18.970  0.50   15.20 ? 12   SER A O   1 
ATOM   87   C CB  A SER A 1 12 ? 1.775   50.190 19.123  0.50   17.93 ? 12   SER A CB  1 
ATOM   88   C CB  B SER A 1 12 ? 1.770   50.309 19.143  0.50   14.38 ? 12   SER A CB  1 
ATOM   89   O OG  A SER A 1 12 ? 1.405   48.854 18.829  0.50   19.59 ? 12   SER A OG  1 
ATOM   90   O OG  B SER A 1 12 ? 1.534   50.750 20.470  0.50   10.42 ? 12   SER A OG  1 
ATOM   91   N N   . ALA A 1 13 ? 3.967   49.475 20.876  1.00   15.34 ? 13   ALA A N   1 
ATOM   92   C CA  . ALA A 1 13 ? 4.748   48.595 21.740  1.00   14.80 ? 13   ALA A CA  1 
ATOM   93   C C   . ALA A 1 13 ? 3.917   47.475 22.343  1.00   16.19 ? 13   ALA A C   1 
ATOM   94   O O   . ALA A 1 13 ? 2.770   47.675 22.744  1.00   15.18 ? 13   ALA A O   1 
ATOM   95   C CB  . ALA A 1 13 ? 5.407   49.411 22.853  1.00   14.23 ? 13   ALA A CB  1 
ATOM   96   N N   . VAL A 1 14 ? 4.506   46.289 22.407  1.00   14.84 ? 14   VAL A N   1 
ATOM   97   C CA  . VAL A 1 14 ? 3.821   45.136 22.965  1.00   16.95 ? 14   VAL A CA  1 
ATOM   98   C C   . VAL A 1 14 ? 4.696   44.488 24.036  1.00   17.74 ? 14   VAL A C   1 
ATOM   99   O O   . VAL A 1 14 ? 5.926   44.612 24.008  1.00   17.17 ? 14   VAL A O   1 
ATOM   100  C CB  . VAL A 1 14 ? 3.504   44.103 21.846  1.00   18.09 ? 14   VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 14 ? 4.801   43.560 21.255  1.00   16.79 ? 14   VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 14 ? 2.643   42.974 22.393  1.00   19.41 ? 14   VAL A CG2 1 
ATOM   103  N N   . THR A 1 15 ? 4.068   43.827 25.004  1.00   16.21 ? 15   THR A N   1 
ATOM   104  C CA  . THR A 1 15 ? 4.831   43.135 26.029  1.00   17.44 ? 15   THR A CA  1 
ATOM   105  C C   . THR A 1 15 ? 5.033   41.734 25.464  1.00   17.30 ? 15   THR A C   1 
ATOM   106  O O   . THR A 1 15 ? 4.068   41.042 25.144  1.00   17.46 ? 15   THR A O   1 
ATOM   107  C CB  . THR A 1 15 ? 4.072   43.050 27.367  1.00   17.09 ? 15   THR A CB  1 
ATOM   108  O OG1 . THR A 1 15 ? 3.859   44.371 27.889  1.00   17.30 ? 15   THR A OG1 1 
ATOM   109  C CG2 . THR A 1 15 ? 4.878   42.238 28.378  1.00   19.00 ? 15   THR A CG2 1 
ATOM   110  N N   . CYS A 1 16 ? 6.287   41.322 25.324  1.00   15.67 ? 16   CYS A N   1 
ATOM   111  C CA  . CYS A 1 16 ? 6.590   40.015 24.765  1.00   15.44 ? 16   CYS A CA  1 
ATOM   112  C C   . CYS A 1 16 ? 6.242   38.860 25.700  1.00   16.60 ? 16   CYS A C   1 
ATOM   113  O O   . CYS A 1 16 ? 6.227   39.020 26.919  1.00   17.01 ? 16   CYS A O   1 
ATOM   114  C CB  . CYS A 1 16 ? 8.066   39.952 24.384  1.00   17.52 ? 16   CYS A CB  1 
ATOM   115  S SG  . CYS A 1 16 ? 8.565   41.225 23.178  1.00   17.22 ? 16   CYS A SG  1 
ATOM   116  N N   . PRO A 1 17 ? 5.966   37.677 25.131  1.00   18.05 ? 17   PRO A N   1 
ATOM   117  C CA  . PRO A 1 17 ? 5.615   36.472 25.889  1.00   19.70 ? 17   PRO A CA  1 
ATOM   118  C C   . PRO A 1 17 ? 6.748   36.072 26.826  1.00   20.02 ? 17   PRO A C   1 
ATOM   119  O O   . PRO A 1 17 ? 7.907   36.410 26.588  1.00   17.87 ? 17   PRO A O   1 
ATOM   120  C CB  . PRO A 1 17 ? 5.408   35.419 24.798  1.00   18.99 ? 17   PRO A CB  1 
ATOM   121  C CG  . PRO A 1 17 ? 5.046   36.217 23.591  1.00   21.27 ? 17   PRO A CG  1 
ATOM   122  C CD  . PRO A 1 17 ? 5.979   37.391 23.686  1.00   19.24 ? 17   PRO A CD  1 
ATOM   123  N N   . PRO A 1 18 ? 6.430   35.341 27.904  1.00   19.74 ? 18   PRO A N   1 
ATOM   124  C CA  . PRO A 1 18 ? 7.506   34.936 28.813  1.00   19.74 ? 18   PRO A CA  1 
ATOM   125  C C   . PRO A 1 18 ? 8.516   34.065 28.060  1.00   19.48 ? 18   PRO A C   1 
ATOM   126  O O   . PRO A 1 18 ? 8.136   33.220 27.248  1.00   19.79 ? 18   PRO A O   1 
ATOM   127  C CB  . PRO A 1 18 ? 6.761   34.188 29.927  1.00   21.26 ? 18   PRO A CB  1 
ATOM   128  C CG  . PRO A 1 18 ? 5.495   33.723 29.264  1.00   23.17 ? 18   PRO A CG  1 
ATOM   129  C CD  . PRO A 1 18 ? 5.117   34.893 28.395  1.00   22.42 ? 18   PRO A CD  1 
ATOM   130  N N   . GLY A 1 19 ? 9.803   34.284 28.311  1.00   17.97 ? 19   GLY A N   1 
ATOM   131  C CA  . GLY A 1 19 ? 10.819  33.510 27.609  1.00   17.68 ? 19   GLY A CA  1 
ATOM   132  C C   . GLY A 1 19 ? 11.356  34.258 26.404  1.00   17.90 ? 19   GLY A C   1 
ATOM   133  O O   . GLY A 1 19 ? 12.416  33.927 25.870  1.00   18.05 ? 19   GLY A O   1 
ATOM   134  N N   . GLU A 1 20 ? 10.606  35.260 25.957  1.00   17.01 ? 20   GLU A N   1 
ATOM   135  C CA  . GLU A 1 20 ? 11.030  36.078 24.829  1.00   17.58 ? 20   GLU A CA  1 
ATOM   136  C C   . GLU A 1 20 ? 11.517  37.369 25.456  1.00   16.42 ? 20   GLU A C   1 
ATOM   137  O O   . GLU A 1 20 ? 10.735  38.277 25.733  1.00   16.11 ? 20   GLU A O   1 
ATOM   138  C CB  . GLU A 1 20 ? 9.863   36.319 23.866  1.00   17.28 ? 20   GLU A CB  1 
ATOM   139  C CG  . GLU A 1 20 ? 9.521   35.079 23.051  1.00   18.99 ? 20   GLU A CG  1 
ATOM   140  C CD  . GLU A 1 20 ? 8.514   35.334 21.942  1.00   21.55 ? 20   GLU A CD  1 
ATOM   141  O OE1 . GLU A 1 20 ? 8.515   36.441 21.359  1.00   22.30 ? 20   GLU A OE1 1 
ATOM   142  O OE2 . GLU A 1 20 ? 7.734   34.411 21.635  1.00   20.04 ? 20   GLU A OE2 1 
ATOM   143  N N   . ASN A 1 21 ? 12.824  37.429 25.696  1.00   16.15 ? 21   ASN A N   1 
ATOM   144  C CA  . ASN A 1 21 ? 13.427  38.579 26.352  1.00   16.96 ? 21   ASN A CA  1 
ATOM   145  C C   . ASN A 1 21 ? 14.251  39.498 25.463  1.00   16.12 ? 21   ASN A C   1 
ATOM   146  O O   . ASN A 1 21 ? 15.066  40.276 25.958  1.00   17.25 ? 21   ASN A O   1 
ATOM   147  C CB  . ASN A 1 21 ? 14.274  38.087 27.523  1.00   17.61 ? 21   ASN A CB  1 
ATOM   148  C CG  . ASN A 1 21 ? 13.462  37.275 28.509  1.00   19.52 ? 21   ASN A CG  1 
ATOM   149  O OD1 . ASN A 1 21 ? 12.502  37.778 29.089  1.00   22.32 ? 21   ASN A OD1 1 
ATOM   150  N ND2 . ASN A 1 21 ? 13.832  36.011 28.694  1.00   18.54 ? 21   ASN A ND2 1 
ATOM   151  N N   . LEU A 1 22 ? 14.026  39.413 24.158  1.00   13.61 ? 22   LEU A N   1 
ATOM   152  C CA  . LEU A 1 22 ? 14.736  40.252 23.201  1.00   13.45 ? 22   LEU A CA  1 
ATOM   153  C C   . LEU A 1 22 ? 13.755  40.928 22.259  1.00   14.42 ? 22   LEU A C   1 
ATOM   154  O O   . LEU A 1 22 ? 12.652  40.432 22.034  1.00   14.65 ? 22   LEU A O   1 
ATOM   155  C CB  . LEU A 1 22 ? 15.689  39.409 22.344  1.00   15.01 ? 22   LEU A CB  1 
ATOM   156  C CG  . LEU A 1 22 ? 16.798  38.608 23.025  1.00   15.84 ? 22   LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 22 ? 17.453  37.683 22.002  1.00   17.50 ? 22   LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 22 ? 17.814  39.546 23.635  1.00   16.90 ? 22   LEU A CD2 1 
ATOM   159  N N   . CYS A 1 23 ? 14.168  42.072 21.723  1.00   13.71 ? 23   CYS A N   1 
ATOM   160  C CA  . CYS A 1 23 ? 13.387  42.790 20.731  1.00   13.60 ? 23   CYS A CA  1 
ATOM   161  C C   . CYS A 1 23 ? 14.230  42.608 19.478  1.00   14.99 ? 23   CYS A C   1 
ATOM   162  O O   . CYS A 1 23 ? 15.436  42.378 19.577  1.00   15.14 ? 23   CYS A O   1 
ATOM   163  C CB  . CYS A 1 23 ? 13.311  44.286 21.037  1.00   13.63 ? 23   CYS A CB  1 
ATOM   164  S SG  . CYS A 1 23 ? 12.421  44.738 22.550  1.00   15.14 ? 23   CYS A SG  1 
ATOM   165  N N   . TYR A 1 24 ? 13.620  42.695 18.306  1.00   13.71 ? 24   TYR A N   1 
ATOM   166  C CA  . TYR A 1 24 ? 14.400  42.565 17.091  1.00   15.32 ? 24   TYR A CA  1 
ATOM   167  C C   . TYR A 1 24 ? 13.913  43.506 16.004  1.00   16.07 ? 24   TYR A C   1 
ATOM   168  O O   . TYR A 1 24 ? 12.759  43.950 15.999  1.00   14.77 ? 24   TYR A O   1 
ATOM   169  C CB  . TYR A 1 24 ? 14.374  41.117 16.568  1.00   14.97 ? 24   TYR A CB  1 
ATOM   170  C CG  . TYR A 1 24 ? 13.121  40.742 15.803  1.00   17.60 ? 24   TYR A CG  1 
ATOM   171  C CD1 . TYR A 1 24 ? 12.964  41.095 14.456  1.00   19.23 ? 24   TYR A CD1 1 
ATOM   172  C CD2 . TYR A 1 24 ? 12.082  40.056 16.429  1.00   15.83 ? 24   TYR A CD2 1 
ATOM   173  C CE1 . TYR A 1 24 ? 11.795  40.774 13.755  1.00   19.02 ? 24   TYR A CE1 1 
ATOM   174  C CE2 . TYR A 1 24 ? 10.913  39.729 15.740  1.00   19.44 ? 24   TYR A CE2 1 
ATOM   175  C CZ  . TYR A 1 24 ? 10.775  40.092 14.409  1.00   20.32 ? 24   TYR A CZ  1 
ATOM   176  O OH  . TYR A 1 24 ? 9.610   39.787 13.744  1.00   19.52 ? 24   TYR A OH  1 
ATOM   177  N N   . ARG A 1 25 ? 14.831  43.833 15.106  1.00   14.69 ? 25   ARG A N   1 
ATOM   178  C CA  . ARG A 1 25 ? 14.528  44.655 13.948  1.00   13.75 ? 25   ARG A CA  1 
ATOM   179  C C   . ARG A 1 25 ? 15.173  43.923 12.786  1.00   14.47 ? 25   ARG A C   1 
ATOM   180  O O   . ARG A 1 25 ? 16.366  43.609 12.818  1.00   14.35 ? 25   ARG A O   1 
ATOM   181  C CB  . ARG A 1 25 ? 15.117  46.061 14.060  1.00   12.50 ? 25   ARG A CB  1 
ATOM   182  C CG  . ARG A 1 25 ? 14.894  46.887 12.794  1.00   12.91 ? 25   ARG A CG  1 
ATOM   183  C CD  . ARG A 1 25 ? 15.236  48.357 12.986  1.00   16.22 ? 25   ARG A CD  1 
ATOM   184  N NE  . ARG A 1 25 ? 16.639  48.541 13.337  1.00   21.82 ? 25   ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 25 ? 17.064  49.123 14.455  1.00   25.12 ? 25   ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 25 ? 16.194  49.592 15.343  1.00   23.63 ? 25   ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 25 ? 18.366  49.216 14.696  1.00   26.18 ? 25   ARG A NH2 1 
ATOM   188  N N   . LYS A 1 26 ? 14.371  43.635 11.774  1.00   14.23 ? 26   LYS A N   1 
ATOM   189  C CA  . LYS A 1 26 ? 14.850  42.944 10.595  1.00   15.77 ? 26   LYS A CA  1 
ATOM   190  C C   . LYS A 1 26 ? 14.604  43.857 9.407   1.00   15.79 ? 26   LYS A C   1 
ATOM   191  O O   . LYS A 1 26 ? 13.516  44.411 9.250   1.00   15.98 ? 26   LYS A O   1 
ATOM   192  C CB  . LYS A 1 26 ? 14.093  41.630 10.416  1.00   18.76 ? 26   LYS A CB  1 
ATOM   193  C CG  . LYS A 1 26 ? 14.704  40.691 9.393   1.00   24.97 ? 26   LYS A CG  1 
ATOM   194  C CD  . LYS A 1 26 ? 13.896  39.397 9.290   1.00   29.59 ? 26   LYS A CD  1 
ATOM   195  C CE  . LYS A 1 26 ? 13.693  38.755 10.659  1.00   33.02 ? 26   LYS A CE  1 
ATOM   196  N NZ  . LYS A 1 26 ? 12.880  37.501 10.592  1.00   38.11 ? 26   LYS A NZ  1 
ATOM   197  N N   . MET A 1 27 ? 15.622  44.028 8.577   1.00   16.12 ? 27   MET A N   1 
ATOM   198  C CA  . MET A 1 27 ? 15.491  44.883 7.410   1.00   15.14 ? 27   MET A CA  1 
ATOM   199  C C   . MET A 1 27 ? 16.077  44.226 6.176   1.00   16.06 ? 27   MET A C   1 
ATOM   200  O O   . MET A 1 27 ? 17.106  43.547 6.245   1.00   15.64 ? 27   MET A O   1 
ATOM   201  C CB  . MET A 1 27 ? 16.181  46.225 7.668   1.00   17.48 ? 27   MET A CB  1 
ATOM   202  C CG  . MET A 1 27 ? 15.498  47.063 8.751   1.00   19.00 ? 27   MET A CG  1 
ATOM   203  S SD  . MET A 1 27 ? 16.375  48.592 9.113   1.00   22.71 ? 27   MET A SD  1 
ATOM   204  C CE  . MET A 1 27 ? 15.968  49.574 7.665   1.00   23.78 ? 27   MET A CE  1 
ATOM   205  N N   . TRP A 1 28 ? 15.416  44.431 5.043   1.00   14.69 ? 28   TRP A N   1 
ATOM   206  C CA  . TRP A 1 28 ? 15.885  43.861 3.794   1.00   16.14 ? 28   TRP A CA  1 
ATOM   207  C C   . TRP A 1 28 ? 15.302  44.627 2.620   1.00   16.79 ? 28   TRP A C   1 
ATOM   208  O O   . TRP A 1 28 ? 14.297  45.331 2.746   1.00   15.95 ? 28   TRP A O   1 
ATOM   209  C CB  . TRP A 1 28 ? 15.493  42.382 3.706   1.00   15.03 ? 28   TRP A CB  1 
ATOM   210  C CG  . TRP A 1 28 ? 14.020  42.144 3.551   1.00   17.46 ? 28   TRP A CG  1 
ATOM   211  C CD1 . TRP A 1 28 ? 13.315  42.065 2.377   1.00   16.61 ? 28   TRP A CD1 1 
ATOM   212  C CD2 . TRP A 1 28 ? 13.070  41.949 4.601   1.00   18.70 ? 28   TRP A CD2 1 
ATOM   213  N NE1 . TRP A 1 28 ? 11.988  41.829 2.636   1.00   19.01 ? 28   TRP A NE1 1 
ATOM   214  C CE2 . TRP A 1 28 ? 11.808  41.752 3.993   1.00   19.04 ? 28   TRP A CE2 1 
ATOM   215  C CE3 . TRP A 1 28 ? 13.160  41.920 6.000   1.00   20.56 ? 28   TRP A CE3 1 
ATOM   216  C CZ2 . TRP A 1 28 ? 10.646  41.528 4.735   1.00   20.87 ? 28   TRP A CZ2 1 
ATOM   217  C CZ3 . TRP A 1 28 ? 12.001  41.697 6.739   1.00   21.99 ? 28   TRP A CZ3 1 
ATOM   218  C CH2 . TRP A 1 28 ? 10.760  41.503 6.102   1.00   21.91 ? 28   TRP A CH2 1 
ATOM   219  N N   . CYS A 1 29 ? 15.948  44.475 1.475   1.00   16.08 ? 29   CYS A N   1 
ATOM   220  C CA  . CYS A 1 29 ? 15.524  45.139 0.259   1.00   16.56 ? 29   CYS A CA  1 
ATOM   221  C C   . CYS A 1 29 ? 14.492  44.360 -0.547  1.00   17.63 ? 29   CYS A C   1 
ATOM   222  O O   . CYS A 1 29 ? 14.603  43.141 -0.700  1.00   17.87 ? 29   CYS A O   1 
ATOM   223  C CB  . CYS A 1 29 ? 16.724  45.342 -0.658  1.00   18.53 ? 29   CYS A CB  1 
ATOM   224  S SG  . CYS A 1 29 ? 17.742  46.834 -0.471  1.00   20.89 ? 29   CYS A SG  1 
ATOM   225  N N   . ASP A 1 30 ? 13.483  45.062 -1.051  1.00   15.95 ? 30   ASP A N   1 
ATOM   226  C CA  . ASP A 1 30 ? 12.535  44.432 -1.955  1.00   18.88 ? 30   ASP A CA  1 
ATOM   227  C C   . ASP A 1 30 ? 12.700  45.290 -3.220  1.00   18.12 ? 30   ASP A C   1 
ATOM   228  O O   . ASP A 1 30 ? 13.682  46.025 -3.331  1.00   17.69 ? 30   ASP A O   1 
ATOM   229  C CB  . ASP A 1 30 ? 11.097  44.398 -1.396  1.00   17.81 ? 30   ASP A CB  1 
ATOM   230  C CG  . ASP A 1 30 ? 10.417  45.749 -1.359  1.00   19.35 ? 30   ASP A CG  1 
ATOM   231  O OD1 . ASP A 1 30 ? 11.031  46.772 -1.713  1.00   18.96 ? 30   ASP A OD1 1 
ATOM   232  O OD2 . ASP A 1 30 ? 9.231   45.769 -0.959  1.00   20.47 ? 30   ASP A OD2 1 
ATOM   233  N N   A VAL A 1 31 ? 11.766  45.207 -4.159  0.70   18.77 ? 31   VAL A N   1 
ATOM   234  N N   B VAL A 1 31 ? 11.762  45.196 -4.157  0.30   18.48 ? 31   VAL A N   1 
ATOM   235  C CA  A VAL A 1 31 ? 11.877  45.971 -5.401  0.70   19.54 ? 31   VAL A CA  1 
ATOM   236  C CA  B VAL A 1 31 ? 11.849  45.954 -5.404  0.30   18.76 ? 31   VAL A CA  1 
ATOM   237  C C   A VAL A 1 31 ? 11.979  47.483 -5.211  0.70   19.96 ? 31   VAL A C   1 
ATOM   238  C C   B VAL A 1 31 ? 11.941  47.475 -5.229  0.30   19.44 ? 31   VAL A C   1 
ATOM   239  O O   A VAL A 1 31 ? 12.618  48.172 -6.010  0.70   19.22 ? 31   VAL A O   1 
ATOM   240  O O   B VAL A 1 31 ? 12.546  48.161 -6.054  0.30   19.06 ? 31   VAL A O   1 
ATOM   241  C CB  A VAL A 1 31 ? 10.681  45.685 -6.328  0.70   20.63 ? 31   VAL A CB  1 
ATOM   242  C CB  B VAL A 1 31 ? 10.648  45.632 -6.327  0.30   18.91 ? 31   VAL A CB  1 
ATOM   243  C CG1 A VAL A 1 31 ? 9.347   45.987 -5.631  0.30   18.12 ? 31   VAL A CG1 1 
ATOM   244  C CG1 B VAL A 1 31 ? 10.332  44.231 -6.249  0.0000 20.18 ? 31   VAL A CG1 1 
ATOM   245  C CG2 A VAL A 1 31 ? 10.777  46.386 -7.641  0.30   17.48 ? 31   VAL A CG2 1 
ATOM   246  C CG2 B VAL A 1 31 ? 9.484   46.535 -5.939  0.0000 20.18 ? 31   VAL A CG2 1 
ATOM   247  N N   . PHE A 1 32 ? 11.346  47.997 -4.160  1.00   19.99 ? 32   PHE A N   1 
ATOM   248  C CA  . PHE A 1 32 ? 11.356  49.436 -3.897  1.00   20.84 ? 32   PHE A CA  1 
ATOM   249  C C   . PHE A 1 32 ? 12.531  49.962 -3.071  1.00   19.26 ? 32   PHE A C   1 
ATOM   250  O O   . PHE A 1 32 ? 12.499  51.110 -2.642  1.00   20.34 ? 32   PHE A O   1 
ATOM   251  C CB  . PHE A 1 32 ? 10.073  49.864 -3.169  1.00   23.45 ? 32   PHE A CB  1 
ATOM   252  C CG  . PHE A 1 32 ? 8.799   49.440 -3.844  1.00   27.42 ? 32   PHE A CG  1 
ATOM   253  C CD1 . PHE A 1 32 ? 8.152   48.265 -3.462  1.00   28.22 ? 32   PHE A CD1 1 
ATOM   254  C CD2 . PHE A 1 32 ? 8.226   50.230 -4.836  1.00   28.68 ? 32   PHE A CD2 1 
ATOM   255  C CE1 . PHE A 1 32 ? 6.948   47.884 -4.057  1.00   29.56 ? 32   PHE A CE1 1 
ATOM   256  C CE2 . PHE A 1 32 ? 7.021   49.860 -5.440  1.00   29.73 ? 32   PHE A CE2 1 
ATOM   257  C CZ  . PHE A 1 32 ? 6.381   48.684 -5.049  1.00   30.00 ? 32   PHE A CZ  1 
ATOM   258  N N   . CYS A 1 33 ? 13.567  49.160 -2.852  1.00   18.34 ? 33   CYS A N   1 
ATOM   259  C CA  . CYS A 1 33 ? 14.677  49.626 -2.022  1.00   16.88 ? 33   CYS A CA  1 
ATOM   260  C C   . CYS A 1 33 ? 15.292  50.945 -2.442  1.00   16.64 ? 33   CYS A C   1 
ATOM   261  O O   . CYS A 1 33 ? 15.602  51.781 -1.596  1.00   14.75 ? 33   CYS A O   1 
ATOM   262  C CB  . CYS A 1 33 ? 15.798  48.596 -1.951  1.00   16.90 ? 33   CYS A CB  1 
ATOM   263  S SG  . CYS A 1 33 ? 16.408  48.351 -0.249  1.00   18.40 ? 33   CYS A SG  1 
ATOM   264  N N   . SER A 1 34 ? 15.477  51.126 -3.745  1.00   16.93 ? 34   SER A N   1 
ATOM   265  C CA  . SER A 1 34 ? 16.097  52.342 -4.258  1.00   17.79 ? 34   SER A CA  1 
ATOM   266  C C   . SER A 1 34 ? 15.368  53.628 -3.893  1.00   17.60 ? 34   SER A C   1 
ATOM   267  O O   . SER A 1 34 ? 16.006  54.660 -3.685  1.00   17.44 ? 34   SER A O   1 
ATOM   268  C CB  . SER A 1 34 ? 16.250  52.258 -5.782  1.00   18.66 ? 34   SER A CB  1 
ATOM   269  O OG  . SER A 1 34 ? 14.991  52.102 -6.415  1.00   23.51 ? 34   SER A OG  1 
ATOM   270  N N   . SER A 1 35 ? 14.042  53.573 -3.802  1.00   16.84 ? 35   SER A N   1 
ATOM   271  C CA  . SER A 1 35 ? 13.266  54.767 -3.484  1.00   18.34 ? 35   SER A CA  1 
ATOM   272  C C   . SER A 1 35 ? 12.737  54.856 -2.053  1.00   18.14 ? 35   SER A C   1 
ATOM   273  O O   . SER A 1 35 ? 12.732  55.935 -1.458  1.00   18.62 ? 35   SER A O   1 
ATOM   274  C CB  . SER A 1 35 ? 12.088  54.894 -4.453  1.00   18.51 ? 35   SER A CB  1 
ATOM   275  O OG  . SER A 1 35 ? 11.180  53.817 -4.297  1.00   20.15 ? 35   SER A OG  1 
ATOM   276  N N   . ARG A 1 36 ? 12.294  53.729 -1.504  1.00   18.74 ? 36   ARG A N   1 
ATOM   277  C CA  . ARG A 1 36 ? 11.731  53.706 -0.157  1.00   19.16 ? 36   ARG A CA  1 
ATOM   278  C C   . ARG A 1 36 ? 12.681  53.218 0.924   1.00   18.46 ? 36   ARG A C   1 
ATOM   279  O O   . ARG A 1 36 ? 12.378  53.327 2.111   1.00   18.93 ? 36   ARG A O   1 
ATOM   280  C CB  . ARG A 1 36 ? 10.495  52.813 -0.122  1.00   21.27 ? 36   ARG A CB  1 
ATOM   281  C CG  . ARG A 1 36 ? 9.432   53.139 -1.144  1.00   23.97 ? 36   ARG A CG  1 
ATOM   282  C CD  . ARG A 1 36 ? 8.320   52.113 -1.041  1.00   27.07 ? 36   ARG A CD  1 
ATOM   283  N NE  . ARG A 1 36 ? 7.276   52.300 -2.043  1.00   30.03 ? 36   ARG A NE  1 
ATOM   284  C CZ  . ARG A 1 36 ? 6.237   51.483 -2.187  1.00   31.77 ? 36   ARG A CZ  1 
ATOM   285  N NH1 . ARG A 1 36 ? 6.108   50.427 -1.392  1.00   29.63 ? 36   ARG A NH1 1 
ATOM   286  N NH2 . ARG A 1 36 ? 5.325   51.719 -3.120  1.00   32.29 ? 36   ARG A NH2 1 
ATOM   287  N N   . GLY A 1 37 ? 13.822  52.673 0.523   1.00   16.89 ? 37   GLY A N   1 
ATOM   288  C CA  . GLY A 1 37 ? 14.746  52.149 1.505   1.00   15.69 ? 37   GLY A CA  1 
ATOM   289  C C   . GLY A 1 37 ? 14.316  50.728 1.812   1.00   15.81 ? 37   GLY A C   1 
ATOM   290  O O   . GLY A 1 37 ? 13.405  50.199 1.171   1.00   14.81 ? 37   GLY A O   1 
ATOM   291  N N   . LYS A 1 38 ? 14.945  50.113 2.806   1.00   15.06 ? 38   LYS A N   1 
ATOM   292  C CA  . LYS A 1 38 ? 14.639  48.737 3.168   1.00   15.91 ? 38   LYS A CA  1 
ATOM   293  C C   . LYS A 1 38 ? 13.332  48.511 3.924   1.00   16.07 ? 38   LYS A C   1 
ATOM   294  O O   . LYS A 1 38 ? 12.838  49.397 4.626   1.00   13.42 ? 38   LYS A O   1 
ATOM   295  C CB  . LYS A 1 38 ? 15.787  48.153 3.993   1.00   17.18 ? 38   LYS A CB  1 
ATOM   296  C CG  . LYS A 1 38 ? 17.090  48.039 3.214   1.00   19.08 ? 38   LYS A CG  1 
ATOM   297  C CD  . LYS A 1 38 ? 18.212  47.439 4.039   1.00   22.64 ? 38   LYS A CD  1 
ATOM   298  C CE  . LYS A 1 38 ? 19.494  47.402 3.205   1.00   24.25 ? 38   LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 38 ? 20.615  46.722 3.897   1.00   29.00 ? 38   LYS A NZ  1 
ATOM   300  N N   . VAL A 1 39 ? 12.784  47.310 3.754   1.00   14.29 ? 39   VAL A N   1 
ATOM   301  C CA  . VAL A 1 39 ? 11.569  46.896 4.449   1.00   14.22 ? 39   VAL A CA  1 
ATOM   302  C C   . VAL A 1 39 ? 11.975  46.819 5.917   1.00   13.79 ? 39   VAL A C   1 
ATOM   303  O O   . VAL A 1 39 ? 13.120  46.475 6.229   1.00   14.13 ? 39   VAL A O   1 
ATOM   304  C CB  . VAL A 1 39 ? 11.094  45.488 3.985   1.00   14.42 ? 39   VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 39 ? 9.887   45.030 4.816   1.00   14.69 ? 39   VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 39 ? 10.734  45.525 2.506   1.00   15.19 ? 39   VAL A CG2 1 
ATOM   307  N N   . VAL A 1 40 ? 11.048  47.151 6.810   1.00   12.32 ? 40   VAL A N   1 
ATOM   308  C CA  . VAL A 1 40 ? 11.313  47.131 8.244   1.00   12.47 ? 40   VAL A CA  1 
ATOM   309  C C   . VAL A 1 40 ? 10.328  46.239 8.979   1.00   13.41 ? 40   VAL A C   1 
ATOM   310  O O   . VAL A 1 40 ? 9.109   46.385 8.842   1.00   12.80 ? 40   VAL A O   1 
ATOM   311  C CB  . VAL A 1 40 ? 11.220  48.555 8.870   1.00   14.69 ? 40   VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 40 ? 11.425  48.481 10.395  1.00   13.43 ? 40   VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 40 ? 12.267  49.477 8.244   1.00   12.61 ? 40   VAL A CG2 1 
ATOM   314  N N   . GLU A 1 41 ? 10.867  45.306 9.753   1.00   12.38 ? 41   GLU A N   1 
ATOM   315  C CA  . GLU A 1 41 ? 10.047  44.407 10.553  1.00   13.34 ? 41   GLU A CA  1 
ATOM   316  C C   . GLU A 1 41 ? 10.555  44.519 11.988  1.00   14.02 ? 41   GLU A C   1 
ATOM   317  O O   . GLU A 1 41 ? 11.764  44.472 12.231  1.00   12.28 ? 41   GLU A O   1 
ATOM   318  C CB  . GLU A 1 41 ? 10.177  42.966 10.057  1.00   14.74 ? 41   GLU A CB  1 
ATOM   319  C CG  . GLU A 1 41 ? 9.387   41.964 10.889  1.00   18.37 ? 41   GLU A CG  1 
ATOM   320  C CD  . GLU A 1 41 ? 9.493   40.555 10.346  1.00   22.70 ? 41   GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 41 ? 9.164   40.357 9.157   1.00   22.84 ? 41   GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 41 ? 9.903   39.649 11.105  1.00   23.52 ? 41   GLU A OE2 1 
ATOM   323  N N   . LEU A 1 42 ? 9.629   44.673 12.927  1.00   12.61 ? 42   LEU A N   1 
ATOM   324  C CA  . LEU A 1 42 ? 9.973   44.818 14.340  1.00   11.91 ? 42   LEU A CA  1 
ATOM   325  C C   . LEU A 1 42 ? 9.138   43.867 15.173  1.00   13.46 ? 42   LEU A C   1 
ATOM   326  O O   . LEU A 1 42 ? 7.933   43.750 14.952  1.00   12.97 ? 42   LEU A O   1 
ATOM   327  C CB  . LEU A 1 42 ? 9.680   46.244 14.801  1.00   11.91 ? 42   LEU A CB  1 
ATOM   328  C CG  . LEU A 1 42 ? 10.254  47.392 13.970  1.00   13.72 ? 42   LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 42 ? 9.696   48.712 14.497  1.00   11.12 ? 42   LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 42 ? 11.777  47.374 14.046  1.00   12.99 ? 42   LEU A CD2 1 
ATOM   331  N N   . GLY A 1 43 ? 9.764   43.197 16.134  1.00   13.11 ? 43   GLY A N   1 
ATOM   332  C CA  . GLY A 1 43 ? 9.005   42.278 16.961  1.00   13.68 ? 43   GLY A CA  1 
ATOM   333  C C   . GLY A 1 43 ? 9.704   41.747 18.195  1.00   15.59 ? 43   GLY A C   1 
ATOM   334  O O   . GLY A 1 43 ? 10.690  42.315 18.674  1.00   12.14 ? 43   GLY A O   1 
ATOM   335  N N   . CYS A 1 44 ? 9.167   40.637 18.695  1.00   15.28 ? 44   CYS A N   1 
ATOM   336  C CA  . CYS A 1 44 ? 9.664   39.946 19.880  1.00   15.94 ? 44   CYS A CA  1 
ATOM   337  C C   . CYS A 1 44 ? 10.444  38.700 19.486  1.00   15.58 ? 44   CYS A C   1 
ATOM   338  O O   . CYS A 1 44 ? 10.233  38.145 18.411  1.00   17.48 ? 44   CYS A O   1 
ATOM   339  C CB  . CYS A 1 44 ? 8.494   39.483 20.741  1.00   15.05 ? 44   CYS A CB  1 
ATOM   340  S SG  . CYS A 1 44 ? 7.485   40.770 21.523  1.00   16.45 ? 44   CYS A SG  1 
ATOM   341  N N   . ALA A 1 45 ? 11.319  38.238 20.374  1.00   15.83 ? 45   ALA A N   1 
ATOM   342  C CA  . ALA A 1 45 ? 12.091  37.032 20.103  1.00   16.30 ? 45   ALA A CA  1 
ATOM   343  C C   . ALA A 1 45 ? 12.678  36.409 21.365  1.00   15.84 ? 45   ALA A C   1 
ATOM   344  O O   . ALA A 1 45 ? 12.973  37.103 22.338  1.00   15.65 ? 45   ALA A O   1 
ATOM   345  C CB  . ALA A 1 45 ? 13.216  37.342 19.103  1.00   16.40 ? 45   ALA A CB  1 
ATOM   346  N N   . ALA A 1 46 ? 12.826  35.089 21.349  1.00   16.64 ? 46   ALA A N   1 
ATOM   347  C CA  . ALA A 1 46 ? 13.423  34.369 22.470  1.00   18.77 ? 46   ALA A CA  1 
ATOM   348  C C   . ALA A 1 46 ? 14.894  34.228 22.079  1.00   19.17 ? 46   ALA A C   1 
ATOM   349  O O   . ALA A 1 46 ? 15.797  34.435 22.891  1.00   21.74 ? 46   ALA A O   1 
ATOM   350  C CB  . ALA A 1 46 ? 12.782  32.994 22.624  1.00   18.66 ? 46   ALA A CB  1 
ATOM   351  N N   . THR A 1 47 ? 15.108  33.881 20.814  1.00   17.44 ? 47   THR A N   1 
ATOM   352  C CA  . THR A 1 47 ? 16.441  33.726 20.241  1.00   17.87 ? 47   THR A CA  1 
ATOM   353  C C   . THR A 1 47 ? 16.509  34.690 19.062  1.00   16.98 ? 47   THR A C   1 
ATOM   354  O O   . THR A 1 47 ? 15.569  34.778 18.272  1.00   16.71 ? 47   THR A O   1 
ATOM   355  C CB  . THR A 1 47 ? 16.669  32.296 19.700  1.00   20.02 ? 47   THR A CB  1 
ATOM   356  O OG1 . THR A 1 47 ? 16.496  31.345 20.757  1.00   21.25 ? 47   THR A OG1 1 
ATOM   357  C CG2 . THR A 1 47 ? 18.077  32.161 19.131  1.00   20.60 ? 47   THR A CG2 1 
ATOM   358  N N   A CYS A 1 48 ? 17.628  35.391 18.935  0.67   15.39 ? 48   CYS A N   1 
ATOM   359  N N   B CYS A 1 48 ? 17.604  35.432 18.952  0.33   14.30 ? 48   CYS A N   1 
ATOM   360  C CA  A CYS A 1 48 ? 17.815  36.337 17.842  0.67   15.82 ? 48   CYS A CA  1 
ATOM   361  C CA  B CYS A 1 48 ? 17.724  36.377 17.854  0.33   13.67 ? 48   CYS A CA  1 
ATOM   362  C C   A CYS A 1 48 ? 17.671  35.643 16.487  0.67   15.72 ? 48   CYS A C   1 
ATOM   363  C C   B CYS A 1 48 ? 17.623  35.648 16.522  0.33   14.51 ? 48   CYS A C   1 
ATOM   364  O O   A CYS A 1 48 ? 18.269  34.594 16.259  0.67   13.71 ? 48   CYS A O   1 
ATOM   365  O O   B CYS A 1 48 ? 18.210  34.584 16.339  0.33   12.13 ? 48   CYS A O   1 
ATOM   366  C CB  A CYS A 1 48 ? 19.207  36.964 17.929  0.67   15.52 ? 48   CYS A CB  1 
ATOM   367  C CB  B CYS A 1 48 ? 19.049  37.132 17.913  0.33   11.87 ? 48   CYS A CB  1 
ATOM   368  S SG  A CYS A 1 48 ? 19.570  37.779 19.494  0.67   21.48 ? 48   CYS A SG  1 
ATOM   369  S SG  B CYS A 1 48 ? 19.161  38.413 16.635  0.33   10.88 ? 48   CYS A SG  1 
ATOM   370  N N   . PRO A 1 49 ? 16.866  36.216 15.574  1.00   16.95 ? 49   PRO A N   1 
ATOM   371  C CA  . PRO A 1 49 ? 16.686  35.613 14.247  1.00   21.20 ? 49   PRO A CA  1 
ATOM   372  C C   . PRO A 1 49 ? 18.055  35.434 13.586  1.00   24.19 ? 49   PRO A C   1 
ATOM   373  O O   . PRO A 1 49 ? 18.848  36.374 13.535  1.00   24.68 ? 49   PRO A O   1 
ATOM   374  C CB  . PRO A 1 49 ? 15.822  36.640 13.520  1.00   22.55 ? 49   PRO A CB  1 
ATOM   375  C CG  . PRO A 1 49 ? 14.988  37.218 14.633  1.00   23.21 ? 49   PRO A CG  1 
ATOM   376  C CD  . PRO A 1 49 ? 16.018  37.412 15.728  1.00   18.93 ? 49   PRO A CD  1 
ATOM   377  N N   A SER A 1 50 ? 18.321  34.233 13.081  0.50   25.43 ? 50   SER A N   1 
ATOM   378  N N   B SER A 1 50 ? 18.330  34.229 13.094  0.50   25.19 ? 50   SER A N   1 
ATOM   379  C CA  A SER A 1 50 ? 19.597  33.932 12.434  0.50   27.77 ? 50   SER A CA  1 
ATOM   380  C CA  B SER A 1 50 ? 19.610  33.932 12.454  0.50   27.26 ? 50   SER A CA  1 
ATOM   381  C C   A SER A 1 50 ? 19.949  34.928 11.334  0.50   29.09 ? 50   SER A C   1 
ATOM   382  C C   B SER A 1 50 ? 19.952  34.918 11.339  0.50   28.80 ? 50   SER A C   1 
ATOM   383  O O   A SER A 1 50 ? 19.077  35.387 10.598  0.50   29.05 ? 50   SER A O   1 
ATOM   384  O O   B SER A 1 50 ? 19.075  35.360 10.599  0.50   28.74 ? 50   SER A O   1 
ATOM   385  C CB  A SER A 1 50 ? 19.570  32.520 11.844  0.50   27.20 ? 50   SER A CB  1 
ATOM   386  C CB  B SER A 1 50 ? 19.602  32.506 11.895  0.50   26.29 ? 50   SER A CB  1 
ATOM   387  O OG  A SER A 1 50 ? 19.361  31.551 12.854  0.50   28.30 ? 50   SER A OG  1 
ATOM   388  O OG  B SER A 1 50 ? 18.547  32.328 10.967  0.50   25.91 ? 50   SER A OG  1 
ATOM   389  N N   . LYS A 1 51 ? 21.235  35.250 11.224  1.00   30.79 ? 51   LYS A N   1 
ATOM   390  C CA  . LYS A 1 51 ? 21.707  36.188 10.207  1.00   34.24 ? 51   LYS A CA  1 
ATOM   391  C C   . LYS A 1 51 ? 21.715  35.586 8.797   1.00   37.04 ? 51   LYS A C   1 
ATOM   392  O O   . LYS A 1 51 ? 22.462  34.651 8.510   1.00   38.72 ? 51   LYS A O   1 
ATOM   393  C CB  . LYS A 1 51 ? 23.115  36.685 10.565  1.00   33.60 ? 51   LYS A CB  1 
ATOM   394  C CG  . LYS A 1 51 ? 23.714  37.672 9.561   1.00   33.19 ? 51   LYS A CG  1 
ATOM   395  C CD  . LYS A 1 51 ? 22.834  38.906 9.386   1.00   31.53 ? 51   LYS A CD  1 
ATOM   396  C CE  . LYS A 1 51 ? 23.438  39.887 8.397   1.00   29.30 ? 51   LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 51 ? 23.605  39.305 7.037   1.00   25.84 ? 51   LYS A NZ  1 
ATOM   398  N N   A LYS A 1 52 ? 20.879  36.145 7.928   0.50   38.15 ? 52   LYS A N   1 
ATOM   399  N N   B LYS A 1 52 ? 20.873  36.131 7.926   0.50   38.10 ? 52   LYS A N   1 
ATOM   400  C CA  A LYS A 1 52 ? 20.749  35.709 6.541   0.50   39.34 ? 52   LYS A CA  1 
ATOM   401  C CA  B LYS A 1 52 ? 20.778  35.672 6.546   0.50   39.23 ? 52   LYS A CA  1 
ATOM   402  C C   A LYS A 1 52 ? 21.537  36.644 5.618   0.50   39.53 ? 52   LYS A C   1 
ATOM   403  C C   B LYS A 1 52 ? 21.554  36.625 5.637   0.50   39.47 ? 52   LYS A C   1 
ATOM   404  O O   A LYS A 1 52 ? 21.510  37.863 5.789   0.50   39.10 ? 52   LYS A O   1 
ATOM   405  O O   B LYS A 1 52 ? 21.527  37.839 5.832   0.50   38.98 ? 52   LYS A O   1 
ATOM   406  C CB  A LYS A 1 52 ? 19.262  35.698 6.159   0.50   40.05 ? 52   LYS A CB  1 
ATOM   407  C CB  B LYS A 1 52 ? 19.312  35.610 6.113   0.50   39.95 ? 52   LYS A CB  1 
ATOM   408  C CG  A LYS A 1 52 ? 18.921  36.253 4.779   0.50   41.53 ? 52   LYS A CG  1 
ATOM   409  C CG  B LYS A 1 52 ? 18.487  34.591 6.884   0.50   41.15 ? 52   LYS A CG  1 
ATOM   410  C CD  A LYS A 1 52 ? 19.242  35.280 3.662   0.50   42.28 ? 52   LYS A CD  1 
ATOM   411  C CD  B LYS A 1 52 ? 17.018  34.627 6.479   0.50   42.65 ? 52   LYS A CD  1 
ATOM   412  C CE  A LYS A 1 52 ? 18.824  35.848 2.317   0.50   42.06 ? 52   LYS A CE  1 
ATOM   413  C CE  B LYS A 1 52 ? 16.836  34.386 4.986   0.50   43.30 ? 52   LYS A CE  1 
ATOM   414  N NZ  A LYS A 1 52 ? 17.377  36.193 2.297   0.50   43.09 ? 52   LYS A NZ  1 
ATOM   415  N NZ  B LYS A 1 52 ? 17.429  33.091 4.547   0.50   44.62 ? 52   LYS A NZ  1 
ATOM   416  N N   . PRO A 1 53 ? 22.254  36.080 4.629   1.00   39.74 ? 53   PRO A N   1 
ATOM   417  C CA  . PRO A 1 53 ? 23.059  36.845 3.667   1.00   39.53 ? 53   PRO A CA  1 
ATOM   418  C C   . PRO A 1 53 ? 22.555  38.222 3.220   1.00   38.42 ? 53   PRO A C   1 
ATOM   419  O O   . PRO A 1 53 ? 23.260  39.219 3.373   1.00   39.82 ? 53   PRO A O   1 
ATOM   420  C CB  . PRO A 1 53 ? 23.197  35.873 2.501   1.00   40.15 ? 53   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 53 ? 23.363  34.578 3.209   1.00   40.87 ? 53   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 53 ? 22.305  34.640 4.305   1.00   40.43 ? 53   PRO A CD  1 
ATOM   423  N N   . TYR A 1 54 ? 21.347  38.287 2.672   1.00   36.58 ? 54   TYR A N   1 
ATOM   424  C CA  . TYR A 1 54 ? 20.822  39.564 2.198   1.00   36.09 ? 54   TYR A CA  1 
ATOM   425  C C   . TYR A 1 54 ? 19.743  40.153 3.105   1.00   34.07 ? 54   TYR A C   1 
ATOM   426  O O   . TYR A 1 54 ? 18.731  40.686 2.644   1.00   34.51 ? 54   TYR A O   1 
ATOM   427  C CB  . TYR A 1 54 ? 20.311  39.386 0.769   1.00   39.35 ? 54   TYR A CB  1 
ATOM   428  C CG  . TYR A 1 54 ? 21.378  38.811 -0.141  1.00   42.76 ? 54   TYR A CG  1 
ATOM   429  C CD1 . TYR A 1 54 ? 22.515  39.553 -0.470  1.00   44.18 ? 54   TYR A CD1 1 
ATOM   430  C CD2 . TYR A 1 54 ? 21.286  37.503 -0.618  1.00   45.20 ? 54   TYR A CD2 1 
ATOM   431  C CE1 . TYR A 1 54 ? 23.537  39.004 -1.249  1.00   45.88 ? 54   TYR A CE1 1 
ATOM   432  C CE2 . TYR A 1 54 ? 22.302  36.943 -1.397  1.00   46.14 ? 54   TYR A CE2 1 
ATOM   433  C CZ  . TYR A 1 54 ? 23.424  37.699 -1.707  1.00   46.92 ? 54   TYR A CZ  1 
ATOM   434  O OH  . TYR A 1 54 ? 24.434  37.145 -2.465  1.00   48.72 ? 54   TYR A OH  1 
ATOM   435  N N   . GLU A 1 55 ? 19.994  40.071 4.406   1.00   29.81 ? 55   GLU A N   1 
ATOM   436  C CA  . GLU A 1 55 ? 19.074  40.571 5.420   1.00   26.49 ? 55   GLU A CA  1 
ATOM   437  C C   . GLU A 1 55 ? 19.880  41.175 6.564   1.00   23.23 ? 55   GLU A C   1 
ATOM   438  O O   . GLU A 1 55 ? 20.950  40.675 6.899   1.00   22.45 ? 55   GLU A O   1 
ATOM   439  C CB  . GLU A 1 55 ? 18.251  39.408 5.975   1.00   30.19 ? 55   GLU A CB  1 
ATOM   440  C CG  . GLU A 1 55 ? 16.753  39.515 5.814   1.00   36.52 ? 55   GLU A CG  1 
ATOM   441  C CD  . GLU A 1 55 ? 16.036  38.278 6.334   1.00   37.52 ? 55   GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 55 ? 16.225  37.931 7.519   1.00   39.75 ? 55   GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 55 ? 15.285  37.654 5.558   1.00   40.75 ? 55   GLU A OE2 1 
ATOM   444  N N   A GLU A 1 56 ? 19.373  42.251 7.155   0.50   20.89 ? 56   GLU A N   1 
ATOM   445  N N   B GLU A 1 56 ? 19.371  42.253 7.151   0.50   20.44 ? 56   GLU A N   1 
ATOM   446  C CA  A GLU A 1 56 ? 20.046  42.878 8.285   0.50   20.18 ? 56   GLU A CA  1 
ATOM   447  C CA  B GLU A 1 56 ? 20.035  42.884 8.284   0.50   19.41 ? 56   GLU A CA  1 
ATOM   448  C C   A GLU A 1 56 ? 19.194  42.584 9.512   0.50   19.37 ? 56   GLU A C   1 
ATOM   449  C C   B GLU A 1 56 ? 19.189  42.574 9.512   0.50   18.87 ? 56   GLU A C   1 
ATOM   450  O O   A GLU A 1 56 ? 17.969  42.700 9.466   0.50   18.64 ? 56   GLU A O   1 
ATOM   451  O O   B GLU A 1 56 ? 17.962  42.667 9.465   0.50   18.11 ? 56   GLU A O   1 
ATOM   452  C CB  A GLU A 1 56 ? 20.156  44.393 8.096   0.50   21.69 ? 56   GLU A CB  1 
ATOM   453  C CB  B GLU A 1 56 ? 20.121  44.404 8.114   0.50   20.13 ? 56   GLU A CB  1 
ATOM   454  C CG  A GLU A 1 56 ? 20.774  44.823 6.780   0.50   25.26 ? 56   GLU A CG  1 
ATOM   455  C CG  B GLU A 1 56 ? 20.845  44.879 6.867   0.50   22.29 ? 56   GLU A CG  1 
ATOM   456  C CD  A GLU A 1 56 ? 21.003  46.319 6.710   0.50   26.21 ? 56   GLU A CD  1 
ATOM   457  C CD  B GLU A 1 56 ? 22.136  44.133 6.618   0.50   22.52 ? 56   GLU A CD  1 
ATOM   458  O OE1 A GLU A 1 56 ? 20.118  47.080 7.156   0.50   27.65 ? 56   GLU A OE1 1 
ATOM   459  O OE1 B GLU A 1 56 ? 22.914  43.945 7.576   0.50   23.15 ? 56   GLU A OE1 1 
ATOM   460  O OE2 A GLU A 1 56 ? 22.063  46.734 6.201   0.50   28.65 ? 56   GLU A OE2 1 
ATOM   461  O OE2 B GLU A 1 56 ? 22.371  43.740 5.456   0.50   25.10 ? 56   GLU A OE2 1 
ATOM   462  N N   . VAL A 1 57 ? 19.835  42.195 10.606  1.00   17.04 ? 57   VAL A N   1 
ATOM   463  C CA  . VAL A 1 57 ? 19.103  41.888 11.821  1.00   16.78 ? 57   VAL A CA  1 
ATOM   464  C C   . VAL A 1 57 ? 19.766  42.506 13.033  1.00   16.62 ? 57   VAL A C   1 
ATOM   465  O O   . VAL A 1 57 ? 20.985  42.432 13.197  1.00   14.61 ? 57   VAL A O   1 
ATOM   466  C CB  . VAL A 1 57 ? 19.000  40.363 12.064  1.00   18.53 ? 57   VAL A CB  1 
ATOM   467  C CG1 . VAL A 1 57 ? 18.210  40.093 13.342  1.00   18.24 ? 57   VAL A CG1 1 
ATOM   468  C CG2 . VAL A 1 57 ? 18.337  39.685 10.879  1.00   21.82 ? 57   VAL A CG2 1 
ATOM   469  N N   . THR A 1 58 ? 18.948  43.136 13.864  1.00   15.74 ? 58   THR A N   1 
ATOM   470  C CA  . THR A 1 58 ? 19.411  43.729 15.107  1.00   16.19 ? 58   THR A CA  1 
ATOM   471  C C   . THR A 1 58 ? 18.538  43.176 16.220  1.00   17.96 ? 58   THR A C   1 
ATOM   472  O O   . THR A 1 58 ? 17.312  43.133 16.093  1.00   16.91 ? 58   THR A O   1 
ATOM   473  C CB  . THR A 1 58 ? 19.249  45.257 15.131  1.00   16.92 ? 58   THR A CB  1 
ATOM   474  O OG1 . THR A 1 58 ? 20.141  45.856 14.184  1.00   15.90 ? 58   THR A OG1 1 
ATOM   475  C CG2 . THR A 1 58 ? 19.552  45.793 16.533  1.00   15.70 ? 58   THR A CG2 1 
ATOM   476  N N   A CYS A 1 59 ? 19.164  42.713 17.305  0.66   18.74 ? 59   CYS A N   1 
ATOM   477  N N   B CYS A 1 59 ? 19.178  42.759 17.301  0.34   17.88 ? 59   CYS A N   1 
ATOM   478  C CA  A CYS A 1 59 ? 18.430  42.177 18.458  0.66   20.57 ? 59   CYS A CA  1 
ATOM   479  C CA  B CYS A 1 59 ? 18.457  42.255 18.448  0.34   18.91 ? 59   CYS A CA  1 
ATOM   480  C C   A CYS A 1 59 ? 18.999  42.811 19.722  0.66   20.96 ? 59   CYS A C   1 
ATOM   481  C C   B CYS A 1 59 ? 18.995  42.994 19.654  0.34   19.82 ? 59   CYS A C   1 
ATOM   482  O O   A CYS A 1 59 ? 20.219  42.866 19.904  0.66   21.11 ? 59   CYS A O   1 
ATOM   483  O O   B CYS A 1 59 ? 20.179  43.349 19.708  0.34   18.98 ? 59   CYS A O   1 
ATOM   484  C CB  A CYS A 1 59 ? 18.564  40.658 18.541  0.66   24.45 ? 59   CYS A CB  1 
ATOM   485  C CB  B CYS A 1 59 ? 18.664  40.752 18.608  0.34   21.61 ? 59   CYS A CB  1 
ATOM   486  S SG  A CYS A 1 59 ? 20.241  40.077 18.858  0.66   30.38 ? 59   CYS A SG  1 
ATOM   487  S SG  B CYS A 1 59 ? 17.675  39.766 17.476  0.34   21.33 ? 59   CYS A SG  1 
ATOM   488  N N   . CYS A 1 60 ? 18.117  43.267 20.605  1.00   18.02 ? 60   CYS A N   1 
ATOM   489  C CA  . CYS A 1 60 ? 18.532  43.957 21.808  1.00   17.20 ? 60   CYS A CA  1 
ATOM   490  C C   . CYS A 1 60 ? 17.672  43.535 22.993  1.00   18.30 ? 60   CYS A C   1 
ATOM   491  O O   . CYS A 1 60 ? 16.629  42.895 22.818  1.00   15.95 ? 60   CYS A O   1 
ATOM   492  C CB  . CYS A 1 60 ? 18.446  45.452 21.547  1.00   17.47 ? 60   CYS A CB  1 
ATOM   493  S SG  . CYS A 1 60 ? 16.843  45.918 20.829  1.00   18.88 ? 60   CYS A SG  1 
ATOM   494  N N   . SER A 1 61 ? 18.093  43.904 24.195  1.00   18.58 ? 61   SER A N   1 
ATOM   495  C CA  . SER A 1 61 ? 17.366  43.461 25.372  1.00   20.43 ? 61   SER A CA  1 
ATOM   496  C C   . SER A 1 61 ? 16.836  44.479 26.370  1.00   20.22 ? 61   SER A C   1 
ATOM   497  O O   . SER A 1 61 ? 16.635  44.144 27.534  1.00   21.03 ? 61   SER A O   1 
ATOM   498  C CB  . SER A 1 61 ? 18.212  42.416 26.100  1.00   23.77 ? 61   SER A CB  1 
ATOM   499  O OG  . SER A 1 61 ? 19.504  42.919 26.371  1.00   25.57 ? 61   SER A OG  1 
ATOM   500  N N   . THR A 1 62 ? 16.625  45.718 25.938  1.00   19.69 ? 62   THR A N   1 
ATOM   501  C CA  . THR A 1 62 ? 16.041  46.718 26.830  1.00   20.66 ? 62   THR A CA  1 
ATOM   502  C C   . THR A 1 62 ? 14.728  47.178 26.195  1.00   19.13 ? 62   THR A C   1 
ATOM   503  O O   . THR A 1 62 ? 14.571  47.132 24.972  1.00   18.29 ? 62   THR A O   1 
ATOM   504  C CB  . THR A 1 62 ? 16.983  47.928 27.081  1.00   21.08 ? 62   THR A CB  1 
ATOM   505  O OG1 . THR A 1 62 ? 17.342  48.545 25.841  1.00   22.21 ? 62   THR A OG1 1 
ATOM   506  C CG2 . THR A 1 62 ? 18.243  47.470 27.808  1.00   21.86 ? 62   THR A CG2 1 
ATOM   507  N N   . ASP A 1 63 ? 13.777  47.597 27.023  1.00   19.58 ? 63   ASP A N   1 
ATOM   508  C CA  . ASP A 1 63 ? 12.472  48.028 26.524  1.00   18.86 ? 63   ASP A CA  1 
ATOM   509  C C   . ASP A 1 63 ? 12.525  49.023 25.362  1.00   18.47 ? 63   ASP A C   1 
ATOM   510  O O   . ASP A 1 63 ? 13.232  50.032 25.416  1.00   16.79 ? 63   ASP A O   1 
ATOM   511  C CB  . ASP A 1 63 ? 11.632  48.642 27.656  1.00   20.63 ? 63   ASP A CB  1 
ATOM   512  C CG  . ASP A 1 63 ? 11.228  47.630 28.721  1.00   20.67 ? 63   ASP A CG  1 
ATOM   513  O OD1 . ASP A 1 63 ? 11.243  46.408 28.463  1.00   19.66 ? 63   ASP A OD1 1 
ATOM   514  O OD2 . ASP A 1 63 ? 10.867  48.071 29.830  1.00   24.93 ? 63   ASP A OD2 1 
ATOM   515  N N   . LYS A 1 64 ? 11.758  48.721 24.318  1.00   16.20 ? 64   LYS A N   1 
ATOM   516  C CA  . LYS A 1 64 ? 11.647  49.560 23.130  1.00   16.80 ? 64   LYS A CA  1 
ATOM   517  C C   . LYS A 1 64 ? 12.988  49.921 22.498  1.00   16.20 ? 64   LYS A C   1 
ATOM   518  O O   . LYS A 1 64 ? 13.174  51.016 21.966  1.00   14.96 ? 64   LYS A O   1 
ATOM   519  C CB  . LYS A 1 64 ? 10.852  50.819 23.482  1.00   18.87 ? 64   LYS A CB  1 
ATOM   520  C CG  . LYS A 1 64 ? 9.429   50.501 23.936  1.00   22.42 ? 64   LYS A CG  1 
ATOM   521  C CD  . LYS A 1 64 ? 8.673   51.729 24.422  1.00   26.95 ? 64   LYS A CD  1 
ATOM   522  C CE  . LYS A 1 64 ? 8.416   52.706 23.296  1.00   30.46 ? 64   LYS A CE  1 
ATOM   523  N NZ  . LYS A 1 64 ? 7.558   53.847 23.739  1.00   35.54 ? 64   LYS A NZ  1 
ATOM   524  N N   . CYS A 1 65 ? 13.911  48.971 22.537  1.00   15.50 ? 65   CYS A N   1 
ATOM   525  C CA  . CYS A 1 65 ? 15.239  49.172 21.976  1.00   16.21 ? 65   CYS A CA  1 
ATOM   526  C C   . CYS A 1 65 ? 15.270  48.932 20.463  1.00   15.70 ? 65   CYS A C   1 
ATOM   527  O O   . CYS A 1 65 ? 16.297  49.146 19.821  1.00   16.11 ? 65   CYS A O   1 
ATOM   528  C CB  . CYS A 1 65 ? 16.227  48.234 22.665  1.00   15.35 ? 65   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 65 ? 15.829  46.465 22.497  1.00   15.83 ? 65   CYS A SG  1 
ATOM   530  N N   . ASN A 1 66 ? 14.141  48.507 19.897  1.00   13.87 ? 66   ASN A N   1 
ATOM   531  C CA  . ASN A 1 66 ? 14.055  48.212 18.465  1.00   13.54 ? 66   ASN A CA  1 
ATOM   532  C C   . ASN A 1 66 ? 13.114  49.157 17.719  1.00   13.76 ? 66   ASN A C   1 
ATOM   533  O O   . ASN A 1 66 ? 12.175  48.716 17.051  1.00   14.58 ? 66   ASN A O   1 
ATOM   534  C CB  . ASN A 1 66 ? 13.568  46.773 18.269  1.00   11.90 ? 66   ASN A CB  1 
ATOM   535  C CG  . ASN A 1 66 ? 12.127  46.579 18.734  1.00   12.78 ? 66   ASN A CG  1 
ATOM   536  O OD1 . ASN A 1 66 ? 11.692  47.191 19.715  1.00   13.65 ? 66   ASN A OD1 1 
ATOM   537  N ND2 . ASN A 1 66 ? 11.385  45.723 18.035  1.00   9.65  ? 66   ASN A ND2 1 
ATOM   538  N N   . PRO A 1 67 ? 13.358  50.469 17.804  1.00   15.33 ? 67   PRO A N   1 
ATOM   539  C CA  . PRO A 1 67 ? 12.462  51.386 17.099  1.00   14.82 ? 67   PRO A CA  1 
ATOM   540  C C   . PRO A 1 67 ? 12.616  51.364 15.585  1.00   15.65 ? 67   PRO A C   1 
ATOM   541  O O   . PRO A 1 67 ? 13.595  50.843 15.040  1.00   15.67 ? 67   PRO A O   1 
ATOM   542  C CB  . PRO A 1 67 ? 12.851  52.744 17.669  1.00   17.09 ? 67   PRO A CB  1 
ATOM   543  C CG  . PRO A 1 67 ? 14.350  52.592 17.811  1.00   15.83 ? 67   PRO A CG  1 
ATOM   544  C CD  . PRO A 1 67 ? 14.471  51.204 18.439  1.00   16.77 ? 67   PRO A CD  1 
ATOM   545  N N   . HIS A 1 68 ? 11.627  51.937 14.916  1.00   15.01 ? 68   HIS A N   1 
ATOM   546  C CA  . HIS A 1 68 ? 11.660  52.073 13.472  1.00   15.45 ? 68   HIS A CA  1 
ATOM   547  C C   . HIS A 1 68 ? 12.796  53.084 13.269  1.00   17.16 ? 68   HIS A C   1 
ATOM   548  O O   . HIS A 1 68 ? 12.990  53.969 14.099  1.00   16.70 ? 68   HIS A O   1 
ATOM   549  C CB  . HIS A 1 68 ? 10.340  52.674 12.984  1.00   14.44 ? 68   HIS A CB  1 
ATOM   550  C CG  . HIS A 1 68 ? 10.318  52.981 11.521  1.00   15.18 ? 68   HIS A CG  1 
ATOM   551  N ND1 . HIS A 1 68 ? 11.340  53.650 10.883  1.00   17.70 ? 68   HIS A ND1 1 
ATOM   552  C CD2 . HIS A 1 68 ? 9.394   52.711 10.569  1.00   15.41 ? 68   HIS A CD2 1 
ATOM   553  C CE1 . HIS A 1 68 ? 11.047  53.777 9.601   1.00   15.74 ? 68   HIS A CE1 1 
ATOM   554  N NE2 . HIS A 1 68 ? 9.871   53.216 9.385   1.00   16.96 ? 68   HIS A NE2 1 
ATOM   555  N N   . PRO A 1 69 ? 13.563  52.960 12.175  1.00   17.70 ? 69   PRO A N   1 
ATOM   556  C CA  . PRO A 1 69 ? 14.673  53.880 11.897  1.00   19.99 ? 69   PRO A CA  1 
ATOM   557  C C   . PRO A 1 69 ? 14.318  55.360 12.071  1.00   22.22 ? 69   PRO A C   1 
ATOM   558  O O   . PRO A 1 69 ? 15.175  56.173 12.415  1.00   22.83 ? 69   PRO A O   1 
ATOM   559  C CB  . PRO A 1 69 ? 15.038  53.540 10.457  1.00   20.91 ? 69   PRO A CB  1 
ATOM   560  C CG  . PRO A 1 69 ? 14.798  52.063 10.409  1.00   19.91 ? 69   PRO A CG  1 
ATOM   561  C CD  . PRO A 1 69 ? 13.474  51.915 11.139  1.00   18.16 ? 69   PRO A CD  1 
ATOM   562  N N   . LYS A 1 70 ? 13.055  55.703 11.840  1.00   23.80 ? 70   LYS A N   1 
ATOM   563  C CA  . LYS A 1 70 ? 12.607  57.086 11.959  1.00   28.11 ? 70   LYS A CA  1 
ATOM   564  C C   . LYS A 1 70 ? 12.252  57.502 13.381  1.00   31.00 ? 70   LYS A C   1 
ATOM   565  O O   . LYS A 1 70 ? 11.757  58.608 13.597  1.00   30.81 ? 70   LYS A O   1 
ATOM   566  C CB  . LYS A 1 70 ? 11.402  57.331 11.048  1.00   29.43 ? 70   LYS A CB  1 
ATOM   567  C CG  . LYS A 1 70 ? 11.730  57.356 9.564   1.00   31.69 ? 70   LYS A CG  1 
ATOM   568  C CD  . LYS A 1 70 ? 12.592  58.556 9.210   1.00   34.77 ? 70   LYS A CD  1 
ATOM   569  C CE  . LYS A 1 70 ? 12.864  58.621 7.717   1.00   36.46 ? 70   LYS A CE  1 
ATOM   570  N NZ  . LYS A 1 70 ? 13.626  59.845 7.350   1.00   36.75 ? 70   LYS A NZ  1 
ATOM   571  N N   . GLN A 1 71 ? 12.500  56.624 14.349  1.00   33.15 ? 71   GLN A N   1 
ATOM   572  C CA  . GLN A 1 71 ? 12.196  56.935 15.745  1.00   36.91 ? 71   GLN A CA  1 
ATOM   573  C C   . GLN A 1 71 ? 13.373  56.658 16.676  1.00   37.31 ? 71   GLN A C   1 
ATOM   574  O O   . GLN A 1 71 ? 14.248  55.846 16.369  1.00   36.99 ? 71   GLN A O   1 
ATOM   575  C CB  . GLN A 1 71 ? 10.988  56.126 16.221  1.00   38.29 ? 71   GLN A CB  1 
ATOM   576  C CG  . GLN A 1 71 ? 9.714   56.376 15.441  1.00   43.42 ? 71   GLN A CG  1 
ATOM   577  C CD  . GLN A 1 71 ? 8.510   55.708 16.080  1.00   45.00 ? 71   GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 71 ? 8.157   56.007 17.220  1.00   46.43 ? 71   GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 71 ? 7.875   54.797 15.349  1.00   46.19 ? 71   GLN A NE2 1 
ATOM   580  N N   . ARG A 1 72 ? 13.421  57.369 17.796  1.00   38.20 ? 72   ARG A N   1 
ATOM   581  C CA  . ARG A 1 72 ? 14.501  57.165 18.759  1.00   38.86 ? 72   ARG A CA  1 
ATOM   582  C C   . ARG A 1 72 ? 14.127  56.038 19.721  1.00   38.40 ? 72   ARG A C   1 
ATOM   583  O O   . ARG A 1 72 ? 12.948  55.797 19.973  1.00   36.66 ? 72   ARG A O   1 
ATOM   584  C CB  . ARG A 1 72 ? 14.764  58.447 19.557  1.00   41.02 ? 72   ARG A CB  1 
ATOM   585  C CG  . ARG A 1 72 ? 13.685  58.799 20.569  1.00   43.39 ? 72   ARG A CG  1 
ATOM   586  C CD  . ARG A 1 72 ? 12.341  59.043 19.899  1.00   45.83 ? 72   ARG A CD  1 
ATOM   587  N NE  . ARG A 1 72 ? 12.460  59.987 18.789  1.00   46.78 ? 72   ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 72 ? 11.434  60.454 18.090  1.00   46.58 ? 72   ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 72 ? 10.196  60.071 18.383  1.00   46.28 ? 72   ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 72 ? 11.648  61.297 17.090  1.00   45.76 ? 72   ARG A NH2 1 
ATOM   591  N N   . PRO A 1 73 ? 15.091  55.317 20.301  1.00   39.23 ? 73   PRO A N   1 
ATOM   592  C CA  . PRO A 1 73 ? 14.891  54.191 21.221  1.00   40.22 ? 73   PRO A CA  1 
ATOM   593  C C   . PRO A 1 73 ? 14.387  54.629 22.595  1.00   40.75 ? 73   PRO A C   1 
ATOM   594  O O   . PRO A 1 73 ? 14.530  55.792 22.976  1.00   41.09 ? 73   PRO A O   1 
ATOM   595  C CB  . PRO A 1 73 ? 16.284  53.561 21.314  1.00   40.42 ? 73   PRO A CB  1 
ATOM   596  C CG  . PRO A 1 73 ? 16.974  54.016 20.055  1.00   41.21 ? 73   PRO A CG  1 
ATOM   597  C CD  . PRO A 1 73 ? 16.512  55.438 19.938  1.00   39.54 ? 73   PRO A CD  1 
ATOM   598  N N   . GLY A 1 74 ? 13.805  53.689 23.334  1.00   40.66 ? 74   GLY A N   1 
ATOM   599  C CA  . GLY A 1 74 ? 13.309  53.986 24.667  1.00   41.42 ? 74   GLY A CA  1 
ATOM   600  C C   . GLY A 1 74 ? 11.863  54.440 24.727  1.00   42.17 ? 74   GLY A C   1 
ATOM   601  O O   . GLY A 1 74 ? 11.230  54.589 23.660  1.00   42.52 ? 74   GLY A O   1 
ATOM   602  O OXT . GLY A 1 74 ? 11.360  54.651 25.850  1.00   43.08 ? 74   GLY A OXT 1 
ATOM   603  N N   . ILE B 2 1  ? -0.472  30.200 12.922  1.00   16.15 ? 1    ILE B N   1 
ATOM   604  C CA  . ILE B 2 1  ? 0.734   29.403 12.549  1.00   15.98 ? 1    ILE B CA  1 
ATOM   605  C C   . ILE B 2 1  ? 0.696   29.130 11.046  1.00   15.96 ? 1    ILE B C   1 
ATOM   606  O O   . ILE B 2 1  ? -0.375  29.091 10.438  1.00   15.97 ? 1    ILE B O   1 
ATOM   607  C CB  . ILE B 2 1  ? 0.768   28.054 13.325  1.00   14.63 ? 1    ILE B CB  1 
ATOM   608  C CG1 . ILE B 2 1  ? 2.071   27.298 13.034  1.00   15.07 ? 1    ILE B CG1 1 
ATOM   609  C CG2 . ILE B 2 1  ? -0.444  27.209 12.956  1.00   16.00 ? 1    ILE B CG2 1 
ATOM   610  C CD1 . ILE B 2 1  ? 2.242   26.025 13.875  1.00   13.06 ? 1    ILE B CD1 1 
ATOM   611  N N   . VAL B 2 2  ? 1.872   28.968 10.453  1.00   15.51 ? 2    VAL B N   1 
ATOM   612  C CA  . VAL B 2 2  ? 1.985   28.693 9.027   1.00   16.39 ? 2    VAL B CA  1 
ATOM   613  C C   . VAL B 2 2  ? 2.433   27.243 8.874   1.00   15.14 ? 2    VAL B C   1 
ATOM   614  O O   . VAL B 2 2  ? 3.433   26.833 9.463   1.00   14.94 ? 2    VAL B O   1 
ATOM   615  C CB  . VAL B 2 2  ? 3.020   29.642 8.361   1.00   16.32 ? 2    VAL B CB  1 
ATOM   616  C CG1 . VAL B 2 2  ? 3.230   29.263 6.896   1.00   14.14 ? 2    VAL B CG1 1 
ATOM   617  C CG2 . VAL B 2 2  ? 2.535   31.088 8.468   1.00   16.99 ? 2    VAL B CG2 1 
ATOM   618  N N   . CYS B 2 3  ? 1.680   26.467 8.101   1.00   14.85 ? 3    CYS B N   1 
ATOM   619  C CA  . CYS B 2 3  ? 2.004   25.060 7.880   1.00   15.33 ? 3    CYS B CA  1 
ATOM   620  C C   . CYS B 2 3  ? 2.040   24.713 6.401   1.00   15.87 ? 3    CYS B C   1 
ATOM   621  O O   . CYS B 2 3  ? 1.359   25.341 5.589   1.00   14.50 ? 3    CYS B O   1 
ATOM   622  C CB  . CYS B 2 3  ? 0.954   24.150 8.526   1.00   12.80 ? 3    CYS B CB  1 
ATOM   623  S SG  . CYS B 2 3  ? 0.715   24.320 10.321  1.00   15.24 ? 3    CYS B SG  1 
ATOM   624  N N   . HIS B 2 4  ? 2.839   23.708 6.059   1.00   16.22 ? 4    HIS B N   1 
ATOM   625  C CA  . HIS B 2 4  ? 2.912   23.237 4.685   1.00   16.99 ? 4    HIS B CA  1 
ATOM   626  C C   . HIS B 2 4  ? 1.608   22.474 4.476   1.00   16.71 ? 4    HIS B C   1 
ATOM   627  O O   . HIS B 2 4  ? 1.067   21.897 5.420   1.00   15.31 ? 4    HIS B O   1 
ATOM   628  C CB  . HIS B 2 4  ? 4.081   22.267 4.503   1.00   17.46 ? 4    HIS B CB  1 
ATOM   629  C CG  . HIS B 2 4  ? 5.430   22.911 4.581   1.00   18.82 ? 4    HIS B CG  1 
ATOM   630  N ND1 . HIS B 2 4  ? 5.966   23.645 3.544   1.00   17.80 ? 4    HIS B ND1 1 
ATOM   631  C CD2 . HIS B 2 4  ? 6.357   22.920 5.569   1.00   19.14 ? 4    HIS B CD2 1 
ATOM   632  C CE1 . HIS B 2 4  ? 7.168   24.075 3.889   1.00   20.43 ? 4    HIS B CE1 1 
ATOM   633  N NE2 . HIS B 2 4  ? 7.429   23.649 5.112   1.00   19.28 ? 4    HIS B NE2 1 
ATOM   634  N N   . THR B 2 5  ? 1.095   22.478 3.251   1.00   16.35 ? 5    THR B N   1 
ATOM   635  C CA  . THR B 2 5  ? -0.131  21.748 2.959   1.00   16.22 ? 5    THR B CA  1 
ATOM   636  C C   . THR B 2 5  ? -0.054  21.095 1.593   1.00   15.39 ? 5    THR B C   1 
ATOM   637  O O   . THR B 2 5  ? 0.491   21.668 0.649   1.00   14.67 ? 5    THR B O   1 
ATOM   638  C CB  . THR B 2 5  ? -1.385  22.653 2.991   1.00   16.72 ? 5    THR B CB  1 
ATOM   639  O OG1 . THR B 2 5  ? -2.534  21.873 2.626   1.00   17.37 ? 5    THR B OG1 1 
ATOM   640  C CG2 . THR B 2 5  ? -1.245  23.825 2.014   1.00   15.88 ? 5    THR B CG2 1 
ATOM   641  N N   . THR B 2 6  ? -0.587  19.883 1.502   1.00   13.70 ? 6    THR B N   1 
ATOM   642  C CA  . THR B 2 6  ? -0.603  19.154 0.244   1.00   15.18 ? 6    THR B CA  1 
ATOM   643  C C   . THR B 2 6  ? -1.921  19.423 -0.484  1.00   16.04 ? 6    THR B C   1 
ATOM   644  O O   . THR B 2 6  ? -2.208  18.819 -1.513  1.00   17.63 ? 6    THR B O   1 
ATOM   645  C CB  . THR B 2 6  ? -0.423  17.638 0.484   1.00   13.94 ? 6    THR B CB  1 
ATOM   646  O OG1 . THR B 2 6  ? -1.259  17.220 1.571   1.00   15.07 ? 6    THR B OG1 1 
ATOM   647  C CG2 . THR B 2 6  ? 1.030   17.326 0.829   1.00   13.07 ? 6    THR B CG2 1 
ATOM   648  N N   . ALA B 2 7  ? -2.720  20.342 0.057   1.00   17.24 ? 7    ALA B N   1 
ATOM   649  C CA  . ALA B 2 7  ? -3.997  20.697 -0.564  1.00   16.76 ? 7    ALA B CA  1 
ATOM   650  C C   . ALA B 2 7  ? -3.747  21.614 -1.759  1.00   17.93 ? 7    ALA B C   1 
ATOM   651  O O   . ALA B 2 7  ? -4.629  21.825 -2.596  1.00   16.73 ? 7    ALA B O   1 
ATOM   652  C CB  . ALA B 2 7  ? -4.899  21.394 0.445   1.00   16.66 ? 7    ALA B CB  1 
ATOM   653  N N   . THR B 2 8  ? -2.543  22.171 -1.826  1.00   17.87 ? 8    THR B N   1 
ATOM   654  C CA  . THR B 2 8  ? -2.185  23.059 -2.922  1.00   20.19 ? 8    THR B CA  1 
ATOM   655  C C   . THR B 2 8  ? -1.160  22.406 -3.833  1.00   21.76 ? 8    THR B C   1 
ATOM   656  O O   . THR B 2 8  ? -0.421  21.504 -3.424  1.00   19.44 ? 8    THR B O   1 
ATOM   657  C CB  . THR B 2 8  ? -1.576  24.393 -2.419  1.00   21.31 ? 8    THR B CB  1 
ATOM   658  O OG1 . THR B 2 8  ? -0.356  24.129 -1.710  1.00   19.71 ? 8    THR B OG1 1 
ATOM   659  C CG2 . THR B 2 8  ? -2.555  25.122 -1.505  1.00   19.91 ? 8    THR B CG2 1 
ATOM   660  N N   . SER B 2 9  ? -1.132  22.875 -5.075  1.00   21.81 ? 9    SER B N   1 
ATOM   661  C CA  . SER B 2 9  ? -0.193  22.397 -6.072  1.00   22.68 ? 9    SER B CA  1 
ATOM   662  C C   . SER B 2 9  ? 0.404   23.632 -6.732  1.00   23.20 ? 9    SER B C   1 
ATOM   663  O O   . SER B 2 9  ? -0.305  24.396 -7.381  1.00   24.60 ? 9    SER B O   1 
ATOM   664  C CB  . SER B 2 9  ? -0.905  21.544 -7.125  1.00   24.18 ? 9    SER B CB  1 
ATOM   665  O OG  . SER B 2 9  ? -0.014  21.207 -8.173  1.00   24.71 ? 9    SER B OG  1 
ATOM   666  N N   . PRO B 2 10 ? 1.713   23.858 -6.553  1.00   22.95 ? 10   PRO B N   1 
ATOM   667  C CA  . PRO B 2 10 ? 2.621   23.015 -5.772  1.00   22.56 ? 10   PRO B CA  1 
ATOM   668  C C   . PRO B 2 10 ? 2.382   23.146 -4.274  1.00   22.45 ? 10   PRO B C   1 
ATOM   669  O O   . PRO B 2 10 ? 1.596   23.992 -3.831  1.00   19.81 ? 10   PRO B O   1 
ATOM   670  C CB  . PRO B 2 10 ? 3.995   23.533 -6.172  1.00   24.44 ? 10   PRO B CB  1 
ATOM   671  C CG  . PRO B 2 10 ? 3.743   24.982 -6.388  1.00   24.83 ? 10   PRO B CG  1 
ATOM   672  C CD  . PRO B 2 10 ? 2.446   24.979 -7.167  1.00   25.03 ? 10   PRO B CD  1 
ATOM   673  N N   . ILE B 2 11 ? 3.061   22.301 -3.503  1.00   21.63 ? 11   ILE B N   1 
ATOM   674  C CA  . ILE B 2 11 ? 2.949   22.335 -2.054  1.00   21.01 ? 11   ILE B CA  1 
ATOM   675  C C   . ILE B 2 11 ? 3.366   23.732 -1.615  1.00   21.08 ? 11   ILE B C   1 
ATOM   676  O O   . ILE B 2 11 ? 4.307   24.306 -2.168  1.00   22.50 ? 11   ILE B O   1 
ATOM   677  C CB  . ILE B 2 11 ? 3.889   21.302 -1.393  1.00   22.63 ? 11   ILE B CB  1 
ATOM   678  C CG1 . ILE B 2 11 ? 3.487   19.885 -1.815  1.00   24.04 ? 11   ILE B CG1 1 
ATOM   679  C CG2 . ILE B 2 11 ? 3.823   21.434 0.123   1.00   24.59 ? 11   ILE B CG2 1 
ATOM   680  C CD1 . ILE B 2 11 ? 4.427   18.796 -1.308  1.00   23.51 ? 11   ILE B CD1 1 
ATOM   681  N N   . SER B 2 12 ? 2.659   24.286 -0.638  1.00   19.05 ? 12   SER B N   1 
ATOM   682  C CA  . SER B 2 12 ? 2.984   25.620 -0.156  1.00   20.81 ? 12   SER B CA  1 
ATOM   683  C C   . SER B 2 12 ? 2.746   25.737 1.342   1.00   20.56 ? 12   SER B C   1 
ATOM   684  O O   . SER B 2 12 ? 2.108   24.876 1.949   1.00   20.28 ? 12   SER B O   1 
ATOM   685  C CB  . SER B 2 12 ? 2.144   26.667 -0.892  1.00   21.46 ? 12   SER B CB  1 
ATOM   686  O OG  . SER B 2 12 ? 0.775   26.549 -0.546  1.00   23.11 ? 12   SER B OG  1 
ATOM   687  N N   . ALA B 2 13 ? 3.269   26.813 1.924   1.00   19.17 ? 13   ALA B N   1 
ATOM   688  C CA  . ALA B 2 13 ? 3.133   27.088 3.347   1.00   18.10 ? 13   ALA B CA  1 
ATOM   689  C C   . ALA B 2 13 ? 2.020   28.116 3.485   1.00   17.99 ? 13   ALA B C   1 
ATOM   690  O O   . ALA B 2 13 ? 2.126   29.231 2.969   1.00   18.71 ? 13   ALA B O   1 
ATOM   691  C CB  . ALA B 2 13 ? 4.443   27.644 3.895   1.00   16.12 ? 13   ALA B CB  1 
ATOM   692  N N   . VAL B 2 14 ? 0.955   27.747 4.183   1.00   16.85 ? 14   VAL B N   1 
ATOM   693  C CA  . VAL B 2 14 ? -0.184  28.640 4.333   1.00   16.59 ? 14   VAL B CA  1 
ATOM   694  C C   . VAL B 2 14 ? -0.561  28.909 5.785   1.00   16.21 ? 14   VAL B C   1 
ATOM   695  O O   . VAL B 2 14 ? -0.231  28.135 6.681   1.00   15.26 ? 14   VAL B O   1 
ATOM   696  C CB  . VAL B 2 14 ? -1.421  28.052 3.620   1.00   18.39 ? 14   VAL B CB  1 
ATOM   697  C CG1 . VAL B 2 14 ? -1.083  27.744 2.163   1.00   18.98 ? 14   VAL B CG1 1 
ATOM   698  C CG2 . VAL B 2 14 ? -1.875  26.781 4.334   1.00   16.24 ? 14   VAL B CG2 1 
ATOM   699  N N   . THR B 2 15 ? -1.259  30.016 6.012   1.00   16.15 ? 15   THR B N   1 
ATOM   700  C CA  . THR B 2 15 ? -1.694  30.352 7.356   1.00   15.92 ? 15   THR B CA  1 
ATOM   701  C C   . THR B 2 15 ? -2.891  29.477 7.692   1.00   15.82 ? 15   THR B C   1 
ATOM   702  O O   . THR B 2 15 ? -3.851  29.408 6.927   1.00   17.37 ? 15   THR B O   1 
ATOM   703  C CB  . THR B 2 15 ? -2.099  31.829 7.465   1.00   17.48 ? 15   THR B CB  1 
ATOM   704  O OG1 . THR B 2 15 ? -0.954  32.651 7.205   1.00   18.39 ? 15   THR B OG1 1 
ATOM   705  C CG2 . THR B 2 15 ? -2.633  32.127 8.857   1.00   17.61 ? 15   THR B CG2 1 
ATOM   706  N N   . CYS B 2 16 ? -2.823  28.800 8.834   1.00   13.68 ? 16   CYS B N   1 
ATOM   707  C CA  . CYS B 2 16 ? -3.893  27.915 9.266   1.00   14.37 ? 16   CYS B CA  1 
ATOM   708  C C   . CYS B 2 16 ? -5.166  28.657 9.629   1.00   15.07 ? 16   CYS B C   1 
ATOM   709  O O   . CYS B 2 16 ? -5.126  29.824 10.019  1.00   14.90 ? 16   CYS B O   1 
ATOM   710  C CB  . CYS B 2 16 ? -3.439  27.104 10.474  1.00   14.59 ? 16   CYS B CB  1 
ATOM   711  S SG  . CYS B 2 16 ? -2.088  25.944 10.103  1.00   15.79 ? 16   CYS B SG  1 
ATOM   712  N N   . PRO B 2 17 ? -6.317  27.981 9.511   1.00   15.47 ? 17   PRO B N   1 
ATOM   713  C CA  . PRO B 2 17 ? -7.582  28.633 9.852   1.00   16.04 ? 17   PRO B CA  1 
ATOM   714  C C   . PRO B 2 17 ? -7.707  28.755 11.370  1.00   17.14 ? 17   PRO B C   1 
ATOM   715  O O   . PRO B 2 17 ? -6.937  28.152 12.114  1.00   17.89 ? 17   PRO B O   1 
ATOM   716  C CB  . PRO B 2 17 ? -8.623  27.697 9.244   1.00   16.80 ? 17   PRO B CB  1 
ATOM   717  C CG  . PRO B 2 17 ? -7.986  26.353 9.395   1.00   17.79 ? 17   PRO B CG  1 
ATOM   718  C CD  . PRO B 2 17 ? -6.547  26.621 8.983   1.00   15.57 ? 17   PRO B CD  1 
ATOM   719  N N   . PRO B 2 18 ? -8.670  29.555 11.844  1.00   18.74 ? 18   PRO B N   1 
ATOM   720  C CA  . PRO B 2 18 ? -8.894  29.755 13.281  1.00   19.56 ? 18   PRO B CA  1 
ATOM   721  C C   . PRO B 2 18 ? -9.156  28.442 14.022  1.00   19.06 ? 18   PRO B C   1 
ATOM   722  O O   . PRO B 2 18 ? -9.880  27.575 13.531  1.00   19.84 ? 18   PRO B O   1 
ATOM   723  C CB  . PRO B 2 18 ? -10.111 30.675 13.311  1.00   19.97 ? 18   PRO B CB  1 
ATOM   724  C CG  . PRO B 2 18 ? -9.944  31.488 12.054  1.00   20.86 ? 18   PRO B CG  1 
ATOM   725  C CD  . PRO B 2 18 ? -9.551  30.426 11.047  1.00   18.68 ? 18   PRO B CD  1 
ATOM   726  N N   . GLY B 2 19 ? -8.559  28.294 15.198  1.00   19.45 ? 19   GLY B N   1 
ATOM   727  C CA  . GLY B 2 19 ? -8.770  27.084 15.973  1.00   19.57 ? 19   GLY B CA  1 
ATOM   728  C C   . GLY B 2 19 ? -7.836  25.940 15.620  1.00   18.35 ? 19   GLY B C   1 
ATOM   729  O O   . GLY B 2 19 ? -7.743  24.964 16.359  1.00   19.16 ? 19   GLY B O   1 
ATOM   730  N N   . GLU B 2 20 ? -7.153  26.045 14.486  1.00   17.20 ? 20   GLU B N   1 
ATOM   731  C CA  . GLU B 2 20 ? -6.214  25.008 14.074  1.00   16.79 ? 20   GLU B CA  1 
ATOM   732  C C   . GLU B 2 20 ? -4.836  25.629 14.203  1.00   16.75 ? 20   GLU B C   1 
ATOM   733  O O   . GLU B 2 20 ? -4.399  26.387 13.338  1.00   16.77 ? 20   GLU B O   1 
ATOM   734  C CB  . GLU B 2 20 ? -6.502  24.565 12.633  1.00   17.43 ? 20   GLU B CB  1 
ATOM   735  C CG  . GLU B 2 20 ? -7.777  23.733 12.517  1.00   19.52 ? 20   GLU B CG  1 
ATOM   736  C CD  . GLU B 2 20 ? -8.079  23.275 11.098  1.00   23.06 ? 20   GLU B CD  1 
ATOM   737  O OE1 . GLU B 2 20 ? -7.137  23.134 10.293  1.00   21.98 ? 20   GLU B OE1 1 
ATOM   738  O OE2 . GLU B 2 20 ? -9.268  23.042 10.790  1.00   24.93 ? 20   GLU B OE2 1 
ATOM   739  N N   . ASN B 2 21 ? -4.151  25.297 15.292  1.00   15.78 ? 21   ASN B N   1 
ATOM   740  C CA  . ASN B 2 21 ? -2.853  25.885 15.570  1.00   16.30 ? 21   ASN B CA  1 
ATOM   741  C C   . ASN B 2 21 ? -1.634  24.978 15.591  1.00   16.20 ? 21   ASN B C   1 
ATOM   742  O O   . ASN B 2 21 ? -0.598  25.342 16.144  1.00   16.88 ? 21   ASN B O   1 
ATOM   743  C CB  . ASN B 2 21 ? -2.946  26.668 16.877  1.00   17.96 ? 21   ASN B CB  1 
ATOM   744  C CG  . ASN B 2 21 ? -4.006  27.743 16.817  1.00   20.18 ? 21   ASN B CG  1 
ATOM   745  O OD1 . ASN B 2 21 ? -3.934  28.645 15.984  1.00   21.72 ? 21   ASN B OD1 1 
ATOM   746  N ND2 . ASN B 2 21 ? -5.006  27.648 17.688  1.00   20.70 ? 21   ASN B ND2 1 
ATOM   747  N N   . LEU B 2 22 ? -1.749  23.792 15.010  1.00   15.55 ? 22   LEU B N   1 
ATOM   748  C CA  . LEU B 2 22 ? -0.589  22.919 14.927  1.00   15.27 ? 22   LEU B CA  1 
ATOM   749  C C   . LEU B 2 22 ? -0.512  22.362 13.515  1.00   13.91 ? 22   LEU B C   1 
ATOM   750  O O   . LEU B 2 22 ? -1.502  22.381 12.780  1.00   13.57 ? 22   LEU B O   1 
ATOM   751  C CB  . LEU B 2 22 ? -0.653  21.804 15.976  1.00   15.99 ? 22   LEU B CB  1 
ATOM   752  C CG  . LEU B 2 22 ? -1.822  20.831 16.061  1.00   18.76 ? 22   LEU B CG  1 
ATOM   753  C CD1 . LEU B 2 22 ? -1.819  19.889 14.861  1.00   18.45 ? 22   LEU B CD1 1 
ATOM   754  C CD2 . LEU B 2 22 ? -1.676  20.035 17.359  1.00   18.12 ? 22   LEU B CD2 1 
ATOM   755  N N   . CYS B 2 23 ? 0.675   21.909 13.127  1.00   11.91 ? 23   CYS B N   1 
ATOM   756  C CA  . CYS B 2 23 ? 0.892   21.349 11.799  1.00   13.33 ? 23   CYS B CA  1 
ATOM   757  C C   . CYS B 2 23 ? 1.010   19.847 11.941  1.00   16.36 ? 23   CYS B C   1 
ATOM   758  O O   . CYS B 2 23 ? 1.279   19.344 13.030  1.00   15.99 ? 23   CYS B O   1 
ATOM   759  C CB  . CYS B 2 23 ? 2.206   21.846 11.189  1.00   11.36 ? 23   CYS B CB  1 
ATOM   760  S SG  . CYS B 2 23 ? 2.457   23.646 11.096  1.00   14.29 ? 23   CYS B SG  1 
ATOM   761  N N   . TYR B 2 24 ? 0.823   19.131 10.838  1.00   16.43 ? 24   TYR B N   1 
ATOM   762  C CA  . TYR B 2 24 ? 0.963   17.686 10.877  1.00   16.77 ? 24   TYR B CA  1 
ATOM   763  C C   . TYR B 2 24 ? 1.436   17.150 9.536   1.00   17.65 ? 24   TYR B C   1 
ATOM   764  O O   . TYR B 2 24 ? 1.271   17.790 8.491   1.00   14.26 ? 24   TYR B O   1 
ATOM   765  C CB  . TYR B 2 24 ? -0.366  17.022 11.266  1.00   17.29 ? 24   TYR B CB  1 
ATOM   766  C CG  . TYR B 2 24 ? -1.376  16.905 10.140  1.00   20.78 ? 24   TYR B CG  1 
ATOM   767  C CD1 . TYR B 2 24 ? -1.334  15.834 9.243   1.00   22.84 ? 24   TYR B CD1 1 
ATOM   768  C CD2 . TYR B 2 24 ? -2.367  17.869 9.966   1.00   20.55 ? 24   TYR B CD2 1 
ATOM   769  C CE1 . TYR B 2 24 ? -2.256  15.728 8.201   1.00   23.62 ? 24   TYR B CE1 1 
ATOM   770  C CE2 . TYR B 2 24 ? -3.294  17.775 8.928   1.00   21.62 ? 24   TYR B CE2 1 
ATOM   771  C CZ  . TYR B 2 24 ? -3.233  16.703 8.050   1.00   23.23 ? 24   TYR B CZ  1 
ATOM   772  O OH  . TYR B 2 24 ? -4.154  16.605 7.032   1.00   24.81 ? 24   TYR B OH  1 
ATOM   773  N N   . ARG B 2 25 ? 2.056   15.979 9.591   1.00   16.14 ? 25   ARG B N   1 
ATOM   774  C CA  . ARG B 2 25 ? 2.522   15.277 8.407   1.00   17.14 ? 25   ARG B CA  1 
ATOM   775  C C   . ARG B 2 25 ? 2.088   13.846 8.649   1.00   18.27 ? 25   ARG B C   1 
ATOM   776  O O   . ARG B 2 25 ? 2.387   13.273 9.699   1.00   19.14 ? 25   ARG B O   1 
ATOM   777  C CB  . ARG B 2 25 ? 4.047   15.325 8.263   1.00   17.76 ? 25   ARG B CB  1 
ATOM   778  C CG  . ARG B 2 25 ? 4.554   14.453 7.104   1.00   20.15 ? 25   ARG B CG  1 
ATOM   779  C CD  . ARG B 2 25 ? 6.048   14.604 6.854   1.00   24.53 ? 25   ARG B CD  1 
ATOM   780  N NE  . ARG B 2 25 ? 6.826   14.326 8.054   1.00   27.40 ? 25   ARG B NE  1 
ATOM   781  C CZ  . ARG B 2 25 ? 7.604   15.216 8.662   1.00   29.84 ? 25   ARG B CZ  1 
ATOM   782  N NH1 . ARG B 2 25 ? 7.716   16.449 8.178   1.00   29.50 ? 25   ARG B NH1 1 
ATOM   783  N NH2 . ARG B 2 25 ? 8.259   14.878 9.765   1.00   30.47 ? 25   ARG B NH2 1 
ATOM   784  N N   . LYS B 2 26 ? 1.359   13.284 7.693   1.00   20.21 ? 26   LYS B N   1 
ATOM   785  C CA  . LYS B 2 26 ? 0.885   11.912 7.800   1.00   22.55 ? 26   LYS B CA  1 
ATOM   786  C C   . LYS B 2 26 ? 1.391   11.149 6.587   1.00   21.96 ? 26   LYS B C   1 
ATOM   787  O O   . LYS B 2 26 ? 1.247   11.612 5.458   1.00   20.11 ? 26   LYS B O   1 
ATOM   788  C CB  . LYS B 2 26 ? -0.643  11.883 7.828   1.00   25.94 ? 26   LYS B CB  1 
ATOM   789  C CG  . LYS B 2 26 ? -1.241  10.492 7.962   1.00   29.67 ? 26   LYS B CG  1 
ATOM   790  C CD  . LYS B 2 26 ? -2.762  10.559 7.994   1.00   33.55 ? 26   LYS B CD  1 
ATOM   791  C CE  . LYS B 2 26 ? -3.252  11.402 9.162   1.00   36.15 ? 26   LYS B CE  1 
ATOM   792  N NZ  . LYS B 2 26 ? -4.729  11.597 9.130   1.00   41.01 ? 26   LYS B NZ  1 
ATOM   793  N N   . MET B 2 27 ? 1.993   9.988  6.820   1.00   20.97 ? 27   MET B N   1 
ATOM   794  C CA  . MET B 2 27 ? 2.512   9.185  5.716   1.00   22.19 ? 27   MET B CA  1 
ATOM   795  C C   . MET B 2 27 ? 2.096   7.730  5.837   1.00   23.47 ? 27   MET B C   1 
ATOM   796  O O   . MET B 2 27 ? 2.071   7.163  6.934   1.00   21.15 ? 27   MET B O   1 
ATOM   797  C CB  . MET B 2 27 ? 4.038   9.274  5.658   1.00   21.96 ? 27   MET B CB  1 
ATOM   798  C CG  . MET B 2 27 ? 4.572   10.695 5.486   1.00   26.58 ? 27   MET B CG  1 
ATOM   799  S SD  . MET B 2 27 ? 6.349   10.754 5.185   1.00   28.33 ? 27   MET B SD  1 
ATOM   800  C CE  . MET B 2 27 ? 6.965   10.054 6.699   1.00   31.19 ? 27   MET B CE  1 
ATOM   801  N N   . TRP B 2 28 ? 1.765   7.128  4.702   1.00   25.07 ? 28   TRP B N   1 
ATOM   802  C CA  . TRP B 2 28 ? 1.363   5.732  4.686   1.00   26.04 ? 28   TRP B CA  1 
ATOM   803  C C   . TRP B 2 28 ? 1.599   5.159  3.301   1.00   26.86 ? 28   TRP B C   1 
ATOM   804  O O   . TRP B 2 28 ? 1.787   5.894  2.332   1.00   25.19 ? 28   TRP B O   1 
ATOM   805  C CB  . TRP B 2 28 ? -0.111  5.598  5.082   1.00   27.56 ? 28   TRP B CB  1 
ATOM   806  C CG  . TRP B 2 28 ? -1.081  6.036  4.031   1.00   29.76 ? 28   TRP B CG  1 
ATOM   807  C CD1 . TRP B 2 28 ? -1.631  5.262  3.049   1.00   31.10 ? 28   TRP B CD1 1 
ATOM   808  C CD2 . TRP B 2 28 ? -1.620  7.351  3.855   1.00   30.49 ? 28   TRP B CD2 1 
ATOM   809  N NE1 . TRP B 2 28 ? -2.483  6.012  2.276   1.00   31.91 ? 28   TRP B NE1 1 
ATOM   810  C CE2 . TRP B 2 28 ? -2.495  7.299  2.748   1.00   31.59 ? 28   TRP B CE2 1 
ATOM   811  C CE3 . TRP B 2 28 ? -1.450  8.569  4.527   1.00   32.04 ? 28   TRP B CE3 1 
ATOM   812  C CZ2 . TRP B 2 28 ? -3.200  8.418  2.296   1.00   31.37 ? 28   TRP B CZ2 1 
ATOM   813  C CZ3 . TRP B 2 28 ? -2.152  9.685  4.076   1.00   32.94 ? 28   TRP B CZ3 1 
ATOM   814  C CH2 . TRP B 2 28 ? -3.016  9.598  2.971   1.00   32.73 ? 28   TRP B CH2 1 
ATOM   815  N N   . CYS B 2 29 ? 1.596   3.838  3.216   1.00   27.13 ? 29   CYS B N   1 
ATOM   816  C CA  . CYS B 2 29 ? 1.816   3.155  1.954   1.00   28.76 ? 29   CYS B CA  1 
ATOM   817  C C   . CYS B 2 29 ? 0.520   2.865  1.210   1.00   28.68 ? 29   CYS B C   1 
ATOM   818  O O   . CYS B 2 29 ? -0.439  2.363  1.798   1.00   28.56 ? 29   CYS B O   1 
ATOM   819  C CB  . CYS B 2 29 ? 2.533   1.829  2.203   1.00   28.46 ? 29   CYS B CB  1 
ATOM   820  S SG  . CYS B 2 29 ? 4.351   1.822  2.095   1.00   32.62 ? 29   CYS B SG  1 
ATOM   821  N N   . ASP B 2 30 ? 0.486   3.194  -0.079  1.00   28.98 ? 30   ASP B N   1 
ATOM   822  C CA  . ASP B 2 30 ? -0.678  2.886  -0.898  1.00   28.82 ? 30   ASP B CA  1 
ATOM   823  C C   . ASP B 2 30 ? -0.181  1.893  -1.953  1.00   29.24 ? 30   ASP B C   1 
ATOM   824  O O   . ASP B 2 30 ? 0.973   1.458  -1.897  1.00   27.45 ? 30   ASP B O   1 
ATOM   825  C CB  . ASP B 2 30 ? -1.282  4.154  -1.529  1.00   28.28 ? 30   ASP B CB  1 
ATOM   826  C CG  . ASP B 2 30 ? -0.500  4.674  -2.725  1.00   27.02 ? 30   ASP B CG  1 
ATOM   827  O OD1 . ASP B 2 30 ? 0.645   4.243  -2.966  1.00   29.74 ? 30   ASP B OD1 1 
ATOM   828  O OD2 . ASP B 2 30 ? -1.049  5.548  -3.428  1.00   28.29 ? 30   ASP B OD2 1 
ATOM   829  N N   . ALA B 2 31 ? -1.036  1.528  -2.901  1.00   29.97 ? 31   ALA B N   1 
ATOM   830  C CA  . ALA B 2 31 ? -0.659  0.561  -3.932  1.00   30.67 ? 31   ALA B CA  1 
ATOM   831  C C   . ALA B 2 31 ? 0.676   0.821  -4.633  1.00   31.32 ? 31   ALA B C   1 
ATOM   832  O O   . ALA B 2 31 ? 1.303   -0.115 -5.128  1.00   32.18 ? 31   ALA B O   1 
ATOM   833  C CB  . ALA B 2 31 ? -1.772  0.458  -4.969  1.00   31.61 ? 31   ALA B CB  1 
ATOM   834  N N   . PHE B 2 32 ? 1.122   2.075  -4.674  1.00   30.68 ? 32   PHE B N   1 
ATOM   835  C CA  . PHE B 2 32 ? 2.375   2.401  -5.357  1.00   30.57 ? 32   PHE B CA  1 
ATOM   836  C C   . PHE B 2 32 ? 3.590   2.681  -4.473  1.00   30.59 ? 32   PHE B C   1 
ATOM   837  O O   . PHE B 2 32 ? 4.522   3.351  -4.920  1.00   29.15 ? 32   PHE B O   1 
ATOM   838  C CB  . PHE B 2 32 ? 2.176   3.610  -6.279  1.00   33.19 ? 32   PHE B CB  1 
ATOM   839  C CG  . PHE B 2 32 ? 1.105   3.421  -7.314  1.00   35.84 ? 32   PHE B CG  1 
ATOM   840  C CD1 . PHE B 2 32 ? -0.237  3.568  -6.981  1.00   37.34 ? 32   PHE B CD1 1 
ATOM   841  C CD2 . PHE B 2 32 ? 1.438   3.085  -8.623  1.00   37.61 ? 32   PHE B CD2 1 
ATOM   842  C CE1 . PHE B 2 32 ? -1.233  3.383  -7.936  1.00   38.84 ? 32   PHE B CE1 1 
ATOM   843  C CE2 . PHE B 2 32 ? 0.451   2.897  -9.586  1.00   38.81 ? 32   PHE B CE2 1 
ATOM   844  C CZ  . PHE B 2 32 ? -0.887  3.046  -9.241  1.00   39.93 ? 32   PHE B CZ  1 
ATOM   845  N N   . CYS B 2 33 ? 3.603   2.167  -3.244  1.00   30.14 ? 33   CYS B N   1 
ATOM   846  C CA  . CYS B 2 33 ? 4.725   2.418  -2.334  1.00   30.78 ? 33   CYS B CA  1 
ATOM   847  C C   . CYS B 2 33 ? 6.098   1.988  -2.829  1.00   32.03 ? 33   CYS B C   1 
ATOM   848  O O   . CYS B 2 33 ? 7.083   2.691  -2.621  1.00   30.85 ? 33   CYS B O   1 
ATOM   849  C CB  . CYS B 2 33 ? 4.490   1.754  -0.972  1.00   31.51 ? 33   CYS B CB  1 
ATOM   850  S SG  . CYS B 2 33 ? 4.754   2.903  0.418   1.00   31.59 ? 33   CYS B SG  1 
ATOM   851  N N   A SER B 2 34 ? 6.164   0.831  -3.478  0.50   32.90 ? 34   SER B N   1 
ATOM   852  N N   B SER B 2 34 ? 6.163   0.830  -3.480  0.50   32.86 ? 34   SER B N   1 
ATOM   853  C CA  A SER B 2 34 ? 7.434   0.318  -3.974  0.50   33.50 ? 34   SER B CA  1 
ATOM   854  C CA  B SER B 2 34 ? 7.433   0.308  -3.979  0.50   33.43 ? 34   SER B CA  1 
ATOM   855  C C   A SER B 2 34 ? 8.114   1.245  -4.977  0.50   33.50 ? 34   SER B C   1 
ATOM   856  C C   B SER B 2 34 ? 8.115   1.227  -4.990  0.50   33.47 ? 34   SER B C   1 
ATOM   857  O O   A SER B 2 34 ? 9.336   1.390  -4.964  0.50   34.26 ? 34   SER B O   1 
ATOM   858  O O   B SER B 2 34 ? 9.339   1.349  -4.995  0.50   34.24 ? 34   SER B O   1 
ATOM   859  C CB  A SER B 2 34 ? 7.235   -1.060 -4.608  0.50   33.82 ? 34   SER B CB  1 
ATOM   860  C CB  B SER B 2 34 ? 7.228   -1.080 -4.599  0.50   33.69 ? 34   SER B CB  1 
ATOM   861  O OG  A SER B 2 34 ? 8.473   -1.590 -5.046  0.50   34.25 ? 34   SER B OG  1 
ATOM   862  O OG  B SER B 2 34 ? 6.356   -1.027 -5.714  0.50   33.92 ? 34   SER B OG  1 
ATOM   863  N N   . SER B 2 35 ? 7.330   1.875  -5.844  1.00   33.22 ? 35   SER B N   1 
ATOM   864  C CA  . SER B 2 35 ? 7.895   2.771  -6.849  1.00   33.15 ? 35   SER B CA  1 
ATOM   865  C C   . SER B 2 35 ? 7.889   4.254  -6.482  1.00   32.23 ? 35   SER B C   1 
ATOM   866  O O   . SER B 2 35 ? 8.827   4.975  -6.816  1.00   32.87 ? 35   SER B O   1 
ATOM   867  C CB  . SER B 2 35 ? 7.180   2.581  -8.193  1.00   33.36 ? 35   SER B CB  1 
ATOM   868  O OG  . SER B 2 35 ? 5.803   2.904  -8.103  1.00   33.80 ? 35   SER B OG  1 
ATOM   869  N N   . ARG B 2 36 ? 6.848   4.710  -5.791  1.00   31.87 ? 36   ARG B N   1 
ATOM   870  C CA  . ARG B 2 36 ? 6.746   6.126  -5.430  1.00   30.23 ? 36   ARG B CA  1 
ATOM   871  C C   . ARG B 2 36 ? 7.085   6.454  -3.980  1.00   29.92 ? 36   ARG B C   1 
ATOM   872  O O   . ARG B 2 36 ? 7.308   7.620  -3.637  1.00   29.73 ? 36   ARG B O   1 
ATOM   873  C CB  . ARG B 2 36 ? 5.331   6.634  -5.718  1.00   29.81 ? 36   ARG B CB  1 
ATOM   874  C CG  . ARG B 2 36 ? 4.860   6.425  -7.142  1.00   32.38 ? 36   ARG B CG  1 
ATOM   875  C CD  . ARG B 2 36 ? 3.397   6.811  -7.291  1.00   32.85 ? 36   ARG B CD  1 
ATOM   876  N NE  . ARG B 2 36 ? 2.884   6.486  -8.618  1.00   35.49 ? 36   ARG B NE  1 
ATOM   877  C CZ  . ARG B 2 36 ? 1.602   6.557  -8.964  1.00   36.44 ? 36   ARG B CZ  1 
ATOM   878  N NH1 . ARG B 2 36 ? 0.691   6.945  -8.081  1.00   36.10 ? 36   ARG B NH1 1 
ATOM   879  N NH2 . ARG B 2 36 ? 1.227   6.235  -10.195 1.00   37.96 ? 36   ARG B NH2 1 
ATOM   880  N N   . GLY B 2 37 ? 7.124   5.438  -3.127  1.00   26.91 ? 37   GLY B N   1 
ATOM   881  C CA  . GLY B 2 37 ? 7.401   5.690  -1.727  1.00   25.16 ? 37   GLY B CA  1 
ATOM   882  C C   . GLY B 2 37 ? 6.062   5.929  -1.054  1.00   24.03 ? 37   GLY B C   1 
ATOM   883  O O   . GLY B 2 37 ? 5.020   5.734  -1.674  1.00   22.07 ? 37   GLY B O   1 
ATOM   884  N N   . LYS B 2 38 ? 6.078   6.363  0.201   1.00   23.51 ? 38   LYS B N   1 
ATOM   885  C CA  . LYS B 2 38 ? 4.841   6.596  0.936   1.00   23.79 ? 38   LYS B CA  1 
ATOM   886  C C   . LYS B 2 38 ? 4.081   7.840  0.502   1.00   22.73 ? 38   LYS B C   1 
ATOM   887  O O   . LYS B 2 38 ? 4.669   8.808  0.011   1.00   22.00 ? 38   LYS B O   1 
ATOM   888  C CB  . LYS B 2 38 ? 5.132   6.714  2.433   1.00   25.36 ? 38   LYS B CB  1 
ATOM   889  C CG  . LYS B 2 38 ? 5.794   5.493  3.044   1.00   28.25 ? 38   LYS B CG  1 
ATOM   890  C CD  . LYS B 2 38 ? 6.033   5.701  4.528   1.00   31.46 ? 38   LYS B CD  1 
ATOM   891  C CE  . LYS B 2 38 ? 6.791   4.530  5.125   1.00   33.49 ? 38   LYS B CE  1 
ATOM   892  N NZ  . LYS B 2 38 ? 7.089   4.743  6.566   1.00   37.74 ? 38   LYS B NZ  1 
ATOM   893  N N   . VAL B 2 39 ? 2.767   7.803  0.690   1.00   21.04 ? 39   VAL B N   1 
ATOM   894  C CA  . VAL B 2 39 ? 1.926   8.944  0.374   1.00   20.84 ? 39   VAL B CA  1 
ATOM   895  C C   . VAL B 2 39 ? 2.291   9.975  1.437   1.00   20.17 ? 39   VAL B C   1 
ATOM   896  O O   . VAL B 2 39 ? 2.607   9.610  2.572   1.00   19.05 ? 39   VAL B O   1 
ATOM   897  C CB  . VAL B 2 39 ? 0.430   8.602  0.518   1.00   21.53 ? 39   VAL B CB  1 
ATOM   898  C CG1 . VAL B 2 39 ? -0.416  9.849  0.287   1.00   21.52 ? 39   VAL B CG1 1 
ATOM   899  C CG2 . VAL B 2 39 ? 0.046   7.507  -0.468  1.00   23.20 ? 39   VAL B CG2 1 
ATOM   900  N N   . VAL B 2 40 ? 2.269   11.249 1.069   1.00   18.69 ? 40   VAL B N   1 
ATOM   901  C CA  . VAL B 2 40 ? 2.591   12.318 2.006   1.00   20.30 ? 40   VAL B CA  1 
ATOM   902  C C   . VAL B 2 40 ? 1.440   13.319 2.059   1.00   19.82 ? 40   VAL B C   1 
ATOM   903  O O   . VAL B 2 40 ? 1.074   13.903 1.040   1.00   19.48 ? 40   VAL B O   1 
ATOM   904  C CB  . VAL B 2 40 ? 3.879   13.071 1.590   1.00   22.58 ? 40   VAL B CB  1 
ATOM   905  C CG1 . VAL B 2 40 ? 4.172   14.195 2.583   1.00   22.30 ? 40   VAL B CG1 1 
ATOM   906  C CG2 . VAL B 2 40 ? 5.054   12.102 1.517   1.00   23.50 ? 40   VAL B CG2 1 
ATOM   907  N N   . GLU B 2 41 ? 0.871   13.491 3.250   1.00   18.45 ? 41   GLU B N   1 
ATOM   908  C CA  . GLU B 2 41 ? -0.225  14.426 3.477   1.00   17.91 ? 41   GLU B CA  1 
ATOM   909  C C   . GLU B 2 41 ? 0.233   15.451 4.514   1.00   17.20 ? 41   GLU B C   1 
ATOM   910  O O   . GLU B 2 41 ? 0.676   15.083 5.603   1.00   16.72 ? 41   GLU B O   1 
ATOM   911  C CB  . GLU B 2 41 ? -1.461  13.687 3.997   1.00   18.46 ? 41   GLU B CB  1 
ATOM   912  C CG  . GLU B 2 41 ? -2.677  14.584 4.189   1.00   24.45 ? 41   GLU B CG  1 
ATOM   913  C CD  . GLU B 2 41 ? -3.885  13.827 4.716   1.00   27.68 ? 41   GLU B CD  1 
ATOM   914  O OE1 . GLU B 2 41 ? -4.282  12.827 4.080   1.00   27.50 ? 41   GLU B OE1 1 
ATOM   915  O OE2 . GLU B 2 41 ? -4.438  14.235 5.763   1.00   29.32 ? 41   GLU B OE2 1 
ATOM   916  N N   . LEU B 2 42 ? 0.124   16.731 4.167   1.00   16.62 ? 42   LEU B N   1 
ATOM   917  C CA  . LEU B 2 42 ? 0.537   17.820 5.051   1.00   15.93 ? 42   LEU B CA  1 
ATOM   918  C C   . LEU B 2 42 ? -0.606  18.807 5.260   1.00   16.24 ? 42   LEU B C   1 
ATOM   919  O O   . LEU B 2 42 ? -1.380  19.074 4.340   1.00   16.31 ? 42   LEU B O   1 
ATOM   920  C CB  . LEU B 2 42 ? 1.716   18.575 4.435   1.00   15.25 ? 42   LEU B CB  1 
ATOM   921  C CG  . LEU B 2 42 ? 2.912   17.744 3.974   1.00   16.29 ? 42   LEU B CG  1 
ATOM   922  C CD1 . LEU B 2 42 ? 3.891   18.637 3.221   1.00   14.96 ? 42   LEU B CD1 1 
ATOM   923  C CD2 . LEU B 2 42 ? 3.576   17.087 5.175   1.00   15.59 ? 42   LEU B CD2 1 
ATOM   924  N N   . GLY B 2 43 ? -0.713  19.357 6.463   1.00   14.97 ? 43   GLY B N   1 
ATOM   925  C CA  . GLY B 2 43 ? -1.775  20.313 6.703   1.00   16.33 ? 43   GLY B CA  1 
ATOM   926  C C   . GLY B 2 43 ? -1.808  20.898 8.096   1.00   16.39 ? 43   GLY B C   1 
ATOM   927  O O   . GLY B 2 43 ? -0.854  20.777 8.865   1.00   16.59 ? 43   GLY B O   1 
ATOM   928  N N   . CYS B 2 44 ? -2.931  21.540 8.398   1.00   17.16 ? 44   CYS B N   1 
ATOM   929  C CA  . CYS B 2 44 ? -3.182  22.167 9.687   1.00   17.86 ? 44   CYS B CA  1 
ATOM   930  C C   . CYS B 2 44 ? -4.194  21.306 10.437  1.00   18.33 ? 44   CYS B C   1 
ATOM   931  O O   . CYS B 2 44 ? -4.928  20.523 9.826   1.00   18.62 ? 44   CYS B O   1 
ATOM   932  C CB  . CYS B 2 44 ? -3.811  23.547 9.494   1.00   16.40 ? 44   CYS B CB  1 
ATOM   933  S SG  . CYS B 2 44 ? -2.851  24.807 8.603   1.00   17.35 ? 44   CYS B SG  1 
ATOM   934  N N   . ALA B 2 45 ? -4.252  21.477 11.754  1.00   17.61 ? 45   ALA B N   1 
ATOM   935  C CA  . ALA B 2 45 ? -5.197  20.739 12.582  1.00   17.29 ? 45   ALA B CA  1 
ATOM   936  C C   . ALA B 2 45 ? -5.308  21.360 13.975  1.00   18.01 ? 45   ALA B C   1 
ATOM   937  O O   . ALA B 2 45 ? -4.401  22.060 14.427  1.00   16.02 ? 45   ALA B O   1 
ATOM   938  C CB  . ALA B 2 45 ? -4.767  19.282 12.697  1.00   17.93 ? 45   ALA B CB  1 
ATOM   939  N N   . ALA B 2 46 ? -6.431  21.112 14.645  1.00   17.66 ? 46   ALA B N   1 
ATOM   940  C CA  . ALA B 2 46 ? -6.640  21.620 15.997  1.00   18.06 ? 46   ALA B CA  1 
ATOM   941  C C   . ALA B 2 46 ? -6.025  20.612 16.965  1.00   19.10 ? 46   ALA B C   1 
ATOM   942  O O   . ALA B 2 46 ? -5.341  20.978 17.919  1.00   17.93 ? 46   ALA B O   1 
ATOM   943  C CB  . ALA B 2 46 ? -8.126  21.773 16.279  1.00   19.68 ? 46   ALA B CB  1 
ATOM   944  N N   . THR B 2 47 ? -6.281  19.335 16.710  1.00   19.82 ? 47   THR B N   1 
ATOM   945  C CA  . THR B 2 47 ? -5.742  18.273 17.545  1.00   21.92 ? 47   THR B CA  1 
ATOM   946  C C   . THR B 2 47 ? -4.930  17.345 16.658  1.00   23.31 ? 47   THR B C   1 
ATOM   947  O O   . THR B 2 47 ? -5.216  17.201 15.465  1.00   22.28 ? 47   THR B O   1 
ATOM   948  C CB  . THR B 2 47 ? -6.866  17.469 18.223  1.00   24.09 ? 47   THR B CB  1 
ATOM   949  O OG1 . THR B 2 47 ? -7.694  16.875 17.220  1.00   27.56 ? 47   THR B OG1 1 
ATOM   950  C CG2 . THR B 2 47 ? -7.719  18.378 19.096  1.00   23.42 ? 47   THR B CG2 1 
ATOM   951  N N   . CYS B 2 48 ? -3.908  16.722 17.229  1.00   23.83 ? 48   CYS B N   1 
ATOM   952  C CA  . CYS B 2 48 ? -3.078  15.820 16.449  1.00   26.51 ? 48   CYS B CA  1 
ATOM   953  C C   . CYS B 2 48 ? -3.912  14.639 15.966  1.00   27.82 ? 48   CYS B C   1 
ATOM   954  O O   . CYS B 2 48 ? -4.594  13.989 16.754  1.00   27.36 ? 48   CYS B O   1 
ATOM   955  C CB  . CYS B 2 48 ? -1.902  15.314 17.281  1.00   25.99 ? 48   CYS B CB  1 
ATOM   956  S SG  . CYS B 2 48 ? -0.663  14.461 16.261  1.00   28.25 ? 48   CYS B SG  1 
ATOM   957  N N   . PRO B 2 49 ? -3.878  14.362 14.653  1.00   30.52 ? 49   PRO B N   1 
ATOM   958  C CA  . PRO B 2 49 ? -4.620  13.263 14.027  1.00   34.47 ? 49   PRO B CA  1 
ATOM   959  C C   . PRO B 2 49 ? -4.298  11.904 14.639  1.00   36.82 ? 49   PRO B C   1 
ATOM   960  O O   . PRO B 2 49 ? -3.148  11.622 14.974  1.00   36.91 ? 49   PRO B O   1 
ATOM   961  C CB  . PRO B 2 49 ? -4.182  13.345 12.567  1.00   33.29 ? 49   PRO B CB  1 
ATOM   962  C CG  . PRO B 2 49 ? -3.947  14.807 12.376  1.00   34.57 ? 49   PRO B CG  1 
ATOM   963  C CD  . PRO B 2 49 ? -3.193  15.173 13.631  1.00   32.64 ? 49   PRO B CD  1 
ATOM   964  N N   . SER B 2 50 ? -5.321  11.066 14.786  1.00   40.79 ? 50   SER B N   1 
ATOM   965  C CA  . SER B 2 50 ? -5.141  9.728  15.344  1.00   43.66 ? 50   SER B CA  1 
ATOM   966  C C   . SER B 2 50 ? -4.289  8.906  14.383  1.00   44.45 ? 50   SER B C   1 
ATOM   967  O O   . SER B 2 50 ? -4.530  8.906  13.176  1.00   45.17 ? 50   SER B O   1 
ATOM   968  C CB  . SER B 2 50 ? -6.497  9.046  15.540  1.00   45.49 ? 50   SER B CB  1 
ATOM   969  O OG  . SER B 2 50 ? -7.184  8.909  14.306  1.00   47.78 ? 50   SER B OG  1 
ATOM   970  N N   . LYS B 2 51 ? -3.291  8.212  14.919  1.00   45.86 ? 51   LYS B N   1 
ATOM   971  C CA  . LYS B 2 51 ? -2.401  7.397  14.100  1.00   46.70 ? 51   LYS B CA  1 
ATOM   972  C C   . LYS B 2 51 ? -2.726  5.911  14.169  1.00   47.66 ? 51   LYS B C   1 
ATOM   973  O O   . LYS B 2 51 ? -2.677  5.306  15.240  1.00   47.48 ? 51   LYS B O   1 
ATOM   974  C CB  . LYS B 2 51 ? -0.945  7.602  14.531  1.00   47.40 ? 51   LYS B CB  1 
ATOM   975  C CG  . LYS B 2 51 ? 0.009   6.550  13.975  1.00   48.53 ? 51   LYS B CG  1 
ATOM   976  C CD  . LYS B 2 51 ? 1.394   6.644  14.597  1.00   48.86 ? 51   LYS B CD  1 
ATOM   977  C CE  . LYS B 2 51 ? 2.245   5.441  14.210  1.00   49.46 ? 51   LYS B CE  1 
ATOM   978  N NZ  . LYS B 2 51 ? 3.635   5.520  14.740  1.00   49.46 ? 51   LYS B NZ  1 
ATOM   979  N N   . LYS B 2 52 ? -3.052  5.327  13.020  1.00   47.87 ? 52   LYS B N   1 
ATOM   980  C CA  . LYS B 2 52 ? -3.351  3.904  12.954  1.00   47.93 ? 52   LYS B CA  1 
ATOM   981  C C   . LYS B 2 52 ? -2.023  3.149  12.933  1.00   46.48 ? 52   LYS B C   1 
ATOM   982  O O   . LYS B 2 52 ? -0.973  3.737  12.675  1.00   46.21 ? 52   LYS B O   1 
ATOM   983  C CB  . LYS B 2 52 ? -4.162  3.586  11.696  1.00   50.23 ? 52   LYS B CB  1 
ATOM   984  C CG  . LYS B 2 52 ? -5.549  4.209  11.682  1.00   52.72 ? 52   LYS B CG  1 
ATOM   985  C CD  . LYS B 2 52 ? -6.346  3.752  10.472  1.00   54.52 ? 52   LYS B CD  1 
ATOM   986  C CE  . LYS B 2 52 ? -7.754  4.325  10.486  1.00   56.42 ? 52   LYS B CE  1 
ATOM   987  N NZ  . LYS B 2 52 ? -8.562  3.838  9.331   1.00   57.66 ? 52   LYS B NZ  1 
ATOM   988  N N   . PRO B 2 53 ? -2.053  1.836  13.210  1.00   45.22 ? 53   PRO B N   1 
ATOM   989  C CA  . PRO B 2 53 ? -0.848  1.002  13.226  1.00   44.51 ? 53   PRO B CA  1 
ATOM   990  C C   . PRO B 2 53 ? 0.041   1.112  11.987  1.00   43.39 ? 53   PRO B C   1 
ATOM   991  O O   . PRO B 2 53 ? 1.267   1.113  12.095  1.00   42.61 ? 53   PRO B O   1 
ATOM   992  C CB  . PRO B 2 53 ? -1.412  -0.404 13.406  1.00   45.07 ? 53   PRO B CB  1 
ATOM   993  C CG  . PRO B 2 53 ? -2.618  -0.159 14.256  1.00   45.37 ? 53   PRO B CG  1 
ATOM   994  C CD  . PRO B 2 53 ? -3.238  1.043  13.585  1.00   44.97 ? 53   PRO B CD  1 
ATOM   995  N N   . TYR B 2 54 ? -0.573  1.207  10.813  1.00   42.87 ? 54   TYR B N   1 
ATOM   996  C CA  . TYR B 2 54 ? 0.191   1.294  9.573   1.00   42.82 ? 54   TYR B CA  1 
ATOM   997  C C   . TYR B 2 54 ? 0.560   2.717  9.167   1.00   42.29 ? 54   TYR B C   1 
ATOM   998  O O   . TYR B 2 54 ? 1.405   2.918  8.293   1.00   41.61 ? 54   TYR B O   1 
ATOM   999  C CB  . TYR B 2 54 ? -0.579  0.630  8.427   1.00   43.65 ? 54   TYR B CB  1 
ATOM   1000 C CG  . TYR B 2 54 ? -1.959  1.203  8.197   1.00   44.95 ? 54   TYR B CG  1 
ATOM   1001 C CD1 . TYR B 2 54 ? -3.041  0.805  8.980   1.00   45.86 ? 54   TYR B CD1 1 
ATOM   1002 C CD2 . TYR B 2 54 ? -2.182  2.151  7.198   1.00   46.52 ? 54   TYR B CD2 1 
ATOM   1003 C CE1 . TYR B 2 54 ? -4.313  1.335  8.774   1.00   46.44 ? 54   TYR B CE1 1 
ATOM   1004 C CE2 . TYR B 2 54 ? -3.450  2.689  6.985   1.00   47.21 ? 54   TYR B CE2 1 
ATOM   1005 C CZ  . TYR B 2 54 ? -4.509  2.275  7.776   1.00   47.02 ? 54   TYR B CZ  1 
ATOM   1006 O OH  . TYR B 2 54 ? -5.764  2.798  7.563   1.00   48.10 ? 54   TYR B OH  1 
ATOM   1007 N N   . GLU B 2 55 ? -0.066  3.706  9.798   1.00   40.30 ? 55   GLU B N   1 
ATOM   1008 C CA  . GLU B 2 55 ? 0.222   5.095  9.461   1.00   39.33 ? 55   GLU B CA  1 
ATOM   1009 C C   . GLU B 2 55 ? 1.332   5.702  10.304  1.00   37.39 ? 55   GLU B C   1 
ATOM   1010 O O   . GLU B 2 55 ? 1.678   5.193  11.368  1.00   38.19 ? 55   GLU B O   1 
ATOM   1011 C CB  . GLU B 2 55 ? -1.033  5.958  9.613   1.00   40.27 ? 55   GLU B CB  1 
ATOM   1012 C CG  . GLU B 2 55 ? -2.229  5.470  8.828   1.00   44.17 ? 55   GLU B CG  1 
ATOM   1013 C CD  . GLU B 2 55 ? -3.416  6.400  8.954   1.00   45.61 ? 55   GLU B CD  1 
ATOM   1014 O OE1 . GLU B 2 55 ? -3.767  6.763  10.096  1.00   47.37 ? 55   GLU B OE1 1 
ATOM   1015 O OE2 . GLU B 2 55 ? -3.999  6.765  7.914   1.00   47.87 ? 55   GLU B OE2 1 
ATOM   1016 N N   A GLU B 2 56 ? 1.888   6.800  9.808   0.50   36.11 ? 56   GLU B N   1 
ATOM   1017 N N   B GLU B 2 56 ? 1.892   6.798  9.809   0.50   35.88 ? 56   GLU B N   1 
ATOM   1018 C CA  A GLU B 2 56 ? 2.953   7.514  10.497  0.50   35.15 ? 56   GLU B CA  1 
ATOM   1019 C CA  B GLU B 2 56 ? 2.949   7.516  10.507  0.50   34.75 ? 56   GLU B CA  1 
ATOM   1020 C C   A GLU B 2 56 ? 2.522   8.973  10.607  0.50   33.72 ? 56   GLU B C   1 
ATOM   1021 C C   B GLU B 2 56 ? 2.520   8.972  10.609  0.50   33.46 ? 56   GLU B C   1 
ATOM   1022 O O   A GLU B 2 56 ? 2.232   9.615  9.598   0.50   32.16 ? 56   GLU B O   1 
ATOM   1023 O O   B GLU B 2 56 ? 2.230   9.612  9.598   0.50   31.90 ? 56   GLU B O   1 
ATOM   1024 C CB  A GLU B 2 56 ? 4.255   7.409  9.702   0.50   36.67 ? 56   GLU B CB  1 
ATOM   1025 C CB  B GLU B 2 56 ? 4.270   7.412  9.744   0.50   35.80 ? 56   GLU B CB  1 
ATOM   1026 C CG  A GLU B 2 56 ? 5.432   8.128  10.333  0.50   39.59 ? 56   GLU B CG  1 
ATOM   1027 C CG  B GLU B 2 56 ? 4.923   6.044  9.824   0.50   38.10 ? 56   GLU B CG  1 
ATOM   1028 C CD  A GLU B 2 56 ? 6.686   8.047  9.485   0.50   41.80 ? 56   GLU B CD  1 
ATOM   1029 C CD  B GLU B 2 56 ? 6.217   5.971  9.042   0.50   39.58 ? 56   GLU B CD  1 
ATOM   1030 O OE1 A GLU B 2 56 ? 7.711   8.646  9.875   0.50   44.17 ? 56   GLU B OE1 1 
ATOM   1031 O OE1 B GLU B 2 56 ? 6.922   4.946  9.154   0.50   41.49 ? 56   GLU B OE1 1 
ATOM   1032 O OE2 A GLU B 2 56 ? 6.648   7.383  8.427   0.50   43.90 ? 56   GLU B OE2 1 
ATOM   1033 O OE2 B GLU B 2 56 ? 6.530   6.934  8.311   0.50   41.84 ? 56   GLU B OE2 1 
ATOM   1034 N N   . VAL B 2 57 ? 2.470   9.489  11.832  1.00   32.56 ? 57   VAL B N   1 
ATOM   1035 C CA  . VAL B 2 57 ? 2.057   10.868 12.053  1.00   30.97 ? 57   VAL B CA  1 
ATOM   1036 C C   . VAL B 2 57 ? 2.976   11.674 12.958  1.00   29.77 ? 57   VAL B C   1 
ATOM   1037 O O   . VAL B 2 57 ? 3.457   11.189 13.982  1.00   28.19 ? 57   VAL B O   1 
ATOM   1038 C CB  . VAL B 2 57 ? 0.634   10.926 12.645  1.00   30.98 ? 57   VAL B CB  1 
ATOM   1039 C CG1 . VAL B 2 57 ? 0.237   12.372 12.911  1.00   32.01 ? 57   VAL B CG1 1 
ATOM   1040 C CG2 . VAL B 2 57 ? -0.352  10.271 11.687  1.00   31.79 ? 57   VAL B CG2 1 
ATOM   1041 N N   . THR B 2 58 ? 3.206   12.919 12.561  1.00   26.33 ? 58   THR B N   1 
ATOM   1042 C CA  . THR B 2 58 ? 4.036   13.836 13.320  1.00   25.85 ? 58   THR B CA  1 
ATOM   1043 C C   . THR B 2 58 ? 3.286   15.155 13.420  1.00   24.78 ? 58   THR B C   1 
ATOM   1044 O O   . THR B 2 58 ? 2.834   15.696 12.412  1.00   22.60 ? 58   THR B O   1 
ATOM   1045 C CB  . THR B 2 58 ? 5.386   14.095 12.617  1.00   27.39 ? 58   THR B CB  1 
ATOM   1046 O OG1 . THR B 2 58 ? 6.153   12.887 12.595  1.00   31.30 ? 58   THR B OG1 1 
ATOM   1047 C CG2 . THR B 2 58 ? 6.170   15.173 13.349  1.00   29.18 ? 58   THR B CG2 1 
ATOM   1048 N N   . CYS B 2 59 ? 3.131   15.653 14.640  1.00   23.61 ? 59   CYS B N   1 
ATOM   1049 C CA  . CYS B 2 59 ? 2.462   16.923 14.859  1.00   23.23 ? 59   CYS B CA  1 
ATOM   1050 C C   . CYS B 2 59 ? 3.450   17.840 15.541  1.00   22.21 ? 59   CYS B C   1 
ATOM   1051 O O   . CYS B 2 59 ? 4.092   17.461 16.522  1.00   20.48 ? 59   CYS B O   1 
ATOM   1052 C CB  . CYS B 2 59 ? 1.226   16.757 15.736  1.00   25.23 ? 59   CYS B CB  1 
ATOM   1053 S SG  . CYS B 2 59 ? -0.133  15.883 14.912  1.00   26.66 ? 59   CYS B SG  1 
ATOM   1054 N N   . CYS B 2 60 ? 3.575   19.045 15.005  1.00   20.43 ? 60   CYS B N   1 
ATOM   1055 C CA  . CYS B 2 60 ? 4.501   20.026 15.541  1.00   20.47 ? 60   CYS B CA  1 
ATOM   1056 C C   . CYS B 2 60 ? 3.804   21.383 15.607  1.00   20.22 ? 60   CYS B C   1 
ATOM   1057 O O   . CYS B 2 60 ? 2.734   21.563 15.018  1.00   19.10 ? 60   CYS B O   1 
ATOM   1058 C CB  . CYS B 2 60 ? 5.746   20.070 14.661  1.00   21.15 ? 60   CYS B CB  1 
ATOM   1059 S SG  . CYS B 2 60 ? 5.390   20.271 12.886  1.00   24.31 ? 60   CYS B SG  1 
ATOM   1060 N N   . SER B 2 61 ? 4.403   22.337 16.315  1.00   18.74 ? 61   SER B N   1 
ATOM   1061 C CA  . SER B 2 61 ? 3.759   23.632 16.488  1.00   18.97 ? 61   SER B CA  1 
ATOM   1062 C C   . SER B 2 61 ? 4.541   24.905 16.174  1.00   18.98 ? 61   SER B C   1 
ATOM   1063 O O   . SER B 2 61 ? 4.293   25.953 16.781  1.00   19.17 ? 61   SER B O   1 
ATOM   1064 C CB  . SER B 2 61 ? 3.202   23.718 17.914  1.00   19.03 ? 61   SER B CB  1 
ATOM   1065 O OG  . SER B 2 61 ? 4.212   23.452 18.871  1.00   19.78 ? 61   SER B OG  1 
ATOM   1066 N N   . THR B 2 62 ? 5.485   24.827 15.244  1.00   17.41 ? 62   THR B N   1 
ATOM   1067 C CA  . THR B 2 62 ? 6.227   26.013 14.841  1.00   18.70 ? 62   THR B CA  1 
ATOM   1068 C C   . THR B 2 62 ? 6.050   26.159 13.332  1.00   17.78 ? 62   THR B C   1 
ATOM   1069 O O   . THR B 2 62 ? 5.838   25.169 12.637  1.00   18.88 ? 62   THR B O   1 
ATOM   1070 C CB  . THR B 2 62 ? 7.729   25.917 15.222  1.00   19.91 ? 62   THR B CB  1 
ATOM   1071 O OG1 . THR B 2 62 ? 8.268   24.669 14.774  1.00   21.30 ? 62   THR B OG1 1 
ATOM   1072 C CG2 . THR B 2 62 ? 7.892   26.032 16.739  1.00   20.90 ? 62   THR B CG2 1 
ATOM   1073 N N   . ASP B 2 63 ? 6.118   27.385 12.825  1.00   17.79 ? 63   ASP B N   1 
ATOM   1074 C CA  . ASP B 2 63 ? 5.926   27.620 11.397  1.00   19.01 ? 63   ASP B CA  1 
ATOM   1075 C C   . ASP B 2 63 ? 6.740   26.711 10.482  1.00   20.56 ? 63   ASP B C   1 
ATOM   1076 O O   . ASP B 2 63 ? 7.939   26.502 10.690  1.00   19.36 ? 63   ASP B O   1 
ATOM   1077 C CB  . ASP B 2 63 ? 6.228   29.080 11.037  1.00   21.37 ? 63   ASP B CB  1 
ATOM   1078 C CG  . ASP B 2 63 ? 5.258   30.061 11.678  1.00   21.93 ? 63   ASP B CG  1 
ATOM   1079 O OD1 . ASP B 2 63 ? 4.129   29.662 12.044  1.00   18.90 ? 63   ASP B OD1 1 
ATOM   1080 O OD2 . ASP B 2 63 ? 5.624   31.247 11.801  1.00   25.56 ? 63   ASP B OD2 1 
ATOM   1081 N N   . LYS B 2 64 ? 6.062   26.173 9.470   1.00   18.41 ? 64   LYS B N   1 
ATOM   1082 C CA  . LYS B 2 64 ? 6.667   25.300 8.470   1.00   18.07 ? 64   LYS B CA  1 
ATOM   1083 C C   . LYS B 2 64 ? 7.441   24.120 9.045   1.00   18.09 ? 64   LYS B C   1 
ATOM   1084 O O   . LYS B 2 64 ? 8.419   23.654 8.458   1.00   17.54 ? 64   LYS B O   1 
ATOM   1085 C CB  . LYS B 2 64 ? 7.562   26.133 7.548   1.00   20.58 ? 64   LYS B CB  1 
ATOM   1086 C CG  . LYS B 2 64 ? 6.782   27.210 6.793   1.00   23.28 ? 64   LYS B CG  1 
ATOM   1087 C CD  . LYS B 2 64 ? 7.632   27.961 5.786   1.00   27.32 ? 64   LYS B CD  1 
ATOM   1088 C CE  . LYS B 2 64 ? 8.570   28.936 6.459   1.00   30.32 ? 64   LYS B CE  1 
ATOM   1089 N NZ  . LYS B 2 64 ? 9.361   29.696 5.449   1.00   35.40 ? 64   LYS B NZ  1 
ATOM   1090 N N   . CYS B 2 65 ? 6.980   23.615 10.180  1.00   15.93 ? 65   CYS B N   1 
ATOM   1091 C CA  . CYS B 2 65 ? 7.644   22.500 10.837  1.00   17.25 ? 65   CYS B CA  1 
ATOM   1092 C C   . CYS B 2 65 ? 7.279   21.129 10.272  1.00   17.36 ? 65   CYS B C   1 
ATOM   1093 O O   . CYS B 2 65 ? 7.843   20.120 10.692  1.00   18.27 ? 65   CYS B O   1 
ATOM   1094 C CB  . CYS B 2 65 ? 7.312   22.523 12.326  1.00   18.91 ? 65   CYS B CB  1 
ATOM   1095 S SG  . CYS B 2 65 ? 5.539   22.278 12.671  1.00   18.83 ? 65   CYS B SG  1 
ATOM   1096 N N   . ASN B 2 66 ? 6.354   21.095 9.316   1.00   16.84 ? 66   ASN B N   1 
ATOM   1097 C CA  . ASN B 2 66 ? 5.890   19.841 8.724   1.00   16.86 ? 66   ASN B CA  1 
ATOM   1098 C C   . ASN B 2 66 ? 6.174   19.756 7.224   1.00   17.72 ? 66   ASN B C   1 
ATOM   1099 O O   . ASN B 2 66 ? 5.262   19.542 6.421   1.00   16.96 ? 66   ASN B O   1 
ATOM   1100 C CB  . ASN B 2 66 ? 4.384   19.718 8.955   1.00   15.62 ? 66   ASN B CB  1 
ATOM   1101 C CG  . ASN B 2 66 ? 3.589   20.751 8.166   1.00   15.97 ? 66   ASN B CG  1 
ATOM   1102 O OD1 . ASN B 2 66 ? 4.031   21.890 7.984   1.00   15.43 ? 66   ASN B OD1 1 
ATOM   1103 N ND2 . ASN B 2 66 ? 2.408   20.363 7.708   1.00   12.24 ? 66   ASN B ND2 1 
ATOM   1104 N N   . PRO B 2 67 ? 7.447   19.886 6.825   1.00   19.16 ? 67   PRO B N   1 
ATOM   1105 C CA  . PRO B 2 67 ? 7.774   19.824 5.399   1.00   19.83 ? 67   PRO B CA  1 
ATOM   1106 C C   . PRO B 2 67 ? 7.691   18.448 4.761   1.00   20.25 ? 67   PRO B C   1 
ATOM   1107 O O   . PRO B 2 67 ? 7.728   17.416 5.437   1.00   19.96 ? 67   PRO B O   1 
ATOM   1108 C CB  . PRO B 2 67 ? 9.197   20.359 5.362   1.00   20.30 ? 67   PRO B CB  1 
ATOM   1109 C CG  . PRO B 2 67 ? 9.774   19.751 6.601   1.00   21.26 ? 67   PRO B CG  1 
ATOM   1110 C CD  . PRO B 2 67 ? 8.675   20.016 7.632   1.00   19.75 ? 67   PRO B CD  1 
ATOM   1111 N N   . HIS B 2 68 ? 7.570   18.453 3.441   1.00   21.07 ? 68   HIS B N   1 
ATOM   1112 C CA  . HIS B 2 68 ? 7.551   17.223 2.667   1.00   22.74 ? 68   HIS B CA  1 
ATOM   1113 C C   . HIS B 2 68 ? 8.989   16.709 2.811   1.00   24.24 ? 68   HIS B C   1 
ATOM   1114 O O   . HIS B 2 68 ? 9.920   17.505 2.954   1.00   21.93 ? 68   HIS B O   1 
ATOM   1115 C CB  . HIS B 2 68 ? 7.248   17.547 1.204   1.00   22.85 ? 68   HIS B CB  1 
ATOM   1116 C CG  . HIS B 2 68 ? 7.399   16.384 0.276   1.00   23.05 ? 68   HIS B CG  1 
ATOM   1117 N ND1 . HIS B 2 68 ? 8.627   15.883 -0.097  1.00   24.34 ? 68   HIS B ND1 1 
ATOM   1118 C CD2 . HIS B 2 68 ? 6.474   15.611 -0.340  1.00   22.09 ? 68   HIS B CD2 1 
ATOM   1119 C CE1 . HIS B 2 68 ? 8.453   14.847 -0.900  1.00   18.96 ? 68   HIS B CE1 1 
ATOM   1120 N NE2 . HIS B 2 68 ? 7.156   14.662 -1.063  1.00   24.31 ? 68   HIS B NE2 1 
ATOM   1121 N N   . PRO B 2 69 ? 9.187   15.383 2.794   1.00   25.53 ? 69   PRO B N   1 
ATOM   1122 C CA  . PRO B 2 69 ? 10.525  14.792 2.926   1.00   28.51 ? 69   PRO B CA  1 
ATOM   1123 C C   . PRO B 2 69 ? 11.608  15.404 2.032   1.00   30.86 ? 69   PRO B C   1 
ATOM   1124 O O   . PRO B 2 69 ? 12.780  15.421 2.404   1.00   31.25 ? 69   PRO B O   1 
ATOM   1125 C CB  . PRO B 2 69 ? 10.277  13.322 2.607   1.00   28.04 ? 69   PRO B CB  1 
ATOM   1126 C CG  . PRO B 2 69 ? 8.921   13.098 3.193   1.00   27.89 ? 69   PRO B CG  1 
ATOM   1127 C CD  . PRO B 2 69 ? 8.156   14.329 2.743   1.00   26.18 ? 69   PRO B CD  1 
ATOM   1128 N N   . LYS B 2 70 ? 11.220  15.899 0.861   1.00   33.18 ? 70   LYS B N   1 
ATOM   1129 C CA  . LYS B 2 70 ? 12.173  16.501 -0.069  1.00   38.75 ? 70   LYS B CA  1 
ATOM   1130 C C   . LYS B 2 70 ? 12.504  17.944 0.311   1.00   41.67 ? 70   LYS B C   1 
ATOM   1131 O O   . LYS B 2 70 ? 13.031  18.702 -0.504  1.00   42.76 ? 70   LYS B O   1 
ATOM   1132 C CB  . LYS B 2 70 ? 11.616  16.476 -1.496  1.00   39.63 ? 70   LYS B CB  1 
ATOM   1133 C CG  . LYS B 2 70 ? 11.266  15.092 -2.040  1.00   42.13 ? 70   LYS B CG  1 
ATOM   1134 C CD  . LYS B 2 70 ? 12.481  14.319 -2.538  1.00   44.92 ? 70   LYS B CD  1 
ATOM   1135 C CE  . LYS B 2 70 ? 13.378  13.848 -1.405  1.00   45.85 ? 70   LYS B CE  1 
ATOM   1136 N NZ  . LYS B 2 70 ? 14.512  13.023 -1.914  1.00   48.49 ? 70   LYS B NZ  1 
ATOM   1137 N N   A GLN B 2 71 ? 12.192  18.315 1.548   0.50   42.58 ? 71   GLN B N   1 
ATOM   1138 N N   B GLN B 2 71 ? 12.190  18.317 1.548   0.50   42.78 ? 71   GLN B N   1 
ATOM   1139 C CA  A GLN B 2 71 ? 12.455  19.665 2.035   0.50   43.59 ? 71   GLN B CA  1 
ATOM   1140 C CA  B GLN B 2 71 ? 12.454  19.668 2.033   0.50   43.93 ? 71   GLN B CA  1 
ATOM   1141 C C   A GLN B 2 71 ? 12.802  19.654 3.519   0.50   44.04 ? 71   GLN B C   1 
ATOM   1142 C C   B GLN B 2 71 ? 12.781  19.666 3.522   0.50   44.26 ? 71   GLN B C   1 
ATOM   1143 O O   A GLN B 2 71 ? 12.472  18.710 4.237   0.50   43.65 ? 71   GLN B O   1 
ATOM   1144 O O   B GLN B 2 71 ? 12.419  18.738 4.247   0.50   43.82 ? 71   GLN B O   1 
ATOM   1145 C CB  A GLN B 2 71 ? 11.231  20.556 1.816   0.50   43.90 ? 71   GLN B CB  1 
ATOM   1146 C CB  B GLN B 2 71 ? 11.243  20.567 1.774   0.50   44.69 ? 71   GLN B CB  1 
ATOM   1147 C CG  A GLN B 2 71 ? 10.822  20.730 0.366   0.50   44.30 ? 71   GLN B CG  1 
ATOM   1148 C CG  B GLN B 2 71 ? 10.975  20.841 0.304   0.50   45.65 ? 71   GLN B CG  1 
ATOM   1149 C CD  A GLN B 2 71 ? 9.600   21.613 0.216   0.50   44.61 ? 71   GLN B CD  1 
ATOM   1150 C CD  B GLN B 2 71 ? 12.072  21.666 -0.344  0.50   46.84 ? 71   GLN B CD  1 
ATOM   1151 O OE1 A GLN B 2 71 ? 9.589   22.757 0.668   0.50   45.10 ? 71   GLN B OE1 1 
ATOM   1152 O OE1 B GLN B 2 71 ? 13.249  21.304 -0.297  0.50   46.95 ? 71   GLN B OE1 1 
ATOM   1153 N NE2 A GLN B 2 71 ? 8.561   21.084 -0.420  0.50   45.19 ? 71   GLN B NE2 1 
ATOM   1154 N NE2 B GLN B 2 71 ? 11.691  22.782 -0.956  0.50   46.62 ? 71   GLN B NE2 1 
ATOM   1155 N N   . ARG B 2 72 ? 13.427  20.717 3.931   1.00   44.25 ? 72   ARG B N   1 
ATOM   1156 C CA  . ARG B 2 72 ? 13.809  20.854 5.330   1.00   45.62 ? 72   ARG B CA  1 
ATOM   1157 C C   . ARG B 2 72 ? 12.798  21.736 6.057   1.00   45.17 ? 72   ARG B C   1 
ATOM   1158 O O   . ARG B 2 72 ? 12.181  22.614 5.452   1.00   44.27 ? 72   ARG B O   1 
ATOM   1159 C CB  . ARG B 2 72 ? 15.207  21.466 5.434   1.00   47.66 ? 72   ARG B CB  1 
ATOM   1160 C CG  . ARG B 2 72 ? 16.297  20.596 4.832   1.00   50.67 ? 72   ARG B CG  1 
ATOM   1161 C CD  . ARG B 2 72 ? 17.641  21.294 4.862   1.00   51.92 ? 72   ARG B CD  1 
ATOM   1162 N NE  . ARG B 2 72 ? 18.704  20.449 4.322   1.00   54.59 ? 72   ARG B NE  1 
ATOM   1163 C CZ  . ARG B 2 72 ? 19.968  20.839 4.185   1.00   54.72 ? 72   ARG B CZ  1 
ATOM   1164 N NH1 . ARG B 2 72 ? 20.322  22.065 4.546   1.00   53.95 ? 72   ARG B NH1 1 
ATOM   1165 N NH2 . ARG B 2 72 ? 20.878  20.003 3.697   1.00   53.81 ? 72   ARG B NH2 1 
ATOM   1166 N N   . PRO B 2 73 ? 12.636  21.512 7.397   1.00   45.95 ? 73   PRO B N   1 
ATOM   1167 C CA  . PRO B 2 73 ? 11.677  22.310 8.167   1.00   46.16 ? 73   PRO B CA  1 
ATOM   1168 C C   . PRO B 2 73 ? 12.151  23.747 8.351   1.00   46.14 ? 73   PRO B C   1 
ATOM   1169 O O   . PRO B 2 73 ? 13.306  24.066 8.068   1.00   46.27 ? 73   PRO B O   1 
ATOM   1170 C CB  . PRO B 2 73 ? 11.590  21.552 9.489   1.00   46.54 ? 73   PRO B CB  1 
ATOM   1171 C CG  . PRO B 2 73 ? 12.986  21.029 9.650   1.00   46.47 ? 73   PRO B CG  1 
ATOM   1172 C CD  . PRO B 2 73 ? 13.305  20.519 8.258   1.00   46.59 ? 73   PRO B CD  1 
ATOM   1173 N N   . GLY B 2 74 ? 11.256  24.614 8.817   1.00   46.26 ? 74   GLY B N   1 
ATOM   1174 C CA  . GLY B 2 74 ? 11.630  25.999 9.029   1.00   46.23 ? 74   GLY B CA  1 
ATOM   1175 C C   . GLY B 2 74 ? 11.310  26.897 7.852   1.00   46.76 ? 74   GLY B C   1 
ATOM   1176 O O   . GLY B 2 74 ? 10.974  28.077 8.083   1.00   47.55 ? 74   GLY B O   1 
ATOM   1177 O OXT . GLY B 2 74 ? 11.415  26.431 6.696   1.00   47.18 ? 74   GLY B OXT 1 
ATOM   1178 N N   . TRP C 3 1  ? -0.163  45.310 5.714   1.00   24.62 ? 1    TRP C N   1 
ATOM   1179 C CA  . TRP C 3 1  ? 0.686   46.468 5.328   1.00   24.42 ? 1    TRP C CA  1 
ATOM   1180 C C   . TRP C 3 1  ? 2.167   46.150 5.503   1.00   24.03 ? 1    TRP C C   1 
ATOM   1181 O O   . TRP C 3 1  ? 2.540   45.144 6.106   1.00   23.78 ? 1    TRP C O   1 
ATOM   1182 C CB  . TRP C 3 1  ? 0.317   47.696 6.166   1.00   24.62 ? 1    TRP C CB  1 
ATOM   1183 C CG  . TRP C 3 1  ? 0.195   47.405 7.637   1.00   25.08 ? 1    TRP C CG  1 
ATOM   1184 C CD1 . TRP C 3 1  ? 1.194   47.023 8.489   1.00   24.12 ? 1    TRP C CD1 1 
ATOM   1185 C CD2 . TRP C 3 1  ? -1.007  47.441 8.417   1.00   23.57 ? 1    TRP C CD2 1 
ATOM   1186 N NE1 . TRP C 3 1  ? 0.684   46.816 9.754   1.00   23.39 ? 1    TRP C NE1 1 
ATOM   1187 C CE2 . TRP C 3 1  ? -0.664  47.065 9.735   1.00   23.18 ? 1    TRP C CE2 1 
ATOM   1188 C CE3 . TRP C 3 1  ? -2.343  47.755 8.129   1.00   24.48 ? 1    TRP C CE3 1 
ATOM   1189 C CZ2 . TRP C 3 1  ? -1.608  46.992 10.764  1.00   23.32 ? 1    TRP C CZ2 1 
ATOM   1190 C CZ3 . TRP C 3 1  ? -3.284  47.684 9.154   1.00   23.37 ? 1    TRP C CZ3 1 
ATOM   1191 C CH2 . TRP C 3 1  ? -2.909  47.304 10.455  1.00   23.93 ? 1    TRP C CH2 1 
ATOM   1192 N N   . ARG C 3 2  ? 3.006   47.025 4.972   1.00   23.90 ? 2    ARG C N   1 
ATOM   1193 C CA  . ARG C 3 2  ? 4.444   46.842 5.053   1.00   23.97 ? 2    ARG C CA  1 
ATOM   1194 C C   . ARG C 3 2  ? 5.104   48.180 5.329   1.00   20.93 ? 2    ARG C C   1 
ATOM   1195 O O   . ARG C 3 2  ? 4.715   49.201 4.758   1.00   20.92 ? 2    ARG C O   1 
ATOM   1196 C CB  . ARG C 3 2  ? 4.964   46.253 3.738   1.00   26.13 ? 2    ARG C CB  1 
ATOM   1197 C CG  . ARG C 3 2  ? 6.475   46.317 3.575   1.00   31.28 ? 2    ARG C CG  1 
ATOM   1198 C CD  . ARG C 3 2  ? 6.953   45.506 2.373   1.00   34.51 ? 2    ARG C CD  1 
ATOM   1199 N NE  . ARG C 3 2  ? 6.770   44.072 2.584   1.00   38.39 ? 2    ARG C NE  1 
ATOM   1200 C CZ  . ARG C 3 2  ? 7.323   43.124 1.833   1.00   40.34 ? 2    ARG C CZ  1 
ATOM   1201 N NH1 . ARG C 3 2  ? 8.104   43.449 0.808   1.00   37.44 ? 2    ARG C NH1 1 
ATOM   1202 N NH2 . ARG C 3 2  ? 7.102   41.847 2.116   1.00   40.20 ? 2    ARG C NH2 1 
ATOM   1203 N N   . TYR C 3 3  ? 6.091   48.179 6.217   1.00   18.22 ? 3    TYR C N   1 
ATOM   1204 C CA  . TYR C 3 3  ? 6.805   49.404 6.543   1.00   15.89 ? 3    TYR C CA  1 
ATOM   1205 C C   . TYR C 3 3  ? 8.164   49.450 5.850   1.00   15.13 ? 3    TYR C C   1 
ATOM   1206 O O   . TYR C 3 3  ? 8.786   48.415 5.600   1.00   14.51 ? 3    TYR C O   1 
ATOM   1207 C CB  . TYR C 3 3  ? 7.042   49.524 8.051   1.00   15.06 ? 3    TYR C CB  1 
ATOM   1208 C CG  . TYR C 3 3  ? 5.809   49.830 8.864   1.00   15.32 ? 3    TYR C CG  1 
ATOM   1209 C CD1 . TYR C 3 3  ? 5.018   48.804 9.395   1.00   14.48 ? 3    TYR C CD1 1 
ATOM   1210 C CD2 . TYR C 3 3  ? 5.440   51.149 9.116   1.00   15.27 ? 3    TYR C CD2 1 
ATOM   1211 C CE1 . TYR C 3 3  ? 3.881   49.095 10.167  1.00   11.88 ? 3    TYR C CE1 1 
ATOM   1212 C CE2 . TYR C 3 3  ? 4.318   51.450 9.875   1.00   17.23 ? 3    TYR C CE2 1 
ATOM   1213 C CZ  . TYR C 3 3  ? 3.545   50.426 10.400  1.00   15.65 ? 3    TYR C CZ  1 
ATOM   1214 O OH  . TYR C 3 3  ? 2.445   50.747 11.161  1.00   17.43 ? 3    TYR C OH  1 
ATOM   1215 N N   . TYR C 3 4  ? 8.600   50.661 5.532   1.00   14.84 ? 4    TYR C N   1 
ATOM   1216 C CA  . TYR C 3 4  ? 9.902   50.887 4.920   1.00   15.34 ? 4    TYR C CA  1 
ATOM   1217 C C   . TYR C 3 4  ? 10.602  51.909 5.807   1.00   16.12 ? 4    TYR C C   1 
ATOM   1218 O O   . TYR C 3 4  ? 9.946   52.695 6.495   1.00   15.35 ? 4    TYR C O   1 
ATOM   1219 C CB  . TYR C 3 4  ? 9.763   51.413 3.486   1.00   15.78 ? 4    TYR C CB  1 
ATOM   1220 C CG  . TYR C 3 4  ? 9.195   50.388 2.528   1.00   18.74 ? 4    TYR C CG  1 
ATOM   1221 C CD1 . TYR C 3 4  ? 7.818   50.198 2.412   1.00   19.65 ? 4    TYR C CD1 1 
ATOM   1222 C CD2 . TYR C 3 4  ? 10.041  49.572 1.769   1.00   18.53 ? 4    TYR C CD2 1 
ATOM   1223 C CE1 . TYR C 3 4  ? 7.293   49.217 1.563   1.00   21.10 ? 4    TYR C CE1 1 
ATOM   1224 C CE2 . TYR C 3 4  ? 9.529   48.591 0.921   1.00   19.16 ? 4    TYR C CE2 1 
ATOM   1225 C CZ  . TYR C 3 4  ? 8.154   48.417 0.823   1.00   21.36 ? 4    TYR C CZ  1 
ATOM   1226 O OH  . TYR C 3 4  ? 7.645   47.435 -0.005  1.00   22.05 ? 4    TYR C OH  1 
ATOM   1227 N N   . GLU C 3 5  ? 11.930  51.907 5.798   1.00   14.88 ? 5    GLU C N   1 
ATOM   1228 C CA  . GLU C 3 5  ? 12.670  52.827 6.648   1.00   16.97 ? 5    GLU C CA  1 
ATOM   1229 C C   . GLU C 3 5  ? 12.407  54.297 6.331   1.00   17.44 ? 5    GLU C C   1 
ATOM   1230 O O   . GLU C 3 5  ? 12.670  55.166 7.158   1.00   18.21 ? 5    GLU C O   1 
ATOM   1231 C CB  . GLU C 3 5  ? 14.175  52.531 6.565   1.00   17.16 ? 5    GLU C CB  1 
ATOM   1232 C CG  . GLU C 3 5  ? 14.814  52.795 5.212   1.00   16.46 ? 5    GLU C CG  1 
ATOM   1233 C CD  . GLU C 3 5  ? 16.284  52.408 5.187   1.00   17.35 ? 5    GLU C CD  1 
ATOM   1234 O OE1 . GLU C 3 5  ? 16.630  51.402 4.527   1.00   16.85 ? 5    GLU C OE1 1 
ATOM   1235 O OE2 . GLU C 3 5  ? 17.093  53.100 5.841   1.00   16.11 ? 5    GLU C OE2 1 
ATOM   1236 N N   . SER C 3 6  ? 11.864  54.571 5.150   1.00   18.49 ? 6    SER C N   1 
ATOM   1237 C CA  . SER C 3 6  ? 11.597  55.948 4.743   1.00   20.01 ? 6    SER C CA  1 
ATOM   1238 C C   . SER C 3 6  ? 10.378  56.612 5.388   1.00   21.42 ? 6    SER C C   1 
ATOM   1239 O O   . SER C 3 6  ? 10.234  57.834 5.325   1.00   22.14 ? 6    SER C O   1 
ATOM   1240 C CB  . SER C 3 6  ? 11.471  56.025 3.216   1.00   20.19 ? 6    SER C CB  1 
ATOM   1241 O OG  . SER C 3 6  ? 10.459  55.158 2.730   1.00   19.84 ? 6    SER C OG  1 
ATOM   1242 N N   . SER C 3 7  ? 9.501   55.834 6.016   1.00   21.42 ? 7    SER C N   1 
ATOM   1243 C CA  . SER C 3 7  ? 8.323   56.438 6.634   1.00   21.14 ? 7    SER C CA  1 
ATOM   1244 C C   . SER C 3 7  ? 7.725   55.654 7.791   1.00   20.21 ? 7    SER C C   1 
ATOM   1245 O O   . SER C 3 7  ? 7.764   54.427 7.812   1.00   15.92 ? 7    SER C O   1 
ATOM   1246 C CB  . SER C 3 7  ? 7.237   56.665 5.578   1.00   22.64 ? 7    SER C CB  1 
ATOM   1247 O OG  . SER C 3 7  ? 6.075   57.220 6.169   1.00   23.37 ? 7    SER C OG  1 
ATOM   1248 N N   . LEU C 3 8  ? 7.178   56.382 8.758   1.00   21.03 ? 8    LEU C N   1 
ATOM   1249 C CA  . LEU C 3 8  ? 6.530   55.766 9.908   1.00   22.52 ? 8    LEU C CA  1 
ATOM   1250 C C   . LEU C 3 8  ? 5.128   55.322 9.500   1.00   24.01 ? 8    LEU C C   1 
ATOM   1251 O O   . LEU C 3 8  ? 4.434   54.646 10.257  1.00   23.61 ? 8    LEU C O   1 
ATOM   1252 C CB  . LEU C 3 8  ? 6.449   56.757 11.072  1.00   23.01 ? 8    LEU C CB  1 
ATOM   1253 C CG  . LEU C 3 8  ? 7.765   56.972 11.823  1.00   23.37 ? 8    LEU C CG  1 
ATOM   1254 C CD1 . LEU C 3 8  ? 7.597   58.068 12.868  1.00   27.16 ? 8    LEU C CD1 1 
ATOM   1255 C CD2 . LEU C 3 8  ? 8.193   55.662 12.476  1.00   23.28 ? 8    LEU C CD2 1 
ATOM   1256 N N   . LEU C 3 9  ? 4.717   55.716 8.298   1.00   24.63 ? 9    LEU C N   1 
ATOM   1257 C CA  . LEU C 3 9  ? 3.411   55.344 7.774   1.00   27.62 ? 9    LEU C CA  1 
ATOM   1258 C C   . LEU C 3 9  ? 3.585   54.082 6.932   1.00   27.55 ? 9    LEU C C   1 
ATOM   1259 O O   . LEU C 3 9  ? 4.480   54.005 6.093   1.00   27.73 ? 9    LEU C O   1 
ATOM   1260 C CB  . LEU C 3 9  ? 2.839   56.473 6.910   1.00   29.82 ? 9    LEU C CB  1 
ATOM   1261 C CG  . LEU C 3 9  ? 2.621   57.819 7.609   1.00   33.10 ? 9    LEU C CG  1 
ATOM   1262 C CD1 . LEU C 3 9  ? 2.079   58.833 6.610   1.00   32.82 ? 9    LEU C CD1 1 
ATOM   1263 C CD2 . LEU C 3 9  ? 1.652   57.646 8.772   1.00   34.84 ? 9    LEU C CD2 1 
ATOM   1264 N N   . PRO C 3 10 ? 2.733   53.072 7.151   1.00   28.08 ? 10   PRO C N   1 
ATOM   1265 C CA  . PRO C 3 10 ? 2.819   51.818 6.398   1.00   28.49 ? 10   PRO C CA  1 
ATOM   1266 C C   . PRO C 3 10 ? 2.293   51.893 4.966   1.00   29.23 ? 10   PRO C C   1 
ATOM   1267 O O   . PRO C 3 10 ? 1.429   52.710 4.648   1.00   28.05 ? 10   PRO C O   1 
ATOM   1268 C CB  . PRO C 3 10 ? 2.008   50.855 7.258   1.00   28.33 ? 10   PRO C CB  1 
ATOM   1269 C CG  . PRO C 3 10 ? 0.932   51.740 7.787   1.00   28.25 ? 10   PRO C CG  1 
ATOM   1270 C CD  . PRO C 3 10 ? 1.698   52.982 8.197   1.00   29.08 ? 10   PRO C CD  1 
ATOM   1271 N N   . TYR C 3 11 ? 2.831   51.034 4.107   1.00   30.15 ? 11   TYR C N   1 
ATOM   1272 C CA  . TYR C 3 11 ? 2.411   50.966 2.713   1.00   32.34 ? 11   TYR C CA  1 
ATOM   1273 C C   . TYR C 3 11 ? 1.494   49.764 2.545   1.00   34.82 ? 11   TYR C C   1 
ATOM   1274 O O   . TYR C 3 11 ? 1.534   48.828 3.345   1.00   34.35 ? 11   TYR C O   1 
ATOM   1275 C CB  . TYR C 3 11 ? 3.613   50.794 1.783   1.00   31.15 ? 11   TYR C CB  1 
ATOM   1276 C CG  . TYR C 3 11 ? 4.409   52.048 1.527   1.00   30.48 ? 11   TYR C CG  1 
ATOM   1277 C CD1 . TYR C 3 11 ? 5.237   52.589 2.508   1.00   30.79 ? 11   TYR C CD1 1 
ATOM   1278 C CD2 . TYR C 3 11 ? 4.343   52.690 0.290   1.00   31.16 ? 11   TYR C CD2 1 
ATOM   1279 C CE1 . TYR C 3 11 ? 5.984   53.739 2.263   1.00   32.53 ? 11   TYR C CE1 1 
ATOM   1280 C CE2 . TYR C 3 11 ? 5.083   53.836 0.034   1.00   32.20 ? 11   TYR C CE2 1 
ATOM   1281 C CZ  . TYR C 3 11 ? 5.901   54.355 1.022   1.00   32.73 ? 11   TYR C CZ  1 
ATOM   1282 O OH  . TYR C 3 11 ? 6.636   55.486 0.760   1.00   33.99 ? 11   TYR C OH  1 
ATOM   1283 N N   . PRO C 3 12 ? 0.654   49.773 1.500   1.00   38.37 ? 12   PRO C N   1 
ATOM   1284 C CA  . PRO C 3 12 ? -0.265  48.658 1.250   1.00   41.49 ? 12   PRO C CA  1 
ATOM   1285 C C   . PRO C 3 12 ? 0.483   47.329 1.109   1.00   44.33 ? 12   PRO C C   1 
ATOM   1286 O O   . PRO C 3 12 ? 1.712   47.310 1.020   1.00   44.89 ? 12   PRO C O   1 
ATOM   1287 C CB  . PRO C 3 12 ? -0.960  49.074 -0.044  1.00   40.97 ? 12   PRO C CB  1 
ATOM   1288 C CG  . PRO C 3 12 ? -0.990  50.566 0.069   1.00   40.69 ? 12   PRO C CG  1 
ATOM   1289 C CD  . PRO C 3 12 ? 0.404   50.878 0.558   1.00   38.20 ? 12   PRO C CD  1 
ATOM   1290 N N   . ASP C 3 13 ? -0.273  46.232 1.090   1.00   47.60 ? 13   ASP C N   1 
ATOM   1291 C CA  . ASP C 3 13 ? 0.269   44.876 0.966   1.00   50.55 ? 13   ASP C CA  1 
ATOM   1292 C C   . ASP C 3 13 ? 0.763   44.350 2.308   1.00   51.74 ? 13   ASP C C   1 
ATOM   1293 O O   . ASP C 3 13 ? 0.164   43.380 2.819   1.00   52.22 ? 13   ASP C O   1 
ATOM   1294 C CB  . ASP C 3 13 ? 1.418   44.836 -0.051  1.00   52.06 ? 13   ASP C CB  1 
ATOM   1295 C CG  . ASP C 3 13 ? 1.001   45.326 -1.423  1.00   53.36 ? 13   ASP C CG  1 
ATOM   1296 O OD1 . ASP C 3 13 ? 1.863   45.361 -2.326  1.00   55.76 ? 13   ASP C OD1 1 
ATOM   1297 O OD2 . ASP C 3 13 ? -0.185  45.676 -1.601  1.00   53.99 ? 13   ASP C OD2 1 
ATOM   1298 O OXT . ASP C 3 13 ? 1.742   44.917 2.836   1.00   54.58 ? 13   ASP C OXT 1 
ATOM   1299 N N   . TRP D 3 1  ? -4.215  17.363 -3.016  1.00   24.76 ? 1    TRP D N   1 
ATOM   1300 C CA  . TRP D 3 1  ? -3.591  16.509 -4.066  1.00   24.10 ? 1    TRP D CA  1 
ATOM   1301 C C   . TRP D 3 1  ? -2.822  15.368 -3.413  1.00   24.15 ? 1    TRP D C   1 
ATOM   1302 O O   . TRP D 3 1  ? -2.470  15.440 -2.236  1.00   24.01 ? 1    TRP D O   1 
ATOM   1303 C CB  . TRP D 3 1  ? -2.620  17.328 -4.923  1.00   23.08 ? 1    TRP D CB  1 
ATOM   1304 C CG  . TRP D 3 1  ? -3.210  18.568 -5.518  1.00   24.62 ? 1    TRP D CG  1 
ATOM   1305 C CD1 . TRP D 3 1  ? -3.335  19.792 -4.918  1.00   22.67 ? 1    TRP D CD1 1 
ATOM   1306 C CD2 . TRP D 3 1  ? -3.773  18.703 -6.827  1.00   24.79 ? 1    TRP D CD2 1 
ATOM   1307 N NE1 . TRP D 3 1  ? -3.940  20.681 -5.776  1.00   23.89 ? 1    TRP D NE1 1 
ATOM   1308 C CE2 . TRP D 3 1  ? -4.220  20.039 -6.955  1.00   25.35 ? 1    TRP D CE2 1 
ATOM   1309 C CE3 . TRP D 3 1  ? -3.944  17.825 -7.906  1.00   26.25 ? 1    TRP D CE3 1 
ATOM   1310 C CZ2 . TRP D 3 1  ? -4.828  20.518 -8.121  1.00   25.37 ? 1    TRP D CZ2 1 
ATOM   1311 C CZ3 . TRP D 3 1  ? -4.550  18.302 -9.068  1.00   27.28 ? 1    TRP D CZ3 1 
ATOM   1312 C CH2 . TRP D 3 1  ? -4.984  19.638 -9.163  1.00   26.09 ? 1    TRP D CH2 1 
ATOM   1313 N N   . ARG D 3 2  ? -2.561  14.317 -4.183  1.00   24.42 ? 2    ARG D N   1 
ATOM   1314 C CA  . ARG D 3 2  ? -1.811  13.179 -3.673  1.00   25.00 ? 2    ARG D CA  1 
ATOM   1315 C C   . ARG D 3 2  ? -0.333  13.315 -4.021  1.00   24.04 ? 2    ARG D C   1 
ATOM   1316 O O   . ARG D 3 2  ? 0.042   13.405 -5.191  1.00   24.68 ? 2    ARG D O   1 
ATOM   1317 C CB  . ARG D 3 2  ? -2.353  11.865 -4.240  1.00   28.16 ? 2    ARG D CB  1 
ATOM   1318 C CG  . ARG D 3 2  ? -1.456  10.675 -3.934  1.00   31.69 ? 2    ARG D CG  1 
ATOM   1319 C CD  . ARG D 3 2  ? -2.249  9.417  -3.656  1.00   35.39 ? 2    ARG D CD  1 
ATOM   1320 N NE  . ARG D 3 2  ? -3.113  9.575  -2.491  1.00   38.05 ? 2    ARG D NE  1 
ATOM   1321 C CZ  . ARG D 3 2  ? -3.795  8.584  -1.929  1.00   40.12 ? 2    ARG D CZ  1 
ATOM   1322 N NH1 . ARG D 3 2  ? -3.712  7.354  -2.424  1.00   41.03 ? 2    ARG D NH1 1 
ATOM   1323 N NH2 . ARG D 3 2  ? -4.565  8.821  -0.875  1.00   41.84 ? 2    ARG D NH2 1 
ATOM   1324 N N   . TYR D 3 3  ? 0.500   13.345 -2.989  1.00   22.05 ? 3    TYR D N   1 
ATOM   1325 C CA  . TYR D 3 3  ? 1.939   13.458 -3.166  1.00   20.33 ? 3    TYR D CA  1 
ATOM   1326 C C   . TYR D 3 3  ? 2.621   12.242 -2.561  1.00   19.81 ? 3    TYR D C   1 
ATOM   1327 O O   . TYR D 3 3  ? 2.070   11.601 -1.667  1.00   19.51 ? 3    TYR D O   1 
ATOM   1328 C CB  . TYR D 3 3  ? 2.479   14.704 -2.464  1.00   20.25 ? 3    TYR D CB  1 
ATOM   1329 C CG  . TYR D 3 3  ? 2.067   16.024 -3.074  1.00   20.66 ? 3    TYR D CG  1 
ATOM   1330 C CD1 . TYR D 3 3  ? 0.899   16.670 -2.669  1.00   19.83 ? 3    TYR D CD1 1 
ATOM   1331 C CD2 . TYR D 3 3  ? 2.874   16.650 -4.025  1.00   20.85 ? 3    TYR D CD2 1 
ATOM   1332 C CE1 . TYR D 3 3  ? 0.549   17.916 -3.192  1.00   18.60 ? 3    TYR D CE1 1 
ATOM   1333 C CE2 . TYR D 3 3  ? 2.536   17.891 -4.556  1.00   20.64 ? 3    TYR D CE2 1 
ATOM   1334 C CZ  . TYR D 3 3  ? 1.374   18.520 -4.134  1.00   20.17 ? 3    TYR D CZ  1 
ATOM   1335 O OH  . TYR D 3 3  ? 1.054   19.761 -4.643  1.00   20.04 ? 3    TYR D OH  1 
ATOM   1336 N N   . TYR D 3 4  ? 3.823   11.940 -3.043  1.00   19.78 ? 4    TYR D N   1 
ATOM   1337 C CA  . TYR D 3 4  ? 4.604   10.814 -2.537  1.00   21.16 ? 4    TYR D CA  1 
ATOM   1338 C C   . TYR D 3 4  ? 5.987   11.291 -2.103  1.00   21.51 ? 4    TYR D C   1 
ATOM   1339 O O   . TYR D 3 4  ? 6.441   12.359 -2.518  1.00   20.69 ? 4    TYR D O   1 
ATOM   1340 C CB  . TYR D 3 4  ? 4.744   9.729  -3.612  1.00   22.35 ? 4    TYR D CB  1 
ATOM   1341 C CG  . TYR D 3 4  ? 3.430   9.098  -4.000  1.00   24.44 ? 4    TYR D CG  1 
ATOM   1342 C CD1 . TYR D 3 4  ? 2.623   9.669  -4.984  1.00   24.34 ? 4    TYR D CD1 1 
ATOM   1343 C CD2 . TYR D 3 4  ? 2.968   7.954  -3.351  1.00   24.47 ? 4    TYR D CD2 1 
ATOM   1344 C CE1 . TYR D 3 4  ? 1.389   9.117  -5.310  1.00   24.74 ? 4    TYR D CE1 1 
ATOM   1345 C CE2 . TYR D 3 4  ? 1.734   7.395  -3.667  1.00   24.56 ? 4    TYR D CE2 1 
ATOM   1346 C CZ  . TYR D 3 4  ? 0.950   7.982  -4.647  1.00   25.41 ? 4    TYR D CZ  1 
ATOM   1347 O OH  . TYR D 3 4  ? -0.273  7.438  -4.956  1.00   26.77 ? 4    TYR D OH  1 
ATOM   1348 N N   . GLU D 3 5  ? 6.657   10.495 -1.273  1.00   21.90 ? 5    GLU D N   1 
ATOM   1349 C CA  . GLU D 3 5  ? 7.985   10.851 -0.774  1.00   25.52 ? 5    GLU D CA  1 
ATOM   1350 C C   . GLU D 3 5  ? 8.965   11.140 -1.899  1.00   26.08 ? 5    GLU D C   1 
ATOM   1351 O O   . GLU D 3 5  ? 9.791   12.039 -1.796  1.00   26.90 ? 5    GLU D O   1 
ATOM   1352 C CB  . GLU D 3 5  ? 8.598   9.718  0.041   1.00   27.65 ? 5    GLU D CB  1 
ATOM   1353 C CG  . GLU D 3 5  ? 8.005   9.441  1.388   1.00   30.87 ? 5    GLU D CG  1 
ATOM   1354 C CD  . GLU D 3 5  ? 8.596   8.172  1.972   1.00   33.48 ? 5    GLU D CD  1 
ATOM   1355 O OE1 . GLU D 3 5  ? 9.792   8.190  2.335   1.00   35.42 ? 5    GLU D OE1 1 
ATOM   1356 O OE2 . GLU D 3 5  ? 7.877   7.155  2.045   1.00   32.51 ? 5    GLU D OE2 1 
ATOM   1357 N N   . SER D 3 6  ? 8.874   10.347 -2.959  1.00   27.28 ? 6    SER D N   1 
ATOM   1358 C CA  . SER D 3 6  ? 9.773   10.456 -4.102  1.00   29.71 ? 6    SER D CA  1 
ATOM   1359 C C   . SER D 3 6  ? 9.833   11.794 -4.834  1.00   30.88 ? 6    SER D C   1 
ATOM   1360 O O   . SER D 3 6  ? 10.891  12.162 -5.351  1.00   30.70 ? 6    SER D O   1 
ATOM   1361 C CB  . SER D 3 6  ? 9.452   9.348  -5.110  1.00   29.15 ? 6    SER D CB  1 
ATOM   1362 O OG  . SER D 3 6  ? 8.087   9.382  -5.488  1.00   30.36 ? 6    SER D OG  1 
ATOM   1363 N N   . SER D 3 7  ? 8.722   12.525 -4.877  1.00   29.94 ? 7    SER D N   1 
ATOM   1364 C CA  . SER D 3 7  ? 8.703   13.795 -5.595  1.00   31.53 ? 7    SER D CA  1 
ATOM   1365 C C   . SER D 3 7  ? 7.819   14.886 -4.992  1.00   31.50 ? 7    SER D C   1 
ATOM   1366 O O   . SER D 3 7  ? 6.965   14.622 -4.147  1.00   30.35 ? 7    SER D O   1 
ATOM   1367 C CB  . SER D 3 7  ? 8.270   13.545 -7.042  1.00   30.81 ? 7    SER D CB  1 
ATOM   1368 O OG  . SER D 3 7  ? 8.085   14.758 -7.747  1.00   32.51 ? 7    SER D OG  1 
ATOM   1369 N N   . LEU D 3 8  ? 8.037   16.115 -5.453  1.00   33.33 ? 8    LEU D N   1 
ATOM   1370 C CA  . LEU D 3 8  ? 7.268   17.269 -5.005  1.00   34.27 ? 8    LEU D CA  1 
ATOM   1371 C C   . LEU D 3 8  ? 6.148   17.557 -5.999  1.00   35.45 ? 8    LEU D C   1 
ATOM   1372 O O   . LEU D 3 8  ? 5.474   18.581 -5.904  1.00   35.06 ? 8    LEU D O   1 
ATOM   1373 C CB  . LEU D 3 8  ? 8.172   18.500 -4.884  1.00   34.65 ? 8    LEU D CB  1 
ATOM   1374 C CG  . LEU D 3 8  ? 9.196   18.512 -3.747  1.00   35.36 ? 8    LEU D CG  1 
ATOM   1375 C CD1 . LEU D 3 8  ? 10.078  19.751 -3.859  1.00   36.71 ? 8    LEU D CD1 1 
ATOM   1376 C CD2 . LEU D 3 8  ? 8.471   18.495 -2.406  1.00   35.98 ? 8    LEU D CD2 1 
ATOM   1377 N N   . LEU D 3 9  ? 5.958   16.655 -6.958  1.00   36.33 ? 9    LEU D N   1 
ATOM   1378 C CA  . LEU D 3 9  ? 4.916   16.825 -7.964  1.00   38.13 ? 9    LEU D CA  1 
ATOM   1379 C C   . LEU D 3 9  ? 3.689   15.981 -7.641  1.00   39.17 ? 9    LEU D C   1 
ATOM   1380 O O   . LEU D 3 9  ? 3.807   14.815 -7.267  1.00   38.61 ? 9    LEU D O   1 
ATOM   1381 C CB  . LEU D 3 9  ? 5.442   16.443 -9.350  1.00   39.81 ? 9    LEU D CB  1 
ATOM   1382 C CG  . LEU D 3 9  ? 6.710   17.146 -9.842  1.00   40.39 ? 9    LEU D CG  1 
ATOM   1383 C CD1 . LEU D 3 9  ? 7.023   16.671 -11.253 1.00   41.87 ? 9    LEU D CD1 1 
ATOM   1384 C CD2 . LEU D 3 9  ? 6.523   18.657 -9.813  1.00   40.55 ? 9    LEU D CD2 1 
ATOM   1385 N N   . PRO D 3 10 ? 2.491   16.566 -7.788  1.00   40.47 ? 10   PRO D N   1 
ATOM   1386 C CA  . PRO D 3 10 ? 1.209   15.904 -7.522  1.00   42.32 ? 10   PRO D CA  1 
ATOM   1387 C C   . PRO D 3 10 ? 0.958   14.731 -8.465  1.00   45.15 ? 10   PRO D C   1 
ATOM   1388 O O   . PRO D 3 10 ? 1.509   14.681 -9.565  1.00   45.38 ? 10   PRO D O   1 
ATOM   1389 C CB  . PRO D 3 10 ? 0.189   17.021 -7.740  1.00   41.59 ? 10   PRO D CB  1 
ATOM   1390 C CG  . PRO D 3 10 ? 0.969   18.269 -7.490  1.00   41.85 ? 10   PRO D CG  1 
ATOM   1391 C CD  . PRO D 3 10 ? 2.278   17.974 -8.160  1.00   40.51 ? 10   PRO D CD  1 
ATOM   1392 N N   . TYR D 3 11 ? 0.114   13.799 -8.029  1.00   47.88 ? 11   TYR D N   1 
ATOM   1393 C CA  . TYR D 3 11 ? -0.238  12.629 -8.827  1.00   50.27 ? 11   TYR D CA  1 
ATOM   1394 C C   . TYR D 3 11 ? -1.734  12.477 -9.118  1.00   52.86 ? 11   TYR D C   1 
ATOM   1395 O O   . TYR D 3 11 ? -2.119  11.661 -9.957  1.00   55.25 ? 11   TYR D O   1 
ATOM   1396 C CB  . TYR D 3 11 ? 0.251   11.345 -8.151  1.00   48.90 ? 11   TYR D CB  1 
ATOM   1397 C CG  . TYR D 3 11 ? 1.678   10.960 -8.470  1.00   48.32 ? 11   TYR D CG  1 
ATOM   1398 C CD1 . TYR D 3 11 ? 2.754   11.649 -7.913  1.00   47.73 ? 11   TYR D CD1 1 
ATOM   1399 C CD2 . TYR D 3 11 ? 1.952   9.884  -9.314  1.00   48.39 ? 11   TYR D CD2 1 
ATOM   1400 C CE1 . TYR D 3 11 ? 4.069   11.271 -8.185  1.00   47.41 ? 11   TYR D CE1 1 
ATOM   1401 C CE2 . TYR D 3 11 ? 3.260   9.500  -9.594  1.00   47.05 ? 11   TYR D CE2 1 
ATOM   1402 C CZ  . TYR D 3 11 ? 4.312   10.194 -9.026  1.00   47.84 ? 11   TYR D CZ  1 
ATOM   1403 O OH  . TYR D 3 11 ? 5.604   9.800  -9.290  1.00   47.34 ? 11   TYR D OH  1 
ATOM   1404 N N   . PRO D 3 12 ? -2.602  13.244 -8.433  1.00   54.63 ? 12   PRO D N   1 
ATOM   1405 C CA  . PRO D 3 12 ? -4.028  13.072 -8.732  1.00   56.43 ? 12   PRO D CA  1 
ATOM   1406 C C   . PRO D 3 12 ? -4.356  13.163 -10.221 1.00   57.74 ? 12   PRO D C   1 
ATOM   1407 O O   . PRO D 3 12 ? -3.464  13.560 -11.002 1.00   58.76 ? 12   PRO D O   1 
ATOM   1408 C CB  . PRO D 3 12 ? -4.682  14.189 -7.926  1.00   56.27 ? 12   PRO D CB  1 
ATOM   1409 C CG  . PRO D 3 12 ? -3.807  14.270 -6.728  1.00   54.52 ? 12   PRO D CG  1 
ATOM   1410 C CD  . PRO D 3 12 ? -2.419  14.203 -7.328  1.00   54.08 ? 12   PRO D CD  1 
HETATM 1411 I I   . IOD E 4 .  ? 18.621  46.140 11.360  0.40   24.20 ? 1075 IOD A I   1 
HETATM 1412 I I   . IOD F 4 .  ? 5.719   11.542 9.642   0.40   39.26 ? 1075 IOD B I   1 
HETATM 1413 O O   . HOH G 5 .  ? 8.606   43.090 30.456  1.00   33.23 ? 2001 HOH A O   1 
HETATM 1414 O O   . HOH G 5 .  ? -0.274  39.433 17.021  1.00   44.11 ? 2002 HOH A O   1 
HETATM 1415 O O   . HOH G 5 .  ? 4.719   40.932 12.217  1.00   44.41 ? 2003 HOH A O   1 
HETATM 1416 O O   . HOH G 5 .  ? 1.259   41.691 18.221  1.00   31.56 ? 2004 HOH A O   1 
HETATM 1417 O O   . HOH G 5 .  ? 5.902   52.115 19.295  1.00   20.07 ? 2005 HOH A O   1 
HETATM 1418 O O   . HOH G 5 .  ? -2.532  50.821 5.582   1.00   39.00 ? 2006 HOH A O   1 
HETATM 1419 O O   . HOH G 5 .  ? -2.058  55.012 7.762   1.00   51.64 ? 2007 HOH A O   1 
HETATM 1420 O O   . HOH G 5 .  ? -3.589  55.064 11.559  1.00   51.87 ? 2008 HOH A O   1 
HETATM 1421 O O   . HOH G 5 .  ? 12.942  38.489 34.002  1.00   49.98 ? 2009 HOH A O   1 
HETATM 1422 O O   . HOH G 5 .  ? 4.795   40.845 17.561  1.00   52.83 ? 2010 HOH A O   1 
HETATM 1423 O O   . HOH G 5 .  ? 5.832   41.909 15.369  1.00   32.63 ? 2011 HOH A O   1 
HETATM 1424 O O   . HOH G 5 .  ? 2.949   57.076 15.256  1.00   52.97 ? 2012 HOH A O   1 
HETATM 1425 O O   . HOH G 5 .  ? 5.510   42.950 11.013  1.00   32.73 ? 2013 HOH A O   1 
HETATM 1426 O O   . HOH G 5 .  ? 4.351   45.155 8.824   1.00   34.73 ? 2014 HOH A O   1 
HETATM 1427 O O   . HOH G 5 .  ? 5.061   38.497 33.787  1.00   41.79 ? 2015 HOH A O   1 
HETATM 1428 O O   . HOH G 5 .  ? -1.314  43.511 10.978  1.00   21.49 ? 2016 HOH A O   1 
HETATM 1429 O O   . HOH G 5 .  ? 2.813   33.003 23.989  1.00   33.13 ? 2017 HOH A O   1 
HETATM 1430 O O   . HOH G 5 .  ? 10.077  35.024 31.925  1.00   60.06 ? 2018 HOH A O   1 
HETATM 1431 O O   . HOH G 5 .  ? 12.162  33.884 32.119  1.00   21.51 ? 2019 HOH A O   1 
HETATM 1432 O O   . HOH G 5 .  ? 12.401  36.164 32.929  1.00   44.99 ? 2020 HOH A O   1 
HETATM 1433 O O   . HOH G 5 .  ? 2.001   36.458 19.054  1.00   54.76 ? 2021 HOH A O   1 
HETATM 1434 O O   . HOH G 5 .  ? -2.737  51.828 8.033   1.00   49.38 ? 2022 HOH A O   1 
HETATM 1435 O O   . HOH G 5 .  ? -0.756  54.425 10.703  1.00   29.83 ? 2023 HOH A O   1 
HETATM 1436 O O   . HOH G 5 .  ? -4.677  52.849 14.701  1.00   24.40 ? 2024 HOH A O   1 
HETATM 1437 O O   . HOH G 5 .  ? 7.725   50.466 28.536  1.00   53.61 ? 2025 HOH A O   1 
HETATM 1438 O O   . HOH G 5 .  ? 17.725  52.838 13.965  1.00   43.57 ? 2026 HOH A O   1 
HETATM 1439 O O   . HOH G 5 .  ? 19.391  53.174 18.318  1.00   60.43 ? 2027 HOH A O   1 
HETATM 1440 O O   . HOH G 5 .  ? 4.629   54.548 15.354  1.00   46.49 ? 2028 HOH A O   1 
HETATM 1441 O O   . HOH G 5 .  ? 13.333  41.293 -3.778  1.00   43.09 ? 2029 HOH A O   1 
HETATM 1442 O O   . HOH G 5 .  ? 4.734   45.308 30.421  1.00   37.38 ? 2030 HOH A O   1 
HETATM 1443 O O   . HOH G 5 .  ? 5.645   38.397 29.601  1.00   42.68 ? 2031 HOH A O   1 
HETATM 1444 O O   . HOH G 5 .  ? 8.873   39.132 27.712  1.00   25.63 ? 2032 HOH A O   1 
HETATM 1445 O O   . HOH G 5 .  ? 11.432  31.894 17.722  1.00   44.73 ? 2033 HOH A O   1 
HETATM 1446 O O   . HOH G 5 .  ? 6.201   32.409 22.856  1.00   21.54 ? 2034 HOH A O   1 
HETATM 1447 O O   . HOH G 5 .  ? 8.065   34.786 18.503  1.00   47.12 ? 2035 HOH A O   1 
HETATM 1448 O O   . HOH G 5 .  ? 5.776   33.931 19.479  1.00   35.12 ? 2036 HOH A O   1 
HETATM 1449 O O   . HOH G 5 .  ? 11.967  35.034 30.199  1.00   40.00 ? 2037 HOH A O   1 
HETATM 1450 O O   . HOH G 5 .  ? 12.203  40.447 29.708  1.00   22.02 ? 2038 HOH A O   1 
HETATM 1451 O O   . HOH G 5 .  ? 15.371  41.411 28.369  1.00   21.63 ? 2039 HOH A O   1 
HETATM 1452 O O   . HOH G 5 .  ? 15.917  34.422 27.384  1.00   30.24 ? 2040 HOH A O   1 
HETATM 1453 O O   . HOH G 5 .  ? 9.930   37.186 29.567  1.00   29.78 ? 2041 HOH A O   1 
HETATM 1454 O O   . HOH G 5 .  ? 20.279  43.878 -1.304  1.00   34.80 ? 2042 HOH A O   1 
HETATM 1455 O O   . HOH G 5 .  ? 9.641   36.575 13.977  1.00   54.55 ? 2043 HOH A O   1 
HETATM 1456 O O   . HOH G 5 .  ? 7.625   38.375 15.080  1.00   42.09 ? 2044 HOH A O   1 
HETATM 1457 O O   . HOH G 5 .  ? 14.278  50.062 30.232  1.00   61.40 ? 2045 HOH A O   1 
HETATM 1458 O O   . HOH G 5 .  ? 5.365   51.087 27.298  1.00   51.89 ? 2046 HOH A O   1 
HETATM 1459 O O   . HOH G 5 .  ? 18.400  51.281 17.033  1.00   48.00 ? 2047 HOH A O   1 
HETATM 1460 O O   . HOH G 5 .  ? 10.345  41.049 0.335   1.00   29.08 ? 2048 HOH A O   1 
HETATM 1461 O O   . HOH G 5 .  ? 12.477  40.741 -1.234  1.00   37.57 ? 2049 HOH A O   1 
HETATM 1462 O O   . HOH G 5 .  ? 16.182  45.616 -4.727  1.00   26.50 ? 2050 HOH A O   1 
HETATM 1463 O O   . HOH G 5 .  ? 12.993  47.653 0.063   1.00   18.54 ? 2051 HOH A O   1 
HETATM 1464 O O   . HOH G 5 .  ? 15.233  49.091 -5.749  1.00   19.06 ? 2052 HOH A O   1 
HETATM 1465 O O   . HOH G 5 .  ? 12.410  51.660 -6.169  1.00   31.75 ? 2053 HOH A O   1 
HETATM 1466 O O   . HOH G 5 .  ? 12.749  58.742 -2.912  1.00   49.25 ? 2054 HOH A O   1 
HETATM 1467 O O   . HOH G 5 .  ? 9.720   57.724 -1.302  1.00   48.59 ? 2055 HOH A O   1 
HETATM 1468 O O   . HOH G 5 .  ? 8.179   54.476 -4.146  1.00   46.85 ? 2056 HOH A O   1 
HETATM 1469 O O   . HOH G 5 .  ? 13.557  57.701 0.525   1.00   32.62 ? 2057 HOH A O   1 
HETATM 1470 O O   . HOH G 5 .  ? 2.916   50.032 -3.028  1.00   42.61 ? 2058 HOH A O   1 
HETATM 1471 O O   . HOH G 5 .  ? 22.843  46.474 2.258   1.00   44.45 ? 2059 HOH A O   1 
HETATM 1472 O O   . HOH G 5 .  ? 19.856  44.056 3.959   1.00   33.56 ? 2060 HOH A O   1 
HETATM 1473 O O   . HOH G 5 .  ? 6.774   45.824 7.532   1.00   18.98 ? 2061 HOH A O   1 
HETATM 1474 O O   . HOH G 5 .  ? 7.033   41.485 8.204   1.00   45.44 ? 2062 HOH A O   1 
HETATM 1475 O O   . HOH G 5 .  ? 6.787   39.425 17.472  1.00   25.15 ? 2063 HOH A O   1 
HETATM 1476 O O   . HOH G 5 .  ? 10.873  36.249 16.519  1.00   35.28 ? 2064 HOH A O   1 
HETATM 1477 O O   . HOH G 5 .  ? 15.071  35.827 25.128  1.00   22.94 ? 2065 HOH A O   1 
HETATM 1478 O O   . HOH G 5 .  ? 12.385  33.432 19.172  1.00   33.08 ? 2066 HOH A O   1 
HETATM 1479 O O   . HOH G 5 .  ? 18.603  34.213 23.359  1.00   30.95 ? 2067 HOH A O   1 
HETATM 1480 O O   . HOH G 5 .  ? 13.562  34.555 16.406  1.00   43.81 ? 2068 HOH A O   1 
HETATM 1481 O O   . HOH G 5 .  ? 13.976  30.131 20.961  1.00   45.65 ? 2069 HOH A O   1 
HETATM 1482 O O   . HOH G 5 .  ? 19.721  35.210 20.991  1.00   23.74 ? 2070 HOH A O   1 
HETATM 1483 O O   . HOH G 5 .  ? 20.612  33.549 17.058  1.00   25.60 ? 2071 HOH A O   1 
HETATM 1484 O O   . HOH G 5 .  ? 21.187  37.323 14.536  1.00   39.22 ? 2072 HOH A O   1 
HETATM 1485 O O   . HOH G 5 .  ? 20.513  31.122 16.042  1.00   38.00 ? 2073 HOH A O   1 
HETATM 1486 O O   . HOH G 5 .  ? 24.819  35.088 6.838   1.00   35.41 ? 2074 HOH A O   1 
HETATM 1487 O O   . HOH G 5 .  ? 25.626  37.391 6.489   1.00   33.36 ? 2075 HOH A O   1 
HETATM 1488 O O   . HOH G 5 .  ? 19.330  37.768 8.958   1.00   31.03 ? 2076 HOH A O   1 
HETATM 1489 O O   . HOH G 5 .  ? 18.547  43.103 1.177   1.00   26.45 ? 2077 HOH A O   1 
HETATM 1490 O O   . HOH G 5 .  ? 24.321  42.098 5.294   1.00   41.27 ? 2078 HOH A O   1 
HETATM 1491 O O   . HOH G 5 .  ? 25.033  44.506 6.139   1.00   43.25 ? 2079 HOH A O   1 
HETATM 1492 O O   . HOH G 5 .  ? 21.618  40.108 14.920  1.00   30.36 ? 2080 HOH A O   1 
HETATM 1493 O O   . HOH G 5 .  ? 21.608  45.585 11.897  1.00   25.21 ? 2081 HOH A O   1 
HETATM 1494 O O   . HOH G 5 .  ? 21.407  48.229 14.590  1.00   26.68 ? 2082 HOH A O   1 
HETATM 1495 O O   . HOH G 5 .  ? 19.627  47.970 24.592  1.00   34.50 ? 2083 HOH A O   1 
HETATM 1496 O O   . HOH G 5 .  ? 9.379   46.169 31.207  1.00   51.59 ? 2084 HOH A O   1 
HETATM 1497 O O   . HOH G 5 .  ? 14.651  47.519 29.921  1.00   27.60 ? 2085 HOH A O   1 
HETATM 1498 O O   . HOH G 5 .  ? 5.117   52.666 25.254  1.00   47.76 ? 2086 HOH A O   1 
HETATM 1499 O O   . HOH G 5 .  ? 14.302  61.431 10.169  1.00   42.00 ? 2087 HOH A O   1 
HETATM 1500 O O   . HOH G 5 .  ? 14.110  59.058 4.865   1.00   36.64 ? 2088 HOH A O   1 
HETATM 1501 O O   . HOH G 5 .  ? 9.202   52.724 16.388  1.00   19.89 ? 2089 HOH A O   1 
HETATM 1502 O O   . HOH G 5 .  ? 9.133   60.500 15.294  1.00   49.28 ? 2090 HOH A O   1 
HETATM 1503 O O   . HOH G 5 .  ? 11.651  58.310 22.854  1.00   52.93 ? 2091 HOH A O   1 
HETATM 1504 O O   . HOH G 5 .  ? 11.518  54.076 21.203  1.00   30.15 ? 2092 HOH A O   1 
HETATM 1505 O O   . HOH H 5 .  ? -1.183  29.710 15.548  1.00   18.47 ? 2001 HOH B O   1 
HETATM 1506 O O   . HOH H 5 .  ? 0.606   32.548 12.106  1.00   27.61 ? 2002 HOH B O   1 
HETATM 1507 O O   . HOH H 5 .  ? -3.044  30.475 11.967  1.00   21.13 ? 2003 HOH B O   1 
HETATM 1508 O O   . HOH H 5 .  ? 7.498   26.996 1.488   1.00   39.04 ? 2004 HOH B O   1 
HETATM 1509 O O   . HOH H 5 .  ? -3.134  2.754  -12.222 1.00   36.74 ? 2005 HOH B O   1 
HETATM 1510 O O   . HOH H 5 .  ? -5.072  2.035  -11.278 1.00   31.96 ? 2006 HOH B O   1 
HETATM 1511 O O   . HOH H 5 .  ? 5.887   24.738 0.859   1.00   26.55 ? 2007 HOH B O   1 
HETATM 1512 O O   . HOH H 5 .  ? -12.547 26.104 20.861  1.00   55.75 ? 2008 HOH B O   1 
HETATM 1513 O O   . HOH H 5 .  ? -10.661 16.811 11.551  1.00   56.92 ? 2009 HOH B O   1 
HETATM 1514 O O   . HOH H 5 .  ? -1.105  3.766  -13.283 1.00   53.21 ? 2010 HOH B O   1 
HETATM 1515 O O   . HOH H 5 .  ? -3.185  15.873 0.409   1.00   31.61 ? 2011 HOH B O   1 
HETATM 1516 O O   . HOH H 5 .  ? 2.989   34.614 9.122   1.00   44.62 ? 2012 HOH B O   1 
HETATM 1517 O O   . HOH H 5 .  ? -1.716  35.967 10.434  1.00   32.74 ? 2013 HOH B O   1 
HETATM 1518 O O   . HOH H 5 .  ? -1.827  38.293 3.782   1.00   59.01 ? 2014 HOH B O   1 
HETATM 1519 O O   . HOH H 5 .  ? -6.194  19.531 -3.158  1.00   27.52 ? 2015 HOH B O   1 
HETATM 1520 O O   . HOH H 5 .  ? -5.131  17.835 1.151   1.00   43.70 ? 2016 HOH B O   1 
HETATM 1521 O O   . HOH H 5 .  ? -12.394 26.884 9.155   1.00   44.49 ? 2017 HOH B O   1 
HETATM 1522 O O   . HOH H 5 .  ? -13.783 29.698 12.201  1.00   48.80 ? 2018 HOH B O   1 
HETATM 1523 O O   . HOH H 5 .  ? -11.371 26.615 18.391  1.00   32.49 ? 2019 HOH B O   1 
HETATM 1524 O O   . HOH H 5 .  ? -10.572 29.276 18.335  1.00   42.28 ? 2020 HOH B O   1 
HETATM 1525 O O   . HOH H 5 .  ? -1.910  20.479 -11.091 1.00   50.71 ? 2021 HOH B O   1 
HETATM 1526 O O   . HOH H 5 .  ? 0.652   26.660 -4.459  1.00   23.88 ? 2022 HOH B O   1 
HETATM 1527 O O   . HOH H 5 .  ? 11.586  17.539 9.076   1.00   47.78 ? 2023 HOH B O   1 
HETATM 1528 O O   . HOH H 5 .  ? -7.302  15.958 11.002  1.00   55.76 ? 2024 HOH B O   1 
HETATM 1529 O O   . HOH H 5 .  ? 6.871   22.971 -3.038  1.00   50.51 ? 2025 HOH B O   1 
HETATM 1530 O O   . HOH H 5 .  ? 5.388   26.682 -2.793  1.00   38.38 ? 2026 HOH B O   1 
HETATM 1531 O O   . HOH H 5 .  ? 7.361   0.248  -10.643 1.00   57.07 ? 2027 HOH B O   1 
HETATM 1532 O O   . HOH H 5 .  ? 4.656   28.502 0.136   1.00   34.78 ? 2028 HOH B O   1 
HETATM 1533 O O   . HOH H 5 .  ? 2.212   3.221  -13.201 1.00   55.31 ? 2029 HOH B O   1 
HETATM 1534 O O   . HOH H 5 .  ? 0.252   33.975 9.374   1.00   28.32 ? 2030 HOH B O   1 
HETATM 1535 O O   . HOH H 5 .  ? 1.863   33.766 5.237   1.00   47.62 ? 2031 HOH B O   1 
HETATM 1536 O O   . HOH H 5 .  ? -2.100  34.923 5.586   1.00   43.40 ? 2032 HOH B O   1 
HETATM 1537 O O   . HOH H 5 .  ? -2.170  31.585 3.706   1.00   22.65 ? 2033 HOH B O   1 
HETATM 1538 O O   . HOH H 5 .  ? -6.243  32.068 11.044  1.00   18.00 ? 2034 HOH B O   1 
HETATM 1539 O O   . HOH H 5 .  ? -4.813  29.316 13.360  1.00   21.31 ? 2035 HOH B O   1 
HETATM 1540 O O   . HOH H 5 .  ? -11.764 27.444 11.691  1.00   43.45 ? 2036 HOH B O   1 
HETATM 1541 O O   . HOH H 5 .  ? -10.878 19.815 17.634  1.00   48.37 ? 2037 HOH B O   1 
HETATM 1542 O O   . HOH H 5 .  ? -10.120 24.460 17.436  1.00   25.15 ? 2038 HOH B O   1 
HETATM 1543 O O   . HOH H 5 .  ? -9.802  21.386 8.329   1.00   58.75 ? 2039 HOH B O   1 
HETATM 1544 O O   . HOH H 5 .  ? -7.208  22.623 7.764   1.00   26.96 ? 2040 HOH B O   1 
HETATM 1545 O O   . HOH H 5 .  ? -7.391  29.565 18.677  1.00   33.47 ? 2041 HOH B O   1 
HETATM 1546 O O   . HOH H 5 .  ? 0.188   27.788 17.021  1.00   17.58 ? 2042 HOH B O   1 
HETATM 1547 O O   . HOH H 5 .  ? -6.166  30.499 15.777  1.00   33.52 ? 2043 HOH B O   1 
HETATM 1548 O O   . HOH H 5 .  ? -5.597  18.554 5.860   1.00   31.34 ? 2044 HOH B O   1 
HETATM 1549 O O   . HOH H 5 .  ? 10.384  21.017 13.779  1.00   47.82 ? 2045 HOH B O   1 
HETATM 1550 O O   . HOH H 5 .  ? 11.415  23.125 12.656  1.00   45.91 ? 2046 HOH B O   1 
HETATM 1551 O O   . HOH H 5 .  ? 9.421   29.759 14.381  1.00   44.98 ? 2047 HOH B O   1 
HETATM 1552 O O   . HOH H 5 .  ? 9.538   17.183 10.160  1.00   48.76 ? 2048 HOH B O   1 
HETATM 1553 O O   . HOH H 5 .  ? -6.427  14.035 9.679   1.00   44.61 ? 2049 HOH B O   1 
HETATM 1554 O O   . HOH H 5 .  ? 16.690  26.439 7.008   1.00   57.19 ? 2050 HOH B O   1 
HETATM 1555 O O   . HOH H 5 .  ? -4.316  5.482  0.293   1.00   47.47 ? 2051 HOH B O   1 
HETATM 1556 O O   . HOH H 5 .  ? 1.473   -2.618 -5.696  1.00   39.23 ? 2052 HOH B O   1 
HETATM 1557 O O   . HOH H 5 .  ? -4.053  1.805  -2.156  1.00   42.76 ? 2053 HOH B O   1 
HETATM 1558 O O   . HOH H 5 .  ? 8.512   1.396  0.574   1.00   46.43 ? 2054 HOH B O   1 
HETATM 1559 O O   . HOH H 5 .  ? 3.955   -0.417 -5.299  1.00   46.27 ? 2055 HOH B O   1 
HETATM 1560 O O   . HOH H 5 .  ? 8.473   -1.335 -8.043  1.00   51.22 ? 2056 HOH B O   1 
HETATM 1561 O O   . HOH H 5 .  ? 9.766   -3.285 -6.339  1.00   43.41 ? 2057 HOH B O   1 
HETATM 1562 O O   . HOH H 5 .  ? 4.515   0.307  -7.995  1.00   49.42 ? 2058 HOH B O   1 
HETATM 1563 O O   . HOH H 5 .  ? 6.719   5.377  -10.400 1.00   52.69 ? 2059 HOH B O   1 
HETATM 1564 O O   . HOH H 5 .  ? 11.346  5.342  -4.167  1.00   52.25 ? 2060 HOH B O   1 
HETATM 1565 O O   . HOH H 5 .  ? -1.319  6.848  -10.695 1.00   48.13 ? 2061 HOH B O   1 
HETATM 1566 O O   . HOH H 5 .  ? 4.458   4.705  -11.299 1.00   51.13 ? 2062 HOH B O   1 
HETATM 1567 O O   . HOH H 5 .  ? 2.688   4.727  -1.415  1.00   22.73 ? 2063 HOH B O   1 
HETATM 1568 O O   . HOH H 5 .  ? -1.041  13.407 -0.530  1.00   26.66 ? 2064 HOH B O   1 
HETATM 1569 O O   . HOH H 5 .  ? -7.237  15.105 3.809   1.00   50.01 ? 2065 HOH B O   1 
HETATM 1570 O O   . HOH H 5 .  ? -4.020  19.179 3.627   1.00   26.34 ? 2066 HOH B O   1 
HETATM 1571 O O   . HOH H 5 .  ? -5.239  21.059 6.819   1.00   17.71 ? 2067 HOH B O   1 
HETATM 1572 O O   . HOH H 5 .  ? -7.512  19.485 9.863   1.00   41.46 ? 2068 HOH B O   1 
HETATM 1573 O O   . HOH H 5 .  ? -8.510  18.794 14.544  1.00   42.15 ? 2069 HOH B O   1 
HETATM 1574 O O   . HOH H 5 .  ? -7.138  16.207 13.882  1.00   32.11 ? 2070 HOH B O   1 
HETATM 1575 O O   . HOH H 5 .  ? -7.777  6.038  14.406  1.00   55.42 ? 2071 HOH B O   1 
HETATM 1576 O O   . HOH H 5 .  ? -3.948  7.913  17.499  1.00   56.43 ? 2072 HOH B O   1 
HETATM 1577 O O   . HOH H 5 .  ? -4.413  6.146  5.350   1.00   50.99 ? 2073 HOH B O   1 
HETATM 1578 O O   . HOH H 5 .  ? 4.049   14.082 16.866  1.00   34.01 ? 2074 HOH B O   1 
HETATM 1579 O O   . HOH H 5 .  ? 3.005   28.461 16.606  1.00   20.53 ? 2075 HOH B O   1 
HETATM 1580 O O   . HOH H 5 .  ? 8.312   22.212 16.347  1.00   11.88 ? 2076 HOH B O   1 
HETATM 1581 O O   . HOH H 5 .  ? 6.710   29.536 15.213  1.00   31.87 ? 2077 HOH B O   1 
HETATM 1582 O O   . HOH H 5 .  ? 9.813   25.223 12.189  1.00   35.18 ? 2078 HOH B O   1 
HETATM 1583 O O   . HOH H 5 .  ? 3.758   30.267 14.494  1.00   34.04 ? 2079 HOH B O   1 
HETATM 1584 O O   . HOH H 5 .  ? 6.375   31.631 7.822   1.00   36.35 ? 2080 HOH B O   1 
HETATM 1585 O O   . HOH H 5 .  ? 15.504  22.396 1.362   1.00   49.68 ? 2081 HOH B O   1 
HETATM 1586 O O   . HOH H 5 .  ? 13.886  21.647 -2.798  1.00   50.37 ? 2082 HOH B O   1 
HETATM 1587 O O   . HOH H 5 .  ? 13.249  24.035 0.980   1.00   54.13 ? 2083 HOH B O   1 
HETATM 1588 O O   . HOH H 5 .  ? 7.203   20.966 1.999   1.00   22.96 ? 2084 HOH B O   1 
HETATM 1589 O O   . HOH H 5 .  ? 12.255  16.714 6.078   1.00   41.18 ? 2085 HOH B O   1 
HETATM 1590 O O   . HOH H 5 .  ? 14.124  25.043 3.630   1.00   56.15 ? 2086 HOH B O   1 
HETATM 1591 O O   . HOH H 5 .  ? 10.263  24.336 5.404   1.00   24.61 ? 2087 HOH B O   1 
HETATM 1592 O O   . HOH H 5 .  ? 17.174  20.550 8.783   1.00   56.12 ? 2088 HOH B O   1 
HETATM 1593 O O   . HOH H 5 .  ? 14.588  26.970 5.495   1.00   56.66 ? 2089 HOH B O   1 
HETATM 1594 O O   . HOH I 5 .  ? 2.607   43.221 8.009   1.00   44.13 ? 2001 HOH C O   1 
HETATM 1595 O O   . HOH I 5 .  ? 4.143   42.830 5.901   1.00   45.65 ? 2002 HOH C O   1 
HETATM 1596 O O   . HOH I 5 .  ? -2.711  46.337 4.387   1.00   47.27 ? 2003 HOH C O   1 
HETATM 1597 O O   . HOH I 5 .  ? 0.036   43.856 8.001   1.00   33.31 ? 2004 HOH C O   1 
HETATM 1598 O O   . HOH I 5 .  ? 6.648   43.456 5.914   1.00   34.43 ? 2005 HOH C O   1 
HETATM 1599 O O   . HOH I 5 .  ? 1.077   55.094 1.361   1.00   49.84 ? 2006 HOH C O   1 
HETATM 1600 O O   . HOH I 5 .  ? 3.030   55.864 2.828   1.00   45.32 ? 2007 HOH C O   1 
HETATM 1601 O O   . HOH I 5 .  ? 19.096  50.399 5.419   1.00   20.74 ? 2008 HOH C O   1 
HETATM 1602 O O   . HOH I 5 .  ? 17.841  52.396 8.635   1.00   26.64 ? 2009 HOH C O   1 
HETATM 1603 O O   . HOH I 5 .  ? 9.206   58.884 1.132   1.00   50.00 ? 2010 HOH C O   1 
HETATM 1604 O O   . HOH I 5 .  ? 4.339   57.949 3.071   1.00   44.04 ? 2011 HOH C O   1 
HETATM 1605 O O   . HOH I 5 .  ? 6.423   59.900 6.113   1.00   44.67 ? 2012 HOH C O   1 
HETATM 1606 O O   . HOH I 5 .  ? 5.570   59.356 8.659   1.00   62.01 ? 2013 HOH C O   1 
HETATM 1607 O O   . HOH I 5 .  ? 3.862   54.021 12.833  1.00   22.52 ? 2014 HOH C O   1 
HETATM 1608 O O   . HOH I 5 .  ? 7.952   59.796 8.950   1.00   21.20 ? 2015 HOH C O   1 
HETATM 1609 O O   . HOH I 5 .  ? 6.782   52.960 5.740   1.00   18.47 ? 2016 HOH C O   1 
HETATM 1610 O O   . HOH I 5 .  ? 8.252   56.567 2.237   1.00   36.87 ? 2017 HOH C O   1 
HETATM 1611 O O   . HOH J 5 .  ? -5.997  15.545 -1.529  1.00   39.71 ? 2001 HOH D O   1 
HETATM 1612 O O   . HOH J 5 .  ? -5.942  2.698  -7.078  1.00   59.98 ? 2002 HOH D O   1 
HETATM 1613 O O   . HOH J 5 .  ? -4.369  2.293  -9.021  1.00   60.08 ? 2003 HOH D O   1 
HETATM 1614 O O   . HOH J 5 .  ? -3.444  11.838 -0.418  1.00   47.84 ? 2004 HOH D O   1 
HETATM 1615 O O   . HOH J 5 .  ? -5.794  6.065  -4.730  1.00   58.07 ? 2005 HOH D O   1 
HETATM 1616 O O   . HOH J 5 .  ? -6.290  9.887  2.025   1.00   47.59 ? 2006 HOH D O   1 
HETATM 1617 O O   . HOH J 5 .  ? 11.187  6.989  -2.160  1.00   54.07 ? 2007 HOH D O   1 
HETATM 1618 O O   . HOH J 5 .  ? 13.069  8.924  -2.577  1.00   47.34 ? 2008 HOH D O   1 
HETATM 1619 O O   . HOH J 5 .  ? 4.803   13.241 -5.229  1.00   21.17 ? 2009 HOH D O   1 
HETATM 1620 O O   . HOH J 5 .  ? 12.057  16.615 -5.881  1.00   32.36 ? 2010 HOH D O   1 
HETATM 1621 O O   . HOH J 5 .  ? 7.479   22.619 -5.626  1.00   43.38 ? 2011 HOH D O   1 
HETATM 1622 O O   . HOH J 5 .  ? 8.183   11.524 -14.664 1.00   56.42 ? 2012 HOH D O   1 
HETATM 1623 O O   . HOH J 5 .  ? 13.723  10.064 -4.962  1.00   52.68 ? 2013 HOH D O   1 
HETATM 1624 O O   . HOH J 5 .  ? 10.288  16.838 -7.404  1.00   36.17 ? 2014 HOH D O   1 
HETATM 1625 O O   . HOH J 5 .  ? 7.130   13.327 -11.042 1.00   46.93 ? 2015 HOH D O   1 
HETATM 1626 O O   . HOH J 5 .  ? 4.957   20.832 -4.830  1.00   33.45 ? 2016 HOH D O   1 
HETATM 1627 O O   . HOH J 5 .  ? 4.523   12.879 -11.328 1.00   38.91 ? 2017 HOH D O   1 
HETATM 1628 O O   . HOH J 5 .  ? 2.359   12.529 -12.568 1.00   47.96 ? 2018 HOH D O   1 
HETATM 1629 O O   . HOH J 5 .  ? 7.362   10.617 -7.673  1.00   51.51 ? 2019 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ILE 1  1  1  ILE ILE A . n 
A 1 2  VAL 2  2  2  VAL VAL A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  HIS 4  4  4  HIS HIS A . n 
A 1 5  THR 5  5  5  THR THR A . n 
A 1 6  THR 6  6  6  THR THR A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 PRO 10 10 10 PRO PRO A . n 
A 1 11 ILE 11 11 11 ILE ILE A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 VAL 14 14 14 VAL VAL A . n 
A 1 15 THR 15 15 15 THR THR A . n 
A 1 16 CYS 16 16 16 CYS CYS A . n 
A 1 17 PRO 17 17 17 PRO PRO A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 GLY 19 19 19 GLY GLY A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 CYS 23 23 23 CYS CYS A . n 
A 1 24 TYR 24 24 24 TYR TYR A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 MET 27 27 27 MET MET A . n 
A 1 28 TRP 28 28 28 TRP TRP A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 VAL 31 31 31 VAL VAL A . n 
A 1 32 PHE 32 32 32 PHE PHE A . n 
A 1 33 CYS 33 33 33 CYS CYS A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 SER 35 35 35 SER SER A . n 
A 1 36 ARG 36 36 36 ARG ARG A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 VAL 39 39 39 VAL VAL A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 LEU 42 42 42 LEU LEU A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 CYS 44 44 44 CYS CYS A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
A 1 47 THR 47 47 47 THR THR A . n 
A 1 48 CYS 48 48 48 CYS CYS A . n 
A 1 49 PRO 49 49 49 PRO PRO A . n 
A 1 50 SER 50 50 50 SER SER A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 LYS 52 52 52 LYS LYS A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 TYR 54 54 54 TYR TYR A . n 
A 1 55 GLU 55 55 55 GLU GLU A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 VAL 57 57 57 VAL VAL A . n 
A 1 58 THR 58 58 58 THR THR A . n 
A 1 59 CYS 59 59 59 CYS CYS A . n 
A 1 60 CYS 60 60 60 CYS CYS A . n 
A 1 61 SER 61 61 61 SER SER A . n 
A 1 62 THR 62 62 62 THR THR A . n 
A 1 63 ASP 63 63 63 ASP ASP A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 CYS 65 65 65 CYS CYS A . n 
A 1 66 ASN 66 66 66 ASN ASN A . n 
A 1 67 PRO 67 67 67 PRO PRO A . n 
A 1 68 HIS 68 68 68 HIS HIS A . n 
A 1 69 PRO 69 69 69 PRO PRO A . n 
A 1 70 LYS 70 70 70 LYS LYS A . n 
A 1 71 GLN 71 71 71 GLN GLN A . n 
A 1 72 ARG 72 72 72 ARG ARG A . n 
A 1 73 PRO 73 73 73 PRO PRO A . n 
A 1 74 GLY 74 74 74 GLY GLY A . n 
B 2 1  ILE 1  1  1  ILE ILE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  CYS 3  3  3  CYS CYS B . n 
B 2 4  HIS 4  4  4  HIS HIS B . n 
B 2 5  THR 5  5  5  THR THR B . n 
B 2 6  THR 6  6  6  THR THR B . n 
B 2 7  ALA 7  7  7  ALA ALA B . n 
B 2 8  THR 8  8  8  THR THR B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 PRO 10 10 10 PRO PRO B . n 
B 2 11 ILE 11 11 11 ILE ILE B . n 
B 2 12 SER 12 12 12 SER SER B . n 
B 2 13 ALA 13 13 13 ALA ALA B . n 
B 2 14 VAL 14 14 14 VAL VAL B . n 
B 2 15 THR 15 15 15 THR THR B . n 
B 2 16 CYS 16 16 16 CYS CYS B . n 
B 2 17 PRO 17 17 17 PRO PRO B . n 
B 2 18 PRO 18 18 18 PRO PRO B . n 
B 2 19 GLY 19 19 19 GLY GLY B . n 
B 2 20 GLU 20 20 20 GLU GLU B . n 
B 2 21 ASN 21 21 21 ASN ASN B . n 
B 2 22 LEU 22 22 22 LEU LEU B . n 
B 2 23 CYS 23 23 23 CYS CYS B . n 
B 2 24 TYR 24 24 24 TYR TYR B . n 
B 2 25 ARG 25 25 25 ARG ARG B . n 
B 2 26 LYS 26 26 26 LYS LYS B . n 
B 2 27 MET 27 27 27 MET MET B . n 
B 2 28 TRP 28 28 28 TRP TRP B . n 
B 2 29 CYS 29 29 29 CYS CYS B . n 
B 2 30 ASP 30 30 30 ASP ASP B . n 
B 2 31 ALA 31 31 31 ALA ALA B . n 
B 2 32 PHE 32 32 32 PHE PHE B . n 
B 2 33 CYS 33 33 33 CYS CYS B . n 
B 2 34 SER 34 34 34 SER SER B . n 
B 2 35 SER 35 35 35 SER SER B . n 
B 2 36 ARG 36 36 36 ARG ARG B . n 
B 2 37 GLY 37 37 37 GLY GLY B . n 
B 2 38 LYS 38 38 38 LYS LYS B . n 
B 2 39 VAL 39 39 39 VAL VAL B . n 
B 2 40 VAL 40 40 40 VAL VAL B . n 
B 2 41 GLU 41 41 41 GLU GLU B . n 
B 2 42 LEU 42 42 42 LEU LEU B . n 
B 2 43 GLY 43 43 43 GLY GLY B . n 
B 2 44 CYS 44 44 44 CYS CYS B . n 
B 2 45 ALA 45 45 45 ALA ALA B . n 
B 2 46 ALA 46 46 46 ALA ALA B . n 
B 2 47 THR 47 47 47 THR THR B . n 
B 2 48 CYS 48 48 48 CYS CYS B . n 
B 2 49 PRO 49 49 49 PRO PRO B . n 
B 2 50 SER 50 50 50 SER SER B . n 
B 2 51 LYS 51 51 51 LYS LYS B . n 
B 2 52 LYS 52 52 52 LYS LYS B . n 
B 2 53 PRO 53 53 53 PRO PRO B . n 
B 2 54 TYR 54 54 54 TYR TYR B . n 
B 2 55 GLU 55 55 55 GLU GLU B . n 
B 2 56 GLU 56 56 56 GLU GLU B . n 
B 2 57 VAL 57 57 57 VAL VAL B . n 
B 2 58 THR 58 58 58 THR THR B . n 
B 2 59 CYS 59 59 59 CYS CYS B . n 
B 2 60 CYS 60 60 60 CYS CYS B . n 
B 2 61 SER 61 61 61 SER SER B . n 
B 2 62 THR 62 62 62 THR THR B . n 
B 2 63 ASP 63 63 63 ASP ASP B . n 
B 2 64 LYS 64 64 64 LYS LYS B . n 
B 2 65 CYS 65 65 65 CYS CYS B . n 
B 2 66 ASN 66 66 66 ASN ASN B . n 
B 2 67 PRO 67 67 67 PRO PRO B . n 
B 2 68 HIS 68 68 68 HIS HIS B . n 
B 2 69 PRO 69 69 69 PRO PRO B . n 
B 2 70 LYS 70 70 70 LYS LYS B . n 
B 2 71 GLN 71 71 71 GLN GLN B . n 
B 2 72 ARG 72 72 72 ARG ARG B . n 
B 2 73 PRO 73 73 73 PRO PRO B . n 
B 2 74 GLY 74 74 74 GLY GLY B . n 
C 3 1  TRP 1  1  1  TRP TRP C . n 
C 3 2  ARG 2  2  2  ARG ARG C . n 
C 3 3  TYR 3  3  3  TYR TYR C . n 
C 3 4  TYR 4  4  4  TYR TYR C . n 
C 3 5  GLU 5  5  5  GLU GLU C . n 
C 3 6  SER 6  6  6  SER SER C . n 
C 3 7  SER 7  7  7  SER SER C . n 
C 3 8  LEU 8  8  8  LEU LEU C . n 
C 3 9  LEU 9  9  9  LEU LEU C . n 
C 3 10 PRO 10 10 10 PRO PRO C . n 
C 3 11 TYR 11 11 11 TYR TYR C . n 
C 3 12 PRO 12 12 12 PRO PRO C . n 
C 3 13 ASP 13 13 13 ASP ASP C . n 
D 3 1  TRP 1  1  1  TRP TRP D . n 
D 3 2  ARG 2  2  2  ARG ARG D . n 
D 3 3  TYR 3  3  3  TYR TYR D . n 
D 3 4  TYR 4  4  4  TYR TYR D . n 
D 3 5  GLU 5  5  5  GLU GLU D . n 
D 3 6  SER 6  6  6  SER SER D . n 
D 3 7  SER 7  7  7  SER SER D . n 
D 3 8  LEU 8  8  8  LEU LEU D . n 
D 3 9  LEU 9  9  9  LEU LEU D . n 
D 3 10 PRO 10 10 10 PRO PRO D . n 
D 3 11 TYR 11 11 11 TYR TYR D . n 
D 3 12 PRO 12 12 12 PRO PRO D . n 
D 3 13 ASP 13 13 ?  ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 IOD 1  1075 1075 IOD IOD A . 
F 4 IOD 1  1075 1075 IOD IOD B . 
G 5 HOH 1  2001 2001 HOH HOH A . 
G 5 HOH 2  2002 2002 HOH HOH A . 
G 5 HOH 3  2003 2003 HOH HOH A . 
G 5 HOH 4  2004 2004 HOH HOH A . 
G 5 HOH 5  2005 2005 HOH HOH A . 
G 5 HOH 6  2006 2006 HOH HOH A . 
G 5 HOH 7  2007 2007 HOH HOH A . 
G 5 HOH 8  2008 2008 HOH HOH A . 
G 5 HOH 9  2009 2009 HOH HOH A . 
G 5 HOH 10 2010 2010 HOH HOH A . 
G 5 HOH 11 2011 2011 HOH HOH A . 
G 5 HOH 12 2012 2012 HOH HOH A . 
G 5 HOH 13 2013 2013 HOH HOH A . 
G 5 HOH 14 2014 2014 HOH HOH A . 
G 5 HOH 15 2015 2015 HOH HOH A . 
G 5 HOH 16 2016 2016 HOH HOH A . 
G 5 HOH 17 2017 2017 HOH HOH A . 
G 5 HOH 18 2018 2018 HOH HOH A . 
G 5 HOH 19 2019 2019 HOH HOH A . 
G 5 HOH 20 2020 2020 HOH HOH A . 
G 5 HOH 21 2021 2021 HOH HOH A . 
G 5 HOH 22 2022 2022 HOH HOH A . 
G 5 HOH 23 2023 2023 HOH HOH A . 
G 5 HOH 24 2024 2024 HOH HOH A . 
G 5 HOH 25 2025 2025 HOH HOH A . 
G 5 HOH 26 2026 2026 HOH HOH A . 
G 5 HOH 27 2027 2027 HOH HOH A . 
G 5 HOH 28 2028 2028 HOH HOH A . 
G 5 HOH 29 2029 2029 HOH HOH A . 
G 5 HOH 30 2030 2030 HOH HOH A . 
G 5 HOH 31 2031 2031 HOH HOH A . 
G 5 HOH 32 2032 2032 HOH HOH A . 
G 5 HOH 33 2033 2033 HOH HOH A . 
G 5 HOH 34 2034 2034 HOH HOH A . 
G 5 HOH 35 2035 2035 HOH HOH A . 
G 5 HOH 36 2036 2036 HOH HOH A . 
G 5 HOH 37 2037 2037 HOH HOH A . 
G 5 HOH 38 2038 2038 HOH HOH A . 
G 5 HOH 39 2039 2039 HOH HOH A . 
G 5 HOH 40 2040 2040 HOH HOH A . 
G 5 HOH 41 2041 2041 HOH HOH A . 
G 5 HOH 42 2042 2042 HOH HOH A . 
G 5 HOH 43 2043 2043 HOH HOH A . 
G 5 HOH 44 2044 2044 HOH HOH A . 
G 5 HOH 45 2045 2045 HOH HOH A . 
G 5 HOH 46 2046 2046 HOH HOH A . 
G 5 HOH 47 2047 2047 HOH HOH A . 
G 5 HOH 48 2048 2048 HOH HOH A . 
G 5 HOH 49 2049 2049 HOH HOH A . 
G 5 HOH 50 2050 2050 HOH HOH A . 
G 5 HOH 51 2051 2051 HOH HOH A . 
G 5 HOH 52 2052 2052 HOH HOH A . 
G 5 HOH 53 2053 2053 HOH HOH A . 
G 5 HOH 54 2054 2054 HOH HOH A . 
G 5 HOH 55 2055 2055 HOH HOH A . 
G 5 HOH 56 2056 2056 HOH HOH A . 
G 5 HOH 57 2057 2057 HOH HOH A . 
G 5 HOH 58 2058 2058 HOH HOH A . 
G 5 HOH 59 2059 2059 HOH HOH A . 
G 5 HOH 60 2060 2060 HOH HOH A . 
G 5 HOH 61 2061 2061 HOH HOH A . 
G 5 HOH 62 2062 2062 HOH HOH A . 
G 5 HOH 63 2063 2063 HOH HOH A . 
G 5 HOH 64 2064 2064 HOH HOH A . 
G 5 HOH 65 2065 2065 HOH HOH A . 
G 5 HOH 66 2066 2066 HOH HOH A . 
G 5 HOH 67 2067 2067 HOH HOH A . 
G 5 HOH 68 2068 2068 HOH HOH A . 
G 5 HOH 69 2069 2069 HOH HOH A . 
G 5 HOH 70 2070 2070 HOH HOH A . 
G 5 HOH 71 2071 2071 HOH HOH A . 
G 5 HOH 72 2072 2072 HOH HOH A . 
G 5 HOH 73 2073 2073 HOH HOH A . 
G 5 HOH 74 2074 2074 HOH HOH A . 
G 5 HOH 75 2075 2075 HOH HOH A . 
G 5 HOH 76 2076 2076 HOH HOH A . 
G 5 HOH 77 2077 2077 HOH HOH A . 
G 5 HOH 78 2078 2078 HOH HOH A . 
G 5 HOH 79 2079 2079 HOH HOH A . 
G 5 HOH 80 2080 2080 HOH HOH A . 
G 5 HOH 81 2081 2081 HOH HOH A . 
G 5 HOH 82 2082 2082 HOH HOH A . 
G 5 HOH 83 2083 2083 HOH HOH A . 
G 5 HOH 84 2084 2084 HOH HOH A . 
G 5 HOH 85 2085 2085 HOH HOH A . 
G 5 HOH 86 2086 2086 HOH HOH A . 
G 5 HOH 87 2087 2087 HOH HOH A . 
G 5 HOH 88 2088 2088 HOH HOH A . 
G 5 HOH 89 2089 2089 HOH HOH A . 
G 5 HOH 90 2090 2090 HOH HOH A . 
G 5 HOH 91 2091 2091 HOH HOH A . 
G 5 HOH 92 2092 2092 HOH HOH A . 
H 5 HOH 1  2001 2001 HOH HOH B . 
H 5 HOH 2  2002 2002 HOH HOH B . 
H 5 HOH 3  2003 2003 HOH HOH B . 
H 5 HOH 4  2004 2004 HOH HOH B . 
H 5 HOH 5  2005 2005 HOH HOH B . 
H 5 HOH 6  2006 2006 HOH HOH B . 
H 5 HOH 7  2007 2007 HOH HOH B . 
H 5 HOH 8  2008 2008 HOH HOH B . 
H 5 HOH 9  2009 2009 HOH HOH B . 
H 5 HOH 10 2010 2010 HOH HOH B . 
H 5 HOH 11 2011 2011 HOH HOH B . 
H 5 HOH 12 2012 2012 HOH HOH B . 
H 5 HOH 13 2013 2013 HOH HOH B . 
H 5 HOH 14 2014 2014 HOH HOH B . 
H 5 HOH 15 2015 2015 HOH HOH B . 
H 5 HOH 16 2016 2016 HOH HOH B . 
H 5 HOH 17 2017 2017 HOH HOH B . 
H 5 HOH 18 2018 2018 HOH HOH B . 
H 5 HOH 19 2019 2019 HOH HOH B . 
H 5 HOH 20 2020 2020 HOH HOH B . 
H 5 HOH 21 2021 2021 HOH HOH B . 
H 5 HOH 22 2022 2022 HOH HOH B . 
H 5 HOH 23 2023 2023 HOH HOH B . 
H 5 HOH 24 2024 2024 HOH HOH B . 
H 5 HOH 25 2025 2025 HOH HOH B . 
H 5 HOH 26 2026 2026 HOH HOH B . 
H 5 HOH 27 2027 2027 HOH HOH B . 
H 5 HOH 28 2028 2028 HOH HOH B . 
H 5 HOH 29 2029 2029 HOH HOH B . 
H 5 HOH 30 2030 2030 HOH HOH B . 
H 5 HOH 31 2031 2031 HOH HOH B . 
H 5 HOH 32 2032 2032 HOH HOH B . 
H 5 HOH 33 2033 2033 HOH HOH B . 
H 5 HOH 34 2034 2034 HOH HOH B . 
H 5 HOH 35 2035 2035 HOH HOH B . 
H 5 HOH 36 2036 2036 HOH HOH B . 
H 5 HOH 37 2037 2037 HOH HOH B . 
H 5 HOH 38 2038 2038 HOH HOH B . 
H 5 HOH 39 2039 2039 HOH HOH B . 
H 5 HOH 40 2040 2040 HOH HOH B . 
H 5 HOH 41 2041 2041 HOH HOH B . 
H 5 HOH 42 2042 2042 HOH HOH B . 
H 5 HOH 43 2043 2043 HOH HOH B . 
H 5 HOH 44 2044 2044 HOH HOH B . 
H 5 HOH 45 2045 2045 HOH HOH B . 
H 5 HOH 46 2046 2046 HOH HOH B . 
H 5 HOH 47 2047 2047 HOH HOH B . 
H 5 HOH 48 2048 2048 HOH HOH B . 
H 5 HOH 49 2049 2049 HOH HOH B . 
H 5 HOH 50 2050 2050 HOH HOH B . 
H 5 HOH 51 2051 2051 HOH HOH B . 
H 5 HOH 52 2052 2052 HOH HOH B . 
H 5 HOH 53 2053 2053 HOH HOH B . 
H 5 HOH 54 2054 2054 HOH HOH B . 
H 5 HOH 55 2055 2055 HOH HOH B . 
H 5 HOH 56 2056 2056 HOH HOH B . 
H 5 HOH 57 2057 2057 HOH HOH B . 
H 5 HOH 58 2058 2058 HOH HOH B . 
H 5 HOH 59 2059 2059 HOH HOH B . 
H 5 HOH 60 2060 2060 HOH HOH B . 
H 5 HOH 61 2061 2061 HOH HOH B . 
H 5 HOH 62 2062 2062 HOH HOH B . 
H 5 HOH 63 2063 2063 HOH HOH B . 
H 5 HOH 64 2064 2064 HOH HOH B . 
H 5 HOH 65 2065 2065 HOH HOH B . 
H 5 HOH 66 2066 2066 HOH HOH B . 
H 5 HOH 67 2067 2067 HOH HOH B . 
H 5 HOH 68 2068 2068 HOH HOH B . 
H 5 HOH 69 2069 2069 HOH HOH B . 
H 5 HOH 70 2070 2070 HOH HOH B . 
H 5 HOH 71 2071 2071 HOH HOH B . 
H 5 HOH 72 2072 2072 HOH HOH B . 
H 5 HOH 73 2073 2073 HOH HOH B . 
H 5 HOH 74 2074 2074 HOH HOH B . 
H 5 HOH 75 2075 2075 HOH HOH B . 
H 5 HOH 76 2076 2076 HOH HOH B . 
H 5 HOH 77 2077 2077 HOH HOH B . 
H 5 HOH 78 2078 2078 HOH HOH B . 
H 5 HOH 79 2079 2079 HOH HOH B . 
H 5 HOH 80 2080 2080 HOH HOH B . 
H 5 HOH 81 2081 2081 HOH HOH B . 
H 5 HOH 82 2082 2082 HOH HOH B . 
H 5 HOH 83 2083 2083 HOH HOH B . 
H 5 HOH 84 2084 2084 HOH HOH B . 
H 5 HOH 85 2085 2085 HOH HOH B . 
H 5 HOH 86 2086 2086 HOH HOH B . 
H 5 HOH 87 2087 2087 HOH HOH B . 
H 5 HOH 88 2088 2088 HOH HOH B . 
H 5 HOH 89 2089 2089 HOH HOH B . 
I 5 HOH 1  2001 2001 HOH HOH C . 
I 5 HOH 2  2002 2002 HOH HOH C . 
I 5 HOH 3  2003 2003 HOH HOH C . 
I 5 HOH 4  2004 2004 HOH HOH C . 
I 5 HOH 5  2005 2005 HOH HOH C . 
I 5 HOH 6  2006 2006 HOH HOH C . 
I 5 HOH 7  2007 2007 HOH HOH C . 
I 5 HOH 8  2008 2008 HOH HOH C . 
I 5 HOH 9  2009 2009 HOH HOH C . 
I 5 HOH 10 2010 2010 HOH HOH C . 
I 5 HOH 11 2011 2011 HOH HOH C . 
I 5 HOH 12 2012 2012 HOH HOH C . 
I 5 HOH 13 2013 2013 HOH HOH C . 
I 5 HOH 14 2014 2014 HOH HOH C . 
I 5 HOH 15 2015 2015 HOH HOH C . 
I 5 HOH 16 2016 2016 HOH HOH C . 
I 5 HOH 17 2017 2017 HOH HOH C . 
J 5 HOH 1  2001 2001 HOH HOH D . 
J 5 HOH 2  2002 2002 HOH HOH D . 
J 5 HOH 3  2003 2003 HOH HOH D . 
J 5 HOH 4  2004 2004 HOH HOH D . 
J 5 HOH 5  2005 2005 HOH HOH D . 
J 5 HOH 6  2006 2006 HOH HOH D . 
J 5 HOH 7  2007 2007 HOH HOH D . 
J 5 HOH 8  2008 2008 HOH HOH D . 
J 5 HOH 9  2009 2009 HOH HOH D . 
J 5 HOH 10 2010 2010 HOH HOH D . 
J 5 HOH 11 2011 2011 HOH HOH D . 
J 5 HOH 12 2012 2012 HOH HOH D . 
J 5 HOH 13 2013 2013 HOH HOH D . 
J 5 HOH 14 2014 2014 HOH HOH D . 
J 5 HOH 15 2015 2015 HOH HOH D . 
J 5 HOH 16 2016 2016 HOH HOH D . 
J 5 HOH 17 2017 2017 HOH HOH D . 
J 5 HOH 18 2018 2018 HOH HOH D . 
J 5 HOH 19 2019 2019 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,I 
2 1 B,D,F,H,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1510 ? 
1 MORE         -9.9 ? 
1 'SSA (A^2)'  6220 ? 
2 'ABSA (A^2)' 1480 ? 
2 MORE         -9.4 ? 
2 'SSA (A^2)'  5930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-10 
2 'Structure model' 1 1 2012-06-20 
3 'Structure model' 1 2 2012-12-19 
4 'Structure model' 1 3 2017-03-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'       
2  2 'Structure model' 'Derived calculations'      
3  2 'Structure model' 'Non-polymer description'   
4  2 'Structure model' Other                       
5  2 'Structure model' 'Refinement description'    
6  2 'Structure model' 'Source and taxonomy'       
7  2 'Structure model' 'Structure summary'         
8  2 'Structure model' 'Version format compliance' 
9  3 'Structure model' 'Database references'       
10 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
MOLREP    phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             1HC9 
_pdbx_entry_details.compound_details     
;THE PEPTIDE BINDS ALPHA-BUNGAROTOXIN AND MIMICKS BINDING
 OF THE TOXIN TO THE NICOTINIC ACETYLCHOLINE RECEPTOR.
 RESIDUES A31 IS SEEN AS VAL WITH OCCUPANCY 0.3 AND ALA
 WITH OCCUPANCY 0.7, ACCORDING TO A WELL KNOWN MUTATION OF
 ALPHA-BUNGAROTOXIN
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 30 ? ? -120.12 -164.36 
2 1 ASP A 30 ? ? -120.12 -164.62 
3 1 TYR A 54 ? ? -105.79 42.79   
4 1 ASN A 66 ? ? -114.65 56.49   
5 1 ASN B 66 ? ? -118.41 57.22   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2002 ? 6.64 . 
2  1 O ? A HOH 2015 ? 6.81 . 
3  1 O ? A HOH 2021 ? 6.61 . 
4  1 O ? B HOH 2005 ? 5.94 . 
5  1 O ? B HOH 2006 ? 7.65 . 
6  1 O ? B HOH 2008 ? 6.68 . 
7  1 O ? B HOH 2009 ? 6.40 . 
8  1 O ? D HOH 2002 ? 6.55 . 
9  1 O ? D HOH 2003 ? 6.94 . 
10 1 O ? D HOH 2012 ? 6.21 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A VAL 31 ? CG1 B A VAL 31 CG1 
2 1 Y 0 A VAL 31 ? CG2 B A VAL 31 CG2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     D 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ASP 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      13 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    D 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ASP 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     13 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'IODIDE ION' IOD 
5 water        HOH 
#