data_1HCR
# 
_entry.id   1HCR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HCR         
RCSB  PDE009       
WWPDB D_1000173783 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HCR 
_pdbx_database_status.recvd_initial_deposition_date   1993-12-17 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Feng, J.-A.'     1 
'Johnson, R.C.'   2 
'Dickerson, R.E.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Hin recombinase bound to DNA: the origin of specificity in major and minor groove interactions.' Science     263 348 355 
1994 SCIEAS US 0036-8075 0038 ? 8278807 ? 
1       
'Crystallization and Prelimanary X-Ray Analysis of the DNA Binding Domain of the Hin Recombinase with its DNA Binding Site' 
J.Mol.Biol. 232 982 986 1993 JMOBAK UK 0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Feng, J.A.'      1 
primary 'Johnson, R.C.'   2 
primary 'Dickerson, R.E.' 3 
1       'Feng, J.-A.'     4 
1       'Simon, M.'       5 
1       'Mack, D.P.'      6 
1       'Dervan, P.B.'    7 
1       'Johnson, R.C.'   8 
1       'Dickerson, R.E.' 9 
# 
_cell.entry_id           1HCR 
_cell.length_a           84.920 
_cell.length_b           81.370 
_cell.length_c           44.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HCR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 
;DNA (5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*TP*AP*AP*GP*A)-3')
;
4324.836 1  ? ? ? ? 
2 polymer man 
;DNA (5'-D(*TP*CP*TP*TP*AP*TP*CP*AP*AP*AP*AP*AP*C)-3')
;
3918.599 1  ? ? ? ? 
3 polymer man 'PROTEIN (HIN RECOMBINASE)'                                6047.051 1  ? ? ? ? 
4 water   nat water                                                      18.015   16 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DA)(DA)(DG)(DA)' TGTTTTTGATAAGA B ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DT)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DA)(DC)'     TCTTATCAAAAAC C ? 
3 'polypeptide(L)'        no no GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN       
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DG  n 
1 3  DT  n 
1 4  DT  n 
1 5  DT  n 
1 6  DT  n 
1 7  DT  n 
1 8  DG  n 
1 9  DA  n 
1 10 DT  n 
1 11 DA  n 
1 12 DA  n 
1 13 DG  n 
1 14 DA  n 
2 1  DT  n 
2 2  DC  n 
2 3  DT  n 
2 4  DT  n 
2 5  DA  n 
2 6  DT  n 
2 7  DC  n 
2 8  DA  n 
2 9  DA  n 
2 10 DA  n 
2 11 DA  n 
2 12 DA  n 
2 13 DC  n 
3 1  GLY n 
3 2  ARG n 
3 3  PRO n 
3 4  ARG n 
3 5  ALA n 
3 6  ILE n 
3 7  ASN n 
3 8  LYS n 
3 9  HIS n 
3 10 GLU n 
3 11 GLN n 
3 12 GLU n 
3 13 GLN n 
3 14 ILE n 
3 15 SER n 
3 16 ARG n 
3 17 LEU n 
3 18 LEU n 
3 19 GLU n 
3 20 LYS n 
3 21 GLY n 
3 22 HIS n 
3 23 PRO n 
3 24 ARG n 
3 25 GLN n 
3 26 GLN n 
3 27 LEU n 
3 28 ALA n 
3 29 ILE n 
3 30 ILE n 
3 31 PHE n 
3 32 GLY n 
3 33 ILE n 
3 34 GLY n 
3 35 VAL n 
3 36 SER n 
3 37 THR n 
3 38 LEU n 
3 39 TYR n 
3 40 ARG n 
3 41 TYR n 
3 42 PHE n 
3 43 PRO n 
3 44 ALA n 
3 45 SER n 
3 46 SER n 
3 47 ILE n 
3 48 LYS n 
3 49 LYS n 
3 50 ARG n 
3 51 MET n 
3 52 ASN n 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HIN_SALTY 3 ? ? P03013 ? 
2 PDB 1HCR      1 ? ? 1HCR   ? 
3 PDB 1HCR      2 ? ? 1HCR   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HCR A 1 ? 52 ? P03013 139 ? 190 ? 139 190 
2 2 1HCR B 1 ? 14 ? 1HCR   2   ? 15  ? 2   15  
3 3 1HCR C 1 ? 13 ? 1HCR   17  ? 29  ? 17  29  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1HCR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   53.79 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 WATER      ? ? ? 
1 2 1 'PEG 1500' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           123.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1HCR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   2.000 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   5346 
_reflns.number_all                   17839 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1HCR 
_refine.ls_number_reflns_obs                     5346 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.000 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2280000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2280000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THIS COORDINATE SET IS PRELIMINARY. REFINEMENT IS STILL IN PROGRESS.

RESIDUES SER 183 AND SER 184 ARE POORLY DEFINED IN THE
ELECTRON DENSITY MAP.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        426 
_refine_hist.pdbx_number_atoms_nucleic_acid   547 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             16 
_refine_hist.number_atoms_total               989 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        8.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.97  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1HCR 
_struct.title                     'HIN RECOMBINASE BOUND TO DNA: THE ORIGIN OF SPECIFICITY IN MAJOR AND MINOR GROOVE INTERACTIONS' 
_struct.pdbx_descriptor           'HIN RECOMBINASE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HCR 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS C 8  ? LYS C 20 ? LYS A 146 LYS A 158 1 ? 13 
HELX_P HELX_P2 2 PRO C 23 ? PHE C 31 ? PRO A 161 PHE A 169 1 ? 9  
HELX_P HELX_P3 3 GLY C 34 ? PHE C 42 ? GLY A 172 PHE A 180 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 1  O4 ? ? ? 1_555 A DG 2  N2 ? ? B DT 2  B DG 3  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog2  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 13 N3 ? ? B DG 3  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 13 O2 ? ? B DG 3  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 13 N4 ? ? B DG 3  C DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 12 N1 ? ? B DT 4  C DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 12 N6 ? ? B DT 4  C DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 11 N1 ? ? B DT 5  C DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 11 N6 ? ? B DT 5  C DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 10 N1 ? ? B DT 6  C DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 10 N6 ? ? B DT 6  C DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 9  N1 ? ? B DT 7  C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 9  N6 ? ? B DT 7  C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 8  N1 ? ? B DT 8  C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 8  N6 ? ? B DT 8  C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 7  N3 ? ? B DG 9  C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 7  O2 ? ? B DG 9  C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 7  N4 ? ? B DG 9  C DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 10 C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 10 C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 5  N1 ? ? B DT 11 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 5  N6 ? ? B DT 11 C DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 4  N3 ? ? B DA 12 C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 4  O4 ? ? B DA 12 C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 3  N3 ? ? B DA 13 C DT 19 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog25 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 2  N3 ? ? B DG 14 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 2  O2 ? ? B DG 14 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 2  N4 ? ? B DG 14 C DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 1  N3 ? ? B DA 15 C DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 1  O4 ? ? B DA 15 C DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? A DG 2  N1 ? ? ? 1_555 A DT 1  O2 ? ? B DG 3  B DT 2  3_756 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HCR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HCR 
_atom_sites.fract_transf_matrix[1][1]   0.011776 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012290 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022707 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'LYS A 186 - LYS A 187 OMEGA =148.79 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   O "O5'" . DT  A 1 1  ? 82.751 55.544 42.340 1.00 61.01 ? 2   DT  B "O5'" 1 
ATOM   2   C "C5'" . DT  A 1 1  ? 84.196 55.371 42.203 1.00 61.63 ? 2   DT  B "C5'" 1 
ATOM   3   C "C4'" . DT  A 1 1  ? 84.734 55.746 40.758 1.00 68.54 ? 2   DT  B "C4'" 1 
ATOM   4   O "O4'" . DT  A 1 1  ? 84.529 57.110 40.328 1.00 63.17 ? 2   DT  B "O4'" 1 
ATOM   5   C "C3'" . DT  A 1 1  ? 86.170 55.318 40.248 1.00 69.18 ? 2   DT  B "C3'" 1 
ATOM   6   O "O3'" . DT  A 1 1  ? 86.067 53.958 39.689 1.00 74.56 ? 2   DT  B "O3'" 1 
ATOM   7   C "C2'" . DT  A 1 1  ? 86.451 56.431 39.205 1.00 61.15 ? 2   DT  B "C2'" 1 
ATOM   8   C "C1'" . DT  A 1 1  ? 85.070 56.970 39.018 1.00 61.65 ? 2   DT  B "C1'" 1 
ATOM   9   N N1    . DT  A 1 1  ? 84.627 57.930 38.002 1.00 56.67 ? 2   DT  B N1    1 
ATOM   10  C C2    . DT  A 1 1  ? 84.603 57.558 36.657 1.00 55.17 ? 2   DT  B C2    1 
ATOM   11  O O2    . DT  A 1 1  ? 84.958 56.506 36.182 1.00 59.72 ? 2   DT  B O2    1 
ATOM   12  N N3    . DT  A 1 1  ? 84.161 58.428 35.769 1.00 43.90 ? 2   DT  B N3    1 
ATOM   13  C C4    . DT  A 1 1  ? 83.728 59.666 36.091 1.00 51.15 ? 2   DT  B C4    1 
ATOM   14  O O4    . DT  A 1 1  ? 83.400 60.376 35.143 1.00 62.50 ? 2   DT  B O4    1 
ATOM   15  C C5    . DT  A 1 1  ? 83.765 60.008 37.525 1.00 50.82 ? 2   DT  B C5    1 
ATOM   16  C C7    . DT  A 1 1  ? 83.274 61.356 38.097 1.00 49.97 ? 2   DT  B C7    1 
ATOM   17  C C6    . DT  A 1 1  ? 84.212 59.132 38.405 1.00 49.10 ? 2   DT  B C6    1 
ATOM   18  P P     . DG  A 1 2  ? 86.670 53.309 38.299 1.00 82.17 ? 3   DG  B P     1 
ATOM   19  O OP1   . DG  A 1 2  ? 86.397 51.843 38.342 1.00 71.52 ? 3   DG  B OP1   1 
ATOM   20  O OP2   . DG  A 1 2  ? 88.064 53.797 38.124 1.00 80.51 ? 3   DG  B OP2   1 
ATOM   21  O "O5'" . DG  A 1 2  ? 85.744 53.987 37.145 1.00 74.16 ? 3   DG  B "O5'" 1 
ATOM   22  C "C5'" . DG  A 1 2  ? 85.018 53.251 36.129 1.00 64.73 ? 3   DG  B "C5'" 1 
ATOM   23  C "C4'" . DG  A 1 2  ? 83.561 53.725 35.916 1.00 52.66 ? 3   DG  B "C4'" 1 
ATOM   24  O "O4'" . DG  A 1 2  ? 83.216 54.734 34.925 1.00 46.96 ? 3   DG  B "O4'" 1 
ATOM   25  C "C3'" . DG  A 1 2  ? 82.776 52.494 35.590 1.00 52.28 ? 3   DG  B "C3'" 1 
ATOM   26  O "O3'" . DG  A 1 2  ? 81.551 52.818 36.295 1.00 59.76 ? 3   DG  B "O3'" 1 
ATOM   27  C "C2'" . DG  A 1 2  ? 82.792 52.543 34.063 1.00 33.94 ? 3   DG  B "C2'" 1 
ATOM   28  C "C1'" . DG  A 1 2  ? 82.460 54.005 33.925 1.00 43.55 ? 3   DG  B "C1'" 1 
ATOM   29  N N9    . DG  A 1 2  ? 82.184 54.577 32.574 1.00 44.72 ? 3   DG  B N9    1 
ATOM   30  C C8    . DG  A 1 2  ? 81.615 53.930 31.502 1.00 47.90 ? 3   DG  B C8    1 
ATOM   31  N N7    . DG  A 1 2  ? 81.415 54.671 30.451 1.00 49.35 ? 3   DG  B N7    1 
ATOM   32  C C5    . DG  A 1 2  ? 81.892 55.920 30.832 1.00 52.03 ? 3   DG  B C5    1 
ATOM   33  C C6    . DG  A 1 2  ? 81.926 57.138 30.085 1.00 48.38 ? 3   DG  B C6    1 
ATOM   34  O O6    . DG  A 1 2  ? 81.540 57.380 28.939 1.00 39.39 ? 3   DG  B O6    1 
ATOM   35  N N1    . DG  A 1 2  ? 82.473 58.156 30.841 1.00 45.61 ? 3   DG  B N1    1 
ATOM   36  C C2    . DG  A 1 2  ? 82.929 58.041 32.150 1.00 48.92 ? 3   DG  B C2    1 
ATOM   37  N N2    . DG  A 1 2  ? 83.392 59.145 32.715 1.00 39.75 ? 3   DG  B N2    1 
ATOM   38  N N3    . DG  A 1 2  ? 82.905 56.909 32.868 1.00 45.78 ? 3   DG  B N3    1 
ATOM   39  C C4    . DG  A 1 2  ? 82.370 55.881 32.139 1.00 46.42 ? 3   DG  B C4    1 
ATOM   40  P P     . DT  A 1 3  ? 81.238 53.019 37.936 1.00 70.01 ? 4   DT  B P     1 
ATOM   41  O OP1   . DT  A 1 3  ? 81.687 51.806 38.676 1.00 68.03 ? 4   DT  B OP1   1 
ATOM   42  O OP2   . DT  A 1 3  ? 79.795 53.339 37.920 1.00 70.92 ? 4   DT  B OP2   1 
ATOM   43  O "O5'" . DT  A 1 3  ? 81.971 54.265 38.707 1.00 61.50 ? 4   DT  B "O5'" 1 
ATOM   44  C "C5'" . DT  A 1 3  ? 81.204 55.343 39.227 1.00 50.65 ? 4   DT  B "C5'" 1 
ATOM   45  C "C4'" . DT  A 1 3  ? 81.419 56.612 38.411 1.00 47.76 ? 4   DT  B "C4'" 1 
ATOM   46  O "O4'" . DT  A 1 3  ? 81.181 56.491 37.021 1.00 45.81 ? 4   DT  B "O4'" 1 
ATOM   47  C "C3'" . DT  A 1 3  ? 80.378 57.569 38.823 1.00 47.46 ? 4   DT  B "C3'" 1 
ATOM   48  O "O3'" . DT  A 1 3  ? 80.828 58.174 40.043 1.00 56.75 ? 4   DT  B "O3'" 1 
ATOM   49  C "C2'" . DT  A 1 3  ? 80.291 58.491 37.625 1.00 44.18 ? 4   DT  B "C2'" 1 
ATOM   50  C "C1'" . DT  A 1 3  ? 80.888 57.799 36.497 1.00 36.77 ? 4   DT  B "C1'" 1 
ATOM   51  N N1    . DT  A 1 3  ? 80.195 57.786 35.170 1.00 32.08 ? 4   DT  B N1    1 
ATOM   52  C C2    . DT  A 1 3  ? 80.168 58.912 34.321 1.00 38.54 ? 4   DT  B C2    1 
ATOM   53  O O2    . DT  A 1 3  ? 80.537 60.055 34.602 1.00 40.82 ? 4   DT  B O2    1 
ATOM   54  N N3    . DT  A 1 3  ? 79.608 58.735 33.070 1.00 35.65 ? 4   DT  B N3    1 
ATOM   55  C C4    . DT  A 1 3  ? 79.060 57.571 32.574 1.00 41.16 ? 4   DT  B C4    1 
ATOM   56  O O4    . DT  A 1 3  ? 78.584 57.489 31.445 1.00 45.53 ? 4   DT  B O4    1 
ATOM   57  C C5    . DT  A 1 3  ? 79.115 56.493 33.505 1.00 41.01 ? 4   DT  B C5    1 
ATOM   58  C C7    . DT  A 1 3  ? 78.521 55.172 33.057 1.00 47.58 ? 4   DT  B C7    1 
ATOM   59  C C6    . DT  A 1 3  ? 79.659 56.618 34.734 1.00 34.77 ? 4   DT  B C6    1 
ATOM   60  P P     . DT  A 1 4  ? 79.784 58.571 41.201 1.00 59.46 ? 5   DT  B P     1 
ATOM   61  O OP1   . DT  A 1 4  ? 80.472 58.975 42.450 1.00 59.68 ? 5   DT  B OP1   1 
ATOM   62  O OP2   . DT  A 1 4  ? 78.760 57.503 41.257 1.00 60.77 ? 5   DT  B OP2   1 
ATOM   63  O "O5'" . DT  A 1 4  ? 79.112 59.865 40.548 1.00 60.22 ? 5   DT  B "O5'" 1 
ATOM   64  C "C5'" . DT  A 1 4  ? 79.839 61.039 40.139 1.00 56.63 ? 5   DT  B "C5'" 1 
ATOM   65  C "C4'" . DT  A 1 4  ? 79.130 61.765 38.949 1.00 55.27 ? 5   DT  B "C4'" 1 
ATOM   66  O "O4'" . DT  A 1 4  ? 78.627 60.802 38.034 1.00 53.64 ? 5   DT  B "O4'" 1 
ATOM   67  C "C3'" . DT  A 1 4  ? 77.872 62.545 39.210 1.00 47.88 ? 5   DT  B "C3'" 1 
ATOM   68  O "O3'" . DT  A 1 4  ? 78.172 63.918 39.342 1.00 51.24 ? 5   DT  B "O3'" 1 
ATOM   69  C "C2'" . DT  A 1 4  ? 77.172 62.457 37.887 1.00 46.55 ? 5   DT  B "C2'" 1 
ATOM   70  C "C1'" . DT  A 1 4  ? 77.935 61.513 37.029 1.00 41.27 ? 5   DT  B "C1'" 1 
ATOM   71  N N1    . DT  A 1 4  ? 77.230 60.561 36.113 1.00 42.95 ? 5   DT  B N1    1 
ATOM   72  C C2    . DT  A 1 4  ? 76.892 61.000 34.827 1.00 45.80 ? 5   DT  B C2    1 
ATOM   73  O O2    . DT  A 1 4  ? 76.998 62.170 34.427 1.00 43.44 ? 5   DT  B O2    1 
ATOM   74  N N3    . DT  A 1 4  ? 76.365 60.038 33.987 1.00 39.06 ? 5   DT  B N3    1 
ATOM   75  C C4    . DT  A 1 4  ? 76.132 58.692 34.284 1.00 44.50 ? 5   DT  B C4    1 
ATOM   76  O O4    . DT  A 1 4  ? 75.709 57.905 33.425 1.00 44.06 ? 5   DT  B O4    1 
ATOM   77  C C5    . DT  A 1 4  ? 76.488 58.338 35.633 1.00 38.66 ? 5   DT  B C5    1 
ATOM   78  C C7    . DT  A 1 4  ? 76.242 56.919 36.074 1.00 43.99 ? 5   DT  B C7    1 
ATOM   79  C C6    . DT  A 1 4  ? 77.009 59.242 36.484 1.00 40.12 ? 5   DT  B C6    1 
ATOM   80  P P     . DT  A 1 5  ? 77.327 64.773 40.378 1.00 56.09 ? 6   DT  B P     1 
ATOM   81  O OP1   . DT  A 1 5  ? 78.263 65.802 40.907 1.00 60.55 ? 6   DT  B OP1   1 
ATOM   82  O OP2   . DT  A 1 5  ? 76.588 63.837 41.285 1.00 46.49 ? 6   DT  B OP2   1 
ATOM   83  O "O5'" . DT  A 1 5  ? 76.259 65.570 39.570 1.00 51.83 ? 6   DT  B "O5'" 1 
ATOM   84  C "C5'" . DT  A 1 5  ? 76.722 66.725 38.955 1.00 47.12 ? 6   DT  B "C5'" 1 
ATOM   85  C "C4'" . DT  A 1 5  ? 75.931 66.843 37.728 1.00 53.59 ? 6   DT  B "C4'" 1 
ATOM   86  O "O4'" . DT  A 1 5  ? 75.895 65.624 36.926 1.00 49.63 ? 6   DT  B "O4'" 1 
ATOM   87  C "C3'" . DT  A 1 5  ? 74.551 67.181 38.137 1.00 54.56 ? 6   DT  B "C3'" 1 
ATOM   88  O "O3'" . DT  A 1 5  ? 74.135 68.106 37.155 1.00 69.64 ? 6   DT  B "O3'" 1 
ATOM   89  C "C2'" . DT  A 1 5  ? 73.888 65.891 37.834 1.00 52.43 ? 6   DT  B "C2'" 1 
ATOM   90  C "C1'" . DT  A 1 5  ? 74.543 65.423 36.538 1.00 41.35 ? 6   DT  B "C1'" 1 
ATOM   91  N N1    . DT  A 1 5  ? 74.272 64.011 36.260 1.00 34.63 ? 6   DT  B N1    1 
ATOM   92  C C2    . DT  A 1 5  ? 74.294 63.548 34.968 1.00 39.06 ? 6   DT  B C2    1 
ATOM   93  O O2    . DT  A 1 5  ? 74.556 64.259 34.006 1.00 44.31 ? 6   DT  B O2    1 
ATOM   94  N N3    . DT  A 1 5  ? 74.018 62.208 34.793 1.00 32.31 ? 6   DT  B N3    1 
ATOM   95  C C4    . DT  A 1 5  ? 73.729 61.311 35.806 1.00 28.10 ? 6   DT  B C4    1 
ATOM   96  O O4    . DT  A 1 5  ? 73.504 60.136 35.561 1.00 42.69 ? 6   DT  B O4    1 
ATOM   97  C C5    . DT  A 1 5  ? 73.723 61.866 37.122 1.00 31.46 ? 6   DT  B C5    1 
ATOM   98  C C7    . DT  A 1 5  ? 73.394 61.003 38.331 1.00 21.73 ? 6   DT  B C7    1 
ATOM   99  C C6    . DT  A 1 5  ? 73.990 63.163 37.303 1.00 37.35 ? 6   DT  B C6    1 
ATOM   100 P P     . DT  A 1 6  ? 73.478 69.499 37.565 1.00 77.57 ? 7   DT  B P     1 
ATOM   101 O OP1   . DT  A 1 6  ? 74.447 70.599 37.247 1.00 73.85 ? 7   DT  B OP1   1 
ATOM   102 O OP2   . DT  A 1 6  ? 72.878 69.363 38.925 1.00 75.32 ? 7   DT  B OP2   1 
ATOM   103 O "O5'" . DT  A 1 6  ? 72.267 69.604 36.567 1.00 69.81 ? 7   DT  B "O5'" 1 
ATOM   104 C "C5'" . DT  A 1 6  ? 72.643 69.584 35.213 1.00 61.09 ? 7   DT  B "C5'" 1 
ATOM   105 C "C4'" . DT  A 1 6  ? 71.843 68.539 34.552 1.00 51.04 ? 7   DT  B "C4'" 1 
ATOM   106 O "O4'" . DT  A 1 6  ? 72.056 67.261 35.123 1.00 47.62 ? 7   DT  B "O4'" 1 
ATOM   107 C "C3'" . DT  A 1 6  ? 70.393 68.742 34.824 1.00 49.38 ? 7   DT  B "C3'" 1 
ATOM   108 O "O3'" . DT  A 1 6  ? 69.954 69.909 34.149 1.00 46.36 ? 7   DT  B "O3'" 1 
ATOM   109 C "C2'" . DT  A 1 6  ? 69.968 67.437 34.198 1.00 53.11 ? 7   DT  B "C2'" 1 
ATOM   110 C "C1'" . DT  A 1 6  ? 71.080 66.492 34.430 1.00 38.66 ? 7   DT  B "C1'" 1 
ATOM   111 N N1    . DT  A 1 6  ? 70.695 65.296 35.177 1.00 33.82 ? 7   DT  B N1    1 
ATOM   112 C C2    . DT  A 1 6  ? 70.445 64.178 34.409 1.00 33.09 ? 7   DT  B C2    1 
ATOM   113 O O2    . DT  A 1 6  ? 70.393 64.163 33.184 1.00 42.79 ? 7   DT  B O2    1 
ATOM   114 N N3    . DT  A 1 6  ? 70.191 63.036 35.092 1.00 21.47 ? 7   DT  B N3    1 
ATOM   115 C C4    . DT  A 1 6  ? 70.158 62.879 36.424 1.00 28.94 ? 7   DT  B C4    1 
ATOM   116 O O4    . DT  A 1 6  ? 69.968 61.759 36.873 1.00 36.05 ? 7   DT  B O4    1 
ATOM   117 C C5    . DT  A 1 6  ? 70.403 64.066 37.174 1.00 28.46 ? 7   DT  B C5    1 
ATOM   118 C C7    . DT  A 1 6  ? 70.370 63.915 38.677 1.00 29.52 ? 7   DT  B C7    1 
ATOM   119 C C6    . DT  A 1 6  ? 70.660 65.236 36.548 1.00 26.24 ? 7   DT  B C6    1 
ATOM   120 P P     . DT  A 1 7  ? 68.423 70.266 33.962 1.00 48.63 ? 8   DT  B P     1 
ATOM   121 O OP1   . DT  A 1 7  ? 68.364 71.573 33.280 1.00 47.02 ? 8   DT  B OP1   1 
ATOM   122 O OP2   . DT  A 1 7  ? 67.748 70.106 35.271 1.00 48.50 ? 8   DT  B OP2   1 
ATOM   123 O "O5'" . DT  A 1 7  ? 67.986 69.171 32.862 1.00 39.40 ? 8   DT  B "O5'" 1 
ATOM   124 C "C5'" . DT  A 1 7  ? 68.699 69.254 31.606 1.00 38.25 ? 8   DT  B "C5'" 1 
ATOM   125 C "C4'" . DT  A 1 7  ? 68.330 68.209 30.507 1.00 39.38 ? 8   DT  B "C4'" 1 
ATOM   126 O "O4'" . DT  A 1 7  ? 68.437 66.905 31.058 1.00 41.32 ? 8   DT  B "O4'" 1 
ATOM   127 C "C3'" . DT  A 1 7  ? 66.926 68.260 29.929 1.00 39.47 ? 8   DT  B "C3'" 1 
ATOM   128 O "O3'" . DT  A 1 7  ? 66.939 68.202 28.489 1.00 32.99 ? 8   DT  B "O3'" 1 
ATOM   129 C "C2'" . DT  A 1 7  ? 66.260 67.052 30.554 1.00 34.15 ? 8   DT  B "C2'" 1 
ATOM   130 C "C1'" . DT  A 1 7  ? 67.360 66.054 30.698 1.00 32.36 ? 8   DT  B "C1'" 1 
ATOM   131 N N1    . DT  A 1 7  ? 67.213 65.167 31.852 1.00 31.37 ? 8   DT  B N1    1 
ATOM   132 C C2    . DT  A 1 7  ? 67.190 63.840 31.620 1.00 30.30 ? 8   DT  B C2    1 
ATOM   133 O O2    . DT  A 1 7  ? 67.256 63.345 30.502 1.00 37.40 ? 8   DT  B O2    1 
ATOM   134 N N3    . DT  A 1 7  ? 67.065 63.064 32.725 1.00 30.84 ? 8   DT  B N3    1 
ATOM   135 C C4    . DT  A 1 7  ? 66.958 63.506 34.005 1.00 35.44 ? 8   DT  B C4    1 
ATOM   136 O O4    . DT  A 1 7  ? 66.840 62.704 34.916 1.00 42.13 ? 8   DT  B O4    1 
ATOM   137 C C5    . DT  A 1 7  ? 66.985 64.900 34.171 1.00 30.49 ? 8   DT  B C5    1 
ATOM   138 C C7    . DT  A 1 7  ? 66.841 65.486 35.567 1.00 33.79 ? 8   DT  B C7    1 
ATOM   139 C C6    . DT  A 1 7  ? 67.112 65.680 33.109 1.00 32.02 ? 8   DT  B C6    1 
ATOM   140 P P     . DG  A 1 8  ? 65.572 68.552 27.862 1.00 36.07 ? 9   DG  B P     1 
ATOM   141 O OP1   . DG  A 1 8  ? 65.685 68.858 26.425 1.00 35.20 ? 9   DG  B OP1   1 
ATOM   142 O OP2   . DG  A 1 8  ? 64.836 69.461 28.785 1.00 24.98 ? 9   DG  B OP2   1 
ATOM   143 O "O5'" . DG  A 1 8  ? 64.882 67.175 27.988 1.00 39.91 ? 9   DG  B "O5'" 1 
ATOM   144 C "C5'" . DG  A 1 8  ? 64.969 66.152 26.985 1.00 43.55 ? 9   DG  B "C5'" 1 
ATOM   145 C "C4'" . DG  A 1 8  ? 63.994 64.980 27.276 1.00 40.47 ? 9   DG  B "C4'" 1 
ATOM   146 O "O4'" . DG  A 1 8  ? 64.246 64.535 28.627 1.00 44.94 ? 9   DG  B "O4'" 1 
ATOM   147 C "C3'" . DG  A 1 8  ? 62.511 65.381 27.256 1.00 37.06 ? 9   DG  B "C3'" 1 
ATOM   148 O "O3'" . DG  A 1 8  ? 61.662 64.301 26.958 1.00 42.35 ? 9   DG  B "O3'" 1 
ATOM   149 C "C2'" . DG  A 1 8  ? 62.202 65.575 28.692 1.00 35.14 ? 9   DG  B "C2'" 1 
ATOM   150 C "C1'" . DG  A 1 8  ? 63.008 64.492 29.267 1.00 33.49 ? 9   DG  B "C1'" 1 
ATOM   151 N N9    . DG  A 1 8  ? 63.207 64.673 30.645 1.00 31.92 ? 9   DG  B N9    1 
ATOM   152 C C8    . DG  A 1 8  ? 63.309 65.792 31.361 1.00 27.00 ? 9   DG  B C8    1 
ATOM   153 N N7    . DG  A 1 8  ? 63.446 65.531 32.620 1.00 34.87 ? 9   DG  B N7    1 
ATOM   154 C C5    . DG  A 1 8  ? 63.432 64.168 32.712 1.00 28.37 ? 9   DG  B C5    1 
ATOM   155 C C6    . DG  A 1 8  ? 63.529 63.346 33.823 1.00 30.85 ? 9   DG  B C6    1 
ATOM   156 O O6    . DG  A 1 8  ? 63.723 63.699 34.978 1.00 41.75 ? 9   DG  B O6    1 
ATOM   157 N N1    . DG  A 1 8  ? 63.446 62.001 33.495 1.00 28.10 ? 9   DG  B N1    1 
ATOM   158 C C2    . DG  A 1 8  ? 63.295 61.518 32.228 1.00 29.29 ? 9   DG  B C2    1 
ATOM   159 N N2    . DG  A 1 8  ? 63.235 60.188 32.078 1.00 34.96 ? 9   DG  B N2    1 
ATOM   160 N N3    . DG  A 1 8  ? 63.211 62.315 31.163 1.00 30.97 ? 9   DG  B N3    1 
ATOM   161 C C4    . DG  A 1 8  ? 63.285 63.626 31.493 1.00 28.05 ? 9   DG  B C4    1 
ATOM   162 P P     . DA  A 1 9  ? 60.411 64.692 26.114 1.00 46.70 ? 10  DA  B P     1 
ATOM   163 O OP1   . DA  A 1 9  ? 60.815 64.892 24.676 1.00 41.63 ? 10  DA  B OP1   1 
ATOM   164 O OP2   . DA  A 1 9  ? 59.702 65.738 26.916 1.00 42.38 ? 10  DA  B OP2   1 
ATOM   165 O "O5'" . DA  A 1 9  ? 59.558 63.386 26.152 1.00 44.39 ? 10  DA  B "O5'" 1 
ATOM   166 C "C5'" . DA  A 1 9  ? 60.033 62.223 25.485 1.00 47.19 ? 10  DA  B "C5'" 1 
ATOM   167 C "C4'" . DA  A 1 9  ? 59.786 61.021 26.380 1.00 41.27 ? 10  DA  B "C4'" 1 
ATOM   168 O "O4'" . DA  A 1 9  ? 60.297 61.302 27.691 1.00 41.25 ? 10  DA  B "O4'" 1 
ATOM   169 C "C3'" . DA  A 1 9  ? 58.328 60.738 26.541 1.00 40.68 ? 10  DA  B "C3'" 1 
ATOM   170 O "O3'" . DA  A 1 9  ? 58.179 59.359 26.736 1.00 52.03 ? 10  DA  B "O3'" 1 
ATOM   171 C "C2'" . DA  A 1 9  ? 58.032 61.420 27.823 1.00 38.17 ? 10  DA  B "C2'" 1 
ATOM   172 C "C1'" . DA  A 1 9  ? 59.250 61.121 28.600 1.00 34.63 ? 10  DA  B "C1'" 1 
ATOM   173 N N9    . DA  A 1 9  ? 59.451 62.084 29.588 1.00 29.54 ? 10  DA  B N9    1 
ATOM   174 C C8    . DA  A 1 9  ? 59.567 63.429 29.433 1.00 37.48 ? 10  DA  B C8    1 
ATOM   175 N N7    . DA  A 1 9  ? 59.775 64.032 30.568 1.00 46.31 ? 10  DA  B N7    1 
ATOM   176 C C5    . DA  A 1 9  ? 59.793 63.009 31.520 1.00 41.67 ? 10  DA  B C5    1 
ATOM   177 C C6    . DA  A 1 9  ? 59.990 63.001 32.927 1.00 38.41 ? 10  DA  B C6    1 
ATOM   178 N N6    . DA  A 1 9  ? 60.230 64.132 33.596 1.00 42.24 ? 10  DA  B N6    1 
ATOM   179 N N1    . DA  A 1 9  ? 59.957 61.821 33.572 1.00 28.29 ? 10  DA  B N1    1 
ATOM   180 C C2    . DA  A 1 9  ? 59.742 60.748 32.826 1.00 40.96 ? 10  DA  B C2    1 
ATOM   181 N N3    . DA  A 1 9  ? 59.550 60.624 31.503 1.00 38.15 ? 10  DA  B N3    1 
ATOM   182 C C4    . DA  A 1 9  ? 59.589 61.815 30.905 1.00 31.96 ? 10  DA  B C4    1 
ATOM   183 P P     . DT  A 1 10 ? 56.964 58.560 26.093 1.00 60.99 ? 11  DT  B P     1 
ATOM   184 O OP1   . DT  A 1 10 ? 57.570 57.477 25.266 1.00 56.65 ? 11  DT  B OP1   1 
ATOM   185 O OP2   . DT  A 1 10 ? 56.042 59.531 25.454 1.00 63.52 ? 11  DT  B OP2   1 
ATOM   186 O "O5'" . DT  A 1 10 ? 56.255 57.980 27.426 1.00 54.17 ? 11  DT  B "O5'" 1 
ATOM   187 C "C5'" . DT  A 1 10 ? 57.024 57.313 28.443 1.00 52.12 ? 11  DT  B "C5'" 1 
ATOM   188 C "C4'" . DT  A 1 10 ? 56.632 57.786 29.840 1.00 51.11 ? 11  DT  B "C4'" 1 
ATOM   189 O "O4'" . DT  A 1 10 ? 56.949 59.138 30.131 1.00 45.63 ? 11  DT  B "O4'" 1 
ATOM   190 C "C3'" . DT  A 1 10 ? 55.140 57.814 29.922 1.00 55.32 ? 11  DT  B "C3'" 1 
ATOM   191 O "O3'" . DT  A 1 10 ? 54.602 56.633 30.547 1.00 63.32 ? 11  DT  B "O3'" 1 
ATOM   192 C "C2'" . DT  A 1 10 ? 54.840 59.119 30.631 1.00 48.59 ? 11  DT  B "C2'" 1 
ATOM   193 C "C1'" . DT  A 1 10 ? 56.119 59.506 31.243 1.00 33.34 ? 11  DT  B "C1'" 1 
ATOM   194 N N1    . DT  A 1 10 ? 56.190 60.960 31.520 1.00 34.38 ? 11  DT  B N1    1 
ATOM   195 C C2    . DT  A 1 10 ? 56.477 61.380 32.811 1.00 34.47 ? 11  DT  B C2    1 
ATOM   196 O O2    . DT  A 1 10 ? 56.647 60.641 33.769 1.00 37.22 ? 11  DT  B O2    1 
ATOM   197 N N3    . DT  A 1 10 ? 56.589 62.730 33.026 1.00 39.26 ? 11  DT  B N3    1 
ATOM   198 C C4    . DT  A 1 10 ? 56.448 63.728 32.082 1.00 40.01 ? 11  DT  B C4    1 
ATOM   199 O O4    . DT  A 1 10 ? 56.601 64.923 32.372 1.00 43.75 ? 11  DT  B O4    1 
ATOM   200 C C5    . DT  A 1 10 ? 56.146 63.198 30.767 1.00 34.64 ? 11  DT  B C5    1 
ATOM   201 C C7    . DT  A 1 10 ? 56.003 64.159 29.635 1.00 44.42 ? 11  DT  B C7    1 
ATOM   202 C C6    . DT  A 1 10 ? 56.024 61.883 30.518 1.00 30.30 ? 11  DT  B C6    1 
ATOM   203 P P     . DA  A 1 11 ? 53.009 56.340 30.535 1.00 70.04 ? 12  DA  B P     1 
ATOM   204 O OP1   . DA  A 1 11 ? 52.761 55.062 29.807 1.00 69.88 ? 12  DA  B OP1   1 
ATOM   205 O OP2   . DA  A 1 11 ? 52.302 57.563 30.088 1.00 73.58 ? 12  DA  B OP2   1 
ATOM   206 O "O5'" . DA  A 1 11 ? 52.605 56.199 32.079 1.00 53.41 ? 12  DA  B "O5'" 1 
ATOM   207 C "C5'" . DA  A 1 11 ? 53.260 55.164 32.771 1.00 46.58 ? 12  DA  B "C5'" 1 
ATOM   208 C "C4'" . DA  A 1 11 ? 53.240 55.399 34.217 1.00 42.16 ? 12  DA  B "C4'" 1 
ATOM   209 O "O4'" . DA  A 1 11 ? 53.761 56.679 34.517 1.00 40.03 ? 12  DA  B "O4'" 1 
ATOM   210 C "C3'" . DA  A 1 11 ? 51.866 55.379 34.663 1.00 41.68 ? 12  DA  B "C3'" 1 
ATOM   211 O "O3'" . DA  A 1 11 ? 51.841 54.648 35.873 1.00 58.71 ? 12  DA  B "O3'" 1 
ATOM   212 C "C2'" . DA  A 1 11 ? 51.574 56.815 34.823 1.00 35.02 ? 12  DA  B "C2'" 1 
ATOM   213 C "C1'" . DA  A 1 11 ? 52.821 57.487 35.141 1.00 30.07 ? 12  DA  B "C1'" 1 
ATOM   214 N N9    . DA  A 1 11 ? 52.782 58.689 34.378 1.00 30.01 ? 12  DA  B N9    1 
ATOM   215 C C8    . DA  A 1 11 ? 52.434 58.927 33.072 1.00 37.67 ? 12  DA  B C8    1 
ATOM   216 N N7    . DA  A 1 11 ? 52.506 60.196 32.681 1.00 32.00 ? 12  DA  B N7    1 
ATOM   217 C C5    . DA  A 1 11 ? 52.930 60.796 33.828 1.00 26.60 ? 12  DA  B C5    1 
ATOM   218 C C6    . DA  A 1 11 ? 53.193 62.083 34.097 1.00 28.39 ? 12  DA  B C6    1 
ATOM   219 N N6    . DA  A 1 11 ? 53.022 62.996 33.173 1.00 37.16 ? 12  DA  B N6    1 
ATOM   220 N N1    . DA  A 1 11 ? 53.597 62.380 35.332 1.00 37.17 ? 12  DA  B N1    1 
ATOM   221 C C2    . DA  A 1 11 ? 53.730 61.430 36.258 1.00 39.36 ? 12  DA  B C2    1 
ATOM   222 N N3    . DA  A 1 11 ? 53.505 60.157 36.112 1.00 37.37 ? 12  DA  B N3    1 
ATOM   223 C C4    . DA  A 1 11 ? 53.101 59.901 34.855 1.00 32.18 ? 12  DA  B C4    1 
ATOM   224 P P     . DA  A 1 12 ? 50.449 54.384 36.613 1.00 59.36 ? 13  DA  B P     1 
ATOM   225 O OP1   . DA  A 1 12 ? 50.663 53.330 37.635 1.00 59.04 ? 13  DA  B OP1   1 
ATOM   226 O OP2   . DA  A 1 12 ? 49.419 54.176 35.554 1.00 56.29 ? 13  DA  B OP2   1 
ATOM   227 O "O5'" . DA  A 1 12 ? 50.220 55.793 37.394 1.00 61.26 ? 13  DA  B "O5'" 1 
ATOM   228 C "C5'" . DA  A 1 12 ? 51.175 56.285 38.373 1.00 61.96 ? 13  DA  B "C5'" 1 
ATOM   229 C "C4'" . DA  A 1 12 ? 50.974 57.735 38.809 1.00 59.82 ? 13  DA  B "C4'" 1 
ATOM   230 O "O4'" . DA  A 1 12 ? 51.294 58.790 37.905 1.00 69.52 ? 13  DA  B "O4'" 1 
ATOM   231 C "C3'" . DA  A 1 12 ? 49.525 57.866 38.896 1.00 61.10 ? 13  DA  B "C3'" 1 
ATOM   232 O "O3'" . DA  A 1 12 ? 49.329 57.310 40.148 1.00 65.65 ? 13  DA  B "O3'" 1 
ATOM   233 C "C2'" . DA  A 1 12 ? 49.263 59.323 38.819 1.00 63.37 ? 13  DA  B "C2'" 1 
ATOM   234 C "C1'" . DA  A 1 12 ? 50.273 59.855 37.908 1.00 68.20 ? 13  DA  B "C1'" 1 
ATOM   235 N N9    . DA  A 1 12 ? 49.878 60.214 36.505 1.00 65.12 ? 13  DA  B N9    1 
ATOM   236 C C8    . DA  A 1 12 ? 49.448 59.419 35.467 1.00 67.70 ? 13  DA  B C8    1 
ATOM   237 N N7    . DA  A 1 12 ? 49.368 60.017 34.302 1.00 64.18 ? 13  DA  B N7    1 
ATOM   238 C C5    . DA  A 1 12 ? 49.769 61.307 34.582 1.00 62.31 ? 13  DA  B C5    1 
ATOM   239 C C6    . DA  A 1 12 ? 49.917 62.437 33.762 1.00 62.48 ? 13  DA  B C6    1 
ATOM   240 N N6    . DA  A 1 12 ? 49.689 62.424 32.443 1.00 64.50 ? 13  DA  B N6    1 
ATOM   241 N N1    . DA  A 1 12 ? 50.328 63.552 34.373 1.00 56.44 ? 13  DA  B N1    1 
ATOM   242 C C2    . DA  A 1 12 ? 50.556 63.485 35.680 1.00 63.00 ? 13  DA  B C2    1 
ATOM   243 N N3    . DA  A 1 12 ? 50.463 62.504 36.559 1.00 60.27 ? 13  DA  B N3    1 
ATOM   244 C C4    . DA  A 1 12 ? 50.056 61.425 35.918 1.00 58.24 ? 13  DA  B C4    1 
ATOM   245 P P     . DG  A 1 13 ? 47.904 57.335 40.773 1.00 67.79 ? 14  DG  B P     1 
ATOM   246 O OP1   . DG  A 1 13 ? 47.751 56.054 41.514 1.00 69.84 ? 14  DG  B OP1   1 
ATOM   247 O OP2   . DG  A 1 13 ? 46.911 57.727 39.721 1.00 67.44 ? 14  DG  B OP2   1 
ATOM   248 O "O5'" . DG  A 1 13 ? 48.211 58.521 41.826 1.00 62.14 ? 14  DG  B "O5'" 1 
ATOM   249 C "C5'" . DG  A 1 13 ? 47.103 59.205 42.365 1.00 60.74 ? 14  DG  B "C5'" 1 
ATOM   250 C "C4'" . DG  A 1 13 ? 47.252 60.689 42.300 1.00 50.51 ? 14  DG  B "C4'" 1 
ATOM   251 O "O4'" . DG  A 1 13 ? 47.734 61.159 41.055 1.00 51.72 ? 14  DG  B "O4'" 1 
ATOM   252 C "C3'" . DG  A 1 13 ? 45.893 61.253 42.454 1.00 49.82 ? 14  DG  B "C3'" 1 
ATOM   253 O "O3'" . DG  A 1 13 ? 45.728 61.863 43.716 1.00 55.21 ? 14  DG  B "O3'" 1 
ATOM   254 C "C2'" . DG  A 1 13 ? 45.704 62.119 41.234 1.00 51.67 ? 14  DG  B "C2'" 1 
ATOM   255 C "C1'" . DG  A 1 13 ? 47.040 62.321 40.563 1.00 43.15 ? 14  DG  B "C1'" 1 
ATOM   256 N N9    . DG  A 1 13 ? 46.962 62.183 39.086 1.00 33.48 ? 14  DG  B N9    1 
ATOM   257 C C8    . DG  A 1 13 ? 46.763 61.046 38.385 1.00 31.64 ? 14  DG  B C8    1 
ATOM   258 N N7    . DG  A 1 13 ? 46.717 61.180 37.105 1.00 29.20 ? 14  DG  B N7    1 
ATOM   259 C C5    . DG  A 1 13 ? 46.896 62.526 36.933 1.00 26.87 ? 14  DG  B C5    1 
ATOM   260 C C6    . DG  A 1 13 ? 46.916 63.266 35.700 1.00 40.44 ? 14  DG  B C6    1 
ATOM   261 O O6    . DG  A 1 13 ? 46.784 62.858 34.536 1.00 42.67 ? 14  DG  B O6    1 
ATOM   262 N N1    . DG  A 1 13 ? 47.107 64.604 35.938 1.00 28.95 ? 14  DG  B N1    1 
ATOM   263 C C2    . DG  A 1 13 ? 47.259 65.125 37.218 1.00 37.50 ? 14  DG  B C2    1 
ATOM   264 N N2    . DG  A 1 13 ? 47.444 66.417 37.280 1.00 32.24 ? 14  DG  B N2    1 
ATOM   265 N N3    . DG  A 1 13 ? 47.241 64.436 38.383 1.00 32.05 ? 14  DG  B N3    1 
ATOM   266 C C4    . DG  A 1 13 ? 47.052 63.142 38.148 1.00 25.64 ? 14  DG  B C4    1 
ATOM   267 P P     . DA  A 1 14 ? 46.652 63.059 44.199 1.00 68.01 ? 15  DA  B P     1 
ATOM   268 O OP1   . DA  A 1 14 ? 48.057 62.824 43.858 1.00 72.36 ? 15  DA  B OP1   1 
ATOM   269 O OP2   . DA  A 1 14 ? 46.353 63.363 45.616 1.00 71.28 ? 15  DA  B OP2   1 
ATOM   270 O "O5'" . DA  A 1 14 ? 46.124 64.261 43.242 1.00 80.43 ? 15  DA  B "O5'" 1 
ATOM   271 C "C5'" . DA  A 1 14 ? 44.823 64.954 43.221 1.00 84.96 ? 15  DA  B "C5'" 1 
ATOM   272 C "C4'" . DA  A 1 14 ? 44.482 65.559 41.811 1.00 75.97 ? 15  DA  B "C4'" 1 
ATOM   273 O "O4'" . DA  A 1 14 ? 44.157 64.596 40.834 1.00 70.30 ? 15  DA  B "O4'" 1 
ATOM   274 C "C3'" . DA  A 1 14 ? 43.308 66.492 41.610 1.00 73.61 ? 15  DA  B "C3'" 1 
ATOM   275 O "O3'" . DA  A 1 14 ? 43.643 67.757 42.140 1.00 78.25 ? 15  DA  B "O3'" 1 
ATOM   276 C "C2'" . DA  A 1 14 ? 43.267 66.546 40.095 1.00 62.16 ? 15  DA  B "C2'" 1 
ATOM   277 C "C1'" . DA  A 1 14 ? 44.194 65.452 39.717 1.00 59.84 ? 15  DA  B "C1'" 1 
ATOM   278 N N9    . DA  A 1 14 ? 43.855 64.713 38.520 1.00 52.55 ? 15  DA  B N9    1 
ATOM   279 C C8    . DA  A 1 14 ? 43.403 63.410 38.337 1.00 50.07 ? 15  DA  B C8    1 
ATOM   280 N N7    . DA  A 1 14 ? 43.231 63.084 37.082 1.00 36.13 ? 15  DA  B N7    1 
ATOM   281 C C5    . DA  A 1 14 ? 43.592 64.248 36.433 1.00 37.62 ? 15  DA  B C5    1 
ATOM   282 C C6    . DA  A 1 14 ? 43.627 64.553 35.112 1.00 43.08 ? 15  DA  B C6    1 
ATOM   283 N N6    . DA  A 1 14 ? 43.214 63.630 34.249 1.00 56.08 ? 15  DA  B N6    1 
ATOM   284 N N1    . DA  A 1 14 ? 44.035 65.786 34.754 1.00 41.99 ? 15  DA  B N1    1 
ATOM   285 C C2    . DA  A 1 14 ? 44.373 66.634 35.703 1.00 45.42 ? 15  DA  B C2    1 
ATOM   286 N N3    . DA  A 1 14 ? 44.381 66.472 37.010 1.00 45.75 ? 15  DA  B N3    1 
ATOM   287 C C4    . DA  A 1 14 ? 43.970 65.232 37.294 1.00 43.87 ? 15  DA  B C4    1 
ATOM   288 O "O5'" . DT  B 2 1  ? 43.433 68.948 25.972 1.00 58.02 ? 17  DT  C "O5'" 1 
ATOM   289 C "C5'" . DT  B 2 1  ? 42.890 70.218 26.317 1.00 52.62 ? 17  DT  C "C5'" 1 
ATOM   290 C "C4'" . DT  B 2 1  ? 43.366 70.645 27.724 1.00 51.70 ? 17  DT  C "C4'" 1 
ATOM   291 O "O4'" . DT  B 2 1  ? 43.120 69.600 28.690 1.00 49.68 ? 17  DT  C "O4'" 1 
ATOM   292 C "C3'" . DT  B 2 1  ? 44.843 70.978 27.852 1.00 51.52 ? 17  DT  C "C3'" 1 
ATOM   293 O "O3'" . DT  B 2 1  ? 44.877 72.222 28.592 1.00 64.13 ? 17  DT  C "O3'" 1 
ATOM   294 C "C2'" . DT  B 2 1  ? 45.329 69.822 28.687 1.00 46.85 ? 17  DT  C "C2'" 1 
ATOM   295 C "C1'" . DT  B 2 1  ? 44.181 69.580 29.645 1.00 40.95 ? 17  DT  C "C1'" 1 
ATOM   296 N N1    . DT  B 2 1  ? 44.240 68.281 30.363 1.00 33.67 ? 17  DT  C N1    1 
ATOM   297 C C2    . DT  B 2 1  ? 44.068 68.217 31.746 1.00 35.74 ? 17  DT  C C2    1 
ATOM   298 O O2    . DT  B 2 1  ? 43.867 69.175 32.465 1.00 52.78 ? 17  DT  C O2    1 
ATOM   299 N N3    . DT  B 2 1  ? 44.131 67.013 32.342 1.00 25.99 ? 17  DT  C N3    1 
ATOM   300 C C4    . DT  B 2 1  ? 44.345 65.867 31.680 1.00 34.94 ? 17  DT  C C4    1 
ATOM   301 O O4    . DT  B 2 1  ? 44.360 64.813 32.293 1.00 39.75 ? 17  DT  C O4    1 
ATOM   302 C C5    . DT  B 2 1  ? 44.521 65.997 30.258 1.00 32.57 ? 17  DT  C C5    1 
ATOM   303 C C7    . DT  B 2 1  ? 44.794 64.765 29.435 1.00 35.73 ? 17  DT  C C7    1 
ATOM   304 C C6    . DT  B 2 1  ? 44.463 67.166 29.652 1.00 27.89 ? 17  DT  C C6    1 
ATOM   305 P P     . DC  B 2 2  ? 46.175 73.115 29.013 1.00 63.61 ? 18  DC  C P     1 
ATOM   306 O OP1   . DC  B 2 2  ? 45.730 74.527 29.184 1.00 60.80 ? 18  DC  C OP1   1 
ATOM   307 O OP2   . DC  B 2 2  ? 47.273 72.784 28.079 1.00 56.32 ? 18  DC  C OP2   1 
ATOM   308 O "O5'" . DC  B 2 2  ? 46.474 72.473 30.455 1.00 59.99 ? 18  DC  C "O5'" 1 
ATOM   309 C "C5'" . DC  B 2 2  ? 47.566 72.752 31.324 1.00 52.18 ? 18  DC  C "C5'" 1 
ATOM   310 C "C4'" . DC  B 2 2  ? 47.212 72.144 32.649 1.00 41.11 ? 18  DC  C "C4'" 1 
ATOM   311 O "O4'" . DC  B 2 2  ? 46.899 70.803 32.376 1.00 44.38 ? 18  DC  C "O4'" 1 
ATOM   312 C "C3'" . DC  B 2 2  ? 48.396 72.052 33.533 1.00 39.30 ? 18  DC  C "C3'" 1 
ATOM   313 O "O3'" . DC  B 2 2  ? 48.297 73.228 34.283 1.00 45.29 ? 18  DC  C "O3'" 1 
ATOM   314 C "C2'" . DC  B 2 2  ? 48.076 70.795 34.351 1.00 38.07 ? 18  DC  C "C2'" 1 
ATOM   315 C "C1'" . DC  B 2 2  ? 47.082 69.992 33.538 1.00 38.35 ? 18  DC  C "C1'" 1 
ATOM   316 N N1    . DC  B 2 2  ? 47.324 68.515 33.167 1.00 39.18 ? 18  DC  C N1    1 
ATOM   317 C C2    . DC  B 2 2  ? 47.134 67.580 34.165 1.00 33.21 ? 18  DC  C C2    1 
ATOM   318 O O2    . DC  B 2 2  ? 46.883 67.964 35.296 1.00 37.11 ? 18  DC  C O2    1 
ATOM   319 N N3    . DC  B 2 2  ? 47.259 66.256 33.899 1.00 26.26 ? 18  DC  C N3    1 
ATOM   320 C C4    . DC  B 2 2  ? 47.583 65.835 32.664 1.00 32.40 ? 18  DC  C C4    1 
ATOM   321 N N4    . DC  B 2 2  ? 47.697 64.519 32.431 1.00 30.63 ? 18  DC  C N4    1 
ATOM   322 C C5    . DC  B 2 2  ? 47.801 66.779 31.593 1.00 27.50 ? 18  DC  C C5    1 
ATOM   323 C C6    . DC  B 2 2  ? 47.660 68.090 31.891 1.00 30.73 ? 18  DC  C C6    1 
ATOM   324 P P     . DT  B 2 3  ? 49.583 73.985 34.809 1.00 47.63 ? 19  DT  C P     1 
ATOM   325 O OP1   . DT  B 2 3  ? 49.136 75.133 35.670 1.00 35.56 ? 19  DT  C OP1   1 
ATOM   326 O OP2   . DT  B 2 3  ? 50.396 74.194 33.578 1.00 47.08 ? 19  DT  C OP2   1 
ATOM   327 O "O5'" . DT  B 2 3  ? 50.305 72.885 35.735 1.00 51.32 ? 19  DT  C "O5'" 1 
ATOM   328 C "C5'" . DT  B 2 3  ? 49.852 72.703 37.109 1.00 52.66 ? 19  DT  C "C5'" 1 
ATOM   329 C "C4'" . DT  B 2 3  ? 50.237 71.381 37.819 1.00 44.64 ? 19  DT  C "C4'" 1 
ATOM   330 O "O4'" . DT  B 2 3  ? 50.015 70.338 36.902 1.00 35.85 ? 19  DT  C "O4'" 1 
ATOM   331 C "C3'" . DT  B 2 3  ? 51.682 71.303 38.245 1.00 41.68 ? 19  DT  C "C3'" 1 
ATOM   332 O "O3'" . DT  B 2 3  ? 51.796 71.398 39.681 1.00 48.03 ? 19  DT  C "O3'" 1 
ATOM   333 C "C2'" . DT  B 2 3  ? 52.136 70.011 37.670 1.00 40.19 ? 19  DT  C "C2'" 1 
ATOM   334 C "C1'" . DT  B 2 3  ? 50.900 69.305 37.277 1.00 35.32 ? 19  DT  C "C1'" 1 
ATOM   335 N N1    . DT  B 2 3  ? 50.991 68.533 36.053 1.00 26.28 ? 19  DT  C N1    1 
ATOM   336 C C2    . DT  B 2 3  ? 50.863 67.187 36.174 1.00 29.68 ? 19  DT  C C2    1 
ATOM   337 O O2    . DT  B 2 3  ? 50.790 66.573 37.228 1.00 45.34 ? 19  DT  C O2    1 
ATOM   338 N N3    . DT  B 2 3  ? 50.864 66.490 35.034 1.00 32.43 ? 19  DT  C N3    1 
ATOM   339 C C4    . DT  B 2 3  ? 50.981 66.971 33.804 1.00 27.08 ? 19  DT  C C4    1 
ATOM   340 O O4    . DT  B 2 3  ? 50.917 66.191 32.871 1.00 42.78 ? 19  DT  C O4    1 
ATOM   341 C C5    . DT  B 2 3  ? 51.125 68.370 33.742 1.00 25.49 ? 19  DT  C C5    1 
ATOM   342 C C7    . DT  B 2 3  ? 51.269 68.977 32.365 1.00 41.68 ? 19  DT  C C7    1 
ATOM   343 C C6    . DT  B 2 3  ? 51.127 69.116 34.844 1.00 28.56 ? 19  DT  C C6    1 
ATOM   344 P P     . DT  B 2 4  ? 53.262 71.665 40.228 1.00 48.09 ? 20  DT  C P     1 
ATOM   345 O OP1   . DT  B 2 4  ? 53.314 72.226 41.593 1.00 45.17 ? 20  DT  C OP1   1 
ATOM   346 O OP2   . DT  B 2 4  ? 54.047 72.320 39.169 1.00 46.27 ? 20  DT  C OP2   1 
ATOM   347 O "O5'" . DT  B 2 4  ? 53.518 70.138 40.349 1.00 52.58 ? 20  DT  C "O5'" 1 
ATOM   348 C "C5'" . DT  B 2 4  ? 52.989 69.394 41.454 1.00 47.63 ? 20  DT  C "C5'" 1 
ATOM   349 C "C4'" . DT  B 2 4  ? 53.503 67.991 41.322 1.00 45.47 ? 20  DT  C "C4'" 1 
ATOM   350 O "O4'" . DT  B 2 4  ? 53.132 67.582 40.018 1.00 46.05 ? 20  DT  C "O4'" 1 
ATOM   351 C "C3'" . DT  B 2 4  ? 55.010 67.830 41.273 1.00 51.95 ? 20  DT  C "C3'" 1 
ATOM   352 O "O3'" . DT  B 2 4  ? 55.724 67.887 42.577 1.00 65.07 ? 20  DT  C "O3'" 1 
ATOM   353 C "C2'" . DT  B 2 4  ? 55.047 66.495 40.577 1.00 46.12 ? 20  DT  C "C2'" 1 
ATOM   354 C "C1'" . DT  B 2 4  ? 53.800 66.355 39.819 1.00 35.18 ? 20  DT  C "C1'" 1 
ATOM   355 N N1    . DT  B 2 4  ? 53.965 66.083 38.403 1.00 30.52 ? 20  DT  C N1    1 
ATOM   356 C C2    . DT  B 2 4  ? 53.691 64.808 38.001 1.00 37.61 ? 20  DT  C C2    1 
ATOM   357 O O2    . DT  B 2 4  ? 53.347 63.922 38.785 1.00 44.16 ? 20  DT  C O2    1 
ATOM   358 N N3    . DT  B 2 4  ? 53.789 64.565 36.627 1.00 27.90 ? 20  DT  C N3    1 
ATOM   359 C C4    . DT  B 2 4  ? 54.123 65.457 35.650 1.00 28.28 ? 20  DT  C C4    1 
ATOM   360 O O4    . DT  B 2 4  ? 54.163 65.144 34.462 1.00 34.19 ? 20  DT  C O4    1 
ATOM   361 C C5    . DT  B 2 4  ? 54.389 66.738 36.157 1.00 25.31 ? 20  DT  C C5    1 
ATOM   362 C C7    . DT  B 2 4  ? 54.741 67.742 35.096 1.00 35.17 ? 20  DT  C C7    1 
ATOM   363 C C6    . DT  B 2 4  ? 54.315 67.034 37.483 1.00 28.18 ? 20  DT  C C6    1 
ATOM   364 P P     . DA  B 2 5  ? 57.354 67.946 42.913 1.00 60.56 ? 21  DA  C P     1 
ATOM   365 O OP1   . DA  B 2 5  ? 57.480 68.232 44.366 1.00 64.30 ? 21  DA  C OP1   1 
ATOM   366 O OP2   . DA  B 2 5  ? 58.077 68.817 41.951 1.00 58.52 ? 21  DA  C OP2   1 
ATOM   367 O "O5'" . DA  B 2 5  ? 57.768 66.394 42.637 1.00 61.39 ? 21  DA  C "O5'" 1 
ATOM   368 C "C5'" . DA  B 2 5  ? 57.169 65.451 43.563 1.00 63.59 ? 21  DA  C "C5'" 1 
ATOM   369 C "C4'" . DA  B 2 5  ? 57.103 63.986 43.147 1.00 56.62 ? 21  DA  C "C4'" 1 
ATOM   370 O "O4'" . DA  B 2 5  ? 56.582 63.893 41.819 1.00 55.25 ? 21  DA  C "O4'" 1 
ATOM   371 C "C3'" . DA  B 2 5  ? 58.462 63.393 43.127 1.00 57.85 ? 21  DA  C "C3'" 1 
ATOM   372 O "O3'" . DA  B 2 5  ? 58.457 62.032 43.563 1.00 55.19 ? 21  DA  C "O3'" 1 
ATOM   373 C "C2'" . DA  B 2 5  ? 58.780 63.529 41.661 1.00 58.45 ? 21  DA  C "C2'" 1 
ATOM   374 C "C1'" . DA  B 2 5  ? 57.509 63.317 40.902 1.00 51.07 ? 21  DA  C "C1'" 1 
ATOM   375 N N9    . DA  B 2 5  ? 57.587 64.059 39.604 1.00 52.25 ? 21  DA  C N9    1 
ATOM   376 C C8    . DA  B 2 5  ? 57.928 65.384 39.401 1.00 52.04 ? 21  DA  C C8    1 
ATOM   377 N N7    . DA  B 2 5  ? 57.911 65.759 38.152 1.00 50.67 ? 21  DA  C N7    1 
ATOM   378 C C5    . DA  B 2 5  ? 57.536 64.609 37.464 1.00 49.18 ? 21  DA  C C5    1 
ATOM   379 C C6    . DA  B 2 5  ? 57.344 64.363 36.096 1.00 51.45 ? 21  DA  C C6    1 
ATOM   380 N N6    . DA  B 2 5  ? 57.497 65.323 35.173 1.00 52.03 ? 21  DA  C N6    1 
ATOM   381 N N1    . DA  B 2 5  ? 56.977 63.121 35.734 1.00 45.10 ? 21  DA  C N1    1 
ATOM   382 C C2    . DA  B 2 5  ? 56.812 62.192 36.675 1.00 47.59 ? 21  DA  C C2    1 
ATOM   383 N N3    . DA  B 2 5  ? 56.963 62.294 37.992 1.00 49.26 ? 21  DA  C N3    1 
ATOM   384 C C4    . DA  B 2 5  ? 57.334 63.561 38.328 1.00 48.29 ? 21  DA  C C4    1 
ATOM   385 P P     . DT  B 2 6  ? 59.854 61.272 43.838 1.00 46.99 ? 22  DT  C P     1 
ATOM   386 O OP1   . DT  B 2 6  ? 59.670 60.364 44.996 1.00 45.86 ? 22  DT  C OP1   1 
ATOM   387 O OP2   . DT  B 2 6  ? 60.920 62.308 43.889 1.00 47.25 ? 22  DT  C OP2   1 
ATOM   388 O "O5'" . DT  B 2 6  ? 60.000 60.394 42.511 1.00 32.89 ? 22  DT  C "O5'" 1 
ATOM   389 C "C5'" . DT  B 2 6  ? 58.966 59.452 42.454 1.00 30.17 ? 22  DT  C "C5'" 1 
ATOM   390 C "C4'" . DT  B 2 6  ? 59.006 58.720 41.212 1.00 34.29 ? 22  DT  C "C4'" 1 
ATOM   391 O "O4'" . DT  B 2 6  ? 58.987 59.668 40.142 1.00 42.49 ? 22  DT  C "O4'" 1 
ATOM   392 C "C3'" . DT  B 2 6  ? 60.259 57.913 41.059 1.00 35.61 ? 22  DT  C "C3'" 1 
ATOM   393 O "O3'" . DT  B 2 6  ? 59.803 56.595 40.791 1.00 42.34 ? 22  DT  C "O3'" 1 
ATOM   394 C "C2'" . DT  B 2 6  ? 60.951 58.551 39.846 1.00 35.56 ? 22  DT  C "C2'" 1 
ATOM   395 C "C1'" . DT  B 2 6  ? 59.847 59.184 39.068 1.00 36.10 ? 22  DT  C "C1'" 1 
ATOM   396 N N1    . DT  B 2 6  ? 60.168 60.347 38.225 1.00 29.83 ? 22  DT  C N1    1 
ATOM   397 C C2    . DT  B 2 6  ? 59.991 60.258 36.849 1.00 28.29 ? 22  DT  C C2    1 
ATOM   398 O O2    . DT  B 2 6  ? 59.742 59.210 36.247 1.00 25.20 ? 22  DT  C O2    1 
ATOM   399 N N3    . DT  B 2 6  ? 60.194 61.431 36.160 1.00 23.96 ? 22  DT  C N3    1 
ATOM   400 C C4    . DT  B 2 6  ? 60.562 62.638 36.709 1.00 32.91 ? 22  DT  C C4    1 
ATOM   401 O O4    . DT  B 2 6  ? 60.683 63.629 35.993 1.00 31.49 ? 22  DT  C O4    1 
ATOM   402 C C5    . DT  B 2 6  ? 60.743 62.612 38.144 1.00 26.13 ? 22  DT  C C5    1 
ATOM   403 C C7    . DT  B 2 6  ? 61.187 63.845 38.908 1.00 19.08 ? 22  DT  C C7    1 
ATOM   404 C C6    . DT  B 2 6  ? 60.539 61.500 38.825 1.00 24.95 ? 22  DT  C C6    1 
ATOM   405 P P     . DC  B 2 7  ? 60.843 55.420 40.732 1.00 48.40 ? 23  DC  C P     1 
ATOM   406 O OP1   . DC  B 2 7  ? 60.081 54.174 40.685 1.00 57.71 ? 23  DC  C OP1   1 
ATOM   407 O OP2   . DC  B 2 7  ? 61.883 55.622 41.768 1.00 49.28 ? 23  DC  C OP2   1 
ATOM   408 O "O5'" . DC  B 2 7  ? 61.506 55.574 39.325 1.00 46.39 ? 23  DC  C "O5'" 1 
ATOM   409 C "C5'" . DC  B 2 7  ? 60.880 55.067 38.173 1.00 41.10 ? 23  DC  C "C5'" 1 
ATOM   410 C "C4'" . DC  B 2 7  ? 61.806 55.502 37.050 1.00 47.94 ? 23  DC  C "C4'" 1 
ATOM   411 O "O4'" . DC  B 2 7  ? 62.027 56.938 37.009 1.00 41.47 ? 23  DC  C "O4'" 1 
ATOM   412 C "C3'" . DC  B 2 7  ? 63.169 54.880 37.278 1.00 39.06 ? 23  DC  C "C3'" 1 
ATOM   413 O "O3'" . DC  B 2 7  ? 63.207 53.897 36.290 1.00 48.78 ? 23  DC  C "O3'" 1 
ATOM   414 C "C2'" . DC  B 2 7  ? 64.108 56.020 37.096 1.00 35.35 ? 23  DC  C "C2'" 1 
ATOM   415 C "C1'" . DC  B 2 7  ? 63.296 57.042 36.393 1.00 28.00 ? 23  DC  C "C1'" 1 
ATOM   416 N N1    . DC  B 2 7  ? 63.604 58.410 36.657 1.00 26.68 ? 23  DC  C N1    1 
ATOM   417 C C2    . DC  B 2 7  ? 63.353 59.274 35.601 1.00 34.28 ? 23  DC  C C2    1 
ATOM   418 O O2    . DC  B 2 7  ? 63.042 58.867 34.461 1.00 28.80 ? 23  DC  C O2    1 
ATOM   419 N N3    . DC  B 2 7  ? 63.527 60.614 35.853 1.00 24.81 ? 23  DC  C N3    1 
ATOM   420 C C4    . DC  B 2 7  ? 63.931 61.059 37.059 1.00 34.76 ? 23  DC  C C4    1 
ATOM   421 N N4    . DC  B 2 7  ? 64.037 62.371 37.268 1.00 37.63 ? 23  DC  C N4    1 
ATOM   422 C C5    . DC  B 2 7  ? 64.207 60.156 38.136 1.00 22.19 ? 23  DC  C C5    1 
ATOM   423 C C6    . DC  B 2 7  ? 64.025 58.845 37.880 1.00 26.49 ? 23  DC  C C6    1 
ATOM   424 P P     . DA  B 2 8  ? 64.506 53.167 35.859 1.00 47.35 ? 24  DA  C P     1 
ATOM   425 O OP1   . DA  B 2 8  ? 64.205 51.766 35.529 1.00 54.46 ? 24  DA  C OP1   1 
ATOM   426 O OP2   . DA  B 2 8  ? 65.576 53.453 36.846 1.00 47.09 ? 24  DA  C OP2   1 
ATOM   427 O "O5'" . DA  B 2 8  ? 64.715 53.933 34.503 1.00 48.79 ? 24  DA  C "O5'" 1 
ATOM   428 C "C5'" . DA  B 2 8  ? 63.837 53.631 33.416 1.00 45.14 ? 24  DA  C "C5'" 1 
ATOM   429 C "C4'" . DA  B 2 8  ? 64.531 53.827 32.066 1.00 48.94 ? 24  DA  C "C4'" 1 
ATOM   430 O "O4'" . DA  B 2 8  ? 65.006 55.170 31.885 1.00 49.80 ? 24  DA  C "O4'" 1 
ATOM   431 C "C3'" . DA  B 2 8  ? 65.791 53.035 31.814 1.00 48.05 ? 24  DA  C "C3'" 1 
ATOM   432 O "O3'" . DA  B 2 8  ? 65.803 53.051 30.406 1.00 44.65 ? 24  DA  C "O3'" 1 
ATOM   433 C "C2'" . DA  B 2 8  ? 66.850 53.924 32.488 1.00 47.05 ? 24  DA  C "C2'" 1 
ATOM   434 C "C1'" . DA  B 2 8  ? 66.384 55.347 32.223 1.00 45.48 ? 24  DA  C "C1'" 1 
ATOM   435 N N9    . DA  B 2 8  ? 66.549 56.332 33.338 1.00 42.67 ? 24  DA  C N9    1 
ATOM   436 C C8    . DA  B 2 8  ? 66.892 56.150 34.663 1.00 48.91 ? 24  DA  C C8    1 
ATOM   437 N N7    . DA  B 2 8  ? 66.993 57.247 35.376 1.00 48.97 ? 24  DA  C N7    1 
ATOM   438 C C5    . DA  B 2 8  ? 66.692 58.225 34.449 1.00 40.33 ? 24  DA  C C5    1 
ATOM   439 C C6    . DA  B 2 8  ? 66.657 59.596 34.557 1.00 38.74 ? 24  DA  C C6    1 
ATOM   440 N N6    . DA  B 2 8  ? 66.924 60.190 35.688 1.00 40.84 ? 24  DA  C N6    1 
ATOM   441 N N1    . DA  B 2 8  ? 66.357 60.328 33.479 1.00 36.00 ? 24  DA  C N1    1 
ATOM   442 C C2    . DA  B 2 8  ? 66.102 59.686 32.332 1.00 42.96 ? 24  DA  C C2    1 
ATOM   443 N N3    . DA  B 2 8  ? 66.099 58.383 32.084 1.00 41.58 ? 24  DA  C N3    1 
ATOM   444 C C4    . DA  B 2 8  ? 66.414 57.694 33.214 1.00 44.38 ? 24  DA  C C4    1 
ATOM   445 P P     . DA  B 2 9  ? 67.089 52.915 29.554 1.00 51.08 ? 25  DA  C P     1 
ATOM   446 O OP1   . DA  B 2 9  ? 66.621 52.452 28.220 1.00 53.03 ? 25  DA  C OP1   1 
ATOM   447 O OP2   . DA  B 2 9  ? 68.106 52.133 30.303 1.00 48.21 ? 25  DA  C OP2   1 
ATOM   448 O "O5'" . DA  B 2 9  ? 67.769 54.373 29.444 1.00 55.51 ? 25  DA  C "O5'" 1 
ATOM   449 C "C5'" . DA  B 2 9  ? 67.355 55.312 28.433 1.00 55.98 ? 25  DA  C "C5'" 1 
ATOM   450 C "C4'" . DA  B 2 9  ? 68.111 56.620 28.449 1.00 43.22 ? 25  DA  C "C4'" 1 
ATOM   451 O "O4'" . DA  B 2 9  ? 68.099 56.969 29.831 1.00 41.35 ? 25  DA  C "O4'" 1 
ATOM   452 C "C3'" . DA  B 2 9  ? 69.566 56.478 28.092 1.00 47.03 ? 25  DA  C "C3'" 1 
ATOM   453 O "O3'" . DA  B 2 9  ? 69.978 57.517 27.187 1.00 55.32 ? 25  DA  C "O3'" 1 
ATOM   454 C "C2'" . DA  B 2 9  ? 70.233 56.599 29.436 1.00 45.88 ? 25  DA  C "C2'" 1 
ATOM   455 C "C1'" . DA  B 2 9  ? 69.336 57.545 30.146 1.00 36.28 ? 25  DA  C "C1'" 1 
ATOM   456 N N9    . DA  B 2 9  ? 69.531 57.639 31.596 1.00 28.76 ? 25  DA  C N9    1 
ATOM   457 C C8    . DA  B 2 9  ? 69.666 56.665 32.502 1.00 27.82 ? 25  DA  C C8    1 
ATOM   458 N N7    . DA  B 2 9  ? 69.849 57.096 33.717 1.00 34.09 ? 25  DA  C N7    1 
ATOM   459 C C5    . DA  B 2 9  ? 69.836 58.470 33.593 1.00 29.86 ? 25  DA  C C5    1 
ATOM   460 C C6    . DA  B 2 9  ? 69.986 59.532 34.521 1.00 29.74 ? 25  DA  C C6    1 
ATOM   461 N N6    . DA  B 2 9  ? 70.206 59.335 35.812 1.00 32.60 ? 25  DA  C N6    1 
ATOM   462 N N1    . DA  B 2 9  ? 69.918 60.793 34.066 1.00 23.27 ? 25  DA  C N1    1 
ATOM   463 C C2    . DA  B 2 9  ? 69.712 60.972 32.769 1.00 33.93 ? 25  DA  C C2    1 
ATOM   464 N N3    . DA  B 2 9  ? 69.559 60.056 31.807 1.00 37.04 ? 25  DA  C N3    1 
ATOM   465 C C4    . DA  B 2 9  ? 69.635 58.800 32.297 1.00 25.21 ? 25  DA  C C4    1 
ATOM   466 P P     . DA  B 2 10 ? 69.829 57.235 25.578 1.00 61.21 ? 26  DA  C P     1 
ATOM   467 O OP1   . DA  B 2 10 ? 68.376 57.036 25.296 1.00 63.44 ? 26  DA  C OP1   1 
ATOM   468 O OP2   . DA  B 2 10 ? 70.793 56.154 25.260 1.00 62.81 ? 26  DA  C OP2   1 
ATOM   469 O "O5'" . DA  B 2 10 ? 70.353 58.496 24.696 1.00 59.90 ? 26  DA  C "O5'" 1 
ATOM   470 C "C5'" . DA  B 2 10 ? 69.616 59.705 24.566 1.00 53.09 ? 26  DA  C "C5'" 1 
ATOM   471 C "C4'" . DA  B 2 10 ? 70.226 60.785 25.407 1.00 46.50 ? 26  DA  C "C4'" 1 
ATOM   472 O "O4'" . DA  B 2 10 ? 70.515 60.349 26.750 1.00 50.73 ? 26  DA  C "O4'" 1 
ATOM   473 C "C3'" . DA  B 2 10 ? 71.502 61.209 24.814 1.00 36.21 ? 26  DA  C "C3'" 1 
ATOM   474 O "O3'" . DA  B 2 10 ? 71.079 62.374 24.145 1.00 35.80 ? 26  DA  C "O3'" 1 
ATOM   475 C "C2'" . DA  B 2 10 ? 72.316 61.477 26.092 1.00 42.41 ? 26  DA  C "C2'" 1 
ATOM   476 C "C1'" . DA  B 2 10 ? 71.480 61.209 27.335 1.00 37.64 ? 26  DA  C "C1'" 1 
ATOM   477 N N9    . DA  B 2 10 ? 72.071 60.490 28.513 1.00 32.01 ? 26  DA  C N9    1 
ATOM   478 C C8    . DA  B 2 10 ? 72.310 59.157 28.720 1.00 27.76 ? 26  DA  C C8    1 
ATOM   479 N N7    . DA  B 2 10 ? 72.716 58.840 29.932 1.00 30.97 ? 26  DA  C N7    1 
ATOM   480 C C5    . DA  B 2 10 ? 72.750 60.072 30.590 1.00 32.59 ? 26  DA  C C5    1 
ATOM   481 C C6    . DA  B 2 10 ? 73.082 60.459 31.932 1.00 35.84 ? 26  DA  C C6    1 
ATOM   482 N N6    . DA  B 2 10 ? 73.460 59.631 32.899 1.00 29.83 ? 26  DA  C N6    1 
ATOM   483 N N1    . DA  B 2 10 ? 73.017 61.739 32.266 1.00 30.06 ? 26  DA  C N1    1 
ATOM   484 C C2    . DA  B 2 10 ? 72.639 62.589 31.308 1.00 43.88 ? 26  DA  C C2    1 
ATOM   485 N N3    . DA  B 2 10 ? 72.298 62.398 30.031 1.00 41.29 ? 26  DA  C N3    1 
ATOM   486 C C4    . DA  B 2 10 ? 72.375 61.073 29.727 1.00 37.64 ? 26  DA  C C4    1 
ATOM   487 P P     . DA  B 2 11 ? 72.075 63.254 23.350 1.00 48.14 ? 27  DA  C P     1 
ATOM   488 O OP1   . DA  B 2 11 ? 71.364 64.463 22.884 1.00 48.17 ? 27  DA  C OP1   1 
ATOM   489 O OP2   . DA  B 2 11 ? 72.774 62.408 22.387 1.00 48.20 ? 27  DA  C OP2   1 
ATOM   490 O "O5'" . DA  B 2 11 ? 73.116 63.725 24.434 1.00 45.06 ? 27  DA  C "O5'" 1 
ATOM   491 C "C5'" . DA  B 2 11 ? 72.874 64.926 25.138 1.00 46.83 ? 27  DA  C "C5'" 1 
ATOM   492 C "C4'" . DA  B 2 11 ? 73.913 65.258 26.193 1.00 45.48 ? 27  DA  C "C4'" 1 
ATOM   493 O "O4'" . DA  B 2 11 ? 74.018 64.296 27.249 1.00 41.66 ? 27  DA  C "O4'" 1 
ATOM   494 C "C3'" . DA  B 2 11 ? 75.250 65.384 25.572 1.00 47.86 ? 27  DA  C "C3'" 1 
ATOM   495 O "O3'" . DA  B 2 11 ? 75.857 66.471 26.283 1.00 50.10 ? 27  DA  C "O3'" 1 
ATOM   496 C "C2'" . DA  B 2 11 ? 75.795 64.023 25.928 1.00 44.76 ? 27  DA  C "C2'" 1 
ATOM   497 C "C1'" . DA  B 2 11 ? 75.408 64.013 27.362 1.00 45.27 ? 27  DA  C "C1'" 1 
ATOM   498 N N9    . DA  B 2 11 ? 75.552 62.780 28.062 1.00 46.87 ? 27  DA  C N9    1 
ATOM   499 C C8    . DA  B 2 11 ? 75.473 61.543 27.529 1.00 51.30 ? 27  DA  C C8    1 
ATOM   500 N N7    . DA  B 2 11 ? 75.572 60.605 28.413 1.00 54.25 ? 27  DA  C N7    1 
ATOM   501 C C5    . DA  B 2 11 ? 75.731 61.279 29.608 1.00 52.54 ? 27  DA  C C5    1 
ATOM   502 C C6    . DA  B 2 11 ? 75.880 60.805 30.911 1.00 49.77 ? 27  DA  C C6    1 
ATOM   503 N N6    . DA  B 2 11 ? 75.846 59.482 31.139 1.00 44.36 ? 27  DA  C N6    1 
ATOM   504 N N1    . DA  B 2 11 ? 76.010 61.699 31.915 1.00 43.92 ? 27  DA  C N1    1 
ATOM   505 C C2    . DA  B 2 11 ? 75.988 62.989 31.593 1.00 49.60 ? 27  DA  C C2    1 
ATOM   506 N N3    . DA  B 2 11 ? 75.852 63.566 30.395 1.00 54.42 ? 27  DA  C N3    1 
ATOM   507 C C4    . DA  B 2 11 ? 75.724 62.625 29.420 1.00 51.59 ? 27  DA  C C4    1 
ATOM   508 P P     . DA  B 2 12 ? 76.583 67.609 25.440 1.00 61.14 ? 28  DA  C P     1 
ATOM   509 O OP1   . DA  B 2 12 ? 76.072 68.881 25.974 1.00 59.63 ? 28  DA  C OP1   1 
ATOM   510 O OP2   . DA  B 2 12 ? 76.483 67.354 23.975 1.00 52.75 ? 28  DA  C OP2   1 
ATOM   511 O "O5'" . DA  B 2 12 ? 78.128 67.464 25.866 1.00 62.32 ? 28  DA  C "O5'" 1 
ATOM   512 C "C5'" . DA  B 2 12 ? 78.498 68.260 26.970 1.00 59.13 ? 28  DA  C "C5'" 1 
ATOM   513 C "C4'" . DA  B 2 12 ? 79.018 67.448 28.077 1.00 55.31 ? 28  DA  C "C4'" 1 
ATOM   514 O "O4'" . DA  B 2 12 ? 78.304 66.256 28.277 1.00 54.74 ? 28  DA  C "O4'" 1 
ATOM   515 C "C3'" . DA  B 2 12 ? 80.376 66.905 27.857 1.00 58.73 ? 28  DA  C "C3'" 1 
ATOM   516 O "O3'" . DA  B 2 12 ? 81.393 67.924 27.812 1.00 61.63 ? 28  DA  C "O3'" 1 
ATOM   517 C "C2'" . DA  B 2 12 ? 80.405 66.207 29.184 1.00 59.45 ? 28  DA  C "C2'" 1 
ATOM   518 C "C1'" . DA  B 2 12 ? 79.059 65.662 29.346 1.00 51.97 ? 28  DA  C "C1'" 1 
ATOM   519 N N9    . DA  B 2 12 ? 79.162 64.211 29.265 1.00 45.33 ? 28  DA  C N9    1 
ATOM   520 C C8    . DA  B 2 12 ? 79.002 63.436 28.162 1.00 43.46 ? 28  DA  C C8    1 
ATOM   521 N N7    . DA  B 2 12 ? 79.061 62.161 28.424 1.00 37.29 ? 28  DA  C N7    1 
ATOM   522 C C5    . DA  B 2 12 ? 79.277 62.094 29.790 1.00 27.14 ? 28  DA  C C5    1 
ATOM   523 C C6    . DA  B 2 12 ? 79.426 61.000 30.640 1.00 25.05 ? 28  DA  C C6    1 
ATOM   524 N N6    . DA  B 2 12 ? 79.414 59.720 30.178 1.00 16.03 ? 28  DA  C N6    1 
ATOM   525 N N1    . DA  B 2 12 ? 79.636 61.281 31.936 1.00 25.32 ? 28  DA  C N1    1 
ATOM   526 C C2    . DA  B 2 12 ? 79.695 62.537 32.337 1.00 28.28 ? 28  DA  C C2    1 
ATOM   527 N N3    . DA  B 2 12 ? 79.570 63.655 31.632 1.00 29.81 ? 28  DA  C N3    1 
ATOM   528 C C4    . DA  B 2 12 ? 79.355 63.340 30.329 1.00 32.90 ? 28  DA  C C4    1 
ATOM   529 P P     . DC  B 2 13 ? 82.918 67.510 27.533 1.00 62.63 ? 29  DC  C P     1 
ATOM   530 O OP1   . DC  B 2 13 ? 83.514 68.508 26.613 1.00 63.67 ? 29  DC  C OP1   1 
ATOM   531 O OP2   . DC  B 2 13 ? 83.016 66.055 27.203 1.00 62.43 ? 29  DC  C OP2   1 
ATOM   532 O "O5'" . DC  B 2 13 ? 83.572 67.807 28.996 1.00 66.75 ? 29  DC  C "O5'" 1 
ATOM   533 C "C5'" . DC  B 2 13 ? 83.479 67.247 30.342 1.00 59.79 ? 29  DC  C "C5'" 1 
ATOM   534 C "C4'" . DC  B 2 13 ? 84.003 65.819 30.582 1.00 47.94 ? 29  DC  C "C4'" 1 
ATOM   535 O "O4'" . DC  B 2 13 ? 83.152 64.895 29.985 1.00 33.99 ? 29  DC  C "O4'" 1 
ATOM   536 C "C3'" . DC  B 2 13 ? 85.365 65.415 30.018 1.00 48.78 ? 29  DC  C "C3'" 1 
ATOM   537 O "O3'" . DC  B 2 13 ? 86.502 65.983 30.716 1.00 60.62 ? 29  DC  C "O3'" 1 
ATOM   538 C "C2'" . DC  B 2 13 ? 85.228 63.939 30.255 1.00 43.45 ? 29  DC  C "C2'" 1 
ATOM   539 C "C1'" . DC  B 2 13 ? 83.721 63.714 30.398 1.00 32.20 ? 29  DC  C "C1'" 1 
ATOM   540 N N1    . DC  B 2 13 ? 83.211 62.662 29.517 1.00 36.37 ? 29  DC  C N1    1 
ATOM   541 C C2    . DC  B 2 13 ? 83.092 61.438 30.119 1.00 48.74 ? 29  DC  C C2    1 
ATOM   542 O O2    . DC  B 2 13 ? 83.411 61.294 31.310 1.00 47.17 ? 29  DC  C O2    1 
ATOM   543 N N3    . DC  B 2 13 ? 82.615 60.381 29.369 1.00 50.59 ? 29  DC  C N3    1 
ATOM   544 C C4    . DC  B 2 13 ? 82.270 60.517 28.090 1.00 49.62 ? 29  DC  C C4    1 
ATOM   545 N N4    . DC  B 2 13 ? 81.785 59.441 27.473 1.00 45.08 ? 29  DC  C N4    1 
ATOM   546 C C5    . DC  B 2 13 ? 82.400 61.800 27.446 1.00 44.97 ? 29  DC  C C5    1 
ATOM   547 C C6    . DC  B 2 13 ? 82.866 62.835 28.193 1.00 35.68 ? 29  DC  C C6    1 
ATOM   548 N N     . GLY C 3 1  ? 78.895 65.583 34.537 1.00 67.59 ? 139 GLY A N     1 
ATOM   549 C CA    . GLY C 3 1  ? 77.456 65.531 34.479 1.00 67.23 ? 139 GLY A CA    1 
ATOM   550 C C     . GLY C 3 1  ? 77.075 66.216 33.185 1.00 65.90 ? 139 GLY A C     1 
ATOM   551 O O     . GLY C 3 1  ? 77.997 66.743 32.531 1.00 67.99 ? 139 GLY A O     1 
ATOM   552 N N     . ARG C 3 2  ? 75.806 66.093 32.785 1.00 63.85 ? 140 ARG A N     1 
ATOM   553 C CA    . ARG C 3 2  ? 75.262 66.688 31.573 1.00 60.95 ? 140 ARG A CA    1 
ATOM   554 C C     . ARG C 3 2  ? 75.117 68.197 31.764 1.00 60.16 ? 140 ARG A C     1 
ATOM   555 O O     . ARG C 3 2  ? 75.306 68.714 32.884 1.00 61.27 ? 140 ARG A O     1 
ATOM   556 C CB    . ARG C 3 2  ? 73.929 66.038 31.319 1.00 58.49 ? 140 ARG A CB    1 
ATOM   557 C CG    . ARG C 3 2  ? 73.268 66.086 29.969 1.00 49.14 ? 140 ARG A CG    1 
ATOM   558 C CD    . ARG C 3 2  ? 71.897 65.715 30.393 1.00 44.06 ? 140 ARG A CD    1 
ATOM   559 N NE    . ARG C 3 2  ? 71.023 65.284 29.331 1.00 45.40 ? 140 ARG A NE    1 
ATOM   560 C CZ    . ARG C 3 2  ? 70.518 66.122 28.413 1.00 46.50 ? 140 ARG A CZ    1 
ATOM   561 N NH1   . ARG C 3 2  ? 70.773 67.461 28.338 1.00 47.41 ? 140 ARG A NH1   1 
ATOM   562 N NH2   . ARG C 3 2  ? 69.589 65.591 27.629 1.00 42.00 ? 140 ARG A NH2   1 
ATOM   563 N N     . PRO C 3 3  ? 74.867 68.944 30.685 1.00 58.90 ? 141 PRO A N     1 
ATOM   564 C CA    . PRO C 3 3  ? 74.560 70.364 30.760 1.00 59.55 ? 141 PRO A CA    1 
ATOM   565 C C     . PRO C 3 3  ? 73.109 70.773 30.949 1.00 61.17 ? 141 PRO A C     1 
ATOM   566 O O     . PRO C 3 3  ? 72.184 70.351 30.242 1.00 57.83 ? 141 PRO A O     1 
ATOM   567 C CB    . PRO C 3 3  ? 75.139 70.915 29.508 1.00 60.89 ? 141 PRO A CB    1 
ATOM   568 C CG    . PRO C 3 3  ? 74.853 69.802 28.549 1.00 62.89 ? 141 PRO A CG    1 
ATOM   569 C CD    . PRO C 3 3  ? 75.354 68.631 29.339 1.00 62.13 ? 141 PRO A CD    1 
ATOM   570 N N     . ARG C 3 4  ? 73.036 71.670 31.937 1.00 61.06 ? 142 ARG A N     1 
ATOM   571 C CA    . ARG C 3 4  ? 71.840 72.335 32.430 1.00 60.43 ? 142 ARG A CA    1 
ATOM   572 C C     . ARG C 3 4  ? 71.107 72.843 31.205 1.00 64.87 ? 142 ARG A C     1 
ATOM   573 O O     . ARG C 3 4  ? 71.712 73.673 30.527 1.00 71.83 ? 142 ARG A O     1 
ATOM   574 C CB    . ARG C 3 4  ? 72.317 73.464 33.304 1.00 55.88 ? 142 ARG A CB    1 
ATOM   575 C CG    . ARG C 3 4  ? 71.361 74.065 34.290 1.00 46.74 ? 142 ARG A CG    1 
ATOM   576 C CD    . ARG C 3 4  ? 71.463 73.167 35.467 1.00 35.44 ? 142 ARG A CD    1 
ATOM   577 N NE    . ARG C 3 4  ? 70.126 73.065 35.969 1.00 49.86 ? 142 ARG A NE    1 
ATOM   578 C CZ    . ARG C 3 4  ? 69.724 73.737 37.049 1.00 57.65 ? 142 ARG A CZ    1 
ATOM   579 N NH1   . ARG C 3 4  ? 70.572 74.535 37.712 1.00 59.00 ? 142 ARG A NH1   1 
ATOM   580 N NH2   . ARG C 3 4  ? 68.440 73.644 37.440 1.00 61.27 ? 142 ARG A NH2   1 
ATOM   581 N N     . ALA C 3 5  ? 69.864 72.475 30.886 1.00 65.95 ? 143 ALA A N     1 
ATOM   582 C CA    . ALA C 3 5  ? 69.329 72.847 29.583 1.00 68.93 ? 143 ALA A CA    1 
ATOM   583 C C     . ALA C 3 5  ? 69.043 74.312 29.327 1.00 70.16 ? 143 ALA A C     1 
ATOM   584 O O     . ALA C 3 5  ? 69.190 74.775 28.187 1.00 72.31 ? 143 ALA A O     1 
ATOM   585 C CB    . ALA C 3 5  ? 68.050 72.129 29.299 1.00 68.45 ? 143 ALA A CB    1 
ATOM   586 N N     . ILE C 3 6  ? 68.628 75.094 30.326 1.00 66.84 ? 144 ILE A N     1 
ATOM   587 C CA    . ILE C 3 6  ? 68.405 76.491 30.038 1.00 62.07 ? 144 ILE A CA    1 
ATOM   588 C C     . ILE C 3 6  ? 69.546 77.199 30.696 1.00 63.37 ? 144 ILE A C     1 
ATOM   589 O O     . ILE C 3 6  ? 69.811 77.187 31.902 1.00 59.11 ? 144 ILE A O     1 
ATOM   590 C CB    . ILE C 3 6  ? 67.059 76.971 30.562 1.00 57.28 ? 144 ILE A CB    1 
ATOM   591 C CG1   . ILE C 3 6  ? 66.626 76.205 31.781 1.00 53.08 ? 144 ILE A CG1   1 
ATOM   592 C CG2   . ILE C 3 6  ? 66.112 76.915 29.383 1.00 50.80 ? 144 ILE A CG2   1 
ATOM   593 C CD1   . ILE C 3 6  ? 65.122 76.214 32.022 1.00 61.66 ? 144 ILE A CD1   1 
ATOM   594 N N     . ASN C 3 7  ? 70.188 77.799 29.703 1.00 68.14 ? 145 ASN A N     1 
ATOM   595 C CA    . ASN C 3 7  ? 71.449 78.530 29.794 1.00 72.26 ? 145 ASN A CA    1 
ATOM   596 C C     . ASN C 3 7  ? 71.279 79.892 30.534 1.00 71.60 ? 145 ASN A C     1 
ATOM   597 O O     . ASN C 3 7  ? 71.193 81.010 29.994 1.00 69.25 ? 145 ASN A O     1 
ATOM   598 C CB    . ASN C 3 7  ? 71.989 78.636 28.299 1.00 76.30 ? 145 ASN A CB    1 
ATOM   599 C CG    . ASN C 3 7  ? 71.558 77.534 27.270 1.00 77.77 ? 145 ASN A CG    1 
ATOM   600 O OD1   . ASN C 3 7  ? 70.837 77.850 26.322 1.00 74.45 ? 145 ASN A OD1   1 
ATOM   601 N ND2   . ASN C 3 7  ? 71.804 76.224 27.273 1.00 72.38 ? 145 ASN A ND2   1 
ATOM   602 N N     . LYS C 3 8  ? 71.119 79.645 31.860 1.00 71.29 ? 146 LYS A N     1 
ATOM   603 C CA    . LYS C 3 8  ? 70.844 80.521 33.018 1.00 68.54 ? 146 LYS A CA    1 
ATOM   604 C C     . LYS C 3 8  ? 70.252 81.878 32.810 1.00 65.74 ? 146 LYS A C     1 
ATOM   605 O O     . LYS C 3 8  ? 69.237 82.165 33.433 1.00 61.80 ? 146 LYS A O     1 
ATOM   606 C CB    . LYS C 3 8  ? 72.095 80.758 33.904 1.00 71.52 ? 146 LYS A CB    1 
ATOM   607 C CG    . LYS C 3 8  ? 71.888 81.088 35.413 1.00 69.02 ? 146 LYS A CG    1 
ATOM   608 C CD    . LYS C 3 8  ? 71.505 82.519 35.740 1.00 62.65 ? 146 LYS A CD    1 
ATOM   609 C CE    . LYS C 3 8  ? 70.122 82.599 36.343 1.00 61.74 ? 146 LYS A CE    1 
ATOM   610 N NZ    . LYS C 3 8  ? 69.477 83.787 35.818 1.00 62.34 ? 146 LYS A NZ    1 
ATOM   611 N N     . HIS C 3 9  ? 70.796 82.747 31.973 1.00 67.02 ? 147 HIS A N     1 
ATOM   612 C CA    . HIS C 3 9  ? 70.137 84.018 31.782 1.00 67.93 ? 147 HIS A CA    1 
ATOM   613 C C     . HIS C 3 9  ? 68.791 83.703 31.112 1.00 68.66 ? 147 HIS A C     1 
ATOM   614 O O     . HIS C 3 9  ? 67.868 84.529 31.173 1.00 69.97 ? 147 HIS A O     1 
ATOM   615 C CB    . HIS C 3 9  ? 71.012 84.921 30.915 1.00 74.45 ? 147 HIS A CB    1 
ATOM   616 C CG    . HIS C 3 9  ? 70.713 84.912 29.412 1.00 76.96 ? 147 HIS A CG    1 
ATOM   617 N ND1   . HIS C 3 9  ? 69.825 85.676 28.771 1.00 79.31 ? 147 HIS A ND1   1 
ATOM   618 C CD2   . HIS C 3 9  ? 71.322 84.094 28.479 1.00 78.66 ? 147 HIS A CD2   1 
ATOM   619 C CE1   . HIS C 3 9  ? 69.875 85.345 27.503 1.00 77.78 ? 147 HIS A CE1   1 
ATOM   620 N NE2   . HIS C 3 9  ? 70.770 84.396 27.336 1.00 77.12 ? 147 HIS A NE2   1 
ATOM   621 N N     . GLU C 3 10 ? 68.649 82.522 30.463 1.00 65.22 ? 148 GLU A N     1 
ATOM   622 C CA    . GLU C 3 10 ? 67.362 82.120 29.921 1.00 62.18 ? 148 GLU A CA    1 
ATOM   623 C C     . GLU C 3 10 ? 66.397 81.701 30.987 1.00 62.48 ? 148 GLU A C     1 
ATOM   624 O O     . GLU C 3 10 ? 65.228 81.587 30.692 1.00 65.22 ? 148 GLU A O     1 
ATOM   625 C CB    . GLU C 3 10 ? 67.488 80.996 28.981 1.00 52.68 ? 148 GLU A CB    1 
ATOM   626 C CG    . GLU C 3 10 ? 68.152 81.660 27.823 1.00 52.49 ? 148 GLU A CG    1 
ATOM   627 C CD    . GLU C 3 10 ? 69.045 80.758 27.009 1.00 56.53 ? 148 GLU A CD    1 
ATOM   628 O OE1   . GLU C 3 10 ? 69.132 79.584 27.312 1.00 62.80 ? 148 GLU A OE1   1 
ATOM   629 O OE2   . GLU C 3 10 ? 69.657 81.207 26.048 1.00 58.55 ? 148 GLU A OE2   1 
ATOM   630 N N     . GLN C 3 11 ? 66.765 81.515 32.246 1.00 64.25 ? 149 GLN A N     1 
ATOM   631 C CA    . GLN C 3 11 ? 65.809 81.201 33.313 1.00 67.87 ? 149 GLN A CA    1 
ATOM   632 C C     . GLN C 3 11 ? 65.050 82.496 33.672 1.00 70.07 ? 149 GLN A C     1 
ATOM   633 O O     . GLN C 3 11 ? 63.870 82.513 34.016 1.00 69.93 ? 149 GLN A O     1 
ATOM   634 C CB    . GLN C 3 11 ? 66.603 80.605 34.503 1.00 64.67 ? 149 GLN A CB    1 
ATOM   635 C CG    . GLN C 3 11 ? 67.282 79.347 33.916 1.00 62.48 ? 149 GLN A CG    1 
ATOM   636 C CD    . GLN C 3 11 ? 68.211 78.487 34.757 1.00 61.73 ? 149 GLN A CD    1 
ATOM   637 O OE1   . GLN C 3 11 ? 68.482 78.778 35.914 1.00 62.67 ? 149 GLN A OE1   1 
ATOM   638 N NE2   . GLN C 3 11 ? 68.740 77.396 34.223 1.00 56.31 ? 149 GLN A NE2   1 
ATOM   639 N N     . GLU C 3 12 ? 65.689 83.648 33.478 1.00 71.81 ? 150 GLU A N     1 
ATOM   640 C CA    . GLU C 3 12 ? 65.093 84.965 33.691 1.00 70.45 ? 150 GLU A CA    1 
ATOM   641 C C     . GLU C 3 12 ? 64.033 85.151 32.637 1.00 68.56 ? 150 GLU A C     1 
ATOM   642 O O     . GLU C 3 12 ? 62.846 85.240 32.953 1.00 70.57 ? 150 GLU A O     1 
ATOM   643 C CB    . GLU C 3 12 ? 66.113 86.075 33.518 1.00 74.16 ? 150 GLU A CB    1 
ATOM   644 C CG    . GLU C 3 12 ? 67.431 85.811 34.233 1.00 69.70 ? 150 GLU A CG    1 
ATOM   645 C CD    . GLU C 3 12 ? 68.303 87.021 34.126 1.00 69.66 ? 150 GLU A CD    1 
ATOM   646 O OE1   . GLU C 3 12 ? 68.009 87.955 34.865 1.00 71.10 ? 150 GLU A OE1   1 
ATOM   647 O OE2   . GLU C 3 12 ? 69.227 87.029 33.308 1.00 69.58 ? 150 GLU A OE2   1 
ATOM   648 N N     . GLN C 3 13 ? 64.551 85.081 31.400 1.00 65.16 ? 151 GLN A N     1 
ATOM   649 C CA    . GLN C 3 13 ? 63.818 85.197 30.154 1.00 61.08 ? 151 GLN A CA    1 
ATOM   650 C C     . GLN C 3 13 ? 62.532 84.396 30.243 1.00 59.57 ? 151 GLN A C     1 
ATOM   651 O O     . GLN C 3 13 ? 61.430 84.938 30.090 1.00 61.40 ? 151 GLN A O     1 
ATOM   652 C CB    . GLN C 3 13 ? 64.742 84.693 29.055 1.00 63.68 ? 151 GLN A CB    1 
ATOM   653 C CG    . GLN C 3 13 ? 64.522 85.142 27.610 1.00 73.85 ? 151 GLN A CG    1 
ATOM   654 C CD    . GLN C 3 13 ? 65.579 84.608 26.634 1.00 78.41 ? 151 GLN A CD    1 
ATOM   655 O OE1   . GLN C 3 13 ? 66.728 84.312 26.994 1.00 77.60 ? 151 GLN A OE1   1 
ATOM   656 N NE2   . GLN C 3 13 ? 65.251 84.481 25.354 1.00 76.01 ? 151 GLN A NE2   1 
ATOM   657 N N     . ILE C 3 14 ? 62.640 83.112 30.596 1.00 56.99 ? 152 ILE A N     1 
ATOM   658 C CA    . ILE C 3 14 ? 61.445 82.319 30.725 1.00 53.59 ? 152 ILE A CA    1 
ATOM   659 C C     . ILE C 3 14 ? 60.664 82.762 31.928 1.00 54.67 ? 152 ILE A C     1 
ATOM   660 O O     . ILE C 3 14 ? 59.563 83.203 31.631 1.00 59.59 ? 152 ILE A O     1 
ATOM   661 C CB    . ILE C 3 14 ? 61.784 80.864 30.826 1.00 43.90 ? 152 ILE A CB    1 
ATOM   662 C CG1   . ILE C 3 14 ? 62.360 80.438 29.501 1.00 42.56 ? 152 ILE A CG1   1 
ATOM   663 C CG2   . ILE C 3 14 ? 60.564 80.048 31.035 1.00 39.95 ? 152 ILE A CG2   1 
ATOM   664 C CD1   . ILE C 3 14 ? 63.390 79.311 29.688 1.00 46.79 ? 152 ILE A CD1   1 
ATOM   665 N N     . SER C 3 15 ? 61.081 82.787 33.190 1.00 55.38 ? 153 SER A N     1 
ATOM   666 C CA    . SER C 3 15 ? 60.209 83.170 34.301 1.00 55.35 ? 153 SER A CA    1 
ATOM   667 C C     . SER C 3 15 ? 59.222 84.265 33.952 1.00 54.32 ? 153 SER A C     1 
ATOM   668 O O     . SER C 3 15 ? 58.005 84.118 34.033 1.00 54.95 ? 153 SER A O     1 
ATOM   669 C CB    . SER C 3 15 ? 60.988 83.690 35.485 1.00 57.97 ? 153 SER A CB    1 
ATOM   670 O OG    . SER C 3 15 ? 61.895 82.737 35.967 1.00 66.25 ? 153 SER A OG    1 
ATOM   671 N N     . ARG C 3 16 ? 59.836 85.239 33.304 1.00 55.73 ? 154 ARG A N     1 
ATOM   672 C CA    . ARG C 3 16 ? 59.150 86.406 32.882 1.00 59.05 ? 154 ARG A CA    1 
ATOM   673 C C     . ARG C 3 16 ? 58.137 85.933 31.889 1.00 58.19 ? 154 ARG A C     1 
ATOM   674 O O     . ARG C 3 16 ? 56.979 85.865 32.277 1.00 59.30 ? 154 ARG A O     1 
ATOM   675 C CB    . ARG C 3 16 ? 60.117 87.368 32.236 1.00 67.74 ? 154 ARG A CB    1 
ATOM   676 C CG    . ARG C 3 16 ? 59.788 88.871 32.310 1.00 69.56 ? 154 ARG A CG    1 
ATOM   677 C CD    . ARG C 3 16 ? 60.278 89.605 31.045 1.00 74.34 ? 154 ARG A CD    1 
ATOM   678 N NE    . ARG C 3 16 ? 59.236 89.580 30.025 1.00 69.91 ? 154 ARG A NE    1 
ATOM   679 C CZ    . ARG C 3 16 ? 59.469 89.508 28.714 1.00 72.35 ? 154 ARG A CZ    1 
ATOM   680 N NH1   . ARG C 3 16 ? 60.703 89.453 28.178 1.00 71.56 ? 154 ARG A NH1   1 
ATOM   681 N NH2   . ARG C 3 16 ? 58.392 89.521 27.927 1.00 73.60 ? 154 ARG A NH2   1 
ATOM   682 N N     . LEU C 3 17 ? 58.492 85.493 30.694 1.00 58.39 ? 155 LEU A N     1 
ATOM   683 C CA    . LEU C 3 17 ? 57.479 85.185 29.708 1.00 60.14 ? 155 LEU A CA    1 
ATOM   684 C C     . LEU C 3 17 ? 56.352 84.315 30.202 1.00 63.04 ? 155 LEU A C     1 
ATOM   685 O O     . LEU C 3 17 ? 55.206 84.629 29.873 1.00 64.92 ? 155 LEU A O     1 
ATOM   686 C CB    . LEU C 3 17 ? 58.065 84.494 28.522 1.00 57.22 ? 155 LEU A CB    1 
ATOM   687 C CG    . LEU C 3 17 ? 59.163 85.226 27.817 1.00 59.00 ? 155 LEU A CG    1 
ATOM   688 C CD1   . LEU C 3 17 ? 59.764 84.340 26.760 1.00 53.38 ? 155 LEU A CD1   1 
ATOM   689 C CD2   . LEU C 3 17 ? 58.605 86.488 27.236 1.00 59.91 ? 155 LEU A CD2   1 
ATOM   690 N N     . LEU C 3 18 ? 56.577 83.287 31.018 1.00 65.34 ? 156 LEU A N     1 
ATOM   691 C CA    . LEU C 3 18 ? 55.439 82.464 31.413 1.00 68.05 ? 156 LEU A CA    1 
ATOM   692 C C     . LEU C 3 18 ? 54.636 83.071 32.560 1.00 68.72 ? 156 LEU A C     1 
ATOM   693 O O     . LEU C 3 18 ? 53.402 82.944 32.537 1.00 67.07 ? 156 LEU A O     1 
ATOM   694 C CB    . LEU C 3 18 ? 55.892 81.001 31.744 1.00 66.14 ? 156 LEU A CB    1 
ATOM   695 C CG    . LEU C 3 18 ? 56.787 80.476 32.851 1.00 61.04 ? 156 LEU A CG    1 
ATOM   696 C CD1   . LEU C 3 18 ? 56.054 80.341 34.195 1.00 60.12 ? 156 LEU A CD1   1 
ATOM   697 C CD2   . LEU C 3 18 ? 57.261 79.106 32.398 1.00 57.15 ? 156 LEU A CD2   1 
ATOM   698 N N     . GLU C 3 19 ? 55.238 83.791 33.509 1.00 67.43 ? 157 GLU A N     1 
ATOM   699 C CA    . GLU C 3 19 ? 54.448 84.464 34.514 1.00 67.60 ? 157 GLU A CA    1 
ATOM   700 C C     . GLU C 3 19 ? 53.703 85.638 33.867 1.00 66.74 ? 157 GLU A C     1 
ATOM   701 O O     . GLU C 3 19 ? 52.748 86.156 34.438 1.00 66.50 ? 157 GLU A O     1 
ATOM   702 C CB    . GLU C 3 19 ? 55.349 84.957 35.655 1.00 73.63 ? 157 GLU A CB    1 
ATOM   703 C CG    . GLU C 3 19 ? 55.730 83.880 36.695 1.00 78.73 ? 157 GLU A CG    1 
ATOM   704 C CD    . GLU C 3 19 ? 56.511 84.407 37.903 1.00 82.70 ? 157 GLU A CD    1 
ATOM   705 O OE1   . GLU C 3 19 ? 55.914 84.918 38.862 1.00 87.57 ? 157 GLU A OE1   1 
ATOM   706 O OE2   . GLU C 3 19 ? 57.738 84.312 37.871 1.00 86.13 ? 157 GLU A OE2   1 
ATOM   707 N N     . LYS C 3 20 ? 54.100 86.126 32.688 1.00 67.29 ? 158 LYS A N     1 
ATOM   708 C CA    . LYS C 3 20 ? 53.298 87.097 31.962 1.00 65.14 ? 158 LYS A CA    1 
ATOM   709 C C     . LYS C 3 20 ? 52.504 86.306 30.888 1.00 64.57 ? 158 LYS A C     1 
ATOM   710 O O     . LYS C 3 20 ? 52.461 86.612 29.692 1.00 66.02 ? 158 LYS A O     1 
ATOM   711 C CB    . LYS C 3 20 ? 54.266 88.154 31.393 1.00 62.98 ? 158 LYS A CB    1 
ATOM   712 C CG    . LYS C 3 20 ? 53.716 89.384 30.654 1.00 66.31 ? 158 LYS A CG    1 
ATOM   713 C CD    . LYS C 3 20 ? 54.599 89.744 29.401 1.00 70.81 ? 158 LYS A CD    1 
ATOM   714 C CE    . LYS C 3 20 ? 54.532 88.703 28.226 1.00 72.61 ? 158 LYS A CE    1 
ATOM   715 N NZ    . LYS C 3 20 ? 55.316 88.990 27.029 1.00 64.95 ? 158 LYS A NZ    1 
ATOM   716 N N     . GLY C 3 21 ? 51.897 85.183 31.287 1.00 62.84 ? 159 GLY A N     1 
ATOM   717 C CA    . GLY C 3 21 ? 50.937 84.464 30.462 1.00 64.23 ? 159 GLY A CA    1 
ATOM   718 C C     . GLY C 3 21 ? 51.465 83.610 29.327 1.00 63.04 ? 159 GLY A C     1 
ATOM   719 O O     . GLY C 3 21 ? 50.857 83.543 28.247 1.00 62.74 ? 159 GLY A O     1 
ATOM   720 N N     . HIS C 3 22 ? 52.567 82.895 29.498 1.00 60.11 ? 160 HIS A N     1 
ATOM   721 C CA    . HIS C 3 22 ? 52.991 82.094 28.376 1.00 59.02 ? 160 HIS A CA    1 
ATOM   722 C C     . HIS C 3 22 ? 52.906 80.623 28.679 1.00 56.29 ? 160 HIS A C     1 
ATOM   723 O O     . HIS C 3 22 ? 53.263 80.151 29.759 1.00 54.03 ? 160 HIS A O     1 
ATOM   724 C CB    . HIS C 3 22 ? 54.410 82.443 27.945 1.00 64.97 ? 160 HIS A CB    1 
ATOM   725 C CG    . HIS C 3 22 ? 54.528 83.652 27.016 1.00 66.93 ? 160 HIS A CG    1 
ATOM   726 N ND1   . HIS C 3 22 ? 54.805 84.929 27.269 1.00 69.54 ? 160 HIS A ND1   1 
ATOM   727 C CD2   . HIS C 3 22 ? 54.394 83.555 25.658 1.00 66.78 ? 160 HIS A CD2   1 
ATOM   728 C CE1   . HIS C 3 22 ? 54.849 85.575 26.127 1.00 70.14 ? 160 HIS A CE1   1 
ATOM   729 N NE2   . HIS C 3 22 ? 54.603 84.731 25.151 1.00 67.15 ? 160 HIS A NE2   1 
ATOM   730 N N     . PRO C 3 23 ? 52.347 79.883 27.725 1.00 56.18 ? 161 PRO A N     1 
ATOM   731 C CA    . PRO C 3 23 ? 52.242 78.438 27.770 1.00 55.06 ? 161 PRO A CA    1 
ATOM   732 C C     . PRO C 3 23 ? 53.549 77.718 27.590 1.00 53.55 ? 161 PRO A C     1 
ATOM   733 O O     . PRO C 3 23 ? 54.323 77.953 26.635 1.00 51.84 ? 161 PRO A O     1 
ATOM   734 C CB    . PRO C 3 23 ? 51.231 78.082 26.689 1.00 58.54 ? 161 PRO A CB    1 
ATOM   735 C CG    . PRO C 3 23 ? 51.279 79.228 25.741 1.00 58.46 ? 161 PRO A CG    1 
ATOM   736 C CD    . PRO C 3 23 ? 51.402 80.388 26.732 1.00 59.54 ? 161 PRO A CD    1 
ATOM   737 N N     . ARG C 3 24 ? 53.721 76.752 28.492 1.00 50.80 ? 162 ARG A N     1 
ATOM   738 C CA    . ARG C 3 24 ? 54.952 76.018 28.427 1.00 46.13 ? 162 ARG A CA    1 
ATOM   739 C C     . ARG C 3 24 ? 55.056 75.280 27.137 1.00 44.64 ? 162 ARG A C     1 
ATOM   740 O O     . ARG C 3 24 ? 56.092 75.424 26.527 1.00 45.15 ? 162 ARG A O     1 
ATOM   741 C CB    . ARG C 3 24 ? 55.103 74.989 29.479 1.00 46.46 ? 162 ARG A CB    1 
ATOM   742 C CG    . ARG C 3 24 ? 55.824 75.484 30.679 1.00 38.85 ? 162 ARG A CG    1 
ATOM   743 C CD    . ARG C 3 24 ? 54.678 75.897 31.532 1.00 49.26 ? 162 ARG A CD    1 
ATOM   744 N NE    . ARG C 3 24 ? 55.095 75.681 32.896 1.00 51.32 ? 162 ARG A NE    1 
ATOM   745 C CZ    . ARG C 3 24 ? 54.524 76.347 33.886 1.00 51.96 ? 162 ARG A CZ    1 
ATOM   746 N NH1   . ARG C 3 24 ? 53.548 77.258 33.663 1.00 46.77 ? 162 ARG A NH1   1 
ATOM   747 N NH2   . ARG C 3 24 ? 54.985 76.078 35.104 1.00 50.05 ? 162 ARG A NH2   1 
ATOM   748 N N     . GLN C 3 25 ? 54.025 74.631 26.627 1.00 43.49 ? 163 GLN A N     1 
ATOM   749 C CA    . GLN C 3 25 ? 54.140 73.832 25.428 1.00 47.70 ? 163 GLN A CA    1 
ATOM   750 C C     . GLN C 3 25 ? 54.730 74.735 24.351 1.00 52.69 ? 163 GLN A C     1 
ATOM   751 O O     . GLN C 3 25 ? 55.628 74.345 23.630 1.00 54.17 ? 163 GLN A O     1 
ATOM   752 C CB    . GLN C 3 25 ? 52.739 73.291 25.066 1.00 49.28 ? 163 GLN A CB    1 
ATOM   753 C CG    . GLN C 3 25 ? 52.019 72.248 25.991 1.00 52.91 ? 163 GLN A CG    1 
ATOM   754 C CD    . GLN C 3 25 ? 51.750 72.636 27.479 1.00 58.98 ? 163 GLN A CD    1 
ATOM   755 O OE1   . GLN C 3 25 ? 51.779 73.827 27.851 1.00 50.99 ? 163 GLN A OE1   1 
ATOM   756 N NE2   . GLN C 3 25 ? 51.492 71.687 28.408 1.00 51.43 ? 163 GLN A NE2   1 
ATOM   757 N N     . GLN C 3 26 ? 54.409 76.029 24.365 1.00 57.26 ? 164 GLN A N     1 
ATOM   758 C CA    . GLN C 3 26 ? 54.979 76.982 23.434 1.00 62.66 ? 164 GLN A CA    1 
ATOM   759 C C     . GLN C 3 26 ? 56.458 77.188 23.738 1.00 65.22 ? 164 GLN A C     1 
ATOM   760 O O     . GLN C 3 26 ? 57.309 76.917 22.882 1.00 65.15 ? 164 GLN A O     1 
ATOM   761 C CB    . GLN C 3 26 ? 54.215 78.293 23.565 1.00 67.02 ? 164 GLN A CB    1 
ATOM   762 C CG    . GLN C 3 26 ? 54.999 79.559 23.199 1.00 70.76 ? 164 GLN A CG    1 
ATOM   763 C CD    . GLN C 3 26 ? 54.306 80.892 23.468 1.00 69.56 ? 164 GLN A CD    1 
ATOM   764 O OE1   . GLN C 3 26 ? 54.942 81.930 23.605 1.00 68.75 ? 164 GLN A OE1   1 
ATOM   765 N NE2   . GLN C 3 26 ? 52.994 81.047 23.424 1.00 69.67 ? 164 GLN A NE2   1 
ATOM   766 N N     . LEU C 3 27 ? 56.764 77.638 24.970 1.00 64.61 ? 165 LEU A N     1 
ATOM   767 C CA    . LEU C 3 27 ? 58.135 77.992 25.393 1.00 61.74 ? 165 LEU A CA    1 
ATOM   768 C C     . LEU C 3 27 ? 59.215 76.930 25.226 1.00 61.58 ? 165 LEU A C     1 
ATOM   769 O O     . LEU C 3 27 ? 60.378 77.239 24.979 1.00 61.82 ? 165 LEU A O     1 
ATOM   770 C CB    . LEU C 3 27 ? 58.107 78.446 26.849 1.00 57.32 ? 165 LEU A CB    1 
ATOM   771 C CG    . LEU C 3 27 ? 57.203 79.659 27.192 1.00 57.60 ? 165 LEU A CG    1 
ATOM   772 C CD1   . LEU C 3 27 ? 57.377 80.021 28.646 1.00 56.00 ? 165 LEU A CD1   1 
ATOM   773 C CD2   . LEU C 3 27 ? 57.635 80.926 26.483 1.00 53.39 ? 165 LEU A CD2   1 
ATOM   774 N N     . ALA C 3 28 ? 58.771 75.681 25.267 1.00 65.80 ? 166 ALA A N     1 
ATOM   775 C CA    . ALA C 3 28 ? 59.582 74.512 25.007 1.00 65.36 ? 166 ALA A CA    1 
ATOM   776 C C     . ALA C 3 28 ? 59.869 74.160 23.562 1.00 65.10 ? 166 ALA A C     1 
ATOM   777 O O     . ALA C 3 28 ? 60.718 73.283 23.386 1.00 68.45 ? 166 ALA A O     1 
ATOM   778 C CB    . ALA C 3 28 ? 58.965 73.273 25.574 1.00 71.47 ? 166 ALA A CB    1 
ATOM   779 N N     . ILE C 3 29 ? 59.256 74.668 22.494 1.00 64.13 ? 167 ILE A N     1 
ATOM   780 C CA    . ILE C 3 29 ? 59.798 74.307 21.185 1.00 67.66 ? 167 ILE A CA    1 
ATOM   781 C C     . ILE C 3 29 ? 60.507 75.482 20.528 1.00 68.15 ? 167 ILE A C     1 
ATOM   782 O O     . ILE C 3 29 ? 61.139 75.359 19.470 1.00 68.89 ? 167 ILE A O     1 
ATOM   783 C CB    . ILE C 3 29 ? 58.760 73.826 20.166 1.00 69.66 ? 167 ILE A CB    1 
ATOM   784 C CG1   . ILE C 3 29 ? 57.340 73.636 20.725 1.00 73.95 ? 167 ILE A CG1   1 
ATOM   785 C CG2   . ILE C 3 29 ? 59.408 72.557 19.591 1.00 70.30 ? 167 ILE A CG2   1 
ATOM   786 C CD1   . ILE C 3 29 ? 56.228 74.624 20.263 1.00 74.40 ? 167 ILE A CD1   1 
ATOM   787 N N     . ILE C 3 30 ? 60.330 76.675 21.101 1.00 65.76 ? 168 ILE A N     1 
ATOM   788 C CA    . ILE C 3 30 ? 61.079 77.802 20.623 1.00 64.03 ? 168 ILE A CA    1 
ATOM   789 C C     . ILE C 3 30 ? 62.376 77.526 21.323 1.00 61.48 ? 168 ILE A C     1 
ATOM   790 O O     . ILE C 3 30 ? 63.323 77.178 20.617 1.00 62.26 ? 168 ILE A O     1 
ATOM   791 C CB    . ILE C 3 30 ? 60.446 79.099 21.072 1.00 63.96 ? 168 ILE A CB    1 
ATOM   792 C CG1   . ILE C 3 30 ? 59.137 79.213 20.344 1.00 63.69 ? 168 ILE A CG1   1 
ATOM   793 C CG2   . ILE C 3 30 ? 61.324 80.291 20.769 1.00 60.96 ? 168 ILE A CG2   1 
ATOM   794 C CD1   . ILE C 3 30 ? 58.348 80.507 20.560 1.00 66.41 ? 168 ILE A CD1   1 
ATOM   795 N N     . PHE C 3 31 ? 62.498 77.592 22.651 1.00 58.17 ? 169 PHE A N     1 
ATOM   796 C CA    . PHE C 3 31 ? 63.781 77.235 23.237 1.00 58.97 ? 169 PHE A CA    1 
ATOM   797 C C     . PHE C 3 31 ? 63.459 75.793 23.311 1.00 61.10 ? 169 PHE A C     1 
ATOM   798 O O     . PHE C 3 31 ? 62.466 75.448 23.947 1.00 63.35 ? 169 PHE A O     1 
ATOM   799 C CB    . PHE C 3 31 ? 64.014 77.607 24.659 1.00 55.82 ? 169 PHE A CB    1 
ATOM   800 C CG    . PHE C 3 31 ? 63.734 79.037 24.996 1.00 58.56 ? 169 PHE A CG    1 
ATOM   801 C CD1   . PHE C 3 31 ? 64.694 80.006 24.702 1.00 57.07 ? 169 PHE A CD1   1 
ATOM   802 C CD2   . PHE C 3 31 ? 62.540 79.349 25.652 1.00 58.73 ? 169 PHE A CD2   1 
ATOM   803 C CE1   . PHE C 3 31 ? 64.439 81.321 25.085 1.00 66.85 ? 169 PHE A CE1   1 
ATOM   804 C CE2   . PHE C 3 31 ? 62.297 80.665 26.035 1.00 60.41 ? 169 PHE A CE2   1 
ATOM   805 C CZ    . PHE C 3 31 ? 63.244 81.648 25.752 1.00 66.62 ? 169 PHE A CZ    1 
ATOM   806 N N     . GLY C 3 32 ? 64.255 74.967 22.676 1.00 62.20 ? 170 GLY A N     1 
ATOM   807 C CA    . GLY C 3 32 ? 63.928 73.532 22.599 1.00 61.35 ? 170 GLY A CA    1 
ATOM   808 C C     . GLY C 3 32 ? 64.255 72.683 23.822 1.00 58.67 ? 170 GLY A C     1 
ATOM   809 O O     . GLY C 3 32 ? 65.344 72.128 23.995 1.00 61.03 ? 170 GLY A O     1 
ATOM   810 N N     . ILE C 3 33 ? 63.349 72.620 24.741 1.00 56.35 ? 171 ILE A N     1 
ATOM   811 C CA    . ILE C 3 33 ? 63.636 71.820 25.878 1.00 55.04 ? 171 ILE A CA    1 
ATOM   812 C C     . ILE C 3 33 ? 62.400 70.943 25.907 1.00 54.23 ? 171 ILE A C     1 
ATOM   813 O O     . ILE C 3 33 ? 61.594 70.900 24.963 1.00 53.81 ? 171 ILE A O     1 
ATOM   814 C CB    . ILE C 3 33 ? 63.868 72.775 27.122 1.00 53.98 ? 171 ILE A CB    1 
ATOM   815 C CG1   . ILE C 3 33 ? 62.729 73.721 27.412 1.00 57.39 ? 171 ILE A CG1   1 
ATOM   816 C CG2   . ILE C 3 33 ? 65.129 73.627 26.820 1.00 55.44 ? 171 ILE A CG2   1 
ATOM   817 C CD1   . ILE C 3 33 ? 63.116 74.547 28.650 1.00 57.49 ? 171 ILE A CD1   1 
ATOM   818 N N     . GLY C 3 34 ? 62.251 70.139 26.938 1.00 48.55 ? 172 GLY A N     1 
ATOM   819 C CA    . GLY C 3 34 ? 61.071 69.328 26.976 1.00 46.64 ? 172 GLY A CA    1 
ATOM   820 C C     . GLY C 3 34 ? 60.191 70.027 27.941 1.00 41.74 ? 172 GLY A C     1 
ATOM   821 O O     . GLY C 3 34 ? 60.690 70.657 28.887 1.00 42.36 ? 172 GLY A O     1 
ATOM   822 N N     . VAL C 3 35 ? 58.892 69.861 27.751 1.00 38.81 ? 173 VAL A N     1 
ATOM   823 C CA    . VAL C 3 35 ? 57.954 70.459 28.687 1.00 34.26 ? 173 VAL A CA    1 
ATOM   824 C C     . VAL C 3 35 ? 58.171 69.954 30.103 1.00 31.26 ? 173 VAL A C     1 
ATOM   825 O O     . VAL C 3 35 ? 57.996 70.709 31.042 1.00 36.30 ? 173 VAL A O     1 
ATOM   826 C CB    . VAL C 3 35 ? 56.566 70.164 28.257 1.00 20.12 ? 173 VAL A CB    1 
ATOM   827 C CG1   . VAL C 3 35 ? 55.685 70.895 29.193 1.00 23.43 ? 173 VAL A CG1   1 
ATOM   828 C CG2   . VAL C 3 35 ? 56.259 70.680 26.855 1.00 22.77 ? 173 VAL A CG2   1 
ATOM   829 N N     . SER C 3 36 ? 58.605 68.735 30.326 1.00 33.72 ? 174 SER A N     1 
ATOM   830 C CA    . SER C 3 36 ? 58.783 68.234 31.677 1.00 39.96 ? 174 SER A CA    1 
ATOM   831 C C     . SER C 3 36 ? 59.830 69.045 32.415 1.00 43.65 ? 174 SER A C     1 
ATOM   832 O O     . SER C 3 36 ? 59.622 69.329 33.604 1.00 46.91 ? 174 SER A O     1 
ATOM   833 C CB    . SER C 3 36 ? 59.206 66.832 31.590 1.00 37.05 ? 174 SER A CB    1 
ATOM   834 O OG    . SER C 3 36 ? 58.515 66.308 30.455 1.00 50.56 ? 174 SER A OG    1 
ATOM   835 N N     . THR C 3 37 ? 60.895 69.483 31.682 1.00 47.88 ? 175 THR A N     1 
ATOM   836 C CA    . THR C 3 37 ? 62.010 70.300 32.181 1.00 46.54 ? 175 THR A CA    1 
ATOM   837 C C     . THR C 3 37 ? 61.520 71.630 32.725 1.00 50.19 ? 175 THR A C     1 
ATOM   838 O O     . THR C 3 37 ? 61.755 71.930 33.906 1.00 51.27 ? 175 THR A O     1 
ATOM   839 C CB    . THR C 3 37 ? 62.975 70.516 31.053 1.00 36.14 ? 175 THR A CB    1 
ATOM   840 O OG1   . THR C 3 37 ? 63.414 69.221 30.713 1.00 29.93 ? 175 THR A OG1   1 
ATOM   841 C CG2   . THR C 3 37 ? 64.160 71.381 31.406 1.00 36.32 ? 175 THR A CG2   1 
ATOM   842 N N     . LEU C 3 38 ? 60.760 72.361 31.875 1.00 52.65 ? 176 LEU A N     1 
ATOM   843 C CA    . LEU C 3 38 ? 60.098 73.617 32.250 1.00 49.69 ? 176 LEU A CA    1 
ATOM   844 C C     . LEU C 3 38 ? 59.212 73.406 33.488 1.00 50.18 ? 176 LEU A C     1 
ATOM   845 O O     . LEU C 3 38 ? 59.414 74.156 34.444 1.00 52.51 ? 176 LEU A O     1 
ATOM   846 C CB    . LEU C 3 38 ? 59.238 74.171 31.082 1.00 45.41 ? 176 LEU A CB    1 
ATOM   847 C CG    . LEU C 3 38 ? 60.008 74.734 29.886 1.00 33.09 ? 176 LEU A CG    1 
ATOM   848 C CD1   . LEU C 3 38 ? 59.215 74.970 28.627 1.00 28.92 ? 176 LEU A CD1   1 
ATOM   849 C CD2   . LEU C 3 38 ? 60.453 76.049 30.332 1.00 27.55 ? 176 LEU A CD2   1 
ATOM   850 N N     . TYR C 3 39 ? 58.313 72.420 33.635 1.00 49.67 ? 177 TYR A N     1 
ATOM   851 C CA    . TYR C 3 39 ? 57.595 72.333 34.914 1.00 49.26 ? 177 TYR A CA    1 
ATOM   852 C C     . TYR C 3 39 ? 58.621 72.001 35.997 1.00 50.69 ? 177 TYR A C     1 
ATOM   853 O O     . TYR C 3 39 ? 58.346 72.364 37.133 1.00 53.30 ? 177 TYR A O     1 
ATOM   854 C CB    . TYR C 3 39 ? 56.445 71.238 34.977 1.00 42.70 ? 177 TYR A CB    1 
ATOM   855 C CG    . TYR C 3 39 ? 55.158 71.500 34.174 1.00 36.08 ? 177 TYR A CG    1 
ATOM   856 C CD1   . TYR C 3 39 ? 54.068 72.203 34.691 1.00 33.05 ? 177 TYR A CD1   1 
ATOM   857 C CD2   . TYR C 3 39 ? 55.088 71.042 32.848 1.00 41.81 ? 177 TYR A CD2   1 
ATOM   858 C CE1   . TYR C 3 39 ? 52.936 72.442 33.888 1.00 29.76 ? 177 TYR A CE1   1 
ATOM   859 C CE2   . TYR C 3 39 ? 53.966 71.273 32.042 1.00 31.85 ? 177 TYR A CE2   1 
ATOM   860 C CZ    . TYR C 3 39 ? 52.893 71.974 32.561 1.00 32.67 ? 177 TYR A CZ    1 
ATOM   861 O OH    . TYR C 3 39 ? 51.804 72.174 31.723 1.00 26.42 ? 177 TYR A OH    1 
ATOM   862 N N     . ARG C 3 40 ? 59.791 71.361 35.791 1.00 47.40 ? 178 ARG A N     1 
ATOM   863 C CA    . ARG C 3 40 ? 60.673 71.119 36.925 1.00 47.52 ? 178 ARG A CA    1 
ATOM   864 C C     . ARG C 3 40 ? 61.286 72.402 37.386 1.00 51.70 ? 178 ARG A C     1 
ATOM   865 O O     . ARG C 3 40 ? 61.384 72.585 38.587 1.00 53.78 ? 178 ARG A O     1 
ATOM   866 C CB    . ARG C 3 40 ? 61.857 70.282 36.653 1.00 44.63 ? 178 ARG A CB    1 
ATOM   867 C CG    . ARG C 3 40 ? 62.217 69.410 37.855 1.00 49.74 ? 178 ARG A CG    1 
ATOM   868 C CD    . ARG C 3 40 ? 63.552 68.705 37.571 1.00 45.91 ? 178 ARG A CD    1 
ATOM   869 N NE    . ARG C 3 40 ? 63.531 67.940 36.331 1.00 44.66 ? 178 ARG A NE    1 
ATOM   870 C CZ    . ARG C 3 40 ? 64.322 68.196 35.296 1.00 34.82 ? 178 ARG A CZ    1 
ATOM   871 N NH1   . ARG C 3 40 ? 65.261 69.117 35.285 1.00 37.38 ? 178 ARG A NH1   1 
ATOM   872 N NH2   . ARG C 3 40 ? 64.188 67.443 34.255 1.00 38.72 ? 178 ARG A NH2   1 
ATOM   873 N N     . TYR C 3 41 ? 61.771 73.240 36.476 1.00 49.85 ? 179 TYR A N     1 
ATOM   874 C CA    . TYR C 3 41 ? 62.403 74.484 36.849 1.00 45.66 ? 179 TYR A CA    1 
ATOM   875 C C     . TYR C 3 41 ? 61.417 75.464 37.432 1.00 47.28 ? 179 TYR A C     1 
ATOM   876 O O     . TYR C 3 41 ? 61.609 75.972 38.527 1.00 52.03 ? 179 TYR A O     1 
ATOM   877 C CB    . TYR C 3 41 ? 63.036 75.145 35.645 1.00 48.45 ? 179 TYR A CB    1 
ATOM   878 C CG    . TYR C 3 41 ? 64.421 74.718 35.185 1.00 41.37 ? 179 TYR A CG    1 
ATOM   879 C CD1   . TYR C 3 41 ? 64.637 73.631 34.356 1.00 40.14 ? 179 TYR A CD1   1 
ATOM   880 C CD2   . TYR C 3 41 ? 65.487 75.496 35.581 1.00 41.67 ? 179 TYR A CD2   1 
ATOM   881 C CE1   . TYR C 3 41 ? 65.930 73.349 33.935 1.00 37.94 ? 179 TYR A CE1   1 
ATOM   882 C CE2   . TYR C 3 41 ? 66.770 75.218 35.154 1.00 40.22 ? 179 TYR A CE2   1 
ATOM   883 C CZ    . TYR C 3 41 ? 66.975 74.152 34.335 1.00 34.84 ? 179 TYR A CZ    1 
ATOM   884 O OH    . TYR C 3 41 ? 68.236 73.957 33.864 1.00 43.00 ? 179 TYR A OH    1 
ATOM   885 N N     . PHE C 3 42 ? 60.342 75.776 36.729 1.00 47.40 ? 180 PHE A N     1 
ATOM   886 C CA    . PHE C 3 42 ? 59.400 76.780 37.148 1.00 46.01 ? 180 PHE A CA    1 
ATOM   887 C C     . PHE C 3 42 ? 58.180 75.903 37.295 1.00 50.14 ? 180 PHE A C     1 
ATOM   888 O O     . PHE C 3 42 ? 57.644 75.474 36.278 1.00 55.70 ? 180 PHE A O     1 
ATOM   889 C CB    . PHE C 3 42 ? 59.162 77.764 36.042 1.00 38.38 ? 180 PHE A CB    1 
ATOM   890 C CG    . PHE C 3 42 ? 60.422 78.256 35.387 1.00 38.52 ? 180 PHE A CG    1 
ATOM   891 C CD1   . PHE C 3 42 ? 61.356 78.996 36.097 1.00 38.88 ? 180 PHE A CD1   1 
ATOM   892 C CD2   . PHE C 3 42 ? 60.655 77.911 34.068 1.00 41.43 ? 180 PHE A CD2   1 
ATOM   893 C CE1   . PHE C 3 42 ? 62.538 79.377 35.477 1.00 38.67 ? 180 PHE A CE1   1 
ATOM   894 C CE2   . PHE C 3 42 ? 61.842 78.313 33.461 1.00 35.97 ? 180 PHE A CE2   1 
ATOM   895 C CZ    . PHE C 3 42 ? 62.784 79.039 34.159 1.00 35.39 ? 180 PHE A CZ    1 
ATOM   896 N N     . PRO C 3 43 ? 57.738 75.514 38.468 1.00 49.68 ? 181 PRO A N     1 
ATOM   897 C CA    . PRO C 3 43 ? 56.489 74.770 38.615 1.00 53.77 ? 181 PRO A CA    1 
ATOM   898 C C     . PRO C 3 43 ? 55.204 75.549 38.900 1.00 53.54 ? 181 PRO A C     1 
ATOM   899 O O     . PRO C 3 43 ? 54.788 76.378 38.106 1.00 53.51 ? 181 PRO A O     1 
ATOM   900 C CB    . PRO C 3 43 ? 56.920 73.764 39.674 1.00 56.29 ? 181 PRO A CB    1 
ATOM   901 C CG    . PRO C 3 43 ? 57.869 74.514 40.598 1.00 51.64 ? 181 PRO A CG    1 
ATOM   902 C CD    . PRO C 3 43 ? 58.657 75.312 39.584 1.00 52.55 ? 181 PRO A CD    1 
ATOM   903 N N     . ALA C 3 44 ? 54.495 75.263 39.990 1.00 60.29 ? 182 ALA A N     1 
ATOM   904 C CA    . ALA C 3 44 ? 53.376 76.036 40.507 1.00 62.58 ? 182 ALA A CA    1 
ATOM   905 C C     . ALA C 3 44 ? 52.827 75.237 41.707 1.00 67.15 ? 182 ALA A C     1 
ATOM   906 O O     . ALA C 3 44 ? 53.452 75.386 42.763 1.00 69.35 ? 182 ALA A O     1 
ATOM   907 C CB    . ALA C 3 44 ? 52.295 76.209 39.445 1.00 63.60 ? 182 ALA A CB    1 
ATOM   908 N N     . SER C 3 45 ? 51.751 74.382 41.642 1.00 72.11 ? 183 SER A N     1 
ATOM   909 C CA    . SER C 3 45 ? 51.197 73.552 42.754 1.00 75.32 ? 183 SER A CA    1 
ATOM   910 C C     . SER C 3 45 ? 50.149 72.432 42.397 1.00 76.27 ? 183 SER A C     1 
ATOM   911 O O     . SER C 3 45 ? 49.463 72.389 41.358 1.00 74.64 ? 183 SER A O     1 
ATOM   912 C CB    . SER C 3 45 ? 50.559 74.486 43.877 1.00 76.71 ? 183 SER A CB    1 
ATOM   913 O OG    . SER C 3 45 ? 50.294 73.862 45.155 1.00 73.63 ? 183 SER A OG    1 
ATOM   914 N N     . SER C 3 46 ? 50.121 71.487 43.370 1.00 75.08 ? 184 SER A N     1 
ATOM   915 C CA    . SER C 3 46 ? 49.182 70.369 43.612 1.00 73.22 ? 184 SER A CA    1 
ATOM   916 C C     . SER C 3 46 ? 48.702 69.197 42.712 1.00 71.62 ? 184 SER A C     1 
ATOM   917 O O     . SER C 3 46 ? 48.403 68.152 43.316 1.00 71.07 ? 184 SER A O     1 
ATOM   918 C CB    . SER C 3 46 ? 47.884 71.045 44.230 1.00 74.97 ? 184 SER A CB    1 
ATOM   919 O OG    . SER C 3 46 ? 48.087 71.800 45.438 1.00 73.05 ? 184 SER A OG    1 
ATOM   920 N N     . ILE C 3 47 ? 48.631 69.176 41.360 1.00 68.49 ? 185 ILE A N     1 
ATOM   921 C CA    . ILE C 3 47 ? 47.858 68.121 40.629 1.00 62.57 ? 185 ILE A CA    1 
ATOM   922 C C     . ILE C 3 47 ? 48.746 66.906 40.304 1.00 58.56 ? 185 ILE A C     1 
ATOM   923 O O     . ILE C 3 47 ? 49.057 66.679 39.154 1.00 59.75 ? 185 ILE A O     1 
ATOM   924 C CB    . ILE C 3 47 ? 47.223 68.903 39.370 1.00 61.12 ? 185 ILE A CB    1 
ATOM   925 C CG1   . ILE C 3 47 ? 46.783 70.344 39.719 1.00 55.83 ? 185 ILE A CG1   1 
ATOM   926 C CG2   . ILE C 3 47 ? 45.907 68.276 38.981 1.00 60.54 ? 185 ILE A CG2   1 
ATOM   927 C CD1   . ILE C 3 47 ? 46.022 71.097 38.624 1.00 51.40 ? 185 ILE A CD1   1 
ATOM   928 N N     . LYS C 3 48 ? 49.043 66.003 41.230 1.00 56.76 ? 186 LYS A N     1 
ATOM   929 C CA    . LYS C 3 48 ? 50.299 65.263 41.151 1.00 59.83 ? 186 LYS A CA    1 
ATOM   930 C C     . LYS C 3 48 ? 50.511 63.783 41.138 1.00 60.34 ? 186 LYS A C     1 
ATOM   931 O O     . LYS C 3 48 ? 49.600 63.131 41.591 1.00 62.28 ? 186 LYS A O     1 
ATOM   932 C CB    . LYS C 3 48 ? 51.191 65.694 42.277 1.00 61.02 ? 186 LYS A CB    1 
ATOM   933 C CG    . LYS C 3 48 ? 50.625 65.321 43.680 1.00 61.90 ? 186 LYS A CG    1 
ATOM   934 C CD    . LYS C 3 48 ? 51.630 65.163 44.845 1.00 65.35 ? 186 LYS A CD    1 
ATOM   935 C CE    . LYS C 3 48 ? 52.663 66.296 45.016 1.00 69.37 ? 186 LYS A CE    1 
ATOM   936 N NZ    . LYS C 3 48 ? 53.825 66.112 44.155 1.00 68.94 ? 186 LYS A NZ    1 
ATOM   937 N N     . LYS C 3 49 ? 51.736 63.333 40.737 1.00 61.79 ? 187 LYS A N     1 
ATOM   938 C CA    . LYS C 3 49 ? 52.383 62.105 41.227 1.00 59.61 ? 187 LYS A CA    1 
ATOM   939 C C     . LYS C 3 49 ? 53.700 61.440 40.788 1.00 61.86 ? 187 LYS A C     1 
ATOM   940 O O     . LYS C 3 49 ? 54.664 61.763 41.486 1.00 61.25 ? 187 LYS A O     1 
ATOM   941 C CB    . LYS C 3 49 ? 51.440 60.944 41.257 1.00 57.95 ? 187 LYS A CB    1 
ATOM   942 C CG    . LYS C 3 49 ? 51.752 60.221 42.576 1.00 58.70 ? 187 LYS A CG    1 
ATOM   943 C CD    . LYS C 3 49 ? 51.666 60.970 43.937 1.00 59.60 ? 187 LYS A CD    1 
ATOM   944 C CE    . LYS C 3 49 ? 50.321 60.828 44.705 1.00 61.54 ? 187 LYS A CE    1 
ATOM   945 N NZ    . LYS C 3 49 ? 49.838 59.457 44.898 1.00 61.52 ? 187 LYS A NZ    1 
ATOM   946 N N     . ARG C 3 50 ? 53.905 60.560 39.758 1.00 65.01 ? 188 ARG A N     1 
ATOM   947 C CA    . ARG C 3 50 ? 55.131 59.704 39.698 1.00 66.56 ? 188 ARG A CA    1 
ATOM   948 C C     . ARG C 3 50 ? 55.326 58.738 38.494 1.00 66.13 ? 188 ARG A C     1 
ATOM   949 O O     . ARG C 3 50 ? 54.437 58.540 37.674 1.00 67.76 ? 188 ARG A O     1 
ATOM   950 C CB    . ARG C 3 50 ? 55.196 58.811 41.003 1.00 68.44 ? 188 ARG A CB    1 
ATOM   951 C CG    . ARG C 3 50 ? 53.925 57.879 41.224 1.00 74.93 ? 188 ARG A CG    1 
ATOM   952 C CD    . ARG C 3 50 ? 53.721 56.947 42.466 1.00 68.84 ? 188 ARG A CD    1 
ATOM   953 N NE    . ARG C 3 50 ? 52.308 56.579 42.571 1.00 66.38 ? 188 ARG A NE    1 
ATOM   954 C CZ    . ARG C 3 50 ? 51.554 56.952 43.622 1.00 64.93 ? 188 ARG A CZ    1 
ATOM   955 N NH1   . ARG C 3 50 ? 52.050 57.655 44.627 1.00 63.19 ? 188 ARG A NH1   1 
ATOM   956 N NH2   . ARG C 3 50 ? 50.237 56.767 43.638 1.00 63.20 ? 188 ARG A NH2   1 
ATOM   957 N N     . MET C 3 51 ? 56.452 57.994 38.539 1.00 65.50 ? 189 MET A N     1 
ATOM   958 C CA    . MET C 3 51 ? 56.866 56.912 37.630 1.00 63.67 ? 189 MET A CA    1 
ATOM   959 C C     . MET C 3 51 ? 57.359 57.283 36.242 1.00 62.44 ? 189 MET A C     1 
ATOM   960 O O     . MET C 3 51 ? 56.940 58.306 35.705 1.00 63.60 ? 189 MET A O     1 
ATOM   961 C CB    . MET C 3 51 ? 55.733 55.856 37.407 1.00 67.41 ? 189 MET A CB    1 
ATOM   962 C CG    . MET C 3 51 ? 55.564 54.668 38.376 1.00 71.17 ? 189 MET A CG    1 
ATOM   963 S SD    . MET C 3 51 ? 54.799 55.048 39.977 1.00 82.11 ? 189 MET A SD    1 
ATOM   964 C CE    . MET C 3 51 ? 53.222 54.245 39.941 1.00 69.20 ? 189 MET A CE    1 
ATOM   965 N N     . ASN C 3 52 ? 58.343 56.504 35.771 1.00 61.93 ? 190 ASN A N     1 
ATOM   966 C CA    . ASN C 3 52 ? 58.768 56.418 34.371 1.00 63.61 ? 190 ASN A CA    1 
ATOM   967 C C     . ASN C 3 52 ? 58.824 54.897 34.182 1.00 68.97 ? 190 ASN A C     1 
ATOM   968 O O     . ASN C 3 52 ? 58.190 54.409 33.249 1.00 74.91 ? 190 ASN A O     1 
ATOM   969 C CB    . ASN C 3 52 ? 60.201 56.943 34.012 1.00 64.56 ? 190 ASN A CB    1 
ATOM   970 C CG    . ASN C 3 52 ? 60.594 56.882 32.513 1.00 65.58 ? 190 ASN A CG    1 
ATOM   971 O OD1   . ASN C 3 52 ? 61.561 56.265 32.101 1.00 62.25 ? 190 ASN A OD1   1 
ATOM   972 N ND2   . ASN C 3 52 ? 59.973 57.526 31.525 1.00 70.34 ? 190 ASN A ND2   1 
ATOM   973 O OXT   . ASN C 3 52 ? 59.460 54.182 34.976 1.00 74.17 ? 190 ASN A OXT   1 
HETATM 974 O O     . HOH D 4 .  ? 73.845 57.821 38.115 1.00 70.75 ? 193 HOH B O     1 
HETATM 975 O O     . HOH D 4 .  ? 48.781 59.455 31.539 1.00 28.71 ? 194 HOH B O     1 
HETATM 976 O O     . HOH D 4 .  ? 75.756 60.791 42.386 1.00 40.33 ? 196 HOH B O     1 
HETATM 977 O O     . HOH D 4 .  ? 79.950 61.548 44.553 1.00 60.57 ? 200 HOH B O     1 
HETATM 978 O O     . HOH D 4 .  ? 46.903 61.527 31.749 1.00 46.26 ? 201 HOH B O     1 
HETATM 979 O O     . HOH D 4 .  ? 84.565 59.389 41.544 1.00 55.18 ? 202 HOH B O     1 
HETATM 980 O O     . HOH D 4 .  ? 83.530 49.393 39.090 1.00 56.57 ? 206 HOH B O     1 
HETATM 981 O O     . HOH E 4 .  ? 60.999 66.315 37.307 1.00 39.21 ? 191 HOH C O     1 
HETATM 982 O O     . HOH E 4 .  ? 59.634 57.430 46.805 1.00 60.22 ? 192 HOH C O     1 
HETATM 983 O O     . HOH E 4 .  ? 51.762 65.114 30.621 1.00 38.85 ? 195 HOH C O     1 
HETATM 984 O O     . HOH E 4 .  ? 64.590 53.677 27.255 1.00 39.21 ? 197 HOH C O     1 
HETATM 985 O O     . HOH E 4 .  ? 58.819 67.899 36.398 1.00 59.89 ? 199 HOH C O     1 
HETATM 986 O O     . HOH E 4 .  ? 65.332 53.397 39.733 1.00 62.77 ? 204 HOH C O     1 
HETATM 987 O O     . HOH E 4 .  ? 42.223 74.490 28.215 1.00 62.45 ? 205 HOH C O     1 
HETATM 988 O O     . HOH F 4 .  ? 50.650 76.050 30.130 1.00 48.32 ? 198 HOH A O     1 
HETATM 989 O O     . HOH F 4 .  ? 52.086 78.890 32.138 1.00 58.39 ? 203 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  2   2   DT  T   B . n 
A 1 2  DG  2  3   3   DG  G   B . n 
A 1 3  DT  3  4   4   DT  T   B . n 
A 1 4  DT  4  5   5   DT  T   B . n 
A 1 5  DT  5  6   6   DT  T   B . n 
A 1 6  DT  6  7   7   DT  T   B . n 
A 1 7  DT  7  8   8   DT  T   B . n 
A 1 8  DG  8  9   9   DG  G   B . n 
A 1 9  DA  9  10  10  DA  A   B . n 
A 1 10 DT  10 11  11  DT  T   B . n 
A 1 11 DA  11 12  12  DA  A   B . n 
A 1 12 DA  12 13  13  DA  A   B . n 
A 1 13 DG  13 14  14  DG  G   B . n 
A 1 14 DA  14 15  15  DA  A   B . n 
B 2 1  DT  1  17  17  DT  T   C . n 
B 2 2  DC  2  18  18  DC  C   C . n 
B 2 3  DT  3  19  19  DT  T   C . n 
B 2 4  DT  4  20  20  DT  T   C . n 
B 2 5  DA  5  21  21  DA  A   C . n 
B 2 6  DT  6  22  22  DT  T   C . n 
B 2 7  DC  7  23  23  DC  C   C . n 
B 2 8  DA  8  24  24  DA  A   C . n 
B 2 9  DA  9  25  25  DA  A   C . n 
B 2 10 DA  10 26  26  DA  A   C . n 
B 2 11 DA  11 27  27  DA  A   C . n 
B 2 12 DA  12 28  28  DA  A   C . n 
B 2 13 DC  13 29  29  DC  C   C . n 
C 3 1  GLY 1  139 139 GLY GLY A . n 
C 3 2  ARG 2  140 140 ARG ARG A . n 
C 3 3  PRO 3  141 141 PRO PRO A . n 
C 3 4  ARG 4  142 142 ARG ARG A . n 
C 3 5  ALA 5  143 143 ALA ALA A . n 
C 3 6  ILE 6  144 144 ILE ILE A . n 
C 3 7  ASN 7  145 145 ASN ASN A . n 
C 3 8  LYS 8  146 146 LYS LYS A . n 
C 3 9  HIS 9  147 147 HIS HIS A . n 
C 3 10 GLU 10 148 148 GLU GLU A . n 
C 3 11 GLN 11 149 149 GLN GLN A . n 
C 3 12 GLU 12 150 150 GLU GLU A . n 
C 3 13 GLN 13 151 151 GLN GLN A . n 
C 3 14 ILE 14 152 152 ILE ILE A . n 
C 3 15 SER 15 153 153 SER SER A . n 
C 3 16 ARG 16 154 154 ARG ARG A . n 
C 3 17 LEU 17 155 155 LEU LEU A . n 
C 3 18 LEU 18 156 156 LEU LEU A . n 
C 3 19 GLU 19 157 157 GLU GLU A . n 
C 3 20 LYS 20 158 158 LYS LYS A . n 
C 3 21 GLY 21 159 159 GLY GLY A . n 
C 3 22 HIS 22 160 160 HIS HIS A . n 
C 3 23 PRO 23 161 161 PRO PRO A . n 
C 3 24 ARG 24 162 162 ARG ARG A . n 
C 3 25 GLN 25 163 163 GLN GLN A . n 
C 3 26 GLN 26 164 164 GLN GLN A . n 
C 3 27 LEU 27 165 165 LEU LEU A . n 
C 3 28 ALA 28 166 166 ALA ALA A . n 
C 3 29 ILE 29 167 167 ILE ILE A . n 
C 3 30 ILE 30 168 168 ILE ILE A . n 
C 3 31 PHE 31 169 169 PHE PHE A . n 
C 3 32 GLY 32 170 170 GLY GLY A . n 
C 3 33 ILE 33 171 171 ILE ILE A . n 
C 3 34 GLY 34 172 172 GLY GLY A . n 
C 3 35 VAL 35 173 173 VAL VAL A . n 
C 3 36 SER 36 174 174 SER SER A . n 
C 3 37 THR 37 175 175 THR THR A . n 
C 3 38 LEU 38 176 176 LEU LEU A . n 
C 3 39 TYR 39 177 177 TYR TYR A . n 
C 3 40 ARG 40 178 178 ARG ARG A . n 
C 3 41 TYR 41 179 179 TYR TYR A . n 
C 3 42 PHE 42 180 180 PHE PHE A . n 
C 3 43 PRO 43 181 181 PRO PRO A . n 
C 3 44 ALA 44 182 182 ALA ALA A . n 
C 3 45 SER 45 183 183 SER SER A . n 
C 3 46 SER 46 184 184 SER SER A . n 
C 3 47 ILE 47 185 185 ILE ILE A . n 
C 3 48 LYS 48 186 186 LYS LYS A . n 
C 3 49 LYS 49 187 187 LYS LYS A . n 
C 3 50 ARG 50 188 188 ARG ARG A . n 
C 3 51 MET 51 189 189 MET MET A . n 
C 3 52 ASN 52 190 190 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1 193 193 HOH HOH B . 
D 4 HOH 2 194 194 HOH HOH B . 
D 4 HOH 3 196 196 HOH HOH B . 
D 4 HOH 4 200 200 HOH HOH B . 
D 4 HOH 5 201 201 HOH HOH B . 
D 4 HOH 6 202 202 HOH HOH B . 
D 4 HOH 7 206 206 HOH HOH B . 
E 4 HOH 1 191 191 HOH HOH C . 
E 4 HOH 2 192 192 HOH HOH C . 
E 4 HOH 3 195 195 HOH HOH C . 
E 4 HOH 4 197 197 HOH HOH C . 
E 4 HOH 5 199 199 HOH HOH C . 
E 4 HOH 6 204 204 HOH HOH C . 
E 4 HOH 7 205 205 HOH HOH C . 
F 4 HOH 1 198 198 HOH HOH A . 
F 4 HOH 2 203 203 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-04-30 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" B DT  2   ? ? "C4'" B DT  2   ? ? 1.587 1.512 0.075  0.007 N 
2  1 C2    B DT  2   ? ? N3    B DT  2   ? ? 1.319 1.373 -0.054 0.008 N 
3  1 C6    B DT  2   ? ? N1    B DT  2   ? ? 1.334 1.378 -0.044 0.007 N 
4  1 C5    B DT  2   ? ? C7    B DT  2   ? ? 1.544 1.496 0.048  0.006 N 
5  1 "O3'" B DG  3   ? ? P     B DT  4   ? ? 1.683 1.607 0.076  0.012 Y 
6  1 "C2'" B DT  4   ? ? "C1'" B DT  4   ? ? 1.452 1.518 -0.066 0.010 N 
7  1 "C5'" B DT  5   ? ? "C4'" B DT  5   ? ? 1.564 1.512 0.052  0.007 N 
8  1 "C5'" B DT  8   ? ? "C4'" B DT  8   ? ? 1.561 1.512 0.049  0.007 N 
9  1 "C4'" B DA  12  ? ? "C3'" B DA  12  ? ? 1.445 1.521 -0.076 0.010 N 
10 1 "C2'" B DA  12  ? ? "C1'" B DA  12  ? ? 1.452 1.518 -0.066 0.010 N 
11 1 C5    B DA  12  ? ? C6    B DA  12  ? ? 1.341 1.406 -0.065 0.009 N 
12 1 "C4'" B DA  13  ? ? "C3'" B DA  13  ? ? 1.458 1.521 -0.063 0.010 N 
13 1 "C5'" B DA  15  ? ? "C4'" B DA  15  ? ? 1.572 1.512 0.060  0.007 N 
14 1 N9    B DA  15  ? ? C4    B DA  15  ? ? 1.336 1.374 -0.038 0.006 N 
15 1 N3    C DT  19  ? ? C4    C DT  19  ? ? 1.326 1.382 -0.056 0.008 N 
16 1 "C5'" C DT  22  ? ? "C4'" C DT  22  ? ? 1.442 1.509 -0.067 0.011 N 
17 1 NE2   A HIS 147 ? ? CD2   A HIS 147 ? ? 1.305 1.373 -0.068 0.011 N 
18 1 NE2   A HIS 160 ? ? CD2   A HIS 160 ? ? 1.298 1.373 -0.075 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 "C5'" B DT  2   ? ? "C4'" B DT  2   ? ? "O4'" B DT  2   ? ? 116.49 109.80 6.69   1.10 N 
2   1 "C1'" B DT  2   ? ? "O4'" B DT  2   ? ? "C4'" B DT  2   ? ? 97.30  110.10 -12.80 1.00 N 
3   1 N1    B DT  2   ? ? "C1'" B DT  2   ? ? "C2'" B DT  2   ? ? 127.02 114.30 12.72  1.40 N 
4   1 "O4'" B DT  2   ? ? "C1'" B DT  2   ? ? N1    B DT  2   ? ? 117.27 108.30 8.97   0.30 N 
5   1 N1    B DT  2   ? ? C2    B DT  2   ? ? N3    B DT  2   ? ? 118.59 114.60 3.99   0.60 N 
6   1 C2    B DT  2   ? ? N3    B DT  2   ? ? C4    B DT  2   ? ? 123.46 127.20 -3.74  0.60 N 
7   1 N3    B DT  2   ? ? C2    B DT  2   ? ? O2    B DT  2   ? ? 114.09 122.30 -8.21  0.60 N 
8   1 N3    B DT  2   ? ? C4    B DT  2   ? ? O4    B DT  2   ? ? 115.55 119.90 -4.35  0.60 N 
9   1 C4    B DT  2   ? ? C5    B DT  2   ? ? C7    B DT  2   ? ? 123.68 119.00 4.68   0.60 N 
10  1 C6    B DT  2   ? ? C5    B DT  2   ? ? C7    B DT  2   ? ? 116.11 122.90 -6.79  0.60 N 
11  1 "C3'" B DT  2   ? ? "O3'" B DT  2   ? ? P     B DG  3   ? ? 131.11 119.70 11.41  1.20 Y 
12  1 "C5'" B DG  3   ? ? "C4'" B DG  3   ? ? "O4'" B DG  3   ? ? 121.96 109.80 12.16  1.10 N 
13  1 "C3'" B DG  3   ? ? "C2'" B DG  3   ? ? "C1'" B DG  3   ? ? 96.92  102.40 -5.48  0.80 N 
14  1 "O4'" B DG  3   ? ? "C1'" B DG  3   ? ? N9    B DG  3   ? ? 121.86 108.30 13.56  0.30 N 
15  1 "C3'" B DG  3   ? ? "O3'" B DG  3   ? ? P     B DT  4   ? ? 131.15 119.70 11.45  1.20 Y 
16  1 "O3'" B DG  3   ? ? P     B DT  4   ? ? "O5'" B DT  4   ? ? 117.81 104.00 13.81  1.90 Y 
17  1 "O4'" B DT  4   ? ? "C1'" B DT  4   ? ? N1    B DT  4   ? ? 114.15 108.30 5.85   0.30 N 
18  1 C4    B DT  4   ? ? C5    B DT  4   ? ? C6    B DT  4   ? ? 122.70 118.00 4.70   0.60 N 
19  1 N3    B DT  4   ? ? C2    B DT  4   ? ? O2    B DT  4   ? ? 116.49 122.30 -5.81  0.60 N 
20  1 "O4'" B DT  5   ? ? "C4'" B DT  5   ? ? "C3'" B DT  5   ? ? 99.63  104.50 -4.87  0.40 N 
21  1 "O4'" B DT  5   ? ? "C1'" B DT  5   ? ? "C2'" B DT  5   ? ? 99.24  105.90 -6.66  0.80 N 
22  1 "O4'" B DT  5   ? ? "C1'" B DT  5   ? ? N1    B DT  5   ? ? 110.24 108.30 1.94   0.30 N 
23  1 "O4'" B DT  6   ? ? "C1'" B DT  6   ? ? "C2'" B DT  6   ? ? 97.65  105.90 -8.25  0.80 N 
24  1 "O4'" B DT  6   ? ? "C1'" B DT  6   ? ? N1    B DT  6   ? ? 111.37 108.30 3.07   0.30 N 
25  1 C6    B DT  6   ? ? C5    B DT  6   ? ? C7    B DT  6   ? ? 119.08 122.90 -3.82  0.60 N 
26  1 "O4'" B DT  7   ? ? "C4'" B DT  7   ? ? "C3'" B DT  7   ? ? 101.29 104.50 -3.21  0.40 N 
27  1 "C1'" B DT  7   ? ? "O4'" B DT  7   ? ? "C4'" B DT  7   ? ? 100.85 110.10 -9.25  1.00 N 
28  1 "C4'" B DT  7   ? ? "C3'" B DT  7   ? ? "C2'" B DT  7   ? ? 94.62  102.20 -7.58  0.70 N 
29  1 "O4'" B DT  7   ? ? "C1'" B DT  7   ? ? N1    B DT  7   ? ? 111.96 108.30 3.66   0.30 N 
30  1 "O4'" B DT  8   ? ? "C1'" B DT  8   ? ? "C2'" B DT  8   ? ? 100.54 105.90 -5.36  0.80 N 
31  1 "O4'" B DT  11  ? ? "C4'" B DT  11  ? ? "C3'" B DT  11  ? ? 101.18 104.50 -3.32  0.40 N 
32  1 "O4'" B DT  11  ? ? "C1'" B DT  11  ? ? "C2'" B DT  11  ? ? 96.49  105.90 -9.41  0.80 N 
33  1 "O4'" B DT  11  ? ? "C1'" B DT  11  ? ? N1    B DT  11  ? ? 111.63 108.30 3.33   0.30 N 
34  1 C4    B DT  11  ? ? C5    B DT  11  ? ? C6    B DT  11  ? ? 123.01 118.00 5.01   0.60 N 
35  1 N3    B DT  11  ? ? C2    B DT  11  ? ? O2    B DT  11  ? ? 117.46 122.30 -4.84  0.60 N 
36  1 C6    B DT  11  ? ? C5    B DT  11  ? ? C7    B DT  11  ? ? 118.75 122.90 -4.15  0.60 N 
37  1 N1    B DA  12  ? ? C6    B DA  12  ? ? N6    B DA  12  ? ? 122.53 118.60 3.93   0.60 N 
38  1 "O4'" B DA  13  ? ? "C4'" B DA  13  ? ? "C3'" B DA  13  ? ? 101.21 104.50 -3.29  0.40 N 
39  1 "C5'" B DA  13  ? ? "C4'" B DA  13  ? ? "O4'" B DA  13  ? ? 119.47 109.80 9.67   1.10 N 
40  1 "O4'" B DA  13  ? ? "C1'" B DA  13  ? ? N9    B DA  13  ? ? 110.66 108.30 2.36   0.30 N 
41  1 N1    B DA  13  ? ? C2    B DA  13  ? ? N3    B DA  13  ? ? 132.87 129.30 3.57   0.50 N 
42  1 C8    B DA  13  ? ? N9    B DA  13  ? ? C4    B DA  13  ? ? 103.30 105.80 -2.50  0.40 N 
43  1 N9    B DA  13  ? ? C4    B DA  13  ? ? C5    B DA  13  ? ? 108.48 105.80 2.68   0.40 N 
44  1 "O4'" B DG  14  ? ? "C1'" B DG  14  ? ? "C2'" B DG  14  ? ? 99.60  105.90 -6.30  0.80 N 
45  1 "O4'" B DA  15  ? ? "C4'" B DA  15  ? ? "C3'" B DA  15  ? ? 98.64  104.50 -5.86  0.40 N 
46  1 "C1'" B DA  15  ? ? "O4'" B DA  15  ? ? "C4'" B DA  15  ? ? 97.38  110.10 -12.72 1.00 N 
47  1 N1    B DA  15  ? ? C6    B DA  15  ? ? N6    B DA  15  ? ? 123.85 118.60 5.25   0.60 N 
48  1 C5    B DA  15  ? ? C6    B DA  15  ? ? N6    B DA  15  ? ? 117.91 123.70 -5.79  0.80 N 
49  1 "O4'" C DT  17  ? ? "C1'" C DT  17  ? ? "C2'" C DT  17  ? ? 97.93  105.90 -7.97  0.80 N 
50  1 "O4'" C DT  17  ? ? "C1'" C DT  17  ? ? N1    C DT  17  ? ? 111.41 108.30 3.11   0.30 N 
51  1 N1    C DT  17  ? ? C2    C DT  17  ? ? N3    C DT  17  ? ? 118.33 114.60 3.73   0.60 N 
52  1 C4    C DT  17  ? ? C5    C DT  17  ? ? C6    C DT  17  ? ? 121.95 118.00 3.95   0.60 N 
53  1 C5    C DT  17  ? ? C6    C DT  17  ? ? N1    C DT  17  ? ? 120.06 123.70 -3.64  0.60 N 
54  1 N3    C DT  17  ? ? C2    C DT  17  ? ? O2    C DT  17  ? ? 116.84 122.30 -5.46  0.60 N 
55  1 C6    C DT  17  ? ? C5    C DT  17  ? ? C7    C DT  17  ? ? 118.82 122.90 -4.08  0.60 N 
56  1 "C3'" C DT  17  ? ? "O3'" C DT  17  ? ? P     C DC  18  ? ? 128.40 119.70 8.70   1.20 Y 
57  1 "O4'" C DC  18  ? ? "C1'" C DC  18  ? ? N1    C DC  18  ? ? 111.60 108.30 3.30   0.30 N 
58  1 "O4'" C DT  19  ? ? "C1'" C DT  19  ? ? N1    C DT  19  ? ? 101.82 108.00 -6.18  0.70 N 
59  1 C5    C DT  19  ? ? C6    C DT  19  ? ? N1    C DT  19  ? ? 119.98 123.70 -3.72  0.60 N 
60  1 N3    C DT  19  ? ? C2    C DT  19  ? ? O2    C DT  19  ? ? 118.28 122.30 -4.02  0.60 N 
61  1 "O3'" C DT  19  ? ? P     C DT  20  ? ? "O5'" C DT  20  ? ? 90.78  104.00 -13.22 1.90 Y 
62  1 "O4'" C DT  20  ? ? "C4'" C DT  20  ? ? "C3'" C DT  20  ? ? 101.53 104.50 -2.97  0.40 N 
63  1 "C4'" C DT  20  ? ? "C3'" C DT  20  ? ? "C2'" C DT  20  ? ? 97.67  102.20 -4.53  0.70 N 
64  1 "O4'" C DT  20  ? ? "C1'" C DT  20  ? ? N1    C DT  20  ? ? 110.75 108.30 2.45   0.30 N 
65  1 C4    C DT  20  ? ? C5    C DT  20  ? ? C6    C DT  20  ? ? 122.71 118.00 4.71   0.60 N 
66  1 C4    C DT  20  ? ? C5    C DT  20  ? ? C7    C DT  20  ? ? 113.53 119.00 -5.47  0.60 N 
67  1 "C3'" C DT  20  ? ? "O3'" C DT  20  ? ? P     C DA  21  ? ? 130.39 119.70 10.69  1.20 Y 
68  1 "O4'" C DA  21  ? ? "C1'" C DA  21  ? ? "C2'" C DA  21  ? ? 99.73  105.90 -6.17  0.80 N 
69  1 "O4'" C DA  21  ? ? "C1'" C DA  21  ? ? N9    C DA  21  ? ? 113.04 108.30 4.74   0.30 N 
70  1 P     C DT  22  ? ? "O5'" C DT  22  ? ? "C5'" C DT  22  ? ? 109.64 120.90 -11.26 1.60 N 
71  1 C6    C DT  22  ? ? C5    C DT  22  ? ? C7    C DT  22  ? ? 118.05 122.90 -4.85  0.60 N 
72  1 "O5'" C DC  23  ? ? "C5'" C DC  23  ? ? "C4'" C DC  23  ? ? 103.36 109.40 -6.04  0.80 N 
73  1 "C1'" C DC  23  ? ? "O4'" C DC  23  ? ? "C4'" C DC  23  ? ? 102.79 110.10 -7.31  1.00 N 
74  1 "O4'" C DC  23  ? ? "C1'" C DC  23  ? ? N1    C DC  23  ? ? 100.58 108.00 -7.42  0.70 N 
75  1 "O4'" C DA  24  ? ? "C4'" C DA  24  ? ? "C3'" C DA  24  ? ? 101.16 104.50 -3.34  0.40 N 
76  1 "O4'" C DA  24  ? ? "C1'" C DA  24  ? ? N9    C DA  24  ? ? 111.33 108.30 3.03   0.30 N 
77  1 "O4'" C DA  25  ? ? "C1'" C DA  25  ? ? "C2'" C DA  25  ? ? 99.44  105.90 -6.46  0.80 N 
78  1 "O4'" C DA  25  ? ? "C1'" C DA  25  ? ? N9    C DA  25  ? ? 111.49 108.30 3.19   0.30 N 
79  1 "C3'" C DA  26  ? ? "C2'" C DA  26  ? ? "C1'" C DA  26  ? ? 110.92 102.50 8.42   1.20 N 
80  1 "O4'" C DA  26  ? ? "C1'" C DA  26  ? ? "C2'" C DA  26  ? ? 98.26  105.90 -7.64  0.80 N 
81  1 "O4'" C DA  27  ? ? "C1'" C DA  27  ? ? "C2'" C DA  27  ? ? 100.17 105.90 -5.73  0.80 N 
82  1 "O4'" C DA  28  ? ? "C4'" C DA  28  ? ? "C3'" C DA  28  ? ? 100.16 104.50 -4.34  0.40 N 
83  1 "C1'" C DA  28  ? ? "O4'" C DA  28  ? ? "C4'" C DA  28  ? ? 100.94 110.10 -9.16  1.00 N 
84  1 "C4'" C DA  28  ? ? "C3'" C DA  28  ? ? "C2'" C DA  28  ? ? 93.27  102.20 -8.93  0.70 N 
85  1 "O4'" C DA  28  ? ? "C1'" C DA  28  ? ? N9    C DA  28  ? ? 114.04 108.30 5.74   0.30 N 
86  1 P     C DC  29  ? ? "O5'" C DC  29  ? ? "C5'" C DC  29  ? ? 137.03 120.90 16.13  1.60 N 
87  1 "C1'" C DC  29  ? ? "O4'" C DC  29  ? ? "C4'" C DC  29  ? ? 100.87 110.10 -9.23  1.00 N 
88  1 "C4'" C DC  29  ? ? "C3'" C DC  29  ? ? "C2'" C DC  29  ? ? 96.91  102.20 -5.29  0.70 N 
89  1 NE    A ARG 140 ? ? CZ    A ARG 140 ? ? NH1   A ARG 140 ? ? 125.45 120.30 5.15   0.50 N 
90  1 NE    A ARG 140 ? ? CZ    A ARG 140 ? ? NH2   A ARG 140 ? ? 114.71 120.30 -5.59  0.50 N 
91  1 NE    A ARG 154 ? ? CZ    A ARG 154 ? ? NH1   A ARG 154 ? ? 123.62 120.30 3.32   0.50 N 
92  1 NE    A ARG 154 ? ? CZ    A ARG 154 ? ? NH2   A ARG 154 ? ? 116.00 120.30 -4.30  0.50 N 
93  1 CA    A LEU 156 ? ? CB    A LEU 156 ? ? CG    A LEU 156 ? ? 130.37 115.30 15.07  2.30 N 
94  1 NE    A ARG 162 ? ? CZ    A ARG 162 ? ? NH2   A ARG 162 ? ? 115.72 120.30 -4.58  0.50 N 
95  1 N     A PHE 169 ? ? CA    A PHE 169 ? ? C     A PHE 169 ? ? 93.86  111.00 -17.14 2.70 N 
96  1 NE    A ARG 178 ? ? CZ    A ARG 178 ? ? NH1   A ARG 178 ? ? 124.53 120.30 4.23   0.50 N 
97  1 NE    A ARG 178 ? ? CZ    A ARG 178 ? ? NH2   A ARG 178 ? ? 117.00 120.30 -3.30  0.50 N 
98  1 CB    A TYR 179 ? ? CG    A TYR 179 ? ? CD2   A TYR 179 ? ? 117.33 121.00 -3.67  0.60 N 
99  1 N     A SER 184 ? ? CA    A SER 184 ? ? C     A SER 184 ? ? 132.16 111.00 21.16  2.70 N 
100 1 N     A LYS 186 ? ? CA    A LYS 186 ? ? C     A LYS 186 ? ? 128.62 111.00 17.62  2.70 N 
101 1 N     A LYS 187 ? ? CA    A LYS 187 ? ? C     A LYS 187 ? ? 129.91 111.00 18.91  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 146 ? ? 20.18   -52.92  
2 1 ARG A 154 ? ? -63.75  -70.54  
3 1 LYS A 158 ? ? -98.63  46.29   
4 1 PRO A 181 ? ? -93.54  -122.61 
5 1 ALA A 182 ? ? 175.47  -97.20  
6 1 SER A 184 ? ? 54.55   -27.02  
7 1 LYS A 187 ? ? 175.13  -85.58  
8 1 ARG A 188 ? ? -179.00 -179.08 
9 1 MET A 189 ? ? 74.14   144.62  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    186 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    187 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            148.79 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     13 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.055 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1HCR 'double helix'        
1HCR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 13 1_555 -0.420 -0.440 0.093  -0.421  -4.081  -1.005  1  B_DG3:DC29_C  B 3  ? C 29 ? 19 1 
1 A DT 3  1_555 B DA 12 1_555 0.585  -0.459 0.101  1.732   -20.460 -9.453  2  B_DT4:DA28_C  B 4  ? C 28 ? 20 1 
1 A DT 4  1_555 B DA 11 1_555 0.869  -0.603 0.167  -9.421  -14.596 -3.478  3  B_DT5:DA27_C  B 5  ? C 27 ? 20 1 
1 A DT 5  1_555 B DA 10 1_555 0.353  -0.323 -0.687 10.796  -26.681 -1.172  4  B_DT6:DA26_C  B 6  ? C 26 ? 20 1 
1 A DT 6  1_555 B DA 9  1_555 -0.554 -0.446 0.265  -6.283  -13.898 1.301   5  B_DT7:DA25_C  B 7  ? C 25 ? 20 1 
1 A DT 7  1_555 B DA 8  1_555 -1.110 -0.283 -0.599 -5.879  -19.139 -10.186 6  B_DT8:DA24_C  B 8  ? C 24 ? 20 1 
1 A DG 8  1_555 B DC 7  1_555 -0.510 -0.461 -0.327 -5.090  -10.128 -3.584  7  B_DG9:DC23_C  B 9  ? C 23 ? 19 1 
1 A DA 9  1_555 B DT 6  1_555 0.538  -0.332 0.063  1.811   -8.069  -8.143  8  B_DA10:DT22_C B 10 ? C 22 ? 20 1 
1 A DT 10 1_555 B DA 5  1_555 0.368  -0.249 0.017  1.068   -13.671 1.597   9  B_DT11:DA21_C B 11 ? C 21 ? 20 1 
1 A DA 11 1_555 B DT 4  1_555 0.689  -0.515 -0.110 3.709   -22.944 -0.209  10 B_DA12:DT20_C B 12 ? C 20 ? 20 1 
1 A DA 12 1_555 B DT 3  1_555 1.203  0.096  0.295  6.363   -15.673 24.002  11 B_DA13:DT19_C B 13 ? C 19 ? ?  1 
1 A DG 13 1_555 B DC 2  1_555 -0.205 -0.348 0.031  -3.521  -19.793 3.216   12 B_DG14:DC18_C B 14 ? C 18 ? 19 1 
1 A DA 14 1_555 B DT 1  1_555 1.087  -0.396 -0.050 -2.352  -27.228 -16.400 13 B_DA15:DT17_C B 15 ? C 17 ? 20 1 
1 A DT 1  1_555 A DG 2  1_555 -3.266 1.634  0.756  -36.391 7.316   92.249  14 B_DT2:DG3_B   B 2  ? B 3  ? ?  ? 
1 A DT 1  1_555 A DG 2  3_756 -3.266 1.634  0.756  -36.391 7.316   92.249  15 B_DT2:DG3_B   B 2  ? B 3  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 13 1_555 A DT 3  1_555 B DA 12 1_555 -1.441 -0.810 3.433 -3.835 5.309   31.404  -2.476 1.880  3.401 9.677  
6.989   32.063  1  BB_DG3DT4:DA28DC29_CC   B 3  ? C 29 ? B 4  ? C 28 ? 
1 A DT 3  1_555 B DA 12 1_555 A DT 4  1_555 B DA 11 1_555 0.419  -0.352 3.636 2.475  1.560   34.046  -0.873 -0.278 3.637 2.659  
-4.218  34.168  2  BB_DT4DT5:DA27DA28_CC   B 4  ? C 28 ? B 5  ? C 27 ? 
1 A DT 4  1_555 B DA 11 1_555 A DT 5  1_555 B DA 10 1_555 -0.246 0.525  2.394 7.802  3.316   34.704  0.505  1.228  2.325 5.459  
-12.843 35.693  3  BB_DT5DT6:DA26DA27_CC   B 5  ? C 27 ? B 6  ? C 26 ? 
1 A DT 5  1_555 B DA 10 1_555 A DT 6  1_555 B DA 9  1_555 1.357  0.590  3.816 -1.512 -3.385  34.866  1.564  -2.514 3.684 -5.630 
2.515   35.057  4  BB_DT6DT7:DA25DA26_CC   B 6  ? C 26 ? B 7  ? C 25 ? 
1 A DT 6  1_555 B DA 9  1_555 A DT 7  1_555 B DA 8  1_555 -1.238 -0.509 3.073 6.713  1.635   31.481  -1.178 3.306  2.729 2.969  
-12.190 32.211  5  BB_DT7DT8:DA24DA25_CC   B 7  ? C 25 ? B 8  ? C 24 ? 
1 A DT 7  1_555 B DA 8  1_555 A DG 8  1_555 B DC 7  1_555 1.050  1.106  3.429 -0.533 8.184   37.941  0.583  -1.651 3.568 12.411 
0.808   38.786  6  BB_DT8DG9:DC23DA24_CC   B 8  ? C 24 ? B 9  ? C 23 ? 
1 A DG 8  1_555 B DC 7  1_555 A DA 9  1_555 B DT 6  1_555 -0.966 0.688  3.196 -7.322 4.103   40.876  0.528  0.575  3.363 5.801  
10.352  41.693  7  BB_DG9DA10:DT22DC23_CC  B 9  ? C 23 ? B 10 ? C 22 ? 
1 A DA 9  1_555 B DT 6  1_555 A DT 10 1_555 B DA 5  1_555 0.985  -0.719 3.346 1.106  -1.133  31.493  -1.105 -1.600 3.401 -2.086 
-2.035  31.532  8  BB_DA10DT11:DA21DT22_CC B 10 ? C 22 ? B 11 ? C 21 ? 
1 A DT 10 1_555 B DA 5  1_555 A DA 11 1_555 B DT 4  1_555 -0.907 1.191  3.322 -0.943 4.064   41.677  1.227  1.167  3.437 5.694  
1.321   41.876  9  BB_DT11DA12:DT20DA21_CC B 11 ? C 21 ? B 12 ? C 20 ? 
1 A DA 11 1_555 B DT 4  1_555 A DA 12 1_555 B DT 3  1_555 1.357  -0.361 3.128 -1.345 1.175   34.641  -0.777 -2.472 3.061 1.972  
2.257   34.686  10 BB_DA12DA13:DT19DT20_CC B 12 ? C 20 ? B 13 ? C 19 ? 
1 A DA 12 1_555 B DT 3  1_555 A DG 13 1_555 B DC 2  1_555 -0.919 0.350  3.396 -2.832 11.206  30.813  -1.438 1.105  3.384 20.220 
5.110   32.861  11 BB_DA13DG14:DC18DT19_CC B 13 ? C 19 ? B 14 ? C 18 ? 
1 A DG 13 1_555 B DC 2  1_555 A DA 14 1_555 B DT 1  1_555 -0.763 -1.142 3.323 -0.415 -4.557  31.467  -1.216 1.313  3.460 -8.347 
0.759   31.789  12 BB_DG14DA15:DT17DC18_CC B 14 ? C 18 ? B 15 ? C 17 ? 
1 A DT 1  1_555 A DG 2  1_555 A DT 1  1_555 A DG 2  3_756 -0.641 4.431  0.000 91.644 146.504 180.000 2.216  0.321  0.000 73.252 
-45.822 180.000 13 BB_DT2DT2:DG3DG3_BB     B 2  ? B 3  ? B 2  ? B 3  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#