data_1HDZ
# 
_entry.id   1HDZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HDZ         
WWPDB D_1000173804 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HDZ 
_pdbx_database_status.recvd_initial_deposition_date   1993-10-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hurley, T.D.' 1 
'Amzel, L.M.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of three human beta alcohol dehydrogenase variants. Correlations with their functional differences.' 
J.Mol.Biol.            239 415  429 1994 JMOBAK UK 0022-2836 0070 ? 8201622 10.1006/jmbi.1994.1382 
1       'The Structure of Human Beta-1 Alcohol Dehydrogenase: Catalytic Effects of Non-Active Site Substitutions'        
Proc.Natl.Acad.Sci.USA 88  8149 ?   1991 PNASA6 US 0027-8424 0040 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hurley, T.D.' 1 
primary 'Bosron, W.F.' 2 
primary 'Stone, C.L.'  3 
primary 'Amzel, L.M.'  4 
1       'Hurley, T.D.' 5 
1       'Amzel, L.M.'  6 
# 
_cell.entry_id           1HDZ 
_cell.length_a           53.560 
_cell.length_b           44.260 
_cell.length_c           93.010 
_cell.angle_alpha        92.36 
_cell.angle_beta         103.63 
_cell.angle_gamma        68.84 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HDZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ALCOHOL DEHYDROGENASE'           39673.137 2  1.1.1.1 ? ? ? 
2 non-polymer syn 'ZINC ION'                        65.409    4  ?       ? ? ? 
3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425   2  ?       ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                    35.453    1  ?       ? ? ? 
5 water       nat water                             18.015    83 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICGTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV
TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI
DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC
INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG
GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICGTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV
TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI
DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC
INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG
GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   ALA n 
1 4   GLY n 
1 5   LYS n 
1 6   VAL n 
1 7   ILE n 
1 8   LYS n 
1 9   CYS n 
1 10  LYS n 
1 11  ALA n 
1 12  ALA n 
1 13  VAL n 
1 14  LEU n 
1 15  TRP n 
1 16  GLU n 
1 17  VAL n 
1 18  LYS n 
1 19  LYS n 
1 20  PRO n 
1 21  PHE n 
1 22  SER n 
1 23  ILE n 
1 24  GLU n 
1 25  ASP n 
1 26  VAL n 
1 27  GLU n 
1 28  VAL n 
1 29  ALA n 
1 30  PRO n 
1 31  PRO n 
1 32  LYS n 
1 33  ALA n 
1 34  TYR n 
1 35  GLU n 
1 36  VAL n 
1 37  ARG n 
1 38  ILE n 
1 39  LYS n 
1 40  MET n 
1 41  VAL n 
1 42  ALA n 
1 43  VAL n 
1 44  GLY n 
1 45  ILE n 
1 46  CYS n 
1 47  GLY n 
1 48  THR n 
1 49  ASP n 
1 50  ASP n 
1 51  HIS n 
1 52  VAL n 
1 53  VAL n 
1 54  SER n 
1 55  GLY n 
1 56  ASN n 
1 57  LEU n 
1 58  VAL n 
1 59  THR n 
1 60  PRO n 
1 61  LEU n 
1 62  PRO n 
1 63  VAL n 
1 64  ILE n 
1 65  LEU n 
1 66  GLY n 
1 67  HIS n 
1 68  GLU n 
1 69  ALA n 
1 70  ALA n 
1 71  GLY n 
1 72  ILE n 
1 73  VAL n 
1 74  GLU n 
1 75  SER n 
1 76  VAL n 
1 77  GLY n 
1 78  GLU n 
1 79  GLY n 
1 80  VAL n 
1 81  THR n 
1 82  THR n 
1 83  VAL n 
1 84  LYS n 
1 85  PRO n 
1 86  GLY n 
1 87  ASP n 
1 88  LYS n 
1 89  VAL n 
1 90  ILE n 
1 91  PRO n 
1 92  LEU n 
1 93  PHE n 
1 94  THR n 
1 95  PRO n 
1 96  GLN n 
1 97  CYS n 
1 98  GLY n 
1 99  LYS n 
1 100 CYS n 
1 101 ARG n 
1 102 VAL n 
1 103 CYS n 
1 104 LYS n 
1 105 ASN n 
1 106 PRO n 
1 107 GLU n 
1 108 SER n 
1 109 ASN n 
1 110 TYR n 
1 111 CYS n 
1 112 LEU n 
1 113 LYS n 
1 114 ASN n 
1 115 ASP n 
1 116 LEU n 
1 117 GLY n 
1 118 ASN n 
1 119 PRO n 
1 120 ARG n 
1 121 GLY n 
1 122 THR n 
1 123 LEU n 
1 124 GLN n 
1 125 ASP n 
1 126 GLY n 
1 127 THR n 
1 128 ARG n 
1 129 ARG n 
1 130 PHE n 
1 131 THR n 
1 132 CYS n 
1 133 ARG n 
1 134 GLY n 
1 135 LYS n 
1 136 PRO n 
1 137 ILE n 
1 138 HIS n 
1 139 HIS n 
1 140 PHE n 
1 141 LEU n 
1 142 GLY n 
1 143 THR n 
1 144 SER n 
1 145 THR n 
1 146 PHE n 
1 147 SER n 
1 148 GLN n 
1 149 TYR n 
1 150 THR n 
1 151 VAL n 
1 152 VAL n 
1 153 ASP n 
1 154 GLU n 
1 155 ASN n 
1 156 ALA n 
1 157 VAL n 
1 158 ALA n 
1 159 LYS n 
1 160 ILE n 
1 161 ASP n 
1 162 ALA n 
1 163 ALA n 
1 164 SER n 
1 165 PRO n 
1 166 LEU n 
1 167 GLU n 
1 168 LYS n 
1 169 VAL n 
1 170 CYS n 
1 171 LEU n 
1 172 ILE n 
1 173 GLY n 
1 174 CYS n 
1 175 GLY n 
1 176 PHE n 
1 177 SER n 
1 178 THR n 
1 179 GLY n 
1 180 TYR n 
1 181 GLY n 
1 182 SER n 
1 183 ALA n 
1 184 VAL n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 LYS n 
1 189 VAL n 
1 190 THR n 
1 191 PRO n 
1 192 GLY n 
1 193 SER n 
1 194 THR n 
1 195 CYS n 
1 196 ALA n 
1 197 VAL n 
1 198 PHE n 
1 199 GLY n 
1 200 LEU n 
1 201 GLY n 
1 202 GLY n 
1 203 VAL n 
1 204 GLY n 
1 205 LEU n 
1 206 SER n 
1 207 ALA n 
1 208 VAL n 
1 209 MET n 
1 210 GLY n 
1 211 CYS n 
1 212 LYS n 
1 213 ALA n 
1 214 ALA n 
1 215 GLY n 
1 216 ALA n 
1 217 ALA n 
1 218 ARG n 
1 219 ILE n 
1 220 ILE n 
1 221 ALA n 
1 222 VAL n 
1 223 ASP n 
1 224 ILE n 
1 225 ASN n 
1 226 LYS n 
1 227 ASP n 
1 228 LYS n 
1 229 PHE n 
1 230 ALA n 
1 231 LYS n 
1 232 ALA n 
1 233 LYS n 
1 234 GLU n 
1 235 LEU n 
1 236 GLY n 
1 237 ALA n 
1 238 THR n 
1 239 GLU n 
1 240 CYS n 
1 241 ILE n 
1 242 ASN n 
1 243 PRO n 
1 244 GLN n 
1 245 ASP n 
1 246 TYR n 
1 247 LYS n 
1 248 LYS n 
1 249 PRO n 
1 250 ILE n 
1 251 GLN n 
1 252 GLU n 
1 253 VAL n 
1 254 LEU n 
1 255 LYS n 
1 256 GLU n 
1 257 MET n 
1 258 THR n 
1 259 ASP n 
1 260 GLY n 
1 261 GLY n 
1 262 VAL n 
1 263 ASP n 
1 264 PHE n 
1 265 SER n 
1 266 PHE n 
1 267 GLU n 
1 268 VAL n 
1 269 ILE n 
1 270 GLY n 
1 271 ARG n 
1 272 LEU n 
1 273 ASP n 
1 274 THR n 
1 275 MET n 
1 276 MET n 
1 277 ALA n 
1 278 SER n 
1 279 LEU n 
1 280 LEU n 
1 281 CYS n 
1 282 CYS n 
1 283 HIS n 
1 284 GLU n 
1 285 ALA n 
1 286 CYS n 
1 287 GLY n 
1 288 THR n 
1 289 SER n 
1 290 VAL n 
1 291 ILE n 
1 292 VAL n 
1 293 GLY n 
1 294 VAL n 
1 295 PRO n 
1 296 PRO n 
1 297 ALA n 
1 298 SER n 
1 299 GLN n 
1 300 ASN n 
1 301 LEU n 
1 302 SER n 
1 303 ILE n 
1 304 ASN n 
1 305 PRO n 
1 306 MET n 
1 307 LEU n 
1 308 LEU n 
1 309 LEU n 
1 310 THR n 
1 311 GLY n 
1 312 ARG n 
1 313 THR n 
1 314 TRP n 
1 315 LYS n 
1 316 GLY n 
1 317 ALA n 
1 318 VAL n 
1 319 TYR n 
1 320 GLY n 
1 321 GLY n 
1 322 PHE n 
1 323 LYS n 
1 324 SER n 
1 325 LYS n 
1 326 GLU n 
1 327 GLY n 
1 328 ILE n 
1 329 PRO n 
1 330 LYS n 
1 331 LEU n 
1 332 VAL n 
1 333 ALA n 
1 334 ASP n 
1 335 PHE n 
1 336 MET n 
1 337 ALA n 
1 338 LYS n 
1 339 LYS n 
1 340 PHE n 
1 341 SER n 
1 342 LEU n 
1 343 ASP n 
1 344 ALA n 
1 345 LEU n 
1 346 ILE n 
1 347 THR n 
1 348 HIS n 
1 349 VAL n 
1 350 LEU n 
1 351 PRO n 
1 352 PHE n 
1 353 GLU n 
1 354 LYS n 
1 355 ILE n 
1 356 ASN n 
1 357 GLU n 
1 358 GLY n 
1 359 PHE n 
1 360 ASP n 
1 361 LEU n 
1 362 LEU n 
1 363 HIS n 
1 364 SER n 
1 365 GLY n 
1 366 LYS n 
1 367 SER n 
1 368 ILE n 
1 369 ARG n 
1 370 THR n 
1 371 VAL n 
1 372 LEU n 
1 373 THR n 
1 374 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADHB_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00325 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV
TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI
DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC
INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG
GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HDZ A 1 ? 374 ? P00325 1 ? 374 ? 1 374 
2 1 1HDZ B 1 ? 374 ? P00325 1 ? 374 ? 1 374 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1HDZ GLY A 47 ? UNP P00325 ARG 47 CONFLICT 47 1 
2 1HDZ GLY B 47 ? UNP P00325 ARG 47 CONFLICT 47 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                    ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                        ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1HDZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   51.08 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1HDZ 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1940000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1940000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5548 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         93 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               5724 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.19  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.077000 
_struct_ncs_oper.matrix[1][2]   0.980700 
_struct_ncs_oper.matrix[1][3]   -0.180000 
_struct_ncs_oper.matrix[2][1]   0.979500 
_struct_ncs_oper.matrix[2][2]   -0.108100 
_struct_ncs_oper.matrix[2][3]   -0.170000 
_struct_ncs_oper.matrix[3][1]   -0.186400 
_struct_ncs_oper.matrix[3][2]   -0.162700 
_struct_ncs_oper.matrix[3][3]   -0.969000 
_struct_ncs_oper.vector[1]      -9.93900 
_struct_ncs_oper.vector[2]      -6.11100 
_struct_ncs_oper.vector[3]      -91.15300 
# 
_struct.entry_id                  1HDZ 
_struct.title                     
'THREE-DIMENSIONAL STRUCTURES OF THREE HUMAN ALCOHOL DEHYDROGENASE VARIANTS: CORRELATIONS WITH THEIR FUNCTIONAL DIFFERENCES' 
_struct.pdbx_descriptor           
'ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (BETA-1 ISOENZYME, HUMAN) MUTANT WITH ARG 47 REPLACED BY GLY (R47G) COMPLEXED WITH NAD+' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HDZ 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE(NAD(A)-CHOH(D))' 
_struct_keywords.text            'OXIDOREDUCTASE(NAD(A)-CHOH(D))' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 4 ? 
I N N 3 ? 
J N N 5 ? 
K N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE ASYMMETRIC UNIT CONTAINS ONE DIMER OF HUMAN ALCOHOL
DEHYDROGENASE.  THE TRANSFORMATION PRESENTED IN *MTRIX*
RECORDS BELOW WILL YIELD APPROXIMATE COORDINATES FOR CHAIN
*B* WHEN APPLIED TO CHAIN *A*.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1A GLY A 47  ? SER A 54  ? GLY A 47  SER A 54  1 ? 8  
HELX_P HELX_P2  H2A CYS A 170 ? ASN A 185 ? CYS A 170 ASN A 185 1 ? 16 
HELX_P HELX_P3  H3A GLY A 201 ? LYS A 212 ? GLY A 201 LYS A 212 1 ? 12 
HELX_P HELX_P4  H4A LYS A 226 ? GLU A 234 ? LYS A 226 GLU A 234 1 ? 9  
HELX_P HELX_P5  H5A ILE A 250 ? MET A 257 ? ILE A 250 MET A 257 1 ? 8  
HELX_P HELX_P6  H6A LEU A 272 ? CYS A 282 ? LEU A 272 CYS A 282 1 ? 11 
HELX_P HELX_P7  H7A MET A 306 ? THR A 310 ? MET A 306 THR A 310 5 ? 5  
HELX_P HELX_P8  H8A LYS A 325 ? ALA A 337 ? LYS A 325 ALA A 337 1 ? 13 
HELX_P HELX_P9  H9A ILE A 355 ? SER A 364 ? ILE A 355 SER A 364 1 ? 10 
HELX_P HELX_P10 H1B GLY B 47  ? SER B 54  ? GLY B 47  SER B 54  1 ? 8  
HELX_P HELX_P11 H2B CYS B 170 ? ASN B 185 ? CYS B 170 ASN B 185 1 ? 16 
HELX_P HELX_P12 H3B GLY B 201 ? LYS B 212 ? GLY B 201 LYS B 212 1 ? 12 
HELX_P HELX_P13 H4B LYS B 226 ? GLU B 234 ? LYS B 226 GLU B 234 1 ? 9  
HELX_P HELX_P14 H5B ILE B 250 ? MET B 257 ? ILE B 250 MET B 257 1 ? 8  
HELX_P HELX_P15 H6B LEU B 272 ? CYS B 282 ? LEU B 272 CYS B 282 1 ? 11 
HELX_P HELX_P16 H7B MET B 306 ? THR B 310 ? MET B 306 THR B 310 5 ? 5  
HELX_P HELX_P17 H8B LYS B 325 ? ALA B 337 ? LYS B 325 ALA B 337 1 ? 13 
HELX_P HELX_P18 H9B ILE B 355 ? SER B 364 ? ILE B 355 SER B 364 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 97  SG  ? ? A ZN 375 A CYS 97  1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc2  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 100 SG  ? ? A ZN 375 A CYS 100 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc3  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 111 SG  ? ? A ZN 375 A CYS 111 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc4  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 103 SG  ? ? A ZN 375 A CYS 103 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc5  metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 67  NE2 ? ? A ZN 376 A HIS 67  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc6  metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 174 SG  ? ? A ZN 376 A CYS 174 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc7  metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 46  SG  ? ? A ZN 376 A CYS 46  1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc8  metalc ? ? F ZN . ZN ? ? ? 1_555 B CYS 97  SG  ? ? B ZN 375 B CYS 97  1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc9  metalc ? ? F ZN . ZN ? ? ? 1_555 B CYS 100 SG  ? ? B ZN 375 B CYS 100 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc10 metalc ? ? F ZN . ZN ? ? ? 1_555 B CYS 103 SG  ? ? B ZN 375 B CYS 103 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc11 metalc ? ? F ZN . ZN ? ? ? 1_555 B CYS 111 SG  ? ? B ZN 375 B CYS 111 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc12 metalc ? ? G ZN . ZN ? ? ? 1_555 B HIS 67  NE2 ? ? B ZN 376 B HIS 67  1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc13 metalc ? ? G ZN . ZN ? ? ? 1_555 B CYS 174 SG  ? ? B ZN 376 B CYS 174 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc14 metalc ? ? G ZN . ZN ? ? ? 1_555 B CYS 46  SG  ? ? B ZN 376 B CYS 46  1_555 ? ? ? ? ? ? ? 2.391 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 61 A . ? LEU 61 A PRO 62 A ? PRO 62 A 1 -6.33 
2 LEU 61 B . ? LEU 61 B PRO 62 B ? PRO 62 B 1 -5.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1A ? 6 ? 
S2A ? 3 ? 
S3A ? 3 ? 
S4A ? 4 ? 
S5A ? 6 ? 
S1B ? 6 ? 
S2B ? 3 ? 
S3B ? 3 ? 
S4B ? 4 ? 
S5B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1A 1 2 ? anti-parallel 
S1A 2 3 ? anti-parallel 
S1A 3 4 ? anti-parallel 
S1A 4 5 ? anti-parallel 
S1A 5 6 ? parallel      
S2A 1 2 ? anti-parallel 
S2A 2 3 ? anti-parallel 
S3A 1 2 ? anti-parallel 
S3A 2 3 ? anti-parallel 
S4A 1 2 ? anti-parallel 
S4A 2 3 ? anti-parallel 
S4A 3 4 ? parallel      
S5A 1 2 ? parallel      
S5A 2 3 ? parallel      
S5A 3 4 ? parallel      
S5A 4 5 ? parallel      
S5A 5 6 ? parallel      
S1B 1 2 ? anti-parallel 
S1B 2 3 ? anti-parallel 
S1B 3 4 ? anti-parallel 
S1B 4 5 ? anti-parallel 
S1B 5 6 ? parallel      
S2B 1 2 ? anti-parallel 
S2B 2 3 ? anti-parallel 
S3B 1 2 ? anti-parallel 
S3B 2 3 ? anti-parallel 
S4B 1 2 ? anti-parallel 
S4B 2 3 ? anti-parallel 
S4B 3 4 ? parallel      
S5B 1 2 ? parallel      
S5B 2 3 ? parallel      
S5B 3 4 ? parallel      
S5B 4 5 ? parallel      
S5B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1A 1 ALA A 156 ? ILE A 160 ? ALA A 156 ILE A 160 
S1A 2 LYS A 88  ? LEU A 92  ? LYS A 88  LEU A 92  
S1A 3 GLU A 68  ? ILE A 72  ? GLU A 68  ILE A 72  
S1A 4 LYS A 39  ? ILE A 45  ? LYS A 39  ILE A 45  
S1A 5 ARG A 369 ? PHE A 374 ? ARG A 369 PHE A 374 
S1A 6 THR A 347 ? PRO A 351 ? THR A 347 PRO A 351 
S2A 1 ILE A 72  ? VAL A 76  ? ILE A 72  VAL A 76  
S2A 2 TYR A 34  ? LYS A 39  ? TYR A 34  LYS A 39  
S2A 3 TYR A 149 ? GLU A 154 ? TYR A 149 GLU A 154 
S3A 1 VAL A 6   ? VAL A 13  ? VAL A 6   VAL A 13  
S3A 2 SER A 22  ? ALA A 29  ? SER A 22  ALA A 29  
S3A 3 ARG A 129 ? THR A 131 ? ARG A 129 THR A 131 
S4A 1 SER A 22  ? GLU A 24  ? SER A 22  GLU A 24  
S4A 2 ALA A 12  ? LEU A 14  ? ALA A 12  LEU A 14  
S4A 3 PRO A 62  ? LEU A 65  ? PRO A 62  LEU A 65  
S4A 4 ILE A 137 ? PHE A 140 ? ILE A 137 PHE A 140 
S5A 1 THR A 238 ? ASN A 242 ? THR A 238 ASN A 242 
S5A 2 ALA A 217 ? ASP A 223 ? ALA A 217 ASP A 223 
S5A 3 SER A 193 ? GLY A 199 ? SER A 193 GLY A 199 
S5A 4 ASP A 263 ? VAL A 268 ? ASP A 263 VAL A 268 
S5A 5 GLY A 287 ? VAL A 292 ? GLY A 287 VAL A 292 
S5A 6 ARG A 312 ? ALA A 317 ? ARG A 312 ALA A 317 
S1B 1 ALA B 156 ? ILE B 160 ? ALA B 156 ILE B 160 
S1B 2 LYS B 88  ? LEU B 92  ? LYS B 88  LEU B 92  
S1B 3 GLU B 68  ? ILE B 72  ? GLU B 68  ILE B 72  
S1B 4 LYS B 39  ? ILE B 45  ? LYS B 39  ILE B 45  
S1B 5 ARG B 369 ? PHE B 374 ? ARG B 369 PHE B 374 
S1B 6 THR B 347 ? PRO B 351 ? THR B 347 PRO B 351 
S2B 1 ILE B 72  ? VAL B 76  ? ILE B 72  VAL B 76  
S2B 2 TYR B 34  ? LYS B 39  ? TYR B 34  LYS B 39  
S2B 3 TYR B 149 ? GLU B 154 ? TYR B 149 GLU B 154 
S3B 1 VAL B 6   ? VAL B 13  ? VAL B 6   VAL B 13  
S3B 2 SER B 22  ? ALA B 29  ? SER B 22  ALA B 29  
S3B 3 ARG B 129 ? THR B 131 ? ARG B 129 THR B 131 
S4B 1 SER B 22  ? GLU B 24  ? SER B 22  GLU B 24  
S4B 2 ALA B 12  ? LEU B 14  ? ALA B 12  LEU B 14  
S4B 3 PRO B 62  ? LEU B 65  ? PRO B 62  LEU B 65  
S4B 4 ILE B 137 ? PHE B 140 ? ILE B 137 PHE B 140 
S5B 1 THR B 238 ? ASN B 242 ? THR B 238 ASN B 242 
S5B 2 ALA B 217 ? ASP B 223 ? ALA B 217 ASP B 223 
S5B 3 SER B 193 ? GLY B 199 ? SER B 193 GLY B 199 
S5B 4 ASP B 263 ? VAL B 268 ? ASP B 263 VAL B 268 
S5B 5 GLY B 287 ? VAL B 292 ? GLY B 287 VAL B 292 
S5B 6 ARG B 312 ? ALA B 317 ? ARG B 312 ALA B 317 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1A 1 2 O ALA A 156 ? O ALA A 156 N LEU A 92  ? N LEU A 92  
S1A 2 3 N VAL A 89  ? N VAL A 89  O GLY A 71  ? O GLY A 71  
S1A 3 4 O ALA A 70  ? O ALA A 70  N ALA A 42  ? N ALA A 42  
S1A 4 5 N ILE A 45  ? N ILE A 45  O THR A 370 ? O THR A 370 
S1A 5 6 N THR A 373 ? N THR A 373 O LEU A 350 ? O LEU A 350 
S2A 1 2 O SER A 75  ? O SER A 75  N ARG A 37  ? N ARG A 37  
S2A 2 3 O TYR A 34  ? O TYR A 34  N GLU A 154 ? N GLU A 154 
S3A 1 2 N ILE A 7   ? N ILE A 7   O VAL A 28  ? O VAL A 28  
S3A 2 3 N ALA A 29  ? N ALA A 29  O ARG A 129 ? O ARG A 129 
S4A 1 2 N SER A 22  ? N SER A 22  O VAL A 13  ? O VAL A 13  
S4A 2 3 N LEU A 14  ? N LEU A 14  O VAL A 63  ? O VAL A 63  
S4A 3 4 O ILE A 64  ? O ILE A 64  N PHE A 140 ? N PHE A 140 
S5A 1 2 O GLU A 239 ? O GLU A 239 N ALA A 221 ? N ALA A 221 
S5A 2 3 O VAL A 222 ? O VAL A 222 N GLY A 199 ? N GLY A 199 
S5A 3 4 O THR A 194 ? O THR A 194 N PHE A 264 ? N PHE A 264 
S5A 4 5 O GLU A 267 ? O GLU A 267 N VAL A 292 ? N VAL A 292 
S5A 5 6 O GLY A 287 ? O GLY A 287 N THR A 313 ? N THR A 313 
S1B 1 2 O ALA B 156 ? O ALA B 156 N LEU B 92  ? N LEU B 92  
S1B 2 3 N VAL B 89  ? N VAL B 89  O GLY B 71  ? O GLY B 71  
S1B 3 4 O ALA B 70  ? O ALA B 70  N ALA B 42  ? N ALA B 42  
S1B 4 5 N ILE B 45  ? N ILE B 45  O THR B 370 ? O THR B 370 
S1B 5 6 N THR B 373 ? N THR B 373 O LEU B 350 ? O LEU B 350 
S2B 1 2 O SER B 75  ? O SER B 75  N ARG B 37  ? N ARG B 37  
S2B 2 3 O TYR B 34  ? O TYR B 34  N GLU B 154 ? N GLU B 154 
S3B 1 2 N ILE B 7   ? N ILE B 7   O VAL B 28  ? O VAL B 28  
S3B 2 3 N ALA B 29  ? N ALA B 29  O ARG B 129 ? O ARG B 129 
S4B 1 2 N SER B 22  ? N SER B 22  O VAL B 13  ? O VAL B 13  
S4B 2 3 N LEU B 14  ? N LEU B 14  O VAL B 63  ? O VAL B 63  
S4B 3 4 O ILE B 64  ? O ILE B 64  N PHE B 140 ? N PHE B 140 
S5B 1 2 O GLU B 239 ? O GLU B 239 N ALA B 221 ? N ALA B 221 
S5B 2 3 O VAL B 222 ? O VAL B 222 N GLY B 199 ? N GLY B 199 
S5B 3 4 O THR B 194 ? O THR B 194 N PHE B 264 ? N PHE B 264 
S5B 4 5 O GLU B 267 ? O GLU B 267 N VAL B 292 ? N VAL B 292 
S5B 5 6 O GLY B 287 ? O GLY B 287 N THR B 313 ? N THR B 313 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ZA1 Unknown  ? ? ? ? 4  ?                                    
ZA2 Unknown  ? ? ? ? 5  ?                                    
NAD Unknown  ? ? ? ? 1  ?                                    
ZB1 Unknown  ? ? ? ? 4  ?                                    
ZB2 Unknown  ? ? ? ? 5  ?                                    
NBD Unknown  ? ? ? ? 1  ?                                    
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 375'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ZN A 376'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 375'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 376'  
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL B 601'  
AC6 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE NAD A 377' 
AC7 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAD B 377' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ZA1 4  CYS A 46  ? CYS A 46  . ? 1_555 ? 
2  ZA1 4  HIS A 67  ? HIS A 67  . ? 1_555 ? 
3  ZA1 4  CYS A 174 ? CYS A 174 . ? 1_555 ? 
4  ZA1 4  ZN  D .   ? ZN  A 376 . ? 1_555 ? 
5  ZA2 5  CYS A 97  ? CYS A 97  . ? 1_555 ? 
6  ZA2 5  CYS A 100 ? CYS A 100 . ? 1_555 ? 
7  ZA2 5  CYS A 103 ? CYS A 103 . ? 1_555 ? 
8  ZA2 5  CYS A 111 ? CYS A 111 . ? 1_555 ? 
9  ZA2 5  ZN  C .   ? ZN  A 375 . ? 1_555 ? 
10 NAD 1  NAD E .   ? NAD A 377 . ? 1_555 ? 
11 ZB1 4  CYS B 46  ? CYS B 46  . ? 1_555 ? 
12 ZB1 4  HIS B 67  ? HIS B 67  . ? 1_555 ? 
13 ZB1 4  CYS B 174 ? CYS B 174 . ? 1_555 ? 
14 ZB1 4  ZN  G .   ? ZN  B 376 . ? 1_555 ? 
15 ZB2 5  CYS B 97  ? CYS B 97  . ? 1_555 ? 
16 ZB2 5  CYS B 100 ? CYS B 100 . ? 1_555 ? 
17 ZB2 5  CYS B 103 ? CYS B 103 . ? 1_555 ? 
18 ZB2 5  CYS B 111 ? CYS B 111 . ? 1_555 ? 
19 ZB2 5  ZN  F .   ? ZN  B 375 . ? 1_555 ? 
20 NBD 1  NAD I .   ? NAD B 377 . ? 1_555 ? 
21 AC1 4  CYS A 97  ? CYS A 97  . ? 1_555 ? 
22 AC1 4  CYS A 100 ? CYS A 100 . ? 1_555 ? 
23 AC1 4  CYS A 103 ? CYS A 103 . ? 1_555 ? 
24 AC1 4  CYS A 111 ? CYS A 111 . ? 1_555 ? 
25 AC2 6  CYS A 46  ? CYS A 46  . ? 1_555 ? 
26 AC2 6  THR A 48  ? THR A 48  . ? 1_555 ? 
27 AC2 6  HIS A 67  ? HIS A 67  . ? 1_555 ? 
28 AC2 6  CYS A 174 ? CYS A 174 . ? 1_555 ? 
29 AC2 6  NAD E .   ? NAD A 377 . ? 1_555 ? 
30 AC2 6  HOH J .   ? HOH A 400 . ? 1_555 ? 
31 AC3 4  CYS B 97  ? CYS B 97  . ? 1_555 ? 
32 AC3 4  CYS B 100 ? CYS B 100 . ? 1_555 ? 
33 AC3 4  CYS B 103 ? CYS B 103 . ? 1_555 ? 
34 AC3 4  CYS B 111 ? CYS B 111 . ? 1_555 ? 
35 AC4 5  CYS B 46  ? CYS B 46  . ? 1_555 ? 
36 AC4 5  THR B 48  ? THR B 48  . ? 1_555 ? 
37 AC4 5  HIS B 67  ? HIS B 67  . ? 1_555 ? 
38 AC4 5  CYS B 174 ? CYS B 174 . ? 1_555 ? 
39 AC4 5  NAD I .   ? NAD B 377 . ? 1_555 ? 
40 AC5 1  ARG B 128 ? ARG B 128 . ? 1_555 ? 
41 AC6 30 GLY A 47  ? GLY A 47  . ? 1_555 ? 
42 AC6 30 THR A 48  ? THR A 48  . ? 1_555 ? 
43 AC6 30 HIS A 51  ? HIS A 51  . ? 1_555 ? 
44 AC6 30 CYS A 174 ? CYS A 174 . ? 1_555 ? 
45 AC6 30 THR A 178 ? THR A 178 . ? 1_555 ? 
46 AC6 30 GLY A 199 ? GLY A 199 . ? 1_555 ? 
47 AC6 30 GLY A 201 ? GLY A 201 . ? 1_555 ? 
48 AC6 30 GLY A 202 ? GLY A 202 . ? 1_555 ? 
49 AC6 30 VAL A 203 ? VAL A 203 . ? 1_555 ? 
50 AC6 30 ASP A 223 ? ASP A 223 . ? 1_555 ? 
51 AC6 30 ILE A 224 ? ILE A 224 . ? 1_555 ? 
52 AC6 30 LYS A 228 ? LYS A 228 . ? 1_555 ? 
53 AC6 30 VAL A 268 ? VAL A 268 . ? 1_555 ? 
54 AC6 30 ILE A 269 ? ILE A 269 . ? 1_555 ? 
55 AC6 30 ARG A 271 ? ARG A 271 . ? 1_555 ? 
56 AC6 30 VAL A 292 ? VAL A 292 . ? 1_555 ? 
57 AC6 30 GLY A 293 ? GLY A 293 . ? 1_555 ? 
58 AC6 30 VAL A 294 ? VAL A 294 . ? 1_555 ? 
59 AC6 30 ALA A 317 ? ALA A 317 . ? 1_555 ? 
60 AC6 30 VAL A 318 ? VAL A 318 . ? 1_555 ? 
61 AC6 30 TYR A 319 ? TYR A 319 . ? 1_555 ? 
62 AC6 30 LEU A 362 ? LEU A 362 . ? 1_555 ? 
63 AC6 30 ARG A 369 ? ARG A 369 . ? 1_555 ? 
64 AC6 30 ZN  D .   ? ZN  A 376 . ? 1_555 ? 
65 AC6 30 HOH J .   ? HOH A 381 . ? 1_555 ? 
66 AC6 30 HOH J .   ? HOH A 382 . ? 1_555 ? 
67 AC6 30 HOH J .   ? HOH A 383 . ? 1_555 ? 
68 AC6 30 HOH J .   ? HOH A 384 . ? 1_555 ? 
69 AC6 30 HOH J .   ? HOH A 398 . ? 1_555 ? 
70 AC6 30 LEU B 309 ? LEU B 309 . ? 1_555 ? 
71 AC7 28 LEU A 309 ? LEU A 309 . ? 1_555 ? 
72 AC7 28 GLY B 47  ? GLY B 47  . ? 1_555 ? 
73 AC7 28 THR B 48  ? THR B 48  . ? 1_555 ? 
74 AC7 28 HIS B 51  ? HIS B 51  . ? 1_555 ? 
75 AC7 28 CYS B 174 ? CYS B 174 . ? 1_555 ? 
76 AC7 28 THR B 178 ? THR B 178 . ? 1_555 ? 
77 AC7 28 LEU B 200 ? LEU B 200 . ? 1_555 ? 
78 AC7 28 GLY B 201 ? GLY B 201 . ? 1_555 ? 
79 AC7 28 GLY B 202 ? GLY B 202 . ? 1_555 ? 
80 AC7 28 VAL B 203 ? VAL B 203 . ? 1_555 ? 
81 AC7 28 ASP B 223 ? ASP B 223 . ? 1_555 ? 
82 AC7 28 LYS B 228 ? LYS B 228 . ? 1_555 ? 
83 AC7 28 ILE B 269 ? ILE B 269 . ? 1_555 ? 
84 AC7 28 ARG B 271 ? ARG B 271 . ? 1_555 ? 
85 AC7 28 VAL B 292 ? VAL B 292 . ? 1_555 ? 
86 AC7 28 GLY B 293 ? GLY B 293 . ? 1_555 ? 
87 AC7 28 VAL B 294 ? VAL B 294 . ? 1_555 ? 
88 AC7 28 ALA B 317 ? ALA B 317 . ? 1_555 ? 
89 AC7 28 VAL B 318 ? VAL B 318 . ? 1_555 ? 
90 AC7 28 TYR B 319 ? TYR B 319 . ? 1_555 ? 
91 AC7 28 LEU B 362 ? LEU B 362 . ? 1_555 ? 
92 AC7 28 ARG B 369 ? ARG B 369 . ? 1_555 ? 
93 AC7 28 ZN  G .   ? ZN  B 376 . ? 1_555 ? 
94 AC7 28 HOH K .   ? HOH B 605 . ? 1_555 ? 
95 AC7 28 HOH K .   ? HOH B 606 . ? 1_555 ? 
96 AC7 28 HOH K .   ? HOH B 607 . ? 1_555 ? 
97 AC7 28 HOH K .   ? HOH B 608 . ? 1_555 ? 
98 AC7 28 HOH K .   ? HOH B 621 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HDZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HDZ 
_atom_sites.fract_transf_matrix[1][1]   0.018671 
_atom_sites.fract_transf_matrix[1][2]   -0.007227 
_atom_sites.fract_transf_matrix[1][3]   0.004883 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024227 
_atom_sites.fract_transf_matrix[2][3]   -0.001175 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011076 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A    62' 
2 'CIS PROLINE - PRO B    62' 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 15.225  12.329  4.759    1.00 60.94 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 15.163  12.656  3.348    1.00 59.50 ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 14.609  11.449  2.611    1.00 57.99 ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 14.051  10.592  3.309    1.00 60.73 ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 16.568  13.001  2.904    1.00 62.90 ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 17.036  13.906  3.901    1.00 69.52 ? 1   SER A OG  1 
ATOM   7    N  N   . THR A 1 2   ? 14.684  11.329  1.281    1.00 50.85 ? 2   THR A N   1 
ATOM   8    C  CA  . THR A 1 2   ? 14.134  10.158  0.613    1.00 42.62 ? 2   THR A CA  1 
ATOM   9    C  C   . THR A 1 2   ? 15.146  9.372   -0.199   1.00 36.73 ? 2   THR A C   1 
ATOM   10   O  O   . THR A 1 2   ? 14.991  8.177   -0.439   1.00 35.50 ? 2   THR A O   1 
ATOM   11   C  CB  . THR A 1 2   ? 12.972  10.646  -0.271   1.00 43.11 ? 2   THR A CB  1 
ATOM   12   O  OG1 . THR A 1 2   ? 13.396  11.881  -0.850   1.00 43.21 ? 2   THR A OG1 1 
ATOM   13   C  CG2 . THR A 1 2   ? 11.688  10.883  0.498    1.00 44.96 ? 2   THR A CG2 1 
ATOM   14   N  N   . ALA A 1 3   ? 16.230  10.030  -0.605   1.00 33.56 ? 3   ALA A N   1 
ATOM   15   C  CA  . ALA A 1 3   ? 17.226  9.390   -1.448   1.00 32.41 ? 3   ALA A CA  1 
ATOM   16   C  C   . ALA A 1 3   ? 17.718  8.043   -0.963   1.00 34.47 ? 3   ALA A C   1 
ATOM   17   O  O   . ALA A 1 3   ? 18.381  7.963   0.065    1.00 38.63 ? 3   ALA A O   1 
ATOM   18   C  CB  . ALA A 1 3   ? 18.461  10.294  -1.624   1.00 22.38 ? 3   ALA A CB  1 
ATOM   19   N  N   . GLY A 1 4   ? 17.300  6.975   -1.629   1.00 33.86 ? 4   GLY A N   1 
ATOM   20   C  CA  . GLY A 1 4   ? 17.780  5.642   -1.302   1.00 30.45 ? 4   GLY A CA  1 
ATOM   21   C  C   . GLY A 1 4   ? 16.847  4.859   -0.413   1.00 30.35 ? 4   GLY A C   1 
ATOM   22   O  O   . GLY A 1 4   ? 17.126  3.715   -0.033   1.00 30.43 ? 4   GLY A O   1 
ATOM   23   N  N   . LYS A 1 5   ? 15.716  5.451   -0.120   1.00 27.95 ? 5   LYS A N   1 
ATOM   24   C  CA  . LYS A 1 5   ? 14.754  4.845   0.763    1.00 29.17 ? 5   LYS A CA  1 
ATOM   25   C  C   . LYS A 1 5   ? 13.522  4.605   -0.082   1.00 28.46 ? 5   LYS A C   1 
ATOM   26   O  O   . LYS A 1 5   ? 13.436  5.184   -1.153   1.00 33.78 ? 5   LYS A O   1 
ATOM   27   C  CB  . LYS A 1 5   ? 14.413  5.818   1.908    1.00 30.71 ? 5   LYS A CB  1 
ATOM   28   C  CG  . LYS A 1 5   ? 15.601  6.420   2.658    1.00 32.40 ? 5   LYS A CG  1 
ATOM   29   C  CD  . LYS A 1 5   ? 15.235  7.542   3.621    1.00 40.80 ? 5   LYS A CD  1 
ATOM   30   C  CE  . LYS A 1 5   ? 14.500  7.070   4.882    1.00 45.74 ? 5   LYS A CE  1 
ATOM   31   N  NZ  . LYS A 1 5   ? 13.156  6.571   4.644    1.00 46.51 ? 5   LYS A NZ  1 
ATOM   32   N  N   . VAL A 1 6   ? 12.586  3.763   0.318    1.00 24.82 ? 6   VAL A N   1 
ATOM   33   C  CA  . VAL A 1 6   ? 11.367  3.549   -0.411   1.00 25.92 ? 6   VAL A CA  1 
ATOM   34   C  C   . VAL A 1 6   ? 10.534  4.794   -0.173   1.00 31.29 ? 6   VAL A C   1 
ATOM   35   O  O   . VAL A 1 6   ? 10.719  5.469   0.849    1.00 37.29 ? 6   VAL A O   1 
ATOM   36   C  CB  . VAL A 1 6   ? 10.715  2.292   0.153    1.00 29.76 ? 6   VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 6   ? 9.204   2.209   -0.005   1.00 29.76 ? 6   VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 6   ? 11.303  1.151   -0.666   1.00 38.05 ? 6   VAL A CG2 1 
ATOM   39   N  N   . ILE A 1 7   ? 9.642   5.172   -1.084   1.00 28.24 ? 7   ILE A N   1 
ATOM   40   C  CA  . ILE A 1 7   ? 8.813   6.326   -0.859   1.00 27.62 ? 7   ILE A CA  1 
ATOM   41   C  C   . ILE A 1 7   ? 7.424   5.757   -0.787   1.00 29.59 ? 7   ILE A C   1 
ATOM   42   O  O   . ILE A 1 7   ? 7.135   4.700   -1.358   1.00 33.14 ? 7   ILE A O   1 
ATOM   43   C  CB  . ILE A 1 7   ? 8.990   7.338   -2.034   1.00 29.52 ? 7   ILE A CB  1 
ATOM   44   C  CG1 . ILE A 1 7   ? 10.340  8.002   -1.850   1.00 22.63 ? 7   ILE A CG1 1 
ATOM   45   C  CG2 . ILE A 1 7   ? 7.880   8.390   -2.093   1.00 29.12 ? 7   ILE A CG2 1 
ATOM   46   C  CD1 . ILE A 1 7   ? 10.582  9.138   -2.833   1.00 24.18 ? 7   ILE A CD1 1 
ATOM   47   N  N   . LYS A 1 8   ? 6.558   6.412   -0.046   1.00 30.18 ? 8   LYS A N   1 
ATOM   48   C  CA  . LYS A 1 8   ? 5.184   5.970   0.059    1.00 34.37 ? 8   LYS A CA  1 
ATOM   49   C  C   . LYS A 1 8   ? 4.476   7.195   -0.487   1.00 32.41 ? 8   LYS A C   1 
ATOM   50   O  O   . LYS A 1 8   ? 4.820   8.310   -0.075   1.00 32.21 ? 8   LYS A O   1 
ATOM   51   C  CB  . LYS A 1 8   ? 4.794   5.744   1.512    1.00 42.23 ? 8   LYS A CB  1 
ATOM   52   C  CG  . LYS A 1 8   ? 4.112   4.417   1.833    1.00 49.31 ? 8   LYS A CG  1 
ATOM   53   C  CD  . LYS A 1 8   ? 2.802   4.145   1.109    1.00 50.81 ? 8   LYS A CD  1 
ATOM   54   C  CE  . LYS A 1 8   ? 2.387   2.788   1.650    1.00 54.78 ? 8   LYS A CE  1 
ATOM   55   N  NZ  . LYS A 1 8   ? 1.407   2.123   0.814    1.00 56.22 ? 8   LYS A NZ  1 
ATOM   56   N  N   . CYS A 1 9   ? 3.552   7.080   -1.434   1.00 29.98 ? 9   CYS A N   1 
ATOM   57   C  CA  . CYS A 1 9   ? 2.880   8.255   -1.969   1.00 25.27 ? 9   CYS A CA  1 
ATOM   58   C  C   . CYS A 1 9   ? 1.564   7.819   -2.530   1.00 23.04 ? 9   CYS A C   1 
ATOM   59   O  O   . CYS A 1 9   ? 1.201   6.640   -2.398   1.00 21.03 ? 9   CYS A O   1 
ATOM   60   C  CB  . CYS A 1 9   ? 3.708   8.929   -3.080   1.00 25.51 ? 9   CYS A CB  1 
ATOM   61   S  SG  . CYS A 1 9   ? 4.405   7.862   -4.369   1.00 31.72 ? 9   CYS A SG  1 
ATOM   62   N  N   . LYS A 1 10  ? 0.791   8.800   -2.990   1.00 25.00 ? 10  LYS A N   1 
ATOM   63   C  CA  . LYS A 1 10  ? -0.470  8.515   -3.660   1.00 27.31 ? 10  LYS A CA  1 
ATOM   64   C  C   . LYS A 1 10  ? -0.102  8.253   -5.127   1.00 25.77 ? 10  LYS A C   1 
ATOM   65   O  O   . LYS A 1 10  ? 0.963   8.690   -5.598   1.00 25.11 ? 10  LYS A O   1 
ATOM   66   C  CB  . LYS A 1 10  ? -1.406  9.713   -3.589   1.00 29.81 ? 10  LYS A CB  1 
ATOM   67   C  CG  . LYS A 1 10  ? -1.606  10.192  -2.166   1.00 32.58 ? 10  LYS A CG  1 
ATOM   68   C  CD  . LYS A 1 10  ? -2.393  9.161   -1.362   1.00 34.80 ? 10  LYS A CD  1 
ATOM   69   C  CE  . LYS A 1 10  ? -2.110  9.297   0.120    1.00 33.43 ? 10  LYS A CE  1 
ATOM   70   N  NZ  . LYS A 1 10  ? -0.700  9.033   0.376    1.00 34.39 ? 10  LYS A NZ  1 
ATOM   71   N  N   . ALA A 1 11  ? -0.945  7.524   -5.853   1.00 26.45 ? 11  ALA A N   1 
ATOM   72   C  CA  . ALA A 1 11  ? -0.779  7.212   -7.274   1.00 26.63 ? 11  ALA A CA  1 
ATOM   73   C  C   . ALA A 1 11  ? -2.128  6.716   -7.741   1.00 28.79 ? 11  ALA A C   1 
ATOM   74   O  O   . ALA A 1 11  ? -2.886  6.179   -6.930   1.00 29.62 ? 11  ALA A O   1 
ATOM   75   C  CB  . ALA A 1 11  ? 0.200   6.092   -7.529   1.00 26.81 ? 11  ALA A CB  1 
ATOM   76   N  N   . ALA A 1 12  ? -2.541  6.896   -8.998   1.00 31.49 ? 12  ALA A N   1 
ATOM   77   C  CA  . ALA A 1 12  ? -3.853  6.434   -9.419   1.00 28.57 ? 12  ALA A CA  1 
ATOM   78   C  C   . ALA A 1 12  ? -3.558  5.119   -10.091  1.00 29.34 ? 12  ALA A C   1 
ATOM   79   O  O   . ALA A 1 12  ? -2.736  5.026   -11.010  1.00 32.09 ? 12  ALA A O   1 
ATOM   80   C  CB  . ALA A 1 12  ? -4.469  7.400   -10.396  1.00 27.51 ? 12  ALA A CB  1 
ATOM   81   N  N   . VAL A 1 13  ? -4.165  4.089   -9.514   1.00 26.82 ? 13  VAL A N   1 
ATOM   82   C  CA  . VAL A 1 13  ? -3.980  2.741   -9.971   1.00 23.80 ? 13  VAL A CA  1 
ATOM   83   C  C   . VAL A 1 13  ? -5.218  2.300   -10.711  1.00 24.06 ? 13  VAL A C   1 
ATOM   84   O  O   . VAL A 1 13  ? -6.349  2.628   -10.318  1.00 25.03 ? 13  VAL A O   1 
ATOM   85   C  CB  . VAL A 1 13  ? -3.693  1.824   -8.740   1.00 24.53 ? 13  VAL A CB  1 
ATOM   86   C  CG1 . VAL A 1 13  ? -3.499  0.395   -9.186   1.00 27.17 ? 13  VAL A CG1 1 
ATOM   87   C  CG2 . VAL A 1 13  ? -2.368  2.184   -8.076   1.00 24.64 ? 13  VAL A CG2 1 
ATOM   88   N  N   . LEU A 1 14  ? -5.005  1.579   -11.810  1.00 25.42 ? 14  LEU A N   1 
ATOM   89   C  CA  . LEU A 1 14  ? -6.119  1.048   -12.583  1.00 27.82 ? 14  LEU A CA  1 
ATOM   90   C  C   . LEU A 1 14  ? -6.017  -0.451  -12.295  1.00 29.41 ? 14  LEU A C   1 
ATOM   91   O  O   . LEU A 1 14  ? -5.033  -1.125  -12.622  1.00 31.67 ? 14  LEU A O   1 
ATOM   92   C  CB  . LEU A 1 14  ? -5.956  1.322   -14.103  1.00 23.46 ? 14  LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 14  ? -7.175  0.931   -14.953  1.00 22.01 ? 14  LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 14  ? -8.206  2.047   -14.968  1.00 22.45 ? 14  LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 14  ? -6.736  0.614   -16.358  1.00 20.82 ? 14  LEU A CD2 1 
ATOM   96   N  N   . TRP A 1 15  ? -6.980  -0.939  -11.522  1.00 30.56 ? 15  TRP A N   1 
ATOM   97   C  CA  . TRP A 1 15  ? -7.043  -2.343  -11.145  1.00 30.39 ? 15  TRP A CA  1 
ATOM   98   C  C   . TRP A 1 15  ? -7.819  -3.104  -12.217  1.00 31.42 ? 15  TRP A C   1 
ATOM   99   O  O   . TRP A 1 15  ? -7.489  -4.259  -12.459  1.00 29.96 ? 15  TRP A O   1 
ATOM   100  C  CB  . TRP A 1 15  ? -7.751  -2.530  -9.748   1.00 26.75 ? 15  TRP A CB  1 
ATOM   101  C  CG  . TRP A 1 15  ? -6.962  -1.991  -8.543   1.00 26.13 ? 15  TRP A CG  1 
ATOM   102  C  CD1 . TRP A 1 15  ? -7.287  -0.779  -7.975   1.00 24.32 ? 15  TRP A CD1 1 
ATOM   103  C  CD2 . TRP A 1 15  ? -5.837  -2.551  -7.976   1.00 23.12 ? 15  TRP A CD2 1 
ATOM   104  N  NE1 . TRP A 1 15  ? -6.359  -0.556  -7.090   1.00 22.82 ? 15  TRP A NE1 1 
ATOM   105  C  CE2 . TRP A 1 15  ? -5.488  -1.568  -7.051   1.00 18.64 ? 15  TRP A CE2 1 
ATOM   106  C  CE3 . TRP A 1 15  ? -5.049  -3.699  -8.094   1.00 27.46 ? 15  TRP A CE3 1 
ATOM   107  C  CZ2 . TRP A 1 15  ? -4.368  -1.701  -6.238   1.00 21.56 ? 15  TRP A CZ2 1 
ATOM   108  C  CZ3 . TRP A 1 15  ? -3.913  -3.838  -7.278   1.00 29.78 ? 15  TRP A CZ3 1 
ATOM   109  C  CH2 . TRP A 1 15  ? -3.578  -2.844  -6.356   1.00 28.80 ? 15  TRP A CH2 1 
ATOM   110  N  N   . GLU A 1 16  ? -8.831  -2.488  -12.856  1.00 29.24 ? 16  GLU A N   1 
ATOM   111  C  CA  . GLU A 1 16  ? -9.644  -3.113  -13.869  1.00 32.66 ? 16  GLU A CA  1 
ATOM   112  C  C   . GLU A 1 16  ? -9.917  -2.125  -14.998  1.00 36.24 ? 16  GLU A C   1 
ATOM   113  O  O   . GLU A 1 16  ? -9.894  -0.900  -14.806  1.00 36.18 ? 16  GLU A O   1 
ATOM   114  C  CB  . GLU A 1 16  ? -11.008 -3.537  -13.353  1.00 38.01 ? 16  GLU A CB  1 
ATOM   115  C  CG  . GLU A 1 16  ? -11.091 -4.777  -12.463  1.00 49.64 ? 16  GLU A CG  1 
ATOM   116  C  CD  . GLU A 1 16  ? -12.507 -5.092  -11.976  1.00 53.12 ? 16  GLU A CD  1 
ATOM   117  O  OE1 . GLU A 1 16  ? -13.272 -5.720  -12.717  1.00 52.96 ? 16  GLU A OE1 1 
ATOM   118  O  OE2 . GLU A 1 16  ? -12.842 -4.708  -10.850  1.00 55.63 ? 16  GLU A OE2 1 
ATOM   119  N  N   . VAL A 1 17  ? -10.199 -2.705  -16.173  1.00 34.82 ? 17  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 17  ? -10.547 -1.975  -17.396  1.00 33.85 ? 17  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 17  ? -11.960 -1.451  -17.150  1.00 33.95 ? 17  VAL A C   1 
ATOM   122  O  O   . VAL A 1 17  ? -12.734 -2.058  -16.397  1.00 33.06 ? 17  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 17  ? -10.513 -2.945  -18.625  1.00 29.39 ? 17  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 17  ? -11.280 -2.458  -19.826  1.00 28.64 ? 17  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 17  ? -9.074  -3.033  -19.062  1.00 28.16 ? 17  VAL A CG2 1 
ATOM   126  N  N   . LYS A 1 18  ? -12.264 -0.307  -17.763  1.00 31.34 ? 18  LYS A N   1 
ATOM   127  C  CA  . LYS A 1 18  ? -13.543 0.352   -17.662  1.00 31.47 ? 18  LYS A CA  1 
ATOM   128  C  C   . LYS A 1 18  ? -13.963 0.679   -16.221  1.00 33.48 ? 18  LYS A C   1 
ATOM   129  O  O   . LYS A 1 18  ? -15.122 0.994   -15.929  1.00 35.27 ? 18  LYS A O   1 
ATOM   130  C  CB  . LYS A 1 18  ? -14.566 -0.531  -18.393  1.00 33.04 ? 18  LYS A CB  1 
ATOM   131  C  CG  . LYS A 1 18  ? -14.469 -0.262  -19.887  1.00 43.50 ? 18  LYS A CG  1 
ATOM   132  C  CD  . LYS A 1 18  ? -15.501 -0.974  -20.769  1.00 48.64 ? 18  LYS A CD  1 
ATOM   133  C  CE  . LYS A 1 18  ? -15.133 -2.414  -21.165  1.00 50.28 ? 18  LYS A CE  1 
ATOM   134  N  NZ  . LYS A 1 18  ? -13.969 -2.463  -22.034  1.00 48.88 ? 18  LYS A NZ  1 
ATOM   135  N  N   . LYS A 1 19  ? -12.994 0.728   -15.304  1.00 32.57 ? 19  LYS A N   1 
ATOM   136  C  CA  . LYS A 1 19  ? -13.255 1.024   -13.911  1.00 31.78 ? 19  LYS A CA  1 
ATOM   137  C  C   . LYS A 1 19  ? -12.568 2.330   -13.629  1.00 30.46 ? 19  LYS A C   1 
ATOM   138  O  O   . LYS A 1 19  ? -11.679 2.710   -14.405  1.00 31.49 ? 19  LYS A O   1 
ATOM   139  C  CB  . LYS A 1 19  ? -12.674 -0.088  -12.999  1.00 34.56 ? 19  LYS A CB  1 
ATOM   140  C  CG  . LYS A 1 19  ? -13.693 -1.003  -12.306  1.00 34.87 ? 19  LYS A CG  1 
ATOM   141  C  CD  . LYS A 1 19  ? -14.831 -1.333  -13.258  1.00 38.93 ? 19  LYS A CD  1 
ATOM   142  C  CE  . LYS A 1 19  ? -15.841 -2.297  -12.704  1.00 45.42 ? 19  LYS A CE  1 
ATOM   143  N  NZ  . LYS A 1 19  ? -15.195 -3.582  -12.556  1.00 51.58 ? 19  LYS A NZ  1 
ATOM   144  N  N   . PRO A 1 20  ? -12.968 3.069   -12.576  1.00 29.31 ? 20  PRO A N   1 
ATOM   145  C  CA  . PRO A 1 20  ? -12.284 4.275   -12.159  1.00 24.70 ? 20  PRO A CA  1 
ATOM   146  C  C   . PRO A 1 20  ? -10.897 3.977   -11.647  1.00 23.76 ? 20  PRO A C   1 
ATOM   147  O  O   . PRO A 1 20  ? -10.518 2.837   -11.380  1.00 26.53 ? 20  PRO A O   1 
ATOM   148  C  CB  . PRO A 1 20  ? -13.166 4.862   -11.117  1.00 23.95 ? 20  PRO A CB  1 
ATOM   149  C  CG  . PRO A 1 20  ? -14.540 4.492   -11.581  1.00 24.17 ? 20  PRO A CG  1 
ATOM   150  C  CD  . PRO A 1 20  ? -14.290 3.029   -11.945  1.00 28.58 ? 20  PRO A CD  1 
ATOM   151  N  N   . PHE A 1 21  ? -10.109 5.036   -11.601  1.00 24.20 ? 21  PHE A N   1 
ATOM   152  C  CA  . PHE A 1 21  ? -8.785  4.970   -11.048  1.00 24.61 ? 21  PHE A CA  1 
ATOM   153  C  C   . PHE A 1 21  ? -8.993  5.033   -9.520   1.00 30.14 ? 21  PHE A C   1 
ATOM   154  O  O   . PHE A 1 21  ? -9.981  5.585   -9.004   1.00 30.54 ? 21  PHE A O   1 
ATOM   155  C  CB  . PHE A 1 21  ? -7.977  6.162   -11.451  1.00 23.40 ? 21  PHE A CB  1 
ATOM   156  C  CG  . PHE A 1 21  ? -7.516  6.155   -12.878  1.00 29.12 ? 21  PHE A CG  1 
ATOM   157  C  CD1 . PHE A 1 21  ? -8.376  6.606   -13.886  1.00 30.53 ? 21  PHE A CD1 1 
ATOM   158  C  CD2 . PHE A 1 21  ? -6.222  5.721   -13.170  1.00 25.66 ? 21  PHE A CD2 1 
ATOM   159  C  CE1 . PHE A 1 21  ? -7.920  6.618   -15.197  1.00 26.61 ? 21  PHE A CE1 1 
ATOM   160  C  CE2 . PHE A 1 21  ? -5.790  5.747   -14.488  1.00 27.30 ? 21  PHE A CE2 1 
ATOM   161  C  CZ  . PHE A 1 21  ? -6.633  6.192   -15.495  1.00 25.98 ? 21  PHE A CZ  1 
ATOM   162  N  N   . SER A 1 22  ? -8.033  4.541   -8.764   1.00 30.75 ? 22  SER A N   1 
ATOM   163  C  CA  . SER A 1 22  ? -8.129  4.550   -7.336   1.00 29.99 ? 22  SER A CA  1 
ATOM   164  C  C   . SER A 1 22  ? -6.858  5.220   -6.862   1.00 29.11 ? 22  SER A C   1 
ATOM   165  O  O   . SER A 1 22  ? -5.752  4.768   -7.175   1.00 25.33 ? 22  SER A O   1 
ATOM   166  C  CB  . SER A 1 22  ? -8.251  3.090   -6.899   1.00 35.09 ? 22  SER A CB  1 
ATOM   167  O  OG  . SER A 1 22  ? -8.698  2.868   -5.562   1.00 40.79 ? 22  SER A OG  1 
ATOM   168  N  N   . ILE A 1 23  ? -6.988  6.351   -6.175   1.00 33.47 ? 23  ILE A N   1 
ATOM   169  C  CA  . ILE A 1 23  ? -5.817  7.043   -5.641   1.00 36.40 ? 23  ILE A CA  1 
ATOM   170  C  C   . ILE A 1 23  ? -5.496  6.199   -4.408   1.00 37.71 ? 23  ILE A C   1 
ATOM   171  O  O   . ILE A 1 23  ? -6.285  6.080   -3.458   1.00 40.51 ? 23  ILE A O   1 
ATOM   172  C  CB  . ILE A 1 23  ? -6.157  8.508   -5.256   1.00 37.05 ? 23  ILE A CB  1 
ATOM   173  C  CG1 . ILE A 1 23  ? -6.454  9.323   -6.522   1.00 33.14 ? 23  ILE A CG1 1 
ATOM   174  C  CG2 . ILE A 1 23  ? -4.978  9.125   -4.483   1.00 36.90 ? 23  ILE A CG2 1 
ATOM   175  C  CD1 . ILE A 1 23  ? -7.937  9.342   -6.931   1.00 32.87 ? 23  ILE A CD1 1 
ATOM   176  N  N   . GLU A 1 24  ? -4.349  5.551   -4.488   1.00 33.39 ? 24  GLU A N   1 
ATOM   177  C  CA  . GLU A 1 24  ? -3.933  4.634   -3.474   1.00 31.63 ? 24  GLU A CA  1 
ATOM   178  C  C   . GLU A 1 24  ? -2.577  5.006   -2.947   1.00 31.48 ? 24  GLU A C   1 
ATOM   179  O  O   . GLU A 1 24  ? -1.870  5.828   -3.526   1.00 34.47 ? 24  GLU A O   1 
ATOM   180  C  CB  . GLU A 1 24  ? -3.858  3.240   -4.066   1.00 35.81 ? 24  GLU A CB  1 
ATOM   181  C  CG  . GLU A 1 24  ? -5.130  2.688   -4.704   1.00 35.78 ? 24  GLU A CG  1 
ATOM   182  C  CD  . GLU A 1 24  ? -5.730  1.480   -4.021   1.00 39.04 ? 24  GLU A CD  1 
ATOM   183  O  OE1 . GLU A 1 24  ? -5.023  0.838   -3.246   1.00 43.79 ? 24  GLU A OE1 1 
ATOM   184  O  OE2 . GLU A 1 24  ? -6.900  1.170   -4.263   1.00 35.65 ? 24  GLU A OE2 1 
ATOM   185  N  N   . ASP A 1 25  ? -2.215  4.419   -1.821   1.00 28.79 ? 25  ASP A N   1 
ATOM   186  C  CA  . ASP A 1 25  ? -0.901  4.634   -1.256   1.00 28.93 ? 25  ASP A CA  1 
ATOM   187  C  C   . ASP A 1 25  ? -0.090  3.545   -1.878   1.00 25.95 ? 25  ASP A C   1 
ATOM   188  O  O   . ASP A 1 25  ? -0.554  2.399   -1.902   1.00 25.86 ? 25  ASP A O   1 
ATOM   189  C  CB  . ASP A 1 25  ? -0.853  4.422   0.231    1.00 30.68 ? 25  ASP A CB  1 
ATOM   190  C  CG  . ASP A 1 25  ? -1.179  5.694   0.927    1.00 30.54 ? 25  ASP A CG  1 
ATOM   191  O  OD1 . ASP A 1 25  ? -2.363  5.952   1.162    1.00 33.82 ? 25  ASP A OD1 1 
ATOM   192  O  OD2 . ASP A 1 25  ? -0.221  6.414   1.188    1.00 36.76 ? 25  ASP A OD2 1 
ATOM   193  N  N   . VAL A 1 26  ? 1.084   3.872   -2.372   1.00 22.90 ? 26  VAL A N   1 
ATOM   194  C  CA  . VAL A 1 26  ? 1.900   2.879   -3.015   1.00 22.91 ? 26  VAL A CA  1 
ATOM   195  C  C   . VAL A 1 26  ? 3.304   3.112   -2.522   1.00 23.78 ? 26  VAL A C   1 
ATOM   196  O  O   . VAL A 1 26  ? 3.664   4.209   -2.046   1.00 25.58 ? 26  VAL A O   1 
ATOM   197  C  CB  . VAL A 1 26  ? 1.873   3.000   -4.617   1.00 22.47 ? 26  VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 26  ? 0.457   2.906   -5.129   1.00 15.48 ? 26  VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 26  ? 2.463   4.335   -5.098   1.00 22.69 ? 26  VAL A CG2 1 
ATOM   200  N  N   . GLU A 1 27  ? 4.111   2.080   -2.649   1.00 23.98 ? 27  GLU A N   1 
ATOM   201  C  CA  . GLU A 1 27  ? 5.488   2.229   -2.256   1.00 29.68 ? 27  GLU A CA  1 
ATOM   202  C  C   . GLU A 1 27  ? 6.191   2.182   -3.604   1.00 27.79 ? 27  GLU A C   1 
ATOM   203  O  O   . GLU A 1 27  ? 5.837   1.369   -4.478   1.00 28.48 ? 27  GLU A O   1 
ATOM   204  C  CB  . GLU A 1 27  ? 5.917   1.077   -1.343   1.00 38.33 ? 27  GLU A CB  1 
ATOM   205  C  CG  . GLU A 1 27  ? 5.185   0.967   0.000    1.00 40.94 ? 27  GLU A CG  1 
ATOM   206  C  CD  . GLU A 1 27  ? 4.236   -0.221  0.022    1.00 49.76 ? 27  GLU A CD  1 
ATOM   207  O  OE1 . GLU A 1 27  ? 4.695   -1.324  0.344    1.00 52.75 ? 27  GLU A OE1 1 
ATOM   208  O  OE2 . GLU A 1 27  ? 3.050   -0.051  -0.292   1.00 52.68 ? 27  GLU A OE2 1 
ATOM   209  N  N   . VAL A 1 28  ? 7.140   3.099   -3.722   1.00 22.60 ? 28  VAL A N   1 
ATOM   210  C  CA  . VAL A 1 28  ? 7.934   3.351   -4.893   1.00 22.65 ? 28  VAL A CA  1 
ATOM   211  C  C   . VAL A 1 28  ? 9.356   3.017   -4.499   1.00 24.18 ? 28  VAL A C   1 
ATOM   212  O  O   . VAL A 1 28  ? 9.924   3.742   -3.692   1.00 29.30 ? 28  VAL A O   1 
ATOM   213  C  CB  . VAL A 1 28  ? 7.813   4.884   -5.310   1.00 20.87 ? 28  VAL A CB  1 
ATOM   214  C  CG1 . VAL A 1 28  ? 8.623   5.148   -6.566   1.00 16.55 ? 28  VAL A CG1 1 
ATOM   215  C  CG2 . VAL A 1 28  ? 6.357   5.266   -5.542   1.00 15.79 ? 28  VAL A CG2 1 
ATOM   216  N  N   . ALA A 1 29  ? 9.961   1.956   -5.008   1.00 23.76 ? 29  ALA A N   1 
ATOM   217  C  CA  . ALA A 1 29  ? 11.326  1.580   -4.686   1.00 20.53 ? 29  ALA A CA  1 
ATOM   218  C  C   . ALA A 1 29  ? 12.389  2.564   -5.148   1.00 24.65 ? 29  ALA A C   1 
ATOM   219  O  O   . ALA A 1 29  ? 12.133  3.324   -6.075   1.00 29.43 ? 29  ALA A O   1 
ATOM   220  C  CB  . ALA A 1 29  ? 11.596  0.267   -5.318   1.00 19.09 ? 29  ALA A CB  1 
ATOM   221  N  N   . PRO A 1 30  ? 13.593  2.671   -4.614   1.00 23.96 ? 30  PRO A N   1 
ATOM   222  C  CA  . PRO A 1 30  ? 14.557  3.629   -5.117   1.00 21.77 ? 30  PRO A CA  1 
ATOM   223  C  C   . PRO A 1 30  ? 15.122  3.252   -6.487   1.00 22.51 ? 30  PRO A C   1 
ATOM   224  O  O   . PRO A 1 30  ? 15.045  2.105   -6.958   1.00 23.73 ? 30  PRO A O   1 
ATOM   225  C  CB  . PRO A 1 30  ? 15.595  3.704   -3.996   1.00 20.03 ? 30  PRO A CB  1 
ATOM   226  C  CG  . PRO A 1 30  ? 15.531  2.369   -3.322   1.00 18.20 ? 30  PRO A CG  1 
ATOM   227  C  CD  . PRO A 1 30  ? 14.016  2.123   -3.337   1.00 24.63 ? 30  PRO A CD  1 
ATOM   228  N  N   . PRO A 1 31  ? 15.729  4.193   -7.189   1.00 22.17 ? 31  PRO A N   1 
ATOM   229  C  CA  . PRO A 1 31  ? 16.322  3.938   -8.478   1.00 22.35 ? 31  PRO A CA  1 
ATOM   230  C  C   . PRO A 1 31  ? 17.434  2.921   -8.517   1.00 27.95 ? 31  PRO A C   1 
ATOM   231  O  O   . PRO A 1 31  ? 18.370  2.998   -7.708   1.00 31.11 ? 31  PRO A O   1 
ATOM   232  C  CB  . PRO A 1 31  ? 16.795  5.282   -8.928   1.00 20.86 ? 31  PRO A CB  1 
ATOM   233  C  CG  . PRO A 1 31  ? 16.940  6.045   -7.634   1.00 17.36 ? 31  PRO A CG  1 
ATOM   234  C  CD  . PRO A 1 31  ? 15.670  5.628   -6.946   1.00 14.48 ? 31  PRO A CD  1 
ATOM   235  N  N   . LYS A 1 32  ? 17.401  1.966   -9.454   1.00 27.93 ? 32  LYS A N   1 
ATOM   236  C  CA  . LYS A 1 32  ? 18.555  1.096   -9.534   1.00 24.79 ? 32  LYS A CA  1 
ATOM   237  C  C   . LYS A 1 32  ? 19.580  1.881   -10.374  1.00 27.64 ? 32  LYS A C   1 
ATOM   238  O  O   . LYS A 1 32  ? 19.407  3.095   -10.596  1.00 26.50 ? 32  LYS A O   1 
ATOM   239  C  CB  . LYS A 1 32  ? 18.164  -0.197  -10.175  1.00 22.05 ? 32  LYS A CB  1 
ATOM   240  C  CG  . LYS A 1 32  ? 17.155  -0.966  -9.325   1.00 22.08 ? 32  LYS A CG  1 
ATOM   241  C  CD  . LYS A 1 32  ? 17.093  -2.371  -9.907   1.00 25.88 ? 32  LYS A CD  1 
ATOM   242  C  CE  . LYS A 1 32  ? 15.926  -3.151  -9.359   1.00 28.18 ? 32  LYS A CE  1 
ATOM   243  N  NZ  . LYS A 1 32  ? 15.765  -4.394  -10.098  1.00 31.70 ? 32  LYS A NZ  1 
ATOM   244  N  N   . ALA A 1 33  ? 20.701  1.327   -10.841  1.00 29.76 ? 33  ALA A N   1 
ATOM   245  C  CA  . ALA A 1 33  ? 21.637  2.121   -11.644  1.00 31.60 ? 33  ALA A CA  1 
ATOM   246  C  C   . ALA A 1 33  ? 20.942  2.506   -12.948  1.00 35.10 ? 33  ALA A C   1 
ATOM   247  O  O   . ALA A 1 33  ? 20.022  1.795   -13.387  1.00 38.57 ? 33  ALA A O   1 
ATOM   248  C  CB  . ALA A 1 33  ? 22.888  1.316   -12.006  1.00 30.62 ? 33  ALA A CB  1 
ATOM   249  N  N   . TYR A 1 34  ? 21.326  3.623   -13.574  1.00 33.42 ? 34  TYR A N   1 
ATOM   250  C  CA  . TYR A 1 34  ? 20.752  4.086   -14.828  1.00 29.53 ? 34  TYR A CA  1 
ATOM   251  C  C   . TYR A 1 34  ? 19.247  4.322   -14.754  1.00 28.63 ? 34  TYR A C   1 
ATOM   252  O  O   . TYR A 1 34  ? 18.587  4.269   -15.793  1.00 30.75 ? 34  TYR A O   1 
ATOM   253  C  CB  . TYR A 1 34  ? 21.033  3.087   -15.964  1.00 28.35 ? 34  TYR A CB  1 
ATOM   254  C  CG  . TYR A 1 34  ? 22.479  2.649   -16.000  1.00 26.44 ? 34  TYR A CG  1 
ATOM   255  C  CD1 . TYR A 1 34  ? 23.483  3.563   -16.288  1.00 25.56 ? 34  TYR A CD1 1 
ATOM   256  C  CD2 . TYR A 1 34  ? 22.784  1.323   -15.701  1.00 25.91 ? 34  TYR A CD2 1 
ATOM   257  C  CE1 . TYR A 1 34  ? 24.812  3.141   -16.267  1.00 25.74 ? 34  TYR A CE1 1 
ATOM   258  C  CE2 . TYR A 1 34  ? 24.107  0.908   -15.681  1.00 25.30 ? 34  TYR A CE2 1 
ATOM   259  C  CZ  . TYR A 1 34  ? 25.106  1.822   -15.957  1.00 23.32 ? 34  TYR A CZ  1 
ATOM   260  O  OH  . TYR A 1 34  ? 26.417  1.424   -15.869  1.00 30.60 ? 34  TYR A OH  1 
ATOM   261  N  N   . GLU A 1 35  ? 18.685  4.562   -13.558  1.00 27.07 ? 35  GLU A N   1 
ATOM   262  C  CA  . GLU A 1 35  ? 17.282  4.870   -13.359  1.00 23.24 ? 35  GLU A CA  1 
ATOM   263  C  C   . GLU A 1 35  ? 17.232  6.177   -12.589  1.00 23.63 ? 35  GLU A C   1 
ATOM   264  O  O   . GLU A 1 35  ? 18.215  6.598   -11.985  1.00 21.75 ? 35  GLU A O   1 
ATOM   265  C  CB  . GLU A 1 35  ? 16.592  3.824   -12.572  1.00 19.61 ? 35  GLU A CB  1 
ATOM   266  C  CG  . GLU A 1 35  ? 16.483  2.545   -13.376  1.00 21.74 ? 35  GLU A CG  1 
ATOM   267  C  CD  . GLU A 1 35  ? 15.660  1.494   -12.674  1.00 26.91 ? 35  GLU A CD  1 
ATOM   268  O  OE1 . GLU A 1 35  ? 14.757  1.840   -11.929  1.00 36.52 ? 35  GLU A OE1 1 
ATOM   269  O  OE2 . GLU A 1 35  ? 15.913  0.313   -12.852  1.00 26.85 ? 35  GLU A OE2 1 
ATOM   270  N  N   . VAL A 1 36  ? 16.094  6.845   -12.584  1.00 25.46 ? 36  VAL A N   1 
ATOM   271  C  CA  . VAL A 1 36  ? 15.912  8.158   -12.014  1.00 20.95 ? 36  VAL A CA  1 
ATOM   272  C  C   . VAL A 1 36  ? 14.582  8.163   -11.288  1.00 22.26 ? 36  VAL A C   1 
ATOM   273  O  O   . VAL A 1 36  ? 13.646  7.546   -11.813  1.00 22.93 ? 36  VAL A O   1 
ATOM   274  C  CB  . VAL A 1 36  ? 15.966  9.136   -13.224  1.00 19.22 ? 36  VAL A CB  1 
ATOM   275  C  CG1 . VAL A 1 36  ? 15.445  10.497  -12.885  1.00 21.27 ? 36  VAL A CG1 1 
ATOM   276  C  CG2 . VAL A 1 36  ? 17.411  9.377   -13.626  1.00 20.54 ? 36  VAL A CG2 1 
ATOM   277  N  N   . ARG A 1 37  ? 14.459  8.784   -10.092  1.00 20.01 ? 37  ARG A N   1 
ATOM   278  C  CA  . ARG A 1 37  ? 13.169  8.849   -9.412   1.00 18.28 ? 37  ARG A CA  1 
ATOM   279  C  C   . ARG A 1 37  ? 12.855  10.325  -9.547   1.00 16.50 ? 37  ARG A C   1 
ATOM   280  O  O   . ARG A 1 37  ? 13.723  11.182  -9.285   1.00 11.33 ? 37  ARG A O   1 
ATOM   281  C  CB  . ARG A 1 37  ? 13.286  8.456   -7.963   1.00 21.24 ? 37  ARG A CB  1 
ATOM   282  C  CG  . ARG A 1 37  ? 11.932  8.312   -7.305   1.00 27.05 ? 37  ARG A CG  1 
ATOM   283  C  CD  . ARG A 1 37  ? 11.959  7.162   -6.323   1.00 34.90 ? 37  ARG A CD  1 
ATOM   284  N  NE  . ARG A 1 37  ? 13.007  7.342   -5.319   1.00 40.49 ? 37  ARG A NE  1 
ATOM   285  C  CZ  . ARG A 1 37  ? 12.987  6.731   -4.134   1.00 36.68 ? 37  ARG A CZ  1 
ATOM   286  N  NH1 . ARG A 1 37  ? 12.010  5.899   -3.756   1.00 34.19 ? 37  ARG A NH1 1 
ATOM   287  N  NH2 . ARG A 1 37  ? 13.986  7.003   -3.319   1.00 34.63 ? 37  ARG A NH2 1 
ATOM   288  N  N   . ILE A 1 38  ? 11.620  10.616  -9.947   1.00 14.54 ? 38  ILE A N   1 
ATOM   289  C  CA  . ILE A 1 38  ? 11.193  11.962  -10.261  1.00 16.36 ? 38  ILE A CA  1 
ATOM   290  C  C   . ILE A 1 38  ? 9.989   12.271  -9.422   1.00 15.48 ? 38  ILE A C   1 
ATOM   291  O  O   . ILE A 1 38  ? 9.197   11.359  -9.173   1.00 16.38 ? 38  ILE A O   1 
ATOM   292  C  CB  . ILE A 1 38  ? 10.853  12.005  -11.823  1.00 19.91 ? 38  ILE A CB  1 
ATOM   293  C  CG1 . ILE A 1 38  ? 12.073  11.610  -12.646  1.00 22.75 ? 38  ILE A CG1 1 
ATOM   294  C  CG2 . ILE A 1 38  ? 10.467  13.395  -12.270  1.00 12.45 ? 38  ILE A CG2 1 
ATOM   295  C  CD1 . ILE A 1 38  ? 11.703  10.950  -14.000  1.00 27.56 ? 38  ILE A CD1 1 
ATOM   296  N  N   . LYS A 1 39  ? 9.790   13.552  -9.119   1.00 18.45 ? 39  LYS A N   1 
ATOM   297  C  CA  . LYS A 1 39  ? 8.683   14.024  -8.309   1.00 23.95 ? 39  LYS A CA  1 
ATOM   298  C  C   . LYS A 1 39  ? 7.779   14.667  -9.348   1.00 23.38 ? 39  LYS A C   1 
ATOM   299  O  O   . LYS A 1 39  ? 8.157   15.670  -9.956   1.00 24.89 ? 39  LYS A O   1 
ATOM   300  C  CB  . LYS A 1 39  ? 9.215   15.046  -7.274   1.00 26.23 ? 39  LYS A CB  1 
ATOM   301  C  CG  . LYS A 1 39  ? 8.256   15.453  -6.141   1.00 34.65 ? 39  LYS A CG  1 
ATOM   302  C  CD  . LYS A 1 39  ? 7.092   16.381  -6.520   1.00 39.56 ? 39  LYS A CD  1 
ATOM   303  C  CE  . LYS A 1 39  ? 5.735   15.973  -5.902   1.00 42.75 ? 39  LYS A CE  1 
ATOM   304  N  NZ  . LYS A 1 39  ? 5.058   14.870  -6.591   1.00 35.26 ? 39  LYS A NZ  1 
ATOM   305  N  N   . MET A 1 40  ? 6.609   14.107  -9.596   1.00 23.07 ? 40  MET A N   1 
ATOM   306  C  CA  . MET A 1 40  ? 5.717   14.646  -10.593  1.00 24.89 ? 40  MET A CA  1 
ATOM   307  C  C   . MET A 1 40  ? 5.170   16.015  -10.264  1.00 27.66 ? 40  MET A C   1 
ATOM   308  O  O   . MET A 1 40  ? 4.565   16.163  -9.215   1.00 31.46 ? 40  MET A O   1 
ATOM   309  C  CB  . MET A 1 40  ? 4.551   13.719  -10.806  1.00 24.83 ? 40  MET A CB  1 
ATOM   310  C  CG  . MET A 1 40  ? 4.864   12.525  -11.690  1.00 30.40 ? 40  MET A CG  1 
ATOM   311  S  SD  . MET A 1 40  ? 5.647   13.084  -13.207  1.00 28.62 ? 40  MET A SD  1 
ATOM   312  C  CE  . MET A 1 40  ? 7.253   12.341  -13.094  1.00 17.30 ? 40  MET A CE  1 
ATOM   313  N  N   . VAL A 1 41  ? 5.350   17.048  -11.090  1.00 25.26 ? 41  VAL A N   1 
ATOM   314  C  CA  . VAL A 1 41  ? 4.789   18.343  -10.778  1.00 20.44 ? 41  VAL A CA  1 
ATOM   315  C  C   . VAL A 1 41  ? 3.499   18.551  -11.579  1.00 25.37 ? 41  VAL A C   1 
ATOM   316  O  O   . VAL A 1 41  ? 2.541   19.132  -11.045  1.00 25.60 ? 41  VAL A O   1 
ATOM   317  C  CB  . VAL A 1 41  ? 5.810   19.402  -11.108  1.00 15.88 ? 41  VAL A CB  1 
ATOM   318  C  CG1 . VAL A 1 41  ? 5.197   20.768  -10.864  1.00 13.08 ? 41  VAL A CG1 1 
ATOM   319  C  CG2 . VAL A 1 41  ? 7.076   19.151  -10.309  1.00 8.12  ? 41  VAL A CG2 1 
ATOM   320  N  N   . ALA A 1 42  ? 3.437   18.105  -12.850  1.00 25.05 ? 42  ALA A N   1 
ATOM   321  C  CA  . ALA A 1 42  ? 2.250   18.269  -13.690  1.00 21.92 ? 42  ALA A CA  1 
ATOM   322  C  C   . ALA A 1 42  ? 2.202   17.157  -14.708  1.00 20.77 ? 42  ALA A C   1 
ATOM   323  O  O   . ALA A 1 42  ? 3.259   16.721  -15.208  1.00 19.27 ? 42  ALA A O   1 
ATOM   324  C  CB  . ALA A 1 42  ? 2.292   19.546  -14.487  1.00 24.17 ? 42  ALA A CB  1 
ATOM   325  N  N   . VAL A 1 43  ? 0.984   16.703  -15.014  1.00 17.41 ? 43  VAL A N   1 
ATOM   326  C  CA  . VAL A 1 43  ? 0.751   15.624  -15.971  1.00 16.56 ? 43  VAL A CA  1 
ATOM   327  C  C   . VAL A 1 43  ? -0.447  15.900  -16.888  1.00 13.52 ? 43  VAL A C   1 
ATOM   328  O  O   . VAL A 1 43  ? -1.487  16.421  -16.427  1.00 8.59  ? 43  VAL A O   1 
ATOM   329  C  CB  . VAL A 1 43  ? 0.497   14.272  -15.229  1.00 18.53 ? 43  VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 43  ? 0.249   13.130  -16.216  1.00 21.23 ? 43  VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 43  ? 1.738   13.860  -14.502  1.00 19.64 ? 43  VAL A CG2 1 
ATOM   332  N  N   . GLY A 1 44  ? -0.373  15.518  -18.171  1.00 5.69  ? 44  GLY A N   1 
ATOM   333  C  CA  . GLY A 1 44  ? -1.534  15.781  -19.009  1.00 2.70  ? 44  GLY A CA  1 
ATOM   334  C  C   . GLY A 1 44  ? -2.311  14.526  -19.241  1.00 2.00  ? 44  GLY A C   1 
ATOM   335  O  O   . GLY A 1 44  ? -1.718  13.436  -19.228  1.00 9.72  ? 44  GLY A O   1 
ATOM   336  N  N   . ILE A 1 45  ? -3.616  14.551  -19.390  1.00 5.22  ? 45  ILE A N   1 
ATOM   337  C  CA  . ILE A 1 45  ? -4.308  13.299  -19.709  1.00 14.25 ? 45  ILE A CA  1 
ATOM   338  C  C   . ILE A 1 45  ? -4.332  13.190  -21.259  1.00 21.72 ? 45  ILE A C   1 
ATOM   339  O  O   . ILE A 1 45  ? -4.833  14.084  -21.951  1.00 17.08 ? 45  ILE A O   1 
ATOM   340  C  CB  . ILE A 1 45  ? -5.694  13.363  -19.133  1.00 19.77 ? 45  ILE A CB  1 
ATOM   341  C  CG1 . ILE A 1 45  ? -5.564  13.381  -17.611  1.00 18.23 ? 45  ILE A CG1 1 
ATOM   342  C  CG2 . ILE A 1 45  ? -6.547  12.241  -19.741  1.00 20.69 ? 45  ILE A CG2 1 
ATOM   343  C  CD1 . ILE A 1 45  ? -6.917  13.548  -16.915  1.00 24.68 ? 45  ILE A CD1 1 
ATOM   344  N  N   . CYS A 1 46  ? -3.745  12.104  -21.794  1.00 25.34 ? 46  CYS A N   1 
ATOM   345  C  CA  . CYS A 1 46  ? -3.619  11.846  -23.223  1.00 24.26 ? 46  CYS A CA  1 
ATOM   346  C  C   . CYS A 1 46  ? -4.524  10.695  -23.621  1.00 24.70 ? 46  CYS A C   1 
ATOM   347  O  O   . CYS A 1 46  ? -4.743  9.824   -22.770  1.00 23.27 ? 46  CYS A O   1 
ATOM   348  C  CB  . CYS A 1 46  ? -2.158  11.515  -23.552  1.00 26.07 ? 46  CYS A CB  1 
ATOM   349  S  SG  . CYS A 1 46  ? -1.842  11.083  -25.289  1.00 18.44 ? 46  CYS A SG  1 
ATOM   350  N  N   . GLY A 1 47  ? -5.020  10.629  -24.878  1.00 24.35 ? 47  GLY A N   1 
ATOM   351  C  CA  . GLY A 1 47  ? -5.930  9.585   -25.361  1.00 19.26 ? 47  GLY A CA  1 
ATOM   352  C  C   . GLY A 1 47  ? -5.353  8.169   -25.266  1.00 19.16 ? 47  GLY A C   1 
ATOM   353  O  O   . GLY A 1 47  ? -6.105  7.188   -25.141  1.00 16.80 ? 47  GLY A O   1 
ATOM   354  N  N   . THR A 1 48  ? -4.026  7.993   -25.355  1.00 17.88 ? 48  THR A N   1 
ATOM   355  C  CA  . THR A 1 48  ? -3.410  6.680   -25.196  1.00 21.25 ? 48  THR A CA  1 
ATOM   356  C  C   . THR A 1 48  ? -3.767  6.137   -23.791  1.00 25.73 ? 48  THR A C   1 
ATOM   357  O  O   . THR A 1 48  ? -4.227  4.984   -23.677  1.00 29.08 ? 48  THR A O   1 
ATOM   358  C  CB  . THR A 1 48  ? -1.884  6.826   -25.382  1.00 22.88 ? 48  THR A CB  1 
ATOM   359  O  OG1 . THR A 1 48  ? -1.696  7.592   -26.574  1.00 24.20 ? 48  THR A OG1 1 
ATOM   360  C  CG2 . THR A 1 48  ? -1.162  5.500   -25.515  1.00 14.89 ? 48  THR A CG2 1 
ATOM   361  N  N   . ASP A 1 49  ? -3.714  6.987   -22.737  1.00 21.48 ? 49  ASP A N   1 
ATOM   362  C  CA  . ASP A 1 49  ? -4.049  6.575   -21.363  1.00 19.51 ? 49  ASP A CA  1 
ATOM   363  C  C   . ASP A 1 49  ? -5.487  6.157   -21.331  1.00 19.74 ? 49  ASP A C   1 
ATOM   364  O  O   . ASP A 1 49  ? -5.834  5.136   -20.775  1.00 25.71 ? 49  ASP A O   1 
ATOM   365  C  CB  . ASP A 1 49  ? -3.893  7.701   -20.330  1.00 14.22 ? 49  ASP A CB  1 
ATOM   366  C  CG  . ASP A 1 49  ? -2.468  8.193   -20.246  1.00 14.90 ? 49  ASP A CG  1 
ATOM   367  O  OD1 . ASP A 1 49  ? -1.579  7.329   -20.182  1.00 12.09 ? 49  ASP A OD1 1 
ATOM   368  O  OD2 . ASP A 1 49  ? -2.249  9.421   -20.274  1.00 12.09 ? 49  ASP A OD2 1 
ATOM   369  N  N   . ASP A 1 50  ? -6.358  6.890   -21.982  1.00 22.27 ? 50  ASP A N   1 
ATOM   370  C  CA  . ASP A 1 50  ? -7.759  6.545   -22.026  1.00 19.14 ? 50  ASP A CA  1 
ATOM   371  C  C   . ASP A 1 50  ? -7.956  5.239   -22.773  1.00 18.53 ? 50  ASP A C   1 
ATOM   372  O  O   . ASP A 1 50  ? -8.873  4.487   -22.448  1.00 18.80 ? 50  ASP A O   1 
ATOM   373  C  CB  . ASP A 1 50  ? -8.511  7.655   -22.722  1.00 17.63 ? 50  ASP A CB  1 
ATOM   374  C  CG  . ASP A 1 50  ? -9.939  7.686   -22.281  1.00 26.72 ? 50  ASP A CG  1 
ATOM   375  O  OD1 . ASP A 1 50  ? -10.172 8.258   -21.231  1.00 36.08 ? 50  ASP A OD1 1 
ATOM   376  O  OD2 . ASP A 1 50  ? -10.810 7.136   -22.945  1.00 31.40 ? 50  ASP A OD2 1 
ATOM   377  N  N   . HIS A 1 51  ? -7.137  4.880   -23.760  1.00 19.26 ? 51  HIS A N   1 
ATOM   378  C  CA  . HIS A 1 51  ? -7.359  3.644   -24.489  1.00 18.69 ? 51  HIS A CA  1 
ATOM   379  C  C   . HIS A 1 51  ? -7.146  2.408   -23.594  1.00 21.46 ? 51  HIS A C   1 
ATOM   380  O  O   . HIS A 1 51  ? -7.843  1.398   -23.757  1.00 20.35 ? 51  HIS A O   1 
ATOM   381  C  CB  . HIS A 1 51  ? -6.437  3.586   -25.726  1.00 15.96 ? 51  HIS A CB  1 
ATOM   382  C  CG  . HIS A 1 51  ? -6.672  4.614   -26.843  1.00 15.06 ? 51  HIS A CG  1 
ATOM   383  N  ND1 . HIS A 1 51  ? -7.743  5.316   -27.270  1.00 18.24 ? 51  HIS A ND1 1 
ATOM   384  C  CD2 . HIS A 1 51  ? -5.615  5.027   -27.620  1.00 15.32 ? 51  HIS A CD2 1 
ATOM   385  C  CE1 . HIS A 1 51  ? -7.343  6.113   -28.244  1.00 18.52 ? 51  HIS A CE1 1 
ATOM   386  N  NE2 . HIS A 1 51  ? -6.062  5.931   -28.445  1.00 11.14 ? 51  HIS A NE2 1 
ATOM   387  N  N   . VAL A 1 52  ? -6.234  2.468   -22.617  1.00 22.69 ? 52  VAL A N   1 
ATOM   388  C  CA  . VAL A 1 52  ? -5.980  1.383   -21.670  1.00 22.78 ? 52  VAL A CA  1 
ATOM   389  C  C   . VAL A 1 52  ? -7.182  1.263   -20.742  1.00 26.27 ? 52  VAL A C   1 
ATOM   390  O  O   . VAL A 1 52  ? -7.630  0.157   -20.412  1.00 30.44 ? 52  VAL A O   1 
ATOM   391  C  CB  . VAL A 1 52  ? -4.748  1.659   -20.822  1.00 21.33 ? 52  VAL A CB  1 
ATOM   392  C  CG1 . VAL A 1 52  ? -4.492  0.506   -19.872  1.00 19.96 ? 52  VAL A CG1 1 
ATOM   393  C  CG2 . VAL A 1 52  ? -3.550  1.797   -21.719  1.00 15.84 ? 52  VAL A CG2 1 
ATOM   394  N  N   . VAL A 1 53  ? -7.735  2.391   -20.302  1.00 25.76 ? 53  VAL A N   1 
ATOM   395  C  CA  . VAL A 1 53  ? -8.917  2.399   -19.456  1.00 24.48 ? 53  VAL A CA  1 
ATOM   396  C  C   . VAL A 1 53  ? -10.015 1.721   -20.254  1.00 28.72 ? 53  VAL A C   1 
ATOM   397  O  O   . VAL A 1 53  ? -10.672 0.803   -19.767  1.00 31.75 ? 53  VAL A O   1 
ATOM   398  C  CB  . VAL A 1 53  ? -9.415  3.834   -19.141  1.00 24.02 ? 53  VAL A CB  1 
ATOM   399  C  CG1 . VAL A 1 53  ? -10.697 3.767   -18.336  1.00 22.65 ? 53  VAL A CG1 1 
ATOM   400  C  CG2 . VAL A 1 53  ? -8.350  4.618   -18.405  1.00 23.56 ? 53  VAL A CG2 1 
ATOM   401  N  N   . SER A 1 54  ? -10.204 2.132   -21.509  1.00 33.44 ? 54  SER A N   1 
ATOM   402  C  CA  . SER A 1 54  ? -11.302 1.600   -22.311  1.00 33.22 ? 54  SER A CA  1 
ATOM   403  C  C   . SER A 1 54  ? -11.183 0.198   -22.837  1.00 27.12 ? 54  SER A C   1 
ATOM   404  O  O   . SER A 1 54  ? -12.219 -0.335  -23.206  1.00 25.77 ? 54  SER A O   1 
ATOM   405  C  CB  . SER A 1 54  ? -11.597 2.535   -23.500  1.00 34.14 ? 54  SER A CB  1 
ATOM   406  O  OG  . SER A 1 54  ? -10.413 2.955   -24.172  1.00 46.00 ? 54  SER A OG  1 
ATOM   407  N  N   . GLY A 1 55  ? -10.004 -0.422  -22.855  1.00 25.48 ? 55  GLY A N   1 
ATOM   408  C  CA  . GLY A 1 55  ? -9.886  -1.778  -23.355  1.00 26.06 ? 55  GLY A CA  1 
ATOM   409  C  C   . GLY A 1 55  ? -9.284  -1.853  -24.751  1.00 27.55 ? 55  GLY A C   1 
ATOM   410  O  O   . GLY A 1 55  ? -9.042  -2.932  -25.285  1.00 27.94 ? 55  GLY A O   1 
ATOM   411  N  N   . ASN A 1 56  ? -8.950  -0.713  -25.358  1.00 28.72 ? 56  ASN A N   1 
ATOM   412  C  CA  . ASN A 1 56  ? -8.399  -0.681  -26.703  1.00 24.38 ? 56  ASN A CA  1 
ATOM   413  C  C   . ASN A 1 56  ? -6.924  -0.930  -26.760  1.00 25.74 ? 56  ASN A C   1 
ATOM   414  O  O   . ASN A 1 56  ? -6.454  -1.326  -27.817  1.00 29.77 ? 56  ASN A O   1 
ATOM   415  C  CB  . ASN A 1 56  ? -8.615  0.644   -27.348  1.00 24.00 ? 56  ASN A CB  1 
ATOM   416  C  CG  . ASN A 1 56  ? -10.081 0.992   -27.443  1.00 30.41 ? 56  ASN A CG  1 
ATOM   417  O  OD1 . ASN A 1 56  ? -10.958 0.133   -27.514  1.00 30.88 ? 56  ASN A OD1 1 
ATOM   418  N  ND2 . ASN A 1 56  ? -10.395 2.280   -27.435  1.00 30.62 ? 56  ASN A ND2 1 
ATOM   419  N  N   . LEU A 1 57  ? -6.120  -0.696  -25.732  1.00 23.07 ? 57  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 57  ? -4.689  -0.918  -25.832  1.00 22.03 ? 57  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 57  ? -4.473  -1.805  -24.622  1.00 26.04 ? 57  LEU A C   1 
ATOM   422  O  O   . LEU A 1 57  ? -4.739  -1.412  -23.482  1.00 29.94 ? 57  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 57  ? -3.965  0.437   -25.750  1.00 11.23 ? 57  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 57  ? -2.528  0.610   -25.319  1.00 13.42 ? 57  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 57  ? -1.514  0.002   -26.266  1.00 8.58  ? 57  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 57  ? -2.291  2.095   -25.246  1.00 13.08 ? 57  LEU A CD2 1 
ATOM   427  N  N   . VAL A 1 58  ? -4.072  -3.044  -24.886  1.00 26.99 ? 58  VAL A N   1 
ATOM   428  C  CA  . VAL A 1 58  ? -3.879  -3.963  -23.798  1.00 26.26 ? 58  VAL A CA  1 
ATOM   429  C  C   . VAL A 1 58  ? -2.489  -3.710  -23.277  1.00 24.58 ? 58  VAL A C   1 
ATOM   430  O  O   . VAL A 1 58  ? -1.543  -3.414  -24.007  1.00 26.89 ? 58  VAL A O   1 
ATOM   431  C  CB  . VAL A 1 58  ? -4.051  -5.499  -24.214  1.00 26.89 ? 58  VAL A CB  1 
ATOM   432  C  CG1 . VAL A 1 58  ? -5.295  -5.600  -25.090  1.00 23.88 ? 58  VAL A CG1 1 
ATOM   433  C  CG2 . VAL A 1 58  ? -2.842  -6.088  -24.937  1.00 27.15 ? 58  VAL A CG2 1 
ATOM   434  N  N   . THR A 1 59  ? -2.464  -3.676  -21.961  1.00 23.94 ? 59  THR A N   1 
ATOM   435  C  CA  . THR A 1 59  ? -1.240  -3.543  -21.220  1.00 22.34 ? 59  THR A CA  1 
ATOM   436  C  C   . THR A 1 59  ? -1.554  -4.400  -19.975  1.00 24.40 ? 59  THR A C   1 
ATOM   437  O  O   . THR A 1 59  ? -2.741  -4.614  -19.640  1.00 26.27 ? 59  THR A O   1 
ATOM   438  C  CB  . THR A 1 59  ? -1.004  -2.065  -20.913  1.00 17.28 ? 59  THR A CB  1 
ATOM   439  O  OG1 . THR A 1 59  ? 0.410   -1.936  -20.699  1.00 21.84 ? 59  THR A OG1 1 
ATOM   440  C  CG2 . THR A 1 59  ? -1.781  -1.561  -19.717  1.00 19.63 ? 59  THR A CG2 1 
ATOM   441  N  N   . PRO A 1 60  ? -0.544  -4.980  -19.316  1.00 23.05 ? 60  PRO A N   1 
ATOM   442  C  CA  . PRO A 1 60  ? -0.697  -5.751  -18.086  1.00 24.22 ? 60  PRO A CA  1 
ATOM   443  C  C   . PRO A 1 60  ? -1.299  -4.979  -16.918  1.00 25.75 ? 60  PRO A C   1 
ATOM   444  O  O   . PRO A 1 60  ? -0.686  -4.016  -16.453  1.00 29.12 ? 60  PRO A O   1 
ATOM   445  C  CB  . PRO A 1 60  ? 0.694   -6.237  -17.767  1.00 22.72 ? 60  PRO A CB  1 
ATOM   446  C  CG  . PRO A 1 60  ? 1.368   -6.273  -19.106  1.00 25.39 ? 60  PRO A CG  1 
ATOM   447  C  CD  . PRO A 1 60  ? 0.844   -5.008  -19.775  1.00 22.53 ? 60  PRO A CD  1 
ATOM   448  N  N   . LEU A 1 61  ? -2.468  -5.379  -16.420  1.00 27.96 ? 61  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 61  ? -3.109  -4.773  -15.256  1.00 29.15 ? 61  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 61  ? -2.658  -5.418  -13.929  1.00 30.86 ? 61  LEU A C   1 
ATOM   451  O  O   . LEU A 1 61  ? -2.094  -6.518  -13.986  1.00 33.59 ? 61  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 61  ? -4.603  -4.912  -15.377  1.00 26.77 ? 61  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 61  ? -5.266  -3.985  -16.373  1.00 27.03 ? 61  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 61  ? -6.747  -4.066  -16.156  1.00 30.61 ? 61  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 61  ? -4.880  -2.550  -16.152  1.00 27.67 ? 61  LEU A CD2 1 
ATOM   456  N  N   . PRO A 1 62  ? -2.687  -4.822  -12.720  1.00 31.96 ? 62  PRO A N   1 
ATOM   457  C  CA  . PRO A 1 62  ? -3.025  -3.415  -12.443  1.00 27.86 ? 62  PRO A CA  1 
ATOM   458  C  C   . PRO A 1 62  ? -1.823  -2.576  -12.859  1.00 20.38 ? 62  PRO A C   1 
ATOM   459  O  O   . PRO A 1 62  ? -0.653  -3.041  -12.888  1.00 19.71 ? 62  PRO A O   1 
ATOM   460  C  CB  . PRO A 1 62  ? -3.333  -3.383  -10.965  1.00 29.33 ? 62  PRO A CB  1 
ATOM   461  C  CG  . PRO A 1 62  ? -2.372  -4.428  -10.449  1.00 31.62 ? 62  PRO A CG  1 
ATOM   462  C  CD  . PRO A 1 62  ? -2.524  -5.546  -11.462  1.00 30.54 ? 62  PRO A CD  1 
ATOM   463  N  N   . VAL A 1 63  ? -2.143  -1.320  -13.164  1.00 17.56 ? 63  VAL A N   1 
ATOM   464  C  CA  . VAL A 1 63  ? -1.132  -0.428  -13.763  1.00 14.51 ? 63  VAL A CA  1 
ATOM   465  C  C   . VAL A 1 63  ? -1.274  1.003   -13.363  1.00 11.21 ? 63  VAL A C   1 
ATOM   466  O  O   . VAL A 1 63  ? -2.402  1.468   -13.073  1.00 11.25 ? 63  VAL A O   1 
ATOM   467  C  CB  . VAL A 1 63  ? -1.232  -0.578  -15.374  1.00 11.85 ? 63  VAL A CB  1 
ATOM   468  C  CG1 . VAL A 1 63  ? -2.572  -0.045  -15.864  1.00 2.00  ? 63  VAL A CG1 1 
ATOM   469  C  CG2 . VAL A 1 63  ? -0.069  0.095   -16.054  1.00 16.88 ? 63  VAL A CG2 1 
ATOM   470  N  N   . ILE A 1 64  ? -0.110  1.624   -13.276  1.00 8.22  ? 64  ILE A N   1 
ATOM   471  C  CA  . ILE A 1 64  ? -0.130  3.057   -13.045  1.00 16.76 ? 64  ILE A CA  1 
ATOM   472  C  C   . ILE A 1 64  ? 0.229   3.641   -14.429  1.00 20.42 ? 64  ILE A C   1 
ATOM   473  O  O   . ILE A 1 64  ? 1.318   3.442   -14.991  1.00 15.65 ? 64  ILE A O   1 
ATOM   474  C  CB  . ILE A 1 64  ? 0.896   3.489   -11.966  1.00 14.36 ? 64  ILE A CB  1 
ATOM   475  C  CG1 . ILE A 1 64  ? 0.359   3.059   -10.596  1.00 14.57 ? 64  ILE A CG1 1 
ATOM   476  C  CG2 . ILE A 1 64  ? 1.035   4.995   -11.893  1.00 7.52  ? 64  ILE A CG2 1 
ATOM   477  C  CD1 . ILE A 1 64  ? 1.389   3.210   -9.455   1.00 18.83 ? 64  ILE A CD1 1 
ATOM   478  N  N   . LEU A 1 65  ? -0.785  4.307   -14.984  1.00 21.88 ? 65  LEU A N   1 
ATOM   479  C  CA  . LEU A 1 65  ? -0.745  4.967   -16.282  1.00 19.05 ? 65  LEU A CA  1 
ATOM   480  C  C   . LEU A 1 65  ? -0.043  6.313   -16.237  1.00 19.25 ? 65  LEU A C   1 
ATOM   481  O  O   . LEU A 1 65  ? 0.687   6.591   -15.290  1.00 22.36 ? 65  LEU A O   1 
ATOM   482  C  CB  . LEU A 1 65  ? -2.200  5.131   -16.801  1.00 7.85  ? 65  LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 65  ? -2.932  3.813   -16.952  1.00 3.86  ? 65  LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 65  ? -4.329  4.014   -17.485  1.00 3.94  ? 65  LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 65  ? -2.126  2.936   -17.879  1.00 4.28  ? 65  LEU A CD2 1 
ATOM   486  N  N   . GLY A 1 66  ? -0.207  7.142   -17.276  1.00 20.02 ? 66  GLY A N   1 
ATOM   487  C  CA  . GLY A 1 66  ? 0.371   8.473   -17.381  1.00 17.35 ? 66  GLY A CA  1 
ATOM   488  C  C   . GLY A 1 66  ? 1.686   8.449   -18.105  1.00 18.36 ? 66  GLY A C   1 
ATOM   489  O  O   . GLY A 1 66  ? 2.473   7.547   -17.879  1.00 20.50 ? 66  GLY A O   1 
ATOM   490  N  N   . HIS A 1 67  ? 1.953   9.398   -18.998  1.00 18.02 ? 67  HIS A N   1 
ATOM   491  C  CA  . HIS A 1 67  ? 3.207   9.437   -19.734  1.00 15.75 ? 67  HIS A CA  1 
ATOM   492  C  C   . HIS A 1 67  ? 3.550   10.793  -20.280  1.00 18.04 ? 67  HIS A C   1 
ATOM   493  O  O   . HIS A 1 67  ? 4.647   10.964  -20.810  1.00 15.91 ? 67  HIS A O   1 
ATOM   494  C  CB  . HIS A 1 67  ? 3.231   8.483   -20.932  1.00 15.05 ? 67  HIS A CB  1 
ATOM   495  C  CG  . HIS A 1 67  ? 2.056   8.602   -21.873  1.00 16.84 ? 67  HIS A CG  1 
ATOM   496  N  ND1 . HIS A 1 67  ? 0.788   8.298   -21.607  1.00 22.07 ? 67  HIS A ND1 1 
ATOM   497  C  CD2 . HIS A 1 67  ? 2.148   9.069   -23.136  1.00 11.28 ? 67  HIS A CD2 1 
ATOM   498  C  CE1 . HIS A 1 67  ? 0.088   8.570   -22.661  1.00 14.14 ? 67  HIS A CE1 1 
ATOM   499  N  NE2 . HIS A 1 67  ? 0.917   9.023   -23.551  1.00 19.64 ? 67  HIS A NE2 1 
ATOM   500  N  N   . GLU A 1 68  ? 2.612   11.741  -20.196  1.00 18.79 ? 68  GLU A N   1 
ATOM   501  C  CA  . GLU A 1 68  ? 2.843   13.094  -20.690  1.00 17.22 ? 68  GLU A CA  1 
ATOM   502  C  C   . GLU A 1 68  ? 3.162   13.913  -19.436  1.00 13.41 ? 68  GLU A C   1 
ATOM   503  O  O   . GLU A 1 68  ? 2.211   14.333  -18.752  1.00 11.28 ? 68  GLU A O   1 
ATOM   504  C  CB  . GLU A 1 68  ? 1.530   13.510  -21.411  1.00 17.66 ? 68  GLU A CB  1 
ATOM   505  C  CG  . GLU A 1 68  ? 1.473   14.939  -21.923  1.00 17.71 ? 68  GLU A CG  1 
ATOM   506  C  CD  . GLU A 1 68  ? 0.189   15.235  -22.690  1.00 22.03 ? 68  GLU A CD  1 
ATOM   507  O  OE1 . GLU A 1 68  ? 0.084   14.771  -23.817  1.00 22.36 ? 68  GLU A OE1 1 
ATOM   508  O  OE2 . GLU A 1 68  ? -0.703  15.940  -22.186  1.00 16.72 ? 68  GLU A OE2 1 
ATOM   509  N  N   . ALA A 1 69  ? 4.401   14.184  -19.059  1.00 13.31 ? 69  ALA A N   1 
ATOM   510  C  CA  . ALA A 1 69  ? 4.622   14.922  -17.837  1.00 16.47 ? 69  ALA A CA  1 
ATOM   511  C  C   . ALA A 1 69  ? 5.899   15.661  -17.662  1.00 18.83 ? 69  ALA A C   1 
ATOM   512  O  O   . ALA A 1 69  ? 6.832   15.485  -18.435  1.00 22.28 ? 69  ALA A O   1 
ATOM   513  C  CB  . ALA A 1 69  ? 4.560   14.024  -16.634  1.00 23.71 ? 69  ALA A CB  1 
ATOM   514  N  N   . ALA A 1 70  ? 5.949   16.477  -16.619  1.00 19.05 ? 70  ALA A N   1 
ATOM   515  C  CA  . ALA A 1 70  ? 7.166   17.183  -16.292  1.00 23.65 ? 70  ALA A CA  1 
ATOM   516  C  C   . ALA A 1 70  ? 7.340   17.088  -14.762  1.00 24.64 ? 70  ALA A C   1 
ATOM   517  O  O   . ALA A 1 70  ? 6.360   17.188  -13.995  1.00 24.42 ? 70  ALA A O   1 
ATOM   518  C  CB  . ALA A 1 70  ? 7.045   18.641  -16.720  1.00 19.68 ? 70  ALA A CB  1 
ATOM   519  N  N   . GLY A 1 71  ? 8.556   16.878  -14.259  1.00 24.58 ? 71  GLY A N   1 
ATOM   520  C  CA  . GLY A 1 71  ? 8.796   16.794  -12.834  1.00 20.52 ? 71  GLY A CA  1 
ATOM   521  C  C   . GLY A 1 71  ? 10.220  17.160  -12.464  1.00 20.06 ? 71  GLY A C   1 
ATOM   522  O  O   . GLY A 1 71  ? 11.007  17.564  -13.323  1.00 21.16 ? 71  GLY A O   1 
ATOM   523  N  N   . ILE A 1 72  ? 10.591  17.059  -11.179  1.00 21.24 ? 72  ILE A N   1 
ATOM   524  C  CA  . ILE A 1 72  ? 11.948  17.383  -10.745  1.00 19.51 ? 72  ILE A CA  1 
ATOM   525  C  C   . ILE A 1 72  ? 12.543  16.072  -10.335  1.00 21.35 ? 72  ILE A C   1 
ATOM   526  O  O   . ILE A 1 72  ? 11.828  15.192  -9.840   1.00 23.89 ? 72  ILE A O   1 
ATOM   527  C  CB  . ILE A 1 72  ? 11.884  18.369  -9.574   1.00 22.85 ? 72  ILE A CB  1 
ATOM   528  C  CG1 . ILE A 1 72  ? 11.536  19.743  -10.140  1.00 26.80 ? 72  ILE A CG1 1 
ATOM   529  C  CG2 . ILE A 1 72  ? 13.208  18.455  -8.832   1.00 22.73 ? 72  ILE A CG2 1 
ATOM   530  C  CD1 . ILE A 1 72  ? 10.547  20.457  -9.210   1.00 27.57 ? 72  ILE A CD1 1 
ATOM   531  N  N   . VAL A 1 73  ? 13.819  15.887  -10.623  1.00 21.73 ? 73  VAL A N   1 
ATOM   532  C  CA  . VAL A 1 73  ? 14.522  14.669  -10.248  1.00 25.34 ? 73  VAL A CA  1 
ATOM   533  C  C   . VAL A 1 73  ? 14.832  14.660  -8.760   1.00 27.14 ? 73  VAL A C   1 
ATOM   534  O  O   . VAL A 1 73  ? 15.546  15.526  -8.245   1.00 27.31 ? 73  VAL A O   1 
ATOM   535  C  CB  . VAL A 1 73  ? 15.821  14.562  -11.045  1.00 24.75 ? 73  VAL A CB  1 
ATOM   536  C  CG1 . VAL A 1 73  ? 16.795  13.529  -10.494  1.00 22.33 ? 73  VAL A CG1 1 
ATOM   537  C  CG2 . VAL A 1 73  ? 15.400  14.165  -12.433  1.00 27.55 ? 73  VAL A CG2 1 
ATOM   538  N  N   . GLU A 1 74  ? 14.305  13.646  -8.097   1.00 28.95 ? 74  GLU A N   1 
ATOM   539  C  CA  . GLU A 1 74  ? 14.502  13.463  -6.671   1.00 29.60 ? 74  GLU A CA  1 
ATOM   540  C  C   . GLU A 1 74  ? 15.831  12.736  -6.445   1.00 29.85 ? 74  GLU A C   1 
ATOM   541  O  O   . GLU A 1 74  ? 16.723  13.228  -5.745   1.00 28.52 ? 74  GLU A O   1 
ATOM   542  C  CB  . GLU A 1 74  ? 13.276  12.699  -6.176   1.00 28.46 ? 74  GLU A CB  1 
ATOM   543  C  CG  . GLU A 1 74  ? 13.180  12.359  -4.710   1.00 32.86 ? 74  GLU A CG  1 
ATOM   544  C  CD  . GLU A 1 74  ? 13.799  11.029  -4.325   1.00 33.01 ? 74  GLU A CD  1 
ATOM   545  O  OE1 . GLU A 1 74  ? 13.263  9.999   -4.706   1.00 37.24 ? 74  GLU A OE1 1 
ATOM   546  O  OE2 . GLU A 1 74  ? 14.801  11.019  -3.623   1.00 30.60 ? 74  GLU A OE2 1 
ATOM   547  N  N   . SER A 1 75  ? 16.048  11.609  -7.104   1.00 29.03 ? 75  SER A N   1 
ATOM   548  C  CA  . SER A 1 75  ? 17.281  10.870  -6.918   1.00 29.52 ? 75  SER A CA  1 
ATOM   549  C  C   . SER A 1 75  ? 17.644  10.188  -8.205   1.00 29.12 ? 75  SER A C   1 
ATOM   550  O  O   . SER A 1 75  ? 16.755  9.963   -9.026   1.00 32.66 ? 75  SER A O   1 
ATOM   551  C  CB  . SER A 1 75  ? 17.084  9.813   -5.826   1.00 30.49 ? 75  SER A CB  1 
ATOM   552  O  OG  . SER A 1 75  ? 15.749  9.280   -5.867   1.00 29.42 ? 75  SER A OG  1 
ATOM   553  N  N   . VAL A 1 76  ? 18.891  9.820   -8.394   1.00 28.04 ? 76  VAL A N   1 
ATOM   554  C  CA  . VAL A 1 76  ? 19.295  9.106   -9.574   1.00 30.61 ? 76  VAL A CA  1 
ATOM   555  C  C   . VAL A 1 76  ? 20.067  7.891   -9.090   1.00 34.23 ? 76  VAL A C   1 
ATOM   556  O  O   . VAL A 1 76  ? 20.620  7.943   -7.988   1.00 36.70 ? 76  VAL A O   1 
ATOM   557  C  CB  . VAL A 1 76  ? 20.188  9.970   -10.514  1.00 27.90 ? 76  VAL A CB  1 
ATOM   558  C  CG1 . VAL A 1 76  ? 19.287  11.070  -11.053  1.00 25.59 ? 76  VAL A CG1 1 
ATOM   559  C  CG2 . VAL A 1 76  ? 21.403  10.553  -9.846   1.00 23.09 ? 76  VAL A CG2 1 
ATOM   560  N  N   . GLY A 1 77  ? 20.053  6.797   -9.855   1.00 33.99 ? 77  GLY A N   1 
ATOM   561  C  CA  . GLY A 1 77  ? 20.756  5.581   -9.515   1.00 32.08 ? 77  GLY A CA  1 
ATOM   562  C  C   . GLY A 1 77  ? 22.213  5.732   -9.865   1.00 33.72 ? 77  GLY A C   1 
ATOM   563  O  O   . GLY A 1 77  ? 22.669  6.789   -10.300  1.00 33.71 ? 77  GLY A O   1 
ATOM   564  N  N   . GLU A 1 78  ? 23.011  4.687   -9.699   1.00 38.81 ? 78  GLU A N   1 
ATOM   565  C  CA  . GLU A 1 78  ? 24.437  4.778   -10.038  1.00 43.48 ? 78  GLU A CA  1 
ATOM   566  C  C   . GLU A 1 78  ? 24.523  4.820   -11.559  1.00 44.46 ? 78  GLU A C   1 
ATOM   567  O  O   . GLU A 1 78  ? 23.581  4.415   -12.248  1.00 43.92 ? 78  GLU A O   1 
ATOM   568  C  CB  . GLU A 1 78  ? 25.252  3.553   -9.606   1.00 47.30 ? 78  GLU A CB  1 
ATOM   569  C  CG  . GLU A 1 78  ? 24.892  2.939   -8.261   1.00 51.66 ? 78  GLU A CG  1 
ATOM   570  C  CD  . GLU A 1 78  ? 24.463  1.478   -8.359   1.00 54.68 ? 78  GLU A CD  1 
ATOM   571  O  OE1 . GLU A 1 78  ? 25.340  0.620   -8.542   1.00 52.21 ? 78  GLU A OE1 1 
ATOM   572  O  OE2 . GLU A 1 78  ? 23.256  1.209   -8.239   1.00 55.52 ? 78  GLU A OE2 1 
ATOM   573  N  N   . GLY A 1 79  ? 25.604  5.320   -12.149  1.00 45.94 ? 79  GLY A N   1 
ATOM   574  C  CA  . GLY A 1 79  ? 25.743  5.346   -13.602  1.00 40.65 ? 79  GLY A CA  1 
ATOM   575  C  C   . GLY A 1 79  ? 25.085  6.544   -14.250  1.00 38.69 ? 79  GLY A C   1 
ATOM   576  O  O   . GLY A 1 79  ? 25.663  7.085   -15.188  1.00 41.62 ? 79  GLY A O   1 
ATOM   577  N  N   . VAL A 1 80  ? 23.926  6.999   -13.755  1.00 34.05 ? 80  VAL A N   1 
ATOM   578  C  CA  . VAL A 1 80  ? 23.210  8.126   -14.318  1.00 31.91 ? 80  VAL A CA  1 
ATOM   579  C  C   . VAL A 1 80  ? 24.084  9.372   -14.418  1.00 35.69 ? 80  VAL A C   1 
ATOM   580  O  O   . VAL A 1 80  ? 24.482  9.971   -13.432  1.00 40.65 ? 80  VAL A O   1 
ATOM   581  C  CB  . VAL A 1 80  ? 21.968  8.397   -13.462  1.00 23.60 ? 80  VAL A CB  1 
ATOM   582  C  CG1 . VAL A 1 80  ? 21.134  9.480   -14.047  1.00 25.43 ? 80  VAL A CG1 1 
ATOM   583  C  CG2 . VAL A 1 80  ? 21.096  7.183   -13.421  1.00 23.64 ? 80  VAL A CG2 1 
ATOM   584  N  N   . THR A 1 81  ? 24.448  9.742   -15.635  1.00 37.84 ? 81  THR A N   1 
ATOM   585  C  CA  . THR A 1 81  ? 25.281  10.911  -15.916  1.00 37.16 ? 81  THR A CA  1 
ATOM   586  C  C   . THR A 1 81  ? 24.564  12.153  -16.438  1.00 35.00 ? 81  THR A C   1 
ATOM   587  O  O   . THR A 1 81  ? 25.045  13.282  -16.317  1.00 34.52 ? 81  THR A O   1 
ATOM   588  C  CB  . THR A 1 81  ? 26.331  10.477  -16.928  1.00 40.92 ? 81  THR A CB  1 
ATOM   589  O  OG1 . THR A 1 81  ? 25.621  9.704   -17.913  1.00 47.50 ? 81  THR A OG1 1 
ATOM   590  C  CG2 . THR A 1 81  ? 27.473  9.686   -16.305  1.00 41.86 ? 81  THR A CG2 1 
ATOM   591  N  N   . THR A 1 82  ? 23.411  11.924  -17.050  1.00 31.79 ? 82  THR A N   1 
ATOM   592  C  CA  . THR A 1 82  ? 22.636  12.959  -17.677  1.00 34.97 ? 82  THR A CA  1 
ATOM   593  C  C   . THR A 1 82  ? 21.791  13.785  -16.753  1.00 41.25 ? 82  THR A C   1 
ATOM   594  O  O   . THR A 1 82  ? 21.387  14.898  -17.084  1.00 46.48 ? 82  THR A O   1 
ATOM   595  C  CB  . THR A 1 82  ? 21.731  12.324  -18.744  1.00 36.31 ? 82  THR A CB  1 
ATOM   596  O  OG1 . THR A 1 82  ? 20.936  11.345  -18.088  1.00 35.91 ? 82  THR A OG1 1 
ATOM   597  C  CG2 . THR A 1 82  ? 22.519  11.666  -19.876  1.00 33.46 ? 82  THR A CG2 1 
ATOM   598  N  N   . VAL A 1 83  ? 21.472  13.206  -15.597  1.00 44.74 ? 83  VAL A N   1 
ATOM   599  C  CA  . VAL A 1 83  ? 20.616  13.838  -14.613  1.00 40.54 ? 83  VAL A CA  1 
ATOM   600  C  C   . VAL A 1 83  ? 21.381  13.966  -13.300  1.00 39.68 ? 83  VAL A C   1 
ATOM   601  O  O   . VAL A 1 83  ? 22.239  13.156  -12.940  1.00 42.07 ? 83  VAL A O   1 
ATOM   602  C  CB  . VAL A 1 83  ? 19.348  12.995  -14.383  1.00 38.78 ? 83  VAL A CB  1 
ATOM   603  C  CG1 . VAL A 1 83  ? 18.279  13.984  -14.058  1.00 39.63 ? 83  VAL A CG1 1 
ATOM   604  C  CG2 . VAL A 1 83  ? 18.893  12.178  -15.572  1.00 41.18 ? 83  VAL A CG2 1 
ATOM   605  N  N   . LYS A 1 84  ? 20.978  15.001  -12.582  1.00 37.16 ? 84  LYS A N   1 
ATOM   606  C  CA  . LYS A 1 84  ? 21.482  15.446  -11.295  1.00 33.85 ? 84  LYS A CA  1 
ATOM   607  C  C   . LYS A 1 84  ? 20.184  15.702  -10.549  1.00 34.50 ? 84  LYS A C   1 
ATOM   608  O  O   . LYS A 1 84  ? 19.194  16.077  -11.192  1.00 36.05 ? 84  LYS A O   1 
ATOM   609  C  CB  . LYS A 1 84  ? 22.213  16.733  -11.470  1.00 32.64 ? 84  LYS A CB  1 
ATOM   610  C  CG  . LYS A 1 84  ? 23.400  16.910  -10.584  1.00 37.30 ? 84  LYS A CG  1 
ATOM   611  C  CD  . LYS A 1 84  ? 24.488  17.700  -11.332  1.00 46.07 ? 84  LYS A CD  1 
ATOM   612  C  CE  . LYS A 1 84  ? 24.889  17.111  -12.704  1.00 50.26 ? 84  LYS A CE  1 
ATOM   613  N  NZ  . LYS A 1 84  ? 24.998  15.653  -12.711  1.00 52.62 ? 84  LYS A NZ  1 
ATOM   614  N  N   . PRO A 1 85  ? 20.050  15.498  -9.241   1.00 35.32 ? 85  PRO A N   1 
ATOM   615  C  CA  . PRO A 1 85  ? 18.817  15.817  -8.504   1.00 34.49 ? 85  PRO A CA  1 
ATOM   616  C  C   . PRO A 1 85  ? 18.493  17.301  -8.643   1.00 33.14 ? 85  PRO A C   1 
ATOM   617  O  O   . PRO A 1 85  ? 19.377  18.120  -8.930   1.00 33.47 ? 85  PRO A O   1 
ATOM   618  C  CB  . PRO A 1 85  ? 19.152  15.352  -7.120   1.00 33.96 ? 85  PRO A CB  1 
ATOM   619  C  CG  . PRO A 1 85  ? 20.091  14.188  -7.376   1.00 28.67 ? 85  PRO A CG  1 
ATOM   620  C  CD  . PRO A 1 85  ? 21.012  14.792  -8.408   1.00 33.17 ? 85  PRO A CD  1 
ATOM   621  N  N   . GLY A 1 86  ? 17.245  17.711  -8.525   1.00 33.73 ? 86  GLY A N   1 
ATOM   622  C  CA  . GLY A 1 86  ? 16.905  19.118  -8.710   1.00 36.72 ? 86  GLY A CA  1 
ATOM   623  C  C   . GLY A 1 86  ? 16.687  19.494  -10.184  1.00 37.86 ? 86  GLY A C   1 
ATOM   624  O  O   . GLY A 1 86  ? 16.010  20.493  -10.465  1.00 38.28 ? 86  GLY A O   1 
ATOM   625  N  N   . ASP A 1 87  ? 17.235  18.733  -11.151  1.00 35.65 ? 87  ASP A N   1 
ATOM   626  C  CA  . ASP A 1 87  ? 17.055  18.997  -12.576  1.00 30.98 ? 87  ASP A CA  1 
ATOM   627  C  C   . ASP A 1 87  ? 15.612  18.807  -12.982  1.00 30.11 ? 87  ASP A C   1 
ATOM   628  O  O   . ASP A 1 87  ? 14.985  17.827  -12.560  1.00 34.05 ? 87  ASP A O   1 
ATOM   629  C  CB  . ASP A 1 87  ? 17.769  18.055  -13.468  1.00 25.60 ? 87  ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 87  ? 19.260  18.108  -13.562  1.00 24.77 ? 87  ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 87  ? 19.892  19.092  -13.191  1.00 25.05 ? 87  ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 87  ? 19.787  17.128  -14.071  1.00 25.41 ? 87  ASP A OD2 1 
ATOM   633  N  N   . LYS A 1 88  ? 15.083  19.727  -13.780  1.00 25.61 ? 88  LYS A N   1 
ATOM   634  C  CA  . LYS A 1 88  ? 13.726  19.602  -14.262  1.00 25.68 ? 88  LYS A CA  1 
ATOM   635  C  C   . LYS A 1 88  ? 13.833  18.603  -15.422  1.00 24.64 ? 88  LYS A C   1 
ATOM   636  O  O   . LYS A 1 88  ? 14.813  18.602  -16.194  1.00 22.01 ? 88  LYS A O   1 
ATOM   637  C  CB  . LYS A 1 88  ? 13.243  20.959  -14.732  1.00 29.13 ? 88  LYS A CB  1 
ATOM   638  C  CG  . LYS A 1 88  ? 12.918  21.884  -13.570  1.00 28.34 ? 88  LYS A CG  1 
ATOM   639  C  CD  . LYS A 1 88  ? 12.232  23.127  -14.063  1.00 28.18 ? 88  LYS A CD  1 
ATOM   640  C  CE  . LYS A 1 88  ? 11.754  23.919  -12.872  1.00 29.07 ? 88  LYS A CE  1 
ATOM   641  N  NZ  . LYS A 1 88  ? 11.035  25.105  -13.303  1.00 26.47 ? 88  LYS A NZ  1 
ATOM   642  N  N   . VAL A 1 89  ? 12.871  17.709  -15.551  1.00 20.47 ? 89  VAL A N   1 
ATOM   643  C  CA  . VAL A 1 89  ? 12.923  16.698  -16.580  1.00 15.29 ? 89  VAL A CA  1 
ATOM   644  C  C   . VAL A 1 89  ? 11.560  16.337  -17.112  1.00 17.25 ? 89  VAL A C   1 
ATOM   645  O  O   . VAL A 1 89  ? 10.525  16.503  -16.431  1.00 16.57 ? 89  VAL A O   1 
ATOM   646  C  CB  . VAL A 1 89  ? 13.556  15.343  -16.109  1.00 14.84 ? 89  VAL A CB  1 
ATOM   647  C  CG1 . VAL A 1 89  ? 15.072  15.443  -15.922  1.00 9.03  ? 89  VAL A CG1 1 
ATOM   648  C  CG2 . VAL A 1 89  ? 12.813  14.899  -14.840  1.00 16.99 ? 89  VAL A CG2 1 
ATOM   649  N  N   . ILE A 1 90  ? 11.566  15.895  -18.373  1.00 16.57 ? 90  ILE A N   1 
ATOM   650  C  CA  . ILE A 1 90  ? 10.337  15.403  -18.967  1.00 17.66 ? 90  ILE A CA  1 
ATOM   651  C  C   . ILE A 1 90  ? 10.648  13.923  -19.209  1.00 19.89 ? 90  ILE A C   1 
ATOM   652  O  O   . ILE A 1 90  ? 11.691  13.554  -19.787  1.00 21.79 ? 90  ILE A O   1 
ATOM   653  C  CB  . ILE A 1 90  ? 10.001  16.105  -20.309  1.00 21.41 ? 90  ILE A CB  1 
ATOM   654  C  CG1 . ILE A 1 90  ? 9.595   17.563  -20.081  1.00 23.42 ? 90  ILE A CG1 1 
ATOM   655  C  CG2 . ILE A 1 90  ? 8.864   15.340  -20.982  1.00 20.62 ? 90  ILE A CG2 1 
ATOM   656  C  CD1 . ILE A 1 90  ? 9.284   18.427  -21.321  1.00 17.16 ? 90  ILE A CD1 1 
ATOM   657  N  N   . PRO A 1 91  ? 9.825   13.031  -18.681  1.00 17.23 ? 91  PRO A N   1 
ATOM   658  C  CA  . PRO A 1 91  ? 9.918   11.623  -18.914  1.00 16.17 ? 91  PRO A CA  1 
ATOM   659  C  C   . PRO A 1 91  ? 9.345   11.317  -20.315  1.00 19.90 ? 91  PRO A C   1 
ATOM   660  O  O   . PRO A 1 91  ? 8.187   11.609  -20.676  1.00 15.22 ? 91  PRO A O   1 
ATOM   661  C  CB  . PRO A 1 91  ? 9.144   11.074  -17.726  1.00 10.83 ? 91  PRO A CB  1 
ATOM   662  C  CG  . PRO A 1 91  ? 8.007   12.039  -17.586  1.00 2.00  ? 91  PRO A CG  1 
ATOM   663  C  CD  . PRO A 1 91  ? 8.784   13.319  -17.698  1.00 13.16 ? 91  PRO A CD  1 
ATOM   664  N  N   . LEU A 1 92  ? 10.179  10.614  -21.079  1.00 19.65 ? 92  LEU A N   1 
ATOM   665  C  CA  . LEU A 1 92  ? 9.888   10.243  -22.458  1.00 14.01 ? 92  LEU A CA  1 
ATOM   666  C  C   . LEU A 1 92  ? 9.143   8.933   -22.642  1.00 14.09 ? 92  LEU A C   1 
ATOM   667  O  O   . LEU A 1 92  ? 9.716   7.900   -22.288  1.00 17.03 ? 92  LEU A O   1 
ATOM   668  C  CB  . LEU A 1 92  ? 11.192  10.158  -23.206  1.00 7.39  ? 92  LEU A CB  1 
ATOM   669  C  CG  . LEU A 1 92  ? 12.145  11.308  -23.046  1.00 3.45  ? 92  LEU A CG  1 
ATOM   670  C  CD1 . LEU A 1 92  ? 13.534  10.893  -23.476  1.00 2.00  ? 92  LEU A CD1 1 
ATOM   671  C  CD2 . LEU A 1 92  ? 11.517  12.501  -23.721  1.00 4.73  ? 92  LEU A CD2 1 
ATOM   672  N  N   . PHE A 1 93  ? 7.964   8.829   -23.267  1.00 12.66 ? 93  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 93  ? 7.345   7.516   -23.399  1.00 13.63 ? 93  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 93  ? 7.989   6.598   -24.426  1.00 15.71 ? 93  PHE A C   1 
ATOM   675  O  O   . PHE A 1 93  ? 7.552   5.459   -24.631  1.00 14.65 ? 93  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 93  ? 5.850   7.660   -23.699  1.00 20.07 ? 93  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 93  ? 5.406   7.898   -25.132  1.00 30.88 ? 93  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 93  ? 5.556   9.155   -25.720  1.00 35.32 ? 93  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 93  ? 4.865   6.832   -25.860  1.00 31.76 ? 93  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 93  ? 5.161   9.340   -27.044  1.00 34.83 ? 93  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 93  ? 4.475   7.028   -27.180  1.00 33.74 ? 93  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 93  ? 4.625   8.282   -27.772  1.00 35.09 ? 93  PHE A CZ  1 
ATOM   683  N  N   . THR A 1 94  ? 9.029   7.048   -25.117  1.00 16.25 ? 94  THR A N   1 
ATOM   684  C  CA  . THR A 1 94  ? 9.742   6.212   -26.047  1.00 15.85 ? 94  THR A CA  1 
ATOM   685  C  C   . THR A 1 94  ? 11.171  6.571   -25.704  1.00 19.00 ? 94  THR A C   1 
ATOM   686  O  O   . THR A 1 94  ? 11.572  7.748   -25.787  1.00 20.81 ? 94  THR A O   1 
ATOM   687  C  CB  . THR A 1 94  ? 9.417   6.563   -27.529  1.00 18.30 ? 94  THR A CB  1 
ATOM   688  O  OG1 . THR A 1 94  ? 8.045   6.181   -27.722  1.00 22.31 ? 94  THR A OG1 1 
ATOM   689  C  CG2 . THR A 1 94  ? 10.338  5.863   -28.545  1.00 9.58  ? 94  THR A CG2 1 
ATOM   690  N  N   . PRO A 1 95  ? 11.940  5.600   -25.220  1.00 16.17 ? 95  PRO A N   1 
ATOM   691  C  CA  . PRO A 1 95  ? 13.324  5.822   -24.807  1.00 18.63 ? 95  PRO A CA  1 
ATOM   692  C  C   . PRO A 1 95  ? 14.195  6.145   -25.997  1.00 23.66 ? 95  PRO A C   1 
ATOM   693  O  O   . PRO A 1 95  ? 13.717  5.931   -27.117  1.00 31.25 ? 95  PRO A O   1 
ATOM   694  C  CB  . PRO A 1 95  ? 13.710  4.529   -24.144  1.00 13.83 ? 95  PRO A CB  1 
ATOM   695  C  CG  . PRO A 1 95  ? 12.838  3.523   -24.827  1.00 12.14 ? 95  PRO A CG  1 
ATOM   696  C  CD  . PRO A 1 95  ? 11.509  4.225   -25.009  1.00 11.25 ? 95  PRO A CD  1 
ATOM   697  N  N   . GLN A 1 96  ? 15.418  6.644   -25.848  1.00 19.40 ? 96  GLN A N   1 
ATOM   698  C  CA  . GLN A 1 96  ? 16.257  6.805   -27.001  1.00 21.44 ? 96  GLN A CA  1 
ATOM   699  C  C   . GLN A 1 96  ? 17.516  6.158   -26.447  1.00 25.24 ? 96  GLN A C   1 
ATOM   700  O  O   . GLN A 1 96  ? 18.457  6.831   -26.026  1.00 26.23 ? 96  GLN A O   1 
ATOM   701  C  CB  . GLN A 1 96  ? 16.485  8.279   -27.356  1.00 25.02 ? 96  GLN A CB  1 
ATOM   702  C  CG  . GLN A 1 96  ? 17.457  8.517   -28.542  1.00 23.11 ? 96  GLN A CG  1 
ATOM   703  C  CD  . GLN A 1 96  ? 17.810  9.981   -28.824  1.00 21.10 ? 96  GLN A CD  1 
ATOM   704  O  OE1 . GLN A 1 96  ? 17.101  10.935  -28.495  1.00 24.99 ? 96  GLN A OE1 1 
ATOM   705  N  NE2 . GLN A 1 96  ? 18.919  10.272  -29.473  1.00 18.23 ? 96  GLN A NE2 1 
ATOM   706  N  N   . CYS A 1 97  ? 17.580  4.816   -26.430  1.00 23.08 ? 97  CYS A N   1 
ATOM   707  C  CA  . CYS A 1 97  ? 18.738  4.089   -25.892  1.00 24.81 ? 97  CYS A CA  1 
ATOM   708  C  C   . CYS A 1 97  ? 20.104  4.412   -26.491  1.00 28.25 ? 97  CYS A C   1 
ATOM   709  O  O   . CYS A 1 97  ? 21.109  3.937   -25.959  1.00 29.05 ? 97  CYS A O   1 
ATOM   710  C  CB  . CYS A 1 97  ? 18.579  2.577   -26.039  1.00 27.14 ? 97  CYS A CB  1 
ATOM   711  S  SG  . CYS A 1 97  ? 19.083  1.918   -27.657  1.00 34.13 ? 97  CYS A SG  1 
ATOM   712  N  N   . GLY A 1 98  ? 20.171  5.105   -27.644  1.00 26.60 ? 98  GLY A N   1 
ATOM   713  C  CA  . GLY A 1 98  ? 21.423  5.469   -28.297  1.00 22.78 ? 98  GLY A CA  1 
ATOM   714  C  C   . GLY A 1 98  ? 22.223  4.308   -28.880  1.00 24.41 ? 98  GLY A C   1 
ATOM   715  O  O   . GLY A 1 98  ? 23.183  4.528   -29.614  1.00 25.57 ? 98  GLY A O   1 
ATOM   716  N  N   . LYS A 1 99  ? 21.878  3.053   -28.654  1.00 25.69 ? 99  LYS A N   1 
ATOM   717  C  CA  . LYS A 1 99  ? 22.709  1.988   -29.183  1.00 29.67 ? 99  LYS A CA  1 
ATOM   718  C  C   . LYS A 1 99  ? 21.969  0.981   -30.044  1.00 29.44 ? 99  LYS A C   1 
ATOM   719  O  O   . LYS A 1 99  ? 22.544  -0.033  -30.463  1.00 29.00 ? 99  LYS A O   1 
ATOM   720  C  CB  . LYS A 1 99  ? 23.373  1.284   -28.002  1.00 34.88 ? 99  LYS A CB  1 
ATOM   721  C  CG  . LYS A 1 99  ? 24.381  2.150   -27.238  1.00 48.32 ? 99  LYS A CG  1 
ATOM   722  C  CD  . LYS A 1 99  ? 24.780  1.620   -25.853  1.00 55.66 ? 99  LYS A CD  1 
ATOM   723  C  CE  . LYS A 1 99  ? 23.748  1.894   -24.745  1.00 59.49 ? 99  LYS A CE  1 
ATOM   724  N  NZ  . LYS A 1 99  ? 22.485  1.196   -24.943  1.00 61.44 ? 99  LYS A NZ  1 
ATOM   725  N  N   . CYS A 1 100 ? 20.670  1.155   -30.294  1.00 27.39 ? 100 CYS A N   1 
ATOM   726  C  CA  . CYS A 1 100 ? 20.055  0.173   -31.127  1.00 26.42 ? 100 CYS A CA  1 
ATOM   727  C  C   . CYS A 1 100 ? 20.068  0.675   -32.573  1.00 30.79 ? 100 CYS A C   1 
ATOM   728  O  O   . CYS A 1 100 ? 20.465  1.823   -32.850  1.00 29.44 ? 100 CYS A O   1 
ATOM   729  C  CB  . CYS A 1 100 ? 18.678  -0.091  -30.583  1.00 21.03 ? 100 CYS A CB  1 
ATOM   730  S  SG  . CYS A 1 100 ? 17.336  1.062   -30.908  1.00 30.82 ? 100 CYS A SG  1 
ATOM   731  N  N   . ARG A 1 101 ? 19.686  -0.226  -33.503  1.00 31.10 ? 101 ARG A N   1 
ATOM   732  C  CA  . ARG A 1 101 ? 19.588  0.042   -34.936  1.00 29.68 ? 101 ARG A CA  1 
ATOM   733  C  C   . ARG A 1 101 ? 18.777  1.307   -35.166  1.00 29.29 ? 101 ARG A C   1 
ATOM   734  O  O   . ARG A 1 101 ? 19.252  2.292   -35.729  1.00 33.28 ? 101 ARG A O   1 
ATOM   735  C  CB  . ARG A 1 101 ? 18.915  -1.131  -35.614  1.00 29.06 ? 101 ARG A CB  1 
ATOM   736  C  CG  . ARG A 1 101 ? 18.729  -0.929  -37.099  1.00 26.41 ? 101 ARG A CG  1 
ATOM   737  C  CD  . ARG A 1 101 ? 18.038  -2.149  -37.687  1.00 31.32 ? 101 ARG A CD  1 
ATOM   738  N  NE  . ARG A 1 101 ? 17.760  -1.938  -39.102  1.00 33.41 ? 101 ARG A NE  1 
ATOM   739  C  CZ  . ARG A 1 101 ? 17.327  -2.896  -39.918  1.00 30.12 ? 101 ARG A CZ  1 
ATOM   740  N  NH1 . ARG A 1 101 ? 17.112  -4.148  -39.503  1.00 22.51 ? 101 ARG A NH1 1 
ATOM   741  N  NH2 . ARG A 1 101 ? 17.072  -2.551  -41.172  1.00 26.40 ? 101 ARG A NH2 1 
ATOM   742  N  N   . VAL A 1 102 ? 17.577  1.335   -34.602  1.00 25.58 ? 102 VAL A N   1 
ATOM   743  C  CA  . VAL A 1 102 ? 16.694  2.473   -34.740  1.00 22.62 ? 102 VAL A CA  1 
ATOM   744  C  C   . VAL A 1 102 ? 17.295  3.756   -34.218  1.00 27.13 ? 102 VAL A C   1 
ATOM   745  O  O   . VAL A 1 102 ? 17.142  4.808   -34.807  1.00 33.16 ? 102 VAL A O   1 
ATOM   746  C  CB  . VAL A 1 102 ? 15.435  2.157   -34.014  1.00 18.00 ? 102 VAL A CB  1 
ATOM   747  C  CG1 . VAL A 1 102 ? 14.481  3.289   -34.192  1.00 20.94 ? 102 VAL A CG1 1 
ATOM   748  C  CG2 . VAL A 1 102 ? 14.851  0.862   -34.532  1.00 19.01 ? 102 VAL A CG2 1 
ATOM   749  N  N   . CYS A 1 103 ? 17.996  3.704   -33.110  1.00 31.38 ? 103 CYS A N   1 
ATOM   750  C  CA  . CYS A 1 103 ? 18.579  4.902   -32.551  1.00 34.12 ? 103 CYS A CA  1 
ATOM   751  C  C   . CYS A 1 103 ? 19.743  5.397   -33.362  1.00 36.55 ? 103 CYS A C   1 
ATOM   752  O  O   . CYS A 1 103 ? 20.035  6.589   -33.326  1.00 37.03 ? 103 CYS A O   1 
ATOM   753  C  CB  . CYS A 1 103 ? 19.063  4.665   -31.124  1.00 32.52 ? 103 CYS A CB  1 
ATOM   754  S  SG  . CYS A 1 103 ? 17.738  4.745   -29.890  1.00 31.30 ? 103 CYS A SG  1 
ATOM   755  N  N   . LYS A 1 104 ? 20.464  4.500   -34.028  1.00 39.24 ? 104 LYS A N   1 
ATOM   756  C  CA  . LYS A 1 104 ? 21.606  4.954   -34.798  1.00 41.32 ? 104 LYS A CA  1 
ATOM   757  C  C   . LYS A 1 104 ? 21.175  5.502   -36.153  1.00 42.64 ? 104 LYS A C   1 
ATOM   758  O  O   . LYS A 1 104 ? 21.779  6.430   -36.697  1.00 43.51 ? 104 LYS A O   1 
ATOM   759  C  CB  . LYS A 1 104 ? 22.571  3.805   -34.963  1.00 42.85 ? 104 LYS A CB  1 
ATOM   760  C  CG  . LYS A 1 104 ? 23.205  3.412   -33.636  1.00 46.02 ? 104 LYS A CG  1 
ATOM   761  C  CD  . LYS A 1 104 ? 24.535  2.724   -33.920  1.00 50.86 ? 104 LYS A CD  1 
ATOM   762  C  CE  . LYS A 1 104 ? 24.613  1.359   -33.247  1.00 55.48 ? 104 LYS A CE  1 
ATOM   763  N  NZ  . LYS A 1 104 ? 23.568  0.457   -33.714  1.00 60.20 ? 104 LYS A NZ  1 
ATOM   764  N  N   . ASN A 1 105 ? 20.102  4.939   -36.701  1.00 43.35 ? 105 ASN A N   1 
ATOM   765  C  CA  . ASN A 1 105 ? 19.549  5.356   -37.973  1.00 43.65 ? 105 ASN A CA  1 
ATOM   766  C  C   . ASN A 1 105 ? 18.979  6.752   -37.749  1.00 46.41 ? 105 ASN A C   1 
ATOM   767  O  O   . ASN A 1 105 ? 17.946  6.909   -37.097  1.00 47.91 ? 105 ASN A O   1 
ATOM   768  C  CB  . ASN A 1 105 ? 18.456  4.383   -38.396  1.00 42.50 ? 105 ASN A CB  1 
ATOM   769  C  CG  . ASN A 1 105 ? 17.696  4.762   -39.660  1.00 45.52 ? 105 ASN A CG  1 
ATOM   770  O  OD1 . ASN A 1 105 ? 17.743  5.896   -40.149  1.00 48.52 ? 105 ASN A OD1 1 
ATOM   771  N  ND2 . ASN A 1 105 ? 16.936  3.831   -40.229  1.00 45.56 ? 105 ASN A ND2 1 
ATOM   772  N  N   . PRO A 1 106 ? 19.544  7.781   -38.390  1.00 47.40 ? 106 PRO A N   1 
ATOM   773  C  CA  . PRO A 1 106 ? 19.244  9.172   -38.123  1.00 46.00 ? 106 PRO A CA  1 
ATOM   774  C  C   . PRO A 1 106 ? 17.813  9.590   -38.324  1.00 44.94 ? 106 PRO A C   1 
ATOM   775  O  O   . PRO A 1 106 ? 17.419  10.655  -37.866  1.00 43.98 ? 106 PRO A O   1 
ATOM   776  C  CB  . PRO A 1 106 ? 20.197  9.906   -39.020  1.00 46.60 ? 106 PRO A CB  1 
ATOM   777  C  CG  . PRO A 1 106 ? 20.135  9.066   -40.271  1.00 46.45 ? 106 PRO A CG  1 
ATOM   778  C  CD  . PRO A 1 106 ? 20.255  7.679   -39.669  1.00 47.88 ? 106 PRO A CD  1 
ATOM   779  N  N   . GLU A 1 107 ? 17.051  8.788   -39.045  1.00 47.59 ? 107 GLU A N   1 
ATOM   780  C  CA  . GLU A 1 107 ? 15.687  9.145   -39.321  1.00 50.22 ? 107 GLU A CA  1 
ATOM   781  C  C   . GLU A 1 107 ? 14.680  8.336   -38.537  1.00 49.45 ? 107 GLU A C   1 
ATOM   782  O  O   . GLU A 1 107 ? 13.479  8.577   -38.702  1.00 53.79 ? 107 GLU A O   1 
ATOM   783  C  CB  . GLU A 1 107 ? 15.393  8.964   -40.806  1.00 57.15 ? 107 GLU A CB  1 
ATOM   784  C  CG  . GLU A 1 107 ? 16.140  9.869   -41.794  1.00 66.34 ? 107 GLU A CG  1 
ATOM   785  C  CD  . GLU A 1 107 ? 15.549  9.796   -43.207  1.00 72.76 ? 107 GLU A CD  1 
ATOM   786  O  OE1 . GLU A 1 107 ? 15.768  8.801   -43.908  1.00 72.35 ? 107 GLU A OE1 1 
ATOM   787  O  OE2 . GLU A 1 107 ? 14.856  10.740  -43.602  1.00 76.14 ? 107 GLU A OE2 1 
ATOM   788  N  N   . SER A 1 108 ? 15.086  7.408   -37.680  1.00 43.57 ? 108 SER A N   1 
ATOM   789  C  CA  . SER A 1 108 ? 14.132  6.581   -36.972  1.00 38.18 ? 108 SER A CA  1 
ATOM   790  C  C   . SER A 1 108 ? 14.050  6.898   -35.510  1.00 32.79 ? 108 SER A C   1 
ATOM   791  O  O   . SER A 1 108 ? 15.063  7.234   -34.910  1.00 34.85 ? 108 SER A O   1 
ATOM   792  C  CB  . SER A 1 108 ? 14.544  5.160   -37.196  1.00 40.30 ? 108 SER A CB  1 
ATOM   793  O  OG  . SER A 1 108 ? 14.272  4.925   -38.560  1.00 47.25 ? 108 SER A OG  1 
ATOM   794  N  N   . ASN A 1 109 ? 12.906  6.811   -34.861  1.00 26.40 ? 109 ASN A N   1 
ATOM   795  C  CA  . ASN A 1 109 ? 12.914  7.126   -33.446  1.00 23.15 ? 109 ASN A CA  1 
ATOM   796  C  C   . ASN A 1 109 ? 12.237  6.070   -32.570  1.00 21.99 ? 109 ASN A C   1 
ATOM   797  O  O   . ASN A 1 109 ? 12.300  6.195   -31.354  1.00 24.31 ? 109 ASN A O   1 
ATOM   798  C  CB  . ASN A 1 109 ? 12.265  8.512   -33.259  1.00 15.92 ? 109 ASN A CB  1 
ATOM   799  C  CG  . ASN A 1 109 ? 10.756  8.469   -33.375  1.00 17.25 ? 109 ASN A CG  1 
ATOM   800  O  OD1 . ASN A 1 109 ? 10.222  7.651   -34.138  1.00 18.33 ? 109 ASN A OD1 1 
ATOM   801  N  ND2 . ASN A 1 109 ? 9.982   9.228   -32.621  1.00 16.71 ? 109 ASN A ND2 1 
ATOM   802  N  N   . TYR A 1 110 ? 11.589  5.017   -33.076  1.00 18.30 ? 110 TYR A N   1 
ATOM   803  C  CA  . TYR A 1 110 ? 10.939  4.005   -32.244  1.00 21.36 ? 110 TYR A CA  1 
ATOM   804  C  C   . TYR A 1 110 ? 11.981  2.994   -31.752  1.00 24.76 ? 110 TYR A C   1 
ATOM   805  O  O   . TYR A 1 110 ? 12.198  1.896   -32.294  1.00 24.68 ? 110 TYR A O   1 
ATOM   806  C  CB  . TYR A 1 110 ? 9.869   3.348   -33.091  1.00 20.05 ? 110 TYR A CB  1 
ATOM   807  C  CG  . TYR A 1 110 ? 9.073   2.219   -32.468  1.00 21.30 ? 110 TYR A CG  1 
ATOM   808  C  CD1 . TYR A 1 110 ? 8.078   2.496   -31.530  1.00 21.67 ? 110 TYR A CD1 1 
ATOM   809  C  CD2 . TYR A 1 110 ? 9.272   0.910   -32.910  1.00 26.03 ? 110 TYR A CD2 1 
ATOM   810  C  CE1 . TYR A 1 110 ? 7.273   1.471   -31.043  1.00 21.78 ? 110 TYR A CE1 1 
ATOM   811  C  CE2 . TYR A 1 110 ? 8.469   -0.126  -32.421  1.00 24.53 ? 110 TYR A CE2 1 
ATOM   812  C  CZ  . TYR A 1 110 ? 7.475   0.171   -31.498  1.00 23.42 ? 110 TYR A CZ  1 
ATOM   813  O  OH  . TYR A 1 110 ? 6.667   -0.837  -31.019  1.00 27.13 ? 110 TYR A OH  1 
ATOM   814  N  N   . CYS A 1 111 ? 12.697  3.432   -30.720  1.00 24.90 ? 111 CYS A N   1 
ATOM   815  C  CA  . CYS A 1 111 ? 13.753  2.649   -30.123  1.00 24.76 ? 111 CYS A CA  1 
ATOM   816  C  C   . CYS A 1 111 ? 13.265  1.287   -29.688  1.00 24.68 ? 111 CYS A C   1 
ATOM   817  O  O   . CYS A 1 111 ? 12.099  1.049   -29.319  1.00 19.63 ? 111 CYS A O   1 
ATOM   818  C  CB  . CYS A 1 111 ? 14.321  3.427   -28.952  1.00 29.76 ? 111 CYS A CB  1 
ATOM   819  S  SG  . CYS A 1 111 ? 15.555  2.519   -27.994  1.00 30.13 ? 111 CYS A SG  1 
ATOM   820  N  N   . LEU A 1 112 ? 14.227  0.375   -29.777  1.00 28.52 ? 112 LEU A N   1 
ATOM   821  C  CA  . LEU A 1 112 ? 13.953  -1.022  -29.442  1.00 32.63 ? 112 LEU A CA  1 
ATOM   822  C  C   . LEU A 1 112 ? 13.700  -1.274  -27.943  1.00 29.42 ? 112 LEU A C   1 
ATOM   823  O  O   . LEU A 1 112 ? 13.008  -2.242  -27.619  1.00 26.98 ? 112 LEU A O   1 
ATOM   824  C  CB  . LEU A 1 112 ? 15.128  -1.875  -30.043  1.00 32.93 ? 112 LEU A CB  1 
ATOM   825  C  CG  . LEU A 1 112 ? 15.211  -1.726  -31.603  1.00 37.53 ? 112 LEU A CG  1 
ATOM   826  C  CD1 . LEU A 1 112 ? 16.344  -2.565  -32.163  1.00 39.00 ? 112 LEU A CD1 1 
ATOM   827  C  CD2 . LEU A 1 112 ? 13.909  -2.171  -32.259  1.00 34.05 ? 112 LEU A CD2 1 
ATOM   828  N  N   . LYS A 1 113 ? 14.118  -0.367  -27.034  1.00 25.33 ? 113 LYS A N   1 
ATOM   829  C  CA  . LYS A 1 113 ? 13.849  -0.501  -25.596  1.00 27.12 ? 113 LYS A CA  1 
ATOM   830  C  C   . LYS A 1 113 ? 12.468  0.047   -25.241  1.00 26.80 ? 113 LYS A C   1 
ATOM   831  O  O   . LYS A 1 113 ? 12.247  0.439   -24.091  1.00 31.65 ? 113 LYS A O   1 
ATOM   832  C  CB  . LYS A 1 113 ? 14.855  0.280   -24.760  1.00 21.97 ? 113 LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 113 ? 16.318  -0.103  -24.905  1.00 27.58 ? 113 LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 113 ? 16.572  -1.593  -24.699  1.00 32.10 ? 113 LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 113 ? 17.876  -1.818  -23.930  1.00 44.16 ? 113 LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 113 ? 17.746  -1.477  -22.509  1.00 49.89 ? 113 LYS A NZ  1 
ATOM   837  N  N   . ASN A 1 114 ? 11.528  0.099   -26.182  1.00 18.99 ? 114 ASN A N   1 
ATOM   838  C  CA  . ASN A 1 114 ? 10.240  0.709   -25.928  1.00 20.53 ? 114 ASN A CA  1 
ATOM   839  C  C   . ASN A 1 114 ? 9.334   -0.331  -25.320  1.00 22.52 ? 114 ASN A C   1 
ATOM   840  O  O   . ASN A 1 114 ? 9.625   -1.519  -25.451  1.00 24.76 ? 114 ASN A O   1 
ATOM   841  C  CB  . ASN A 1 114 ? 9.579   1.220   -27.251  1.00 20.32 ? 114 ASN A CB  1 
ATOM   842  C  CG  . ASN A 1 114 ? 9.039   0.093   -28.139  1.00 16.81 ? 114 ASN A CG  1 
ATOM   843  O  OD1 . ASN A 1 114 ? 7.878   -0.351  -28.046  1.00 15.12 ? 114 ASN A OD1 1 
ATOM   844  N  ND2 . ASN A 1 114 ? 9.875   -0.459  -28.991  1.00 15.91 ? 114 ASN A ND2 1 
ATOM   845  N  N   . ASP A 1 115 ? 8.174   0.054   -24.784  1.00 23.15 ? 115 ASP A N   1 
ATOM   846  C  CA  . ASP A 1 115 ? 7.272   -0.919  -24.228  1.00 21.90 ? 115 ASP A CA  1 
ATOM   847  C  C   . ASP A 1 115 ? 5.917   -0.701  -24.871  1.00 24.61 ? 115 ASP A C   1 
ATOM   848  O  O   . ASP A 1 115 ? 4.895   -1.153  -24.348  1.00 25.99 ? 115 ASP A O   1 
ATOM   849  C  CB  . ASP A 1 115 ? 7.236   -0.733  -22.692  1.00 26.42 ? 115 ASP A CB  1 
ATOM   850  C  CG  . ASP A 1 115 ? 6.955   -2.037  -21.936  1.00 30.04 ? 115 ASP A CG  1 
ATOM   851  O  OD1 . ASP A 1 115 ? 7.864   -2.876  -21.820  1.00 30.20 ? 115 ASP A OD1 1 
ATOM   852  O  OD2 . ASP A 1 115 ? 5.817   -2.204  -21.479  1.00 24.51 ? 115 ASP A OD2 1 
ATOM   853  N  N   . LEU A 1 116 ? 5.831   -0.002  -26.006  1.00 26.23 ? 116 LEU A N   1 
ATOM   854  C  CA  . LEU A 1 116 ? 4.546   0.182   -26.659  1.00 27.18 ? 116 LEU A CA  1 
ATOM   855  C  C   . LEU A 1 116 ? 4.241   -1.036  -27.526  1.00 28.07 ? 116 LEU A C   1 
ATOM   856  O  O   . LEU A 1 116 ? 3.105   -1.520  -27.564  1.00 26.06 ? 116 LEU A O   1 
ATOM   857  C  CB  . LEU A 1 116 ? 4.517   1.423   -27.579  1.00 29.23 ? 116 LEU A CB  1 
ATOM   858  C  CG  . LEU A 1 116 ? 3.293   1.492   -28.522  1.00 26.83 ? 116 LEU A CG  1 
ATOM   859  C  CD1 . LEU A 1 116 ? 2.048   1.893   -27.741  1.00 29.80 ? 116 LEU A CD1 1 
ATOM   860  C  CD2 . LEU A 1 116 ? 3.607   2.431   -29.664  1.00 32.19 ? 116 LEU A CD2 1 
ATOM   861  N  N   . GLY A 1 117 ? 5.258   -1.509  -28.253  1.00 29.45 ? 117 GLY A N   1 
ATOM   862  C  CA  . GLY A 1 117 ? 5.084   -2.632  -29.152  1.00 31.02 ? 117 GLY A CA  1 
ATOM   863  C  C   . GLY A 1 117 ? 4.428   -3.845  -28.531  1.00 30.73 ? 117 GLY A C   1 
ATOM   864  O  O   . GLY A 1 117 ? 3.334   -4.253  -28.905  1.00 29.12 ? 117 GLY A O   1 
ATOM   865  N  N   . ASN A 1 118 ? 5.152   -4.474  -27.617  1.00 32.56 ? 118 ASN A N   1 
ATOM   866  C  CA  . ASN A 1 118 ? 4.585   -5.622  -26.948  1.00 31.57 ? 118 ASN A CA  1 
ATOM   867  C  C   . ASN A 1 118 ? 4.826   -5.257  -25.504  1.00 25.91 ? 118 ASN A C   1 
ATOM   868  O  O   . ASN A 1 118 ? 5.938   -5.429  -24.995  1.00 23.57 ? 118 ASN A O   1 
ATOM   869  C  CB  . ASN A 1 118 ? 5.318   -6.914  -27.296  1.00 36.13 ? 118 ASN A CB  1 
ATOM   870  C  CG  . ASN A 1 118 ? 4.439   -8.108  -26.946  1.00 47.94 ? 118 ASN A CG  1 
ATOM   871  O  OD1 . ASN A 1 118 ? 3.501   -8.023  -26.149  1.00 53.58 ? 118 ASN A OD1 1 
ATOM   872  N  ND2 . ASN A 1 118 ? 4.649   -9.271  -27.557  1.00 53.00 ? 118 ASN A ND2 1 
ATOM   873  N  N   . PRO A 1 119 ? 3.853   -4.649  -24.839  1.00 23.46 ? 119 PRO A N   1 
ATOM   874  C  CA  . PRO A 1 119 ? 4.012   -4.158  -23.484  1.00 26.14 ? 119 PRO A CA  1 
ATOM   875  C  C   . PRO A 1 119 ? 4.213   -5.200  -22.369  1.00 28.63 ? 119 PRO A C   1 
ATOM   876  O  O   . PRO A 1 119 ? 3.377   -6.072  -22.119  1.00 29.82 ? 119 PRO A O   1 
ATOM   877  C  CB  . PRO A 1 119 ? 2.788   -3.275  -23.311  1.00 16.61 ? 119 PRO A CB  1 
ATOM   878  C  CG  . PRO A 1 119 ? 1.724   -3.995  -24.047  1.00 19.25 ? 119 PRO A CG  1 
ATOM   879  C  CD  . PRO A 1 119 ? 2.469   -4.588  -25.253  1.00 19.82 ? 119 PRO A CD  1 
ATOM   880  N  N   . ARG A 1 120 ? 5.405   -5.125  -21.745  1.00 30.02 ? 120 ARG A N   1 
ATOM   881  C  CA  . ARG A 1 120 ? 5.789   -5.961  -20.599  1.00 30.71 ? 120 ARG A CA  1 
ATOM   882  C  C   . ARG A 1 120 ? 5.104   -5.461  -19.319  1.00 30.75 ? 120 ARG A C   1 
ATOM   883  O  O   . ARG A 1 120 ? 4.677   -6.208  -18.444  1.00 31.54 ? 120 ARG A O   1 
ATOM   884  C  CB  . ARG A 1 120 ? 7.274   -5.884  -20.326  1.00 32.41 ? 120 ARG A CB  1 
ATOM   885  C  CG  . ARG A 1 120 ? 8.282   -6.803  -20.990  1.00 36.69 ? 120 ARG A CG  1 
ATOM   886  C  CD  . ARG A 1 120 ? 9.587   -6.085  -20.623  1.00 44.52 ? 120 ARG A CD  1 
ATOM   887  N  NE  . ARG A 1 120 ? 10.809  -6.878  -20.665  1.00 48.72 ? 120 ARG A NE  1 
ATOM   888  C  CZ  . ARG A 1 120 ? 12.020  -6.309  -20.532  1.00 53.19 ? 120 ARG A CZ  1 
ATOM   889  N  NH1 . ARG A 1 120 ? 12.157  -4.987  -20.370  1.00 53.93 ? 120 ARG A NH1 1 
ATOM   890  N  NH2 . ARG A 1 120 ? 13.123  -7.070  -20.501  1.00 54.18 ? 120 ARG A NH2 1 
ATOM   891  N  N   . GLY A 1 121 ? 5.039   -4.140  -19.168  1.00 29.97 ? 121 GLY A N   1 
ATOM   892  C  CA  . GLY A 1 121 ? 4.462   -3.495  -18.008  1.00 26.07 ? 121 GLY A CA  1 
ATOM   893  C  C   . GLY A 1 121 ? 5.573   -3.319  -16.981  1.00 22.31 ? 121 GLY A C   1 
ATOM   894  O  O   . GLY A 1 121 ? 5.288   -3.195  -15.802  1.00 24.98 ? 121 GLY A O   1 
ATOM   895  N  N   . THR A 1 122 ? 6.842   -3.263  -17.355  1.00 18.05 ? 122 THR A N   1 
ATOM   896  C  CA  . THR A 1 122 ? 7.927   -3.149  -16.422  1.00 17.25 ? 122 THR A CA  1 
ATOM   897  C  C   . THR A 1 122 ? 8.864   -2.040  -16.877  1.00 20.49 ? 122 THR A C   1 
ATOM   898  O  O   . THR A 1 122 ? 8.507   -1.177  -17.693  1.00 28.22 ? 122 THR A O   1 
ATOM   899  C  CB  . THR A 1 122 ? 8.671   -4.500  -16.380  1.00 20.59 ? 122 THR A CB  1 
ATOM   900  O  OG1 . THR A 1 122 ? 9.485   -4.529  -17.553  1.00 22.43 ? 122 THR A OG1 1 
ATOM   901  C  CG2 . THR A 1 122 ? 7.737   -5.731  -16.333  1.00 9.16  ? 122 THR A CG2 1 
ATOM   902  N  N   . LEU A 1 123 ? 10.031  -1.952  -16.275  1.00 17.19 ? 123 LEU A N   1 
ATOM   903  C  CA  . LEU A 1 123 ? 11.007  -1.012  -16.738  1.00 17.94 ? 123 LEU A CA  1 
ATOM   904  C  C   . LEU A 1 123 ? 11.919  -1.886  -17.621  1.00 20.38 ? 123 LEU A C   1 
ATOM   905  O  O   . LEU A 1 123 ? 11.776  -3.120  -17.691  1.00 17.16 ? 123 LEU A O   1 
ATOM   906  C  CB  . LEU A 1 123 ? 11.824  -0.421  -15.607  1.00 16.46 ? 123 LEU A CB  1 
ATOM   907  C  CG  . LEU A 1 123 ? 11.260  0.645   -14.681  1.00 15.53 ? 123 LEU A CG  1 
ATOM   908  C  CD1 . LEU A 1 123 ? 12.435  1.130   -13.905  1.00 12.55 ? 123 LEU A CD1 1 
ATOM   909  C  CD2 . LEU A 1 123 ? 10.732  1.896   -15.356  1.00 16.93 ? 123 LEU A CD2 1 
ATOM   910  N  N   . GLN A 1 124 ? 12.925  -1.277  -18.259  1.00 21.23 ? 124 GLN A N   1 
ATOM   911  C  CA  . GLN A 1 124 ? 13.814  -1.993  -19.158  1.00 28.38 ? 124 GLN A CA  1 
ATOM   912  C  C   . GLN A 1 124 ? 14.530  -3.211  -18.592  1.00 33.78 ? 124 GLN A C   1 
ATOM   913  O  O   . GLN A 1 124 ? 14.775  -4.174  -19.321  1.00 37.60 ? 124 GLN A O   1 
ATOM   914  C  CB  . GLN A 1 124 ? 14.844  -1.011  -19.730  1.00 25.07 ? 124 GLN A CB  1 
ATOM   915  C  CG  . GLN A 1 124 ? 14.146  -0.181  -20.801  1.00 20.25 ? 124 GLN A CG  1 
ATOM   916  C  CD  . GLN A 1 124 ? 14.974  0.999   -21.263  1.00 24.10 ? 124 GLN A CD  1 
ATOM   917  O  OE1 . GLN A 1 124 ? 16.192  0.908   -21.479  1.00 25.15 ? 124 GLN A OE1 1 
ATOM   918  N  NE2 . GLN A 1 124 ? 14.328  2.151   -21.390  1.00 18.53 ? 124 GLN A NE2 1 
ATOM   919  N  N   . ASP A 1 125 ? 14.827  -3.250  -17.296  1.00 33.13 ? 125 ASP A N   1 
ATOM   920  C  CA  . ASP A 1 125 ? 15.491  -4.424  -16.744  1.00 33.58 ? 125 ASP A CA  1 
ATOM   921  C  C   . ASP A 1 125 ? 14.497  -5.546  -16.473  1.00 33.10 ? 125 ASP A C   1 
ATOM   922  O  O   . ASP A 1 125 ? 14.850  -6.484  -15.770  1.00 35.90 ? 125 ASP A O   1 
ATOM   923  C  CB  . ASP A 1 125 ? 16.201  -4.076  -15.434  1.00 34.53 ? 125 ASP A CB  1 
ATOM   924  C  CG  . ASP A 1 125 ? 15.329  -3.803  -14.207  1.00 31.19 ? 125 ASP A CG  1 
ATOM   925  O  OD1 . ASP A 1 125 ? 14.134  -3.519  -14.327  1.00 34.10 ? 125 ASP A OD1 1 
ATOM   926  O  OD2 . ASP A 1 125 ? 15.875  -3.861  -13.112  1.00 32.05 ? 125 ASP A OD2 1 
ATOM   927  N  N   . GLY A 1 126 ? 13.240  -5.469  -16.900  1.00 30.43 ? 126 GLY A N   1 
ATOM   928  C  CA  . GLY A 1 126 ? 12.308  -6.536  -16.640  1.00 31.27 ? 126 GLY A CA  1 
ATOM   929  C  C   . GLY A 1 126 ? 11.595  -6.388  -15.314  1.00 34.63 ? 126 GLY A C   1 
ATOM   930  O  O   . GLY A 1 126 ? 10.576  -7.061  -15.131  1.00 40.21 ? 126 GLY A O   1 
ATOM   931  N  N   . THR A 1 127 ? 12.008  -5.557  -14.354  1.00 33.41 ? 127 THR A N   1 
ATOM   932  C  CA  . THR A 1 127 ? 11.276  -5.465  -13.093  1.00 32.26 ? 127 THR A CA  1 
ATOM   933  C  C   . THR A 1 127 ? 10.417  -4.209  -12.915  1.00 33.73 ? 127 THR A C   1 
ATOM   934  O  O   . THR A 1 127 ? 10.612  -3.181  -13.585  1.00 33.25 ? 127 THR A O   1 
ATOM   935  C  CB  . THR A 1 127 ? 12.322  -5.616  -11.966  1.00 29.68 ? 127 THR A CB  1 
ATOM   936  O  OG1 . THR A 1 127 ? 13.333  -4.657  -12.187  1.00 28.74 ? 127 THR A OG1 1 
ATOM   937  C  CG2 . THR A 1 127 ? 13.048  -6.955  -11.993  1.00 31.93 ? 127 THR A CG2 1 
ATOM   938  N  N   . ARG A 1 128 ? 9.411   -4.331  -12.043  1.00 31.62 ? 128 ARG A N   1 
ATOM   939  C  CA  . ARG A 1 128 ? 8.494   -3.266  -11.689  1.00 30.34 ? 128 ARG A CA  1 
ATOM   940  C  C   . ARG A 1 128 ? 9.045   -2.503  -10.459  1.00 29.59 ? 128 ARG A C   1 
ATOM   941  O  O   . ARG A 1 128 ? 10.094  -2.877  -9.966   1.00 31.77 ? 128 ARG A O   1 
ATOM   942  C  CB  . ARG A 1 128 ? 7.124   -3.859  -11.381  1.00 28.34 ? 128 ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 128 ? 6.517   -4.831  -12.398  1.00 31.27 ? 128 ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 128 ? 5.153   -5.048  -11.774  1.00 33.96 ? 128 ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 128 ? 4.456   -6.339  -11.820  1.00 38.72 ? 128 ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 128 ? 4.994   -7.541  -11.545  1.00 41.40 ? 128 ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 128 ? 6.287   -7.703  -11.200  1.00 35.50 ? 128 ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 128 ? 4.184   -8.613  -11.624  1.00 40.97 ? 128 ARG A NH2 1 
ATOM   949  N  N   . ARG A 1 129 ? 8.445   -1.449  -9.871   1.00 26.39 ? 129 ARG A N   1 
ATOM   950  C  CA  . ARG A 1 129 ? 9.016   -0.708  -8.724   1.00 19.85 ? 129 ARG A CA  1 
ATOM   951  C  C   . ARG A 1 129 ? 7.905   -0.111  -7.847   1.00 20.20 ? 129 ARG A C   1 
ATOM   952  O  O   . ARG A 1 129 ? 8.135   0.765   -6.990   1.00 19.35 ? 129 ARG A O   1 
ATOM   953  C  CB  . ARG A 1 129 ? 9.844   0.496   -9.136   1.00 17.93 ? 129 ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 129 ? 10.992  0.313   -10.053  1.00 20.69 ? 129 ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 129 ? 12.340  0.304   -9.358   1.00 15.39 ? 129 ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 129 ? 13.349  -0.099  -10.303  1.00 16.23 ? 129 ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 129 ? 13.349  -1.323  -10.857  1.00 23.72 ? 129 ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 129 ? 12.449  -2.230  -10.555  1.00 17.80 ? 129 ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 129 ? 14.234  -1.655  -11.782  1.00 24.58 ? 129 ARG A NH2 1 
ATOM   960  N  N   . PHE A 1 130 ? 6.667   -0.511  -8.102   1.00 18.60 ? 130 PHE A N   1 
ATOM   961  C  CA  . PHE A 1 130 ? 5.558   0.051   -7.387   1.00 22.80 ? 130 PHE A CA  1 
ATOM   962  C  C   . PHE A 1 130 ? 4.910   -1.185  -6.843   1.00 28.18 ? 130 PHE A C   1 
ATOM   963  O  O   . PHE A 1 130 ? 4.847   -2.209  -7.544   1.00 25.84 ? 130 PHE A O   1 
ATOM   964  C  CB  . PHE A 1 130 ? 4.535   0.730   -8.265   1.00 24.98 ? 130 PHE A CB  1 
ATOM   965  C  CG  . PHE A 1 130 ? 5.029   1.898   -9.094   1.00 33.21 ? 130 PHE A CG  1 
ATOM   966  C  CD1 . PHE A 1 130 ? 5.342   3.117   -8.494   1.00 34.24 ? 130 PHE A CD1 1 
ATOM   967  C  CD2 . PHE A 1 130 ? 5.139   1.747   -10.478  1.00 35.54 ? 130 PHE A CD2 1 
ATOM   968  C  CE1 . PHE A 1 130 ? 5.763   4.182   -9.274   1.00 35.57 ? 130 PHE A CE1 1 
ATOM   969  C  CE2 . PHE A 1 130 ? 5.560   2.823   -11.247  1.00 34.86 ? 130 PHE A CE2 1 
ATOM   970  C  CZ  . PHE A 1 130 ? 5.870   4.032   -10.649  1.00 34.32 ? 130 PHE A CZ  1 
ATOM   971  N  N   . THR A 1 131 ? 4.462   -0.979  -5.603   1.00 31.27 ? 131 THR A N   1 
ATOM   972  C  CA  . THR A 1 131 ? 3.800   -1.966  -4.767   1.00 30.67 ? 131 THR A CA  1 
ATOM   973  C  C   . THR A 1 131 ? 2.625   -1.235  -4.121   1.00 28.60 ? 131 THR A C   1 
ATOM   974  O  O   . THR A 1 131 ? 2.746   -0.074  -3.728   1.00 29.06 ? 131 THR A O   1 
ATOM   975  C  CB  . THR A 1 131 ? 4.822   -2.488  -3.725   1.00 34.42 ? 131 THR A CB  1 
ATOM   976  O  OG1 . THR A 1 131 ? 6.109   -1.841  -3.865   1.00 41.36 ? 131 THR A OG1 1 
ATOM   977  C  CG2 . THR A 1 131 ? 5.014   -3.973  -3.965   1.00 40.35 ? 131 THR A CG2 1 
ATOM   978  N  N   . CYS A 1 132 ? 1.452   -1.832  -4.074   1.00 27.61 ? 132 CYS A N   1 
ATOM   979  C  CA  . CYS A 1 132 ? 0.272   -1.230  -3.495   1.00 31.25 ? 132 CYS A CA  1 
ATOM   980  C  C   . CYS A 1 132 ? -0.427  -2.448  -2.933   1.00 36.05 ? 132 CYS A C   1 
ATOM   981  O  O   . CYS A 1 132 ? -0.706  -3.393  -3.671   1.00 37.31 ? 132 CYS A O   1 
ATOM   982  C  CB  . CYS A 1 132 ? -0.583  -0.588  -4.565   1.00 33.22 ? 132 CYS A CB  1 
ATOM   983  S  SG  . CYS A 1 132 ? -2.246  -0.069  -4.069   1.00 39.25 ? 132 CYS A SG  1 
ATOM   984  N  N   . ARG A 1 133 ? -0.624  -2.459  -1.603   1.00 38.68 ? 133 ARG A N   1 
ATOM   985  C  CA  . ARG A 1 133 ? -1.248  -3.557  -0.856   1.00 38.61 ? 133 ARG A CA  1 
ATOM   986  C  C   . ARG A 1 133 ? -0.402  -4.820  -1.017   1.00 41.73 ? 133 ARG A C   1 
ATOM   987  O  O   . ARG A 1 133 ? -0.925  -5.912  -1.244   1.00 43.63 ? 133 ARG A O   1 
ATOM   988  C  CB  . ARG A 1 133 ? -2.692  -3.826  -1.361   1.00 37.84 ? 133 ARG A CB  1 
ATOM   989  C  CG  . ARG A 1 133 ? -3.547  -2.573  -1.313   1.00 39.11 ? 133 ARG A CG  1 
ATOM   990  C  CD  . ARG A 1 133 ? -4.981  -2.821  -1.686   1.00 40.43 ? 133 ARG A CD  1 
ATOM   991  N  NE  . ARG A 1 133 ? -5.647  -1.534  -1.642   1.00 48.17 ? 133 ARG A NE  1 
ATOM   992  C  CZ  . ARG A 1 133 ? -6.978  -1.397  -1.581   1.00 54.18 ? 133 ARG A CZ  1 
ATOM   993  N  NH1 . ARG A 1 133 ? -7.813  -2.437  -1.549   1.00 56.91 ? 133 ARG A NH1 1 
ATOM   994  N  NH2 . ARG A 1 133 ? -7.496  -0.172  -1.580   1.00 57.60 ? 133 ARG A NH2 1 
ATOM   995  N  N   . GLY A 1 134 ? 0.938   -4.719  -0.980   1.00 42.40 ? 134 GLY A N   1 
ATOM   996  C  CA  . GLY A 1 134 ? 1.788   -5.895  -1.143   1.00 42.24 ? 134 GLY A CA  1 
ATOM   997  C  C   . GLY A 1 134 ? 1.916   -6.358  -2.599   1.00 44.63 ? 134 GLY A C   1 
ATOM   998  O  O   . GLY A 1 134 ? 2.972   -6.859  -2.995   1.00 45.51 ? 134 GLY A O   1 
ATOM   999  N  N   . LYS A 1 135 ? 0.863   -6.234  -3.411   1.00 42.45 ? 135 LYS A N   1 
ATOM   1000 C  CA  . LYS A 1 135 ? 0.883   -6.587  -4.817   1.00 39.97 ? 135 LYS A CA  1 
ATOM   1001 C  C   . LYS A 1 135 ? 1.793   -5.692  -5.670   1.00 37.26 ? 135 LYS A C   1 
ATOM   1002 O  O   . LYS A 1 135 ? 1.890   -4.479  -5.416   1.00 35.69 ? 135 LYS A O   1 
ATOM   1003 C  CB  . LYS A 1 135 ? -0.534  -6.510  -5.330   1.00 41.82 ? 135 LYS A CB  1 
ATOM   1004 C  CG  . LYS A 1 135 ? -1.344  -7.697  -4.851   1.00 44.50 ? 135 LYS A CG  1 
ATOM   1005 C  CD  . LYS A 1 135 ? -2.832  -7.478  -5.056   1.00 47.29 ? 135 LYS A CD  1 
ATOM   1006 C  CE  . LYS A 1 135 ? -3.355  -6.392  -4.116   1.00 50.61 ? 135 LYS A CE  1 
ATOM   1007 N  NZ  . LYS A 1 135 ? -4.811  -6.372  -4.119   1.00 51.87 ? 135 LYS A NZ  1 
ATOM   1008 N  N   . PRO A 1 136 ? 2.524   -6.221  -6.666   1.00 37.11 ? 136 PRO A N   1 
ATOM   1009 C  CA  . PRO A 1 136 ? 3.300   -5.429  -7.618   1.00 34.76 ? 136 PRO A CA  1 
ATOM   1010 C  C   . PRO A 1 136 ? 2.343   -4.728  -8.586   1.00 30.79 ? 136 PRO A C   1 
ATOM   1011 O  O   . PRO A 1 136 ? 1.282   -5.241  -8.983   1.00 28.56 ? 136 PRO A O   1 
ATOM   1012 C  CB  . PRO A 1 136 ? 4.206   -6.419  -8.300   1.00 34.58 ? 136 PRO A CB  1 
ATOM   1013 C  CG  . PRO A 1 136 ? 4.184   -7.621  -7.382   1.00 32.12 ? 136 PRO A CG  1 
ATOM   1014 C  CD  . PRO A 1 136 ? 2.728   -7.638  -6.950   1.00 34.74 ? 136 PRO A CD  1 
ATOM   1015 N  N   . ILE A 1 137 ? 2.696   -3.483  -8.878   1.00 27.44 ? 137 ILE A N   1 
ATOM   1016 C  CA  . ILE A 1 137 ? 1.933   -2.686  -9.791   1.00 26.85 ? 137 ILE A CA  1 
ATOM   1017 C  C   . ILE A 1 137 ? 2.897   -2.498  -10.965  1.00 26.11 ? 137 ILE A C   1 
ATOM   1018 O  O   . ILE A 1 137 ? 4.122   -2.301  -10.812  1.00 19.63 ? 137 ILE A O   1 
ATOM   1019 C  CB  . ILE A 1 137 ? 1.553   -1.347  -9.143   1.00 31.44 ? 137 ILE A CB  1 
ATOM   1020 C  CG1 . ILE A 1 137 ? 0.784   -1.587  -7.848   1.00 31.84 ? 137 ILE A CG1 1 
ATOM   1021 C  CG2 . ILE A 1 137 ? 0.652   -0.546  -10.099  1.00 28.60 ? 137 ILE A CG2 1 
ATOM   1022 C  CD1 . ILE A 1 137 ? -0.551  -2.343  -8.034   1.00 32.43 ? 137 ILE A CD1 1 
ATOM   1023 N  N   . HIS A 1 138 ? 2.280   -2.678  -12.148  1.00 25.97 ? 138 HIS A N   1 
ATOM   1024 C  CA  . HIS A 1 138 ? 2.981   -2.532  -13.421  1.00 26.17 ? 138 HIS A CA  1 
ATOM   1025 C  C   . HIS A 1 138 ? 3.165   -1.080  -13.846  1.00 23.99 ? 138 HIS A C   1 
ATOM   1026 O  O   . HIS A 1 138 ? 2.379   -0.178  -13.530  1.00 22.89 ? 138 HIS A O   1 
ATOM   1027 C  CB  . HIS A 1 138 ? 2.234   -3.167  -14.570  1.00 24.48 ? 138 HIS A CB  1 
ATOM   1028 C  CG  . HIS A 1 138 ? 2.145   -4.669  -14.556  1.00 15.11 ? 138 HIS A CG  1 
ATOM   1029 N  ND1 . HIS A 1 138 ? 1.088   -5.420  -14.256  1.00 19.38 ? 138 HIS A ND1 1 
ATOM   1030 C  CD2 . HIS A 1 138 ? 3.189   -5.487  -14.888  1.00 14.15 ? 138 HIS A CD2 1 
ATOM   1031 C  CE1 . HIS A 1 138 ? 1.451   -6.674  -14.397  1.00 18.50 ? 138 HIS A CE1 1 
ATOM   1032 N  NE2 . HIS A 1 138 ? 2.718   -6.694  -14.781  1.00 18.07 ? 138 HIS A NE2 1 
ATOM   1033 N  N   . HIS A 1 139 ? 4.250   -0.879  -14.568  1.00 24.03 ? 139 HIS A N   1 
ATOM   1034 C  CA  . HIS A 1 139 ? 4.552   0.415   -15.147  1.00 26.66 ? 139 HIS A CA  1 
ATOM   1035 C  C   . HIS A 1 139 ? 3.783   0.545   -16.485  1.00 28.44 ? 139 HIS A C   1 
ATOM   1036 O  O   . HIS A 1 139 ? 3.237   -0.441  -17.008  1.00 26.32 ? 139 HIS A O   1 
ATOM   1037 C  CB  . HIS A 1 139 ? 6.026   0.544   -15.433  1.00 24.25 ? 139 HIS A CB  1 
ATOM   1038 C  CG  . HIS A 1 139 ? 6.933   0.603   -14.218  1.00 28.51 ? 139 HIS A CG  1 
ATOM   1039 N  ND1 . HIS A 1 139 ? 7.831   1.542   -13.957  1.00 30.24 ? 139 HIS A ND1 1 
ATOM   1040 C  CD2 . HIS A 1 139 ? 7.000   -0.322  -13.205  1.00 24.08 ? 139 HIS A CD2 1 
ATOM   1041 C  CE1 . HIS A 1 139 ? 8.447   1.260   -12.852  1.00 26.13 ? 139 HIS A CE1 1 
ATOM   1042 N  NE2 . HIS A 1 139 ? 7.937   0.136   -12.417  1.00 27.69 ? 139 HIS A NE2 1 
ATOM   1043 N  N   . PHE A 1 140 ? 3.706   1.758   -17.038  1.00 27.80 ? 140 PHE A N   1 
ATOM   1044 C  CA  . PHE A 1 140 ? 3.050   2.022   -18.303  1.00 26.83 ? 140 PHE A CA  1 
ATOM   1045 C  C   . PHE A 1 140 ? 4.050   2.783   -19.137  1.00 23.47 ? 140 PHE A C   1 
ATOM   1046 O  O   . PHE A 1 140 ? 4.583   3.806   -18.687  1.00 21.66 ? 140 PHE A O   1 
ATOM   1047 C  CB  . PHE A 1 140 ? 1.860   2.907   -18.189  1.00 28.53 ? 140 PHE A CB  1 
ATOM   1048 C  CG  . PHE A 1 140 ? 1.106   3.087   -19.494  1.00 32.22 ? 140 PHE A CG  1 
ATOM   1049 C  CD1 . PHE A 1 140 ? 0.546   1.979   -20.143  1.00 31.08 ? 140 PHE A CD1 1 
ATOM   1050 C  CD2 . PHE A 1 140 ? 0.902   4.370   -19.995  1.00 32.93 ? 140 PHE A CD2 1 
ATOM   1051 C  CE1 . PHE A 1 140 ? -0.230  2.159   -21.285  1.00 27.23 ? 140 PHE A CE1 1 
ATOM   1052 C  CE2 . PHE A 1 140 ? 0.122   4.534   -21.140  1.00 34.77 ? 140 PHE A CE2 1 
ATOM   1053 C  CZ  . PHE A 1 140 ? -0.442  3.433   -21.777  1.00 27.91 ? 140 PHE A CZ  1 
ATOM   1054 N  N   . LEU A 1 141 ? 4.369   2.207   -20.308  1.00 19.11 ? 141 LEU A N   1 
ATOM   1055 C  CA  . LEU A 1 141 ? 5.291   2.769   -21.296  1.00 13.49 ? 141 LEU A CA  1 
ATOM   1056 C  C   . LEU A 1 141 ? 6.570   3.239   -20.679  1.00 15.84 ? 141 LEU A C   1 
ATOM   1057 O  O   . LEU A 1 141 ? 7.207   4.194   -21.171  1.00 14.60 ? 141 LEU A O   1 
ATOM   1058 C  CB  . LEU A 1 141 ? 4.652   3.949   -22.041  1.00 11.19 ? 141 LEU A CB  1 
ATOM   1059 C  CG  . LEU A 1 141 ? 3.357   3.679   -22.807  1.00 12.74 ? 141 LEU A CG  1 
ATOM   1060 C  CD1 . LEU A 1 141 ? 2.859   4.950   -23.447  1.00 17.15 ? 141 LEU A CD1 1 
ATOM   1061 C  CD2 . LEU A 1 141 ? 3.610   2.594   -23.839  1.00 14.01 ? 141 LEU A CD2 1 
ATOM   1062 N  N   . GLY A 1 142 ? 6.863   2.541   -19.551  1.00 16.85 ? 142 GLY A N   1 
ATOM   1063 C  CA  . GLY A 1 142 ? 8.045   2.758   -18.703  1.00 15.58 ? 142 GLY A CA  1 
ATOM   1064 C  C   . GLY A 1 142 ? 8.075   4.122   -18.027  1.00 9.89  ? 142 GLY A C   1 
ATOM   1065 O  O   . GLY A 1 142 ? 9.156   4.531   -17.612  1.00 10.22 ? 142 GLY A O   1 
ATOM   1066 N  N   . THR A 1 143 ? 6.970   4.855   -17.915  1.00 9.58  ? 143 THR A N   1 
ATOM   1067 C  CA  . THR A 1 143 ? 6.977   6.180   -17.312  1.00 18.47 ? 143 THR A CA  1 
ATOM   1068 C  C   . THR A 1 143 ? 6.030   6.279   -16.120  1.00 21.68 ? 143 THR A C   1 
ATOM   1069 O  O   . THR A 1 143 ? 6.411   6.885   -15.121  1.00 26.06 ? 143 THR A O   1 
ATOM   1070 C  CB  . THR A 1 143 ? 6.555   7.309   -18.292  1.00 16.70 ? 143 THR A CB  1 
ATOM   1071 O  OG1 . THR A 1 143 ? 5.235   7.017   -18.791  1.00 13.15 ? 143 THR A OG1 1 
ATOM   1072 C  CG2 . THR A 1 143 ? 7.556   7.452   -19.380  1.00 16.47 ? 143 THR A CG2 1 
ATOM   1073 N  N   . SER A 1 144 ? 4.786   5.825   -16.228  1.00 21.28 ? 144 SER A N   1 
ATOM   1074 C  CA  . SER A 1 144 ? 3.835   5.839   -15.114  1.00 25.64 ? 144 SER A CA  1 
ATOM   1075 C  C   . SER A 1 144 ? 3.834   7.135   -14.306  1.00 27.62 ? 144 SER A C   1 
ATOM   1076 O  O   . SER A 1 144 ? 4.097   7.166   -13.098  1.00 30.71 ? 144 SER A O   1 
ATOM   1077 C  CB  . SER A 1 144 ? 4.184   4.634   -14.252  1.00 28.21 ? 144 SER A CB  1 
ATOM   1078 O  OG  . SER A 1 144 ? 4.077   3.421   -15.000  1.00 23.95 ? 144 SER A OG  1 
ATOM   1079 N  N   . THR A 1 145 ? 3.648   8.256   -14.993  1.00 25.68 ? 145 THR A N   1 
ATOM   1080 C  CA  . THR A 1 145 ? 3.661   9.544   -14.343  1.00 17.69 ? 145 THR A CA  1 
ATOM   1081 C  C   . THR A 1 145 ? 2.388   9.775   -13.543  1.00 14.06 ? 145 THR A C   1 
ATOM   1082 O  O   . THR A 1 145 ? 2.300   10.798  -12.873  1.00 16.53 ? 145 THR A O   1 
ATOM   1083 C  CB  . THR A 1 145 ? 3.841   10.666  -15.409  1.00 11.09 ? 145 THR A CB  1 
ATOM   1084 O  OG1 . THR A 1 145 ? 2.762   10.546  -16.311  1.00 8.17  ? 145 THR A OG1 1 
ATOM   1085 C  CG2 . THR A 1 145 ? 5.106   10.588  -16.178  1.00 2.24  ? 145 THR A CG2 1 
ATOM   1086 N  N   . PHE A 1 146 ? 1.335   8.968   -13.565  1.00 14.00 ? 146 PHE A N   1 
ATOM   1087 C  CA  . PHE A 1 146 ? 0.143   9.277   -12.768  1.00 17.90 ? 146 PHE A CA  1 
ATOM   1088 C  C   . PHE A 1 146 ? 0.370   8.862   -11.292  1.00 20.82 ? 146 PHE A C   1 
ATOM   1089 O  O   . PHE A 1 146 ? -0.417  8.143   -10.663  1.00 21.96 ? 146 PHE A O   1 
ATOM   1090 C  CB  . PHE A 1 146 ? -1.039  8.526   -13.338  1.00 20.31 ? 146 PHE A CB  1 
ATOM   1091 C  CG  . PHE A 1 146 ? -1.784  9.093   -14.536  1.00 27.79 ? 146 PHE A CG  1 
ATOM   1092 C  CD1 . PHE A 1 146 ? -1.555  10.380  -15.033  1.00 25.67 ? 146 PHE A CD1 1 
ATOM   1093 C  CD2 . PHE A 1 146 ? -2.753  8.277   -15.146  1.00 30.23 ? 146 PHE A CD2 1 
ATOM   1094 C  CE1 . PHE A 1 146 ? -2.294  10.847  -16.126  1.00 25.90 ? 146 PHE A CE1 1 
ATOM   1095 C  CE2 . PHE A 1 146 ? -3.488  8.752   -16.237  1.00 29.28 ? 146 PHE A CE2 1 
ATOM   1096 C  CZ  . PHE A 1 146 ? -3.257  10.034  -16.729  1.00 26.92 ? 146 PHE A CZ  1 
ATOM   1097 N  N   . SER A 1 147 ? 1.449   9.336   -10.684  1.00 18.35 ? 147 SER A N   1 
ATOM   1098 C  CA  . SER A 1 147 ? 1.842   9.027   -9.348   1.00 19.16 ? 147 SER A CA  1 
ATOM   1099 C  C   . SER A 1 147 ? 2.683   10.207  -8.900   1.00 19.16 ? 147 SER A C   1 
ATOM   1100 O  O   . SER A 1 147 ? 3.269   10.885  -9.727   1.00 17.77 ? 147 SER A O   1 
ATOM   1101 C  CB  . SER A 1 147 ? 2.659   7.748   -9.371   1.00 19.18 ? 147 SER A CB  1 
ATOM   1102 O  OG  . SER A 1 147 ? 3.519   7.664   -8.239   1.00 20.44 ? 147 SER A OG  1 
ATOM   1103 N  N   . GLN A 1 148 ? 2.843   10.439  -7.599   1.00 20.62 ? 148 GLN A N   1 
ATOM   1104 C  CA  . GLN A 1 148 ? 3.636   11.557  -7.138   1.00 19.15 ? 148 GLN A CA  1 
ATOM   1105 C  C   . GLN A 1 148 ? 5.092   11.274  -7.339   1.00 16.76 ? 148 GLN A C   1 
ATOM   1106 O  O   . GLN A 1 148 ? 5.883   12.212  -7.355   1.00 19.05 ? 148 GLN A O   1 
ATOM   1107 C  CB  . GLN A 1 148 ? 3.384   11.829  -5.680   1.00 21.21 ? 148 GLN A CB  1 
ATOM   1108 C  CG  . GLN A 1 148 ? 1.908   12.101  -5.431   1.00 21.18 ? 148 GLN A CG  1 
ATOM   1109 C  CD  . GLN A 1 148 ? 1.646   12.459  -3.984   1.00 30.52 ? 148 GLN A CD  1 
ATOM   1110 O  OE1 . GLN A 1 148 ? 1.541   11.586  -3.128   1.00 32.08 ? 148 GLN A OE1 1 
ATOM   1111 N  NE2 . GLN A 1 148 ? 1.549   13.734  -3.641   1.00 36.44 ? 148 GLN A NE2 1 
ATOM   1112 N  N   . TYR A 1 149 ? 5.519   10.030  -7.503   1.00 16.56 ? 149 TYR A N   1 
ATOM   1113 C  CA  . TYR A 1 149 ? 6.921   9.764   -7.725   1.00 17.13 ? 149 TYR A CA  1 
ATOM   1114 C  C   . TYR A 1 149 ? 6.948   8.590   -8.663   1.00 18.74 ? 149 TYR A C   1 
ATOM   1115 O  O   . TYR A 1 149 ? 6.076   7.693   -8.584   1.00 17.10 ? 149 TYR A O   1 
ATOM   1116 C  CB  . TYR A 1 149 ? 7.674   9.357   -6.454   1.00 19.88 ? 149 TYR A CB  1 
ATOM   1117 C  CG  . TYR A 1 149 ? 7.991   10.514  -5.524   1.00 19.06 ? 149 TYR A CG  1 
ATOM   1118 C  CD1 . TYR A 1 149 ? 7.079   10.950  -4.547   1.00 18.47 ? 149 TYR A CD1 1 
ATOM   1119 C  CD2 . TYR A 1 149 ? 9.237   11.114  -5.650   1.00 22.83 ? 149 TYR A CD2 1 
ATOM   1120 C  CE1 . TYR A 1 149 ? 7.433   11.996  -3.694   1.00 17.23 ? 149 TYR A CE1 1 
ATOM   1121 C  CE2 . TYR A 1 149 ? 9.593   12.151  -4.794   1.00 24.24 ? 149 TYR A CE2 1 
ATOM   1122 C  CZ  . TYR A 1 149 ? 8.690   12.580  -3.822   1.00 24.45 ? 149 TYR A CZ  1 
ATOM   1123 O  OH  . TYR A 1 149 ? 9.104   13.573  -2.947   1.00 29.13 ? 149 TYR A OH  1 
ATOM   1124 N  N   . THR A 1 150 ? 7.938   8.589   -9.556   1.00 16.27 ? 150 THR A N   1 
ATOM   1125 C  CA  . THR A 1 150 ? 8.025   7.466   -10.459  1.00 16.87 ? 150 THR A CA  1 
ATOM   1126 C  C   . THR A 1 150 ? 9.462   7.267   -10.769  1.00 15.68 ? 150 THR A C   1 
ATOM   1127 O  O   . THR A 1 150 ? 10.294  8.126   -10.473  1.00 18.88 ? 150 THR A O   1 
ATOM   1128 C  CB  . THR A 1 150 ? 7.128   7.765   -11.703  1.00 18.66 ? 150 THR A CB  1 
ATOM   1129 O  OG1 . THR A 1 150 ? 6.911   6.508   -12.330  1.00 16.19 ? 150 THR A OG1 1 
ATOM   1130 C  CG2 . THR A 1 150 ? 7.690   8.837   -12.613  1.00 14.16 ? 150 THR A CG2 1 
ATOM   1131 N  N   . VAL A 1 151 ? 9.741   6.061   -11.225  1.00 20.39 ? 151 VAL A N   1 
ATOM   1132 C  CA  . VAL A 1 151 ? 11.112  5.676   -11.532  1.00 23.09 ? 151 VAL A CA  1 
ATOM   1133 C  C   . VAL A 1 151 ? 11.026  5.364   -13.025  1.00 23.82 ? 151 VAL A C   1 
ATOM   1134 O  O   . VAL A 1 151 ? 10.124  4.671   -13.540  1.00 25.75 ? 151 VAL A O   1 
ATOM   1135 C  CB  . VAL A 1 151 ? 11.574  4.401   -10.712  1.00 22.80 ? 151 VAL A CB  1 
ATOM   1136 C  CG1 . VAL A 1 151 ? 13.091  4.315   -10.639  1.00 10.57 ? 151 VAL A CG1 1 
ATOM   1137 C  CG2 . VAL A 1 151 ? 11.053  4.488   -9.287   1.00 20.23 ? 151 VAL A CG2 1 
ATOM   1138 N  N   . VAL A 1 152 ? 11.988  5.942   -13.708  1.00 22.95 ? 152 VAL A N   1 
ATOM   1139 C  CA  . VAL A 1 152 ? 12.099  5.882   -15.145  1.00 22.58 ? 152 VAL A CA  1 
ATOM   1140 C  C   . VAL A 1 152 ? 13.547  5.571   -15.524  1.00 23.33 ? 152 VAL A C   1 
ATOM   1141 O  O   . VAL A 1 152 ? 14.460  5.977   -14.794  1.00 23.43 ? 152 VAL A O   1 
ATOM   1142 C  CB  . VAL A 1 152 ? 11.622  7.259   -15.645  1.00 19.12 ? 152 VAL A CB  1 
ATOM   1143 C  CG1 . VAL A 1 152 ? 11.978  7.366   -17.099  1.00 19.14 ? 152 VAL A CG1 1 
ATOM   1144 C  CG2 . VAL A 1 152 ? 10.113  7.457   -15.465  1.00 16.34 ? 152 VAL A CG2 1 
ATOM   1145 N  N   . ASP A 1 153 ? 13.826  4.849   -16.611  1.00 22.73 ? 153 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 153 ? 15.191  4.587   -17.029  1.00 21.07 ? 153 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 153 ? 15.802  5.890   -17.457  1.00 20.73 ? 153 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 153 ? 15.061  6.782   -17.840  1.00 23.26 ? 153 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 153 ? 15.222  3.681   -18.192  1.00 19.35 ? 153 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 153 ? 14.991  2.269   -17.759  1.00 18.69 ? 153 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 153 ? 15.980  1.698   -17.295  1.00 19.29 ? 153 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 153 ? 13.859  1.776   -17.891  1.00 17.11 ? 153 ASP A OD2 1 
ATOM   1153 N  N   . GLU A 1 154 ? 17.118  6.017   -17.455  1.00 22.89 ? 154 GLU A N   1 
ATOM   1154 C  CA  . GLU A 1 154 ? 17.826  7.232   -17.818  1.00 23.07 ? 154 GLU A CA  1 
ATOM   1155 C  C   . GLU A 1 154 ? 17.560  7.579   -19.278  1.00 26.24 ? 154 GLU A C   1 
ATOM   1156 O  O   . GLU A 1 154 ? 17.142  8.698   -19.600  1.00 32.19 ? 154 GLU A O   1 
ATOM   1157 C  CB  . GLU A 1 154 ? 19.314  7.022   -17.595  1.00 21.60 ? 154 GLU A CB  1 
ATOM   1158 C  CG  . GLU A 1 154 ? 20.131  8.309   -17.677  1.00 17.99 ? 154 GLU A CG  1 
ATOM   1159 C  CD  . GLU A 1 154 ? 21.636  8.152   -17.547  1.00 20.05 ? 154 GLU A CD  1 
ATOM   1160 O  OE1 . GLU A 1 154 ? 22.175  7.041   -17.540  1.00 23.59 ? 154 GLU A OE1 1 
ATOM   1161 O  OE2 . GLU A 1 154 ? 22.308  9.173   -17.463  1.00 25.44 ? 154 GLU A OE2 1 
ATOM   1162 N  N   . ASN A 1 155 ? 17.703  6.603   -20.179  1.00 21.00 ? 155 ASN A N   1 
ATOM   1163 C  CA  . ASN A 1 155 ? 17.452  6.834   -21.596  1.00 19.44 ? 155 ASN A CA  1 
ATOM   1164 C  C   . ASN A 1 155 ? 16.011  7.246   -21.907  1.00 20.98 ? 155 ASN A C   1 
ATOM   1165 O  O   . ASN A 1 155 ? 15.698  7.636   -23.033  1.00 25.63 ? 155 ASN A O   1 
ATOM   1166 C  CB  . ASN A 1 155 ? 17.797  5.585   -22.384  1.00 16.90 ? 155 ASN A CB  1 
ATOM   1167 C  CG  . ASN A 1 155 ? 16.957  4.370   -22.080  1.00 15.85 ? 155 ASN A CG  1 
ATOM   1168 O  OD1 . ASN A 1 155 ? 15.816  4.444   -21.650  1.00 19.79 ? 155 ASN A OD1 1 
ATOM   1169 N  ND2 . ASN A 1 155 ? 17.498  3.190   -22.292  1.00 18.95 ? 155 ASN A ND2 1 
ATOM   1170 N  N   . ALA A 1 156 ? 15.081  7.110   -20.962  1.00 16.23 ? 156 ALA A N   1 
ATOM   1171 C  CA  . ALA A 1 156 ? 13.728  7.525   -21.153  1.00 8.43  ? 156 ALA A CA  1 
ATOM   1172 C  C   . ALA A 1 156 ? 13.489  8.821   -20.414  1.00 8.40  ? 156 ALA A C   1 
ATOM   1173 O  O   . ALA A 1 156 ? 12.332  9.105   -20.101  1.00 9.81  ? 156 ALA A O   1 
ATOM   1174 C  CB  . ALA A 1 156 ? 12.784  6.486   -20.633  1.00 10.47 ? 156 ALA A CB  1 
ATOM   1175 N  N   . VAL A 1 157 ? 14.480  9.678   -20.126  1.00 10.64 ? 157 VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 157 ? 14.198  10.919  -19.419  1.00 12.65 ? 157 VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 157 ? 15.063  12.031  -20.007  1.00 15.55 ? 157 VAL A C   1 
ATOM   1178 O  O   . VAL A 1 157 ? 16.253  11.866  -20.317  1.00 7.41  ? 157 VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 157 ? 14.460  10.714  -17.857  1.00 19.25 ? 157 VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 157 ? 15.902  10.943  -17.448  1.00 17.23 ? 157 VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 157 ? 13.648  11.721  -17.077  1.00 19.21 ? 157 VAL A CG2 1 
ATOM   1182 N  N   . ALA A 1 158 ? 14.422  13.202  -20.164  1.00 20.22 ? 158 ALA A N   1 
ATOM   1183 C  CA  . ALA A 1 158 ? 15.078  14.373  -20.717  1.00 19.81 ? 158 ALA A CA  1 
ATOM   1184 C  C   . ALA A 1 158 ? 15.226  15.549  -19.741  1.00 17.14 ? 158 ALA A C   1 
ATOM   1185 O  O   . ALA A 1 158 ? 14.255  15.985  -19.136  1.00 13.86 ? 158 ALA A O   1 
ATOM   1186 C  CB  . ALA A 1 158 ? 14.291  14.857  -21.936  1.00 19.41 ? 158 ALA A CB  1 
ATOM   1187 N  N   . LYS A 1 159 ? 16.409  16.117  -19.602  1.00 18.86 ? 159 LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 159 ? 16.633  17.255  -18.750  1.00 26.10 ? 159 LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 159 ? 16.245  18.450  -19.595  1.00 28.24 ? 159 LYS A C   1 
ATOM   1190 O  O   . LYS A 1 159 ? 16.722  18.576  -20.732  1.00 30.20 ? 159 LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 159 ? 18.111  17.375  -18.354  1.00 30.36 ? 159 LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 159 ? 18.320  18.557  -17.413  1.00 35.94 ? 159 LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 159 ? 19.804  18.806  -17.146  1.00 42.07 ? 159 LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 159 ? 20.269  20.172  -17.685  1.00 47.67 ? 159 LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 159 ? 19.426  21.279  -17.245  1.00 49.17 ? 159 LYS A NZ  1 
ATOM   1196 N  N   . ILE A 1 160 ? 15.396  19.316  -19.065  1.00 26.93 ? 160 ILE A N   1 
ATOM   1197 C  CA  . ILE A 1 160 ? 14.958  20.492  -19.794  1.00 27.07 ? 160 ILE A CA  1 
ATOM   1198 C  C   . ILE A 1 160 ? 15.384  21.773  -19.084  1.00 32.90 ? 160 ILE A C   1 
ATOM   1199 O  O   . ILE A 1 160 ? 15.939  21.715  -17.982  1.00 39.33 ? 160 ILE A O   1 
ATOM   1200 C  CB  . ILE A 1 160 ? 13.436  20.438  -19.975  1.00 19.85 ? 160 ILE A CB  1 
ATOM   1201 C  CG1 . ILE A 1 160 ? 12.711  20.367  -18.665  1.00 8.34  ? 160 ILE A CG1 1 
ATOM   1202 C  CG2 . ILE A 1 160 ? 13.144  19.236  -20.880  1.00 15.20 ? 160 ILE A CG2 1 
ATOM   1203 C  CD1 . ILE A 1 160 ? 11.185  20.553  -18.738  1.00 8.02  ? 160 ILE A CD1 1 
ATOM   1204 N  N   . ASP A 1 161 ? 15.125  22.953  -19.655  1.00 35.01 ? 161 ASP A N   1 
ATOM   1205 C  CA  . ASP A 1 161 ? 15.540  24.243  -19.115  1.00 36.07 ? 161 ASP A CA  1 
ATOM   1206 C  C   . ASP A 1 161 ? 15.130  24.463  -17.667  1.00 33.19 ? 161 ASP A C   1 
ATOM   1207 O  O   . ASP A 1 161 ? 13.974  24.293  -17.332  1.00 31.56 ? 161 ASP A O   1 
ATOM   1208 C  CB  . ASP A 1 161 ? 14.959  25.349  -20.018  1.00 43.08 ? 161 ASP A CB  1 
ATOM   1209 C  CG  . ASP A 1 161 ? 15.441  26.792  -19.807  1.00 51.66 ? 161 ASP A CG  1 
ATOM   1210 O  OD1 . ASP A 1 161 ? 16.586  27.021  -19.407  1.00 59.28 ? 161 ASP A OD1 1 
ATOM   1211 O  OD2 . ASP A 1 161 ? 14.662  27.709  -20.062  1.00 53.42 ? 161 ASP A OD2 1 
ATOM   1212 N  N   . ALA A 1 162 ? 16.015  24.872  -16.759  1.00 32.03 ? 162 ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 162 ? 15.643  25.073  -15.357  1.00 28.71 ? 162 ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 162 ? 14.522  26.070  -15.160  1.00 29.23 ? 162 ALA A C   1 
ATOM   1215 O  O   . ALA A 1 162 ? 13.799  26.023  -14.179  1.00 29.36 ? 162 ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 162 ? 16.812  25.572  -14.562  1.00 23.55 ? 162 ALA A CB  1 
ATOM   1217 N  N   . ALA A 1 163 ? 14.357  26.975  -16.121  1.00 29.04 ? 163 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 163 ? 13.316  27.953  -16.025  1.00 27.26 ? 163 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 163 ? 12.055  27.482  -16.724  1.00 30.03 ? 163 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 163 ? 11.111  28.260  -16.869  1.00 32.84 ? 163 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 163 ? 13.823  29.213  -16.644  1.00 30.73 ? 163 ALA A CB  1 
ATOM   1222 N  N   . SER A 1 164 ? 11.950  26.217  -17.137  1.00 30.72 ? 164 SER A N   1 
ATOM   1223 C  CA  . SER A 1 164 ? 10.762  25.760  -17.829  1.00 28.77 ? 164 SER A CA  1 
ATOM   1224 C  C   . SER A 1 164 ? 9.506   25.813  -16.969  1.00 28.69 ? 164 SER A C   1 
ATOM   1225 O  O   . SER A 1 164 ? 9.541   25.340  -15.834  1.00 29.34 ? 164 SER A O   1 
ATOM   1226 C  CB  . SER A 1 164 ? 10.915  24.330  -18.288  1.00 26.82 ? 164 SER A CB  1 
ATOM   1227 O  OG  . SER A 1 164 ? 12.100  24.016  -18.993  1.00 29.59 ? 164 SER A OG  1 
ATOM   1228 N  N   . PRO A 1 165 ? 8.354   26.335  -17.421  1.00 27.49 ? 165 PRO A N   1 
ATOM   1229 C  CA  . PRO A 1 165 ? 7.100   26.242  -16.665  1.00 24.22 ? 165 PRO A CA  1 
ATOM   1230 C  C   . PRO A 1 165 ? 6.558   24.825  -16.779  1.00 25.33 ? 165 PRO A C   1 
ATOM   1231 O  O   . PRO A 1 165 ? 5.820   24.464  -17.707  1.00 28.21 ? 165 PRO A O   1 
ATOM   1232 C  CB  . PRO A 1 165 ? 6.193   27.319  -17.273  1.00 20.09 ? 165 PRO A CB  1 
ATOM   1233 C  CG  . PRO A 1 165 ? 6.766   27.484  -18.667  1.00 18.05 ? 165 PRO A CG  1 
ATOM   1234 C  CD  . PRO A 1 165 ? 8.266   27.288  -18.525  1.00 19.03 ? 165 PRO A CD  1 
ATOM   1235 N  N   . LEU A 1 166 ? 6.844   23.978  -15.799  1.00 26.51 ? 166 LEU A N   1 
ATOM   1236 C  CA  . LEU A 1 166 ? 6.426   22.570  -15.826  1.00 21.83 ? 166 LEU A CA  1 
ATOM   1237 C  C   . LEU A 1 166 ? 4.957   22.271  -16.003  1.00 20.52 ? 166 LEU A C   1 
ATOM   1238 O  O   . LEU A 1 166 ? 4.605   21.187  -16.454  1.00 18.55 ? 166 LEU A O   1 
ATOM   1239 C  CB  . LEU A 1 166 ? 6.912   21.883  -14.560  1.00 14.39 ? 166 LEU A CB  1 
ATOM   1240 C  CG  . LEU A 1 166 ? 8.400   21.992  -14.312  1.00 14.41 ? 166 LEU A CG  1 
ATOM   1241 C  CD1 . LEU A 1 166 ? 8.782   21.069  -13.199  1.00 15.74 ? 166 LEU A CD1 1 
ATOM   1242 C  CD2 . LEU A 1 166 ? 9.183   21.594  -15.543  1.00 17.79 ? 166 LEU A CD2 1 
ATOM   1243 N  N   . GLU A 1 167 ? 4.086   23.252  -15.791  1.00 21.85 ? 167 GLU A N   1 
ATOM   1244 C  CA  . GLU A 1 167 ? 2.640   23.017  -15.910  1.00 23.42 ? 167 GLU A CA  1 
ATOM   1245 C  C   . GLU A 1 167 ? 2.100   23.331  -17.294  1.00 22.23 ? 167 GLU A C   1 
ATOM   1246 O  O   . GLU A 1 167 ? 0.907   23.204  -17.560  1.00 25.47 ? 167 GLU A O   1 
ATOM   1247 C  CB  . GLU A 1 167 ? 1.824   23.850  -14.905  1.00 26.96 ? 167 GLU A CB  1 
ATOM   1248 C  CG  . GLU A 1 167 ? 2.557   24.415  -13.687  1.00 39.43 ? 167 GLU A CG  1 
ATOM   1249 C  CD  . GLU A 1 167 ? 3.521   25.552  -14.038  1.00 49.07 ? 167 GLU A CD  1 
ATOM   1250 O  OE1 . GLU A 1 167 ? 3.102   26.538  -14.669  1.00 50.12 ? 167 GLU A OE1 1 
ATOM   1251 O  OE2 . GLU A 1 167 ? 4.703   25.422  -13.698  1.00 51.24 ? 167 GLU A OE2 1 
ATOM   1252 N  N   . LYS A 1 168 ? 3.013   23.788  -18.155  1.00 22.91 ? 168 LYS A N   1 
ATOM   1253 C  CA  . LYS A 1 168 ? 2.799   24.138  -19.553  1.00 18.18 ? 168 LYS A CA  1 
ATOM   1254 C  C   . LYS A 1 168 ? 3.648   23.113  -20.312  1.00 17.62 ? 168 LYS A C   1 
ATOM   1255 O  O   . LYS A 1 168 ? 3.170   22.244  -21.034  1.00 19.95 ? 168 LYS A O   1 
ATOM   1256 C  CB  . LYS A 1 168 ? 3.323   25.553  -19.822  1.00 16.51 ? 168 LYS A CB  1 
ATOM   1257 C  CG  . LYS A 1 168 ? 2.135   26.436  -19.957  1.00 25.49 ? 168 LYS A CG  1 
ATOM   1258 C  CD  . LYS A 1 168 ? 2.226   27.601  -18.995  1.00 32.74 ? 168 LYS A CD  1 
ATOM   1259 C  CE  . LYS A 1 168 ? 0.885   28.344  -18.980  1.00 37.42 ? 168 LYS A CE  1 
ATOM   1260 N  NZ  . LYS A 1 168 ? -0.219  27.453  -18.650  1.00 38.88 ? 168 LYS A NZ  1 
ATOM   1261 N  N   . VAL A 1 169 ? 4.955   23.141  -20.105  1.00 13.91 ? 169 VAL A N   1 
ATOM   1262 C  CA  . VAL A 1 169 ? 5.858   22.222  -20.740  1.00 15.56 ? 169 VAL A CA  1 
ATOM   1263 C  C   . VAL A 1 169 ? 5.565   20.718  -20.629  1.00 20.15 ? 169 VAL A C   1 
ATOM   1264 O  O   . VAL A 1 169 ? 6.082   19.952  -21.451  1.00 25.03 ? 169 VAL A O   1 
ATOM   1265 C  CB  . VAL A 1 169 ? 7.190   22.667  -20.177  1.00 13.61 ? 169 VAL A CB  1 
ATOM   1266 C  CG1 . VAL A 1 169 ? 8.140   21.568  -19.841  1.00 15.28 ? 169 VAL A CG1 1 
ATOM   1267 C  CG2 . VAL A 1 169 ? 7.782   23.538  -21.264  1.00 17.39 ? 169 VAL A CG2 1 
ATOM   1268 N  N   . CYS A 1 170 ? 4.750   20.177  -19.724  1.00 18.62 ? 170 CYS A N   1 
ATOM   1269 C  CA  . CYS A 1 170 ? 4.548   18.747  -19.730  1.00 17.70 ? 170 CYS A CA  1 
ATOM   1270 C  C   . CYS A 1 170 ? 3.903   18.256  -21.034  1.00 20.12 ? 170 CYS A C   1 
ATOM   1271 O  O   . CYS A 1 170 ? 4.074   17.101  -21.453  1.00 21.31 ? 170 CYS A O   1 
ATOM   1272 C  CB  . CYS A 1 170 ? 3.688   18.381  -18.546  1.00 10.90 ? 170 CYS A CB  1 
ATOM   1273 S  SG  . CYS A 1 170 ? 2.115   19.216  -18.615  1.00 12.23 ? 170 CYS A SG  1 
ATOM   1274 N  N   . LEU A 1 171 ? 3.170   19.140  -21.729  1.00 20.24 ? 171 LEU A N   1 
ATOM   1275 C  CA  . LEU A 1 171 ? 2.514   18.817  -22.989  1.00 18.10 ? 171 LEU A CA  1 
ATOM   1276 C  C   . LEU A 1 171 ? 3.497   18.343  -24.064  1.00 15.39 ? 171 LEU A C   1 
ATOM   1277 O  O   . LEU A 1 171 ? 3.212   17.427  -24.843  1.00 20.49 ? 171 LEU A O   1 
ATOM   1278 C  CB  . LEU A 1 171 ? 1.773   20.039  -23.448  1.00 14.71 ? 171 LEU A CB  1 
ATOM   1279 C  CG  . LEU A 1 171 ? 0.418   20.223  -22.908  1.00 11.98 ? 171 LEU A CG  1 
ATOM   1280 C  CD1 . LEU A 1 171 ? -0.365  21.264  -23.660  1.00 18.85 ? 171 LEU A CD1 1 
ATOM   1281 C  CD2 . LEU A 1 171 ? -0.344  19.011  -23.225  1.00 18.98 ? 171 LEU A CD2 1 
ATOM   1282 N  N   . ILE A 1 172 ? 4.676   18.931  -24.087  1.00 9.30  ? 172 ILE A N   1 
ATOM   1283 C  CA  . ILE A 1 172 ? 5.747   18.558  -24.975  1.00 7.90  ? 172 ILE A CA  1 
ATOM   1284 C  C   . ILE A 1 172 ? 6.197   17.117  -24.709  1.00 16.47 ? 172 ILE A C   1 
ATOM   1285 O  O   . ILE A 1 172 ? 6.943   16.547  -25.509  1.00 18.93 ? 172 ILE A O   1 
ATOM   1286 C  CB  . ILE A 1 172 ? 6.905   19.538  -24.742  1.00 2.00  ? 172 ILE A CB  1 
ATOM   1287 C  CG1 . ILE A 1 172 ? 6.406   20.942  -25.063  1.00 6.72  ? 172 ILE A CG1 1 
ATOM   1288 C  CG2 . ILE A 1 172 ? 8.110   19.240  -25.635  1.00 6.17  ? 172 ILE A CG2 1 
ATOM   1289 C  CD1 . ILE A 1 172 ? 7.494   22.026  -24.917  1.00 6.95  ? 172 ILE A CD1 1 
ATOM   1290 N  N   . GLY A 1 173 ? 5.790   16.439  -23.630  1.00 20.40 ? 173 GLY A N   1 
ATOM   1291 C  CA  . GLY A 1 173 ? 6.258   15.079  -23.361  1.00 20.69 ? 173 GLY A CA  1 
ATOM   1292 C  C   . GLY A 1 173 ? 5.620   14.006  -24.221  1.00 19.33 ? 173 GLY A C   1 
ATOM   1293 O  O   . GLY A 1 173 ? 6.114   12.887  -24.332  1.00 15.20 ? 173 GLY A O   1 
ATOM   1294 N  N   . CYS A 1 174 ? 4.455   14.350  -24.768  1.00 21.36 ? 174 CYS A N   1 
ATOM   1295 C  CA  . CYS A 1 174 ? 3.744   13.449  -25.634  1.00 21.67 ? 174 CYS A CA  1 
ATOM   1296 C  C   . CYS A 1 174 ? 2.893   14.260  -26.601  1.00 22.89 ? 174 CYS A C   1 
ATOM   1297 O  O   . CYS A 1 174 ? 3.380   14.563  -27.683  1.00 27.38 ? 174 CYS A O   1 
ATOM   1298 C  CB  . CYS A 1 174 ? 2.840   12.476  -24.847  1.00 20.55 ? 174 CYS A CB  1 
ATOM   1299 S  SG  . CYS A 1 174 ? 1.815   11.563  -26.025  1.00 17.04 ? 174 CYS A SG  1 
ATOM   1300 N  N   . GLY A 1 175 ? 1.702   14.736  -26.231  1.00 23.49 ? 175 GLY A N   1 
ATOM   1301 C  CA  . GLY A 1 175 ? 0.739   15.426  -27.090  1.00 22.72 ? 175 GLY A CA  1 
ATOM   1302 C  C   . GLY A 1 175 ? 1.239   16.474  -28.072  1.00 22.40 ? 175 GLY A C   1 
ATOM   1303 O  O   . GLY A 1 175 ? 1.002   16.367  -29.270  1.00 17.22 ? 175 GLY A O   1 
ATOM   1304 N  N   . PHE A 1 176 ? 1.958   17.487  -27.616  1.00 23.49 ? 176 PHE A N   1 
ATOM   1305 C  CA  . PHE A 1 176 ? 2.384   18.501  -28.537  1.00 23.96 ? 176 PHE A CA  1 
ATOM   1306 C  C   . PHE A 1 176 ? 3.441   17.989  -29.482  1.00 24.94 ? 176 PHE A C   1 
ATOM   1307 O  O   . PHE A 1 176 ? 3.224   18.083  -30.691  1.00 28.08 ? 176 PHE A O   1 
ATOM   1308 C  CB  . PHE A 1 176 ? 2.919   19.732  -27.779  1.00 21.76 ? 176 PHE A CB  1 
ATOM   1309 C  CG  . PHE A 1 176 ? 3.444   20.790  -28.743  1.00 15.91 ? 176 PHE A CG  1 
ATOM   1310 C  CD1 . PHE A 1 176 ? 2.548   21.618  -29.443  1.00 17.63 ? 176 PHE A CD1 1 
ATOM   1311 C  CD2 . PHE A 1 176 ? 4.813   20.875  -28.990  1.00 13.25 ? 176 PHE A CD2 1 
ATOM   1312 C  CE1 . PHE A 1 176 ? 3.031   22.520  -30.404  1.00 5.23  ? 176 PHE A CE1 1 
ATOM   1313 C  CE2 . PHE A 1 176 ? 5.282   21.776  -29.949  1.00 14.86 ? 176 PHE A CE2 1 
ATOM   1314 C  CZ  . PHE A 1 176 ? 4.392   22.589  -30.648  1.00 10.74 ? 176 PHE A CZ  1 
ATOM   1315 N  N   . SER A 1 177 ? 4.551   17.432  -29.002  1.00 21.65 ? 177 SER A N   1 
ATOM   1316 C  CA  . SER A 1 177 ? 5.614   16.991  -29.886  1.00 21.31 ? 177 SER A CA  1 
ATOM   1317 C  C   . SER A 1 177 ? 5.134   15.908  -30.831  1.00 20.39 ? 177 SER A C   1 
ATOM   1318 O  O   . SER A 1 177 ? 5.675   15.786  -31.925  1.00 22.63 ? 177 SER A O   1 
ATOM   1319 C  CB  . SER A 1 177 ? 6.802   16.510  -29.041  1.00 13.03 ? 177 SER A CB  1 
ATOM   1320 O  OG  . SER A 1 177 ? 6.219   15.747  -28.029  1.00 24.04 ? 177 SER A OG  1 
ATOM   1321 N  N   . THR A 1 178 ? 4.109   15.150  -30.454  1.00 18.30 ? 178 THR A N   1 
ATOM   1322 C  CA  . THR A 1 178 ? 3.571   14.152  -31.336  1.00 20.03 ? 178 THR A CA  1 
ATOM   1323 C  C   . THR A 1 178 ? 2.882   14.901  -32.461  1.00 24.96 ? 178 THR A C   1 
ATOM   1324 O  O   . THR A 1 178 ? 3.384   14.795  -33.587  1.00 27.71 ? 178 THR A O   1 
ATOM   1325 C  CB  . THR A 1 178 ? 2.558   13.235  -30.623  1.00 19.36 ? 178 THR A CB  1 
ATOM   1326 O  OG1 . THR A 1 178 ? 3.306   12.418  -29.715  1.00 22.96 ? 178 THR A OG1 1 
ATOM   1327 C  CG2 . THR A 1 178 ? 1.805   12.312  -31.578  1.00 18.76 ? 178 THR A CG2 1 
ATOM   1328 N  N   . GLY A 1 179 ? 1.843   15.722  -32.191  1.00 23.91 ? 179 GLY A N   1 
ATOM   1329 C  CA  . GLY A 1 179 ? 1.084   16.440  -33.196  1.00 18.63 ? 179 GLY A CA  1 
ATOM   1330 C  C   . GLY A 1 179 ? 1.941   17.269  -34.130  1.00 16.16 ? 179 GLY A C   1 
ATOM   1331 O  O   . GLY A 1 179 ? 2.032   17.047  -35.337  1.00 18.94 ? 179 GLY A O   1 
ATOM   1332 N  N   . TYR A 1 180 ? 2.685   18.158  -33.536  1.00 17.23 ? 180 TYR A N   1 
ATOM   1333 C  CA  . TYR A 1 180 ? 3.531   19.056  -34.283  1.00 20.16 ? 180 TYR A CA  1 
ATOM   1334 C  C   . TYR A 1 180 ? 4.589   18.359  -35.116  1.00 25.17 ? 180 TYR A C   1 
ATOM   1335 O  O   . TYR A 1 180 ? 4.837   18.793  -36.247  1.00 32.32 ? 180 TYR A O   1 
ATOM   1336 C  CB  . TYR A 1 180 ? 4.143   19.987  -33.293  1.00 10.64 ? 180 TYR A CB  1 
ATOM   1337 C  CG  . TYR A 1 180 ? 4.990   21.127  -33.804  1.00 7.82  ? 180 TYR A CG  1 
ATOM   1338 C  CD1 . TYR A 1 180 ? 4.417   22.364  -34.120  1.00 4.86  ? 180 TYR A CD1 1 
ATOM   1339 C  CD2 . TYR A 1 180 ? 6.366   20.928  -33.893  1.00 8.68  ? 180 TYR A CD2 1 
ATOM   1340 C  CE1 . TYR A 1 180 ? 5.243   23.404  -34.522  1.00 2.00  ? 180 TYR A CE1 1 
ATOM   1341 C  CE2 . TYR A 1 180 ? 7.199   21.966  -34.292  1.00 9.04  ? 180 TYR A CE2 1 
ATOM   1342 C  CZ  . TYR A 1 180 ? 6.625   23.202  -34.603  1.00 14.00 ? 180 TYR A CZ  1 
ATOM   1343 O  OH  . TYR A 1 180 ? 7.471   24.253  -34.972  1.00 23.03 ? 180 TYR A OH  1 
ATOM   1344 N  N   . GLY A 1 181 ? 5.224   17.297  -34.621  1.00 23.22 ? 181 GLY A N   1 
ATOM   1345 C  CA  . GLY A 1 181 ? 6.243   16.593  -35.350  1.00 15.79 ? 181 GLY A CA  1 
ATOM   1346 C  C   . GLY A 1 181 ? 5.598   15.770  -36.429  1.00 16.43 ? 181 GLY A C   1 
ATOM   1347 O  O   . GLY A 1 181 ? 6.224   15.526  -37.454  1.00 21.62 ? 181 GLY A O   1 
ATOM   1348 N  N   . SER A 1 182 ? 4.349   15.368  -36.294  1.00 13.16 ? 182 SER A N   1 
ATOM   1349 C  CA  . SER A 1 182 ? 3.691   14.583  -37.305  1.00 13.28 ? 182 SER A CA  1 
ATOM   1350 C  C   . SER A 1 182 ? 3.667   15.308  -38.635  1.00 19.38 ? 182 SER A C   1 
ATOM   1351 O  O   . SER A 1 182 ? 3.931   14.719  -39.680  1.00 17.92 ? 182 SER A O   1 
ATOM   1352 C  CB  . SER A 1 182 ? 2.300   14.308  -36.906  1.00 7.62  ? 182 SER A CB  1 
ATOM   1353 O  OG  . SER A 1 182 ? 2.364   13.453  -35.785  1.00 21.34 ? 182 SER A OG  1 
ATOM   1354 N  N   . ALA A 1 183 ? 3.433   16.614  -38.563  1.00 22.16 ? 183 ALA A N   1 
ATOM   1355 C  CA  . ALA A 1 183 ? 3.368   17.488  -39.698  1.00 18.82 ? 183 ALA A CA  1 
ATOM   1356 C  C   . ALA A 1 183 ? 4.770   17.884  -40.074  1.00 19.66 ? 183 ALA A C   1 
ATOM   1357 O  O   . ALA A 1 183 ? 5.261   17.481  -41.120  1.00 27.15 ? 183 ALA A O   1 
ATOM   1358 C  CB  . ALA A 1 183 ? 2.550   18.675  -39.297  1.00 21.62 ? 183 ALA A CB  1 
ATOM   1359 N  N   . VAL A 1 184 ? 5.489   18.599  -39.245  1.00 19.34 ? 184 VAL A N   1 
ATOM   1360 C  CA  . VAL A 1 184 ? 6.836   19.051  -39.523  1.00 19.10 ? 184 VAL A CA  1 
ATOM   1361 C  C   . VAL A 1 184 ? 7.913   18.009  -39.829  1.00 22.81 ? 184 VAL A C   1 
ATOM   1362 O  O   . VAL A 1 184 ? 8.816   18.305  -40.618  1.00 26.46 ? 184 VAL A O   1 
ATOM   1363 C  CB  . VAL A 1 184 ? 7.153   19.953  -38.301  1.00 21.38 ? 184 VAL A CB  1 
ATOM   1364 C  CG1 . VAL A 1 184 ? 8.619   20.217  -38.165  1.00 19.16 ? 184 VAL A CG1 1 
ATOM   1365 C  CG2 . VAL A 1 184 ? 6.490   21.315  -38.491  1.00 23.18 ? 184 VAL A CG2 1 
ATOM   1366 N  N   . ASN A 1 185 ? 7.894   16.805  -39.243  1.00 23.38 ? 185 ASN A N   1 
ATOM   1367 C  CA  . ASN A 1 185 ? 8.939   15.796  -39.482  1.00 20.92 ? 185 ASN A CA  1 
ATOM   1368 C  C   . ASN A 1 185 ? 8.428   14.535  -40.121  1.00 18.91 ? 185 ASN A C   1 
ATOM   1369 O  O   . ASN A 1 185 ? 9.120   13.945  -40.938  1.00 23.33 ? 185 ASN A O   1 
ATOM   1370 C  CB  . ASN A 1 185 ? 9.626   15.209  -38.272  1.00 22.03 ? 185 ASN A CB  1 
ATOM   1371 C  CG  . ASN A 1 185 ? 10.287  16.147  -37.297  1.00 25.37 ? 185 ASN A CG  1 
ATOM   1372 O  OD1 . ASN A 1 185 ? 11.161  16.954  -37.619  1.00 25.45 ? 185 ASN A OD1 1 
ATOM   1373 N  ND2 . ASN A 1 185 ? 9.867   16.019  -36.046  1.00 25.30 ? 185 ASN A ND2 1 
ATOM   1374 N  N   . VAL A 1 186 ? 7.259   14.049  -39.764  1.00 13.52 ? 186 VAL A N   1 
ATOM   1375 C  CA  . VAL A 1 186 ? 6.821   12.827  -40.361  1.00 17.13 ? 186 VAL A CA  1 
ATOM   1376 C  C   . VAL A 1 186 ? 6.333   13.086  -41.785  1.00 21.32 ? 186 VAL A C   1 
ATOM   1377 O  O   . VAL A 1 186 ? 6.967   12.614  -42.723  1.00 20.37 ? 186 VAL A O   1 
ATOM   1378 C  CB  . VAL A 1 186 ? 5.706   12.170  -39.483  1.00 12.79 ? 186 VAL A CB  1 
ATOM   1379 C  CG1 . VAL A 1 186 ? 5.277   10.831  -40.050  1.00 10.18 ? 186 VAL A CG1 1 
ATOM   1380 C  CG2 . VAL A 1 186 ? 6.271   11.834  -38.104  1.00 22.66 ? 186 VAL A CG2 1 
ATOM   1381 N  N   . ALA A 1 187 ? 5.222   13.815  -41.959  1.00 18.75 ? 187 ALA A N   1 
ATOM   1382 C  CA  . ALA A 1 187 ? 4.673   14.071  -43.255  1.00 18.08 ? 187 ALA A CA  1 
ATOM   1383 C  C   . ALA A 1 187 ? 5.488   15.114  -43.995  1.00 22.11 ? 187 ALA A C   1 
ATOM   1384 O  O   . ALA A 1 187 ? 5.429   15.184  -45.215  1.00 27.75 ? 187 ALA A O   1 
ATOM   1385 C  CB  . ALA A 1 187 ? 3.249   14.543  -43.124  1.00 8.02  ? 187 ALA A CB  1 
ATOM   1386 N  N   . LYS A 1 188 ? 6.296   15.907  -43.322  1.00 21.15 ? 188 LYS A N   1 
ATOM   1387 C  CA  . LYS A 1 188 ? 7.097   16.917  -43.953  1.00 20.44 ? 188 LYS A CA  1 
ATOM   1388 C  C   . LYS A 1 188 ? 6.293   17.837  -44.848  1.00 19.15 ? 188 LYS A C   1 
ATOM   1389 O  O   . LYS A 1 188 ? 6.687   18.104  -45.973  1.00 22.50 ? 188 LYS A O   1 
ATOM   1390 C  CB  . LYS A 1 188 ? 8.224   16.273  -44.754  1.00 26.81 ? 188 LYS A CB  1 
ATOM   1391 C  CG  . LYS A 1 188 ? 9.204   15.482  -43.900  1.00 32.09 ? 188 LYS A CG  1 
ATOM   1392 C  CD  . LYS A 1 188 ? 10.607  16.064  -43.975  1.00 35.44 ? 188 LYS A CD  1 
ATOM   1393 C  CE  . LYS A 1 188 ? 11.589  14.921  -43.660  1.00 42.64 ? 188 LYS A CE  1 
ATOM   1394 N  NZ  . LYS A 1 188 ? 12.980  15.345  -43.772  1.00 43.92 ? 188 LYS A NZ  1 
ATOM   1395 N  N   . VAL A 1 189 ? 5.145   18.312  -44.322  1.00 17.27 ? 189 VAL A N   1 
ATOM   1396 C  CA  . VAL A 1 189 ? 4.247   19.265  -44.958  1.00 13.66 ? 189 VAL A CA  1 
ATOM   1397 C  C   . VAL A 1 189 ? 5.058   20.356  -45.662  1.00 21.40 ? 189 VAL A C   1 
ATOM   1398 O  O   . VAL A 1 189 ? 6.098   20.836  -45.186  1.00 22.67 ? 189 VAL A O   1 
ATOM   1399 C  CB  . VAL A 1 189 ? 3.340   19.827  -43.876  1.00 8.97  ? 189 VAL A CB  1 
ATOM   1400 C  CG1 . VAL A 1 189 ? 2.553   21.065  -44.262  1.00 11.02 ? 189 VAL A CG1 1 
ATOM   1401 C  CG2 . VAL A 1 189 ? 2.261   18.792  -43.675  1.00 5.04  ? 189 VAL A CG2 1 
ATOM   1402 N  N   . THR A 1 190 ? 4.595   20.699  -46.861  1.00 23.43 ? 190 THR A N   1 
ATOM   1403 C  CA  . THR A 1 190 ? 5.281   21.651  -47.734  1.00 20.11 ? 190 THR A CA  1 
ATOM   1404 C  C   . THR A 1 190 ? 4.597   22.993  -47.707  1.00 18.15 ? 190 THR A C   1 
ATOM   1405 O  O   . THR A 1 190 ? 3.363   22.997  -47.569  1.00 14.38 ? 190 THR A O   1 
ATOM   1406 C  CB  . THR A 1 190 ? 5.272   21.056  -49.170  1.00 21.84 ? 190 THR A CB  1 
ATOM   1407 O  OG1 . THR A 1 190 ? 3.948   20.517  -49.354  1.00 25.40 ? 190 THR A OG1 1 
ATOM   1408 C  CG2 . THR A 1 190 ? 6.336   19.999  -49.417  1.00 20.90 ? 190 THR A CG2 1 
ATOM   1409 N  N   . PRO A 1 191 ? 5.247   24.150  -47.888  1.00 19.42 ? 191 PRO A N   1 
ATOM   1410 C  CA  . PRO A 1 191 ? 4.552   25.436  -47.934  1.00 19.56 ? 191 PRO A CA  1 
ATOM   1411 C  C   . PRO A 1 191 ? 3.531   25.398  -49.083  1.00 24.04 ? 191 PRO A C   1 
ATOM   1412 O  O   . PRO A 1 191 ? 3.731   24.765  -50.129  1.00 24.09 ? 191 PRO A O   1 
ATOM   1413 C  CB  . PRO A 1 191 ? 5.639   26.417  -48.144  1.00 18.22 ? 191 PRO A CB  1 
ATOM   1414 C  CG  . PRO A 1 191 ? 6.912   25.737  -47.715  1.00 12.30 ? 191 PRO A CG  1 
ATOM   1415 C  CD  . PRO A 1 191 ? 6.669   24.310  -48.163  1.00 17.71 ? 191 PRO A CD  1 
ATOM   1416 N  N   . GLY A 1 192 ? 2.377   25.986  -48.880  1.00 22.84 ? 192 GLY A N   1 
ATOM   1417 C  CA  . GLY A 1 192 ? 1.381   26.000  -49.899  1.00 23.20 ? 192 GLY A CA  1 
ATOM   1418 C  C   . GLY A 1 192 ? 0.582   24.738  -49.949  1.00 26.72 ? 192 GLY A C   1 
ATOM   1419 O  O   . GLY A 1 192 ? -0.384  24.734  -50.716  1.00 30.77 ? 192 GLY A O   1 
ATOM   1420 N  N   . SER A 1 193 ? 0.832   23.684  -49.172  1.00 27.11 ? 193 SER A N   1 
ATOM   1421 C  CA  . SER A 1 193 ? 0.008   22.498  -49.328  1.00 24.68 ? 193 SER A CA  1 
ATOM   1422 C  C   . SER A 1 193 ? -1.352  22.578  -48.692  1.00 23.57 ? 193 SER A C   1 
ATOM   1423 O  O   . SER A 1 193 ? -1.656  23.509  -47.958  1.00 25.87 ? 193 SER A O   1 
ATOM   1424 C  CB  . SER A 1 193 ? 0.766   21.320  -48.778  1.00 29.27 ? 193 SER A CB  1 
ATOM   1425 O  OG  . SER A 1 193 ? 1.336   21.629  -47.516  1.00 33.68 ? 193 SER A OG  1 
ATOM   1426 N  N   . THR A 1 194 ? -2.154  21.571  -48.960  1.00 22.76 ? 194 THR A N   1 
ATOM   1427 C  CA  . THR A 1 194 ? -3.483  21.445  -48.426  1.00 23.98 ? 194 THR A CA  1 
ATOM   1428 C  C   . THR A 1 194 ? -3.401  20.256  -47.452  1.00 23.10 ? 194 THR A C   1 
ATOM   1429 O  O   . THR A 1 194 ? -3.065  19.138  -47.885  1.00 19.46 ? 194 THR A O   1 
ATOM   1430 C  CB  . THR A 1 194 ? -4.407  21.232  -49.666  1.00 22.74 ? 194 THR A CB  1 
ATOM   1431 O  OG1 . THR A 1 194 ? -4.725  22.542  -50.080  1.00 29.93 ? 194 THR A OG1 1 
ATOM   1432 C  CG2 . THR A 1 194 ? -5.706  20.535  -49.436  1.00 23.13 ? 194 THR A CG2 1 
ATOM   1433 N  N   . CYS A 1 195 ? -3.704  20.434  -46.161  1.00 22.80 ? 195 CYS A N   1 
ATOM   1434 C  CA  . CYS A 1 195 ? -3.607  19.354  -45.196  1.00 14.65 ? 195 CYS A CA  1 
ATOM   1435 C  C   . CYS A 1 195 ? -4.944  19.080  -44.569  1.00 11.76 ? 195 CYS A C   1 
ATOM   1436 O  O   . CYS A 1 195 ? -5.691  20.032  -44.383  1.00 16.30 ? 195 CYS A O   1 
ATOM   1437 C  CB  . CYS A 1 195 ? -2.635  19.727  -44.121  1.00 4.87  ? 195 CYS A CB  1 
ATOM   1438 S  SG  . CYS A 1 195 ? -0.950  20.159  -44.621  1.00 13.58 ? 195 CYS A SG  1 
ATOM   1439 N  N   . ALA A 1 196 ? -5.349  17.841  -44.335  1.00 10.00 ? 196 ALA A N   1 
ATOM   1440 C  CA  . ALA A 1 196 ? -6.586  17.558  -43.623  1.00 11.67 ? 196 ALA A CA  1 
ATOM   1441 C  C   . ALA A 1 196 ? -6.122  16.956  -42.275  1.00 13.54 ? 196 ALA A C   1 
ATOM   1442 O  O   . ALA A 1 196 ? -5.070  16.305  -42.243  1.00 12.65 ? 196 ALA A O   1 
ATOM   1443 C  CB  . ALA A 1 196 ? -7.420  16.524  -44.281  1.00 8.26  ? 196 ALA A CB  1 
ATOM   1444 N  N   . VAL A 1 197 ? -6.781  17.214  -41.128  1.00 12.63 ? 197 VAL A N   1 
ATOM   1445 C  CA  . VAL A 1 197 ? -6.429  16.702  -39.802  1.00 5.64  ? 197 VAL A CA  1 
ATOM   1446 C  C   . VAL A 1 197 ? -7.709  16.159  -39.250  1.00 3.69  ? 197 VAL A C   1 
ATOM   1447 O  O   . VAL A 1 197 ? -8.702  16.868  -39.163  1.00 6.22  ? 197 VAL A O   1 
ATOM   1448 C  CB  . VAL A 1 197 ? -5.907  17.792  -38.868  1.00 7.56  ? 197 VAL A CB  1 
ATOM   1449 C  CG1 . VAL A 1 197 ? -5.690  17.185  -37.495  1.00 11.69 ? 197 VAL A CG1 1 
ATOM   1450 C  CG2 . VAL A 1 197 ? -4.515  18.260  -39.262  1.00 3.30  ? 197 VAL A CG2 1 
ATOM   1451 N  N   . PHE A 1 198 ? -7.762  14.870  -38.984  1.00 6.11  ? 198 PHE A N   1 
ATOM   1452 C  CA  . PHE A 1 198 ? -8.949  14.231  -38.469  1.00 11.16 ? 198 PHE A CA  1 
ATOM   1453 C  C   . PHE A 1 198 ? -8.759  14.122  -36.964  1.00 17.69 ? 198 PHE A C   1 
ATOM   1454 O  O   . PHE A 1 198 ? -7.765  13.513  -36.551  1.00 21.17 ? 198 PHE A O   1 
ATOM   1455 C  CB  . PHE A 1 198 ? -9.054  12.859  -39.086  1.00 14.20 ? 198 PHE A CB  1 
ATOM   1456 C  CG  . PHE A 1 198 ? -9.617  12.806  -40.490  1.00 10.35 ? 198 PHE A CG  1 
ATOM   1457 C  CD1 . PHE A 1 198 ? -8.870  13.253  -41.577  1.00 11.53 ? 198 PHE A CD1 1 
ATOM   1458 C  CD2 . PHE A 1 198 ? -10.895 12.297  -40.672  1.00 5.25  ? 198 PHE A CD2 1 
ATOM   1459 C  CE1 . PHE A 1 198 ? -9.417  13.183  -42.849  1.00 5.40  ? 198 PHE A CE1 1 
ATOM   1460 C  CE2 . PHE A 1 198 ? -11.439 12.222  -41.956  1.00 2.90  ? 198 PHE A CE2 1 
ATOM   1461 C  CZ  . PHE A 1 198 ? -10.698 12.668  -43.037  1.00 2.99  ? 198 PHE A CZ  1 
ATOM   1462 N  N   . GLY A 1 199 ? -9.651  14.670  -36.137  1.00 19.85 ? 199 GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 199 ? -9.537  14.604  -34.675  1.00 14.75 ? 199 GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 199 ? -8.920  15.848  -34.056  1.00 11.86 ? 199 GLY A C   1 
ATOM   1465 O  O   . GLY A 1 199 ? -7.776  16.192  -34.275  1.00 6.87  ? 199 GLY A O   1 
ATOM   1466 N  N   . LEU A 1 200 ? -9.614  16.568  -33.194  1.00 14.80 ? 200 LEU A N   1 
ATOM   1467 C  CA  . LEU A 1 200 ? -9.023  17.768  -32.632  1.00 24.03 ? 200 LEU A CA  1 
ATOM   1468 C  C   . LEU A 1 200 ? -8.837  17.699  -31.090  1.00 27.50 ? 200 LEU A C   1 
ATOM   1469 O  O   . LEU A 1 200 ? -9.402  18.475  -30.292  1.00 27.31 ? 200 LEU A O   1 
ATOM   1470 C  CB  . LEU A 1 200 ? -9.893  18.990  -33.061  1.00 24.83 ? 200 LEU A CB  1 
ATOM   1471 C  CG  . LEU A 1 200 ? -10.082 19.210  -34.573  1.00 19.66 ? 200 LEU A CG  1 
ATOM   1472 C  CD1 . LEU A 1 200 ? -11.119 20.289  -34.794  1.00 13.63 ? 200 LEU A CD1 1 
ATOM   1473 C  CD2 . LEU A 1 200 ? -8.736  19.481  -35.217  1.00 6.38  ? 200 LEU A CD2 1 
ATOM   1474 N  N   . GLY A 1 201 ? -8.063  16.690  -30.674  1.00 20.25 ? 201 GLY A N   1 
ATOM   1475 C  CA  . GLY A 1 201 ? -7.742  16.576  -29.280  1.00 19.10 ? 201 GLY A CA  1 
ATOM   1476 C  C   . GLY A 1 201 ? -6.489  17.369  -29.120  1.00 15.83 ? 201 GLY A C   1 
ATOM   1477 O  O   . GLY A 1 201 ? -6.058  18.023  -30.065  1.00 16.45 ? 201 GLY A O   1 
ATOM   1478 N  N   . GLY A 1 202 ? -5.809  17.377  -27.998  1.00 15.53 ? 202 GLY A N   1 
ATOM   1479 C  CA  . GLY A 1 202 ? -4.586  18.139  -27.900  1.00 11.20 ? 202 GLY A CA  1 
ATOM   1480 C  C   . GLY A 1 202 ? -3.554  17.625  -28.874  1.00 13.23 ? 202 GLY A C   1 
ATOM   1481 O  O   . GLY A 1 202 ? -2.587  18.347  -29.132  1.00 17.75 ? 202 GLY A O   1 
ATOM   1482 N  N   . VAL A 1 203 ? -3.625  16.403  -29.426  1.00 17.00 ? 203 VAL A N   1 
ATOM   1483 C  CA  . VAL A 1 203 ? -2.597  15.960  -30.385  1.00 18.77 ? 203 VAL A CA  1 
ATOM   1484 C  C   . VAL A 1 203 ? -3.084  16.439  -31.769  1.00 15.09 ? 203 VAL A C   1 
ATOM   1485 O  O   . VAL A 1 203 ? -2.301  17.030  -32.522  1.00 9.19  ? 203 VAL A O   1 
ATOM   1486 C  CB  . VAL A 1 203 ? -2.421  14.422  -30.368  1.00 21.06 ? 203 VAL A CB  1 
ATOM   1487 C  CG1 . VAL A 1 203 ? -1.211  14.074  -31.205  1.00 19.02 ? 203 VAL A CG1 1 
ATOM   1488 C  CG2 . VAL A 1 203 ? -2.108  13.893  -28.987  1.00 24.53 ? 203 VAL A CG2 1 
ATOM   1489 N  N   . GLY A 1 204 ? -4.377  16.295  -32.085  1.00 11.89 ? 204 GLY A N   1 
ATOM   1490 C  CA  . GLY A 1 204 ? -4.966  16.788  -33.328  1.00 14.85 ? 204 GLY A CA  1 
ATOM   1491 C  C   . GLY A 1 204 ? -4.687  18.283  -33.507  1.00 17.77 ? 204 GLY A C   1 
ATOM   1492 O  O   . GLY A 1 204 ? -4.155  18.723  -34.536  1.00 26.86 ? 204 GLY A O   1 
ATOM   1493 N  N   . LEU A 1 205 ? -4.848  19.107  -32.476  1.00 12.72 ? 205 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 205 ? -4.608  20.519  -32.596  1.00 12.40 ? 205 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 205 ? -3.139  20.852  -32.700  1.00 13.62 ? 205 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 205 ? -2.765  21.907  -33.225  1.00 21.87 ? 205 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 205 ? -5.268  21.232  -31.402  1.00 17.81 ? 205 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 205 ? -6.795  21.352  -31.541  1.00 20.30 ? 205 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 205 ? -7.517  21.680  -30.259  1.00 14.24 ? 205 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 205 ? -7.004  22.406  -32.587  1.00 16.18 ? 205 LEU A CD2 1 
ATOM   1501 N  N   . SER A 1 206 ? -2.225  20.015  -32.281  1.00 14.51 ? 206 SER A N   1 
ATOM   1502 C  CA  . SER A 1 206 ? -0.826  20.379  -32.430  1.00 17.40 ? 206 SER A CA  1 
ATOM   1503 C  C   . SER A 1 206 ? -0.391  20.004  -33.848  1.00 16.29 ? 206 SER A C   1 
ATOM   1504 O  O   . SER A 1 206 ? 0.655   20.434  -34.326  1.00 17.77 ? 206 SER A O   1 
ATOM   1505 C  CB  . SER A 1 206 ? -0.010  19.629  -31.357  1.00 19.42 ? 206 SER A CB  1 
ATOM   1506 O  OG  . SER A 1 206 ? -0.498  19.891  -30.054  1.00 17.53 ? 206 SER A OG  1 
ATOM   1507 N  N   . ALA A 1 207 ? -1.158  19.132  -34.521  1.00 17.02 ? 207 ALA A N   1 
ATOM   1508 C  CA  . ALA A 1 207 ? -0.911  18.701  -35.884  1.00 16.55 ? 207 ALA A CA  1 
ATOM   1509 C  C   . ALA A 1 207 ? -1.315  19.913  -36.713  1.00 17.70 ? 207 ALA A C   1 
ATOM   1510 O  O   . ALA A 1 207 ? -0.500  20.328  -37.528  1.00 14.71 ? 207 ALA A O   1 
ATOM   1511 C  CB  . ALA A 1 207 ? -1.790  17.531  -36.207  1.00 17.74 ? 207 ALA A CB  1 
ATOM   1512 N  N   . VAL A 1 208 ? -2.506  20.536  -36.461  1.00 18.36 ? 208 VAL A N   1 
ATOM   1513 C  CA  . VAL A 1 208 ? -2.962  21.778  -37.105  1.00 17.82 ? 208 VAL A CA  1 
ATOM   1514 C  C   . VAL A 1 208 ? -1.825  22.783  -36.917  1.00 24.39 ? 208 VAL A C   1 
ATOM   1515 O  O   . VAL A 1 208 ? -1.226  23.266  -37.881  1.00 31.21 ? 208 VAL A O   1 
ATOM   1516 C  CB  . VAL A 1 208 ? -4.222  22.358  -36.435  1.00 14.28 ? 208 VAL A CB  1 
ATOM   1517 C  CG1 . VAL A 1 208 ? -4.476  23.740  -37.006  1.00 15.06 ? 208 VAL A CG1 1 
ATOM   1518 C  CG2 . VAL A 1 208 ? -5.452  21.540  -36.712  1.00 4.70  ? 208 VAL A CG2 1 
ATOM   1519 N  N   . MET A 1 209 ? -1.434  23.019  -35.672  1.00 24.51 ? 209 MET A N   1 
ATOM   1520 C  CA  . MET A 1 209 ? -0.348  23.915  -35.338  1.00 25.12 ? 209 MET A CA  1 
ATOM   1521 C  C   . MET A 1 209 ? 0.961   23.565  -36.056  1.00 26.08 ? 209 MET A C   1 
ATOM   1522 O  O   . MET A 1 209 ? 1.784   24.450  -36.315  1.00 29.49 ? 209 MET A O   1 
ATOM   1523 C  CB  . MET A 1 209 ? -0.229  23.843  -33.818  1.00 28.52 ? 209 MET A CB  1 
ATOM   1524 C  CG  . MET A 1 209 ? 0.522   24.950  -33.071  1.00 27.26 ? 209 MET A CG  1 
ATOM   1525 S  SD  . MET A 1 209 ? 0.468   24.843  -31.252  1.00 24.03 ? 209 MET A SD  1 
ATOM   1526 C  CE  . MET A 1 209 ? -1.195  24.280  -31.161  1.00 6.17  ? 209 MET A CE  1 
ATOM   1527 N  N   . GLY A 1 210 ? 1.229   22.301  -36.414  1.00 26.33 ? 210 GLY A N   1 
ATOM   1528 C  CA  . GLY A 1 210 ? 2.448   21.910  -37.126  1.00 24.89 ? 210 GLY A CA  1 
ATOM   1529 C  C   . GLY A 1 210 ? 2.329   22.189  -38.626  1.00 23.25 ? 210 GLY A C   1 
ATOM   1530 O  O   . GLY A 1 210 ? 3.291   22.629  -39.267  1.00 19.23 ? 210 GLY A O   1 
ATOM   1531 N  N   . CYS A 1 211 ? 1.132   21.951  -39.193  1.00 24.13 ? 211 CYS A N   1 
ATOM   1532 C  CA  . CYS A 1 211 ? 0.823   22.225  -40.596  1.00 24.21 ? 211 CYS A CA  1 
ATOM   1533 C  C   . CYS A 1 211 ? 0.942   23.739  -40.838  1.00 26.62 ? 211 CYS A C   1 
ATOM   1534 O  O   . CYS A 1 211 ? 1.590   24.181  -41.798  1.00 22.00 ? 211 CYS A O   1 
ATOM   1535 C  CB  . CYS A 1 211 ? -0.572  21.787  -40.901  1.00 19.46 ? 211 CYS A CB  1 
ATOM   1536 S  SG  . CYS A 1 211 ? -0.778  19.996  -40.838  1.00 22.66 ? 211 CYS A SG  1 
ATOM   1537 N  N   . LYS A 1 212 ? 0.405   24.580  -39.934  1.00 29.34 ? 212 LYS A N   1 
ATOM   1538 C  CA  . LYS A 1 212 ? 0.519   26.028  -40.067  1.00 29.81 ? 212 LYS A CA  1 
ATOM   1539 C  C   . LYS A 1 212 ? 1.974   26.433  -39.941  1.00 31.06 ? 212 LYS A C   1 
ATOM   1540 O  O   . LYS A 1 212 ? 2.458   27.271  -40.701  1.00 35.79 ? 212 LYS A O   1 
ATOM   1541 C  CB  . LYS A 1 212 ? -0.258  26.787  -38.991  1.00 31.43 ? 212 LYS A CB  1 
ATOM   1542 C  CG  . LYS A 1 212 ? -0.102  28.290  -39.227  1.00 38.89 ? 212 LYS A CG  1 
ATOM   1543 C  CD  . LYS A 1 212 ? -0.768  29.218  -38.234  1.00 46.86 ? 212 LYS A CD  1 
ATOM   1544 C  CE  . LYS A 1 212 ? -0.333  30.644  -38.587  1.00 50.33 ? 212 LYS A CE  1 
ATOM   1545 N  NZ  . LYS A 1 212 ? -0.897  31.638  -37.688  1.00 54.48 ? 212 LYS A NZ  1 
ATOM   1546 N  N   . ALA A 1 213 ? 2.766   25.847  -39.052  1.00 31.06 ? 213 ALA A N   1 
ATOM   1547 C  CA  . ALA A 1 213 ? 4.153   26.290  -38.973  1.00 28.44 ? 213 ALA A CA  1 
ATOM   1548 C  C   . ALA A 1 213 ? 4.971   25.866  -40.175  1.00 27.98 ? 213 ALA A C   1 
ATOM   1549 O  O   . ALA A 1 213 ? 6.087   26.354  -40.361  1.00 26.88 ? 213 ALA A O   1 
ATOM   1550 C  CB  . ALA A 1 213 ? 4.801   25.728  -37.739  1.00 26.61 ? 213 ALA A CB  1 
ATOM   1551 N  N   . ALA A 1 214 ? 4.418   24.941  -40.980  1.00 28.60 ? 214 ALA A N   1 
ATOM   1552 C  CA  . ALA A 1 214 ? 5.107   24.433  -42.149  1.00 28.47 ? 214 ALA A CA  1 
ATOM   1553 C  C   . ALA A 1 214 ? 4.846   25.232  -43.420  1.00 32.97 ? 214 ALA A C   1 
ATOM   1554 O  O   . ALA A 1 214 ? 5.552   25.130  -44.432  1.00 34.48 ? 214 ALA A O   1 
ATOM   1555 C  CB  . ALA A 1 214 ? 4.682   23.020  -42.358  1.00 21.50 ? 214 ALA A CB  1 
ATOM   1556 N  N   . GLY A 1 215 ? 3.823   26.078  -43.368  1.00 33.73 ? 215 GLY A N   1 
ATOM   1557 C  CA  . GLY A 1 215 ? 3.461   26.895  -44.491  1.00 28.57 ? 215 GLY A CA  1 
ATOM   1558 C  C   . GLY A 1 215 ? 2.247   26.326  -45.200  1.00 30.60 ? 215 GLY A C   1 
ATOM   1559 O  O   . GLY A 1 215 ? 1.970   26.771  -46.316  1.00 35.69 ? 215 GLY A O   1 
ATOM   1560 N  N   . ALA A 1 216 ? 1.500   25.357  -44.669  1.00 25.97 ? 216 ALA A N   1 
ATOM   1561 C  CA  . ALA A 1 216 ? 0.338   24.864  -45.361  1.00 24.66 ? 216 ALA A CA  1 
ATOM   1562 C  C   . ALA A 1 216 ? -0.597  26.021  -45.693  1.00 30.01 ? 216 ALA A C   1 
ATOM   1563 O  O   . ALA A 1 216 ? -0.789  26.968  -44.922  1.00 30.18 ? 216 ALA A O   1 
ATOM   1564 C  CB  . ALA A 1 216 ? -0.427  23.879  -44.514  1.00 21.00 ? 216 ALA A CB  1 
ATOM   1565 N  N   . ALA A 1 217 ? -1.059  25.987  -46.941  1.00 31.23 ? 217 ALA A N   1 
ATOM   1566 C  CA  . ALA A 1 217 ? -1.951  26.997  -47.432  1.00 25.77 ? 217 ALA A CA  1 
ATOM   1567 C  C   . ALA A 1 217 ? -3.304  26.730  -46.849  1.00 21.89 ? 217 ALA A C   1 
ATOM   1568 O  O   . ALA A 1 217 ? -3.959  27.672  -46.431  1.00 25.72 ? 217 ALA A O   1 
ATOM   1569 C  CB  . ALA A 1 217 ? -2.061  26.931  -48.937  1.00 29.77 ? 217 ALA A CB  1 
ATOM   1570 N  N   . ARG A 1 218 ? -3.782  25.502  -46.840  1.00 19.47 ? 218 ARG A N   1 
ATOM   1571 C  CA  . ARG A 1 218 ? -5.088  25.212  -46.280  1.00 20.64 ? 218 ARG A CA  1 
ATOM   1572 C  C   . ARG A 1 218 ? -4.884  24.126  -45.263  1.00 20.37 ? 218 ARG A C   1 
ATOM   1573 O  O   . ARG A 1 218 ? -3.950  23.330  -45.383  1.00 22.53 ? 218 ARG A O   1 
ATOM   1574 C  CB  . ARG A 1 218 ? -6.096  24.639  -47.273  1.00 22.33 ? 218 ARG A CB  1 
ATOM   1575 C  CG  . ARG A 1 218 ? -6.726  25.607  -48.261  1.00 24.54 ? 218 ARG A CG  1 
ATOM   1576 C  CD  . ARG A 1 218 ? -7.598  24.828  -49.245  1.00 18.60 ? 218 ARG A CD  1 
ATOM   1577 N  NE  . ARG A 1 218 ? -8.946  24.590  -48.777  1.00 12.57 ? 218 ARG A NE  1 
ATOM   1578 C  CZ  . ARG A 1 218 ? -9.856  24.008  -49.573  1.00 14.32 ? 218 ARG A CZ  1 
ATOM   1579 N  NH1 . ARG A 1 218 ? -9.575  23.607  -50.817  1.00 21.90 ? 218 ARG A NH1 1 
ATOM   1580 N  NH2 . ARG A 1 218 ? -11.102 23.843  -49.161  1.00 13.89 ? 218 ARG A NH2 1 
ATOM   1581 N  N   . ILE A 1 219 ? -5.765  24.085  -44.272  1.00 21.04 ? 219 ILE A N   1 
ATOM   1582 C  CA  . ILE A 1 219 ? -5.782  23.090  -43.204  1.00 14.97 ? 219 ILE A CA  1 
ATOM   1583 C  C   . ILE A 1 219 ? -7.256  22.824  -42.933  1.00 13.22 ? 219 ILE A C   1 
ATOM   1584 O  O   . ILE A 1 219 ? -7.913  23.688  -42.367  1.00 16.98 ? 219 ILE A O   1 
ATOM   1585 C  CB  . ILE A 1 219 ? -5.074  23.618  -41.917  1.00 8.78  ? 219 ILE A CB  1 
ATOM   1586 C  CG1 . ILE A 1 219 ? -3.585  23.844  -42.092  1.00 5.72  ? 219 ILE A CG1 1 
ATOM   1587 C  CG2 . ILE A 1 219 ? -5.077  22.489  -40.923  1.00 11.76 ? 219 ILE A CG2 1 
ATOM   1588 C  CD1 . ILE A 1 219 ? -2.933  25.116  -41.573  1.00 5.76  ? 219 ILE A CD1 1 
ATOM   1589 N  N   . ILE A 1 220 ? -7.872  21.750  -43.410  1.00 11.64 ? 220 ILE A N   1 
ATOM   1590 C  CA  . ILE A 1 220 ? -9.264  21.468  -43.110  1.00 12.65 ? 220 ILE A CA  1 
ATOM   1591 C  C   . ILE A 1 220 ? -9.150  20.626  -41.824  1.00 17.51 ? 220 ILE A C   1 
ATOM   1592 O  O   . ILE A 1 220 ? -8.359  19.668  -41.776  1.00 18.03 ? 220 ILE A O   1 
ATOM   1593 C  CB  . ILE A 1 220 ? -9.929  20.645  -44.275  1.00 11.22 ? 220 ILE A CB  1 
ATOM   1594 C  CG1 . ILE A 1 220 ? -10.025 21.388  -45.631  1.00 11.91 ? 220 ILE A CG1 1 
ATOM   1595 C  CG2 . ILE A 1 220 ? -11.365 20.360  -43.856  1.00 9.13  ? 220 ILE A CG2 1 
ATOM   1596 C  CD1 . ILE A 1 220 ? -8.754  21.529  -46.473  1.00 7.83  ? 220 ILE A CD1 1 
ATOM   1597 N  N   . ALA A 1 221 ? -9.922  20.903  -40.771  1.00 18.37 ? 221 ALA A N   1 
ATOM   1598 C  CA  . ALA A 1 221 ? -9.876  20.220  -39.489  1.00 14.06 ? 221 ALA A CA  1 
ATOM   1599 C  C   . ALA A 1 221 ? -11.140 19.447  -39.428  1.00 15.18 ? 221 ALA A C   1 
ATOM   1600 O  O   . ALA A 1 221 ? -12.207 20.028  -39.612  1.00 21.20 ? 221 ALA A O   1 
ATOM   1601 C  CB  . ALA A 1 221 ? -9.841  21.231  -38.391  1.00 13.76 ? 221 ALA A CB  1 
ATOM   1602 N  N   . VAL A 1 222 ? -11.133 18.159  -39.157  1.00 14.85 ? 222 VAL A N   1 
ATOM   1603 C  CA  . VAL A 1 222 ? -12.379 17.405  -39.200  1.00 11.52 ? 222 VAL A CA  1 
ATOM   1604 C  C   . VAL A 1 222 ? -12.703 16.961  -37.765  1.00 15.37 ? 222 VAL A C   1 
ATOM   1605 O  O   . VAL A 1 222 ? -11.777 16.548  -37.044  1.00 16.65 ? 222 VAL A O   1 
ATOM   1606 C  CB  . VAL A 1 222 ? -12.138 16.190  -40.181  1.00 8.21  ? 222 VAL A CB  1 
ATOM   1607 C  CG1 . VAL A 1 222 ? -13.364 15.313  -40.208  1.00 2.00  ? 222 VAL A CG1 1 
ATOM   1608 C  CG2 . VAL A 1 222 ? -11.878 16.624  -41.620  1.00 9.76  ? 222 VAL A CG2 1 
ATOM   1609 N  N   . ASP A 1 223 ? -13.930 17.021  -37.254  1.00 14.24 ? 223 ASP A N   1 
ATOM   1610 C  CA  . ASP A 1 223 ? -14.206 16.512  -35.939  1.00 13.23 ? 223 ASP A CA  1 
ATOM   1611 C  C   . ASP A 1 223 ? -15.677 16.399  -35.799  1.00 13.51 ? 223 ASP A C   1 
ATOM   1612 O  O   . ASP A 1 223 ? -16.391 17.202  -36.365  1.00 19.86 ? 223 ASP A O   1 
ATOM   1613 C  CB  . ASP A 1 223 ? -13.721 17.404  -34.795  1.00 16.72 ? 223 ASP A CB  1 
ATOM   1614 C  CG  . ASP A 1 223 ? -13.369 16.562  -33.541  1.00 15.62 ? 223 ASP A CG  1 
ATOM   1615 O  OD1 . ASP A 1 223 ? -14.200 15.806  -33.059  1.00 9.90  ? 223 ASP A OD1 1 
ATOM   1616 O  OD2 . ASP A 1 223 ? -12.247 16.628  -33.052  1.00 11.66 ? 223 ASP A OD2 1 
ATOM   1617 N  N   . ILE A 1 224 ? -16.190 15.385  -35.108  1.00 14.01 ? 224 ILE A N   1 
ATOM   1618 C  CA  . ILE A 1 224 ? -17.629 15.300  -34.914  1.00 15.44 ? 224 ILE A CA  1 
ATOM   1619 C  C   . ILE A 1 224 ? -18.086 16.215  -33.759  1.00 16.10 ? 224 ILE A C   1 
ATOM   1620 O  O   . ILE A 1 224 ? -19.283 16.335  -33.448  1.00 20.61 ? 224 ILE A O   1 
ATOM   1621 C  CB  . ILE A 1 224 ? -18.080 13.861  -34.601  1.00 14.41 ? 224 ILE A CB  1 
ATOM   1622 C  CG1 . ILE A 1 224 ? -17.402 13.364  -33.335  1.00 12.16 ? 224 ILE A CG1 1 
ATOM   1623 C  CG2 . ILE A 1 224 ? -17.833 12.993  -35.834  1.00 15.47 ? 224 ILE A CG2 1 
ATOM   1624 C  CD1 . ILE A 1 224 ? -17.968 11.988  -32.950  1.00 10.80 ? 224 ILE A CD1 1 
ATOM   1625 N  N   . ASN A 1 225 ? -17.118 16.864  -33.118  1.00 12.82 ? 225 ASN A N   1 
ATOM   1626 C  CA  . ASN A 1 225 ? -17.371 17.772  -32.042  1.00 16.57 ? 225 ASN A CA  1 
ATOM   1627 C  C   . ASN A 1 225 ? -17.068 19.215  -32.414  1.00 16.65 ? 225 ASN A C   1 
ATOM   1628 O  O   . ASN A 1 225 ? -15.948 19.726  -32.406  1.00 13.74 ? 225 ASN A O   1 
ATOM   1629 C  CB  . ASN A 1 225 ? -16.539 17.374  -30.800  1.00 18.37 ? 225 ASN A CB  1 
ATOM   1630 C  CG  . ASN A 1 225 ? -16.869 18.230  -29.571  1.00 19.11 ? 225 ASN A CG  1 
ATOM   1631 O  OD1 . ASN A 1 225 ? -17.922 18.891  -29.494  1.00 14.07 ? 225 ASN A OD1 1 
ATOM   1632 N  ND2 . ASN A 1 225 ? -15.958 18.266  -28.606  1.00 18.11 ? 225 ASN A ND2 1 
ATOM   1633 N  N   . LYS A 1 226 ? -18.168 19.884  -32.694  1.00 23.58 ? 226 LYS A N   1 
ATOM   1634 C  CA  . LYS A 1 226 ? -18.197 21.301  -33.062  1.00 27.62 ? 226 LYS A CA  1 
ATOM   1635 C  C   . LYS A 1 226 ? -17.436 22.249  -32.153  1.00 28.56 ? 226 LYS A C   1 
ATOM   1636 O  O   . LYS A 1 226 ? -16.833 23.220  -32.606  1.00 33.24 ? 226 LYS A O   1 
ATOM   1637 C  CB  . LYS A 1 226 ? -19.598 21.837  -33.072  1.00 31.88 ? 226 LYS A CB  1 
ATOM   1638 C  CG  . LYS A 1 226 ? -20.638 20.983  -33.755  1.00 38.39 ? 226 LYS A CG  1 
ATOM   1639 C  CD  . LYS A 1 226 ? -22.009 21.482  -33.314  1.00 44.07 ? 226 LYS A CD  1 
ATOM   1640 C  CE  . LYS A 1 226 ? -22.289 22.939  -33.675  1.00 45.06 ? 226 LYS A CE  1 
ATOM   1641 N  NZ  . LYS A 1 226 ? -23.700 23.204  -33.456  1.00 47.41 ? 226 LYS A NZ  1 
ATOM   1642 N  N   . ASP A 1 227 ? -17.443 22.038  -30.847  1.00 30.87 ? 227 ASP A N   1 
ATOM   1643 C  CA  . ASP A 1 227 ? -16.768 22.923  -29.898  1.00 29.71 ? 227 ASP A CA  1 
ATOM   1644 C  C   . ASP A 1 227 ? -15.290 23.023  -30.093  1.00 28.34 ? 227 ASP A C   1 
ATOM   1645 O  O   . ASP A 1 227 ? -14.670 23.978  -29.628  1.00 31.80 ? 227 ASP A O   1 
ATOM   1646 C  CB  . ASP A 1 227 ? -17.026 22.470  -28.460  1.00 32.12 ? 227 ASP A CB  1 
ATOM   1647 C  CG  . ASP A 1 227 ? -18.492 22.611  -28.054  1.00 36.93 ? 227 ASP A CG  1 
ATOM   1648 O  OD1 . ASP A 1 227 ? -19.042 23.705  -28.220  1.00 40.03 ? 227 ASP A OD1 1 
ATOM   1649 O  OD2 . ASP A 1 227 ? -19.084 21.628  -27.589  1.00 40.05 ? 227 ASP A OD2 1 
ATOM   1650 N  N   . LYS A 1 228 ? -14.712 22.075  -30.823  1.00 27.33 ? 228 LYS A N   1 
ATOM   1651 C  CA  . LYS A 1 228 ? -13.280 22.082  -31.049  1.00 27.08 ? 228 LYS A CA  1 
ATOM   1652 C  C   . LYS A 1 228 ? -12.847 23.046  -32.139  1.00 28.08 ? 228 LYS A C   1 
ATOM   1653 O  O   . LYS A 1 228 ? -11.697 23.514  -32.188  1.00 27.87 ? 228 LYS A O   1 
ATOM   1654 C  CB  . LYS A 1 228 ? -12.871 20.664  -31.389  1.00 27.22 ? 228 LYS A CB  1 
ATOM   1655 C  CG  . LYS A 1 228 ? -13.103 19.640  -30.287  1.00 26.42 ? 228 LYS A CG  1 
ATOM   1656 C  CD  . LYS A 1 228 ? -12.140 19.927  -29.160  1.00 30.00 ? 228 LYS A CD  1 
ATOM   1657 C  CE  . LYS A 1 228 ? -12.224 18.812  -28.143  1.00 33.73 ? 228 LYS A CE  1 
ATOM   1658 N  NZ  . LYS A 1 228 ? -11.502 17.640  -28.597  1.00 32.99 ? 228 LYS A NZ  1 
ATOM   1659 N  N   . PHE A 1 229 ? -13.825 23.402  -32.988  1.00 29.30 ? 229 PHE A N   1 
ATOM   1660 C  CA  . PHE A 1 229 ? -13.614 24.246  -34.155  1.00 24.45 ? 229 PHE A CA  1 
ATOM   1661 C  C   . PHE A 1 229 ? -13.007 25.602  -33.913  1.00 25.31 ? 229 PHE A C   1 
ATOM   1662 O  O   . PHE A 1 229 ? -12.015 25.959  -34.564  1.00 24.78 ? 229 PHE A O   1 
ATOM   1663 C  CB  . PHE A 1 229 ? -14.942 24.339  -34.837  1.00 21.77 ? 229 PHE A CB  1 
ATOM   1664 C  CG  . PHE A 1 229 ? -15.386 23.020  -35.494  1.00 20.43 ? 229 PHE A CG  1 
ATOM   1665 C  CD1 . PHE A 1 229 ? -14.545 21.897  -35.567  1.00 19.42 ? 229 PHE A CD1 1 
ATOM   1666 C  CD2 . PHE A 1 229 ? -16.654 22.943  -36.049  1.00 13.64 ? 229 PHE A CD2 1 
ATOM   1667 C  CE1 . PHE A 1 229 ? -14.985 20.728  -36.182  1.00 15.08 ? 229 PHE A CE1 1 
ATOM   1668 C  CE2 . PHE A 1 229 ? -17.080 21.767  -36.662  1.00 15.94 ? 229 PHE A CE2 1 
ATOM   1669 C  CZ  . PHE A 1 229 ? -16.248 20.658  -36.726  1.00 11.99 ? 229 PHE A CZ  1 
ATOM   1670 N  N   . ALA A 1 230 ? -13.500 26.306  -32.890  1.00 25.72 ? 230 ALA A N   1 
ATOM   1671 C  CA  . ALA A 1 230 ? -12.995 27.624  -32.530  1.00 22.77 ? 230 ALA A CA  1 
ATOM   1672 C  C   . ALA A 1 230 ? -11.529 27.603  -32.179  1.00 23.54 ? 230 ALA A C   1 
ATOM   1673 O  O   . ALA A 1 230 ? -10.756 28.466  -32.618  1.00 23.14 ? 230 ALA A O   1 
ATOM   1674 C  CB  . ALA A 1 230 ? -13.752 28.127  -31.358  1.00 23.65 ? 230 ALA A CB  1 
ATOM   1675 N  N   . LYS A 1 231 ? -11.097 26.569  -31.442  1.00 25.35 ? 231 LYS A N   1 
ATOM   1676 C  CA  . LYS A 1 231 ? -9.688  26.481  -31.089  1.00 25.26 ? 231 LYS A CA  1 
ATOM   1677 C  C   . LYS A 1 231 ? -8.879  26.101  -32.310  1.00 23.26 ? 231 LYS A C   1 
ATOM   1678 O  O   . LYS A 1 231 ? -7.817  26.686  -32.536  1.00 24.96 ? 231 LYS A O   1 
ATOM   1679 C  CB  . LYS A 1 231 ? -9.468  25.451  -29.995  1.00 28.72 ? 231 LYS A CB  1 
ATOM   1680 C  CG  . LYS A 1 231 ? -8.624  26.038  -28.870  1.00 31.10 ? 231 LYS A CG  1 
ATOM   1681 C  CD  . LYS A 1 231 ? -9.537  26.887  -27.997  1.00 35.42 ? 231 LYS A CD  1 
ATOM   1682 C  CE  . LYS A 1 231 ? -8.797  27.618  -26.884  1.00 37.79 ? 231 LYS A CE  1 
ATOM   1683 N  NZ  . LYS A 1 231 ? -8.708  26.752  -25.727  1.00 43.18 ? 231 LYS A NZ  1 
ATOM   1684 N  N   . ALA A 1 232 ? -9.366  25.164  -33.135  1.00 21.00 ? 232 ALA A N   1 
ATOM   1685 C  CA  . ALA A 1 232 ? -8.681  24.760  -34.375  1.00 18.34 ? 232 ALA A CA  1 
ATOM   1686 C  C   . ALA A 1 232 ? -8.373  25.950  -35.275  1.00 21.57 ? 232 ALA A C   1 
ATOM   1687 O  O   . ALA A 1 232 ? -7.223  26.171  -35.708  1.00 19.46 ? 232 ALA A O   1 
ATOM   1688 C  CB  . ALA A 1 232 ? -9.541  23.798  -35.180  1.00 13.23 ? 232 ALA A CB  1 
ATOM   1689 N  N   . LYS A 1 233 ? -9.445  26.753  -35.462  1.00 24.73 ? 233 LYS A N   1 
ATOM   1690 C  CA  . LYS A 1 233 ? -9.416  27.964  -36.261  1.00 25.14 ? 233 LYS A CA  1 
ATOM   1691 C  C   . LYS A 1 233 ? -8.412  28.894  -35.650  1.00 25.92 ? 233 LYS A C   1 
ATOM   1692 O  O   . LYS A 1 233 ? -7.440  29.224  -36.328  1.00 30.02 ? 233 LYS A O   1 
ATOM   1693 C  CB  . LYS A 1 233 ? -10.817 28.583  -36.322  1.00 28.92 ? 233 LYS A CB  1 
ATOM   1694 C  CG  . LYS A 1 233 ? -11.604 27.755  -37.361  1.00 34.40 ? 233 LYS A CG  1 
ATOM   1695 C  CD  . LYS A 1 233 ? -12.666 28.479  -38.191  1.00 38.67 ? 233 LYS A CD  1 
ATOM   1696 C  CE  . LYS A 1 233 ? -14.038 28.628  -37.487  1.00 42.41 ? 233 LYS A CE  1 
ATOM   1697 N  NZ  . LYS A 1 233 ? -14.797 27.386  -37.412  1.00 39.04 ? 233 LYS A NZ  1 
ATOM   1698 N  N   . GLU A 1 234 ? -8.500  29.211  -34.368  1.00 25.68 ? 234 GLU A N   1 
ATOM   1699 C  CA  . GLU A 1 234 ? -7.509  30.069  -33.717  1.00 26.11 ? 234 GLU A CA  1 
ATOM   1700 C  C   . GLU A 1 234 ? -6.087  29.546  -33.909  1.00 24.81 ? 234 GLU A C   1 
ATOM   1701 O  O   . GLU A 1 234 ? -5.130  30.313  -34.024  1.00 25.33 ? 234 GLU A O   1 
ATOM   1702 C  CB  . GLU A 1 234 ? -7.847  30.132  -32.231  1.00 31.50 ? 234 GLU A CB  1 
ATOM   1703 C  CG  . GLU A 1 234 ? -6.890  30.887  -31.287  1.00 41.08 ? 234 GLU A CG  1 
ATOM   1704 C  CD  . GLU A 1 234 ? -6.941  30.517  -29.790  1.00 43.14 ? 234 GLU A CD  1 
ATOM   1705 O  OE1 . GLU A 1 234 ? -7.866  29.819  -29.359  1.00 44.00 ? 234 GLU A OE1 1 
ATOM   1706 O  OE2 . GLU A 1 234 ? -6.037  30.932  -29.051  1.00 41.60 ? 234 GLU A OE2 1 
ATOM   1707 N  N   . LEU A 1 235 ? -5.908  28.227  -33.949  1.00 23.80 ? 235 LEU A N   1 
ATOM   1708 C  CA  . LEU A 1 235 ? -4.563  27.695  -34.090  1.00 26.55 ? 235 LEU A CA  1 
ATOM   1709 C  C   . LEU A 1 235 ? -4.007  27.543  -35.506  1.00 29.03 ? 235 LEU A C   1 
ATOM   1710 O  O   . LEU A 1 235 ? -2.810  27.246  -35.701  1.00 26.29 ? 235 LEU A O   1 
ATOM   1711 C  CB  . LEU A 1 235 ? -4.515  26.359  -33.330  1.00 21.23 ? 235 LEU A CB  1 
ATOM   1712 C  CG  . LEU A 1 235 ? -4.520  26.496  -31.808  1.00 10.84 ? 235 LEU A CG  1 
ATOM   1713 C  CD1 . LEU A 1 235 ? -4.639  25.142  -31.161  1.00 14.80 ? 235 LEU A CD1 1 
ATOM   1714 C  CD2 . LEU A 1 235 ? -3.240  27.126  -31.362  1.00 7.46  ? 235 LEU A CD2 1 
ATOM   1715 N  N   . GLY A 1 236 ? -4.868  27.735  -36.509  1.00 28.24 ? 236 GLY A N   1 
ATOM   1716 C  CA  . GLY A 1 236 ? -4.396  27.655  -37.879  1.00 26.41 ? 236 GLY A CA  1 
ATOM   1717 C  C   . GLY A 1 236 ? -5.325  26.956  -38.846  1.00 23.54 ? 236 GLY A C   1 
ATOM   1718 O  O   . GLY A 1 236 ? -5.001  26.958  -40.021  1.00 28.81 ? 236 GLY A O   1 
ATOM   1719 N  N   . ALA A 1 237 ? -6.457  26.364  -38.495  1.00 20.93 ? 237 ALA A N   1 
ATOM   1720 C  CA  . ALA A 1 237 ? -7.284  25.680  -39.461  1.00 20.65 ? 237 ALA A CA  1 
ATOM   1721 C  C   . ALA A 1 237 ? -7.936  26.702  -40.373  1.00 27.25 ? 237 ALA A C   1 
ATOM   1722 O  O   . ALA A 1 237 ? -8.449  27.716  -39.874  1.00 34.25 ? 237 ALA A O   1 
ATOM   1723 C  CB  . ALA A 1 237 ? -8.367  24.888  -38.771  1.00 16.89 ? 237 ALA A CB  1 
ATOM   1724 N  N   . THR A 1 238 ? -7.905  26.486  -41.702  1.00 24.35 ? 238 THR A N   1 
ATOM   1725 C  CA  . THR A 1 238 ? -8.512  27.424  -42.618  1.00 19.72 ? 238 THR A CA  1 
ATOM   1726 C  C   . THR A 1 238 ? -9.986  27.118  -42.629  1.00 19.02 ? 238 THR A C   1 
ATOM   1727 O  O   . THR A 1 238 ? -10.791 28.009  -42.859  1.00 23.60 ? 238 THR A O   1 
ATOM   1728 C  CB  . THR A 1 238 ? -7.922  27.288  -44.030  1.00 20.61 ? 238 THR A CB  1 
ATOM   1729 O  OG1 . THR A 1 238 ? -7.946  25.917  -44.392  1.00 18.40 ? 238 THR A OG1 1 
ATOM   1730 C  CG2 . THR A 1 238 ? -6.494  27.797  -44.098  1.00 19.65 ? 238 THR A CG2 1 
ATOM   1731 N  N   . GLU A 1 239 ? -10.419 25.883  -42.449  1.00 18.19 ? 239 GLU A N   1 
ATOM   1732 C  CA  . GLU A 1 239 ? -11.854 25.600  -42.401  1.00 18.85 ? 239 GLU A CA  1 
ATOM   1733 C  C   . GLU A 1 239 ? -12.020 24.399  -41.501  1.00 19.67 ? 239 GLU A C   1 
ATOM   1734 O  O   . GLU A 1 239 ? -11.018 23.704  -41.307  1.00 20.99 ? 239 GLU A O   1 
ATOM   1735 C  CB  . GLU A 1 239 ? -12.427 25.276  -43.746  1.00 21.62 ? 239 GLU A CB  1 
ATOM   1736 C  CG  . GLU A 1 239 ? -11.607 24.400  -44.636  1.00 32.61 ? 239 GLU A CG  1 
ATOM   1737 C  CD  . GLU A 1 239 ? -11.328 25.051  -45.973  1.00 34.83 ? 239 GLU A CD  1 
ATOM   1738 O  OE1 . GLU A 1 239 ? -12.260 25.096  -46.765  1.00 37.75 ? 239 GLU A OE1 1 
ATOM   1739 O  OE2 . GLU A 1 239 ? -10.204 25.504  -46.212  1.00 38.46 ? 239 GLU A OE2 1 
ATOM   1740 N  N   . CYS A 1 240 ? -13.213 24.107  -40.983  1.00 17.28 ? 240 CYS A N   1 
ATOM   1741 C  CA  . CYS A 1 240 ? -13.420 23.025  -40.050  1.00 15.02 ? 240 CYS A CA  1 
ATOM   1742 C  C   . CYS A 1 240 ? -14.652 22.329  -40.489  1.00 16.26 ? 240 CYS A C   1 
ATOM   1743 O  O   . CYS A 1 240 ? -15.625 23.028  -40.741  1.00 20.64 ? 240 CYS A O   1 
ATOM   1744 C  CB  . CYS A 1 240 ? -13.681 23.537  -38.631  1.00 17.27 ? 240 CYS A CB  1 
ATOM   1745 S  SG  . CYS A 1 240 ? -12.315 24.494  -37.947  1.00 21.66 ? 240 CYS A SG  1 
ATOM   1746 N  N   . ILE A 1 241 ? -14.751 21.012  -40.571  1.00 19.35 ? 241 ILE A N   1 
ATOM   1747 C  CA  . ILE A 1 241 ? -15.994 20.421  -41.042  1.00 21.48 ? 241 ILE A CA  1 
ATOM   1748 C  C   . ILE A 1 241 ? -16.371 19.317  -40.100  1.00 17.24 ? 241 ILE A C   1 
ATOM   1749 O  O   . ILE A 1 241 ? -15.519 18.757  -39.444  1.00 22.62 ? 241 ILE A O   1 
ATOM   1750 C  CB  . ILE A 1 241 ? -15.876 19.879  -42.552  1.00 22.98 ? 241 ILE A CB  1 
ATOM   1751 C  CG1 . ILE A 1 241 ? -14.805 18.859  -42.775  1.00 27.27 ? 241 ILE A CG1 1 
ATOM   1752 C  CG2 . ILE A 1 241 ? -15.521 21.073  -43.449  1.00 22.58 ? 241 ILE A CG2 1 
ATOM   1753 C  CD1 . ILE A 1 241 ? -14.786 18.412  -44.260  1.00 33.16 ? 241 ILE A CD1 1 
ATOM   1754 N  N   . ASN A 1 242 ? -17.637 19.012  -39.984  1.00 17.98 ? 242 ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 242 ? -18.092 17.982  -39.098  1.00 22.42 ? 242 ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 242 ? -18.814 16.962  -39.935  1.00 25.35 ? 242 ASN A C   1 
ATOM   1757 O  O   . ASN A 1 242 ? -19.861 17.265  -40.530  1.00 23.08 ? 242 ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 242 ? -19.021 18.584  -38.060  1.00 20.12 ? 242 ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 242 ? -19.846 17.626  -37.226  1.00 19.87 ? 242 ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 242 ? -19.987 16.409  -37.413  1.00 19.99 ? 242 ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 242 ? -20.539 18.230  -36.285  1.00 24.87 ? 242 ASN A ND2 1 
ATOM   1762 N  N   . PRO A 1 243 ? -18.292 15.730  -39.964  1.00 26.95 ? 243 PRO A N   1 
ATOM   1763 C  CA  . PRO A 1 243 ? -18.825 14.618  -40.736  1.00 26.08 ? 243 PRO A CA  1 
ATOM   1764 C  C   . PRO A 1 243 ? -20.306 14.388  -40.658  1.00 27.83 ? 243 PRO A C   1 
ATOM   1765 O  O   . PRO A 1 243 ? -20.925 13.893  -41.579  1.00 32.55 ? 243 PRO A O   1 
ATOM   1766 C  CB  . PRO A 1 243 ? -18.016 13.433  -40.246  1.00 22.62 ? 243 PRO A CB  1 
ATOM   1767 C  CG  . PRO A 1 243 ? -16.650 14.040  -40.095  1.00 23.08 ? 243 PRO A CG  1 
ATOM   1768 C  CD  . PRO A 1 243 ? -17.004 15.354  -39.377  1.00 28.07 ? 243 PRO A CD  1 
ATOM   1769 N  N   . GLN A 1 244 ? -20.941 14.791  -39.595  1.00 31.05 ? 244 GLN A N   1 
ATOM   1770 C  CA  . GLN A 1 244 ? -22.351 14.526  -39.437  1.00 35.18 ? 244 GLN A CA  1 
ATOM   1771 C  C   . GLN A 1 244 ? -23.239 15.515  -40.153  1.00 33.36 ? 244 GLN A C   1 
ATOM   1772 O  O   . GLN A 1 244 ? -24.468 15.421  -40.109  1.00 34.84 ? 244 GLN A O   1 
ATOM   1773 C  CB  . GLN A 1 244 ? -22.630 14.500  -37.936  1.00 41.18 ? 244 GLN A CB  1 
ATOM   1774 C  CG  . GLN A 1 244 ? -21.889 13.325  -37.312  1.00 46.30 ? 244 GLN A CG  1 
ATOM   1775 C  CD  . GLN A 1 244 ? -21.743 13.446  -35.814  1.00 51.83 ? 244 GLN A CD  1 
ATOM   1776 O  OE1 . GLN A 1 244 ? -22.114 12.547  -35.070  1.00 52.76 ? 244 GLN A OE1 1 
ATOM   1777 N  NE2 . GLN A 1 244 ? -21.174 14.540  -35.321  1.00 56.72 ? 244 GLN A NE2 1 
ATOM   1778 N  N   . ASP A 1 245 ? -22.619 16.519  -40.753  1.00 30.23 ? 245 ASP A N   1 
ATOM   1779 C  CA  . ASP A 1 245 ? -23.392 17.501  -41.465  1.00 27.74 ? 245 ASP A CA  1 
ATOM   1780 C  C   . ASP A 1 245 ? -23.693 17.132  -42.893  1.00 26.64 ? 245 ASP A C   1 
ATOM   1781 O  O   . ASP A 1 245 ? -24.653 17.622  -43.501  1.00 26.15 ? 245 ASP A O   1 
ATOM   1782 C  CB  . ASP A 1 245 ? -22.649 18.807  -41.393  1.00 26.86 ? 245 ASP A CB  1 
ATOM   1783 C  CG  . ASP A 1 245 ? -22.748 19.402  -39.991  1.00 25.69 ? 245 ASP A CG  1 
ATOM   1784 O  OD1 . ASP A 1 245 ? -23.746 19.144  -39.290  1.00 20.47 ? 245 ASP A OD1 1 
ATOM   1785 O  OD2 . ASP A 1 245 ? -21.826 20.134  -39.620  1.00 24.98 ? 245 ASP A OD2 1 
ATOM   1786 N  N   . TYR A 1 246 ? -22.906 16.191  -43.386  1.00 25.31 ? 246 TYR A N   1 
ATOM   1787 C  CA  . TYR A 1 246 ? -23.023 15.748  -44.745  1.00 25.83 ? 246 TYR A CA  1 
ATOM   1788 C  C   . TYR A 1 246 ? -23.770 14.460  -44.953  1.00 29.84 ? 246 TYR A C   1 
ATOM   1789 O  O   . TYR A 1 246 ? -23.833 13.597  -44.077  1.00 32.27 ? 246 TYR A O   1 
ATOM   1790 C  CB  . TYR A 1 246 ? -21.682 15.590  -45.291  1.00 22.01 ? 246 TYR A CB  1 
ATOM   1791 C  CG  . TYR A 1 246 ? -20.895 16.864  -45.223  1.00 17.35 ? 246 TYR A CG  1 
ATOM   1792 C  CD1 . TYR A 1 246 ? -21.054 17.805  -46.226  1.00 16.14 ? 246 TYR A CD1 1 
ATOM   1793 C  CD2 . TYR A 1 246 ? -19.950 17.038  -44.217  1.00 21.05 ? 246 TYR A CD2 1 
ATOM   1794 C  CE1 . TYR A 1 246 ? -20.244 18.937  -46.230  1.00 21.70 ? 246 TYR A CE1 1 
ATOM   1795 C  CE2 . TYR A 1 246 ? -19.134 18.168  -44.218  1.00 22.26 ? 246 TYR A CE2 1 
ATOM   1796 C  CZ  . TYR A 1 246 ? -19.290 19.101  -45.237  1.00 20.19 ? 246 TYR A CZ  1 
ATOM   1797 O  OH  . TYR A 1 246 ? -18.442 20.174  -45.314  1.00 20.64 ? 246 TYR A OH  1 
ATOM   1798 N  N   . LYS A 1 247 ? -24.336 14.358  -46.148  1.00 29.43 ? 247 LYS A N   1 
ATOM   1799 C  CA  . LYS A 1 247 ? -25.055 13.178  -46.537  1.00 29.67 ? 247 LYS A CA  1 
ATOM   1800 C  C   . LYS A 1 247 ? -24.125 12.217  -47.274  1.00 31.62 ? 247 LYS A C   1 
ATOM   1801 O  O   . LYS A 1 247 ? -24.487 11.057  -47.478  1.00 33.47 ? 247 LYS A O   1 
ATOM   1802 C  CB  . LYS A 1 247 ? -26.193 13.549  -47.446  1.00 34.16 ? 247 LYS A CB  1 
ATOM   1803 C  CG  . LYS A 1 247 ? -27.493 13.829  -46.737  1.00 38.60 ? 247 LYS A CG  1 
ATOM   1804 C  CD  . LYS A 1 247 ? -28.572 14.002  -47.796  1.00 41.52 ? 247 LYS A CD  1 
ATOM   1805 C  CE  . LYS A 1 247 ? -29.958 14.124  -47.167  1.00 47.15 ? 247 LYS A CE  1 
ATOM   1806 N  NZ  . LYS A 1 247 ? -30.085 15.325  -46.359  1.00 52.07 ? 247 LYS A NZ  1 
ATOM   1807 N  N   . LYS A 1 248 ? -22.921 12.619  -47.685  1.00 31.14 ? 248 LYS A N   1 
ATOM   1808 C  CA  . LYS A 1 248 ? -22.046 11.720  -48.416  1.00 36.14 ? 248 LYS A CA  1 
ATOM   1809 C  C   . LYS A 1 248 ? -20.739 11.490  -47.680  1.00 36.45 ? 248 LYS A C   1 
ATOM   1810 O  O   . LYS A 1 248 ? -20.293 12.411  -46.994  1.00 37.19 ? 248 LYS A O   1 
ATOM   1811 C  CB  . LYS A 1 248 ? -21.742 12.284  -49.832  1.00 36.62 ? 248 LYS A CB  1 
ATOM   1812 C  CG  . LYS A 1 248 ? -21.277 13.733  -49.867  1.00 42.06 ? 248 LYS A CG  1 
ATOM   1813 C  CD  . LYS A 1 248 ? -20.714 14.135  -51.220  1.00 45.01 ? 248 LYS A CD  1 
ATOM   1814 C  CE  . LYS A 1 248 ? -21.766 13.988  -52.320  1.00 49.55 ? 248 LYS A CE  1 
ATOM   1815 N  NZ  . LYS A 1 248 ? -21.198 14.245  -53.634  1.00 49.91 ? 248 LYS A NZ  1 
ATOM   1816 N  N   . PRO A 1 249 ? -20.069 10.330  -47.810  1.00 35.73 ? 249 PRO A N   1 
ATOM   1817 C  CA  . PRO A 1 249 ? -18.799 10.001  -47.156  1.00 32.55 ? 249 PRO A CA  1 
ATOM   1818 C  C   . PRO A 1 249 ? -17.779 11.117  -47.117  1.00 31.98 ? 249 PRO A C   1 
ATOM   1819 O  O   . PRO A 1 249 ? -17.381 11.689  -48.143  1.00 35.90 ? 249 PRO A O   1 
ATOM   1820 C  CB  . PRO A 1 249 ? -18.312 8.800   -47.904  1.00 28.22 ? 249 PRO A CB  1 
ATOM   1821 C  CG  . PRO A 1 249 ? -19.604 8.072   -48.126  1.00 33.37 ? 249 PRO A CG  1 
ATOM   1822 C  CD  . PRO A 1 249 ? -20.543 9.182   -48.575  1.00 33.99 ? 249 PRO A CD  1 
ATOM   1823 N  N   . ILE A 1 250 ? -17.283 11.358  -45.913  1.00 24.49 ? 250 ILE A N   1 
ATOM   1824 C  CA  . ILE A 1 250 ? -16.346 12.426  -45.699  1.00 22.15 ? 250 ILE A CA  1 
ATOM   1825 C  C   . ILE A 1 250 ? -15.108 12.467  -46.590  1.00 21.99 ? 250 ILE A C   1 
ATOM   1826 O  O   . ILE A 1 250 ? -14.522 13.536  -46.770  1.00 24.47 ? 250 ILE A O   1 
ATOM   1827 C  CB  . ILE A 1 250 ? -16.018 12.388  -44.160  1.00 26.84 ? 250 ILE A CB  1 
ATOM   1828 C  CG1 . ILE A 1 250 ? -15.186 13.596  -43.734  1.00 23.87 ? 250 ILE A CG1 1 
ATOM   1829 C  CG2 . ILE A 1 250 ? -15.250 11.114  -43.838  1.00 34.46 ? 250 ILE A CG2 1 
ATOM   1830 C  CD1 . ILE A 1 250 ? -15.919 14.936  -43.968  1.00 24.23 ? 250 ILE A CD1 1 
ATOM   1831 N  N   . GLN A 1 251 ? -14.656 11.380  -47.222  1.00 22.93 ? 251 GLN A N   1 
ATOM   1832 C  CA  . GLN A 1 251 ? -13.483 11.487  -48.098  1.00 20.33 ? 251 GLN A CA  1 
ATOM   1833 C  C   . GLN A 1 251 ? -13.939 12.056  -49.443  1.00 18.07 ? 251 GLN A C   1 
ATOM   1834 O  O   . GLN A 1 251 ? -13.252 12.875  -50.055  1.00 14.42 ? 251 GLN A O   1 
ATOM   1835 C  CB  . GLN A 1 251 ? -12.815 10.138  -48.293  1.00 20.07 ? 251 GLN A CB  1 
ATOM   1836 C  CG  . GLN A 1 251 ? -13.644 8.947   -48.763  1.00 22.97 ? 251 GLN A CG  1 
ATOM   1837 C  CD  . GLN A 1 251 ? -14.538 8.314   -47.720  1.00 27.11 ? 251 GLN A CD  1 
ATOM   1838 O  OE1 . GLN A 1 251 ? -15.311 7.430   -48.032  1.00 31.38 ? 251 GLN A OE1 1 
ATOM   1839 N  NE2 . GLN A 1 251 ? -14.585 8.679   -46.443  1.00 34.36 ? 251 GLN A NE2 1 
ATOM   1840 N  N   . GLU A 1 252 ? -15.179 11.756  -49.833  1.00 17.84 ? 252 GLU A N   1 
ATOM   1841 C  CA  . GLU A 1 252 ? -15.701 12.268  -51.076  1.00 20.98 ? 252 GLU A CA  1 
ATOM   1842 C  C   . GLU A 1 252 ? -15.870 13.781  -50.964  1.00 24.65 ? 252 GLU A C   1 
ATOM   1843 O  O   . GLU A 1 252 ? -15.388 14.510  -51.853  1.00 23.38 ? 252 GLU A O   1 
ATOM   1844 C  CB  . GLU A 1 252 ? -17.009 11.540  -51.384  1.00 18.85 ? 252 GLU A CB  1 
ATOM   1845 C  CG  . GLU A 1 252 ? -16.805 10.079  -51.841  1.00 30.08 ? 252 GLU A CG  1 
ATOM   1846 C  CD  . GLU A 1 252 ? -15.513 9.717   -52.618  1.00 40.98 ? 252 GLU A CD  1 
ATOM   1847 O  OE1 . GLU A 1 252 ? -15.203 10.302  -53.674  1.00 34.81 ? 252 GLU A OE1 1 
ATOM   1848 O  OE2 . GLU A 1 252 ? -14.798 8.821   -52.143  1.00 51.62 ? 252 GLU A OE2 1 
ATOM   1849 N  N   . VAL A 1 253 ? -16.425 14.251  -49.820  1.00 24.08 ? 253 VAL A N   1 
ATOM   1850 C  CA  . VAL A 1 253 ? -16.615 15.678  -49.533  1.00 21.07 ? 253 VAL A CA  1 
ATOM   1851 C  C   . VAL A 1 253 ? -15.300 16.412  -49.662  1.00 21.63 ? 253 VAL A C   1 
ATOM   1852 O  O   . VAL A 1 253 ? -15.175 17.416  -50.361  1.00 26.84 ? 253 VAL A O   1 
ATOM   1853 C  CB  . VAL A 1 253 ? -17.136 15.919  -48.099  1.00 22.70 ? 253 VAL A CB  1 
ATOM   1854 C  CG1 . VAL A 1 253 ? -17.014 17.385  -47.715  1.00 17.51 ? 253 VAL A CG1 1 
ATOM   1855 C  CG2 . VAL A 1 253 ? -18.605 15.522  -48.024  1.00 22.17 ? 253 VAL A CG2 1 
ATOM   1856 N  N   . LEU A 1 254 ? -14.281 15.906  -49.002  1.00 20.49 ? 254 LEU A N   1 
ATOM   1857 C  CA  . LEU A 1 254 ? -13.000 16.552  -49.049  1.00 19.34 ? 254 LEU A CA  1 
ATOM   1858 C  C   . LEU A 1 254 ? -12.355 16.454  -50.408  1.00 19.22 ? 254 LEU A C   1 
ATOM   1859 O  O   . LEU A 1 254 ? -11.684 17.409  -50.790  1.00 19.24 ? 254 LEU A O   1 
ATOM   1860 C  CB  . LEU A 1 254 ? -12.126 15.937  -47.964  1.00 22.46 ? 254 LEU A CB  1 
ATOM   1861 C  CG  . LEU A 1 254 ? -12.159 16.626  -46.608  1.00 20.60 ? 254 LEU A CG  1 
ATOM   1862 C  CD1 . LEU A 1 254 ? -11.930 15.615  -45.506  1.00 19.20 ? 254 LEU A CD1 1 
ATOM   1863 C  CD2 . LEU A 1 254 ? -11.098 17.722  -46.599  1.00 22.04 ? 254 LEU A CD2 1 
ATOM   1864 N  N   . LYS A 1 255 ? -12.484 15.354  -51.153  1.00 21.87 ? 255 LYS A N   1 
ATOM   1865 C  CA  . LYS A 1 255 ? -11.923 15.253  -52.496  1.00 22.83 ? 255 LYS A CA  1 
ATOM   1866 C  C   . LYS A 1 255 ? -12.550 16.357  -53.346  1.00 23.77 ? 255 LYS A C   1 
ATOM   1867 O  O   . LYS A 1 255 ? -11.799 17.146  -53.936  1.00 25.45 ? 255 LYS A O   1 
ATOM   1868 C  CB  . LYS A 1 255 ? -12.239 13.888  -53.082  1.00 23.87 ? 255 LYS A CB  1 
ATOM   1869 C  CG  . LYS A 1 255 ? -11.150 12.868  -52.756  1.00 30.16 ? 255 LYS A CG  1 
ATOM   1870 C  CD  . LYS A 1 255 ? -11.667 11.434  -52.750  1.00 32.60 ? 255 LYS A CD  1 
ATOM   1871 C  CE  . LYS A 1 255 ? -11.825 10.809  -54.116  1.00 36.86 ? 255 LYS A CE  1 
ATOM   1872 N  NZ  . LYS A 1 255 ? -12.362 9.467   -53.962  1.00 43.65 ? 255 LYS A NZ  1 
ATOM   1873 N  N   . GLU A 1 256 ? -13.889 16.490  -53.345  1.00 22.61 ? 256 GLU A N   1 
ATOM   1874 C  CA  . GLU A 1 256 ? -14.597 17.547  -54.072  1.00 24.90 ? 256 GLU A CA  1 
ATOM   1875 C  C   . GLU A 1 256 ? -14.174 18.954  -53.696  1.00 26.14 ? 256 GLU A C   1 
ATOM   1876 O  O   . GLU A 1 256 ? -14.112 19.855  -54.532  1.00 30.79 ? 256 GLU A O   1 
ATOM   1877 C  CB  . GLU A 1 256 ? -16.079 17.560  -53.838  1.00 25.12 ? 256 GLU A CB  1 
ATOM   1878 C  CG  . GLU A 1 256 ? -16.947 16.545  -54.534  1.00 31.22 ? 256 GLU A CG  1 
ATOM   1879 C  CD  . GLU A 1 256 ? -18.419 16.810  -54.226  1.00 43.45 ? 256 GLU A CD  1 
ATOM   1880 O  OE1 . GLU A 1 256 ? -18.942 17.880  -54.587  1.00 50.91 ? 256 GLU A OE1 1 
ATOM   1881 O  OE2 . GLU A 1 256 ? -19.043 15.941  -53.616  1.00 43.99 ? 256 GLU A OE2 1 
ATOM   1882 N  N   . MET A 1 257 ? -13.887 19.137  -52.416  1.00 24.68 ? 257 MET A N   1 
ATOM   1883 C  CA  . MET A 1 257 ? -13.469 20.394  -51.833  1.00 19.85 ? 257 MET A CA  1 
ATOM   1884 C  C   . MET A 1 257 ? -12.042 20.761  -52.128  1.00 19.81 ? 257 MET A C   1 
ATOM   1885 O  O   . MET A 1 257 ? -11.670 21.924  -51.936  1.00 21.33 ? 257 MET A O   1 
ATOM   1886 C  CB  . MET A 1 257 ? -13.670 20.278  -50.335  1.00 22.27 ? 257 MET A CB  1 
ATOM   1887 C  CG  . MET A 1 257 ? -13.303 21.429  -49.394  1.00 26.97 ? 257 MET A CG  1 
ATOM   1888 S  SD  . MET A 1 257 ? -13.564 20.972  -47.655  1.00 35.10 ? 257 MET A SD  1 
ATOM   1889 C  CE  . MET A 1 257 ? -15.226 20.371  -47.743  1.00 23.31 ? 257 MET A CE  1 
ATOM   1890 N  N   . THR A 1 258 ? -11.201 19.811  -52.534  1.00 18.12 ? 258 THR A N   1 
ATOM   1891 C  CA  . THR A 1 258 ? -9.808  20.166  -52.718  1.00 22.01 ? 258 THR A CA  1 
ATOM   1892 C  C   . THR A 1 258 ? -9.149  19.832  -54.038  1.00 26.68 ? 258 THR A C   1 
ATOM   1893 O  O   . THR A 1 258 ? -7.917  19.853  -54.149  1.00 24.41 ? 258 THR A O   1 
ATOM   1894 C  CB  . THR A 1 258 ? -8.979  19.537  -51.553  1.00 25.83 ? 258 THR A CB  1 
ATOM   1895 O  OG1 . THR A 1 258 ? -9.390  18.172  -51.381  1.00 21.10 ? 258 THR A OG1 1 
ATOM   1896 C  CG2 . THR A 1 258 ? -9.128  20.351  -50.279  1.00 20.92 ? 258 THR A CG2 1 
ATOM   1897 N  N   . ASP A 1 259 ? -9.998  19.527  -55.033  1.00 32.28 ? 259 ASP A N   1 
ATOM   1898 C  CA  . ASP A 1 259 ? -9.574  19.226  -56.398  1.00 36.78 ? 259 ASP A CA  1 
ATOM   1899 C  C   . ASP A 1 259 ? -8.896  17.857  -56.427  1.00 36.98 ? 259 ASP A C   1 
ATOM   1900 O  O   . ASP A 1 259 ? -7.802  17.571  -56.914  1.00 32.88 ? 259 ASP A O   1 
ATOM   1901 C  CB  . ASP A 1 259 ? -8.657  20.417  -56.897  1.00 40.08 ? 259 ASP A CB  1 
ATOM   1902 C  CG  . ASP A 1 259 ? -8.003  20.373  -58.276  1.00 45.96 ? 259 ASP A CG  1 
ATOM   1903 O  OD1 . ASP A 1 259 ? -8.646  19.949  -59.240  1.00 51.86 ? 259 ASP A OD1 1 
ATOM   1904 O  OD2 . ASP A 1 259 ? -6.843  20.781  -58.384  1.00 46.60 ? 259 ASP A OD2 1 
ATOM   1905 N  N   . GLY A 1 260 ? -9.719  16.982  -55.862  1.00 38.26 ? 260 GLY A N   1 
ATOM   1906 C  CA  . GLY A 1 260 ? -9.415  15.580  -55.806  1.00 38.87 ? 260 GLY A CA  1 
ATOM   1907 C  C   . GLY A 1 260 ? -8.522  15.131  -54.685  1.00 38.01 ? 260 GLY A C   1 
ATOM   1908 O  O   . GLY A 1 260 ? -7.696  14.248  -54.919  1.00 40.78 ? 260 GLY A O   1 
ATOM   1909 N  N   . GLY A 1 261 ? -8.627  15.721  -53.508  1.00 35.55 ? 261 GLY A N   1 
ATOM   1910 C  CA  . GLY A 1 261 ? -7.844  15.260  -52.395  1.00 27.79 ? 261 GLY A CA  1 
ATOM   1911 C  C   . GLY A 1 261 ? -6.776  16.203  -51.918  1.00 25.77 ? 261 GLY A C   1 
ATOM   1912 O  O   . GLY A 1 261 ? -6.093  16.899  -52.655  1.00 24.01 ? 261 GLY A O   1 
ATOM   1913 N  N   . VAL A 1 262 ? -6.567  16.084  -50.615  1.00 24.63 ? 262 VAL A N   1 
ATOM   1914 C  CA  . VAL A 1 262 ? -5.555  16.874  -49.939  1.00 18.55 ? 262 VAL A CA  1 
ATOM   1915 C  C   . VAL A 1 262 ? -4.166  16.375  -50.290  1.00 18.75 ? 262 VAL A C   1 
ATOM   1916 O  O   . VAL A 1 262 ? -3.956  15.296  -50.871  1.00 18.70 ? 262 VAL A O   1 
ATOM   1917 C  CB  . VAL A 1 262 ? -5.775  16.785  -48.415  1.00 21.08 ? 262 VAL A CB  1 
ATOM   1918 C  CG1 . VAL A 1 262 ? -7.165  17.271  -48.060  1.00 18.68 ? 262 VAL A CG1 1 
ATOM   1919 C  CG2 . VAL A 1 262 ? -5.715  15.364  -47.937  1.00 20.14 ? 262 VAL A CG2 1 
ATOM   1920 N  N   . ASP A 1 263 ? -3.160  17.115  -49.874  1.00 19.63 ? 263 ASP A N   1 
ATOM   1921 C  CA  . ASP A 1 263 ? -1.815  16.684  -50.131  1.00 20.84 ? 263 ASP A CA  1 
ATOM   1922 C  C   . ASP A 1 263 ? -1.291  15.870  -48.952  1.00 22.42 ? 263 ASP A C   1 
ATOM   1923 O  O   . ASP A 1 263 ? -0.540  14.899  -49.155  1.00 20.64 ? 263 ASP A O   1 
ATOM   1924 C  CB  . ASP A 1 263 ? -0.885  17.864  -50.334  1.00 27.04 ? 263 ASP A CB  1 
ATOM   1925 C  CG  . ASP A 1 263 ? -1.166  18.756  -51.532  1.00 31.28 ? 263 ASP A CG  1 
ATOM   1926 O  OD1 . ASP A 1 263 ? -1.704  18.285  -52.531  1.00 33.10 ? 263 ASP A OD1 1 
ATOM   1927 O  OD2 . ASP A 1 263 ? -0.828  19.934  -51.457  1.00 34.28 ? 263 ASP A OD2 1 
ATOM   1928 N  N   . PHE A 1 264 ? -1.659  16.286  -47.726  1.00 19.05 ? 264 PHE A N   1 
ATOM   1929 C  CA  . PHE A 1 264 ? -1.228  15.655  -46.475  1.00 14.96 ? 264 PHE A CA  1 
ATOM   1930 C  C   . PHE A 1 264 ? -2.408  15.349  -45.588  1.00 13.79 ? 264 PHE A C   1 
ATOM   1931 O  O   . PHE A 1 264 ? -3.126  16.316  -45.336  1.00 17.41 ? 264 PHE A O   1 
ATOM   1932 C  CB  . PHE A 1 264 ? -0.278  16.596  -45.806  1.00 10.77 ? 264 PHE A CB  1 
ATOM   1933 C  CG  . PHE A 1 264 ? 1.021   16.688  -46.608  1.00 10.04 ? 264 PHE A CG  1 
ATOM   1934 C  CD1 . PHE A 1 264 ? 1.898   15.595  -46.660  1.00 11.80 ? 264 PHE A CD1 1 
ATOM   1935 C  CD2 . PHE A 1 264 ? 1.370   17.868  -47.243  1.00 8.37  ? 264 PHE A CD2 1 
ATOM   1936 C  CE1 . PHE A 1 264 ? 3.127   15.694  -47.330  1.00 8.87  ? 264 PHE A CE1 1 
ATOM   1937 C  CE2 . PHE A 1 264 ? 2.599   17.959  -47.912  1.00 10.95 ? 264 PHE A CE2 1 
ATOM   1938 C  CZ  . PHE A 1 264 ? 3.484   16.884  -47.956  1.00 5.74  ? 264 PHE A CZ  1 
ATOM   1939 N  N   . SER A 1 265 ? -2.804  14.124  -45.208  1.00 12.74 ? 265 SER A N   1 
ATOM   1940 C  CA  . SER A 1 265 ? -3.949  13.990  -44.311  1.00 15.49 ? 265 SER A CA  1 
ATOM   1941 C  C   . SER A 1 265 ? -3.447  13.283  -43.052  1.00 16.17 ? 265 SER A C   1 
ATOM   1942 O  O   . SER A 1 265 ? -2.481  12.527  -43.140  1.00 13.72 ? 265 SER A O   1 
ATOM   1943 C  CB  . SER A 1 265 ? -5.106  13.223  -44.957  1.00 13.14 ? 265 SER A CB  1 
ATOM   1944 O  OG  . SER A 1 265 ? -4.707  12.095  -45.682  1.00 23.09 ? 265 SER A OG  1 
ATOM   1945 N  N   . PHE A 1 266 ? -4.010  13.615  -41.879  1.00 14.06 ? 266 PHE A N   1 
ATOM   1946 C  CA  . PHE A 1 266 ? -3.556  13.117  -40.572  1.00 11.89 ? 266 PHE A CA  1 
ATOM   1947 C  C   . PHE A 1 266 ? -4.664  12.513  -39.789  1.00 10.49 ? 266 PHE A C   1 
ATOM   1948 O  O   . PHE A 1 266 ? -5.718  13.140  -39.653  1.00 12.65 ? 266 PHE A O   1 
ATOM   1949 C  CB  . PHE A 1 266 ? -3.008  14.220  -39.714  1.00 2.73  ? 266 PHE A CB  1 
ATOM   1950 C  CG  . PHE A 1 266 ? -1.812  14.930  -40.381  1.00 4.48  ? 266 PHE A CG  1 
ATOM   1951 C  CD1 . PHE A 1 266 ? -2.011  16.003  -41.246  1.00 2.92  ? 266 PHE A CD1 1 
ATOM   1952 C  CD2 . PHE A 1 266 ? -0.528  14.489  -40.132  1.00 2.00  ? 266 PHE A CD2 1 
ATOM   1953 C  CE1 . PHE A 1 266 ? -0.938  16.627  -41.857  1.00 2.00  ? 266 PHE A CE1 1 
ATOM   1954 C  CE2 . PHE A 1 266 ? 0.554   15.115  -40.742  1.00 4.14  ? 266 PHE A CE2 1 
ATOM   1955 C  CZ  . PHE A 1 266 ? 0.351   16.183  -41.610  1.00 2.00  ? 266 PHE A CZ  1 
ATOM   1956 N  N   . GLU A 1 267 ? -4.511  11.281  -39.347  1.00 10.21 ? 267 GLU A N   1 
ATOM   1957 C  CA  . GLU A 1 267 ? -5.574  10.728  -38.557  1.00 12.18 ? 267 GLU A CA  1 
ATOM   1958 C  C   . GLU A 1 267 ? -5.112  10.811  -37.097  1.00 15.09 ? 267 GLU A C   1 
ATOM   1959 O  O   . GLU A 1 267 ? -4.128  10.121  -36.764  1.00 14.80 ? 267 GLU A O   1 
ATOM   1960 C  CB  . GLU A 1 267 ? -5.814  9.316   -38.982  1.00 8.07  ? 267 GLU A CB  1 
ATOM   1961 C  CG  . GLU A 1 267 ? -7.173  8.919   -38.455  1.00 15.08 ? 267 GLU A CG  1 
ATOM   1962 C  CD  . GLU A 1 267 ? -7.185  8.099   -37.171  1.00 15.37 ? 267 GLU A CD  1 
ATOM   1963 O  OE1 . GLU A 1 267 ? -6.145  8.038   -36.513  1.00 11.48 ? 267 GLU A OE1 1 
ATOM   1964 O  OE2 . GLU A 1 267 ? -8.226  7.496   -36.869  1.00 2.92  ? 267 GLU A OE2 1 
ATOM   1965 N  N   . VAL A 1 268 ? -5.720  11.644  -36.211  1.00 12.67 ? 268 VAL A N   1 
ATOM   1966 C  CA  . VAL A 1 268 ? -5.299  11.702  -34.797  1.00 13.63 ? 268 VAL A CA  1 
ATOM   1967 C  C   . VAL A 1 268 ? -6.458  11.407  -33.849  1.00 10.93 ? 268 VAL A C   1 
ATOM   1968 O  O   . VAL A 1 268 ? -6.835  12.166  -32.971  1.00 14.99 ? 268 VAL A O   1 
ATOM   1969 C  CB  . VAL A 1 268 ? -4.699  13.067  -34.517  1.00 11.33 ? 268 VAL A CB  1 
ATOM   1970 C  CG1 . VAL A 1 268 ? -3.708  12.844  -33.421  1.00 10.34 ? 268 VAL A CG1 1 
ATOM   1971 C  CG2 . VAL A 1 268 ? -3.887  13.650  -35.672  1.00 14.00 ? 268 VAL A CG2 1 
ATOM   1972 N  N   . ILE A 1 269 ? -7.036  10.226  -34.036  1.00 8.29  ? 269 ILE A N   1 
ATOM   1973 C  CA  . ILE A 1 269 ? -8.198  9.766   -33.299  1.00 9.99  ? 269 ILE A CA  1 
ATOM   1974 C  C   . ILE A 1 269 ? -7.899  8.345   -32.862  1.00 17.84 ? 269 ILE A C   1 
ATOM   1975 O  O   . ILE A 1 269 ? -7.947  8.017   -31.681  1.00 22.08 ? 269 ILE A O   1 
ATOM   1976 C  CB  . ILE A 1 269 ? -9.463  9.694   -34.176  1.00 11.45 ? 269 ILE A CB  1 
ATOM   1977 C  CG1 . ILE A 1 269 ? -9.725  11.056  -34.789  1.00 11.53 ? 269 ILE A CG1 1 
ATOM   1978 C  CG2 . ILE A 1 269 ? -10.637 9.182   -33.355  1.00 8.72  ? 269 ILE A CG2 1 
ATOM   1979 C  CD1 . ILE A 1 269 ? -10.756 11.030  -35.917  1.00 11.18 ? 269 ILE A CD1 1 
ATOM   1980 N  N   . GLY A 1 270 ? -7.637  7.467   -33.825  1.00 18.00 ? 270 GLY A N   1 
ATOM   1981 C  CA  . GLY A 1 270 ? -7.372  6.069   -33.582  1.00 17.05 ? 270 GLY A CA  1 
ATOM   1982 C  C   . GLY A 1 270 ? -8.572  5.207   -33.967  1.00 18.85 ? 270 GLY A C   1 
ATOM   1983 O  O   . GLY A 1 270 ? -8.860  4.223   -33.303  1.00 25.67 ? 270 GLY A O   1 
ATOM   1984 N  N   . ARG A 1 271 ? -9.393  5.506   -34.957  1.00 21.37 ? 271 ARG A N   1 
ATOM   1985 C  CA  . ARG A 1 271 ? -10.503 4.640   -35.321  1.00 21.74 ? 271 ARG A CA  1 
ATOM   1986 C  C   . ARG A 1 271 ? -10.245 4.073   -36.710  1.00 23.96 ? 271 ARG A C   1 
ATOM   1987 O  O   . ARG A 1 271 ? -9.570  4.721   -37.509  1.00 27.10 ? 271 ARG A O   1 
ATOM   1988 C  CB  . ARG A 1 271 ? -11.768 5.413   -35.347  1.00 19.77 ? 271 ARG A CB  1 
ATOM   1989 C  CG  . ARG A 1 271 ? -12.225 5.838   -33.981  1.00 28.45 ? 271 ARG A CG  1 
ATOM   1990 C  CD  . ARG A 1 271 ? -13.312 6.863   -34.105  1.00 32.75 ? 271 ARG A CD  1 
ATOM   1991 N  NE  . ARG A 1 271 ? -14.390 6.330   -34.918  1.00 41.46 ? 271 ARG A NE  1 
ATOM   1992 C  CZ  . ARG A 1 271 ? -15.375 5.595   -34.412  1.00 45.09 ? 271 ARG A CZ  1 
ATOM   1993 N  NH1 . ARG A 1 271 ? -15.443 5.345   -33.111  1.00 48.86 ? 271 ARG A NH1 1 
ATOM   1994 N  NH2 . ARG A 1 271 ? -16.323 5.132   -35.227  1.00 45.03 ? 271 ARG A NH2 1 
ATOM   1995 N  N   . LEU A 1 272 ? -10.761 2.912   -37.087  1.00 25.83 ? 272 LEU A N   1 
ATOM   1996 C  CA  . LEU A 1 272 ? -10.518 2.369   -38.425  1.00 26.34 ? 272 LEU A CA  1 
ATOM   1997 C  C   . LEU A 1 272 ? -11.241 3.086   -39.552  1.00 22.20 ? 272 LEU A C   1 
ATOM   1998 O  O   . LEU A 1 272 ? -10.673 3.360   -40.608  1.00 25.47 ? 272 LEU A O   1 
ATOM   1999 C  CB  . LEU A 1 272 ? -10.916 0.913   -38.489  1.00 22.78 ? 272 LEU A CB  1 
ATOM   2000 C  CG  . LEU A 1 272 ? -10.098 -0.024  -37.656  1.00 21.33 ? 272 LEU A CG  1 
ATOM   2001 C  CD1 . LEU A 1 272 ? -10.717 -1.376  -37.936  1.00 30.09 ? 272 LEU A CD1 1 
ATOM   2002 C  CD2 . LEU A 1 272 ? -8.619  0.024   -37.934  1.00 13.16 ? 272 LEU A CD2 1 
ATOM   2003 N  N   . ASP A 1 273 ? -12.479 3.468   -39.335  1.00 19.99 ? 273 ASP A N   1 
ATOM   2004 C  CA  . ASP A 1 273 ? -13.250 4.186   -40.333  1.00 21.93 ? 273 ASP A CA  1 
ATOM   2005 C  C   . ASP A 1 273 ? -12.570 5.519   -40.687  1.00 22.62 ? 273 ASP A C   1 
ATOM   2006 O  O   . ASP A 1 273 ? -12.462 5.884   -41.850  1.00 27.17 ? 273 ASP A O   1 
ATOM   2007 C  CB  . ASP A 1 273 ? -14.668 4.373   -39.774  1.00 21.17 ? 273 ASP A CB  1 
ATOM   2008 C  CG  . ASP A 1 273 ? -14.874 5.198   -38.514  1.00 26.92 ? 273 ASP A CG  1 
ATOM   2009 O  OD1 . ASP A 1 273 ? -13.911 5.555   -37.847  1.00 30.72 ? 273 ASP A OD1 1 
ATOM   2010 O  OD2 . ASP A 1 273 ? -16.025 5.507   -38.203  1.00 32.21 ? 273 ASP A OD2 1 
ATOM   2011 N  N   . THR A 1 274 ? -11.953 6.216   -39.736  1.00 20.22 ? 274 THR A N   1 
ATOM   2012 C  CA  . THR A 1 274 ? -11.288 7.462   -40.011  1.00 15.80 ? 274 THR A CA  1 
ATOM   2013 C  C   . THR A 1 274 ? -9.910  7.218   -40.534  1.00 19.17 ? 274 THR A C   1 
ATOM   2014 O  O   . THR A 1 274 ? -9.349  8.120   -41.163  1.00 22.72 ? 274 THR A O   1 
ATOM   2015 C  CB  . THR A 1 274 ? -11.262 8.313   -38.722  1.00 18.29 ? 274 THR A CB  1 
ATOM   2016 O  OG1 . THR A 1 274 ? -10.994 7.440   -37.621  1.00 14.05 ? 274 THR A OG1 1 
ATOM   2017 C  CG2 . THR A 1 274 ? -12.586 9.048   -38.524  1.00 7.03  ? 274 THR A CG2 1 
ATOM   2018 N  N   . MET A 1 275 ? -9.302  6.045   -40.331  1.00 18.52 ? 275 MET A N   1 
ATOM   2019 C  CA  . MET A 1 275 ? -7.966  5.841   -40.886  1.00 18.31 ? 275 MET A CA  1 
ATOM   2020 C  C   . MET A 1 275 ? -8.088  5.527   -42.379  1.00 16.77 ? 275 MET A C   1 
ATOM   2021 O  O   . MET A 1 275 ? -7.210  5.843   -43.180  1.00 10.11 ? 275 MET A O   1 
ATOM   2022 C  CB  . MET A 1 275 ? -7.290  4.708   -40.232  1.00 18.90 ? 275 MET A CB  1 
ATOM   2023 C  CG  . MET A 1 275 ? -6.805  5.010   -38.860  1.00 19.25 ? 275 MET A CG  1 
ATOM   2024 S  SD  . MET A 1 275 ? -6.190  3.461   -38.194  1.00 16.84 ? 275 MET A SD  1 
ATOM   2025 C  CE  . MET A 1 275 ? -4.970  4.225   -37.166  1.00 19.40 ? 275 MET A CE  1 
ATOM   2026 N  N   . MET A 1 276 ? -9.209  4.894   -42.722  1.00 13.42 ? 276 MET A N   1 
ATOM   2027 C  CA  . MET A 1 276 ? -9.555  4.567   -44.074  1.00 14.57 ? 276 MET A CA  1 
ATOM   2028 C  C   . MET A 1 276 ? -9.918  5.895   -44.735  1.00 18.97 ? 276 MET A C   1 
ATOM   2029 O  O   . MET A 1 276 ? -9.228  6.329   -45.669  1.00 18.35 ? 276 MET A O   1 
ATOM   2030 C  CB  . MET A 1 276 ? -10.756 3.629   -44.114  1.00 16.31 ? 276 MET A CB  1 
ATOM   2031 C  CG  . MET A 1 276 ? -11.055 3.069   -45.511  1.00 27.25 ? 276 MET A CG  1 
ATOM   2032 S  SD  . MET A 1 276 ? -9.811  1.968   -46.259  1.00 30.52 ? 276 MET A SD  1 
ATOM   2033 C  CE  . MET A 1 276 ? -8.462  2.985   -46.777  1.00 26.24 ? 276 MET A CE  1 
ATOM   2034 N  N   . ALA A 1 277 ? -10.932 6.627   -44.237  1.00 19.45 ? 277 ALA A N   1 
ATOM   2035 C  CA  . ALA A 1 277 ? -11.309 7.908   -44.818  1.00 14.69 ? 277 ALA A CA  1 
ATOM   2036 C  C   . ALA A 1 277 ? -10.148 8.872   -44.915  1.00 14.13 ? 277 ALA A C   1 
ATOM   2037 O  O   . ALA A 1 277 ? -10.060 9.634   -45.858  1.00 16.99 ? 277 ALA A O   1 
ATOM   2038 C  CB  . ALA A 1 277 ? -12.365 8.537   -43.994  1.00 17.81 ? 277 ALA A CB  1 
ATOM   2039 N  N   . SER A 1 278 ? -9.168  8.834   -44.029  1.00 17.21 ? 278 SER A N   1 
ATOM   2040 C  CA  . SER A 1 278 ? -8.033  9.719   -44.081  1.00 12.66 ? 278 SER A CA  1 
ATOM   2041 C  C   . SER A 1 278 ? -7.140  9.216   -45.178  1.00 15.63 ? 278 SER A C   1 
ATOM   2042 O  O   . SER A 1 278 ? -6.372  10.037  -45.682  1.00 17.97 ? 278 SER A O   1 
ATOM   2043 C  CB  . SER A 1 278 ? -7.338  9.692   -42.714  1.00 10.66 ? 278 SER A CB  1 
ATOM   2044 O  OG  . SER A 1 278 ? -6.112  10.401  -42.554  1.00 18.77 ? 278 SER A OG  1 
ATOM   2045 N  N   . LEU A 1 279 ? -7.107  7.917   -45.549  1.00 13.92 ? 279 LEU A N   1 
ATOM   2046 C  CA  . LEU A 1 279 ? -6.241  7.491   -46.652  1.00 12.90 ? 279 LEU A CA  1 
ATOM   2047 C  C   . LEU A 1 279 ? -6.907  8.020   -47.947  1.00 11.30 ? 279 LEU A C   1 
ATOM   2048 O  O   . LEU A 1 279 ? -6.359  8.817   -48.690  1.00 15.89 ? 279 LEU A O   1 
ATOM   2049 C  CB  . LEU A 1 279 ? -6.132  5.950   -46.692  1.00 6.37  ? 279 LEU A CB  1 
ATOM   2050 C  CG  . LEU A 1 279 ? -5.157  5.395   -47.740  1.00 5.08  ? 279 LEU A CG  1 
ATOM   2051 C  CD1 . LEU A 1 279 ? -3.735  5.912   -47.506  1.00 2.00  ? 279 LEU A CD1 1 
ATOM   2052 C  CD2 . LEU A 1 279 ? -5.217  3.903   -47.688  1.00 3.29  ? 279 LEU A CD2 1 
ATOM   2053 N  N   . LEU A 1 280 ? -8.149  7.624   -48.150  1.00 6.25  ? 280 LEU A N   1 
ATOM   2054 C  CA  . LEU A 1 280 ? -8.973  8.006   -49.237  1.00 12.38 ? 280 LEU A CA  1 
ATOM   2055 C  C   . LEU A 1 280 ? -9.018  9.506   -49.535  1.00 21.48 ? 280 LEU A C   1 
ATOM   2056 O  O   . LEU A 1 280 ? -8.901  9.897   -50.701  1.00 28.74 ? 280 LEU A O   1 
ATOM   2057 C  CB  . LEU A 1 280 ? -10.352 7.500   -48.939  1.00 3.77  ? 280 LEU A CB  1 
ATOM   2058 C  CG  . LEU A 1 280 ? -10.551 5.999   -48.873  1.00 4.56  ? 280 LEU A CG  1 
ATOM   2059 C  CD1 . LEU A 1 280 ? -12.022 5.653   -48.602  1.00 2.00  ? 280 LEU A CD1 1 
ATOM   2060 C  CD2 . LEU A 1 280 ? -10.096 5.406   -50.181  1.00 2.00  ? 280 LEU A CD2 1 
ATOM   2061 N  N   . CYS A 1 281 ? -9.107  10.374  -48.522  1.00 18.67 ? 281 CYS A N   1 
ATOM   2062 C  CA  . CYS A 1 281 ? -9.220  11.824  -48.699  1.00 14.07 ? 281 CYS A CA  1 
ATOM   2063 C  C   . CYS A 1 281 ? -7.986  12.427  -49.276  1.00 9.43  ? 281 CYS A C   1 
ATOM   2064 O  O   . CYS A 1 281 ? -8.034  13.595  -49.684  1.00 9.77  ? 281 CYS A O   1 
ATOM   2065 C  CB  . CYS A 1 281 ? -9.517  12.584  -47.340  1.00 13.89 ? 281 CYS A CB  1 
ATOM   2066 S  SG  . CYS A 1 281 ? -8.071  13.171  -46.397  1.00 18.71 ? 281 CYS A SG  1 
ATOM   2067 N  N   . CYS A 1 282 ? -6.857  11.740  -49.324  1.00 11.45 ? 282 CYS A N   1 
ATOM   2068 C  CA  . CYS A 1 282 ? -5.685  12.432  -49.846  1.00 16.33 ? 282 CYS A CA  1 
ATOM   2069 C  C   . CYS A 1 282 ? -5.556  12.077  -51.327  1.00 20.84 ? 282 CYS A C   1 
ATOM   2070 O  O   . CYS A 1 282 ? -6.023  11.036  -51.819  1.00 23.90 ? 282 CYS A O   1 
ATOM   2071 C  CB  . CYS A 1 282 ? -4.430  12.027  -49.009  1.00 13.53 ? 282 CYS A CB  1 
ATOM   2072 S  SG  . CYS A 1 282 ? -3.900  10.306  -49.155  1.00 21.42 ? 282 CYS A SG  1 
ATOM   2073 N  N   . HIS A 1 283 ? -4.898  12.959  -52.070  1.00 21.08 ? 283 HIS A N   1 
ATOM   2074 C  CA  . HIS A 1 283 ? -4.740  12.797  -53.487  1.00 17.28 ? 283 HIS A CA  1 
ATOM   2075 C  C   . HIS A 1 283 ? -4.037  11.505  -53.825  1.00 18.84 ? 283 HIS A C   1 
ATOM   2076 O  O   . HIS A 1 283 ? -2.870  11.250  -53.482  1.00 17.08 ? 283 HIS A O   1 
ATOM   2077 C  CB  . HIS A 1 283 ? -3.934  13.955  -54.077  1.00 19.50 ? 283 HIS A CB  1 
ATOM   2078 C  CG  . HIS A 1 283 ? -4.178  14.075  -55.591  1.00 31.95 ? 283 HIS A CG  1 
ATOM   2079 N  ND1 . HIS A 1 283 ? -5.281  14.520  -56.195  1.00 34.04 ? 283 HIS A ND1 1 
ATOM   2080 C  CD2 . HIS A 1 283 ? -3.312  13.678  -56.585  1.00 28.94 ? 283 HIS A CD2 1 
ATOM   2081 C  CE1 . HIS A 1 283 ? -5.127  14.400  -57.485  1.00 35.71 ? 283 HIS A CE1 1 
ATOM   2082 N  NE2 . HIS A 1 283 ? -3.934  13.892  -57.706  1.00 30.54 ? 283 HIS A NE2 1 
ATOM   2083 N  N   . GLU A 1 284 ? -4.747  10.846  -54.732  1.00 20.45 ? 284 GLU A N   1 
ATOM   2084 C  CA  . GLU A 1 284 ? -4.375  9.561   -55.319  1.00 22.26 ? 284 GLU A CA  1 
ATOM   2085 C  C   . GLU A 1 284 ? -3.005  9.435   -55.969  1.00 21.09 ? 284 GLU A C   1 
ATOM   2086 O  O   . GLU A 1 284 ? -2.467  8.344   -56.129  1.00 24.30 ? 284 GLU A O   1 
ATOM   2087 C  CB  . GLU A 1 284 ? -5.484  9.275   -56.279  1.00 25.32 ? 284 GLU A CB  1 
ATOM   2088 C  CG  . GLU A 1 284 ? -5.353  8.157   -57.261  1.00 33.67 ? 284 GLU A CG  1 
ATOM   2089 C  CD  . GLU A 1 284 ? -6.106  8.537   -58.519  1.00 37.35 ? 284 GLU A CD  1 
ATOM   2090 O  OE1 . GLU A 1 284 ? -5.638  9.446   -59.209  1.00 40.81 ? 284 GLU A OE1 1 
ATOM   2091 O  OE2 . GLU A 1 284 ? -7.151  7.938   -58.796  1.00 36.88 ? 284 GLU A OE2 1 
ATOM   2092 N  N   . ALA A 1 285 ? -2.370  10.544  -56.301  1.00 19.23 ? 285 ALA A N   1 
ATOM   2093 C  CA  . ALA A 1 285 ? -1.087  10.487  -56.955  1.00 18.47 ? 285 ALA A CA  1 
ATOM   2094 C  C   . ALA A 1 285 ? -0.016  11.316  -56.307  1.00 22.63 ? 285 ALA A C   1 
ATOM   2095 O  O   . ALA A 1 285 ? 1.144   11.268  -56.722  1.00 27.44 ? 285 ALA A O   1 
ATOM   2096 C  CB  . ALA A 1 285 ? -1.237  10.962  -58.374  1.00 22.43 ? 285 ALA A CB  1 
ATOM   2097 N  N   . CYS A 1 286 ? -0.377  12.123  -55.319  1.00 21.68 ? 286 CYS A N   1 
ATOM   2098 C  CA  . CYS A 1 286 ? 0.630   12.947  -54.669  1.00 24.88 ? 286 CYS A CA  1 
ATOM   2099 C  C   . CYS A 1 286 ? 0.414   13.058  -53.141  1.00 24.31 ? 286 CYS A C   1 
ATOM   2100 O  O   . CYS A 1 286 ? 1.169   13.777  -52.468  1.00 23.30 ? 286 CYS A O   1 
ATOM   2101 C  CB  . CYS A 1 286 ? 0.609   14.353  -55.338  1.00 28.44 ? 286 CYS A CB  1 
ATOM   2102 S  SG  . CYS A 1 286 ? -1.036  15.133  -55.390  1.00 32.69 ? 286 CYS A SG  1 
ATOM   2103 N  N   . GLY A 1 287 ? -0.590  12.364  -52.579  1.00 18.83 ? 287 GLY A N   1 
ATOM   2104 C  CA  . GLY A 1 287 ? -0.882  12.463  -51.175  1.00 22.54 ? 287 GLY A CA  1 
ATOM   2105 C  C   . GLY A 1 287 ? -0.094  11.498  -50.300  1.00 24.94 ? 287 GLY A C   1 
ATOM   2106 O  O   . GLY A 1 287 ? 0.285   10.400  -50.727  1.00 21.83 ? 287 GLY A O   1 
ATOM   2107 N  N   . THR A 1 288 ? 0.159   12.009  -49.086  1.00 25.68 ? 288 THR A N   1 
ATOM   2108 C  CA  . THR A 1 288 ? 0.794   11.324  -47.969  1.00 19.92 ? 288 THR A CA  1 
ATOM   2109 C  C   . THR A 1 288 ? -0.260  11.282  -46.848  1.00 16.94 ? 288 THR A C   1 
ATOM   2110 O  O   . THR A 1 288 ? -0.773  12.351  -46.480  1.00 12.07 ? 288 THR A O   1 
ATOM   2111 C  CB  . THR A 1 288 ? 1.960   12.098  -47.496  1.00 18.31 ? 288 THR A CB  1 
ATOM   2112 O  OG1 . THR A 1 288 ? 2.844   12.159  -48.580  1.00 20.46 ? 288 THR A OG1 1 
ATOM   2113 C  CG2 . THR A 1 288 ? 2.623   11.473  -46.289  1.00 25.25 ? 288 THR A CG2 1 
ATOM   2114 N  N   . SER A 1 289 ? -0.653  10.105  -46.337  1.00 16.19 ? 289 SER A N   1 
ATOM   2115 C  CA  . SER A 1 289 ? -1.613  9.920   -45.238  1.00 13.00 ? 289 SER A CA  1 
ATOM   2116 C  C   . SER A 1 289 ? -0.690  9.463   -44.104  1.00 15.23 ? 289 SER A C   1 
ATOM   2117 O  O   . SER A 1 289 ? 0.148   8.546   -44.258  1.00 12.89 ? 289 SER A O   1 
ATOM   2118 C  CB  . SER A 1 289 ? -2.550  8.815   -45.498  1.00 14.10 ? 289 SER A CB  1 
ATOM   2119 O  OG  . SER A 1 289 ? -3.817  8.914   -44.884  1.00 25.29 ? 289 SER A OG  1 
ATOM   2120 N  N   . VAL A 1 290 ? -0.734  10.206  -43.004  1.00 14.40 ? 290 VAL A N   1 
ATOM   2121 C  CA  . VAL A 1 290 ? 0.061   9.909   -41.835  1.00 13.61 ? 290 VAL A CA  1 
ATOM   2122 C  C   . VAL A 1 290 ? -0.866  9.427   -40.726  1.00 14.22 ? 290 VAL A C   1 
ATOM   2123 O  O   . VAL A 1 290 ? -1.933  10.031  -40.472  1.00 13.50 ? 290 VAL A O   1 
ATOM   2124 C  CB  . VAL A 1 290 ? 0.800   11.153  -41.438  1.00 9.69  ? 290 VAL A CB  1 
ATOM   2125 C  CG1 . VAL A 1 290 ? 1.762   10.855  -40.309  1.00 14.73 ? 290 VAL A CG1 1 
ATOM   2126 C  CG2 . VAL A 1 290 ? 1.688   11.586  -42.560  1.00 21.17 ? 290 VAL A CG2 1 
ATOM   2127 N  N   . ILE A 1 291 ? -0.513  8.273   -40.143  1.00 14.13 ? 291 ILE A N   1 
ATOM   2128 C  CA  . ILE A 1 291 ? -1.270  7.669   -39.027  1.00 16.72 ? 291 ILE A CA  1 
ATOM   2129 C  C   . ILE A 1 291 ? -0.590  8.043   -37.716  1.00 16.50 ? 291 ILE A C   1 
ATOM   2130 O  O   . ILE A 1 291 ? 0.612   7.791   -37.503  1.00 17.93 ? 291 ILE A O   1 
ATOM   2131 C  CB  . ILE A 1 291 ? -1.300  6.154   -39.067  1.00 18.46 ? 291 ILE A CB  1 
ATOM   2132 C  CG1 . ILE A 1 291 ? -2.045  5.697   -40.280  1.00 13.82 ? 291 ILE A CG1 1 
ATOM   2133 C  CG2 . ILE A 1 291 ? -1.964  5.628   -37.796  1.00 19.08 ? 291 ILE A CG2 1 
ATOM   2134 C  CD1 . ILE A 1 291 ? -2.038  4.170   -40.336  1.00 10.67 ? 291 ILE A CD1 1 
ATOM   2135 N  N   . VAL A 1 292 ? -1.403  8.723   -36.908  1.00 15.43 ? 292 VAL A N   1 
ATOM   2136 C  CA  . VAL A 1 292 ? -0.973  9.177   -35.604  1.00 17.71 ? 292 VAL A CA  1 
ATOM   2137 C  C   . VAL A 1 292 ? -1.832  8.511   -34.509  1.00 20.37 ? 292 VAL A C   1 
ATOM   2138 O  O   . VAL A 1 292 ? -1.298  8.127   -33.471  1.00 23.09 ? 292 VAL A O   1 
ATOM   2139 C  CB  . VAL A 1 292 ? -1.090  10.689  -35.549  1.00 17.07 ? 292 VAL A CB  1 
ATOM   2140 C  CG1 . VAL A 1 292 ? -0.448  11.154  -34.246  1.00 13.48 ? 292 VAL A CG1 1 
ATOM   2141 C  CG2 . VAL A 1 292 ? -0.321  11.367  -36.704  1.00 23.11 ? 292 VAL A CG2 1 
ATOM   2142 N  N   . GLY A 1 293 ? -3.138  8.306   -34.681  1.00 15.40 ? 293 GLY A N   1 
ATOM   2143 C  CA  . GLY A 1 293 ? -3.965  7.700   -33.671  1.00 19.89 ? 293 GLY A CA  1 
ATOM   2144 C  C   . GLY A 1 293 ? -3.595  6.248   -33.440  1.00 24.25 ? 293 GLY A C   1 
ATOM   2145 O  O   . GLY A 1 293 ? -3.200  5.597   -34.404  1.00 27.16 ? 293 GLY A O   1 
ATOM   2146 N  N   . VAL A 1 294 ? -3.749  5.699   -32.215  1.00 23.96 ? 294 VAL A N   1 
ATOM   2147 C  CA  . VAL A 1 294 ? -3.371  4.324   -31.952  1.00 15.47 ? 294 VAL A CA  1 
ATOM   2148 C  C   . VAL A 1 294 ? -4.634  3.515   -32.150  1.00 18.17 ? 294 VAL A C   1 
ATOM   2149 O  O   . VAL A 1 294 ? -5.720  3.865   -31.659  1.00 15.18 ? 294 VAL A O   1 
ATOM   2150 C  CB  . VAL A 1 294 ? -2.797  4.226   -30.538  1.00 11.42 ? 294 VAL A CB  1 
ATOM   2151 C  CG1 . VAL A 1 294 ? -2.470  2.793   -30.183  1.00 12.04 ? 294 VAL A CG1 1 
ATOM   2152 C  CG2 . VAL A 1 294 ? -1.472  4.991   -30.475  1.00 4.50  ? 294 VAL A CG2 1 
ATOM   2153 N  N   . PRO A 1 295 ? -4.523  2.469   -32.986  1.00 20.02 ? 295 PRO A N   1 
ATOM   2154 C  CA  . PRO A 1 295 ? -5.631  1.600   -33.388  1.00 21.73 ? 295 PRO A CA  1 
ATOM   2155 C  C   . PRO A 1 295 ? -6.192  0.716   -32.271  1.00 23.90 ? 295 PRO A C   1 
ATOM   2156 O  O   . PRO A 1 295 ? -5.445  0.291   -31.394  1.00 26.90 ? 295 PRO A O   1 
ATOM   2157 C  CB  . PRO A 1 295 ? -5.074  0.762   -34.519  1.00 20.80 ? 295 PRO A CB  1 
ATOM   2158 C  CG  . PRO A 1 295 ? -3.758  1.414   -34.868  1.00 26.10 ? 295 PRO A CG  1 
ATOM   2159 C  CD  . PRO A 1 295 ? -3.277  1.971   -33.550  1.00 19.51 ? 295 PRO A CD  1 
ATOM   2160 N  N   . PRO A 1 296 ? -7.456  0.337   -32.269  1.00 25.07 ? 296 PRO A N   1 
ATOM   2161 C  CA  . PRO A 1 296 ? -7.997  -0.586  -31.291  1.00 28.83 ? 296 PRO A CA  1 
ATOM   2162 C  C   . PRO A 1 296 ? -7.383  -1.970  -31.524  1.00 33.96 ? 296 PRO A C   1 
ATOM   2163 O  O   . PRO A 1 296 ? -7.323  -2.439  -32.672  1.00 37.36 ? 296 PRO A O   1 
ATOM   2164 C  CB  . PRO A 1 296 ? -9.479  -0.513  -31.524  1.00 28.29 ? 296 PRO A CB  1 
ATOM   2165 C  CG  . PRO A 1 296 ? -9.601  -0.144  -32.989  1.00 28.73 ? 296 PRO A CG  1 
ATOM   2166 C  CD  . PRO A 1 296 ? -8.442  0.782   -33.247  1.00 26.88 ? 296 PRO A CD  1 
ATOM   2167 N  N   . ALA A 1 297 ? -6.886  -2.589  -30.444  1.00 32.70 ? 297 ALA A N   1 
ATOM   2168 C  CA  . ALA A 1 297 ? -6.252  -3.900  -30.438  1.00 29.49 ? 297 ALA A CA  1 
ATOM   2169 C  C   . ALA A 1 297 ? -6.814  -4.915  -31.411  1.00 25.17 ? 297 ALA A C   1 
ATOM   2170 O  O   . ALA A 1 297 ? -8.026  -5.073  -31.516  1.00 23.15 ? 297 ALA A O   1 
ATOM   2171 C  CB  . ALA A 1 297 ? -6.335  -4.519  -29.052  1.00 29.66 ? 297 ALA A CB  1 
ATOM   2172 N  N   . SER A 1 298 ? -5.884  -5.524  -32.155  1.00 24.28 ? 298 SER A N   1 
ATOM   2173 C  CA  . SER A 1 298 ? -6.176  -6.536  -33.152  1.00 28.38 ? 298 SER A CA  1 
ATOM   2174 C  C   . SER A 1 298 ? -7.159  -6.181  -34.271  1.00 33.38 ? 298 SER A C   1 
ATOM   2175 O  O   . SER A 1 298 ? -7.691  -7.079  -34.933  1.00 36.18 ? 298 SER A O   1 
ATOM   2176 C  CB  . SER A 1 298 ? -6.648  -7.792  -32.411  1.00 27.84 ? 298 SER A CB  1 
ATOM   2177 O  OG  . SER A 1 298 ? -5.510  -8.417  -31.815  1.00 35.84 ? 298 SER A OG  1 
ATOM   2178 N  N   . GLN A 1 299 ? -7.433  -4.910  -34.578  1.00 36.27 ? 299 GLN A N   1 
ATOM   2179 C  CA  . GLN A 1 299 ? -8.368  -4.626  -35.650  1.00 38.09 ? 299 GLN A CA  1 
ATOM   2180 C  C   . GLN A 1 299 ? -7.635  -4.388  -36.967  1.00 36.88 ? 299 GLN A C   1 
ATOM   2181 O  O   . GLN A 1 299 ? -6.458  -4.011  -37.054  1.00 35.19 ? 299 GLN A O   1 
ATOM   2182 C  CB  . GLN A 1 299 ? -9.235  -3.442  -35.249  1.00 39.97 ? 299 GLN A CB  1 
ATOM   2183 C  CG  . GLN A 1 299 ? -10.269 -3.952  -34.252  1.00 44.26 ? 299 GLN A CG  1 
ATOM   2184 C  CD  . GLN A 1 299 ? -11.407 -2.982  -33.956  1.00 53.23 ? 299 GLN A CD  1 
ATOM   2185 O  OE1 . GLN A 1 299 ? -12.117 -3.109  -32.971  1.00 57.31 ? 299 GLN A OE1 1 
ATOM   2186 N  NE2 . GLN A 1 299 ? -11.711 -1.942  -34.720  1.00 57.20 ? 299 GLN A NE2 1 
ATOM   2187 N  N   . ASN A 1 300 ? -8.362  -4.720  -38.023  1.00 36.27 ? 300 ASN A N   1 
ATOM   2188 C  CA  . ASN A 1 300 ? -7.826  -4.637  -39.361  1.00 37.03 ? 300 ASN A CA  1 
ATOM   2189 C  C   . ASN A 1 300 ? -8.581  -3.750  -40.319  1.00 35.06 ? 300 ASN A C   1 
ATOM   2190 O  O   . ASN A 1 300 ? -9.775  -3.494  -40.132  1.00 35.17 ? 300 ASN A O   1 
ATOM   2191 C  CB  . ASN A 1 300 ? -7.746  -6.046  -39.945  1.00 38.36 ? 300 ASN A CB  1 
ATOM   2192 C  CG  . ASN A 1 300 ? -6.538  -6.827  -39.467  1.00 39.43 ? 300 ASN A CG  1 
ATOM   2193 O  OD1 . ASN A 1 300 ? -6.466  -8.040  -39.619  1.00 41.75 ? 300 ASN A OD1 1 
ATOM   2194 N  ND2 . ASN A 1 300 ? -5.521  -6.234  -38.865  1.00 45.02 ? 300 ASN A ND2 1 
ATOM   2195 N  N   . LEU A 1 301 ? -7.850  -3.302  -41.333  1.00 30.98 ? 301 LEU A N   1 
ATOM   2196 C  CA  . LEU A 1 301 ? -8.380  -2.468  -42.394  1.00 29.26 ? 301 LEU A CA  1 
ATOM   2197 C  C   . LEU A 1 301 ? -8.238  -3.256  -43.691  1.00 26.89 ? 301 LEU A C   1 
ATOM   2198 O  O   . LEU A 1 301 ? -7.146  -3.778  -43.901  1.00 21.06 ? 301 LEU A O   1 
ATOM   2199 C  CB  . LEU A 1 301 ? -7.571  -1.170  -42.524  1.00 25.71 ? 301 LEU A CB  1 
ATOM   2200 C  CG  . LEU A 1 301 ? -7.835  -0.017  -41.585  1.00 20.46 ? 301 LEU A CG  1 
ATOM   2201 C  CD1 . LEU A 1 301 ? -6.764  1.064   -41.735  1.00 19.22 ? 301 LEU A CD1 1 
ATOM   2202 C  CD2 . LEU A 1 301 ? -9.218  0.531   -41.899  1.00 20.83 ? 301 LEU A CD2 1 
ATOM   2203 N  N   . SER A 1 302 ? -9.263  -3.438  -44.533  1.00 27.39 ? 302 SER A N   1 
ATOM   2204 C  CA  . SER A 1 302 ? -9.102  -4.109  -45.824  1.00 28.25 ? 302 SER A CA  1 
ATOM   2205 C  C   . SER A 1 302 ? -8.789  -3.032  -46.883  1.00 27.52 ? 302 SER A C   1 
ATOM   2206 O  O   . SER A 1 302 ? -9.704  -2.343  -47.327  1.00 26.07 ? 302 SER A O   1 
ATOM   2207 C  CB  . SER A 1 302 ? -10.381 -4.843  -46.245  1.00 29.01 ? 302 SER A CB  1 
ATOM   2208 O  OG  . SER A 1 302 ? -10.607 -6.078  -45.567  1.00 33.69 ? 302 SER A OG  1 
ATOM   2209 N  N   . ILE A 1 303 ? -7.571  -2.758  -47.328  1.00 26.75 ? 303 ILE A N   1 
ATOM   2210 C  CA  . ILE A 1 303 ? -7.414  -1.727  -48.337  1.00 30.45 ? 303 ILE A CA  1 
ATOM   2211 C  C   . ILE A 1 303 ? -7.206  -2.387  -49.698  1.00 32.11 ? 303 ILE A C   1 
ATOM   2212 O  O   . ILE A 1 303 ? -6.758  -3.540  -49.793  1.00 33.16 ? 303 ILE A O   1 
ATOM   2213 C  CB  . ILE A 1 303 ? -6.200  -0.761  -48.050  1.00 29.63 ? 303 ILE A CB  1 
ATOM   2214 C  CG1 . ILE A 1 303 ? -4.866  -1.364  -48.347  1.00 27.47 ? 303 ILE A CG1 1 
ATOM   2215 C  CG2 . ILE A 1 303 ? -6.240  -0.391  -46.582  1.00 31.57 ? 303 ILE A CG2 1 
ATOM   2216 C  CD1 . ILE A 1 303 ? -4.069  -0.318  -49.120  1.00 30.73 ? 303 ILE A CD1 1 
ATOM   2217 N  N   . ASN A 1 304 ? -7.574  -1.714  -50.790  1.00 28.88 ? 304 ASN A N   1 
ATOM   2218 C  CA  . ASN A 1 304 ? -7.320  -2.258  -52.107  1.00 22.26 ? 304 ASN A CA  1 
ATOM   2219 C  C   . ASN A 1 304 ? -5.915  -1.748  -52.399  1.00 21.36 ? 304 ASN A C   1 
ATOM   2220 O  O   . ASN A 1 304 ? -5.773  -0.516  -52.380  1.00 22.25 ? 304 ASN A O   1 
ATOM   2221 C  CB  . ASN A 1 304 ? -8.276  -1.700  -53.142  1.00 23.13 ? 304 ASN A CB  1 
ATOM   2222 C  CG  . ASN A 1 304 ? -8.014  -2.271  -54.545  1.00 30.62 ? 304 ASN A CG  1 
ATOM   2223 O  OD1 . ASN A 1 304 ? -6.917  -2.180  -55.115  1.00 30.52 ? 304 ASN A OD1 1 
ATOM   2224 N  ND2 . ASN A 1 304 ? -9.000  -2.900  -55.168  1.00 33.59 ? 304 ASN A ND2 1 
ATOM   2225 N  N   . PRO A 1 305 ? -4.868  -2.551  -52.699  1.00 16.98 ? 305 PRO A N   1 
ATOM   2226 C  CA  . PRO A 1 305 ? -3.503  -2.064  -52.961  1.00 14.12 ? 305 PRO A CA  1 
ATOM   2227 C  C   . PRO A 1 305 ? -3.435  -1.006  -54.051  1.00 16.38 ? 305 PRO A C   1 
ATOM   2228 O  O   . PRO A 1 305 ? -2.489  -0.200  -54.126  1.00 13.50 ? 305 PRO A O   1 
ATOM   2229 C  CB  . PRO A 1 305 ? -2.701  -3.306  -53.312  1.00 14.44 ? 305 PRO A CB  1 
ATOM   2230 C  CG  . PRO A 1 305 ? -3.535  -4.454  -52.781  1.00 10.59 ? 305 PRO A CG  1 
ATOM   2231 C  CD  . PRO A 1 305 ? -4.975  -3.994  -52.940  1.00 11.48 ? 305 PRO A CD  1 
ATOM   2232 N  N   . MET A 1 306 ? -4.439  -0.996  -54.954  1.00 21.30 ? 306 MET A N   1 
ATOM   2233 C  CA  . MET A 1 306 ? -4.463  0.012   -56.007  1.00 25.38 ? 306 MET A CA  1 
ATOM   2234 C  C   . MET A 1 306 ? -4.491  1.431   -55.459  1.00 24.99 ? 306 MET A C   1 
ATOM   2235 O  O   . MET A 1 306 ? -3.861  2.303   -56.065  1.00 25.14 ? 306 MET A O   1 
ATOM   2236 C  CB  . MET A 1 306 ? -5.646  -0.198  -56.903  1.00 30.40 ? 306 MET A CB  1 
ATOM   2237 C  CG  . MET A 1 306 ? -5.168  -1.029  -58.079  1.00 38.89 ? 306 MET A CG  1 
ATOM   2238 S  SD  . MET A 1 306 ? -4.974  -0.068  -59.600  1.00 43.10 ? 306 MET A SD  1 
ATOM   2239 C  CE  . MET A 1 306 ? -3.751  1.167   -59.302  1.00 41.95 ? 306 MET A CE  1 
ATOM   2240 N  N   . LEU A 1 307 ? -5.043  1.613   -54.232  1.00 22.51 ? 307 LEU A N   1 
ATOM   2241 C  CA  . LEU A 1 307 ? -5.079  2.910   -53.579  1.00 18.92 ? 307 LEU A CA  1 
ATOM   2242 C  C   . LEU A 1 307 ? -3.685  3.465   -53.429  1.00 19.78 ? 307 LEU A C   1 
ATOM   2243 O  O   . LEU A 1 307 ? -3.458  4.669   -53.383  1.00 21.56 ? 307 LEU A O   1 
ATOM   2244 C  CB  . LEU A 1 307 ? -5.682  2.835   -52.202  1.00 13.42 ? 307 LEU A CB  1 
ATOM   2245 C  CG  . LEU A 1 307 ? -7.089  2.309   -52.116  1.00 15.17 ? 307 LEU A CG  1 
ATOM   2246 C  CD1 . LEU A 1 307 ? -7.671  2.559   -50.747  1.00 15.51 ? 307 LEU A CD1 1 
ATOM   2247 C  CD2 . LEU A 1 307 ? -7.939  3.031   -53.108  1.00 14.30 ? 307 LEU A CD2 1 
ATOM   2248 N  N   . LEU A 1 308 ? -2.723  2.555   -53.364  1.00 22.16 ? 308 LEU A N   1 
ATOM   2249 C  CA  . LEU A 1 308 ? -1.348  2.942   -53.214  1.00 23.46 ? 308 LEU A CA  1 
ATOM   2250 C  C   . LEU A 1 308 ? -0.512  2.982   -54.461  1.00 21.15 ? 308 LEU A C   1 
ATOM   2251 O  O   . LEU A 1 308 ? 0.414   3.796   -54.505  1.00 17.20 ? 308 LEU A O   1 
ATOM   2252 C  CB  . LEU A 1 308 ? -0.719  2.005   -52.182  1.00 30.20 ? 308 LEU A CB  1 
ATOM   2253 C  CG  . LEU A 1 308 ? -1.092  2.245   -50.705  1.00 31.75 ? 308 LEU A CG  1 
ATOM   2254 C  CD1 . LEU A 1 308 ? -0.734  1.020   -49.944  1.00 30.26 ? 308 LEU A CD1 1 
ATOM   2255 C  CD2 . LEU A 1 308 ? -0.346  3.440   -50.116  1.00 30.52 ? 308 LEU A CD2 1 
ATOM   2256 N  N   . LEU A 1 309 ? -0.798  2.147   -55.477  1.00 23.19 ? 309 LEU A N   1 
ATOM   2257 C  CA  . LEU A 1 309 ? 0.000   2.092   -56.711  1.00 19.80 ? 309 LEU A CA  1 
ATOM   2258 C  C   . LEU A 1 309 ? 0.109   3.414   -57.475  1.00 20.30 ? 309 LEU A C   1 
ATOM   2259 O  O   . LEU A 1 309 ? 1.190   3.821   -57.913  1.00 19.77 ? 309 LEU A O   1 
ATOM   2260 C  CB  . LEU A 1 309 ? -0.592  1.025   -57.612  1.00 22.60 ? 309 LEU A CB  1 
ATOM   2261 C  CG  . LEU A 1 309 ? 0.153   0.548   -58.855  1.00 24.16 ? 309 LEU A CG  1 
ATOM   2262 C  CD1 . LEU A 1 309 ? 1.458   -0.176  -58.538  1.00 22.21 ? 309 LEU A CD1 1 
ATOM   2263 C  CD2 . LEU A 1 309 ? -0.722  -0.467  -59.524  1.00 31.60 ? 309 LEU A CD2 1 
ATOM   2264 N  N   . THR A 1 310 ? -0.984  4.179   -57.502  1.00 20.57 ? 310 THR A N   1 
ATOM   2265 C  CA  . THR A 1 310 ? -1.059  5.442   -58.192  1.00 17.76 ? 310 THR A CA  1 
ATOM   2266 C  C   . THR A 1 310 ? -0.135  6.508   -57.649  1.00 20.53 ? 310 THR A C   1 
ATOM   2267 O  O   . THR A 1 310 ? 0.060   7.521   -58.327  1.00 23.51 ? 310 THR A O   1 
ATOM   2268 C  CB  . THR A 1 310 ? -2.537  5.834   -58.150  1.00 21.57 ? 310 THR A CB  1 
ATOM   2269 O  OG1 . THR A 1 310 ? -2.970  5.710   -56.808  1.00 26.64 ? 310 THR A OG1 1 
ATOM   2270 C  CG2 . THR A 1 310 ? -3.436  4.871   -58.916  1.00 16.03 ? 310 THR A CG2 1 
ATOM   2271 N  N   . GLY A 1 311 ? 0.500   6.312   -56.485  1.00 19.97 ? 311 GLY A N   1 
ATOM   2272 C  CA  . GLY A 1 311 ? 1.420   7.310   -55.909  1.00 18.80 ? 311 GLY A CA  1 
ATOM   2273 C  C   . GLY A 1 311 ? 1.167   7.738   -54.444  1.00 19.59 ? 311 GLY A C   1 
ATOM   2274 O  O   . GLY A 1 311 ? 1.792   8.692   -53.962  1.00 18.36 ? 311 GLY A O   1 
ATOM   2275 N  N   . ARG A 1 312 ? 0.230   7.138   -53.692  1.00 18.32 ? 312 ARG A N   1 
ATOM   2276 C  CA  . ARG A 1 312 ? 0.010   7.500   -52.306  1.00 15.65 ? 312 ARG A CA  1 
ATOM   2277 C  C   . ARG A 1 312 ? 1.074   6.898   -51.385  1.00 19.44 ? 312 ARG A C   1 
ATOM   2278 O  O   . ARG A 1 312 ? 1.667   5.850   -51.671  1.00 20.80 ? 312 ARG A O   1 
ATOM   2279 C  CB  . ARG A 1 312 ? -1.332  7.017   -51.879  1.00 11.51 ? 312 ARG A CB  1 
ATOM   2280 C  CG  . ARG A 1 312 ? -2.394  8.045   -52.128  1.00 8.50  ? 312 ARG A CG  1 
ATOM   2281 C  CD  . ARG A 1 312 ? -3.617  7.359   -51.651  1.00 8.16  ? 312 ARG A CD  1 
ATOM   2282 N  NE  . ARG A 1 312 ? -4.822  8.142   -51.847  1.00 11.01 ? 312 ARG A NE  1 
ATOM   2283 C  CZ  . ARG A 1 312 ? -5.814  7.654   -52.602  1.00 14.33 ? 312 ARG A CZ  1 
ATOM   2284 N  NH1 . ARG A 1 312 ? -5.708  6.456   -53.193  1.00 14.16 ? 312 ARG A NH1 1 
ATOM   2285 N  NH2 . ARG A 1 312 ? -6.947  8.342   -52.739  1.00 13.58 ? 312 ARG A NH2 1 
ATOM   2286 N  N   . THR A 1 313 ? 1.401   7.638   -50.338  1.00 21.14 ? 313 THR A N   1 
ATOM   2287 C  CA  . THR A 1 313 ? 2.329   7.250   -49.285  1.00 20.13 ? 313 THR A CA  1 
ATOM   2288 C  C   . THR A 1 313 ? 1.451   7.135   -48.026  1.00 19.14 ? 313 THR A C   1 
ATOM   2289 O  O   . THR A 1 313 ? 0.630   8.020   -47.724  1.00 15.35 ? 313 THR A O   1 
ATOM   2290 C  CB  . THR A 1 313 ? 3.367   8.329   -49.110  1.00 17.44 ? 313 THR A CB  1 
ATOM   2291 O  OG1 . THR A 1 313 ? 4.069   8.322   -50.314  1.00 23.35 ? 313 THR A OG1 1 
ATOM   2292 C  CG2 . THR A 1 313 ? 4.371   8.110   -48.029  1.00 22.83 ? 313 THR A CG2 1 
ATOM   2293 N  N   . TRP A 1 314 ? 1.528   5.982   -47.372  1.00 18.28 ? 314 TRP A N   1 
ATOM   2294 C  CA  . TRP A 1 314 ? 0.833   5.660   -46.123  1.00 14.63 ? 314 TRP A CA  1 
ATOM   2295 C  C   . TRP A 1 314 ? 1.965   5.395   -45.148  1.00 14.59 ? 314 TRP A C   1 
ATOM   2296 O  O   . TRP A 1 314 ? 2.788   4.514   -45.397  1.00 15.90 ? 314 TRP A O   1 
ATOM   2297 C  CB  . TRP A 1 314 ? 0.074   4.385   -46.161  1.00 8.34  ? 314 TRP A CB  1 
ATOM   2298 C  CG  . TRP A 1 314 ? -1.161  4.319   -45.290  1.00 8.93  ? 314 TRP A CG  1 
ATOM   2299 C  CD1 . TRP A 1 314 ? -1.582  5.329   -44.466  1.00 6.26  ? 314 TRP A CD1 1 
ATOM   2300 C  CD2 . TRP A 1 314 ? -2.007  3.236   -45.287  1.00 5.32  ? 314 TRP A CD2 1 
ATOM   2301 N  NE1 . TRP A 1 314 ? -2.707  4.877   -43.948  1.00 7.66  ? 314 TRP A NE1 1 
ATOM   2302 C  CE2 . TRP A 1 314 ? -3.002  3.641   -44.404  1.00 2.00  ? 314 TRP A CE2 1 
ATOM   2303 C  CE3 . TRP A 1 314 ? -2.041  1.993   -45.909  1.00 7.98  ? 314 TRP A CE3 1 
ATOM   2304 C  CZ2 . TRP A 1 314 ? -4.069  2.811   -44.123  1.00 5.25  ? 314 TRP A CZ2 1 
ATOM   2305 C  CZ3 . TRP A 1 314 ? -3.123  1.149   -45.614  1.00 11.32 ? 314 TRP A CZ3 1 
ATOM   2306 C  CH2 . TRP A 1 314 ? -4.131  1.553   -44.729  1.00 5.11  ? 314 TRP A CH2 1 
ATOM   2307 N  N   . LYS A 1 315 ? 2.075   6.158   -44.079  1.00 13.23 ? 315 LYS A N   1 
ATOM   2308 C  CA  . LYS A 1 315 ? 3.096   5.958   -43.096  1.00 11.14 ? 315 LYS A CA  1 
ATOM   2309 C  C   . LYS A 1 315 ? 2.496   6.252   -41.742  1.00 15.72 ? 315 LYS A C   1 
ATOM   2310 O  O   . LYS A 1 315 ? 1.353   6.711   -41.648  1.00 21.63 ? 315 LYS A O   1 
ATOM   2311 C  CB  . LYS A 1 315 ? 4.240   6.872   -43.358  1.00 9.75  ? 315 LYS A CB  1 
ATOM   2312 C  CG  . LYS A 1 315 ? 3.894   8.335   -43.528  1.00 12.08 ? 315 LYS A CG  1 
ATOM   2313 C  CD  . LYS A 1 315 ? 5.180   9.078   -43.484  1.00 10.06 ? 315 LYS A CD  1 
ATOM   2314 C  CE  . LYS A 1 315 ? 6.180   8.665   -44.516  1.00 14.49 ? 315 LYS A CE  1 
ATOM   2315 N  NZ  . LYS A 1 315 ? 7.282   9.616   -44.492  1.00 21.94 ? 315 LYS A NZ  1 
ATOM   2316 N  N   . GLY A 1 316 ? 3.194   5.953   -40.667  1.00 17.26 ? 316 GLY A N   1 
ATOM   2317 C  CA  . GLY A 1 316 ? 2.731   6.231   -39.328  1.00 18.02 ? 316 GLY A CA  1 
ATOM   2318 C  C   . GLY A 1 316 ? 3.947   6.584   -38.505  1.00 21.92 ? 316 GLY A C   1 
ATOM   2319 O  O   . GLY A 1 316 ? 5.081   6.422   -38.990  1.00 22.65 ? 316 GLY A O   1 
ATOM   2320 N  N   . ALA A 1 317 ? 3.781   7.160   -37.317  1.00 21.82 ? 317 ALA A N   1 
ATOM   2321 C  CA  . ALA A 1 317 ? 4.957   7.393   -36.487  1.00 20.67 ? 317 ALA A CA  1 
ATOM   2322 C  C   . ALA A 1 317 ? 4.531   7.584   -35.054  1.00 20.01 ? 317 ALA A C   1 
ATOM   2323 O  O   . ALA A 1 317 ? 3.350   7.761   -34.709  1.00 16.83 ? 317 ALA A O   1 
ATOM   2324 C  CB  . ALA A 1 317 ? 5.748   8.625   -36.879  1.00 21.32 ? 317 ALA A CB  1 
ATOM   2325 N  N   . VAL A 1 318 ? 5.563   7.512   -34.229  1.00 19.27 ? 318 VAL A N   1 
ATOM   2326 C  CA  . VAL A 1 318 ? 5.442   7.610   -32.799  1.00 19.92 ? 318 VAL A CA  1 
ATOM   2327 C  C   . VAL A 1 318 ? 6.185   8.871   -32.429  1.00 21.00 ? 318 VAL A C   1 
ATOM   2328 O  O   . VAL A 1 318 ? 7.215   9.185   -33.039  1.00 21.34 ? 318 VAL A O   1 
ATOM   2329 C  CB  . VAL A 1 318 ? 6.031   6.238   -32.271  1.00 20.29 ? 318 VAL A CB  1 
ATOM   2330 C  CG1 . VAL A 1 318 ? 7.073   6.337   -31.162  1.00 15.43 ? 318 VAL A CG1 1 
ATOM   2331 C  CG2 . VAL A 1 318 ? 4.817   5.461   -31.816  1.00 17.20 ? 318 VAL A CG2 1 
ATOM   2332 N  N   . TYR A 1 319 ? 5.667   9.669   -31.493  1.00 22.71 ? 319 TYR A N   1 
ATOM   2333 C  CA  . TYR A 1 319 ? 6.347   10.877  -31.044  1.00 23.96 ? 319 TYR A CA  1 
ATOM   2334 C  C   . TYR A 1 319 ? 6.680   11.929  -32.110  1.00 24.91 ? 319 TYR A C   1 
ATOM   2335 O  O   . TYR A 1 319 ? 7.697   12.637  -32.007  1.00 26.11 ? 319 TYR A O   1 
ATOM   2336 C  CB  . TYR A 1 319 ? 7.621   10.435  -30.337  1.00 30.66 ? 319 TYR A CB  1 
ATOM   2337 C  CG  . TYR A 1 319 ? 7.799   10.849  -28.891  1.00 34.30 ? 319 TYR A CG  1 
ATOM   2338 C  CD1 . TYR A 1 319 ? 7.154   11.957  -28.339  1.00 34.16 ? 319 TYR A CD1 1 
ATOM   2339 C  CD2 . TYR A 1 319 ? 8.693   10.093  -28.135  1.00 39.62 ? 319 TYR A CD2 1 
ATOM   2340 C  CE1 . TYR A 1 319 ? 7.411   12.301  -27.015  1.00 41.68 ? 319 TYR A CE1 1 
ATOM   2341 C  CE2 . TYR A 1 319 ? 8.954   10.431  -26.814  1.00 40.80 ? 319 TYR A CE2 1 
ATOM   2342 C  CZ  . TYR A 1 319 ? 8.311   11.531  -26.258  1.00 42.47 ? 319 TYR A CZ  1 
ATOM   2343 O  OH  . TYR A 1 319 ? 8.634   11.862  -24.958  1.00 39.36 ? 319 TYR A OH  1 
ATOM   2344 N  N   . GLY A 1 320 ? 5.892   12.034  -33.192  1.00 20.22 ? 320 GLY A N   1 
ATOM   2345 C  CA  . GLY A 1 320 ? 6.165   13.031  -34.205  1.00 15.63 ? 320 GLY A CA  1 
ATOM   2346 C  C   . GLY A 1 320 ? 7.513   12.906  -34.888  1.00 15.04 ? 320 GLY A C   1 
ATOM   2347 O  O   . GLY A 1 320 ? 8.017   13.868  -35.481  1.00 14.67 ? 320 GLY A O   1 
ATOM   2348 N  N   . GLY A 1 321 ? 8.097   11.703  -34.838  1.00 13.13 ? 321 GLY A N   1 
ATOM   2349 C  CA  . GLY A 1 321 ? 9.379   11.430  -35.442  1.00 8.52  ? 321 GLY A CA  1 
ATOM   2350 C  C   . GLY A 1 321 ? 10.509  12.029  -34.671  1.00 12.26 ? 321 GLY A C   1 
ATOM   2351 O  O   . GLY A 1 321 ? 11.653  12.022  -35.133  1.00 18.62 ? 321 GLY A O   1 
ATOM   2352 N  N   . PHE A 1 322 ? 10.260  12.509  -33.455  1.00 16.52 ? 322 PHE A N   1 
ATOM   2353 C  CA  . PHE A 1 322 ? 11.307  13.132  -32.679  1.00 18.49 ? 322 PHE A CA  1 
ATOM   2354 C  C   . PHE A 1 322 ? 12.116  12.054  -31.992  1.00 23.00 ? 322 PHE A C   1 
ATOM   2355 O  O   . PHE A 1 322 ? 11.518  11.091  -31.502  1.00 25.42 ? 322 PHE A O   1 
ATOM   2356 C  CB  . PHE A 1 322 ? 10.675  14.081  -31.642  1.00 19.25 ? 322 PHE A CB  1 
ATOM   2357 C  CG  . PHE A 1 322 ? 10.189  15.413  -32.204  1.00 16.52 ? 322 PHE A CG  1 
ATOM   2358 C  CD1 . PHE A 1 322 ? 11.111  16.331  -32.728  1.00 16.71 ? 322 PHE A CD1 1 
ATOM   2359 C  CD2 . PHE A 1 322 ? 8.822   15.729  -32.200  1.00 19.80 ? 322 PHE A CD2 1 
ATOM   2360 C  CE1 . PHE A 1 322 ? 10.667  17.554  -33.246  1.00 15.10 ? 322 PHE A CE1 1 
ATOM   2361 C  CE2 . PHE A 1 322 ? 8.389   16.960  -32.719  1.00 21.55 ? 322 PHE A CE2 1 
ATOM   2362 C  CZ  . PHE A 1 322 ? 9.314   17.877  -33.246  1.00 15.82 ? 322 PHE A CZ  1 
ATOM   2363 N  N   . LYS A 1 323 ? 13.453  12.088  -31.999  1.00 23.89 ? 323 LYS A N   1 
ATOM   2364 C  CA  . LYS A 1 323 ? 14.230  11.109  -31.242  1.00 22.33 ? 323 LYS A CA  1 
ATOM   2365 C  C   . LYS A 1 323 ? 14.087  11.803  -29.884  1.00 25.15 ? 323 LYS A C   1 
ATOM   2366 O  O   . LYS A 1 323 ? 14.564  12.938  -29.678  1.00 25.52 ? 323 LYS A O   1 
ATOM   2367 C  CB  . LYS A 1 323 ? 15.658  11.087  -31.707  1.00 20.11 ? 323 LYS A CB  1 
ATOM   2368 C  CG  . LYS A 1 323 ? 15.780  10.294  -32.970  1.00 22.89 ? 323 LYS A CG  1 
ATOM   2369 C  CD  . LYS A 1 323 ? 17.250  10.204  -33.327  1.00 30.33 ? 323 LYS A CD  1 
ATOM   2370 C  CE  . LYS A 1 323 ? 17.443  9.280   -34.528  1.00 32.79 ? 323 LYS A CE  1 
ATOM   2371 N  NZ  . LYS A 1 323 ? 17.368  7.884   -34.120  1.00 35.55 ? 323 LYS A NZ  1 
ATOM   2372 N  N   . SER A 1 324 ? 13.367  11.111  -29.005  1.00 24.63 ? 324 SER A N   1 
ATOM   2373 C  CA  . SER A 1 324 ? 12.951  11.591  -27.702  1.00 23.06 ? 324 SER A CA  1 
ATOM   2374 C  C   . SER A 1 324 ? 13.853  12.391  -26.806  1.00 24.48 ? 324 SER A C   1 
ATOM   2375 O  O   . SER A 1 324 ? 13.484  13.503  -26.388  1.00 20.89 ? 324 SER A O   1 
ATOM   2376 C  CB  . SER A 1 324 ? 12.454  10.422  -26.921  1.00 19.89 ? 324 SER A CB  1 
ATOM   2377 O  OG  . SER A 1 324 ? 13.477  9.468   -26.745  1.00 19.02 ? 324 SER A OG  1 
ATOM   2378 N  N   . LYS A 1 325 ? 15.034  11.845  -26.548  1.00 26.61 ? 325 LYS A N   1 
ATOM   2379 C  CA  . LYS A 1 325 ? 15.931  12.511  -25.622  1.00 32.07 ? 325 LYS A CA  1 
ATOM   2380 C  C   . LYS A 1 325 ? 16.591  13.744  -26.218  1.00 34.24 ? 325 LYS A C   1 
ATOM   2381 O  O   . LYS A 1 325 ? 16.917  14.650  -25.457  1.00 34.94 ? 325 LYS A O   1 
ATOM   2382 C  CB  . LYS A 1 325 ? 16.963  11.472  -25.146  1.00 35.44 ? 325 LYS A CB  1 
ATOM   2383 C  CG  . LYS A 1 325 ? 17.499  11.736  -23.745  1.00 36.99 ? 325 LYS A CG  1 
ATOM   2384 C  CD  . LYS A 1 325 ? 18.596  10.749  -23.404  1.00 35.98 ? 325 LYS A CD  1 
ATOM   2385 C  CE  . LYS A 1 325 ? 19.439  11.193  -22.207  1.00 36.94 ? 325 LYS A CE  1 
ATOM   2386 N  NZ  . LYS A 1 325 ? 18.795  10.906  -20.946  1.00 35.84 ? 325 LYS A NZ  1 
ATOM   2387 N  N   . GLU A 1 326 ? 16.830  13.842  -27.542  1.00 34.67 ? 326 GLU A N   1 
ATOM   2388 C  CA  . GLU A 1 326 ? 17.438  15.033  -28.152  1.00 30.02 ? 326 GLU A CA  1 
ATOM   2389 C  C   . GLU A 1 326 ? 16.405  16.102  -28.515  1.00 27.50 ? 326 GLU A C   1 
ATOM   2390 O  O   . GLU A 1 326 ? 16.645  17.310  -28.390  1.00 29.25 ? 326 GLU A O   1 
ATOM   2391 C  CB  . GLU A 1 326 ? 18.165  14.696  -29.435  1.00 33.56 ? 326 GLU A CB  1 
ATOM   2392 C  CG  . GLU A 1 326 ? 19.311  13.725  -29.255  1.00 45.96 ? 326 GLU A CG  1 
ATOM   2393 C  CD  . GLU A 1 326 ? 20.037  13.321  -30.544  1.00 52.66 ? 326 GLU A CD  1 
ATOM   2394 O  OE1 . GLU A 1 326 ? 19.406  12.746  -31.438  1.00 52.65 ? 326 GLU A OE1 1 
ATOM   2395 O  OE2 . GLU A 1 326 ? 21.245  13.563  -30.639  1.00 55.85 ? 326 GLU A OE2 1 
ATOM   2396 N  N   . GLY A 1 327 ? 15.243  15.632  -28.958  1.00 23.02 ? 327 GLY A N   1 
ATOM   2397 C  CA  . GLY A 1 327 ? 14.142  16.439  -29.417  1.00 20.88 ? 327 GLY A CA  1 
ATOM   2398 C  C   . GLY A 1 327 ? 13.435  17.217  -28.358  1.00 28.28 ? 327 GLY A C   1 
ATOM   2399 O  O   . GLY A 1 327 ? 13.514  18.449  -28.394  1.00 34.35 ? 327 GLY A O   1 
ATOM   2400 N  N   . ILE A 1 328 ? 12.785  16.555  -27.378  1.00 29.75 ? 328 ILE A N   1 
ATOM   2401 C  CA  . ILE A 1 328 ? 12.049  17.243  -26.308  1.00 26.61 ? 328 ILE A CA  1 
ATOM   2402 C  C   . ILE A 1 328 ? 12.850  18.352  -25.637  1.00 23.22 ? 328 ILE A C   1 
ATOM   2403 O  O   . ILE A 1 328 ? 12.262  19.388  -25.352  1.00 26.41 ? 328 ILE A O   1 
ATOM   2404 C  CB  . ILE A 1 328 ? 11.590  16.229  -25.257  1.00 28.62 ? 328 ILE A CB  1 
ATOM   2405 C  CG1 . ILE A 1 328 ? 10.818  15.085  -25.909  1.00 32.04 ? 328 ILE A CG1 1 
ATOM   2406 C  CG2 . ILE A 1 328 ? 10.694  16.901  -24.266  1.00 29.26 ? 328 ILE A CG2 1 
ATOM   2407 C  CD1 . ILE A 1 328 ? 9.614   15.367  -26.799  1.00 31.27 ? 328 ILE A CD1 1 
ATOM   2408 N  N   . PRO A 1 329 ? 14.150  18.289  -25.388  1.00 18.47 ? 329 PRO A N   1 
ATOM   2409 C  CA  . PRO A 1 329 ? 14.924  19.428  -24.917  1.00 20.92 ? 329 PRO A CA  1 
ATOM   2410 C  C   . PRO A 1 329 ? 14.780  20.662  -25.837  1.00 24.95 ? 329 PRO A C   1 
ATOM   2411 O  O   . PRO A 1 329 ? 14.266  21.725  -25.423  1.00 25.79 ? 329 PRO A O   1 
ATOM   2412 C  CB  . PRO A 1 329 ? 16.330  18.884  -24.848  1.00 26.03 ? 329 PRO A CB  1 
ATOM   2413 C  CG  . PRO A 1 329 ? 16.134  17.442  -24.491  1.00 22.28 ? 329 PRO A CG  1 
ATOM   2414 C  CD  . PRO A 1 329 ? 14.924  17.064  -25.307  1.00 16.48 ? 329 PRO A CD  1 
ATOM   2415 N  N   . LYS A 1 330 ? 15.194  20.522  -27.112  1.00 25.66 ? 330 LYS A N   1 
ATOM   2416 C  CA  . LYS A 1 330 ? 15.110  21.573  -28.133  1.00 22.57 ? 330 LYS A CA  1 
ATOM   2417 C  C   . LYS A 1 330 ? 13.694  22.134  -28.253  1.00 18.75 ? 330 LYS A C   1 
ATOM   2418 O  O   . LYS A 1 330 ? 13.498  23.347  -28.343  1.00 18.36 ? 330 LYS A O   1 
ATOM   2419 C  CB  . LYS A 1 330 ? 15.516  21.036  -29.499  1.00 25.21 ? 330 LYS A CB  1 
ATOM   2420 C  CG  . LYS A 1 330 ? 16.951  20.565  -29.550  1.00 27.64 ? 330 LYS A CG  1 
ATOM   2421 C  CD  . LYS A 1 330 ? 17.348  20.336  -30.997  1.00 36.09 ? 330 LYS A CD  1 
ATOM   2422 C  CE  . LYS A 1 330 ? 18.728  19.679  -31.158  1.00 38.81 ? 330 LYS A CE  1 
ATOM   2423 N  NZ  . LYS A 1 330 ? 18.623  18.229  -31.035  1.00 39.37 ? 330 LYS A NZ  1 
ATOM   2424 N  N   . LEU A 1 331 ? 12.661  21.313  -28.251  1.00 15.33 ? 331 LEU A N   1 
ATOM   2425 C  CA  . LEU A 1 331 ? 11.317  21.828  -28.315  1.00 16.27 ? 331 LEU A CA  1 
ATOM   2426 C  C   . LEU A 1 331 ? 10.924  22.673  -27.119  1.00 23.06 ? 331 LEU A C   1 
ATOM   2427 O  O   . LEU A 1 331 ? 9.993   23.472  -27.213  1.00 24.97 ? 331 LEU A O   1 
ATOM   2428 C  CB  . LEU A 1 331 ? 10.365  20.695  -28.423  1.00 17.91 ? 331 LEU A CB  1 
ATOM   2429 C  CG  . LEU A 1 331 ? 9.988   20.144  -29.785  1.00 12.81 ? 331 LEU A CG  1 
ATOM   2430 C  CD1 . LEU A 1 331 ? 8.892   19.119  -29.593  1.00 6.59  ? 331 LEU A CD1 1 
ATOM   2431 C  CD2 . LEU A 1 331 ? 9.435   21.249  -30.676  1.00 14.36 ? 331 LEU A CD2 1 
ATOM   2432 N  N   . VAL A 1 332 ? 11.577  22.504  -25.959  1.00 25.92 ? 332 VAL A N   1 
ATOM   2433 C  CA  . VAL A 1 332 ? 11.291  23.282  -24.757  1.00 22.85 ? 332 VAL A CA  1 
ATOM   2434 C  C   . VAL A 1 332 ? 12.056  24.556  -25.038  1.00 19.19 ? 332 VAL A C   1 
ATOM   2435 O  O   . VAL A 1 332 ? 11.487  25.632  -24.888  1.00 21.19 ? 332 VAL A O   1 
ATOM   2436 C  CB  . VAL A 1 332 ? 11.816  22.528  -23.487  1.00 28.15 ? 332 VAL A CB  1 
ATOM   2437 C  CG1 . VAL A 1 332 ? 11.963  23.494  -22.321  1.00 23.96 ? 332 VAL A CG1 1 
ATOM   2438 C  CG2 . VAL A 1 332 ? 10.818  21.434  -23.064  1.00 22.98 ? 332 VAL A CG2 1 
ATOM   2439 N  N   . ALA A 1 333 ? 13.331  24.508  -25.409  1.00 13.49 ? 333 ALA A N   1 
ATOM   2440 C  CA  . ALA A 1 333 ? 14.076  25.700  -25.786  1.00 17.72 ? 333 ALA A CA  1 
ATOM   2441 C  C   . ALA A 1 333 ? 13.228  26.601  -26.710  1.00 22.05 ? 333 ALA A C   1 
ATOM   2442 O  O   . ALA A 1 333 ? 13.038  27.790  -26.432  1.00 25.22 ? 333 ALA A O   1 
ATOM   2443 C  CB  . ALA A 1 333 ? 15.315  25.316  -26.553  1.00 20.55 ? 333 ALA A CB  1 
ATOM   2444 N  N   . ASP A 1 334 ? 12.615  26.027  -27.753  1.00 20.77 ? 334 ASP A N   1 
ATOM   2445 C  CA  . ASP A 1 334 ? 11.756  26.733  -28.676  1.00 22.65 ? 334 ASP A CA  1 
ATOM   2446 C  C   . ASP A 1 334 ? 10.607  27.420  -27.980  1.00 26.32 ? 334 ASP A C   1 
ATOM   2447 O  O   . ASP A 1 334 ? 10.267  28.566  -28.287  1.00 26.85 ? 334 ASP A O   1 
ATOM   2448 C  CB  . ASP A 1 334 ? 11.152  25.797  -29.676  1.00 23.46 ? 334 ASP A CB  1 
ATOM   2449 C  CG  . ASP A 1 334 ? 12.026  25.380  -30.827  1.00 22.16 ? 334 ASP A CG  1 
ATOM   2450 O  OD1 . ASP A 1 334 ? 13.218  25.692  -30.878  1.00 22.84 ? 334 ASP A OD1 1 
ATOM   2451 O  OD2 . ASP A 1 334 ? 11.462  24.719  -31.686  1.00 29.82 ? 334 ASP A OD2 1 
ATOM   2452 N  N   . PHE A 1 335 ? 9.991   26.641  -27.089  1.00 27.86 ? 335 PHE A N   1 
ATOM   2453 C  CA  . PHE A 1 335 ? 8.894   27.086  -26.245  1.00 26.90 ? 335 PHE A CA  1 
ATOM   2454 C  C   . PHE A 1 335 ? 9.328   28.321  -25.473  1.00 26.85 ? 335 PHE A C   1 
ATOM   2455 O  O   . PHE A 1 335 ? 8.602   29.314  -25.452  1.00 28.14 ? 335 PHE A O   1 
ATOM   2456 C  CB  . PHE A 1 335 ? 8.490   25.988  -25.238  1.00 22.69 ? 335 PHE A CB  1 
ATOM   2457 C  CG  . PHE A 1 335 ? 7.440   26.474  -24.264  1.00 21.91 ? 335 PHE A CG  1 
ATOM   2458 C  CD1 . PHE A 1 335 ? 6.109   26.474  -24.661  1.00 20.35 ? 335 PHE A CD1 1 
ATOM   2459 C  CD2 . PHE A 1 335 ? 7.819   26.987  -23.016  1.00 18.59 ? 335 PHE A CD2 1 
ATOM   2460 C  CE1 . PHE A 1 335 ? 5.147   26.995  -23.812  1.00 18.87 ? 335 PHE A CE1 1 
ATOM   2461 C  CE2 . PHE A 1 335 ? 6.858   27.507  -22.182  1.00 9.84  ? 335 PHE A CE2 1 
ATOM   2462 C  CZ  . PHE A 1 335 ? 5.523   27.515  -22.572  1.00 18.35 ? 335 PHE A CZ  1 
ATOM   2463 N  N   . MET A 1 336 ? 10.502  28.259  -24.846  1.00 27.66 ? 336 MET A N   1 
ATOM   2464 C  CA  . MET A 1 336 ? 11.012  29.365  -24.055  1.00 30.00 ? 336 MET A CA  1 
ATOM   2465 C  C   . MET A 1 336 ? 11.183  30.581  -24.954  1.00 32.55 ? 336 MET A C   1 
ATOM   2466 O  O   . MET A 1 336 ? 10.652  31.646  -24.636  1.00 36.29 ? 336 MET A O   1 
ATOM   2467 C  CB  . MET A 1 336 ? 12.357  28.984  -23.393  1.00 26.74 ? 336 MET A CB  1 
ATOM   2468 C  CG  . MET A 1 336 ? 12.299  27.812  -22.411  1.00 28.08 ? 336 MET A CG  1 
ATOM   2469 S  SD  . MET A 1 336 ? 11.056  27.969  -21.099  1.00 32.73 ? 336 MET A SD  1 
ATOM   2470 C  CE  . MET A 1 336 ? 11.859  29.165  -20.098  1.00 23.33 ? 336 MET A CE  1 
ATOM   2471 N  N   . ALA A 1 337 ? 11.816  30.403  -26.126  1.00 32.69 ? 337 ALA A N   1 
ATOM   2472 C  CA  . ALA A 1 337 ? 12.046  31.436  -27.152  1.00 29.49 ? 337 ALA A CA  1 
ATOM   2473 C  C   . ALA A 1 337 ? 10.793  32.048  -27.773  1.00 27.54 ? 337 ALA A C   1 
ATOM   2474 O  O   . ALA A 1 337 ? 10.855  32.948  -28.615  1.00 31.58 ? 337 ALA A O   1 
ATOM   2475 C  CB  . ALA A 1 337 ? 12.868  30.868  -28.310  1.00 26.31 ? 337 ALA A CB  1 
ATOM   2476 N  N   . LYS A 1 338 ? 9.655   31.507  -27.382  1.00 23.52 ? 338 LYS A N   1 
ATOM   2477 C  CA  . LYS A 1 338 ? 8.329   31.896  -27.753  1.00 29.01 ? 338 LYS A CA  1 
ATOM   2478 C  C   . LYS A 1 338 ? 7.901   31.460  -29.134  1.00 31.55 ? 338 LYS A C   1 
ATOM   2479 O  O   . LYS A 1 338 ? 6.900   31.945  -29.657  1.00 33.88 ? 338 LYS A O   1 
ATOM   2480 C  CB  . LYS A 1 338 ? 8.186   33.415  -27.578  1.00 31.27 ? 338 LYS A CB  1 
ATOM   2481 C  CG  . LYS A 1 338 ? 6.818   33.835  -27.047  1.00 34.60 ? 338 LYS A CG  1 
ATOM   2482 C  CD  . LYS A 1 338 ? 7.013   34.819  -25.905  1.00 40.62 ? 338 LYS A CD  1 
ATOM   2483 C  CE  . LYS A 1 338 ? 5.652   35.418  -25.508  1.00 44.25 ? 338 LYS A CE  1 
ATOM   2484 N  NZ  . LYS A 1 338 ? 5.676   36.026  -24.178  1.00 44.54 ? 338 LYS A NZ  1 
ATOM   2485 N  N   . LYS A 1 339 ? 8.561   30.456  -29.715  1.00 30.95 ? 339 LYS A N   1 
ATOM   2486 C  CA  . LYS A 1 339 ? 8.169   29.969  -31.026  1.00 28.31 ? 339 LYS A CA  1 
ATOM   2487 C  C   . LYS A 1 339 ? 6.733   29.477  -31.062  1.00 27.65 ? 339 LYS A C   1 
ATOM   2488 O  O   . LYS A 1 339 ? 6.116   29.531  -32.116  1.00 31.49 ? 339 LYS A O   1 
ATOM   2489 C  CB  . LYS A 1 339 ? 8.975   28.785  -31.502  1.00 31.42 ? 339 LYS A CB  1 
ATOM   2490 C  CG  . LYS A 1 339 ? 10.159  29.035  -32.375  1.00 36.52 ? 339 LYS A CG  1 
ATOM   2491 C  CD  . LYS A 1 339 ? 11.335  29.412  -31.516  1.00 37.34 ? 339 LYS A CD  1 
ATOM   2492 C  CE  . LYS A 1 339 ? 12.506  29.626  -32.446  1.00 42.86 ? 339 LYS A CE  1 
ATOM   2493 N  NZ  . LYS A 1 339 ? 12.260  30.787  -33.288  1.00 49.47 ? 339 LYS A NZ  1 
ATOM   2494 N  N   . PHE A 1 340 ? 6.138   28.947  -30.000  1.00 27.68 ? 340 PHE A N   1 
ATOM   2495 C  CA  . PHE A 1 340 ? 4.771   28.445  -30.058  1.00 23.51 ? 340 PHE A CA  1 
ATOM   2496 C  C   . PHE A 1 340 ? 4.187   28.550  -28.671  1.00 23.01 ? 340 PHE A C   1 
ATOM   2497 O  O   . PHE A 1 340 ? 4.923   28.771  -27.713  1.00 22.15 ? 340 PHE A O   1 
ATOM   2498 C  CB  . PHE A 1 340 ? 4.764   27.006  -30.538  1.00 25.29 ? 340 PHE A CB  1 
ATOM   2499 C  CG  . PHE A 1 340 ? 5.653   26.057  -29.760  1.00 31.51 ? 340 PHE A CG  1 
ATOM   2500 C  CD1 . PHE A 1 340 ? 5.169   25.417  -28.611  1.00 33.16 ? 340 PHE A CD1 1 
ATOM   2501 C  CD2 . PHE A 1 340 ? 6.949   25.812  -30.218  1.00 31.94 ? 340 PHE A CD2 1 
ATOM   2502 C  CE1 . PHE A 1 340 ? 5.998   24.525  -27.933  1.00 34.90 ? 340 PHE A CE1 1 
ATOM   2503 C  CE2 . PHE A 1 340 ? 7.770   24.918  -29.531  1.00 28.52 ? 340 PHE A CE2 1 
ATOM   2504 C  CZ  . PHE A 1 340 ? 7.293   24.278  -28.394  1.00 31.78 ? 340 PHE A CZ  1 
ATOM   2505 N  N   . SER A 1 341 ? 2.900   28.319  -28.504  1.00 21.22 ? 341 SER A N   1 
ATOM   2506 C  CA  . SER A 1 341 ? 2.282   28.502  -27.238  1.00 18.66 ? 341 SER A CA  1 
ATOM   2507 C  C   . SER A 1 341 ? 1.454   27.280  -26.961  1.00 21.68 ? 341 SER A C   1 
ATOM   2508 O  O   . SER A 1 341 ? 0.749   26.811  -27.859  1.00 20.59 ? 341 SER A O   1 
ATOM   2509 C  CB  . SER A 1 341 ? 1.447   29.775  -27.354  1.00 21.77 ? 341 SER A CB  1 
ATOM   2510 O  OG  . SER A 1 341 ? 0.683   30.188  -26.218  1.00 29.26 ? 341 SER A OG  1 
ATOM   2511 N  N   . LEU A 1 342 ? 1.483   26.779  -25.711  1.00 22.42 ? 342 LEU A N   1 
ATOM   2512 C  CA  . LEU A 1 342 ? 0.704   25.602  -25.374  1.00 17.62 ? 342 LEU A CA  1 
ATOM   2513 C  C   . LEU A 1 342 ? -0.578  25.985  -24.692  1.00 19.65 ? 342 LEU A C   1 
ATOM   2514 O  O   . LEU A 1 342 ? -1.518  25.196  -24.605  1.00 21.01 ? 342 LEU A O   1 
ATOM   2515 C  CB  . LEU A 1 342 ? 1.554   24.715  -24.508  1.00 21.26 ? 342 LEU A CB  1 
ATOM   2516 C  CG  . LEU A 1 342 ? 2.872   24.252  -25.135  1.00 20.77 ? 342 LEU A CG  1 
ATOM   2517 C  CD1 . LEU A 1 342 ? 3.749   23.558  -24.149  1.00 27.00 ? 342 LEU A CD1 1 
ATOM   2518 C  CD2 . LEU A 1 342 ? 2.549   23.270  -26.231  1.00 27.01 ? 342 LEU A CD2 1 
ATOM   2519 N  N   . ASP A 1 343 ? -0.706  27.249  -24.293  1.00 22.11 ? 343 ASP A N   1 
ATOM   2520 C  CA  . ASP A 1 343 ? -1.891  27.747  -23.605  1.00 20.43 ? 343 ASP A CA  1 
ATOM   2521 C  C   . ASP A 1 343 ? -3.235  27.437  -24.164  1.00 23.21 ? 343 ASP A C   1 
ATOM   2522 O  O   . ASP A 1 343 ? -4.175  27.255  -23.384  1.00 26.68 ? 343 ASP A O   1 
ATOM   2523 C  CB  . ASP A 1 343 ? -1.900  29.240  -23.470  1.00 23.44 ? 343 ASP A CB  1 
ATOM   2524 C  CG  . ASP A 1 343 ? -0.911  29.727  -22.439  1.00 29.91 ? 343 ASP A CG  1 
ATOM   2525 O  OD1 . ASP A 1 343 ? 0.295   29.523  -22.596  1.00 31.55 ? 343 ASP A OD1 1 
ATOM   2526 O  OD2 . ASP A 1 343 ? -1.374  30.307  -21.464  1.00 39.58 ? 343 ASP A OD2 1 
ATOM   2527 N  N   . ALA A 1 344 ? -3.403  27.345  -25.482  1.00 23.06 ? 344 ALA A N   1 
ATOM   2528 C  CA  . ALA A 1 344 ? -4.766  27.099  -25.962  1.00 20.74 ? 344 ALA A CA  1 
ATOM   2529 C  C   . ALA A 1 344 ? -5.185  25.660  -25.772  1.00 17.10 ? 344 ALA A C   1 
ATOM   2530 O  O   . ALA A 1 344 ? -6.362  25.335  -25.741  1.00 15.81 ? 344 ALA A O   1 
ATOM   2531 C  CB  . ALA A 1 344 ? -4.875  27.456  -27.445  1.00 25.43 ? 344 ALA A CB  1 
ATOM   2532 N  N   . LEU A 1 345 ? -4.186  24.797  -25.637  1.00 16.81 ? 345 LEU A N   1 
ATOM   2533 C  CA  . LEU A 1 345 ? -4.416  23.379  -25.486  1.00 20.20 ? 345 LEU A CA  1 
ATOM   2534 C  C   . LEU A 1 345 ? -4.876  23.023  -24.091  1.00 21.71 ? 345 LEU A C   1 
ATOM   2535 O  O   . LEU A 1 345 ? -5.765  22.182  -23.902  1.00 24.17 ? 345 LEU A O   1 
ATOM   2536 C  CB  . LEU A 1 345 ? -3.126  22.614  -25.816  1.00 21.92 ? 345 LEU A CB  1 
ATOM   2537 C  CG  . LEU A 1 345 ? -2.541  22.856  -27.212  1.00 22.27 ? 345 LEU A CG  1 
ATOM   2538 C  CD1 . LEU A 1 345 ? -1.284  22.055  -27.403  1.00 24.20 ? 345 LEU A CD1 1 
ATOM   2539 C  CD2 . LEU A 1 345 ? -3.551  22.443  -28.259  1.00 26.21 ? 345 LEU A CD2 1 
ATOM   2540 N  N   . ILE A 1 346 ? -4.255  23.655  -23.095  1.00 22.76 ? 346 ILE A N   1 
ATOM   2541 C  CA  . ILE A 1 346 ? -4.565  23.393  -21.702  1.00 19.73 ? 346 ILE A CA  1 
ATOM   2542 C  C   . ILE A 1 346 ? -5.879  24.048  -21.350  1.00 21.03 ? 346 ILE A C   1 
ATOM   2543 O  O   . ILE A 1 346 ? -5.908  25.240  -21.064  1.00 24.79 ? 346 ILE A O   1 
ATOM   2544 C  CB  . ILE A 1 346 ? -3.433  23.937  -20.859  1.00 18.07 ? 346 ILE A CB  1 
ATOM   2545 C  CG1 . ILE A 1 346 ? -2.159  23.188  -21.174  1.00 19.01 ? 346 ILE A CG1 1 
ATOM   2546 C  CG2 . ILE A 1 346 ? -3.794  23.784  -19.392  1.00 24.36 ? 346 ILE A CG2 1 
ATOM   2547 C  CD1 . ILE A 1 346 ? -0.923  24.034  -20.870  1.00 23.77 ? 346 ILE A CD1 1 
ATOM   2548 N  N   . THR A 1 347 ? -6.994  23.347  -21.394  1.00 21.51 ? 347 THR A N   1 
ATOM   2549 C  CA  . THR A 1 347 ? -8.209  24.002  -21.010  1.00 25.57 ? 347 THR A CA  1 
ATOM   2550 C  C   . THR A 1 347 ? -8.534  23.856  -19.510  1.00 33.04 ? 347 THR A C   1 
ATOM   2551 O  O   . THR A 1 347 ? -9.275  24.665  -18.941  1.00 37.41 ? 347 THR A O   1 
ATOM   2552 C  CB  . THR A 1 347 ? -9.326  23.445  -21.879  1.00 24.79 ? 347 THR A CB  1 
ATOM   2553 O  OG1 . THR A 1 347 ? -9.504  22.047  -21.677  1.00 29.66 ? 347 THR A OG1 1 
ATOM   2554 C  CG2 . THR A 1 347 ? -8.963  23.678  -23.320  1.00 30.30 ? 347 THR A CG2 1 
ATOM   2555 N  N   . HIS A 1 348 ? -8.078  22.809  -18.805  1.00 33.46 ? 348 HIS A N   1 
ATOM   2556 C  CA  . HIS A 1 348 ? -8.391  22.594  -17.404  1.00 31.83 ? 348 HIS A CA  1 
ATOM   2557 C  C   . HIS A 1 348 ? -7.158  22.173  -16.655  1.00 33.89 ? 348 HIS A C   1 
ATOM   2558 O  O   . HIS A 1 348 ? -6.281  21.532  -17.225  1.00 34.28 ? 348 HIS A O   1 
ATOM   2559 C  CB  . HIS A 1 348 ? -9.371  21.491  -17.188  1.00 34.17 ? 348 HIS A CB  1 
ATOM   2560 C  CG  . HIS A 1 348 ? -10.694 21.673  -17.902  1.00 35.28 ? 348 HIS A CG  1 
ATOM   2561 N  ND1 . HIS A 1 348 ? -11.864 22.052  -17.404  1.00 40.50 ? 348 HIS A ND1 1 
ATOM   2562 C  CD2 . HIS A 1 348 ? -10.880 21.416  -19.226  1.00 30.78 ? 348 HIS A CD2 1 
ATOM   2563 C  CE1 . HIS A 1 348 ? -12.752 22.032  -18.370  1.00 39.19 ? 348 HIS A CE1 1 
ATOM   2564 N  NE2 . HIS A 1 348 ? -12.140 21.647  -19.459  1.00 37.40 ? 348 HIS A NE2 1 
ATOM   2565 N  N   . VAL A 1 349 ? -7.061  22.591  -15.396  1.00 36.04 ? 349 VAL A N   1 
ATOM   2566 C  CA  . VAL A 1 349 ? -5.972  22.243  -14.498  1.00 34.62 ? 349 VAL A CA  1 
ATOM   2567 C  C   . VAL A 1 349 ? -6.769  21.702  -13.320  1.00 36.01 ? 349 VAL A C   1 
ATOM   2568 O  O   . VAL A 1 349 ? -7.723  22.352  -12.880  1.00 40.12 ? 349 VAL A O   1 
ATOM   2569 C  CB  . VAL A 1 349 ? -5.183  23.436  -14.024  1.00 30.38 ? 349 VAL A CB  1 
ATOM   2570 C  CG1 . VAL A 1 349 ? -4.016  22.923  -13.215  1.00 28.70 ? 349 VAL A CG1 1 
ATOM   2571 C  CG2 . VAL A 1 349 ? -4.660  24.241  -15.195  1.00 30.96 ? 349 VAL A CG2 1 
ATOM   2572 N  N   . LEU A 1 350 ? -6.481  20.492  -12.877  1.00 32.88 ? 350 LEU A N   1 
ATOM   2573 C  CA  . LEU A 1 350 ? -7.164  19.863  -11.769  1.00 26.75 ? 350 LEU A CA  1 
ATOM   2574 C  C   . LEU A 1 350 ? -6.049  19.345  -10.879  1.00 28.04 ? 350 LEU A C   1 
ATOM   2575 O  O   . LEU A 1 350 ? -4.907  19.160  -11.335  1.00 27.00 ? 350 LEU A O   1 
ATOM   2576 C  CB  . LEU A 1 350 ? -7.993  18.687  -12.224  1.00 23.55 ? 350 LEU A CB  1 
ATOM   2577 C  CG  . LEU A 1 350 ? -9.203  18.853  -13.107  1.00 25.98 ? 350 LEU A CG  1 
ATOM   2578 C  CD1 . LEU A 1 350 ? -9.972  17.550  -13.174  1.00 27.89 ? 350 LEU A CD1 1 
ATOM   2579 C  CD2 . LEU A 1 350 ? -10.119 19.906  -12.519  1.00 36.93 ? 350 LEU A CD2 1 
ATOM   2580 N  N   . PRO A 1 351 ? -6.268  19.149  -9.574   1.00 30.79 ? 351 PRO A N   1 
ATOM   2581 C  CA  . PRO A 1 351 ? -5.267  18.547  -8.697   1.00 28.74 ? 351 PRO A CA  1 
ATOM   2582 C  C   . PRO A 1 351 ? -5.240  17.076  -9.063   1.00 29.27 ? 351 PRO A C   1 
ATOM   2583 O  O   . PRO A 1 351 ? -6.244  16.529  -9.531   1.00 32.77 ? 351 PRO A O   1 
ATOM   2584 C  CB  . PRO A 1 351 ? -5.782  18.853  -7.329   1.00 24.35 ? 351 PRO A CB  1 
ATOM   2585 C  CG  . PRO A 1 351 ? -7.275  18.835  -7.528   1.00 22.18 ? 351 PRO A CG  1 
ATOM   2586 C  CD  . PRO A 1 351 ? -7.430  19.624  -8.806   1.00 30.24 ? 351 PRO A CD  1 
ATOM   2587 N  N   . PHE A 1 352 ? -4.146  16.389  -8.819   1.00 27.63 ? 352 PHE A N   1 
ATOM   2588 C  CA  . PHE A 1 352 ? -4.011  14.987  -9.143   1.00 29.17 ? 352 PHE A CA  1 
ATOM   2589 C  C   . PHE A 1 352 ? -5.151  14.095  -8.685   1.00 30.92 ? 352 PHE A C   1 
ATOM   2590 O  O   . PHE A 1 352 ? -5.607  13.179  -9.368   1.00 34.44 ? 352 PHE A O   1 
ATOM   2591 C  CB  . PHE A 1 352 ? -2.696  14.575  -8.549   1.00 31.62 ? 352 PHE A CB  1 
ATOM   2592 C  CG  . PHE A 1 352 ? -2.463  13.084  -8.485   1.00 40.79 ? 352 PHE A CG  1 
ATOM   2593 C  CD1 . PHE A 1 352 ? -2.372  12.333  -9.657   1.00 41.53 ? 352 PHE A CD1 1 
ATOM   2594 C  CD2 . PHE A 1 352 ? -2.337  12.481  -7.226   1.00 40.24 ? 352 PHE A CD2 1 
ATOM   2595 C  CE1 . PHE A 1 352 ? -2.151  10.961  -9.552   1.00 46.10 ? 352 PHE A CE1 1 
ATOM   2596 C  CE2 . PHE A 1 352 ? -2.117  11.117  -7.137   1.00 39.18 ? 352 PHE A CE2 1 
ATOM   2597 C  CZ  . PHE A 1 352 ? -2.024  10.359  -8.297   1.00 43.04 ? 352 PHE A CZ  1 
ATOM   2598 N  N   . GLU A 1 353 ? -5.667  14.426  -7.517   1.00 33.29 ? 353 GLU A N   1 
ATOM   2599 C  CA  . GLU A 1 353 ? -6.718  13.670  -6.874   1.00 35.74 ? 353 GLU A CA  1 
ATOM   2600 C  C   . GLU A 1 353 ? -7.996  13.684  -7.684   1.00 37.55 ? 353 GLU A C   1 
ATOM   2601 O  O   . GLU A 1 353 ? -8.838  12.790  -7.576   1.00 39.51 ? 353 GLU A O   1 
ATOM   2602 C  CB  . GLU A 1 353 ? -6.965  14.253  -5.489   1.00 38.13 ? 353 GLU A CB  1 
ATOM   2603 C  CG  . GLU A 1 353 ? -5.874  14.084  -4.424   1.00 42.41 ? 353 GLU A CG  1 
ATOM   2604 C  CD  . GLU A 1 353 ? -4.578  14.873  -4.591   1.00 48.23 ? 353 GLU A CD  1 
ATOM   2605 O  OE1 . GLU A 1 353 ? -4.598  15.962  -5.177   1.00 52.03 ? 353 GLU A OE1 1 
ATOM   2606 O  OE2 . GLU A 1 353 ? -3.539  14.390  -4.122   1.00 48.50 ? 353 GLU A OE2 1 
ATOM   2607 N  N   . LYS A 1 354 ? -8.150  14.682  -8.546   1.00 38.08 ? 354 LYS A N   1 
ATOM   2608 C  CA  . LYS A 1 354 ? -9.343  14.776  -9.358   1.00 38.25 ? 354 LYS A CA  1 
ATOM   2609 C  C   . LYS A 1 354 ? -9.203  14.121  -10.727  1.00 36.74 ? 354 LYS A C   1 
ATOM   2610 O  O   . LYS A 1 354 ? -10.045 14.352  -11.613  1.00 38.08 ? 354 LYS A O   1 
ATOM   2611 C  CB  . LYS A 1 354 ? -9.709  16.243  -9.485   1.00 39.94 ? 354 LYS A CB  1 
ATOM   2612 C  CG  . LYS A 1 354 ? -11.144 16.332  -8.982   1.00 45.12 ? 354 LYS A CG  1 
ATOM   2613 C  CD  . LYS A 1 354 ? -11.585 17.739  -8.614   1.00 49.51 ? 354 LYS A CD  1 
ATOM   2614 C  CE  . LYS A 1 354 ? -10.825 18.251  -7.403   1.00 52.85 ? 354 LYS A CE  1 
ATOM   2615 N  NZ  . LYS A 1 354 ? -11.344 19.536  -6.976   1.00 58.13 ? 354 LYS A NZ  1 
ATOM   2616 N  N   . ILE A 1 355 ? -8.211  13.218  -10.864  1.00 31.56 ? 355 ILE A N   1 
ATOM   2617 C  CA  . ILE A 1 355 ? -7.922  12.497  -12.094  1.00 29.02 ? 355 ILE A CA  1 
ATOM   2618 C  C   . ILE A 1 355 ? -9.121  11.897  -12.777  1.00 27.48 ? 355 ILE A C   1 
ATOM   2619 O  O   . ILE A 1 355 ? -9.289  12.128  -13.963  1.00 29.74 ? 355 ILE A O   1 
ATOM   2620 C  CB  . ILE A 1 355 ? -6.823  11.397  -11.817  1.00 28.68 ? 355 ILE A CB  1 
ATOM   2621 C  CG1 . ILE A 1 355 ? -6.440  10.719  -13.129  1.00 20.11 ? 355 ILE A CG1 1 
ATOM   2622 C  CG2 . ILE A 1 355 ? -7.311  10.357  -10.788  1.00 34.62 ? 355 ILE A CG2 1 
ATOM   2623 C  CD1 . ILE A 1 355 ? -4.983  10.252  -13.107  1.00 12.56 ? 355 ILE A CD1 1 
ATOM   2624 N  N   . ASN A 1 356 ? -10.044 11.239  -12.101  1.00 32.59 ? 356 ASN A N   1 
ATOM   2625 C  CA  . ASN A 1 356 ? -11.204 10.655  -12.762  1.00 36.19 ? 356 ASN A CA  1 
ATOM   2626 C  C   . ASN A 1 356 ? -12.094 11.720  -13.397  1.00 38.94 ? 356 ASN A C   1 
ATOM   2627 O  O   . ASN A 1 356 ? -12.634 11.541  -14.486  1.00 38.57 ? 356 ASN A O   1 
ATOM   2628 C  CB  . ASN A 1 356 ? -12.030 9.851   -11.766  1.00 36.06 ? 356 ASN A CB  1 
ATOM   2629 C  CG  . ASN A 1 356 ? -11.459 8.492   -11.416  1.00 39.21 ? 356 ASN A CG  1 
ATOM   2630 O  OD1 . ASN A 1 356 ? -11.505 7.545   -12.193  1.00 44.19 ? 356 ASN A OD1 1 
ATOM   2631 N  ND2 . ASN A 1 356 ? -10.896 8.304   -10.237  1.00 41.38 ? 356 ASN A ND2 1 
ATOM   2632 N  N   . GLU A 1 357 ? -12.199 12.890  -12.758  1.00 41.78 ? 357 GLU A N   1 
ATOM   2633 C  CA  . GLU A 1 357 ? -13.020 13.982  -13.255  1.00 43.89 ? 357 GLU A CA  1 
ATOM   2634 C  C   . GLU A 1 357 ? -12.340 14.462  -14.542  1.00 43.16 ? 357 GLU A C   1 
ATOM   2635 O  O   . GLU A 1 357 ? -13.017 14.826  -15.506  1.00 46.48 ? 357 GLU A O   1 
ATOM   2636 C  CB  . GLU A 1 357 ? -13.085 15.083  -12.183  1.00 47.25 ? 357 GLU A CB  1 
ATOM   2637 C  CG  . GLU A 1 357 ? -14.381 15.912  -12.196  1.00 54.66 ? 357 GLU A CG  1 
ATOM   2638 C  CD  . GLU A 1 357 ? -14.232 17.447  -12.246  1.00 59.76 ? 357 GLU A CD  1 
ATOM   2639 O  OE1 . GLU A 1 357 ? -13.419 18.005  -11.501  1.00 60.01 ? 357 GLU A OE1 1 
ATOM   2640 O  OE2 . GLU A 1 357 ? -14.942 18.090  -13.035  1.00 59.64 ? 357 GLU A OE2 1 
ATOM   2641 N  N   . GLY A 1 358 ? -11.003 14.405  -14.618  1.00 39.10 ? 358 GLY A N   1 
ATOM   2642 C  CA  . GLY A 1 358 ? -10.259 14.785  -15.802  1.00 34.06 ? 358 GLY A CA  1 
ATOM   2643 C  C   . GLY A 1 358 ? -10.617 13.846  -16.953  1.00 32.73 ? 358 GLY A C   1 
ATOM   2644 O  O   . GLY A 1 358 ? -10.828 14.265  -18.088  1.00 38.21 ? 358 GLY A O   1 
ATOM   2645 N  N   . PHE A 1 359 ? -10.761 12.552  -16.711  1.00 27.75 ? 359 PHE A N   1 
ATOM   2646 C  CA  . PHE A 1 359 ? -11.112 11.644  -17.767  1.00 23.62 ? 359 PHE A CA  1 
ATOM   2647 C  C   . PHE A 1 359 ? -12.561 11.843  -18.155  1.00 28.51 ? 359 PHE A C   1 
ATOM   2648 O  O   . PHE A 1 359 ? -12.967 11.506  -19.269  1.00 31.13 ? 359 PHE A O   1 
ATOM   2649 C  CB  . PHE A 1 359 ? -10.843 10.220  -17.303  1.00 16.46 ? 359 PHE A CB  1 
ATOM   2650 C  CG  . PHE A 1 359 ? -9.378  9.857   -17.472  1.00 12.89 ? 359 PHE A CG  1 
ATOM   2651 C  CD1 . PHE A 1 359 ? -8.411  10.349  -16.603  1.00 12.45 ? 359 PHE A CD1 1 
ATOM   2652 C  CD2 . PHE A 1 359 ? -8.995  9.053   -18.545  1.00 11.81 ? 359 PHE A CD2 1 
ATOM   2653 C  CE1 . PHE A 1 359 ? -7.066  10.038  -16.810  1.00 15.10 ? 359 PHE A CE1 1 
ATOM   2654 C  CE2 . PHE A 1 359 ? -7.659  8.746   -18.751  1.00 12.38 ? 359 PHE A CE2 1 
ATOM   2655 C  CZ  . PHE A 1 359 ? -6.691  9.242   -17.877  1.00 13.17 ? 359 PHE A CZ  1 
ATOM   2656 N  N   . ASP A 1 360 ? -13.414 12.375  -17.291  1.00 33.24 ? 360 ASP A N   1 
ATOM   2657 C  CA  . ASP A 1 360 ? -14.809 12.613  -17.628  1.00 35.32 ? 360 ASP A CA  1 
ATOM   2658 C  C   . ASP A 1 360 ? -14.916 13.818  -18.536  1.00 32.80 ? 360 ASP A C   1 
ATOM   2659 O  O   . ASP A 1 360 ? -15.765 13.845  -19.443  1.00 30.35 ? 360 ASP A O   1 
ATOM   2660 C  CB  . ASP A 1 360 ? -15.637 12.857  -16.377  1.00 40.63 ? 360 ASP A CB  1 
ATOM   2661 C  CG  . ASP A 1 360 ? -15.630 11.662  -15.431  1.00 50.37 ? 360 ASP A CG  1 
ATOM   2662 O  OD1 . ASP A 1 360 ? -15.834 10.512  -15.864  1.00 51.67 ? 360 ASP A OD1 1 
ATOM   2663 O  OD2 . ASP A 1 360 ? -15.407 11.909  -14.246  1.00 53.39 ? 360 ASP A OD2 1 
ATOM   2664 N  N   . LEU A 1 361 ? -14.018 14.785  -18.323  1.00 28.74 ? 361 LEU A N   1 
ATOM   2665 C  CA  . LEU A 1 361 ? -13.992 15.978  -19.143  1.00 27.84 ? 361 LEU A CA  1 
ATOM   2666 C  C   . LEU A 1 361 ? -13.613 15.570  -20.564  1.00 27.31 ? 361 LEU A C   1 
ATOM   2667 O  O   . LEU A 1 361 ? -14.282 16.009  -21.513  1.00 28.77 ? 361 LEU A O   1 
ATOM   2668 C  CB  . LEU A 1 361 ? -12.985 16.967  -18.567  1.00 26.47 ? 361 LEU A CB  1 
ATOM   2669 C  CG  . LEU A 1 361 ? -13.379 17.698  -17.285  1.00 21.83 ? 361 LEU A CG  1 
ATOM   2670 C  CD1 . LEU A 1 361 ? -12.255 18.627  -16.927  1.00 17.38 ? 361 LEU A CD1 1 
ATOM   2671 C  CD2 . LEU A 1 361 ? -14.686 18.483  -17.465  1.00 19.43 ? 361 LEU A CD2 1 
ATOM   2672 N  N   . LEU A 1 362 ? -12.569 14.752  -20.743  1.00 25.33 ? 362 LEU A N   1 
ATOM   2673 C  CA  . LEU A 1 362 ? -12.158 14.233  -22.046  1.00 25.64 ? 362 LEU A CA  1 
ATOM   2674 C  C   . LEU A 1 362 ? -13.383 13.558  -22.641  1.00 26.88 ? 362 LEU A C   1 
ATOM   2675 O  O   . LEU A 1 362 ? -13.962 14.037  -23.601  1.00 33.73 ? 362 LEU A O   1 
ATOM   2676 C  CB  . LEU A 1 362 ? -11.051 13.215  -21.887  1.00 23.66 ? 362 LEU A CB  1 
ATOM   2677 C  CG  . LEU A 1 362 ? -10.201 12.667  -23.038  1.00 25.52 ? 362 LEU A CG  1 
ATOM   2678 C  CD1 . LEU A 1 362 ? -9.346  13.722  -23.750  1.00 20.83 ? 362 LEU A CD1 1 
ATOM   2679 C  CD2 . LEU A 1 362 ? -9.237  11.697  -22.403  1.00 19.76 ? 362 LEU A CD2 1 
ATOM   2680 N  N   . HIS A 1 363 ? -13.952 12.574  -21.982  1.00 26.74 ? 363 HIS A N   1 
ATOM   2681 C  CA  . HIS A 1 363 ? -15.110 11.847  -22.454  1.00 24.73 ? 363 HIS A CA  1 
ATOM   2682 C  C   . HIS A 1 363 ? -16.348 12.635  -22.839  1.00 29.16 ? 363 HIS A C   1 
ATOM   2683 O  O   . HIS A 1 363 ? -17.246 12.067  -23.459  1.00 31.88 ? 363 HIS A O   1 
ATOM   2684 C  CB  . HIS A 1 363 ? -15.538 10.844  -21.409  1.00 25.71 ? 363 HIS A CB  1 
ATOM   2685 C  CG  . HIS A 1 363 ? -14.537 9.769   -21.027  1.00 26.85 ? 363 HIS A CG  1 
ATOM   2686 N  ND1 . HIS A 1 363 ? -14.741 8.884   -20.074  1.00 27.87 ? 363 HIS A ND1 1 
ATOM   2687 C  CD2 . HIS A 1 363 ? -13.299 9.516   -21.582  1.00 27.02 ? 363 HIS A CD2 1 
ATOM   2688 C  CE1 . HIS A 1 363 ? -13.690 8.104   -20.027  1.00 30.86 ? 363 HIS A CE1 1 
ATOM   2689 N  NE2 . HIS A 1 363 ? -12.834 8.485   -20.932  1.00 26.90 ? 363 HIS A NE2 1 
ATOM   2690 N  N   . SER A 1 364 ? -16.431 13.904  -22.467  1.00 33.20 ? 364 SER A N   1 
ATOM   2691 C  CA  . SER A 1 364 ? -17.577 14.723  -22.792  1.00 36.79 ? 364 SER A CA  1 
ATOM   2692 C  C   . SER A 1 364 ? -17.261 15.767  -23.842  1.00 37.45 ? 364 SER A C   1 
ATOM   2693 O  O   . SER A 1 364 ? -18.131 16.561  -24.155  1.00 43.51 ? 364 SER A O   1 
ATOM   2694 C  CB  . SER A 1 364 ? -18.061 15.407  -21.534  1.00 38.16 ? 364 SER A CB  1 
ATOM   2695 O  OG  . SER A 1 364 ? -18.313 14.414  -20.557  1.00 46.73 ? 364 SER A OG  1 
ATOM   2696 N  N   . GLY A 1 365 ? -16.057 15.906  -24.383  1.00 37.17 ? 365 GLY A N   1 
ATOM   2697 C  CA  . GLY A 1 365 ? -15.774 16.912  -25.406  1.00 38.40 ? 365 GLY A CA  1 
ATOM   2698 C  C   . GLY A 1 365 ? -15.625 18.325  -24.863  1.00 38.54 ? 365 GLY A C   1 
ATOM   2699 O  O   . GLY A 1 365 ? -15.654 19.325  -25.596  1.00 38.22 ? 365 GLY A O   1 
ATOM   2700 N  N   . LYS A 1 366 ? -15.367 18.356  -23.554  1.00 35.94 ? 366 LYS A N   1 
ATOM   2701 C  CA  . LYS A 1 366 ? -15.230 19.604  -22.837  1.00 32.31 ? 366 LYS A CA  1 
ATOM   2702 C  C   . LYS A 1 366 ? -13.796 20.052  -22.694  1.00 28.29 ? 366 LYS A C   1 
ATOM   2703 O  O   . LYS A 1 366 ? -13.470 21.218  -22.427  1.00 28.42 ? 366 LYS A O   1 
ATOM   2704 C  CB  . LYS A 1 366 ? -15.839 19.451  -21.454  1.00 36.07 ? 366 LYS A CB  1 
ATOM   2705 C  CG  . LYS A 1 366 ? -17.287 18.984  -21.406  1.00 40.49 ? 366 LYS A CG  1 
ATOM   2706 C  CD  . LYS A 1 366 ? -18.239 19.927  -22.149  1.00 44.82 ? 366 LYS A CD  1 
ATOM   2707 C  CE  . LYS A 1 366 ? -19.713 19.486  -22.028  1.00 46.35 ? 366 LYS A CE  1 
ATOM   2708 N  NZ  . LYS A 1 366 ? -19.972 18.169  -22.596  1.00 45.48 ? 366 LYS A NZ  1 
ATOM   2709 N  N   . SER A 1 367 ? -12.878 19.118  -22.841  1.00 25.64 ? 367 SER A N   1 
ATOM   2710 C  CA  . SER A 1 367 ? -11.481 19.478  -22.657  1.00 22.02 ? 367 SER A CA  1 
ATOM   2711 C  C   . SER A 1 367 ? -10.678 19.088  -23.874  1.00 17.89 ? 367 SER A C   1 
ATOM   2712 O  O   . SER A 1 367 ? -11.107 18.186  -24.585  1.00 19.44 ? 367 SER A O   1 
ATOM   2713 C  CB  . SER A 1 367 ? -10.928 18.747  -21.460  1.00 17.14 ? 367 SER A CB  1 
ATOM   2714 O  OG  . SER A 1 367 ? -11.384 17.396  -21.497  1.00 16.22 ? 367 SER A OG  1 
ATOM   2715 N  N   . ILE A 1 368 ? -9.595  19.814  -24.097  1.00 11.64 ? 368 ILE A N   1 
ATOM   2716 C  CA  . ILE A 1 368 ? -8.654  19.485  -25.123  1.00 15.43 ? 368 ILE A CA  1 
ATOM   2717 C  C   . ILE A 1 368 ? -7.677  18.850  -24.116  1.00 19.12 ? 368 ILE A C   1 
ATOM   2718 O  O   . ILE A 1 368 ? -7.932  17.703  -23.735  1.00 22.72 ? 368 ILE A O   1 
ATOM   2719 C  CB  . ILE A 1 368 ? -8.181  20.788  -25.767  1.00 15.76 ? 368 ILE A CB  1 
ATOM   2720 C  CG1 . ILE A 1 368 ? -9.356  21.455  -26.492  1.00 18.97 ? 368 ILE A CG1 1 
ATOM   2721 C  CG2 . ILE A 1 368 ? -7.069  20.488  -26.745  1.00 8.56  ? 368 ILE A CG2 1 
ATOM   2722 C  CD1 . ILE A 1 368 ? -9.032  22.882  -26.946  1.00 22.22 ? 368 ILE A CD1 1 
ATOM   2723 N  N   . ARG A 1 369 ? -6.626  19.495  -23.600  1.00 17.89 ? 369 ARG A N   1 
ATOM   2724 C  CA  . ARG A 1 369 ? -5.775  18.889  -22.594  1.00 22.73 ? 369 ARG A CA  1 
ATOM   2725 C  C   . ARG A 1 369 ? -6.154  19.254  -21.143  1.00 27.17 ? 369 ARG A C   1 
ATOM   2726 O  O   . ARG A 1 369 ? -6.372  20.440  -20.851  1.00 29.82 ? 369 ARG A O   1 
ATOM   2727 C  CB  . ARG A 1 369 ? -4.321  19.305  -22.772  1.00 17.27 ? 369 ARG A CB  1 
ATOM   2728 C  CG  . ARG A 1 369 ? -3.547  18.420  -23.716  1.00 18.07 ? 369 ARG A CG  1 
ATOM   2729 C  CD  . ARG A 1 369 ? -3.591  16.961  -23.269  1.00 19.27 ? 369 ARG A CD  1 
ATOM   2730 N  NE  . ARG A 1 369 ? -2.656  16.118  -23.996  1.00 13.53 ? 369 ARG A NE  1 
ATOM   2731 C  CZ  . ARG A 1 369 ? -3.052  15.232  -24.919  1.00 10.62 ? 369 ARG A CZ  1 
ATOM   2732 N  NH1 . ARG A 1 369 ? -4.303  15.062  -25.279  1.00 2.00  ? 369 ARG A NH1 1 
ATOM   2733 N  NH2 . ARG A 1 369 ? -2.194  14.353  -25.370  1.00 9.32  ? 369 ARG A NH2 1 
ATOM   2734 N  N   . THR A 1 370 ? -6.355  18.304  -20.234  1.00 26.96 ? 370 THR A N   1 
ATOM   2735 C  CA  . THR A 1 370 ? -6.574  18.587  -18.817  1.00 27.45 ? 370 THR A CA  1 
ATOM   2736 C  C   . THR A 1 370 ? -5.192  18.379  -18.190  1.00 28.20 ? 370 THR A C   1 
ATOM   2737 O  O   . THR A 1 370 ? -4.548  17.357  -18.485  1.00 34.11 ? 370 THR A O   1 
ATOM   2738 C  CB  . THR A 1 370 ? -7.559  17.605  -18.119  1.00 26.07 ? 370 THR A CB  1 
ATOM   2739 O  OG1 . THR A 1 370 ? -8.883  17.887  -18.585  1.00 31.67 ? 370 THR A OG1 1 
ATOM   2740 C  CG2 . THR A 1 370 ? -7.549  17.772  -16.605  1.00 24.87 ? 370 THR A CG2 1 
ATOM   2741 N  N   . VAL A 1 371 ? -4.676  19.303  -17.381  1.00 25.86 ? 371 VAL A N   1 
ATOM   2742 C  CA  . VAL A 1 371 ? -3.393  19.143  -16.716  1.00 27.21 ? 371 VAL A CA  1 
ATOM   2743 C  C   . VAL A 1 371 ? -3.712  18.866  -15.244  1.00 27.89 ? 371 VAL A C   1 
ATOM   2744 O  O   . VAL A 1 371 ? -4.634  19.438  -14.653  1.00 26.29 ? 371 VAL A O   1 
ATOM   2745 C  CB  . VAL A 1 371 ? -2.568  20.402  -16.845  1.00 28.81 ? 371 VAL A CB  1 
ATOM   2746 C  CG1 . VAL A 1 371 ? -1.255  20.302  -16.068  1.00 31.12 ? 371 VAL A CG1 1 
ATOM   2747 C  CG2 . VAL A 1 371 ? -2.248  20.579  -18.320  1.00 33.35 ? 371 VAL A CG2 1 
ATOM   2748 N  N   . LEU A 1 372 ? -2.996  17.914  -14.671  1.00 26.48 ? 372 LEU A N   1 
ATOM   2749 C  CA  . LEU A 1 372 ? -3.154  17.488  -13.313  1.00 22.12 ? 372 LEU A CA  1 
ATOM   2750 C  C   . LEU A 1 372 ? -1.921  17.949  -12.567  1.00 22.58 ? 372 LEU A C   1 
ATOM   2751 O  O   . LEU A 1 372 ? -0.789  17.698  -13.009  1.00 20.36 ? 372 LEU A O   1 
ATOM   2752 C  CB  . LEU A 1 372 ? -3.250  15.992  -13.236  1.00 15.42 ? 372 LEU A CB  1 
ATOM   2753 C  CG  . LEU A 1 372 ? -4.417  15.304  -13.893  1.00 13.89 ? 372 LEU A CG  1 
ATOM   2754 C  CD1 . LEU A 1 372 ? -4.223  13.847  -13.581  1.00 13.79 ? 372 LEU A CD1 1 
ATOM   2755 C  CD2 . LEU A 1 372 ? -5.779  15.793  -13.438  1.00 12.31 ? 372 LEU A CD2 1 
ATOM   2756 N  N   . THR A 1 373 ? -2.173  18.658  -11.459  1.00 25.25 ? 373 THR A N   1 
ATOM   2757 C  CA  . THR A 1 373 ? -1.123  19.211  -10.600  1.00 27.65 ? 373 THR A CA  1 
ATOM   2758 C  C   . THR A 1 373 ? -0.920  18.339  -9.379   1.00 28.72 ? 373 THR A C   1 
ATOM   2759 O  O   . THR A 1 373 ? -1.877  17.701  -8.887   1.00 23.80 ? 373 THR A O   1 
ATOM   2760 C  CB  . THR A 1 373 ? -1.498  20.634  -10.138  1.00 29.16 ? 373 THR A CB  1 
ATOM   2761 O  OG1 . THR A 1 373 ? -2.933  20.738  -10.105  1.00 35.96 ? 373 THR A OG1 1 
ATOM   2762 C  CG2 . THR A 1 373 ? -0.906  21.679  -11.053  1.00 28.71 ? 373 THR A CG2 1 
ATOM   2763 N  N   . PHE A 1 374 ? 0.336   18.251  -8.979   1.00 33.40 ? 374 PHE A N   1 
ATOM   2764 C  CA  . PHE A 1 374 ? 0.694   17.500  -7.789   1.00 38.41 ? 374 PHE A CA  1 
ATOM   2765 C  C   . PHE A 1 374 ? 1.033   18.469  -6.649   1.00 43.45 ? 374 PHE A C   1 
ATOM   2766 O  O   . PHE A 1 374 ? 0.783   19.679  -6.773   1.00 44.09 ? 374 PHE A O   1 
ATOM   2767 C  CB  . PHE A 1 374 ? 1.895   16.612  -8.067   1.00 37.22 ? 374 PHE A CB  1 
ATOM   2768 C  CG  . PHE A 1 374 ? 1.563   15.482  -9.011   1.00 40.60 ? 374 PHE A CG  1 
ATOM   2769 C  CD1 . PHE A 1 374 ? 1.618   15.686  -10.387  1.00 38.10 ? 374 PHE A CD1 1 
ATOM   2770 C  CD2 . PHE A 1 374 ? 1.193   14.244  -8.495   1.00 39.04 ? 374 PHE A CD2 1 
ATOM   2771 C  CE1 . PHE A 1 374 ? 1.297   14.638  -11.234  1.00 37.94 ? 374 PHE A CE1 1 
ATOM   2772 C  CE2 . PHE A 1 374 ? 0.876   13.205  -9.360   1.00 35.82 ? 374 PHE A CE2 1 
ATOM   2773 C  CZ  . PHE A 1 374 ? 0.927   13.398  -10.729  1.00 37.35 ? 374 PHE A CZ  1 
ATOM   2774 O  OXT . PHE A 1 374 ? 1.547   18.002  -5.628   1.00 51.44 ? 374 PHE A OXT 1 
ATOM   2775 N  N   . SER B 1 1   ? 2.164   8.288   -100.318 1.00 58.72 ? 1   SER B N   1 
ATOM   2776 C  CA  . SER B 1 1   ? 2.544   8.690   -98.984  1.00 57.91 ? 1   SER B CA  1 
ATOM   2777 C  C   . SER B 1 1   ? 1.554   7.936   -98.111  1.00 55.57 ? 1   SER B C   1 
ATOM   2778 O  O   . SER B 1 1   ? 0.464   7.651   -98.616  1.00 55.38 ? 1   SER B O   1 
ATOM   2779 C  CB  . SER B 1 1   ? 2.367   10.203  -98.918  1.00 60.44 ? 1   SER B CB  1 
ATOM   2780 O  OG  . SER B 1 1   ? 2.775   10.741  -100.183 1.00 61.93 ? 1   SER B OG  1 
ATOM   2781 N  N   . THR B 1 2   ? 1.943   7.545   -96.898  1.00 52.24 ? 2   THR B N   1 
ATOM   2782 C  CA  . THR B 1 2   ? 1.077   6.837   -95.950  1.00 45.33 ? 2   THR B CA  1 
ATOM   2783 C  C   . THR B 1 2   ? 0.069   7.813   -95.357  1.00 39.75 ? 2   THR B C   1 
ATOM   2784 O  O   . THR B 1 2   ? -1.128  7.571   -95.210  1.00 41.43 ? 2   THR B O   1 
ATOM   2785 C  CB  . THR B 1 2   ? 1.959   6.221   -94.817  1.00 46.49 ? 2   THR B CB  1 
ATOM   2786 O  OG1 . THR B 1 2   ? 3.079   7.110   -94.658  1.00 49.28 ? 2   THR B OG1 1 
ATOM   2787 C  CG2 . THR B 1 2   ? 2.449   4.815   -95.108  1.00 44.35 ? 2   THR B CG2 1 
ATOM   2788 N  N   . ALA B 1 3   ? 0.680   8.946   -95.021  1.00 33.42 ? 3   ALA B N   1 
ATOM   2789 C  CA  . ALA B 1 3   ? 0.051   10.078  -94.397  1.00 32.61 ? 3   ALA B CA  1 
ATOM   2790 C  C   . ALA B 1 3   ? -1.383  10.405  -94.752  1.00 34.90 ? 3   ALA B C   1 
ATOM   2791 O  O   . ALA B 1 3   ? -1.799  10.085  -95.855  1.00 40.47 ? 3   ALA B O   1 
ATOM   2792 C  CB  . ALA B 1 3   ? 0.912   11.276  -94.688  1.00 30.59 ? 3   ALA B CB  1 
ATOM   2793 N  N   . GLY B 1 4   ? -2.193  10.996  -93.868  1.00 30.50 ? 4   GLY B N   1 
ATOM   2794 C  CA  . GLY B 1 4   ? -3.547  11.396  -94.192  1.00 22.15 ? 4   GLY B CA  1 
ATOM   2795 C  C   . GLY B 1 4   ? -4.463  10.258  -94.565  1.00 26.41 ? 4   GLY B C   1 
ATOM   2796 O  O   . GLY B 1 4   ? -5.679  10.488  -94.555  1.00 24.84 ? 4   GLY B O   1 
ATOM   2797 N  N   . LYS B 1 5   ? -4.003  9.040   -94.864  1.00 30.14 ? 5   LYS B N   1 
ATOM   2798 C  CA  . LYS B 1 5   ? -4.923  7.991   -95.234  1.00 35.10 ? 5   LYS B CA  1 
ATOM   2799 C  C   . LYS B 1 5   ? -4.819  6.900   -94.192  1.00 36.73 ? 5   LYS B C   1 
ATOM   2800 O  O   . LYS B 1 5   ? -3.839  6.773   -93.465  1.00 39.56 ? 5   LYS B O   1 
ATOM   2801 C  CB  . LYS B 1 5   ? -4.564  7.446   -96.653  1.00 42.70 ? 5   LYS B CB  1 
ATOM   2802 C  CG  . LYS B 1 5   ? -5.733  6.716   -97.412  1.00 51.52 ? 5   LYS B CG  1 
ATOM   2803 C  CD  . LYS B 1 5   ? -5.808  5.166   -97.314  1.00 53.79 ? 5   LYS B CD  1 
ATOM   2804 C  CE  . LYS B 1 5   ? -7.249  4.599   -97.379  1.00 52.80 ? 5   LYS B CE  1 
ATOM   2805 N  NZ  . LYS B 1 5   ? -7.306  3.185   -97.015  1.00 48.99 ? 5   LYS B NZ  1 
ATOM   2806 N  N   . VAL B 1 6   ? -5.910  6.156   -94.099  1.00 35.52 ? 6   VAL B N   1 
ATOM   2807 C  CA  . VAL B 1 6   ? -6.044  5.031   -93.217  1.00 35.45 ? 6   VAL B CA  1 
ATOM   2808 C  C   . VAL B 1 6   ? -4.998  3.984   -93.571  1.00 37.80 ? 6   VAL B C   1 
ATOM   2809 O  O   . VAL B 1 6   ? -4.920  3.573   -94.727  1.00 42.22 ? 6   VAL B O   1 
ATOM   2810 C  CB  . VAL B 1 6   ? -7.485  4.551   -93.408  1.00 35.21 ? 6   VAL B CB  1 
ATOM   2811 C  CG1 . VAL B 1 6   ? -7.681  3.068   -93.102  1.00 37.17 ? 6   VAL B CG1 1 
ATOM   2812 C  CG2 . VAL B 1 6   ? -8.339  5.384   -92.471  1.00 35.67 ? 6   VAL B CG2 1 
ATOM   2813 N  N   . ILE B 1 7   ? -4.148  3.555   -92.653  1.00 37.43 ? 7   ILE B N   1 
ATOM   2814 C  CA  . ILE B 1 7   ? -3.192  2.512   -92.968  1.00 34.88 ? 7   ILE B CA  1 
ATOM   2815 C  C   . ILE B 1 7   ? -3.889  1.217   -92.634  1.00 37.43 ? 7   ILE B C   1 
ATOM   2816 O  O   . ILE B 1 7   ? -4.799  1.175   -91.805  1.00 39.85 ? 7   ILE B O   1 
ATOM   2817 C  CB  . ILE B 1 7   ? -1.921  2.643   -92.128  1.00 33.70 ? 7   ILE B CB  1 
ATOM   2818 C  CG1 . ILE B 1 7   ? -1.203  3.870   -92.653  1.00 32.44 ? 7   ILE B CG1 1 
ATOM   2819 C  CG2 . ILE B 1 7   ? -1.007  1.423   -92.215  1.00 31.84 ? 7   ILE B CG2 1 
ATOM   2820 C  CD1 . ILE B 1 7   ? 0.274   3.992   -92.275  1.00 29.68 ? 7   ILE B CD1 1 
ATOM   2821 N  N   . LYS B 1 8   ? -3.531  0.166   -93.354  1.00 38.66 ? 8   LYS B N   1 
ATOM   2822 C  CA  . LYS B 1 8   ? -4.039  -1.169  -93.104  1.00 39.35 ? 8   LYS B CA  1 
ATOM   2823 C  C   . LYS B 1 8   ? -2.738  -1.909  -92.822  1.00 39.17 ? 8   LYS B C   1 
ATOM   2824 O  O   . LYS B 1 8   ? -1.720  -1.714  -93.500  1.00 39.62 ? 8   LYS B O   1 
ATOM   2825 C  CB  . LYS B 1 8   ? -4.723  -1.753  -94.313  1.00 38.99 ? 8   LYS B CB  1 
ATOM   2826 C  CG  . LYS B 1 8   ? -5.070  -3.213  -94.118  1.00 39.90 ? 8   LYS B CG  1 
ATOM   2827 C  CD  . LYS B 1 8   ? -6.279  -3.415  -94.963  1.00 37.96 ? 8   LYS B CD  1 
ATOM   2828 C  CE  . LYS B 1 8   ? -6.413  -4.873  -95.211  1.00 42.30 ? 8   LYS B CE  1 
ATOM   2829 N  NZ  . LYS B 1 8   ? -7.799  -5.117  -95.544  1.00 49.18 ? 8   LYS B NZ  1 
ATOM   2830 N  N   . CYS B 1 9   ? -2.745  -2.684  -91.753  1.00 39.84 ? 9   CYS B N   1 
ATOM   2831 C  CA  . CYS B 1 9   ? -1.575  -3.421  -91.335  1.00 38.09 ? 9   CYS B CA  1 
ATOM   2832 C  C   . CYS B 1 9   ? -2.088  -4.551  -90.461  1.00 36.63 ? 9   CYS B C   1 
ATOM   2833 O  O   . CYS B 1 9   ? -3.300  -4.841  -90.418  1.00 33.25 ? 9   CYS B O   1 
ATOM   2834 C  CB  . CYS B 1 9   ? -0.642  -2.454  -90.570  1.00 39.35 ? 9   CYS B CB  1 
ATOM   2835 S  SG  . CYS B 1 9   ? -1.446  -1.626  -89.171  1.00 41.31 ? 9   CYS B SG  1 
ATOM   2836 N  N   . LYS B 1 10  ? -1.114  -5.182  -89.812  1.00 36.58 ? 10  LYS B N   1 
ATOM   2837 C  CA  . LYS B 1 10  ? -1.282  -6.284  -88.894  1.00 36.12 ? 10  LYS B CA  1 
ATOM   2838 C  C   . LYS B 1 10  ? -1.169  -5.811  -87.441  1.00 32.31 ? 10  LYS B C   1 
ATOM   2839 O  O   . LYS B 1 10  ? -0.322  -4.976  -87.043  1.00 30.35 ? 10  LYS B O   1 
ATOM   2840 C  CB  . LYS B 1 10  ? -0.215  -7.334  -89.171  1.00 40.28 ? 10  LYS B CB  1 
ATOM   2841 C  CG  . LYS B 1 10  ? -0.298  -8.031  -90.510  1.00 46.62 ? 10  LYS B CG  1 
ATOM   2842 C  CD  . LYS B 1 10  ? -1.617  -8.789  -90.560  1.00 51.04 ? 10  LYS B CD  1 
ATOM   2843 C  CE  . LYS B 1 10  ? -1.667  -9.786  -91.711  1.00 55.00 ? 10  LYS B CE  1 
ATOM   2844 N  NZ  . LYS B 1 10  ? -2.911  -10.539 -91.644  1.00 55.75 ? 10  LYS B NZ  1 
ATOM   2845 N  N   . ALA B 1 11  ? -2.030  -6.417  -86.644  1.00 30.53 ? 11  ALA B N   1 
ATOM   2846 C  CA  . ALA B 1 11  ? -2.100  -6.148  -85.228  1.00 31.47 ? 11  ALA B CA  1 
ATOM   2847 C  C   . ALA B 1 11  ? -2.612  -7.380  -84.529  1.00 34.39 ? 11  ALA B C   1 
ATOM   2848 O  O   . ALA B 1 11  ? -3.536  -8.036  -85.026  1.00 36.18 ? 11  ALA B O   1 
ATOM   2849 C  CB  . ALA B 1 11  ? -3.085  -5.063  -84.876  1.00 26.38 ? 11  ALA B CB  1 
ATOM   2850 N  N   . ALA B 1 12  ? -1.990  -7.699  -83.391  1.00 34.82 ? 12  ALA B N   1 
ATOM   2851 C  CA  . ALA B 1 12  ? -2.395  -8.814  -82.553  1.00 31.07 ? 12  ALA B CA  1 
ATOM   2852 C  C   . ALA B 1 12  ? -3.553  -8.228  -81.763  1.00 30.33 ? 12  ALA B C   1 
ATOM   2853 O  O   . ALA B 1 12  ? -3.382  -7.309  -80.950  1.00 29.34 ? 12  ALA B O   1 
ATOM   2854 C  CB  . ALA B 1 12  ? -1.284  -9.191  -81.596  1.00 33.77 ? 12  ALA B CB  1 
ATOM   2855 N  N   . VAL B 1 13  ? -4.746  -8.719  -82.051  1.00 30.72 ? 13  VAL B N   1 
ATOM   2856 C  CA  . VAL B 1 13  ? -5.958  -8.234  -81.422  1.00 33.45 ? 13  VAL B CA  1 
ATOM   2857 C  C   . VAL B 1 13  ? -6.409  -9.281  -80.422  1.00 37.18 ? 13  VAL B C   1 
ATOM   2858 O  O   . VAL B 1 13  ? -6.378  -10.467 -80.775  1.00 39.54 ? 13  VAL B O   1 
ATOM   2859 C  CB  . VAL B 1 13  ? -7.065  -8.026  -82.492  1.00 38.06 ? 13  VAL B CB  1 
ATOM   2860 C  CG1 . VAL B 1 13  ? -8.307  -7.404  -81.845  1.00 37.95 ? 13  VAL B CG1 1 
ATOM   2861 C  CG2 . VAL B 1 13  ? -6.544  -7.132  -83.615  1.00 36.74 ? 13  VAL B CG2 1 
ATOM   2862 N  N   . LEU B 1 14  ? -6.795  -8.911  -79.188  1.00 36.84 ? 14  LEU B N   1 
ATOM   2863 C  CA  . LEU B 1 14  ? -7.273  -9.865  -78.202  1.00 35.01 ? 14  LEU B CA  1 
ATOM   2864 C  C   . LEU B 1 14  ? -8.773  -9.683  -78.258  1.00 35.60 ? 14  LEU B C   1 
ATOM   2865 O  O   . LEU B 1 14  ? -9.296  -8.601  -77.966  1.00 35.97 ? 14  LEU B O   1 
ATOM   2866 C  CB  . LEU B 1 14  ? -6.797  -9.561  -76.760  1.00 33.41 ? 14  LEU B CB  1 
ATOM   2867 C  CG  . LEU B 1 14  ? -7.276  -10.578 -75.690  1.00 30.19 ? 14  LEU B CG  1 
ATOM   2868 C  CD1 . LEU B 1 14  ? -6.444  -11.843 -75.823  1.00 30.44 ? 14  LEU B CD1 1 
ATOM   2869 C  CD2 . LEU B 1 14  ? -7.136  -10.029 -74.278  1.00 36.16 ? 14  LEU B CD2 1 
ATOM   2870 N  N   . TRP B 1 15  ? -9.480  -10.725 -78.654  1.00 37.57 ? 15  TRP B N   1 
ATOM   2871 C  CA  . TRP B 1 15  ? -10.920 -10.626 -78.776  1.00 42.27 ? 15  TRP B CA  1 
ATOM   2872 C  C   . TRP B 1 15  ? -11.690 -11.055 -77.535  1.00 45.70 ? 15  TRP B C   1 
ATOM   2873 O  O   . TRP B 1 15  ? -12.801 -10.583 -77.262  1.00 47.12 ? 15  TRP B O   1 
ATOM   2874 C  CB  . TRP B 1 15  ? -11.364 -11.471 -80.007  1.00 41.36 ? 15  TRP B CB  1 
ATOM   2875 C  CG  . TRP B 1 15  ? -10.879 -10.910 -81.345  1.00 44.40 ? 15  TRP B CG  1 
ATOM   2876 C  CD1 . TRP B 1 15  ? -9.642  -11.218 -81.864  1.00 45.77 ? 15  TRP B CD1 1 
ATOM   2877 C  CD2 . TRP B 1 15  ? -11.561 -10.006 -82.111  1.00 40.98 ? 15  TRP B CD2 1 
ATOM   2878 N  NE1 . TRP B 1 15  ? -9.528  -10.495 -82.943  1.00 42.74 ? 15  TRP B NE1 1 
ATOM   2879 C  CE2 . TRP B 1 15  ? -10.640 -9.758  -83.131  1.00 42.16 ? 15  TRP B CE2 1 
ATOM   2880 C  CE3 . TRP B 1 15  ? -12.796 -9.355  -82.086  1.00 40.03 ? 15  TRP B CE3 1 
ATOM   2881 C  CZ2 . TRP B 1 15  ? -10.952 -8.842  -84.139  1.00 39.27 ? 15  TRP B CZ2 1 
ATOM   2882 C  CZ3 . TRP B 1 15  ? -13.099 -8.443  -83.101  1.00 38.08 ? 15  TRP B CZ3 1 
ATOM   2883 C  CH2 . TRP B 1 15  ? -12.181 -8.187  -84.117  1.00 36.30 ? 15  TRP B CH2 1 
ATOM   2884 N  N   . GLU B 1 16  ? -11.082 -11.952 -76.765  1.00 48.12 ? 16  GLU B N   1 
ATOM   2885 C  CA  . GLU B 1 16  ? -11.689 -12.522 -75.584  1.00 49.56 ? 16  GLU B CA  1 
ATOM   2886 C  C   . GLU B 1 16  ? -10.581 -12.717 -74.563  1.00 50.72 ? 16  GLU B C   1 
ATOM   2887 O  O   . GLU B 1 16  ? -9.396  -12.727 -74.904  1.00 50.62 ? 16  GLU B O   1 
ATOM   2888 C  CB  . GLU B 1 16  ? -12.314 -13.824 -76.017  1.00 53.69 ? 16  GLU B CB  1 
ATOM   2889 C  CG  . GLU B 1 16  ? -13.294 -14.484 -75.063  1.00 59.03 ? 16  GLU B CG  1 
ATOM   2890 C  CD  . GLU B 1 16  ? -14.293 -15.400 -75.768  1.00 59.08 ? 16  GLU B CD  1 
ATOM   2891 O  OE1 . GLU B 1 16  ? -14.840 -15.014 -76.804  1.00 60.37 ? 16  GLU B OE1 1 
ATOM   2892 O  OE2 . GLU B 1 16  ? -14.540 -16.494 -75.266  1.00 58.75 ? 16  GLU B OE2 1 
ATOM   2893 N  N   . VAL B 1 17  ? -10.928 -12.878 -73.291  1.00 52.11 ? 17  VAL B N   1 
ATOM   2894 C  CA  . VAL B 1 17  ? -9.935  -13.043 -72.231  1.00 48.99 ? 17  VAL B CA  1 
ATOM   2895 C  C   . VAL B 1 17  ? -9.477  -14.489 -72.204  1.00 45.73 ? 17  VAL B C   1 
ATOM   2896 O  O   . VAL B 1 17  ? -10.295 -15.359 -72.511  1.00 46.45 ? 17  VAL B O   1 
ATOM   2897 C  CB  . VAL B 1 17  ? -10.607 -12.578 -70.908  1.00 48.52 ? 17  VAL B CB  1 
ATOM   2898 C  CG1 . VAL B 1 17  ? -11.568 -13.619 -70.326  1.00 47.22 ? 17  VAL B CG1 1 
ATOM   2899 C  CG2 . VAL B 1 17  ? -9.484  -12.179 -69.987  1.00 47.93 ? 17  VAL B CG2 1 
ATOM   2900 N  N   . LYS B 1 18  ? -8.216  -14.758 -71.866  1.00 44.15 ? 18  LYS B N   1 
ATOM   2901 C  CA  . LYS B 1 18  ? -7.667  -16.113 -71.829  1.00 47.91 ? 18  LYS B CA  1 
ATOM   2902 C  C   . LYS B 1 18  ? -7.855  -16.809 -73.177  1.00 48.74 ? 18  LYS B C   1 
ATOM   2903 O  O   . LYS B 1 18  ? -8.246  -17.970 -73.321  1.00 48.98 ? 18  LYS B O   1 
ATOM   2904 C  CB  . LYS B 1 18  ? -8.346  -16.960 -70.721  1.00 48.71 ? 18  LYS B CB  1 
ATOM   2905 C  CG  . LYS B 1 18  ? -7.850  -16.740 -69.303  1.00 51.18 ? 18  LYS B CG  1 
ATOM   2906 C  CD  . LYS B 1 18  ? -8.690  -17.499 -68.281  1.00 50.83 ? 18  LYS B CD  1 
ATOM   2907 C  CE  . LYS B 1 18  ? -10.036 -16.816 -68.001  1.00 53.90 ? 18  LYS B CE  1 
ATOM   2908 N  NZ  . LYS B 1 18  ? -9.909  -15.556 -67.277  1.00 51.67 ? 18  LYS B NZ  1 
ATOM   2909 N  N   . LYS B 1 19  ? -7.560  -16.072 -74.226  1.00 49.25 ? 19  LYS B N   1 
ATOM   2910 C  CA  . LYS B 1 19  ? -7.708  -16.576 -75.570  1.00 47.87 ? 19  LYS B CA  1 
ATOM   2911 C  C   . LYS B 1 19  ? -6.435  -16.188 -76.268  1.00 46.90 ? 19  LYS B C   1 
ATOM   2912 O  O   . LYS B 1 19  ? -5.750  -15.245 -75.833  1.00 47.88 ? 19  LYS B O   1 
ATOM   2913 C  CB  . LYS B 1 19  ? -8.892  -15.927 -76.263  1.00 49.12 ? 19  LYS B CB  1 
ATOM   2914 C  CG  . LYS B 1 19  ? -9.972  -16.923 -76.612  1.00 50.85 ? 19  LYS B CG  1 
ATOM   2915 C  CD  . LYS B 1 19  ? -10.666 -17.491 -75.400  1.00 54.77 ? 19  LYS B CD  1 
ATOM   2916 C  CE  . LYS B 1 19  ? -11.595 -18.603 -75.844  1.00 60.08 ? 19  LYS B CE  1 
ATOM   2917 N  NZ  . LYS B 1 19  ? -12.578 -18.122 -76.802  1.00 62.27 ? 19  LYS B NZ  1 
ATOM   2918 N  N   . PRO B 1 20  ? -6.011  -16.943 -77.286  1.00 45.76 ? 20  PRO B N   1 
ATOM   2919 C  CA  . PRO B 1 20  ? -4.837  -16.602 -78.065  1.00 43.74 ? 20  PRO B CA  1 
ATOM   2920 C  C   . PRO B 1 20  ? -5.081  -15.326 -78.854  1.00 44.92 ? 20  PRO B C   1 
ATOM   2921 O  O   . PRO B 1 20  ? -6.214  -15.008 -79.248  1.00 46.37 ? 20  PRO B O   1 
ATOM   2922 C  CB  . PRO B 1 20  ? -4.636  -17.823 -78.890  1.00 40.66 ? 20  PRO B CB  1 
ATOM   2923 C  CG  . PRO B 1 20  ? -6.013  -18.407 -79.040  1.00 39.95 ? 20  PRO B CG  1 
ATOM   2924 C  CD  . PRO B 1 20  ? -6.497  -18.276 -77.631  1.00 43.79 ? 20  PRO B CD  1 
ATOM   2925 N  N   . PHE B 1 21  ? -4.020  -14.546 -79.021  1.00 45.49 ? 21  PHE B N   1 
ATOM   2926 C  CA  . PHE B 1 21  ? -4.147  -13.341 -79.822  1.00 46.50 ? 21  PHE B CA  1 
ATOM   2927 C  C   . PHE B 1 21  ? -4.376  -13.740 -81.277  1.00 44.72 ? 21  PHE B C   1 
ATOM   2928 O  O   . PHE B 1 21  ? -3.922  -14.809 -81.718  1.00 44.89 ? 21  PHE B O   1 
ATOM   2929 C  CB  . PHE B 1 21  ? -2.899  -12.519 -79.826  1.00 46.14 ? 21  PHE B CB  1 
ATOM   2930 C  CG  . PHE B 1 21  ? -2.618  -11.766 -78.548  1.00 48.53 ? 21  PHE B CG  1 
ATOM   2931 C  CD1 . PHE B 1 21  ? -3.524  -10.817 -78.075  1.00 50.31 ? 21  PHE B CD1 1 
ATOM   2932 C  CD2 . PHE B 1 21  ? -1.408  -11.972 -77.895  1.00 47.55 ? 21  PHE B CD2 1 
ATOM   2933 C  CE1 . PHE B 1 21  ? -3.201  -10.066 -76.947  1.00 47.61 ? 21  PHE B CE1 1 
ATOM   2934 C  CE2 . PHE B 1 21  ? -1.100  -11.218 -76.773  1.00 46.59 ? 21  PHE B CE2 1 
ATOM   2935 C  CZ  . PHE B 1 21  ? -1.988  -10.267 -76.300  1.00 44.34 ? 21  PHE B CZ  1 
ATOM   2936 N  N   . SER B 1 22  ? -5.128  -12.921 -82.002  1.00 42.11 ? 22  SER B N   1 
ATOM   2937 C  CA  . SER B 1 22  ? -5.340  -13.141 -83.419  1.00 39.45 ? 22  SER B CA  1 
ATOM   2938 C  C   . SER B 1 22  ? -4.431  -12.160 -84.109  1.00 37.23 ? 22  SER B C   1 
ATOM   2939 O  O   . SER B 1 22  ? -4.493  -10.979 -83.751  1.00 35.94 ? 22  SER B O   1 
ATOM   2940 C  CB  . SER B 1 22  ? -6.722  -12.795 -83.897  1.00 39.92 ? 22  SER B CB  1 
ATOM   2941 O  OG  . SER B 1 22  ? -7.766  -13.634 -83.439  1.00 47.45 ? 22  SER B OG  1 
ATOM   2942 N  N   . ILE B 1 23  ? -3.504  -12.550 -84.988  1.00 40.66 ? 23  ILE B N   1 
ATOM   2943 C  CA  . ILE B 1 23  ? -2.756  -11.519 -85.714  1.00 44.42 ? 23  ILE B CA  1 
ATOM   2944 C  C   . ILE B 1 23  ? -3.763  -11.211 -86.846  1.00 44.95 ? 23  ILE B C   1 
ATOM   2945 O  O   . ILE B 1 23  ? -4.286  -12.109 -87.528  1.00 45.42 ? 23  ILE B O   1 
ATOM   2946 C  CB  . ILE B 1 23  ? -1.410  -12.071 -86.236  1.00 45.85 ? 23  ILE B CB  1 
ATOM   2947 C  CG1 . ILE B 1 23  ? -0.461  -12.224 -85.058  1.00 43.14 ? 23  ILE B CG1 1 
ATOM   2948 C  CG2 . ILE B 1 23  ? -0.781  -11.126 -87.275  1.00 48.72 ? 23  ILE B CG2 1 
ATOM   2949 C  CD1 . ILE B 1 23  ? -0.576  -13.612 -84.398  1.00 51.25 ? 23  ILE B CD1 1 
ATOM   2950 N  N   . GLU B 1 24  ? -4.172  -9.956  -86.982  1.00 44.25 ? 24  GLU B N   1 
ATOM   2951 C  CA  . GLU B 1 24  ? -5.190  -9.586  -87.957  1.00 42.84 ? 24  GLU B CA  1 
ATOM   2952 C  C   . GLU B 1 24  ? -4.884  -8.303  -88.703  1.00 41.57 ? 24  GLU B C   1 
ATOM   2953 O  O   . GLU B 1 24  ? -3.868  -7.646  -88.445  1.00 42.87 ? 24  GLU B O   1 
ATOM   2954 C  CB  . GLU B 1 24  ? -6.535  -9.447  -87.255  1.00 39.63 ? 24  GLU B CB  1 
ATOM   2955 C  CG  . GLU B 1 24  ? -7.176  -10.797 -87.002  1.00 39.73 ? 24  GLU B CG  1 
ATOM   2956 C  CD  . GLU B 1 24  ? -8.617  -10.749 -86.515  1.00 47.05 ? 24  GLU B CD  1 
ATOM   2957 O  OE1 . GLU B 1 24  ? -9.307  -9.782  -86.825  1.00 53.67 ? 24  GLU B OE1 1 
ATOM   2958 O  OE2 . GLU B 1 24  ? -9.070  -11.688 -85.854  1.00 46.94 ? 24  GLU B OE2 1 
ATOM   2959 N  N   . ASP B 1 25  ? -5.752  -7.977  -89.666  1.00 39.02 ? 25  ASP B N   1 
ATOM   2960 C  CA  . ASP B 1 25  ? -5.593  -6.778  -90.479  1.00 35.34 ? 25  ASP B CA  1 
ATOM   2961 C  C   . ASP B 1 25  ? -6.522  -5.733  -89.975  1.00 31.63 ? 25  ASP B C   1 
ATOM   2962 O  O   . ASP B 1 25  ? -7.745  -5.963  -90.017  1.00 32.65 ? 25  ASP B O   1 
ATOM   2963 C  CB  . ASP B 1 25  ? -5.951  -7.000  -91.922  1.00 37.11 ? 25  ASP B CB  1 
ATOM   2964 C  CG  . ASP B 1 25  ? -4.989  -7.966  -92.536  1.00 36.59 ? 25  ASP B CG  1 
ATOM   2965 O  OD1 . ASP B 1 25  ? -3.824  -7.580  -92.672  1.00 35.51 ? 25  ASP B OD1 1 
ATOM   2966 O  OD2 . ASP B 1 25  ? -5.427  -9.080  -92.838  1.00 37.77 ? 25  ASP B OD2 1 
ATOM   2967 N  N   . VAL B 1 26  ? -5.931  -4.626  -89.548  1.00 25.53 ? 26  VAL B N   1 
ATOM   2968 C  CA  . VAL B 1 26  ? -6.703  -3.544  -88.990  1.00 25.62 ? 26  VAL B CA  1 
ATOM   2969 C  C   . VAL B 1 26  ? -6.307  -2.247  -89.664  1.00 27.73 ? 26  VAL B C   1 
ATOM   2970 O  O   . VAL B 1 26  ? -5.185  -2.054  -90.181  1.00 23.25 ? 26  VAL B O   1 
ATOM   2971 C  CB  . VAL B 1 26  ? -6.485  -3.403  -87.403  1.00 24.29 ? 26  VAL B CB  1 
ATOM   2972 C  CG1 . VAL B 1 26  ? -6.954  -4.665  -86.706  1.00 24.92 ? 26  VAL B CG1 1 
ATOM   2973 C  CG2 . VAL B 1 26  ? -5.037  -3.180  -87.041  1.00 18.64 ? 26  VAL B CG2 1 
ATOM   2974 N  N   . GLU B 1 27  ? -7.270  -1.345  -89.524  1.00 29.71 ? 27  GLU B N   1 
ATOM   2975 C  CA  . GLU B 1 27  ? -7.129  -0.023  -90.092  1.00 31.27 ? 27  GLU B CA  1 
ATOM   2976 C  C   . GLU B 1 27  ? -6.840  0.959   -88.958  1.00 30.06 ? 27  GLU B C   1 
ATOM   2977 O  O   . GLU B 1 27  ? -7.607  1.069   -88.004  1.00 32.52 ? 27  GLU B O   1 
ATOM   2978 C  CB  . GLU B 1 27  ? -8.419  0.351   -90.823  1.00 31.58 ? 27  GLU B CB  1 
ATOM   2979 C  CG  . GLU B 1 27  ? -8.905  -0.619  -91.895  1.00 29.13 ? 27  GLU B CG  1 
ATOM   2980 C  CD  . GLU B 1 27  ? -9.755  -1.772  -91.392  1.00 32.34 ? 27  GLU B CD  1 
ATOM   2981 O  OE1 . GLU B 1 27  ? -10.820 -1.506  -90.837  1.00 33.62 ? 27  GLU B OE1 1 
ATOM   2982 O  OE2 . GLU B 1 27  ? -9.368  -2.932  -91.566  1.00 34.74 ? 27  GLU B OE2 1 
ATOM   2983 N  N   . VAL B 1 28  ? -5.695  1.611   -89.072  1.00 25.68 ? 28  VAL B N   1 
ATOM   2984 C  CA  . VAL B 1 28  ? -5.159  2.577   -88.148  1.00 27.05 ? 28  VAL B CA  1 
ATOM   2985 C  C   . VAL B 1 28  ? -5.476  3.890   -88.831  1.00 31.31 ? 28  VAL B C   1 
ATOM   2986 O  O   . VAL B 1 28  ? -4.964  4.177   -89.909  1.00 35.87 ? 28  VAL B O   1 
ATOM   2987 C  CB  . VAL B 1 28  ? -3.630  2.388   -88.014  1.00 23.92 ? 28  VAL B CB  1 
ATOM   2988 C  CG1 . VAL B 1 28  ? -2.977  3.455   -87.165  1.00 13.88 ? 28  VAL B CG1 1 
ATOM   2989 C  CG2 . VAL B 1 28  ? -3.395  1.048   -87.382  1.00 24.31 ? 28  VAL B CG2 1 
ATOM   2990 N  N   . ALA B 1 29  ? -6.349  4.678   -88.235  1.00 33.31 ? 29  ALA B N   1 
ATOM   2991 C  CA  . ALA B 1 29  ? -6.776  5.962   -88.756  1.00 31.85 ? 29  ALA B CA  1 
ATOM   2992 C  C   . ALA B 1 29  ? -5.633  6.937   -88.758  1.00 32.20 ? 29  ALA B C   1 
ATOM   2993 O  O   . ALA B 1 29  ? -4.603  6.672   -88.144  1.00 35.96 ? 29  ALA B O   1 
ATOM   2994 C  CB  . ALA B 1 29  ? -7.880  6.560   -87.891  1.00 30.29 ? 29  ALA B CB  1 
ATOM   2995 N  N   . PRO B 1 30  ? -5.724  8.057   -89.458  1.00 32.05 ? 30  PRO B N   1 
ATOM   2996 C  CA  . PRO B 1 30  ? -4.681  9.067   -89.389  1.00 31.33 ? 30  PRO B CA  1 
ATOM   2997 C  C   . PRO B 1 30  ? -4.773  9.876   -88.076  1.00 29.92 ? 30  PRO B C   1 
ATOM   2998 O  O   . PRO B 1 30  ? -5.854  10.002  -87.460  1.00 26.54 ? 30  PRO B O   1 
ATOM   2999 C  CB  . PRO B 1 30  ? -4.901  9.856   -90.693  1.00 27.25 ? 30  PRO B CB  1 
ATOM   3000 C  CG  . PRO B 1 30  ? -6.393  9.756   -90.892  1.00 25.79 ? 30  PRO B CG  1 
ATOM   3001 C  CD  . PRO B 1 30  ? -6.624  8.291   -90.584  1.00 27.92 ? 30  PRO B CD  1 
ATOM   3002 N  N   . PRO B 1 31  ? -3.643  10.430  -87.614  1.00 27.85 ? 31  PRO B N   1 
ATOM   3003 C  CA  . PRO B 1 31  ? -3.577  11.232  -86.411  1.00 27.25 ? 31  PRO B CA  1 
ATOM   3004 C  C   . PRO B 1 31  ? -4.441  12.475  -86.401  1.00 28.69 ? 31  PRO B C   1 
ATOM   3005 O  O   . PRO B 1 31  ? -4.401  13.253  -87.358  1.00 33.15 ? 31  PRO B O   1 
ATOM   3006 C  CB  . PRO B 1 31  ? -2.105  11.581  -86.247  1.00 28.57 ? 31  PRO B CB  1 
ATOM   3007 C  CG  . PRO B 1 31  ? -1.512  11.388  -87.622  1.00 28.92 ? 31  PRO B CG  1 
ATOM   3008 C  CD  . PRO B 1 31  ? -2.295  10.181  -88.138  1.00 27.93 ? 31  PRO B CD  1 
ATOM   3009 N  N   . LYS B 1 32  ? -5.254  12.695  -85.364  1.00 23.01 ? 32  LYS B N   1 
ATOM   3010 C  CA  . LYS B 1 32  ? -5.998  13.926  -85.309  1.00 19.24 ? 32  LYS B CA  1 
ATOM   3011 C  C   . LYS B 1 32  ? -5.030  14.986  -84.794  1.00 22.59 ? 32  LYS B C   1 
ATOM   3012 O  O   . LYS B 1 32  ? -3.801  14.820  -84.836  1.00 24.38 ? 32  LYS B O   1 
ATOM   3013 C  CB  . LYS B 1 32  ? -7.160  13.818  -84.390  1.00 14.72 ? 32  LYS B CB  1 
ATOM   3014 C  CG  . LYS B 1 32  ? -8.153  12.747  -84.811  1.00 13.64 ? 32  LYS B CG  1 
ATOM   3015 C  CD  . LYS B 1 32  ? -9.393  12.993  -83.965  1.00 21.56 ? 32  LYS B CD  1 
ATOM   3016 C  CE  . LYS B 1 32  ? -10.406 11.877  -84.108  1.00 24.40 ? 32  LYS B CE  1 
ATOM   3017 N  NZ  . LYS B 1 32  ? -11.370 11.972  -83.024  1.00 31.91 ? 32  LYS B NZ  1 
ATOM   3018 N  N   . ALA B 1 33  ? -5.475  16.125  -84.308  1.00 27.63 ? 33  ALA B N   1 
ATOM   3019 C  CA  . ALA B 1 33  ? -4.528  17.139  -83.868  1.00 32.85 ? 33  ALA B CA  1 
ATOM   3020 C  C   . ALA B 1 33  ? -3.963  16.697  -82.529  1.00 36.62 ? 33  ALA B C   1 
ATOM   3021 O  O   . ALA B 1 33  ? -4.682  16.090  -81.720  1.00 37.64 ? 33  ALA B O   1 
ATOM   3022 C  CB  . ALA B 1 33  ? -5.244  18.483  -83.729  1.00 34.01 ? 33  ALA B CB  1 
ATOM   3023 N  N   . TYR B 1 34  ? -2.682  16.999  -82.294  1.00 37.94 ? 34  TYR B N   1 
ATOM   3024 C  CA  . TYR B 1 34  ? -1.984  16.614  -81.067  1.00 38.48 ? 34  TYR B CA  1 
ATOM   3025 C  C   . TYR B 1 34  ? -1.830  15.089  -80.912  1.00 38.48 ? 34  TYR B C   1 
ATOM   3026 O  O   . TYR B 1 34  ? -1.717  14.565  -79.787  1.00 39.92 ? 34  TYR B O   1 
ATOM   3027 C  CB  . TYR B 1 34  ? -2.728  17.212  -79.813  1.00 36.90 ? 34  TYR B CB  1 
ATOM   3028 C  CG  . TYR B 1 34  ? -2.849  18.709  -79.957  1.00 30.64 ? 34  TYR B CG  1 
ATOM   3029 C  CD1 . TYR B 1 34  ? -1.691  19.490  -79.936  1.00 25.76 ? 34  TYR B CD1 1 
ATOM   3030 C  CD2 . TYR B 1 34  ? -4.098  19.265  -80.224  1.00 31.52 ? 34  TYR B CD2 1 
ATOM   3031 C  CE1 . TYR B 1 34  ? -1.784  20.847  -80.208  1.00 29.35 ? 34  TYR B CE1 1 
ATOM   3032 C  CE2 . TYR B 1 34  ? -4.196  20.622  -80.503  1.00 30.56 ? 34  TYR B CE2 1 
ATOM   3033 C  CZ  . TYR B 1 34  ? -3.037  21.399  -80.495  1.00 34.15 ? 34  TYR B CZ  1 
ATOM   3034 O  OH  . TYR B 1 34  ? -3.128  22.748  -80.804  1.00 41.35 ? 34  TYR B OH  1 
ATOM   3035 N  N   . GLU B 1 35  ? -1.845  14.348  -82.028  1.00 31.07 ? 35  GLU B N   1 
ATOM   3036 C  CA  . GLU B 1 35  ? -1.659  12.915  -81.993  1.00 25.19 ? 35  GLU B CA  1 
ATOM   3037 C  C   . GLU B 1 35  ? -0.487  12.618  -82.921  1.00 29.88 ? 35  GLU B C   1 
ATOM   3038 O  O   . GLU B 1 35  ? -0.035  13.513  -83.655  1.00 31.84 ? 35  GLU B O   1 
ATOM   3039 C  CB  . GLU B 1 35  ? -2.887  12.209  -82.472  1.00 18.67 ? 35  GLU B CB  1 
ATOM   3040 C  CG  . GLU B 1 35  ? -4.056  12.516  -81.590  1.00 15.69 ? 35  GLU B CG  1 
ATOM   3041 C  CD  . GLU B 1 35  ? -5.299  11.743  -81.936  1.00 22.80 ? 35  GLU B CD  1 
ATOM   3042 O  OE1 . GLU B 1 35  ? -5.227  10.790  -82.702  1.00 28.80 ? 35  GLU B OE1 1 
ATOM   3043 O  OE2 . GLU B 1 35  ? -6.360  12.080  -81.426  1.00 24.74 ? 35  GLU B OE2 1 
ATOM   3044 N  N   . VAL B 1 36  ? 0.048   11.395  -82.904  1.00 28.39 ? 36  VAL B N   1 
ATOM   3045 C  CA  . VAL B 1 36  ? 1.208   10.999  -83.673  1.00 28.58 ? 36  VAL B CA  1 
ATOM   3046 C  C   . VAL B 1 36  ? 0.927   9.580   -84.131  1.00 35.35 ? 36  VAL B C   1 
ATOM   3047 O  O   . VAL B 1 36  ? 0.303   8.841   -83.353  1.00 36.04 ? 36  VAL B O   1 
ATOM   3048 C  CB  . VAL B 1 36  ? 2.456   11.042  -82.752  1.00 25.58 ? 36  VAL B CB  1 
ATOM   3049 C  CG1 . VAL B 1 36  ? 3.665   10.534  -83.480  1.00 28.07 ? 36  VAL B CG1 1 
ATOM   3050 C  CG2 . VAL B 1 36  ? 2.799   12.472  -82.348  1.00 22.46 ? 36  VAL B CG2 1 
ATOM   3051 N  N   . ARG B 1 37  ? 1.266   9.186   -85.379  1.00 37.16 ? 37  ARG B N   1 
ATOM   3052 C  CA  . ARG B 1 37  ? 1.078   7.805   -85.827  1.00 36.89 ? 37  ARG B CA  1 
ATOM   3053 C  C   . ARG B 1 37  ? 2.512   7.329   -85.892  1.00 35.76 ? 37  ARG B C   1 
ATOM   3054 O  O   . ARG B 1 37  ? 3.390   8.033   -86.394  1.00 35.70 ? 37  ARG B O   1 
ATOM   3055 C  CB  . ARG B 1 37  ? 0.436   7.708   -87.183  1.00 36.82 ? 37  ARG B CB  1 
ATOM   3056 C  CG  . ARG B 1 37  ? 0.088   6.245   -87.439  1.00 38.86 ? 37  ARG B CG  1 
ATOM   3057 C  CD  . ARG B 1 37  ? -1.140  6.120   -88.323  1.00 43.01 ? 37  ARG B CD  1 
ATOM   3058 N  NE  . ARG B 1 37  ? -0.931  6.749   -89.619  1.00 49.31 ? 37  ARG B NE  1 
ATOM   3059 C  CZ  . ARG B 1 37  ? -1.829  6.778   -90.611  1.00 46.12 ? 37  ARG B CZ  1 
ATOM   3060 N  NH1 . ARG B 1 37  ? -3.043  6.216   -90.520  1.00 39.79 ? 37  ARG B NH1 1 
ATOM   3061 N  NH2 . ARG B 1 37  ? -1.454  7.406   -91.726  1.00 45.39 ? 37  ARG B NH2 1 
ATOM   3062 N  N   . ILE B 1 38  ? 2.794   6.148   -85.378  1.00 37.85 ? 38  ILE B N   1 
ATOM   3063 C  CA  . ILE B 1 38  ? 4.156   5.648   -85.246  1.00 39.02 ? 38  ILE B CA  1 
ATOM   3064 C  C   . ILE B 1 38  ? 4.203   4.272   -85.856  1.00 36.68 ? 38  ILE B C   1 
ATOM   3065 O  O   . ILE B 1 38  ? 3.208   3.539   -85.750  1.00 36.91 ? 38  ILE B O   1 
ATOM   3066 C  CB  . ILE B 1 38  ? 4.534   5.552   -83.711  1.00 41.97 ? 38  ILE B CB  1 
ATOM   3067 C  CG1 . ILE B 1 38  ? 4.338   6.886   -83.014  1.00 44.40 ? 38  ILE B CG1 1 
ATOM   3068 C  CG2 . ILE B 1 38  ? 6.008   5.165   -83.534  1.00 40.35 ? 38  ILE B CG2 1 
ATOM   3069 C  CD1 . ILE B 1 38  ? 4.176   6.726   -81.497  1.00 48.07 ? 38  ILE B CD1 1 
ATOM   3070 N  N   . LYS B 1 39  ? 5.362   3.946   -86.430  1.00 35.84 ? 39  LYS B N   1 
ATOM   3071 C  CA  . LYS B 1 39  ? 5.620   2.639   -87.008  1.00 35.77 ? 39  LYS B CA  1 
ATOM   3072 C  C   . LYS B 1 39  ? 6.502   1.967   -85.961  1.00 32.71 ? 39  LYS B C   1 
ATOM   3073 O  O   . LYS B 1 39  ? 7.592   2.440   -85.592  1.00 27.09 ? 39  LYS B O   1 
ATOM   3074 C  CB  . LYS B 1 39  ? 6.414   2.696   -88.329  1.00 41.10 ? 39  LYS B CB  1 
ATOM   3075 C  CG  . LYS B 1 39  ? 6.408   1.319   -89.017  1.00 40.92 ? 39  LYS B CG  1 
ATOM   3076 C  CD  . LYS B 1 39  ? 7.315   1.260   -90.240  1.00 42.28 ? 39  LYS B CD  1 
ATOM   3077 C  CE  . LYS B 1 39  ? 7.215   -0.103  -90.937  1.00 43.76 ? 39  LYS B CE  1 
ATOM   3078 N  NZ  . LYS B 1 39  ? 5.904   -0.330  -91.543  1.00 42.63 ? 39  LYS B NZ  1 
ATOM   3079 N  N   . MET B 1 40  ? 5.978   0.847   -85.501  1.00 32.70 ? 40  MET B N   1 
ATOM   3080 C  CA  . MET B 1 40  ? 6.595   0.035   -84.469  1.00 36.86 ? 40  MET B CA  1 
ATOM   3081 C  C   . MET B 1 40  ? 7.855   -0.716  -84.884  1.00 35.05 ? 40  MET B C   1 
ATOM   3082 O  O   . MET B 1 40  ? 7.793   -1.631  -85.683  1.00 36.24 ? 40  MET B O   1 
ATOM   3083 C  CB  . MET B 1 40  ? 5.517   -0.952  -83.932  1.00 37.02 ? 40  MET B CB  1 
ATOM   3084 C  CG  . MET B 1 40  ? 4.411   -0.250  -83.140  1.00 35.90 ? 40  MET B CG  1 
ATOM   3085 S  SD  . MET B 1 40  ? 5.062   0.510   -81.640  1.00 41.12 ? 40  MET B SD  1 
ATOM   3086 C  CE  . MET B 1 40  ? 4.995   2.259   -81.863  1.00 34.69 ? 40  MET B CE  1 
ATOM   3087 N  N   . VAL B 1 41  ? 9.022   -0.370  -84.381  1.00 33.69 ? 41  VAL B N   1 
ATOM   3088 C  CA  . VAL B 1 41  ? 10.227  -1.087  -84.741  1.00 35.77 ? 41  VAL B CA  1 
ATOM   3089 C  C   . VAL B 1 41  ? 10.454  -2.270  -83.777  1.00 41.24 ? 41  VAL B C   1 
ATOM   3090 O  O   . VAL B 1 41  ? 10.876  -3.357  -84.191  1.00 43.01 ? 41  VAL B O   1 
ATOM   3091 C  CB  . VAL B 1 41  ? 11.373  -0.064  -84.704  1.00 35.50 ? 41  VAL B CB  1 
ATOM   3092 C  CG1 . VAL B 1 41  ? 12.732  -0.691  -84.985  1.00 34.23 ? 41  VAL B CG1 1 
ATOM   3093 C  CG2 . VAL B 1 41  ? 11.074  0.981   -85.755  1.00 35.36 ? 41  VAL B CG2 1 
ATOM   3094 N  N   . ALA B 1 42  ? 10.170  -2.110  -82.471  1.00 42.01 ? 42  ALA B N   1 
ATOM   3095 C  CA  . ALA B 1 42  ? 10.387  -3.143  -81.463  1.00 39.00 ? 42  ALA B CA  1 
ATOM   3096 C  C   . ALA B 1 42  ? 9.447   -3.014  -80.259  1.00 39.27 ? 42  ALA B C   1 
ATOM   3097 O  O   . ALA B 1 42  ? 9.167   -1.908  -79.756  1.00 42.63 ? 42  ALA B O   1 
ATOM   3098 C  CB  . ALA B 1 42  ? 11.827  -3.041  -81.006  1.00 38.11 ? 42  ALA B CB  1 
ATOM   3099 N  N   . VAL B 1 43  ? 8.955   -4.153  -79.779  1.00 35.48 ? 43  VAL B N   1 
ATOM   3100 C  CA  . VAL B 1 43  ? 8.003   -4.260  -78.680  1.00 32.36 ? 43  VAL B CA  1 
ATOM   3101 C  C   . VAL B 1 43  ? 8.394   -5.247  -77.562  1.00 31.58 ? 43  VAL B C   1 
ATOM   3102 O  O   . VAL B 1 43  ? 8.575   -6.429  -77.876  1.00 25.94 ? 43  VAL B O   1 
ATOM   3103 C  CB  . VAL B 1 43  ? 6.659   -4.657  -79.315  1.00 30.22 ? 43  VAL B CB  1 
ATOM   3104 C  CG1 . VAL B 1 43  ? 5.698   -5.213  -78.290  1.00 29.52 ? 43  VAL B CG1 1 
ATOM   3105 C  CG2 . VAL B 1 43  ? 6.042   -3.418  -79.933  1.00 33.39 ? 43  VAL B CG2 1 
ATOM   3106 N  N   . GLY B 1 44  ? 8.456   -4.863  -76.268  1.00 28.42 ? 44  GLY B N   1 
ATOM   3107 C  CA  . GLY B 1 44  ? 8.803   -5.814  -75.216  1.00 25.26 ? 44  GLY B CA  1 
ATOM   3108 C  C   . GLY B 1 44  ? 7.536   -6.443  -74.646  1.00 23.09 ? 44  GLY B C   1 
ATOM   3109 O  O   . GLY B 1 44  ? 6.494   -5.762  -74.692  1.00 22.86 ? 44  GLY B O   1 
ATOM   3110 N  N   . ILE B 1 45  ? 7.484   -7.701  -74.190  1.00 21.28 ? 45  ILE B N   1 
ATOM   3111 C  CA  . ILE B 1 45  ? 6.233   -8.180  -73.577  1.00 26.88 ? 45  ILE B CA  1 
ATOM   3112 C  C   . ILE B 1 45  ? 6.430   -7.973  -72.075  1.00 27.02 ? 45  ILE B C   1 
ATOM   3113 O  O   . ILE B 1 45  ? 7.402   -8.454  -71.504  1.00 24.20 ? 45  ILE B O   1 
ATOM   3114 C  CB  . ILE B 1 45  ? 5.961   -9.674  -73.872  1.00 30.31 ? 45  ILE B CB  1 
ATOM   3115 C  CG1 . ILE B 1 45  ? 5.519   -9.812  -75.309  1.00 29.51 ? 45  ILE B CG1 1 
ATOM   3116 C  CG2 . ILE B 1 45  ? 4.841   -10.222 -72.986  1.00 34.60 ? 45  ILE B CG2 1 
ATOM   3117 C  CD1 . ILE B 1 45  ? 5.468   -11.268 -75.745  1.00 22.39 ? 45  ILE B CD1 1 
ATOM   3118 N  N   . CYS B 1 46  ? 5.491   -7.226  -71.483  1.00 27.94 ? 46  CYS B N   1 
ATOM   3119 C  CA  . CYS B 1 46  ? 5.511   -6.823  -70.083  1.00 26.72 ? 46  CYS B CA  1 
ATOM   3120 C  C   . CYS B 1 46  ? 4.356   -7.452  -69.325  1.00 27.56 ? 46  CYS B C   1 
ATOM   3121 O  O   . CYS B 1 46  ? 3.267   -7.664  -69.923  1.00 24.65 ? 46  CYS B O   1 
ATOM   3122 C  CB  . CYS B 1 46  ? 5.406   -5.322  -70.007  1.00 31.09 ? 46  CYS B CB  1 
ATOM   3123 S  SG  . CYS B 1 46  ? 5.539   -4.591  -68.361  1.00 33.24 ? 46  CYS B SG  1 
ATOM   3124 N  N   . GLY B 1 47  ? 4.592   -7.692  -68.010  1.00 22.52 ? 47  GLY B N   1 
ATOM   3125 C  CA  . GLY B 1 47  ? 3.621   -8.330  -67.132  1.00 17.39 ? 47  GLY B CA  1 
ATOM   3126 C  C   . GLY B 1 47  ? 2.240   -7.693  -67.139  1.00 15.79 ? 47  GLY B C   1 
ATOM   3127 O  O   . GLY B 1 47  ? 1.215   -8.392  -67.057  1.00 15.33 ? 47  GLY B O   1 
ATOM   3128 N  N   . THR B 1 48  ? 2.138   -6.359  -67.252  1.00 16.12 ? 48  THR B N   1 
ATOM   3129 C  CA  . THR B 1 48  ? 0.829   -5.715  -67.289  1.00 19.72 ? 48  THR B CA  1 
ATOM   3130 C  C   . THR B 1 48  ? -0.009  -6.203  -68.487  1.00 25.45 ? 48  THR B C   1 
ATOM   3131 O  O   . THR B 1 48  ? -1.225  -6.409  -68.303  1.00 30.00 ? 48  THR B O   1 
ATOM   3132 C  CB  . THR B 1 48  ? 1.028   -4.188  -67.328  1.00 23.83 ? 48  THR B CB  1 
ATOM   3133 O  OG1 . THR B 1 48  ? 1.921   -3.799  -66.265  1.00 19.76 ? 48  THR B OG1 1 
ATOM   3134 C  CG2 . THR B 1 48  ? -0.299  -3.488  -67.216  1.00 18.18 ? 48  THR B CG2 1 
ATOM   3135 N  N   . ASP B 1 49  ? 0.608   -6.517  -69.656  1.00 20.83 ? 49  ASP B N   1 
ATOM   3136 C  CA  . ASP B 1 49  ? -0.124  -7.052  -70.813  1.00 21.53 ? 49  ASP B CA  1 
ATOM   3137 C  C   . ASP B 1 49  ? -0.816  -8.372  -70.513  1.00 22.26 ? 49  ASP B C   1 
ATOM   3138 O  O   . ASP B 1 49  ? -2.010  -8.613  -70.760  1.00 26.77 ? 49  ASP B O   1 
ATOM   3139 C  CB  . ASP B 1 49  ? 0.829   -7.279  -72.019  1.00 21.54 ? 49  ASP B CB  1 
ATOM   3140 C  CG  . ASP B 1 49  ? 1.258   -5.969  -72.633  1.00 14.59 ? 49  ASP B CG  1 
ATOM   3141 O  OD1 . ASP B 1 49  ? 0.346   -5.247  -73.011  1.00 19.98 ? 49  ASP B OD1 1 
ATOM   3142 O  OD2 . ASP B 1 49  ? 2.448   -5.638  -72.689  1.00 14.17 ? 49  ASP B OD2 1 
ATOM   3143 N  N   . ASP B 1 50  ? -0.025  -9.228  -69.877  1.00 25.61 ? 50  ASP B N   1 
ATOM   3144 C  CA  . ASP B 1 50  ? -0.445  -10.566 -69.479  1.00 26.08 ? 50  ASP B CA  1 
ATOM   3145 C  C   . ASP B 1 50  ? -1.650  -10.461 -68.604  1.00 24.43 ? 50  ASP B C   1 
ATOM   3146 O  O   . ASP B 1 50  ? -2.587  -11.221 -68.830  1.00 23.77 ? 50  ASP B O   1 
ATOM   3147 C  CB  . ASP B 1 50  ? 0.605   -11.296 -68.654  1.00 32.84 ? 50  ASP B CB  1 
ATOM   3148 C  CG  . ASP B 1 50  ? 0.550   -12.814 -68.759  1.00 38.30 ? 50  ASP B CG  1 
ATOM   3149 O  OD1 . ASP B 1 50  ? -0.445  -13.455 -68.401  1.00 31.56 ? 50  ASP B OD1 1 
ATOM   3150 O  OD2 . ASP B 1 50  ? 1.552   -13.349 -69.221  1.00 43.61 ? 50  ASP B OD2 1 
ATOM   3151 N  N   . HIS B 1 51  ? -1.705  -9.481  -67.685  1.00 22.34 ? 51  HIS B N   1 
ATOM   3152 C  CA  . HIS B 1 51  ? -2.853  -9.423  -66.789  1.00 21.75 ? 51  HIS B CA  1 
ATOM   3153 C  C   . HIS B 1 51  ? -4.173  -9.229  -67.522  1.00 23.41 ? 51  HIS B C   1 
ATOM   3154 O  O   . HIS B 1 51  ? -5.205  -9.691  -66.994  1.00 22.69 ? 51  HIS B O   1 
ATOM   3155 C  CB  . HIS B 1 51  ? -2.689  -8.307  -65.729  1.00 18.88 ? 51  HIS B CB  1 
ATOM   3156 C  CG  . HIS B 1 51  ? -1.431  -8.444  -64.876  1.00 16.47 ? 51  HIS B CG  1 
ATOM   3157 N  ND1 . HIS B 1 51  ? -0.775  -9.543  -64.483  1.00 22.19 ? 51  HIS B ND1 1 
ATOM   3158 C  CD2 . HIS B 1 51  ? -0.698  -7.379  -64.416  1.00 22.08 ? 51  HIS B CD2 1 
ATOM   3159 C  CE1 . HIS B 1 51  ? 0.307   -9.197  -63.825  1.00 18.31 ? 51  HIS B CE1 1 
ATOM   3160 N  NE2 . HIS B 1 51  ? 0.333   -7.894  -63.796  1.00 22.25 ? 51  HIS B NE2 1 
ATOM   3161 N  N   . VAL B 1 52  ? -4.172  -8.614  -68.724  1.00 23.05 ? 52  VAL B N   1 
ATOM   3162 C  CA  . VAL B 1 52  ? -5.400  -8.444  -69.497  1.00 19.63 ? 52  VAL B CA  1 
ATOM   3163 C  C   . VAL B 1 52  ? -5.703  -9.802  -70.093  1.00 20.49 ? 52  VAL B C   1 
ATOM   3164 O  O   . VAL B 1 52  ? -6.858  -10.237 -70.087  1.00 19.68 ? 52  VAL B O   1 
ATOM   3165 C  CB  . VAL B 1 52  ? -5.245  -7.431  -70.626  1.00 21.15 ? 52  VAL B CB  1 
ATOM   3166 C  CG1 . VAL B 1 52  ? -6.636  -7.200  -71.184  1.00 19.08 ? 52  VAL B CG1 1 
ATOM   3167 C  CG2 . VAL B 1 52  ? -4.641  -6.105  -70.145  1.00 23.13 ? 52  VAL B CG2 1 
ATOM   3168 N  N   . VAL B 1 53  ? -4.681  -10.541 -70.553  1.00 24.14 ? 53  VAL B N   1 
ATOM   3169 C  CA  . VAL B 1 53  ? -4.953  -11.878 -71.071  1.00 27.67 ? 53  VAL B CA  1 
ATOM   3170 C  C   . VAL B 1 53  ? -5.530  -12.740 -69.935  1.00 31.20 ? 53  VAL B C   1 
ATOM   3171 O  O   . VAL B 1 53  ? -6.533  -13.420 -70.155  1.00 31.70 ? 53  VAL B O   1 
ATOM   3172 C  CB  . VAL B 1 53  ? -3.674  -12.557 -71.607  1.00 27.74 ? 53  VAL B CB  1 
ATOM   3173 C  CG1 . VAL B 1 53  ? -4.058  -13.958 -72.095  1.00 24.27 ? 53  VAL B CG1 1 
ATOM   3174 C  CG2 . VAL B 1 53  ? -3.020  -11.734 -72.705  1.00 24.49 ? 53  VAL B CG2 1 
ATOM   3175 N  N   . SER B 1 54  ? -4.950  -12.731 -68.724  1.00 35.50 ? 54  SER B N   1 
ATOM   3176 C  CA  . SER B 1 54  ? -5.419  -13.504 -67.562  1.00 36.49 ? 54  SER B CA  1 
ATOM   3177 C  C   . SER B 1 54  ? -6.815  -13.169 -67.086  1.00 34.75 ? 54  SER B C   1 
ATOM   3178 O  O   . SER B 1 54  ? -7.555  -14.033 -66.631  1.00 37.59 ? 54  SER B O   1 
ATOM   3179 C  CB  . SER B 1 54  ? -4.549  -13.292 -66.339  1.00 38.33 ? 54  SER B CB  1 
ATOM   3180 O  OG  . SER B 1 54  ? -3.143  -13.393 -66.568  1.00 48.37 ? 54  SER B OG  1 
ATOM   3181 N  N   . GLY B 1 55  ? -7.177  -11.899 -67.177  1.00 33.51 ? 55  GLY B N   1 
ATOM   3182 C  CA  . GLY B 1 55  ? -8.455  -11.449 -66.672  1.00 33.69 ? 55  GLY B CA  1 
ATOM   3183 C  C   . GLY B 1 55  ? -8.194  -10.676 -65.382  1.00 35.94 ? 55  GLY B C   1 
ATOM   3184 O  O   . GLY B 1 55  ? -9.119  -10.234 -64.705  1.00 40.16 ? 55  GLY B O   1 
ATOM   3185 N  N   . ASN B 1 56  ? -6.933  -10.424 -65.037  1.00 35.20 ? 56  ASN B N   1 
ATOM   3186 C  CA  . ASN B 1 56  ? -6.610  -9.707  -63.814  1.00 39.39 ? 56  ASN B CA  1 
ATOM   3187 C  C   . ASN B 1 56  ? -6.704  -8.202  -63.953  1.00 42.12 ? 56  ASN B C   1 
ATOM   3188 O  O   . ASN B 1 56  ? -6.802  -7.509  -62.941  1.00 46.59 ? 56  ASN B O   1 
ATOM   3189 C  CB  . ASN B 1 56  ? -5.187  -10.020 -63.322  1.00 35.61 ? 56  ASN B CB  1 
ATOM   3190 C  CG  . ASN B 1 56  ? -5.064  -11.407 -62.722  1.00 37.03 ? 56  ASN B CG  1 
ATOM   3191 O  OD1 . ASN B 1 56  ? -6.060  -12.076 -62.453  1.00 37.75 ? 56  ASN B OD1 1 
ATOM   3192 N  ND2 . ASN B 1 56  ? -3.861  -11.902 -62.458  1.00 36.67 ? 56  ASN B ND2 1 
ATOM   3193 N  N   . LEU B 1 57  ? -6.621  -7.632  -65.148  1.00 38.73 ? 57  LEU B N   1 
ATOM   3194 C  CA  . LEU B 1 57  ? -6.694  -6.189  -65.291  1.00 35.54 ? 57  LEU B CA  1 
ATOM   3195 C  C   . LEU B 1 57  ? -7.832  -6.049  -66.275  1.00 36.45 ? 57  LEU B C   1 
ATOM   3196 O  O   . LEU B 1 57  ? -7.731  -6.464  -67.430  1.00 40.21 ? 57  LEU B O   1 
ATOM   3197 C  CB  . LEU B 1 57  ? -5.368  -5.704  -65.836  1.00 27.63 ? 57  LEU B CB  1 
ATOM   3198 C  CG  . LEU B 1 57  ? -5.088  -4.239  -65.990  1.00 25.47 ? 57  LEU B CG  1 
ATOM   3199 C  CD1 . LEU B 1 57  ? -4.948  -3.527  -64.662  1.00 21.73 ? 57  LEU B CD1 1 
ATOM   3200 C  CD2 . LEU B 1 57  ? -3.772  -4.128  -66.713  1.00 24.69 ? 57  LEU B CD2 1 
ATOM   3201 N  N   . VAL B 1 58  ? -8.973  -5.584  -65.805  1.00 34.06 ? 58  VAL B N   1 
ATOM   3202 C  CA  . VAL B 1 58  ? -10.118 -5.447  -66.674  1.00 32.27 ? 58  VAL B CA  1 
ATOM   3203 C  C   . VAL B 1 58  ? -9.934  -4.232  -67.567  1.00 35.30 ? 58  VAL B C   1 
ATOM   3204 O  O   . VAL B 1 58  ? -9.437  -3.197  -67.133  1.00 38.38 ? 58  VAL B O   1 
ATOM   3205 C  CB  . VAL B 1 58  ? -11.330 -5.356  -65.760  1.00 29.32 ? 58  VAL B CB  1 
ATOM   3206 C  CG1 . VAL B 1 58  ? -12.602 -4.961  -66.464  1.00 27.80 ? 58  VAL B CG1 1 
ATOM   3207 C  CG2 . VAL B 1 58  ? -11.544 -6.753  -65.211  1.00 33.71 ? 58  VAL B CG2 1 
ATOM   3208 N  N   . THR B 1 59  ? -10.289 -4.326  -68.827  1.00 36.46 ? 59  THR B N   1 
ATOM   3209 C  CA  . THR B 1 59  ? -10.161 -3.203  -69.745  1.00 38.73 ? 59  THR B CA  1 
ATOM   3210 C  C   . THR B 1 59  ? -11.167 -3.537  -70.849  1.00 37.29 ? 59  THR B C   1 
ATOM   3211 O  O   . THR B 1 59  ? -11.514 -4.725  -71.018  1.00 38.29 ? 59  THR B O   1 
ATOM   3212 C  CB  . THR B 1 59  ? -8.679  -3.119  -70.262  1.00 38.47 ? 59  THR B CB  1 
ATOM   3213 O  OG1 . THR B 1 59  ? -8.472  -1.761  -70.665  1.00 42.77 ? 59  THR B OG1 1 
ATOM   3214 C  CG2 . THR B 1 59  ? -8.364  -4.083  -71.402  1.00 37.67 ? 59  THR B CG2 1 
ATOM   3215 N  N   . PRO B 1 60  ? -11.729 -2.553  -71.572  1.00 32.89 ? 60  PRO B N   1 
ATOM   3216 C  CA  . PRO B 1 60  ? -12.669 -2.798  -72.648  1.00 29.68 ? 60  PRO B CA  1 
ATOM   3217 C  C   . PRO B 1 60  ? -11.983 -3.599  -73.734  1.00 26.02 ? 60  PRO B C   1 
ATOM   3218 O  O   . PRO B 1 60  ? -10.886 -3.248  -74.183  1.00 22.27 ? 60  PRO B O   1 
ATOM   3219 C  CB  . PRO B 1 60  ? -13.089 -1.426  -73.101  1.00 31.58 ? 60  PRO B CB  1 
ATOM   3220 C  CG  . PRO B 1 60  ? -12.939 -0.601  -71.853  1.00 30.74 ? 60  PRO B CG  1 
ATOM   3221 C  CD  . PRO B 1 60  ? -11.608 -1.122  -71.318  1.00 32.18 ? 60  PRO B CD  1 
ATOM   3222 N  N   . LEU B 1 61  ? -12.645 -4.690  -74.087  1.00 25.05 ? 61  LEU B N   1 
ATOM   3223 C  CA  . LEU B 1 61  ? -12.207 -5.586  -75.143  1.00 32.77 ? 61  LEU B CA  1 
ATOM   3224 C  C   . LEU B 1 61  ? -13.116 -5.422  -76.398  1.00 35.20 ? 61  LEU B C   1 
ATOM   3225 O  O   . LEU B 1 61  ? -14.224 -4.886  -76.271  1.00 37.38 ? 61  LEU B O   1 
ATOM   3226 C  CB  . LEU B 1 61  ? -12.274 -7.048  -74.688  1.00 31.16 ? 61  LEU B CB  1 
ATOM   3227 C  CG  . LEU B 1 61  ? -11.364 -7.619  -73.621  1.00 27.80 ? 61  LEU B CG  1 
ATOM   3228 C  CD1 . LEU B 1 61  ? -11.668 -9.085  -73.525  1.00 25.83 ? 61  LEU B CD1 1 
ATOM   3229 C  CD2 . LEU B 1 61  ? -9.912  -7.448  -73.953  1.00 30.92 ? 61  LEU B CD2 1 
ATOM   3230 N  N   . PRO B 1 62  ? -12.768 -5.726  -77.655  1.00 35.04 ? 62  PRO B N   1 
ATOM   3231 C  CA  . PRO B 1 62  ? -11.437 -6.159  -78.094  1.00 31.24 ? 62  PRO B CA  1 
ATOM   3232 C  C   . PRO B 1 62  ? -10.445 -5.049  -77.903  1.00 25.89 ? 62  PRO B C   1 
ATOM   3233 O  O   . PRO B 1 62  ? -10.843 -3.877  -77.763  1.00 30.80 ? 62  PRO B O   1 
ATOM   3234 C  CB  . PRO B 1 62  ? -11.612 -6.569  -79.548  1.00 35.46 ? 62  PRO B CB  1 
ATOM   3235 C  CG  . PRO B 1 62  ? -12.914 -5.897  -79.953  1.00 38.05 ? 62  PRO B CG  1 
ATOM   3236 C  CD  . PRO B 1 62  ? -13.759 -6.007  -78.699  1.00 36.82 ? 62  PRO B CD  1 
ATOM   3237 N  N   . VAL B 1 63  ? -9.171  -5.391  -77.859  1.00 19.06 ? 63  VAL B N   1 
ATOM   3238 C  CA  . VAL B 1 63  ? -8.161  -4.382  -77.632  1.00 19.09 ? 63  VAL B CA  1 
ATOM   3239 C  C   . VAL B 1 63  ? -6.885  -4.889  -78.285  1.00 19.84 ? 63  VAL B C   1 
ATOM   3240 O  O   . VAL B 1 63  ? -6.769  -6.085  -78.577  1.00 21.14 ? 63  VAL B O   1 
ATOM   3241 C  CB  . VAL B 1 63  ? -7.957  -4.144  -76.033  1.00 19.94 ? 63  VAL B CB  1 
ATOM   3242 C  CG1 . VAL B 1 63  ? -7.561  -5.458  -75.359  1.00 18.31 ? 63  VAL B CG1 1 
ATOM   3243 C  CG2 . VAL B 1 63  ? -6.825  -3.139  -75.717  1.00 14.22 ? 63  VAL B CG2 1 
ATOM   3244 N  N   . ILE B 1 64  ? -5.982  -3.954  -78.542  1.00 17.17 ? 64  ILE B N   1 
ATOM   3245 C  CA  . ILE B 1 64  ? -4.675  -4.238  -79.055  1.00 23.42 ? 64  ILE B CA  1 
ATOM   3246 C  C   . ILE B 1 64  ? -3.839  -3.797  -77.826  1.00 26.90 ? 64  ILE B C   1 
ATOM   3247 O  O   . ILE B 1 64  ? -3.861  -2.639  -77.376  1.00 24.62 ? 64  ILE B O   1 
ATOM   3248 C  CB  . ILE B 1 64  ? -4.470  -3.380  -80.358  1.00 26.13 ? 64  ILE B CB  1 
ATOM   3249 C  CG1 . ILE B 1 64  ? -5.297  -4.040  -81.472  1.00 29.98 ? 64  ILE B CG1 1 
ATOM   3250 C  CG2 . ILE B 1 64  ? -3.011  -3.263  -80.764  1.00 17.70 ? 64  ILE B CG2 1 
ATOM   3251 C  CD1 . ILE B 1 64  ? -5.578  -3.119  -82.682  1.00 33.53 ? 64  ILE B CD1 1 
ATOM   3252 N  N   . LEU B 1 65  ? -3.128  -4.744  -77.220  1.00 25.35 ? 65  LEU B N   1 
ATOM   3253 C  CA  . LEU B 1 65  ? -2.327  -4.445  -76.047  1.00 25.54 ? 65  LEU B CA  1 
ATOM   3254 C  C   . LEU B 1 65  ? -0.980  -3.908  -76.485  1.00 24.09 ? 65  LEU B C   1 
ATOM   3255 O  O   . LEU B 1 65  ? -0.791  -3.553  -77.645  1.00 29.50 ? 65  LEU B O   1 
ATOM   3256 C  CB  . LEU B 1 65  ? -2.142  -5.740  -75.184  1.00 20.84 ? 65  LEU B CB  1 
ATOM   3257 C  CG  . LEU B 1 65  ? -3.393  -6.441  -74.695  1.00 13.66 ? 65  LEU B CG  1 
ATOM   3258 C  CD1 . LEU B 1 65  ? -3.032  -7.742  -74.057  1.00 19.32 ? 65  LEU B CD1 1 
ATOM   3259 C  CD2 . LEU B 1 65  ? -4.133  -5.516  -73.781  1.00 6.67  ? 65  LEU B CD2 1 
ATOM   3260 N  N   . GLY B 1 66  ? -0.046  -3.860  -75.549  1.00 16.32 ? 66  GLY B N   1 
ATOM   3261 C  CA  . GLY B 1 66  ? 1.305   -3.475  -75.813  1.00 11.78 ? 66  GLY B CA  1 
ATOM   3262 C  C   . GLY B 1 66  ? 1.467   -2.077  -75.361  1.00 12.71 ? 66  GLY B C   1 
ATOM   3263 O  O   . GLY B 1 66  ? 0.533   -1.293  -75.488  1.00 13.66 ? 66  GLY B O   1 
ATOM   3264 N  N   . HIS B 1 67  ? 2.605   -1.799  -74.752  1.00 11.69 ? 67  HIS B N   1 
ATOM   3265 C  CA  . HIS B 1 67  ? 2.873   -0.450  -74.308  1.00 15.85 ? 67  HIS B CA  1 
ATOM   3266 C  C   . HIS B 1 67  ? 4.344   -0.291  -74.078  1.00 18.01 ? 67  HIS B C   1 
ATOM   3267 O  O   . HIS B 1 67  ? 4.798   0.811   -73.777  1.00 21.79 ? 67  HIS B O   1 
ATOM   3268 C  CB  . HIS B 1 67  ? 2.106   -0.084  -73.011  1.00 16.92 ? 67  HIS B CB  1 
ATOM   3269 C  CG  . HIS B 1 67  ? 2.295   -1.072  -71.879  1.00 25.69 ? 67  HIS B CG  1 
ATOM   3270 N  ND1 . HIS B 1 67  ? 1.576   -2.172  -71.676  1.00 26.27 ? 67  HIS B ND1 1 
ATOM   3271 C  CD2 . HIS B 1 67  ? 3.311   -0.997  -70.954  1.00 20.04 ? 67  HIS B CD2 1 
ATOM   3272 C  CE1 . HIS B 1 67  ? 2.125   -2.785  -70.670  1.00 22.60 ? 67  HIS B CE1 1 
ATOM   3273 N  NE2 . HIS B 1 67  ? 3.148   -2.074  -70.258  1.00 27.66 ? 67  HIS B NE2 1 
ATOM   3274 N  N   . GLU B 1 68  ? 5.133   -1.355  -74.228  1.00 21.05 ? 68  GLU B N   1 
ATOM   3275 C  CA  . GLU B 1 68  ? 6.563   -1.193  -74.036  1.00 28.37 ? 68  GLU B CA  1 
ATOM   3276 C  C   . GLU B 1 68  ? 7.107   -1.145  -75.465  1.00 32.63 ? 68  GLU B C   1 
ATOM   3277 O  O   . GLU B 1 68  ? 6.962   -2.160  -76.179  1.00 32.24 ? 68  GLU B O   1 
ATOM   3278 C  CB  . GLU B 1 68  ? 7.056   -2.387  -73.227  1.00 28.91 ? 68  GLU B CB  1 
ATOM   3279 C  CG  . GLU B 1 68  ? 8.496   -2.114  -72.818  1.00 36.33 ? 68  GLU B CG  1 
ATOM   3280 C  CD  . GLU B 1 68  ? 9.047   -3.110  -71.818  1.00 38.08 ? 68  GLU B CD  1 
ATOM   3281 O  OE1 . GLU B 1 68  ? 8.825   -4.308  -71.969  1.00 36.27 ? 68  GLU B OE1 1 
ATOM   3282 O  OE2 . GLU B 1 68  ? 9.712   -2.668  -70.889  1.00 40.06 ? 68  GLU B OE2 1 
ATOM   3283 N  N   . ALA B 1 69  ? 7.732   -0.035  -75.901  1.00 33.76 ? 69  ALA B N   1 
ATOM   3284 C  CA  . ALA B 1 69  ? 8.136   0.088   -77.292  1.00 34.92 ? 69  ALA B CA  1 
ATOM   3285 C  C   . ALA B 1 69  ? 8.982   1.257   -77.750  1.00 37.27 ? 69  ALA B C   1 
ATOM   3286 O  O   . ALA B 1 69  ? 9.168   2.277   -77.072  1.00 37.46 ? 69  ALA B O   1 
ATOM   3287 C  CB  . ALA B 1 69  ? 6.909   0.142   -78.187  1.00 36.83 ? 69  ALA B CB  1 
ATOM   3288 N  N   . ALA B 1 70  ? 9.497   1.064   -78.962  1.00 38.40 ? 70  ALA B N   1 
ATOM   3289 C  CA  . ALA B 1 70  ? 10.263  2.090   -79.650  1.00 40.36 ? 70  ALA B CA  1 
ATOM   3290 C  C   . ALA B 1 70  ? 9.787   1.993   -81.105  1.00 40.89 ? 70  ALA B C   1 
ATOM   3291 O  O   . ALA B 1 70  ? 9.367   0.930   -81.608  1.00 40.25 ? 70  ALA B O   1 
ATOM   3292 C  CB  . ALA B 1 70  ? 11.763  1.827   -79.570  1.00 39.10 ? 70  ALA B CB  1 
ATOM   3293 N  N   . GLY B 1 71  ? 9.790   3.114   -81.800  1.00 40.42 ? 71  GLY B N   1 
ATOM   3294 C  CA  . GLY B 1 71  ? 9.334   3.171   -83.166  1.00 39.68 ? 71  GLY B CA  1 
ATOM   3295 C  C   . GLY B 1 71  ? 9.864   4.428   -83.817  1.00 39.61 ? 71  GLY B C   1 
ATOM   3296 O  O   . GLY B 1 71  ? 10.723  5.131   -83.262  1.00 40.67 ? 71  GLY B O   1 
ATOM   3297 N  N   . ILE B 1 72  ? 9.372   4.686   -85.023  1.00 38.56 ? 72  ILE B N   1 
ATOM   3298 C  CA  . ILE B 1 72  ? 9.775   5.860   -85.785  1.00 37.12 ? 72  ILE B CA  1 
ATOM   3299 C  C   . ILE B 1 72  ? 8.480   6.598   -86.047  1.00 35.15 ? 72  ILE B C   1 
ATOM   3300 O  O   . ILE B 1 72  ? 7.429   5.948   -86.265  1.00 34.12 ? 72  ILE B O   1 
ATOM   3301 C  CB  . ILE B 1 72  ? 10.448  5.453   -87.138  1.00 38.81 ? 72  ILE B CB  1 
ATOM   3302 C  CG1 . ILE B 1 72  ? 11.750  4.653   -86.940  1.00 36.51 ? 72  ILE B CG1 1 
ATOM   3303 C  CG2 . ILE B 1 72  ? 10.773  6.746   -87.884  1.00 37.31 ? 72  ILE B CG2 1 
ATOM   3304 C  CD1 . ILE B 1 72  ? 12.033  3.662   -88.084  1.00 35.33 ? 72  ILE B CD1 1 
ATOM   3305 N  N   . VAL B 1 73  ? 8.529   7.933   -86.006  1.00 33.55 ? 73  VAL B N   1 
ATOM   3306 C  CA  . VAL B 1 73  ? 7.303   8.678   -86.273  1.00 37.66 ? 73  VAL B CA  1 
ATOM   3307 C  C   . VAL B 1 73  ? 6.988   8.722   -87.762  1.00 39.93 ? 73  VAL B C   1 
ATOM   3308 O  O   . VAL B 1 73  ? 7.772   9.187   -88.593  1.00 38.75 ? 73  VAL B O   1 
ATOM   3309 C  CB  . VAL B 1 73  ? 7.357   10.128  -85.799  1.00 34.61 ? 73  VAL B CB  1 
ATOM   3310 C  CG1 . VAL B 1 73  ? 6.031   10.805  -86.120  1.00 32.99 ? 73  VAL B CG1 1 
ATOM   3311 C  CG2 . VAL B 1 73  ? 7.582   10.182  -84.318  1.00 33.40 ? 73  VAL B CG2 1 
ATOM   3312 N  N   . GLU B 1 74  ? 5.796   8.231   -88.054  1.00 42.27 ? 74  GLU B N   1 
ATOM   3313 C  CA  . GLU B 1 74  ? 5.312   8.221   -89.404  1.00 45.29 ? 74  GLU B CA  1 
ATOM   3314 C  C   . GLU B 1 74  ? 4.667   9.594   -89.601  1.00 46.20 ? 74  GLU B C   1 
ATOM   3315 O  O   . GLU B 1 74  ? 5.342   10.471  -90.132  1.00 49.24 ? 74  GLU B O   1 
ATOM   3316 C  CB  . GLU B 1 74  ? 4.342   7.065   -89.537  1.00 45.77 ? 74  GLU B CB  1 
ATOM   3317 C  CG  . GLU B 1 74  ? 3.797   6.932   -90.937  1.00 48.52 ? 74  GLU B CG  1 
ATOM   3318 C  CD  . GLU B 1 74  ? 2.292   6.973   -90.878  1.00 52.11 ? 74  GLU B CD  1 
ATOM   3319 O  OE1 . GLU B 1 74  ? 1.712   6.022   -90.375  1.00 53.67 ? 74  GLU B OE1 1 
ATOM   3320 O  OE2 . GLU B 1 74  ? 1.702   7.954   -91.309  1.00 53.36 ? 74  GLU B OE2 1 
ATOM   3321 N  N   . SER B 1 75  ? 3.446   9.924   -89.192  1.00 44.86 ? 75  SER B N   1 
ATOM   3322 C  CA  . SER B 1 75  ? 2.963   11.268  -89.440  1.00 45.21 ? 75  SER B CA  1 
ATOM   3323 C  C   . SER B 1 75  ? 2.615   11.918  -88.120  1.00 46.51 ? 75  SER B C   1 
ATOM   3324 O  O   . SER B 1 75  ? 2.282   11.197  -87.171  1.00 48.65 ? 75  SER B O   1 
ATOM   3325 C  CB  . SER B 1 75  ? 1.728   11.231  -90.351  1.00 43.26 ? 75  SER B CB  1 
ATOM   3326 O  OG  . SER B 1 75  ? 0.707   10.301  -89.991  1.00 45.18 ? 75  SER B OG  1 
ATOM   3327 N  N   . VAL B 1 76  ? 2.749   13.234  -87.986  1.00 45.50 ? 76  VAL B N   1 
ATOM   3328 C  CA  . VAL B 1 76  ? 2.348   13.883  -86.753  1.00 46.57 ? 76  VAL B CA  1 
ATOM   3329 C  C   . VAL B 1 76  ? 1.082   14.636  -87.146  1.00 45.58 ? 76  VAL B C   1 
ATOM   3330 O  O   . VAL B 1 76  ? 0.961   15.029  -88.306  1.00 49.16 ? 76  VAL B O   1 
ATOM   3331 C  CB  . VAL B 1 76  ? 3.447   14.845  -86.223  1.00 48.36 ? 76  VAL B CB  1 
ATOM   3332 C  CG1 . VAL B 1 76  ? 4.629   13.978  -85.820  1.00 43.64 ? 76  VAL B CG1 1 
ATOM   3333 C  CG2 . VAL B 1 76  ? 3.860   15.904  -87.236  1.00 48.66 ? 76  VAL B CG2 1 
ATOM   3334 N  N   . GLY B 1 77  ? 0.091   14.774  -86.278  1.00 41.99 ? 77  GLY B N   1 
ATOM   3335 C  CA  . GLY B 1 77  ? -1.139  15.477  -86.599  1.00 35.93 ? 77  GLY B CA  1 
ATOM   3336 C  C   . GLY B 1 77  ? -0.918  16.963  -86.460  1.00 34.00 ? 77  GLY B C   1 
ATOM   3337 O  O   . GLY B 1 77  ? 0.206   17.434  -86.267  1.00 31.17 ? 77  GLY B O   1 
ATOM   3338 N  N   . GLU B 1 78  ? -1.959  17.776  -86.516  1.00 37.19 ? 78  GLU B N   1 
ATOM   3339 C  CA  . GLU B 1 78  ? -1.725  19.201  -86.388  1.00 42.61 ? 78  GLU B CA  1 
ATOM   3340 C  C   . GLU B 1 78  ? -1.569  19.740  -84.959  1.00 43.42 ? 78  GLU B C   1 
ATOM   3341 O  O   . GLU B 1 78  ? -2.204  19.321  -83.972  1.00 40.62 ? 78  GLU B O   1 
ATOM   3342 C  CB  . GLU B 1 78  ? -2.831  19.952  -87.088  1.00 50.38 ? 78  GLU B CB  1 
ATOM   3343 C  CG  . GLU B 1 78  ? -2.148  20.617  -88.292  1.00 62.50 ? 78  GLU B CG  1 
ATOM   3344 C  CD  . GLU B 1 78  ? -3.044  21.539  -89.104  1.00 65.55 ? 78  GLU B CD  1 
ATOM   3345 O  OE1 . GLU B 1 78  ? -3.967  21.038  -89.765  1.00 68.36 ? 78  GLU B OE1 1 
ATOM   3346 O  OE2 . GLU B 1 78  ? -2.800  22.752  -89.061  1.00 64.97 ? 78  GLU B OE2 1 
ATOM   3347 N  N   . GLY B 1 79  ? -0.609  20.664  -84.918  1.00 39.86 ? 79  GLY B N   1 
ATOM   3348 C  CA  . GLY B 1 79  ? -0.231  21.333  -83.702  1.00 35.58 ? 79  GLY B CA  1 
ATOM   3349 C  C   . GLY B 1 79  ? 0.925   20.600  -83.049  1.00 37.08 ? 79  GLY B C   1 
ATOM   3350 O  O   . GLY B 1 79  ? 1.529   21.149  -82.116  1.00 37.97 ? 79  GLY B O   1 
ATOM   3351 N  N   . VAL B 1 80  ? 1.330   19.413  -83.542  1.00 35.05 ? 80  VAL B N   1 
ATOM   3352 C  CA  . VAL B 1 80  ? 2.405   18.658  -82.915  1.00 33.68 ? 80  VAL B CA  1 
ATOM   3353 C  C   . VAL B 1 80  ? 3.792   19.284  -83.084  1.00 37.52 ? 80  VAL B C   1 
ATOM   3354 O  O   . VAL B 1 80  ? 4.477   19.228  -84.101  1.00 42.89 ? 80  VAL B O   1 
ATOM   3355 C  CB  . VAL B 1 80  ? 2.355   17.205  -83.454  1.00 26.44 ? 80  VAL B CB  1 
ATOM   3356 C  CG1 . VAL B 1 80  ? 3.413   16.351  -82.782  1.00 27.86 ? 80  VAL B CG1 1 
ATOM   3357 C  CG2 . VAL B 1 80  ? 1.016   16.568  -83.109  1.00 22.25 ? 80  VAL B CG2 1 
ATOM   3358 N  N   . THR B 1 81  ? 4.184   19.910  -81.993  1.00 38.15 ? 81  THR B N   1 
ATOM   3359 C  CA  . THR B 1 81  ? 5.445   20.610  -81.859  1.00 38.90 ? 81  THR B CA  1 
ATOM   3360 C  C   . THR B 1 81  ? 6.628   19.820  -81.336  1.00 41.09 ? 81  THR B C   1 
ATOM   3361 O  O   . THR B 1 81  ? 7.746   20.339  -81.418  1.00 43.10 ? 81  THR B O   1 
ATOM   3362 C  CB  . THR B 1 81  ? 5.172   21.865  -80.966  1.00 41.20 ? 81  THR B CB  1 
ATOM   3363 O  OG1 . THR B 1 81  ? 6.411   22.416  -80.507  1.00 42.91 ? 81  THR B OG1 1 
ATOM   3364 C  CG2 . THR B 1 81  ? 4.309   21.511  -79.754  1.00 41.46 ? 81  THR B CG2 1 
ATOM   3365 N  N   . THR B 1 82  ? 6.490   18.616  -80.794  1.00 40.82 ? 82  THR B N   1 
ATOM   3366 C  CA  . THR B 1 82  ? 7.644   17.940  -80.224  1.00 39.74 ? 82  THR B CA  1 
ATOM   3367 C  C   . THR B 1 82  ? 8.386   16.870  -81.017  1.00 39.38 ? 82  THR B C   1 
ATOM   3368 O  O   . THR B 1 82  ? 9.566   16.590  -80.774  1.00 38.51 ? 82  THR B O   1 
ATOM   3369 C  CB  . THR B 1 82  ? 7.133   17.424  -78.849  1.00 42.85 ? 82  THR B CB  1 
ATOM   3370 O  OG1 . THR B 1 82  ? 5.962   16.634  -79.060  1.00 34.17 ? 82  THR B OG1 1 
ATOM   3371 C  CG2 . THR B 1 82  ? 6.821   18.601  -77.908  1.00 42.26 ? 82  THR B CG2 1 
ATOM   3372 N  N   . VAL B 1 83  ? 7.678   16.208  -81.930  1.00 40.20 ? 83  VAL B N   1 
ATOM   3373 C  CA  . VAL B 1 83  ? 8.260   15.171  -82.764  1.00 43.80 ? 83  VAL B CA  1 
ATOM   3374 C  C   . VAL B 1 83  ? 7.894   15.497  -84.220  1.00 47.06 ? 83  VAL B C   1 
ATOM   3375 O  O   . VAL B 1 83  ? 6.807   16.013  -84.510  1.00 48.03 ? 83  VAL B O   1 
ATOM   3376 C  CB  . VAL B 1 83  ? 7.720   13.764  -82.362  1.00 43.21 ? 83  VAL B CB  1 
ATOM   3377 C  CG1 . VAL B 1 83  ? 8.363   13.378  -81.035  1.00 42.41 ? 83  VAL B CG1 1 
ATOM   3378 C  CG2 . VAL B 1 83  ? 6.201   13.745  -82.241  1.00 37.18 ? 83  VAL B CG2 1 
ATOM   3379 N  N   . LYS B 1 84  ? 8.812   15.193  -85.133  1.00 47.88 ? 84  LYS B N   1 
ATOM   3380 C  CA  . LYS B 1 84  ? 8.696   15.442  -86.572  1.00 48.16 ? 84  LYS B CA  1 
ATOM   3381 C  C   . LYS B 1 84  ? 8.698   14.049  -87.172  1.00 47.71 ? 84  LYS B C   1 
ATOM   3382 O  O   . LYS B 1 84  ? 9.234   13.137  -86.524  1.00 46.72 ? 84  LYS B O   1 
ATOM   3383 C  CB  . LYS B 1 84  ? 9.920   16.167  -87.168  1.00 48.62 ? 84  LYS B CB  1 
ATOM   3384 C  CG  . LYS B 1 84  ? 10.426  17.480  -86.570  1.00 49.90 ? 84  LYS B CG  1 
ATOM   3385 C  CD  . LYS B 1 84  ? 9.673   18.724  -87.052  1.00 55.55 ? 84  LYS B CD  1 
ATOM   3386 C  CE  . LYS B 1 84  ? 8.204   18.823  -86.636  1.00 56.65 ? 84  LYS B CE  1 
ATOM   3387 N  NZ  . LYS B 1 84  ? 7.613   20.030  -87.179  1.00 60.00 ? 84  LYS B NZ  1 
ATOM   3388 N  N   . PRO B 1 85  ? 8.150   13.803  -88.369  1.00 48.69 ? 85  PRO B N   1 
ATOM   3389 C  CA  . PRO B 1 85  ? 8.236   12.513  -89.053  1.00 47.93 ? 85  PRO B CA  1 
ATOM   3390 C  C   . PRO B 1 85  ? 9.693   12.073  -89.117  1.00 47.54 ? 85  PRO B C   1 
ATOM   3391 O  O   . PRO B 1 85  ? 10.603  12.897  -89.243  1.00 47.46 ? 85  PRO B O   1 
ATOM   3392 C  CB  . PRO B 1 85  ? 7.591   12.811  -90.374  1.00 45.32 ? 85  PRO B CB  1 
ATOM   3393 C  CG  . PRO B 1 85  ? 6.467   13.716  -89.960  1.00 43.83 ? 85  PRO B CG  1 
ATOM   3394 C  CD  . PRO B 1 85  ? 7.226   14.683  -89.068  1.00 47.76 ? 85  PRO B CD  1 
ATOM   3395 N  N   . GLY B 1 86  ? 9.974   10.801  -88.923  1.00 48.75 ? 86  GLY B N   1 
ATOM   3396 C  CA  . GLY B 1 86  ? 11.344  10.326  -88.944  1.00 51.30 ? 86  GLY B CA  1 
ATOM   3397 C  C   . GLY B 1 86  ? 11.958  10.303  -87.554  1.00 51.90 ? 86  GLY B C   1 
ATOM   3398 O  O   . GLY B 1 86  ? 12.871  9.509   -87.311  1.00 52.11 ? 86  GLY B O   1 
ATOM   3399 N  N   . ASP B 1 87  ? 11.497  11.149  -86.624  1.00 51.37 ? 87  ASP B N   1 
ATOM   3400 C  CA  . ASP B 1 87  ? 12.011  11.141  -85.265  1.00 49.48 ? 87  ASP B CA  1 
ATOM   3401 C  C   . ASP B 1 87  ? 11.770  9.805   -84.568  1.00 47.36 ? 87  ASP B C   1 
ATOM   3402 O  O   . ASP B 1 87  ? 10.696  9.194   -84.711  1.00 46.04 ? 87  ASP B O   1 
ATOM   3403 C  CB  . ASP B 1 87  ? 11.353  12.222  -84.418  1.00 49.44 ? 87  ASP B CB  1 
ATOM   3404 C  CG  . ASP B 1 87  ? 12.043  13.580  -84.414  1.00 51.74 ? 87  ASP B CG  1 
ATOM   3405 O  OD1 . ASP B 1 87  ? 13.228  13.682  -84.731  1.00 53.12 ? 87  ASP B OD1 1 
ATOM   3406 O  OD2 . ASP B 1 87  ? 11.392  14.555  -84.048  1.00 55.03 ? 87  ASP B OD2 1 
ATOM   3407 N  N   . LYS B 1 88  ? 12.828  9.335   -83.891  1.00 44.10 ? 88  LYS B N   1 
ATOM   3408 C  CA  . LYS B 1 88  ? 12.757  8.105   -83.117  1.00 43.41 ? 88  LYS B CA  1 
ATOM   3409 C  C   . LYS B 1 88  ? 11.915  8.436   -81.876  1.00 42.74 ? 88  LYS B C   1 
ATOM   3410 O  O   . LYS B 1 88  ? 12.029  9.498   -81.221  1.00 40.22 ? 88  LYS B O   1 
ATOM   3411 C  CB  . LYS B 1 88  ? 14.162  7.668   -82.744  1.00 43.86 ? 88  LYS B CB  1 
ATOM   3412 C  CG  . LYS B 1 88  ? 14.583  6.525   -83.661  1.00 42.41 ? 88  LYS B CG  1 
ATOM   3413 C  CD  . LYS B 1 88  ? 16.088  6.357   -83.580  1.00 38.11 ? 88  LYS B CD  1 
ATOM   3414 C  CE  . LYS B 1 88  ? 16.549  5.140   -84.365  1.00 35.78 ? 88  LYS B CE  1 
ATOM   3415 N  NZ  . LYS B 1 88  ? 17.998  5.106   -84.351  1.00 32.25 ? 88  LYS B NZ  1 
ATOM   3416 N  N   . VAL B 1 89  ? 11.060  7.471   -81.552  1.00 39.71 ? 89  VAL B N   1 
ATOM   3417 C  CA  . VAL B 1 89  ? 10.089  7.656   -80.497  1.00 36.38 ? 89  VAL B CA  1 
ATOM   3418 C  C   . VAL B 1 89  ? 9.799   6.436   -79.599  1.00 35.67 ? 89  VAL B C   1 
ATOM   3419 O  O   . VAL B 1 89  ? 9.866   5.290   -80.062  1.00 33.71 ? 89  VAL B O   1 
ATOM   3420 C  CB  . VAL B 1 89  ? 8.927   8.210   -81.370  1.00 31.22 ? 89  VAL B CB  1 
ATOM   3421 C  CG1 . VAL B 1 89  ? 7.660   7.410   -81.265  1.00 31.59 ? 89  VAL B CG1 1 
ATOM   3422 C  CG2 . VAL B 1 89  ? 8.753   9.635   -80.989  1.00 29.59 ? 89  VAL B CG2 1 
ATOM   3423 N  N   . ILE B 1 90  ? 9.497   6.666   -78.310  1.00 34.89 ? 90  ILE B N   1 
ATOM   3424 C  CA  . ILE B 1 90  ? 9.117   5.635   -77.330  1.00 29.04 ? 90  ILE B CA  1 
ATOM   3425 C  C   . ILE B 1 90  ? 7.774   6.123   -76.809  1.00 22.79 ? 90  ILE B C   1 
ATOM   3426 O  O   . ILE B 1 90  ? 7.696   7.235   -76.265  1.00 27.41 ? 90  ILE B O   1 
ATOM   3427 C  CB  . ILE B 1 90  ? 10.104  5.535   -76.132  1.00 31.40 ? 90  ILE B CB  1 
ATOM   3428 C  CG1 . ILE B 1 90  ? 11.341  4.727   -76.484  1.00 33.32 ? 90  ILE B CG1 1 
ATOM   3429 C  CG2 . ILE B 1 90  ? 9.424   4.792   -74.993  1.00 35.62 ? 90  ILE B CG2 1 
ATOM   3430 C  CD1 . ILE B 1 90  ? 12.457  4.794   -75.412  1.00 30.10 ? 90  ILE B CD1 1 
ATOM   3431 N  N   . PRO B 1 91  ? 6.676   5.426   -77.000  1.00 16.12 ? 91  PRO B N   1 
ATOM   3432 C  CA  . PRO B 1 91  ? 5.406   5.834   -76.473  1.00 20.40 ? 91  PRO B CA  1 
ATOM   3433 C  C   . PRO B 1 91  ? 5.370   5.474   -74.971  1.00 28.63 ? 91  PRO B C   1 
ATOM   3434 O  O   . PRO B 1 91  ? 5.823   4.399   -74.546  1.00 35.02 ? 91  PRO B O   1 
ATOM   3435 C  CB  . PRO B 1 91  ? 4.441   5.091   -77.363  1.00 13.25 ? 91  PRO B CB  1 
ATOM   3436 C  CG  . PRO B 1 91  ? 5.115   3.763   -77.559  1.00 5.26  ? 91  PRO B CG  1 
ATOM   3437 C  CD  . PRO B 1 91  ? 6.593   4.142   -77.682  1.00 11.63 ? 91  PRO B CD  1 
ATOM   3438 N  N   . LEU B 1 92  ? 4.787   6.389   -74.192  1.00 26.94 ? 92  LEU B N   1 
ATOM   3439 C  CA  . LEU B 1 92  ? 4.667   6.342   -72.746  1.00 22.42 ? 92  LEU B CA  1 
ATOM   3440 C  C   . LEU B 1 92  ? 3.349   5.792   -72.226  1.00 24.51 ? 92  LEU B C   1 
ATOM   3441 O  O   . LEU B 1 92  ? 2.350   6.426   -72.576  1.00 25.62 ? 92  LEU B O   1 
ATOM   3442 C  CB  . LEU B 1 92  ? 4.856   7.729   -72.256  1.00 14.50 ? 92  LEU B CB  1 
ATOM   3443 C  CG  . LEU B 1 92  ? 6.131   8.343   -72.805  1.00 19.22 ? 92  LEU B CG  1 
ATOM   3444 C  CD1 . LEU B 1 92  ? 5.999   9.834   -72.692  1.00 21.85 ? 92  LEU B CD1 1 
ATOM   3445 C  CD2 . LEU B 1 92  ? 7.348   7.793   -72.123  1.00 16.39 ? 92  LEU B CD2 1 
ATOM   3446 N  N   . PHE B 1 93  ? 3.196   4.739   -71.376  1.00 21.82 ? 93  PHE B N   1 
ATOM   3447 C  CA  . PHE B 1 93  ? 1.842   4.300   -70.965  1.00 19.34 ? 93  PHE B CA  1 
ATOM   3448 C  C   . PHE B 1 93  ? 1.138   5.248   -69.987  1.00 20.34 ? 93  PHE B C   1 
ATOM   3449 O  O   . PHE B 1 93  ? -0.051  5.123   -69.645  1.00 19.22 ? 93  PHE B O   1 
ATOM   3450 C  CB  . PHE B 1 93  ? 1.870   2.889   -70.340  1.00 25.52 ? 93  PHE B CB  1 
ATOM   3451 C  CG  . PHE B 1 93  ? 2.720   2.623   -69.084  1.00 35.54 ? 93  PHE B CG  1 
ATOM   3452 C  CD1 . PHE B 1 93  ? 4.090   2.351   -69.196  1.00 34.24 ? 93  PHE B CD1 1 
ATOM   3453 C  CD2 . PHE B 1 93  ? 2.129   2.672   -67.814  1.00 36.70 ? 93  PHE B CD2 1 
ATOM   3454 C  CE1 . PHE B 1 93  ? 4.853   2.143   -68.054  1.00 34.67 ? 93  PHE B CE1 1 
ATOM   3455 C  CE2 . PHE B 1 93  ? 2.905   2.462   -66.678  1.00 34.85 ? 93  PHE B CE2 1 
ATOM   3456 C  CZ  . PHE B 1 93  ? 4.264   2.201   -66.799  1.00 34.54 ? 93  PHE B CZ  1 
ATOM   3457 N  N   . THR B 1 94  ? 1.910   6.197   -69.462  1.00 16.46 ? 94  THR B N   1 
ATOM   3458 C  CA  . THR B 1 94  ? 1.369   7.183   -68.583  1.00 20.78 ? 94  THR B CA  1 
ATOM   3459 C  C   . THR B 1 94  ? 1.857   8.468   -69.220  1.00 21.74 ? 94  THR B C   1 
ATOM   3460 O  O   . THR B 1 94  ? 3.070   8.662   -69.422  1.00 19.91 ? 94  THR B O   1 
ATOM   3461 C  CB  . THR B 1 94  ? 1.892   6.953   -67.109  1.00 25.92 ? 94  THR B CB  1 
ATOM   3462 O  OG1 . THR B 1 94  ? 1.129   5.827   -66.637  1.00 26.43 ? 94  THR B OG1 1 
ATOM   3463 C  CG2 . THR B 1 94  ? 1.738   8.140   -66.158  1.00 18.08 ? 94  THR B CG2 1 
ATOM   3464 N  N   . PRO B 1 95  ? 0.884   9.301   -69.630  1.00 22.00 ? 95  PRO B N   1 
ATOM   3465 C  CA  . PRO B 1 95  ? 1.144   10.589  -70.261  1.00 24.33 ? 95  PRO B CA  1 
ATOM   3466 C  C   . PRO B 1 95  ? 1.773   11.615  -69.340  1.00 25.64 ? 95  PRO B C   1 
ATOM   3467 O  O   . PRO B 1 95  ? 1.796   11.421  -68.119  1.00 31.42 ? 95  PRO B O   1 
ATOM   3468 C  CB  . PRO B 1 95  ? -0.217  11.029  -70.781  1.00 17.99 ? 95  PRO B CB  1 
ATOM   3469 C  CG  . PRO B 1 95  ? -1.217  10.312  -69.901  1.00 18.10 ? 95  PRO B CG  1 
ATOM   3470 C  CD  . PRO B 1 95  ? -0.556  8.992   -69.633  1.00 19.47 ? 95  PRO B CD  1 
ATOM   3471 N  N   . GLN B 1 96  ? 2.327   12.685  -69.886  1.00 20.24 ? 96  GLN B N   1 
ATOM   3472 C  CA  . GLN B 1 96  ? 2.800   13.735  -69.042  1.00 14.92 ? 96  GLN B CA  1 
ATOM   3473 C  C   . GLN B 1 96  ? 2.150   14.917  -69.723  1.00 18.84 ? 96  GLN B C   1 
ATOM   3474 O  O   . GLN B 1 96  ? 2.808   15.753  -70.332  1.00 22.36 ? 96  GLN B O   1 
ATOM   3475 C  CB  . GLN B 1 96  ? 4.319   13.881  -69.039  1.00 14.29 ? 96  GLN B CB  1 
ATOM   3476 C  CG  . GLN B 1 96  ? 4.668   15.039  -68.099  1.00 8.43  ? 96  GLN B CG  1 
ATOM   3477 C  CD  . GLN B 1 96  ? 6.130   15.398  -68.011  1.00 13.36 ? 96  GLN B CD  1 
ATOM   3478 O  OE1 . GLN B 1 96  ? 7.045   14.747  -68.533  1.00 15.71 ? 96  GLN B OE1 1 
ATOM   3479 N  NE2 . GLN B 1 96  ? 6.384   16.492  -67.315  1.00 16.52 ? 96  GLN B NE2 1 
ATOM   3480 N  N   . CYS B 1 97  ? 0.819   15.075  -69.618  1.00 20.92 ? 97  CYS B N   1 
ATOM   3481 C  CA  . CYS B 1 97  ? 0.100   16.194  -70.235  1.00 20.99 ? 97  CYS B CA  1 
ATOM   3482 C  C   . CYS B 1 97  ? 0.621   17.602  -69.954  1.00 23.23 ? 97  CYS B C   1 
ATOM   3483 O  O   . CYS B 1 97  ? 0.076   18.561  -70.503  1.00 26.45 ? 97  CYS B O   1 
ATOM   3484 C  CB  . CYS B 1 97  ? -1.383  16.198  -69.835  1.00 22.17 ? 97  CYS B CB  1 
ATOM   3485 S  SG  . CYS B 1 97  ? -1.760  17.144  -68.328  1.00 30.64 ? 97  CYS B SG  1 
ATOM   3486 N  N   . GLY B 1 98  ? 1.647   17.798  -69.124  1.00 22.43 ? 98  GLY B N   1 
ATOM   3487 C  CA  . GLY B 1 98  ? 2.216   19.093  -68.789  1.00 21.75 ? 98  GLY B CA  1 
ATOM   3488 C  C   . GLY B 1 98  ? 1.276   20.048  -68.051  1.00 24.37 ? 98  GLY B C   1 
ATOM   3489 O  O   . GLY B 1 98  ? 1.792   20.940  -67.381  1.00 26.31 ? 98  GLY B O   1 
ATOM   3490 N  N   . LYS B 1 99  ? -0.054  19.907  -68.021  1.00 25.31 ? 99  LYS B N   1 
ATOM   3491 C  CA  . LYS B 1 99  ? -0.836  20.943  -67.369  1.00 32.48 ? 99  LYS B CA  1 
ATOM   3492 C  C   . LYS B 1 99  ? -1.670  20.638  -66.137  1.00 35.15 ? 99  LYS B C   1 
ATOM   3493 O  O   . LYS B 1 99  ? -2.241  21.542  -65.519  1.00 38.35 ? 99  LYS B O   1 
ATOM   3494 C  CB  . LYS B 1 99  ? -1.742  21.579  -68.463  1.00 33.94 ? 99  LYS B CB  1 
ATOM   3495 C  CG  . LYS B 1 99  ? -2.722  20.652  -69.184  1.00 34.46 ? 99  LYS B CG  1 
ATOM   3496 C  CD  . LYS B 1 99  ? -3.965  20.282  -68.376  1.00 36.65 ? 99  LYS B CD  1 
ATOM   3497 C  CE  . LYS B 1 99  ? -4.409  18.880  -68.778  1.00 40.44 ? 99  LYS B CE  1 
ATOM   3498 N  NZ  . LYS B 1 99  ? -5.410  18.308  -67.895  1.00 38.19 ? 99  LYS B NZ  1 
ATOM   3499 N  N   . CYS B 1 100 ? -1.875  19.367  -65.813  1.00 32.95 ? 100 CYS B N   1 
ATOM   3500 C  CA  . CYS B 1 100 ? -2.700  19.052  -64.677  1.00 29.51 ? 100 CYS B CA  1 
ATOM   3501 C  C   . CYS B 1 100 ? -1.901  19.180  -63.379  1.00 28.55 ? 100 CYS B C   1 
ATOM   3502 O  O   . CYS B 1 100 ? -0.669  19.335  -63.415  1.00 26.12 ? 100 CYS B O   1 
ATOM   3503 C  CB  . CYS B 1 100 ? -3.263  17.644  -64.891  1.00 26.44 ? 100 CYS B CB  1 
ATOM   3504 S  SG  . CYS B 1 100 ? -2.114  16.278  -64.610  1.00 34.24 ? 100 CYS B SG  1 
ATOM   3505 N  N   . ARG B 1 101 ? -2.645  19.121  -62.248  1.00 27.03 ? 101 ARG B N   1 
ATOM   3506 C  CA  . ARG B 1 101 ? -2.177  19.164  -60.848  1.00 22.35 ? 101 ARG B CA  1 
ATOM   3507 C  C   . ARG B 1 101 ? -0.980  18.229  -60.668  1.00 21.83 ? 101 ARG B C   1 
ATOM   3508 O  O   . ARG B 1 101 ? 0.123   18.666  -60.313  1.00 20.92 ? 101 ARG B O   1 
ATOM   3509 C  CB  . ARG B 1 101 ? -3.311  18.706  -59.943  1.00 23.11 ? 101 ARG B CB  1 
ATOM   3510 C  CG  . ARG B 1 101 ? -2.966  18.841  -58.469  1.00 29.11 ? 101 ARG B CG  1 
ATOM   3511 C  CD  . ARG B 1 101 ? -3.896  18.050  -57.563  1.00 27.94 ? 101 ARG B CD  1 
ATOM   3512 N  NE  . ARG B 1 101 ? -3.625  18.405  -56.181  1.00 28.76 ? 101 ARG B NE  1 
ATOM   3513 C  CZ  . ARG B 1 101 ? -4.453  18.048  -55.183  1.00 28.18 ? 101 ARG B CZ  1 
ATOM   3514 N  NH1 . ARG B 1 101 ? -5.561  17.352  -55.391  1.00 25.16 ? 101 ARG B NH1 1 
ATOM   3515 N  NH2 . ARG B 1 101 ? -4.190  18.427  -53.937  1.00 27.72 ? 101 ARG B NH2 1 
ATOM   3516 N  N   . VAL B 1 102 ? -1.185  16.936  -61.019  1.00 18.57 ? 102 VAL B N   1 
ATOM   3517 C  CA  . VAL B 1 102 ? -0.102  15.971  -60.912  1.00 19.28 ? 102 VAL B CA  1 
ATOM   3518 C  C   . VAL B 1 102 ? 1.059   16.418  -61.775  1.00 23.83 ? 102 VAL B C   1 
ATOM   3519 O  O   . VAL B 1 102 ? 2.184   16.328  -61.294  1.00 27.61 ? 102 VAL B O   1 
ATOM   3520 C  CB  . VAL B 1 102 ? -0.506  14.573  -61.366  1.00 18.18 ? 102 VAL B CB  1 
ATOM   3521 C  CG1 . VAL B 1 102 ? 0.665   13.653  -61.066  1.00 20.13 ? 102 VAL B CG1 1 
ATOM   3522 C  CG2 . VAL B 1 102 ? -1.715  14.038  -60.633  1.00 12.12 ? 102 VAL B CG2 1 
ATOM   3523 N  N   . CYS B 1 103 ? 0.823   16.960  -62.981  1.00 26.14 ? 103 CYS B N   1 
ATOM   3524 C  CA  . CYS B 1 103 ? 1.940   17.383  -63.839  1.00 27.72 ? 103 CYS B CA  1 
ATOM   3525 C  C   . CYS B 1 103 ? 2.615   18.656  -63.348  1.00 26.28 ? 103 CYS B C   1 
ATOM   3526 O  O   . CYS B 1 103 ? 3.828   18.808  -63.485  1.00 24.88 ? 103 CYS B O   1 
ATOM   3527 C  CB  . CYS B 1 103 ? 1.443   17.561  -65.305  1.00 24.45 ? 103 CYS B CB  1 
ATOM   3528 S  SG  . CYS B 1 103 ? 1.191   15.990  -66.193  1.00 20.42 ? 103 CYS B SG  1 
ATOM   3529 N  N   . LYS B 1 104 ? 1.902   19.591  -62.733  1.00 29.53 ? 104 LYS B N   1 
ATOM   3530 C  CA  . LYS B 1 104 ? 2.533   20.813  -62.242  1.00 33.30 ? 104 LYS B CA  1 
ATOM   3531 C  C   . LYS B 1 104 ? 3.318   20.525  -60.947  1.00 34.52 ? 104 LYS B C   1 
ATOM   3532 O  O   . LYS B 1 104 ? 4.341   21.152  -60.623  1.00 32.50 ? 104 LYS B O   1 
ATOM   3533 C  CB  . LYS B 1 104 ? 1.460   21.846  -61.983  1.00 37.63 ? 104 LYS B CB  1 
ATOM   3534 C  CG  . LYS B 1 104 ? 0.626   22.227  -63.190  1.00 40.81 ? 104 LYS B CG  1 
ATOM   3535 C  CD  . LYS B 1 104 ? 0.786   23.714  -63.459  1.00 42.00 ? 104 LYS B CD  1 
ATOM   3536 C  CE  . LYS B 1 104 ? -0.227  24.172  -64.491  1.00 43.19 ? 104 LYS B CE  1 
ATOM   3537 N  NZ  . LYS B 1 104 ? -1.583  23.929  -64.020  1.00 44.53 ? 104 LYS B NZ  1 
ATOM   3538 N  N   . ASN B 1 105 ? 2.825   19.548  -60.181  1.00 33.98 ? 105 ASN B N   1 
ATOM   3539 C  CA  . ASN B 1 105 ? 3.463   19.135  -58.943  1.00 36.65 ? 105 ASN B CA  1 
ATOM   3540 C  C   . ASN B 1 105 ? 4.791   18.432  -59.228  1.00 34.86 ? 105 ASN B C   1 
ATOM   3541 O  O   . ASN B 1 105 ? 4.804   17.306  -59.707  1.00 32.24 ? 105 ASN B O   1 
ATOM   3542 C  CB  . ASN B 1 105 ? 2.511   18.196  -58.188  1.00 41.20 ? 105 ASN B CB  1 
ATOM   3543 C  CG  . ASN B 1 105 ? 3.001   17.660  -56.846  1.00 41.44 ? 105 ASN B CG  1 
ATOM   3544 O  OD1 . ASN B 1 105 ? 4.157   17.261  -56.664  1.00 46.58 ? 105 ASN B OD1 1 
ATOM   3545 N  ND2 . ASN B 1 105 ? 2.134   17.643  -55.844  1.00 40.91 ? 105 ASN B ND2 1 
ATOM   3546 N  N   . PRO B 1 106 ? 5.943   18.970  -58.839  1.00 36.45 ? 106 PRO B N   1 
ATOM   3547 C  CA  . PRO B 1 106 ? 7.251   18.406  -59.133  1.00 36.71 ? 106 PRO B CA  1 
ATOM   3548 C  C   . PRO B 1 106 ? 7.537   17.008  -58.632  1.00 38.60 ? 106 PRO B C   1 
ATOM   3549 O  O   . PRO B 1 106 ? 8.505   16.399  -59.079  1.00 38.67 ? 106 PRO B O   1 
ATOM   3550 C  CB  . PRO B 1 106 ? 8.215   19.414  -58.564  1.00 33.15 ? 106 PRO B CB  1 
ATOM   3551 C  CG  . PRO B 1 106 ? 7.475   19.844  -57.333  1.00 36.62 ? 106 PRO B CG  1 
ATOM   3552 C  CD  . PRO B 1 106 ? 6.073   20.062  -57.881  1.00 38.96 ? 106 PRO B CD  1 
ATOM   3553 N  N   . GLU B 1 107 ? 6.747   16.508  -57.687  1.00 41.00 ? 107 GLU B N   1 
ATOM   3554 C  CA  . GLU B 1 107 ? 7.001   15.209  -57.133  1.00 41.28 ? 107 GLU B CA  1 
ATOM   3555 C  C   . GLU B 1 107 ? 6.093   14.111  -57.624  1.00 40.22 ? 107 GLU B C   1 
ATOM   3556 O  O   . GLU B 1 107 ? 6.494   12.952  -57.506  1.00 43.76 ? 107 GLU B O   1 
ATOM   3557 C  CB  . GLU B 1 107 ? 6.910   15.286  -55.617  1.00 48.22 ? 107 GLU B CB  1 
ATOM   3558 C  CG  . GLU B 1 107 ? 8.250   15.054  -54.908  1.00 57.06 ? 107 GLU B CG  1 
ATOM   3559 C  CD  . GLU B 1 107 ? 9.149   16.284  -54.794  1.00 65.19 ? 107 GLU B CD  1 
ATOM   3560 O  OE1 . GLU B 1 107 ? 9.010   16.994  -53.796  1.00 71.09 ? 107 GLU B OE1 1 
ATOM   3561 O  OE2 . GLU B 1 107 ? 9.985   16.531  -55.673  1.00 65.61 ? 107 GLU B OE2 1 
ATOM   3562 N  N   . SER B 1 108 ? 4.892   14.364  -58.132  1.00 35.86 ? 108 SER B N   1 
ATOM   3563 C  CA  . SER B 1 108 ? 4.035   13.284  -58.579  1.00 31.78 ? 108 SER B CA  1 
ATOM   3564 C  C   . SER B 1 108 ? 4.130   12.946  -60.070  1.00 30.03 ? 108 SER B C   1 
ATOM   3565 O  O   . SER B 1 108 ? 4.667   13.766  -60.802  1.00 25.95 ? 108 SER B O   1 
ATOM   3566 C  CB  . SER B 1 108 ? 2.650   13.677  -58.198  1.00 36.30 ? 108 SER B CB  1 
ATOM   3567 O  OG  . SER B 1 108 ? 2.403   15.078  -58.353  1.00 45.30 ? 108 SER B OG  1 
ATOM   3568 N  N   . ASN B 1 109 ? 3.688   11.788  -60.615  1.00 30.62 ? 109 ASN B N   1 
ATOM   3569 C  CA  . ASN B 1 109 ? 3.778   11.540  -62.070  1.00 28.77 ? 109 ASN B CA  1 
ATOM   3570 C  C   . ASN B 1 109 ? 2.562   10.868  -62.701  1.00 28.02 ? 109 ASN B C   1 
ATOM   3571 O  O   . ASN B 1 109 ? 2.512   10.737  -63.924  1.00 29.19 ? 109 ASN B O   1 
ATOM   3572 C  CB  . ASN B 1 109 ? 5.012   10.671  -62.459  1.00 28.76 ? 109 ASN B CB  1 
ATOM   3573 C  CG  . ASN B 1 109 ? 4.884   9.164   -62.239  1.00 27.48 ? 109 ASN B CG  1 
ATOM   3574 O  OD1 . ASN B 1 109 ? 4.012   8.718   -61.500  1.00 27.22 ? 109 ASN B OD1 1 
ATOM   3575 N  ND2 . ASN B 1 109 ? 5.693   8.303   -62.836  1.00 24.28 ? 109 ASN B ND2 1 
ATOM   3576 N  N   . TYR B 1 110 ? 1.554   10.422  -61.949  1.00 24.40 ? 110 TYR B N   1 
ATOM   3577 C  CA  . TYR B 1 110 ? 0.371   9.764   -62.493  1.00 23.98 ? 110 TYR B CA  1 
ATOM   3578 C  C   . TYR B 1 110 ? -0.573  10.833  -63.048  1.00 27.67 ? 110 TYR B C   1 
ATOM   3579 O  O   . TYR B 1 110 ? -1.587  11.231  -62.441  1.00 25.58 ? 110 TYR B O   1 
ATOM   3580 C  CB  . TYR B 1 110 ? -0.252  8.963   -61.353  1.00 16.45 ? 110 TYR B CB  1 
ATOM   3581 C  CG  . TYR B 1 110 ? -1.508  8.150   -61.599  1.00 6.08  ? 110 TYR B CG  1 
ATOM   3582 C  CD1 . TYR B 1 110 ? -1.416  6.895   -62.165  1.00 7.49  ? 110 TYR B CD1 1 
ATOM   3583 C  CD2 . TYR B 1 110 ? -2.740  8.626   -61.201  1.00 9.84  ? 110 TYR B CD2 1 
ATOM   3584 C  CE1 . TYR B 1 110 ? -2.551  6.107   -62.320  1.00 2.00  ? 110 TYR B CE1 1 
ATOM   3585 C  CE2 . TYR B 1 110 ? -3.883  7.841   -61.355  1.00 8.76  ? 110 TYR B CE2 1 
ATOM   3586 C  CZ  . TYR B 1 110 ? -3.773  6.575   -61.908  1.00 2.66  ? 110 TYR B CZ  1 
ATOM   3587 O  OH  . TYR B 1 110 ? -4.889  5.741   -61.970  1.00 9.03  ? 110 TYR B OH  1 
ATOM   3588 N  N   . CYS B 1 111 ? -0.173  11.343  -64.224  1.00 26.94 ? 111 CYS B N   1 
ATOM   3589 C  CA  . CYS B 1 111 ? -0.919  12.378  -64.900  1.00 23.25 ? 111 CYS B CA  1 
ATOM   3590 C  C   . CYS B 1 111 ? -2.340  11.921  -65.052  1.00 19.11 ? 111 CYS B C   1 
ATOM   3591 O  O   . CYS B 1 111 ? -2.643  10.771  -65.375  1.00 23.70 ? 111 CYS B O   1 
ATOM   3592 C  CB  . CYS B 1 111 ? -0.343  12.680  -66.294  1.00 32.03 ? 111 CYS B CB  1 
ATOM   3593 S  SG  . CYS B 1 111 ? -1.436  13.745  -67.300  1.00 31.02 ? 111 CYS B SG  1 
ATOM   3594 N  N   . LEU B 1 112 ? -3.214  12.871  -64.838  1.00 16.98 ? 112 LEU B N   1 
ATOM   3595 C  CA  . LEU B 1 112 ? -4.645  12.644  -64.882  1.00 18.65 ? 112 LEU B CA  1 
ATOM   3596 C  C   . LEU B 1 112 ? -5.234  12.124  -66.153  1.00 20.48 ? 112 LEU B C   1 
ATOM   3597 O  O   . LEU B 1 112 ? -6.317  11.568  -66.152  1.00 24.15 ? 112 LEU B O   1 
ATOM   3598 C  CB  . LEU B 1 112 ? -5.306  13.964  -64.455  1.00 23.11 ? 112 LEU B CB  1 
ATOM   3599 C  CG  . LEU B 1 112 ? -5.364  13.951  -62.899  1.00 29.40 ? 112 LEU B CG  1 
ATOM   3600 C  CD1 . LEU B 1 112 ? -4.799  15.210  -62.282  1.00 28.20 ? 112 LEU B CD1 1 
ATOM   3601 C  CD2 . LEU B 1 112 ? -6.812  13.700  -62.515  1.00 29.29 ? 112 LEU B CD2 1 
ATOM   3602 N  N   . LYS B 1 113 ? -4.502  12.327  -67.249  1.00 27.12 ? 113 LYS B N   1 
ATOM   3603 C  CA  . LYS B 1 113 ? -4.886  11.887  -68.579  1.00 28.46 ? 113 LYS B CA  1 
ATOM   3604 C  C   . LYS B 1 113 ? -4.717  10.398  -68.784  1.00 29.86 ? 113 LYS B C   1 
ATOM   3605 O  O   . LYS B 1 113 ? -5.060  9.900   -69.855  1.00 31.81 ? 113 LYS B O   1 
ATOM   3606 C  CB  . LYS B 1 113 ? -4.052  12.637  -69.652  1.00 28.03 ? 113 LYS B CB  1 
ATOM   3607 C  CG  . LYS B 1 113 ? -4.510  14.081  -69.976  1.00 26.54 ? 113 LYS B CG  1 
ATOM   3608 C  CD  . LYS B 1 113 ? -6.027  14.076  -70.199  1.00 31.05 ? 113 LYS B CD  1 
ATOM   3609 C  CE  . LYS B 1 113 ? -6.604  15.376  -70.714  1.00 37.95 ? 113 LYS B CE  1 
ATOM   3610 N  NZ  . LYS B 1 113 ? -6.220  16.495  -69.874  1.00 39.70 ? 113 LYS B NZ  1 
ATOM   3611 N  N   . ASN B 1 114 ? -4.081  9.738   -67.801  1.00 27.28 ? 114 ASN B N   1 
ATOM   3612 C  CA  . ASN B 1 114 ? -3.786  8.315   -67.788  1.00 23.54 ? 114 ASN B CA  1 
ATOM   3613 C  C   . ASN B 1 114 ? -5.015  7.472   -68.083  1.00 22.85 ? 114 ASN B C   1 
ATOM   3614 O  O   . ASN B 1 114 ? -6.145  7.870   -67.809  1.00 23.70 ? 114 ASN B O   1 
ATOM   3615 C  CB  . ASN B 1 114 ? -3.205  7.899   -66.402  1.00 19.82 ? 114 ASN B CB  1 
ATOM   3616 C  CG  . ASN B 1 114 ? -4.289  7.786   -65.341  1.00 17.41 ? 114 ASN B CG  1 
ATOM   3617 O  OD1 . ASN B 1 114 ? -4.958  6.740   -65.226  1.00 18.69 ? 114 ASN B OD1 1 
ATOM   3618 N  ND2 . ASN B 1 114 ? -4.540  8.860   -64.598  1.00 10.87 ? 114 ASN B ND2 1 
ATOM   3619 N  N   . ASP B 1 115 ? -4.832  6.292   -68.652  1.00 23.83 ? 115 ASP B N   1 
ATOM   3620 C  CA  . ASP B 1 115 ? -5.998  5.470   -68.877  1.00 22.87 ? 115 ASP B CA  1 
ATOM   3621 C  C   . ASP B 1 115 ? -5.857  4.190   -68.051  1.00 22.49 ? 115 ASP B C   1 
ATOM   3622 O  O   . ASP B 1 115 ? -6.520  3.177   -68.306  1.00 17.24 ? 115 ASP B O   1 
ATOM   3623 C  CB  . ASP B 1 115 ? -6.121  5.170   -70.384  1.00 25.49 ? 115 ASP B CB  1 
ATOM   3624 C  CG  . ASP B 1 115 ? -7.518  4.675   -70.697  1.00 30.91 ? 115 ASP B CG  1 
ATOM   3625 O  OD1 . ASP B 1 115 ? -8.472  5.335   -70.297  1.00 37.31 ? 115 ASP B OD1 1 
ATOM   3626 O  OD2 . ASP B 1 115 ? -7.656  3.609   -71.290  1.00 32.30 ? 115 ASP B OD2 1 
ATOM   3627 N  N   . LEU B 1 116 ? -5.023  4.261   -67.003  1.00 25.98 ? 116 LEU B N   1 
ATOM   3628 C  CA  . LEU B 1 116 ? -4.781  3.134   -66.124  1.00 28.75 ? 116 LEU B CA  1 
ATOM   3629 C  C   . LEU B 1 116 ? -5.846  2.994   -65.068  1.00 31.04 ? 116 LEU B C   1 
ATOM   3630 O  O   . LEU B 1 116 ? -6.449  1.934   -64.939  1.00 32.21 ? 116 LEU B O   1 
ATOM   3631 C  CB  . LEU B 1 116 ? -3.440  3.276   -65.431  1.00 32.17 ? 116 LEU B CB  1 
ATOM   3632 C  CG  . LEU B 1 116 ? -3.030  2.161   -64.478  1.00 30.59 ? 116 LEU B CG  1 
ATOM   3633 C  CD1 . LEU B 1 116 ? -3.114  0.806   -65.173  1.00 27.05 ? 116 LEU B CD1 1 
ATOM   3634 C  CD2 . LEU B 1 116 ? -1.644  2.500   -63.948  1.00 30.63 ? 116 LEU B CD2 1 
ATOM   3635 N  N   . GLY B 1 117 ? -6.100  4.088   -64.355  1.00 35.56 ? 117 GLY B N   1 
ATOM   3636 C  CA  . GLY B 1 117 ? -7.059  4.094   -63.269  1.00 37.90 ? 117 GLY B CA  1 
ATOM   3637 C  C   . GLY B 1 117 ? -8.409  3.555   -63.640  1.00 40.36 ? 117 GLY B C   1 
ATOM   3638 O  O   . GLY B 1 117 ? -8.863  2.555   -63.096  1.00 47.11 ? 117 GLY B O   1 
ATOM   3639 N  N   . ASN B 1 118 ? -9.105  4.235   -64.521  1.00 40.10 ? 118 ASN B N   1 
ATOM   3640 C  CA  . ASN B 1 118 ? -10.408 3.746   -64.906  1.00 42.33 ? 118 ASN B CA  1 
ATOM   3641 C  C   . ASN B 1 118 ? -10.209 3.668   -66.409  1.00 43.06 ? 118 ASN B C   1 
ATOM   3642 O  O   . ASN B 1 118 ? -10.348 4.687   -67.099  1.00 43.44 ? 118 ASN B O   1 
ATOM   3643 C  CB  . ASN B 1 118 ? -11.444 4.773   -64.474  1.00 45.68 ? 118 ASN B CB  1 
ATOM   3644 C  CG  . ASN B 1 118 ? -12.846 4.408   -64.929  1.00 52.23 ? 118 ASN B CG  1 
ATOM   3645 O  OD1 . ASN B 1 118 ? -13.521 3.572   -64.337  1.00 56.79 ? 118 ASN B OD1 1 
ATOM   3646 N  ND2 . ASN B 1 118 ? -13.340 4.999   -66.005  1.00 57.38 ? 118 ASN B ND2 1 
ATOM   3647 N  N   . PRO B 1 119 ? -9.752  2.532   -66.958  1.00 41.86 ? 119 PRO B N   1 
ATOM   3648 C  CA  . PRO B 1 119 ? -9.441  2.380   -68.365  1.00 37.47 ? 119 PRO B CA  1 
ATOM   3649 C  C   . PRO B 1 119 ? -10.661 2.434   -69.292  1.00 33.89 ? 119 PRO B C   1 
ATOM   3650 O  O   . PRO B 1 119 ? -11.624 1.693   -69.105  1.00 27.11 ? 119 PRO B O   1 
ATOM   3651 C  CB  . PRO B 1 119 ? -8.691  1.072   -68.393  1.00 34.51 ? 119 PRO B CB  1 
ATOM   3652 C  CG  . PRO B 1 119 ? -9.452  0.245   -67.413  1.00 36.60 ? 119 PRO B CG  1 
ATOM   3653 C  CD  . PRO B 1 119 ? -9.640  1.243   -66.284  1.00 40.79 ? 119 PRO B CD  1 
ATOM   3654 N  N   . ARG B 1 120 ? -10.693 3.386   -70.241  1.00 33.74 ? 120 ARG B N   1 
ATOM   3655 C  CA  . ARG B 1 120 ? -11.783 3.421   -71.202  1.00 33.60 ? 120 ARG B CA  1 
ATOM   3656 C  C   . ARG B 1 120 ? -11.305 2.898   -72.568  1.00 32.75 ? 120 ARG B C   1 
ATOM   3657 O  O   . ARG B 1 120 ? -12.073 2.740   -73.507  1.00 33.24 ? 120 ARG B O   1 
ATOM   3658 C  CB  . ARG B 1 120 ? -12.344 4.852   -71.302  1.00 31.88 ? 120 ARG B CB  1 
ATOM   3659 C  CG  . ARG B 1 120 ? -11.417 6.006   -71.640  1.00 35.79 ? 120 ARG B CG  1 
ATOM   3660 C  CD  . ARG B 1 120 ? -12.319 7.219   -71.587  1.00 37.60 ? 120 ARG B CD  1 
ATOM   3661 N  NE  . ARG B 1 120 ? -11.623 8.466   -71.873  1.00 42.25 ? 120 ARG B NE  1 
ATOM   3662 C  CZ  . ARG B 1 120 ? -12.288 9.551   -72.308  1.00 43.73 ? 120 ARG B CZ  1 
ATOM   3663 N  NH1 . ARG B 1 120 ? -13.611 9.531   -72.502  1.00 44.88 ? 120 ARG B NH1 1 
ATOM   3664 N  NH2 . ARG B 1 120 ? -11.627 10.687  -72.558  1.00 43.91 ? 120 ARG B NH2 1 
ATOM   3665 N  N   . GLY B 1 121 ? -10.033 2.548   -72.713  1.00 32.95 ? 121 GLY B N   1 
ATOM   3666 C  CA  . GLY B 1 121 ? -9.484  2.010   -73.948  1.00 33.67 ? 121 GLY B CA  1 
ATOM   3667 C  C   . GLY B 1 121 ? -9.668  2.878   -75.182  1.00 35.07 ? 121 GLY B C   1 
ATOM   3668 O  O   . GLY B 1 121 ? -10.051 2.369   -76.241  1.00 38.46 ? 121 GLY B O   1 
ATOM   3669 N  N   . THR B 1 122 ? -9.386  4.174   -75.091  1.00 29.71 ? 122 THR B N   1 
ATOM   3670 C  CA  . THR B 1 122 ? -9.536  5.082   -76.197  1.00 26.48 ? 122 THR B CA  1 
ATOM   3671 C  C   . THR B 1 122 ? -8.329  6.005   -76.127  1.00 26.49 ? 122 THR B C   1 
ATOM   3672 O  O   . THR B 1 122 ? -7.398  5.721   -75.366  1.00 30.22 ? 122 THR B O   1 
ATOM   3673 C  CB  . THR B 1 122 ? -10.852 5.909   -76.069  1.00 26.38 ? 122 THR B CB  1 
ATOM   3674 O  OG1 . THR B 1 122 ? -10.613 6.892   -75.061  1.00 25.03 ? 122 THR B OG1 1 
ATOM   3675 C  CG2 . THR B 1 122 ? -12.066 5.099   -75.718  1.00 16.35 ? 122 THR B CG2 1 
ATOM   3676 N  N   . LEU B 1 123 ? -8.200  7.050   -76.937  1.00 24.65 ? 123 LEU B N   1 
ATOM   3677 C  CA  . LEU B 1 123 ? -7.093  7.966   -76.773  1.00 21.81 ? 123 LEU B CA  1 
ATOM   3678 C  C   . LEU B 1 123 ? -7.756  9.089   -75.978  1.00 22.00 ? 123 LEU B C   1 
ATOM   3679 O  O   . LEU B 1 123 ? -8.994  9.128   -75.821  1.00 18.82 ? 123 LEU B O   1 
ATOM   3680 C  CB  . LEU B 1 123 ? -6.560  8.528   -78.076  1.00 26.54 ? 123 LEU B CB  1 
ATOM   3681 C  CG  . LEU B 1 123 ? -5.732  7.668   -79.028  1.00 31.50 ? 123 LEU B CG  1 
ATOM   3682 C  CD1 . LEU B 1 123 ? -5.074  8.585   -80.034  1.00 32.38 ? 123 LEU B CD1 1 
ATOM   3683 C  CD2 . LEU B 1 123 ? -4.605  6.947   -78.316  1.00 32.00 ? 123 LEU B CD2 1 
ATOM   3684 N  N   . GLN B 1 124 ? -6.936  10.050  -75.527  1.00 19.80 ? 124 GLN B N   1 
ATOM   3685 C  CA  . GLN B 1 124 ? -7.403  11.127  -74.675  1.00 20.25 ? 124 GLN B CA  1 
ATOM   3686 C  C   . GLN B 1 124 ? -8.658  11.857  -75.081  1.00 25.77 ? 124 GLN B C   1 
ATOM   3687 O  O   . GLN B 1 124 ? -9.320  12.379  -74.188  1.00 29.78 ? 124 GLN B O   1 
ATOM   3688 C  CB  . GLN B 1 124 ? -6.256  12.124  -74.469  1.00 18.30 ? 124 GLN B CB  1 
ATOM   3689 C  CG  . GLN B 1 124 ? -5.200  11.553  -73.497  1.00 9.95  ? 124 GLN B CG  1 
ATOM   3690 C  CD  . GLN B 1 124 ? -3.949  12.403  -73.419  1.00 19.57 ? 124 GLN B CD  1 
ATOM   3691 O  OE1 . GLN B 1 124 ? -4.007  13.635  -73.515  1.00 21.49 ? 124 GLN B OE1 1 
ATOM   3692 N  NE2 . GLN B 1 124 ? -2.756  11.838  -73.272  1.00 4.02  ? 124 GLN B NE2 1 
ATOM   3693 N  N   . ASP B 1 125 ? -9.094  11.872  -76.353  1.00 26.59 ? 125 ASP B N   1 
ATOM   3694 C  CA  . ASP B 1 125 ? -10.337 12.570  -76.689  1.00 23.05 ? 125 ASP B CA  1 
ATOM   3695 C  C   . ASP B 1 125 ? -11.523 11.656  -76.617  1.00 21.99 ? 125 ASP B C   1 
ATOM   3696 O  O   . ASP B 1 125 ? -12.614 12.060  -76.997  1.00 26.87 ? 125 ASP B O   1 
ATOM   3697 C  CB  . ASP B 1 125 ? -10.309 13.164  -78.086  1.00 31.27 ? 125 ASP B CB  1 
ATOM   3698 C  CG  . ASP B 1 125 ? -9.856  12.183  -79.145  1.00 38.61 ? 125 ASP B CG  1 
ATOM   3699 O  OD1 . ASP B 1 125 ? -10.706 11.441  -79.606  1.00 35.29 ? 125 ASP B OD1 1 
ATOM   3700 O  OD2 . ASP B 1 125 ? -8.667  12.164  -79.474  1.00 45.17 ? 125 ASP B OD2 1 
ATOM   3701 N  N   . GLY B 1 126 ? -11.371 10.410  -76.189  1.00 19.56 ? 126 GLY B N   1 
ATOM   3702 C  CA  . GLY B 1 126 ? -12.506 9.525   -76.065  1.00 17.09 ? 126 GLY B CA  1 
ATOM   3703 C  C   . GLY B 1 126 ? -12.835 8.740   -77.306  1.00 19.15 ? 126 GLY B C   1 
ATOM   3704 O  O   . GLY B 1 126 ? -13.947 8.209   -77.365  1.00 19.86 ? 126 GLY B O   1 
ATOM   3705 N  N   . THR B 1 127 ? -11.939 8.598   -78.292  1.00 22.26 ? 127 THR B N   1 
ATOM   3706 C  CA  . THR B 1 127 ? -12.271 7.815   -79.499  1.00 24.04 ? 127 THR B CA  1 
ATOM   3707 C  C   . THR B 1 127 ? -11.133 6.835   -79.834  1.00 24.11 ? 127 THR B C   1 
ATOM   3708 O  O   . THR B 1 127 ? -9.990  7.017   -79.365  1.00 19.45 ? 127 THR B O   1 
ATOM   3709 C  CB  . THR B 1 127 ? -12.522 8.768   -80.722  1.00 19.78 ? 127 THR B CB  1 
ATOM   3710 O  OG1 . THR B 1 127 ? -11.293 9.432   -80.982  1.00 20.31 ? 127 THR B OG1 1 
ATOM   3711 C  CG2 . THR B 1 127 ? -13.497 9.898   -80.480  1.00 13.39 ? 127 THR B CG2 1 
ATOM   3712 N  N   . ARG B 1 128 ? -11.384 5.800   -80.640  1.00 27.49 ? 128 ARG B N   1 
ATOM   3713 C  CA  . ARG B 1 128 ? -10.353 4.844   -81.046  1.00 27.02 ? 128 ARG B CA  1 
ATOM   3714 C  C   . ARG B 1 128 ? -9.845  5.128   -82.457  1.00 26.56 ? 128 ARG B C   1 
ATOM   3715 O  O   . ARG B 1 128 ? -10.514 5.765   -83.256  1.00 28.33 ? 128 ARG B O   1 
ATOM   3716 C  CB  . ARG B 1 128 ? -10.891 3.423   -81.009  1.00 25.85 ? 128 ARG B CB  1 
ATOM   3717 C  CG  . ARG B 1 128 ? -11.208 3.008   -79.590  1.00 23.22 ? 128 ARG B CG  1 
ATOM   3718 C  CD  . ARG B 1 128 ? -12.664 3.185   -79.326  1.00 19.16 ? 128 ARG B CD  1 
ATOM   3719 N  NE  . ARG B 1 128 ? -13.306 1.899   -79.431  1.00 21.89 ? 128 ARG B NE  1 
ATOM   3720 C  CZ  . ARG B 1 128 ? -14.610 1.802   -79.723  1.00 26.27 ? 128 ARG B CZ  1 
ATOM   3721 N  NH1 . ARG B 1 128 ? -15.377 2.865   -79.953  1.00 25.02 ? 128 ARG B NH1 1 
ATOM   3722 N  NH2 . ARG B 1 128 ? -15.191 0.599   -79.733  1.00 30.85 ? 128 ARG B NH2 1 
ATOM   3723 N  N   . ARG B 1 129 ? -8.657  4.668   -82.838  1.00 25.00 ? 129 ARG B N   1 
ATOM   3724 C  CA  . ARG B 1 129 ? -8.163  4.919   -84.178  1.00 22.24 ? 129 ARG B CA  1 
ATOM   3725 C  C   . ARG B 1 129 ? -8.026  3.550   -84.836  1.00 25.52 ? 129 ARG B C   1 
ATOM   3726 O  O   . ARG B 1 129 ? -7.210  3.435   -85.756  1.00 27.79 ? 129 ARG B O   1 
ATOM   3727 C  CB  . ARG B 1 129 ? -6.799  5.554   -84.163  1.00 23.22 ? 129 ARG B CB  1 
ATOM   3728 C  CG  . ARG B 1 129 ? -6.691  6.877   -83.463  1.00 29.69 ? 129 ARG B CG  1 
ATOM   3729 C  CD  . ARG B 1 129 ? -7.229  8.021   -84.275  1.00 23.84 ? 129 ARG B CD  1 
ATOM   3730 N  NE  . ARG B 1 129 ? -7.396  9.155   -83.400  1.00 18.46 ? 129 ARG B NE  1 
ATOM   3731 C  CZ  . ARG B 1 129 ? -8.494  9.279   -82.660  1.00 21.53 ? 129 ARG B CZ  1 
ATOM   3732 N  NH1 . ARG B 1 129 ? -9.475  8.378   -82.730  1.00 13.15 ? 129 ARG B NH1 1 
ATOM   3733 N  NH2 . ARG B 1 129 ? -8.575  10.290  -81.802  1.00 18.37 ? 129 ARG B NH2 1 
ATOM   3734 N  N   . PHE B 1 130 ? -8.736  2.478   -84.429  1.00 22.73 ? 130 PHE B N   1 
ATOM   3735 C  CA  . PHE B 1 130 ? -8.501  1.187   -85.052  1.00 22.66 ? 130 PHE B CA  1 
ATOM   3736 C  C   . PHE B 1 130 ? -9.840  0.604   -85.336  1.00 25.38 ? 130 PHE B C   1 
ATOM   3737 O  O   . PHE B 1 130 ? -10.788 0.765   -84.549  1.00 28.31 ? 130 PHE B O   1 
ATOM   3738 C  CB  . PHE B 1 130 ? -7.829  0.126   -84.200  1.00 19.53 ? 130 PHE B CB  1 
ATOM   3739 C  CG  . PHE B 1 130 ? -6.517  0.527   -83.562  1.00 29.31 ? 130 PHE B CG  1 
ATOM   3740 C  CD1 . PHE B 1 130 ? -5.375  0.699   -84.350  1.00 27.21 ? 130 PHE B CD1 1 
ATOM   3741 C  CD2 . PHE B 1 130 ? -6.459  0.702   -82.162  1.00 28.67 ? 130 PHE B CD2 1 
ATOM   3742 C  CE1 . PHE B 1 130 ? -4.168  1.043   -83.738  1.00 27.55 ? 130 PHE B CE1 1 
ATOM   3743 C  CE2 . PHE B 1 130 ? -5.245  1.045   -81.567  1.00 27.18 ? 130 PHE B CE2 1 
ATOM   3744 C  CZ  . PHE B 1 130 ? -4.102  1.218   -82.353  1.00 29.15 ? 130 PHE B CZ  1 
ATOM   3745 N  N   . THR B 1 131 ? -9.824  -0.080  -86.471  1.00 24.24 ? 131 THR B N   1 
ATOM   3746 C  CA  . THR B 1 131 ? -10.965 -0.771  -86.995  1.00 24.86 ? 131 THR B CA  1 
ATOM   3747 C  C   . THR B 1 131 ? -10.543 -2.178  -87.421  1.00 24.35 ? 131 THR B C   1 
ATOM   3748 O  O   . THR B 1 131 ? -9.365  -2.444  -87.714  1.00 23.39 ? 131 THR B O   1 
ATOM   3749 C  CB  . THR B 1 131 ? -11.515 0.098   -88.174  1.00 31.73 ? 131 THR B CB  1 
ATOM   3750 O  OG1 . THR B 1 131 ? -10.475 0.989   -88.654  1.00 32.27 ? 131 THR B OG1 1 
ATOM   3751 C  CG2 . THR B 1 131 ? -12.759 0.839   -87.719  1.00 24.56 ? 131 THR B CG2 1 
ATOM   3752 N  N   . CYS B 1 132 ? -11.463 -3.123  -87.417  1.00 21.98 ? 132 CYS B N   1 
ATOM   3753 C  CA  . CYS B 1 132 ? -11.165 -4.467  -87.835  1.00 25.72 ? 132 CYS B CA  1 
ATOM   3754 C  C   . CYS B 1 132 ? -12.536 -5.063  -88.012  1.00 30.15 ? 132 CYS B C   1 
ATOM   3755 O  O   . CYS B 1 132 ? -13.381 -4.853  -87.146  1.00 32.22 ? 132 CYS B O   1 
ATOM   3756 C  CB  . CYS B 1 132 ? -10.406 -5.176  -86.750  1.00 29.79 ? 132 CYS B CB  1 
ATOM   3757 S  SG  . CYS B 1 132 ? -10.087 -6.937  -86.937  1.00 33.12 ? 132 CYS B SG  1 
ATOM   3758 N  N   . ARG B 1 133 ? -12.824 -5.662  -89.175  1.00 32.42 ? 133 ARG B N   1 
ATOM   3759 C  CA  . ARG B 1 133 ? -14.093 -6.307  -89.483  1.00 33.70 ? 133 ARG B CA  1 
ATOM   3760 C  C   . ARG B 1 133 ? -15.321 -5.464  -89.226  1.00 36.85 ? 133 ARG B C   1 
ATOM   3761 O  O   . ARG B 1 133 ? -16.376 -5.949  -88.809  1.00 38.59 ? 133 ARG B O   1 
ATOM   3762 C  CB  . ARG B 1 133 ? -14.190 -7.597  -88.693  1.00 39.98 ? 133 ARG B CB  1 
ATOM   3763 C  CG  . ARG B 1 133 ? -13.142 -8.571  -89.189  1.00 48.44 ? 133 ARG B CG  1 
ATOM   3764 C  CD  . ARG B 1 133 ? -12.661 -9.396  -88.026  1.00 56.69 ? 133 ARG B CD  1 
ATOM   3765 N  NE  . ARG B 1 133 ? -11.531 -10.173 -88.484  1.00 63.95 ? 133 ARG B NE  1 
ATOM   3766 C  CZ  . ARG B 1 133 ? -11.654 -11.454 -88.839  1.00 69.48 ? 133 ARG B CZ  1 
ATOM   3767 N  NH1 . ARG B 1 133 ? -12.830 -12.104 -88.783  1.00 68.79 ? 133 ARG B NH1 1 
ATOM   3768 N  NH2 . ARG B 1 133 ? -10.573 -12.077 -89.311  1.00 72.65 ? 133 ARG B NH2 1 
ATOM   3769 N  N   . GLY B 1 134 ? -15.218 -4.168  -89.489  1.00 36.43 ? 134 GLY B N   1 
ATOM   3770 C  CA  . GLY B 1 134 ? -16.362 -3.299  -89.308  1.00 38.03 ? 134 GLY B CA  1 
ATOM   3771 C  C   . GLY B 1 134 ? -16.657 -3.056  -87.844  1.00 38.04 ? 134 GLY B C   1 
ATOM   3772 O  O   . GLY B 1 134 ? -17.765 -2.668  -87.445  1.00 38.49 ? 134 GLY B O   1 
ATOM   3773 N  N   . LYS B 1 135 ? -15.608 -3.219  -87.052  1.00 36.78 ? 135 LYS B N   1 
ATOM   3774 C  CA  . LYS B 1 135 ? -15.707 -3.032  -85.629  1.00 34.74 ? 135 LYS B CA  1 
ATOM   3775 C  C   . LYS B 1 135 ? -14.560 -2.172  -85.161  1.00 31.75 ? 135 LYS B C   1 
ATOM   3776 O  O   . LYS B 1 135 ? -13.445 -2.267  -85.687  1.00 34.41 ? 135 LYS B O   1 
ATOM   3777 C  CB  . LYS B 1 135 ? -15.678 -4.394  -84.943  1.00 35.88 ? 135 LYS B CB  1 
ATOM   3778 C  CG  . LYS B 1 135 ? -17.025 -5.048  -85.189  1.00 35.01 ? 135 LYS B CG  1 
ATOM   3779 C  CD  . LYS B 1 135 ? -17.094 -6.515  -84.867  1.00 36.27 ? 135 LYS B CD  1 
ATOM   3780 C  CE  . LYS B 1 135 ? -18.545 -6.903  -85.147  1.00 44.25 ? 135 LYS B CE  1 
ATOM   3781 N  NZ  . LYS B 1 135 ? -19.508 -6.100  -84.385  1.00 43.43 ? 135 LYS B NZ  1 
ATOM   3782 N  N   . PRO B 1 136 ? -14.828 -1.248  -84.241  1.00 28.91 ? 136 PRO B N   1 
ATOM   3783 C  CA  . PRO B 1 136 ? -13.802 -0.447  -83.601  1.00 27.55 ? 136 PRO B CA  1 
ATOM   3784 C  C   . PRO B 1 136 ? -13.181 -1.322  -82.497  1.00 28.85 ? 136 PRO B C   1 
ATOM   3785 O  O   . PRO B 1 136 ? -13.848 -2.064  -81.761  1.00 27.68 ? 136 PRO B O   1 
ATOM   3786 C  CB  . PRO B 1 136 ? -14.590 0.750   -83.161  1.00 26.52 ? 136 PRO B CB  1 
ATOM   3787 C  CG  . PRO B 1 136 ? -15.927 0.158   -82.751  1.00 26.49 ? 136 PRO B CG  1 
ATOM   3788 C  CD  . PRO B 1 136 ? -16.174 -0.935  -83.757  1.00 27.10 ? 136 PRO B CD  1 
ATOM   3789 N  N   . ILE B 1 137 ? -11.863 -1.274  -82.446  1.00 28.74 ? 137 ILE B N   1 
ATOM   3790 C  CA  . ILE B 1 137 ? -11.068 -2.051  -81.524  1.00 29.12 ? 137 ILE B CA  1 
ATOM   3791 C  C   . ILE B 1 137 ? -10.535 -1.020  -80.553  1.00 29.10 ? 137 ILE B C   1 
ATOM   3792 O  O   . ILE B 1 137 ? -10.189 0.107   -80.935  1.00 29.77 ? 137 ILE B O   1 
ATOM   3793 C  CB  . ILE B 1 137 ? -9.899  -2.765  -82.298  1.00 32.65 ? 137 ILE B CB  1 
ATOM   3794 C  CG1 . ILE B 1 137 ? -10.415 -3.651  -83.436  1.00 29.89 ? 137 ILE B CG1 1 
ATOM   3795 C  CG2 . ILE B 1 137 ? -9.120  -3.630  -81.337  1.00 30.79 ? 137 ILE B CG2 1 
ATOM   3796 C  CD1 . ILE B 1 137 ? -11.394 -4.764  -83.013  1.00 30.10 ? 137 ILE B CD1 1 
ATOM   3797 N  N   . HIS B 1 138 ? -10.440 -1.391  -79.278  1.00 30.18 ? 138 HIS B N   1 
ATOM   3798 C  CA  . HIS B 1 138 ? -9.946  -0.436  -78.281  1.00 26.59 ? 138 HIS B CA  1 
ATOM   3799 C  C   . HIS B 1 138 ? -8.441  -0.390  -78.144  1.00 19.97 ? 138 HIS B C   1 
ATOM   3800 O  O   . HIS B 1 138 ? -7.715  -1.315  -78.520  1.00 20.07 ? 138 HIS B O   1 
ATOM   3801 C  CB  . HIS B 1 138 ? -10.456 -0.724  -76.892  1.00 17.97 ? 138 HIS B CB  1 
ATOM   3802 C  CG  . HIS B 1 138 ? -11.942 -0.763  -76.770  1.00 5.29  ? 138 HIS B CG  1 
ATOM   3803 N  ND1 . HIS B 1 138 ? -12.698 -1.850  -76.900  1.00 8.85  ? 138 HIS B ND1 1 
ATOM   3804 C  CD2 . HIS B 1 138 ? -12.737 0.299   -76.426  1.00 8.62  ? 138 HIS B CD2 1 
ATOM   3805 C  CE1 . HIS B 1 138 ? -13.958 -1.507  -76.635  1.00 9.90  ? 138 HIS B CE1 1 
ATOM   3806 N  NE2 . HIS B 1 138 ? -13.961 -0.207  -76.354  1.00 13.91 ? 138 HIS B NE2 1 
ATOM   3807 N  N   . HIS B 1 139 ? -8.031  0.746   -77.608  1.00 15.94 ? 139 HIS B N   1 
ATOM   3808 C  CA  . HIS B 1 139 ? -6.634  0.995   -77.302  1.00 21.30 ? 139 HIS B CA  1 
ATOM   3809 C  C   . HIS B 1 139 ? -6.323  0.511   -75.874  1.00 24.19 ? 139 HIS B C   1 
ATOM   3810 O  O   . HIS B 1 139 ? -7.243  0.246   -75.095  1.00 25.39 ? 139 HIS B O   1 
ATOM   3811 C  CB  . HIS B 1 139 ? -6.303  2.470   -77.332  1.00 22.11 ? 139 HIS B CB  1 
ATOM   3812 C  CG  . HIS B 1 139 ? -6.307  3.136   -78.690  1.00 27.20 ? 139 HIS B CG  1 
ATOM   3813 N  ND1 . HIS B 1 139 ? -5.222  3.555   -79.330  1.00 24.95 ? 139 HIS B ND1 1 
ATOM   3814 C  CD2 . HIS B 1 139 ? -7.427  3.468   -79.430  1.00 25.00 ? 139 HIS B CD2 1 
ATOM   3815 C  CE1 . HIS B 1 139 ? -5.621  4.149   -80.421  1.00 26.83 ? 139 HIS B CE1 1 
ATOM   3816 N  NE2 . HIS B 1 139 ? -6.949  4.089   -80.475  1.00 26.28 ? 139 HIS B NE2 1 
ATOM   3817 N  N   . PHE B 1 140 ? -5.058  0.411   -75.464  1.00 25.43 ? 140 PHE B N   1 
ATOM   3818 C  CA  . PHE B 1 140 ? -4.661  -0.009  -74.137  1.00 21.93 ? 140 PHE B CA  1 
ATOM   3819 C  C   . PHE B 1 140 ? -3.575  0.969   -73.769  1.00 21.42 ? 140 PHE B C   1 
ATOM   3820 O  O   . PHE B 1 140 ? -2.532  1.092   -74.431  1.00 18.02 ? 140 PHE B O   1 
ATOM   3821 C  CB  . PHE B 1 140 ? -4.087  -1.398  -74.132  1.00 21.48 ? 140 PHE B CB  1 
ATOM   3822 C  CG  . PHE B 1 140 ? -3.517  -1.933  -72.814  1.00 29.29 ? 140 PHE B CG  1 
ATOM   3823 C  CD1 . PHE B 1 140 ? -4.361  -2.265  -71.741  1.00 29.24 ? 140 PHE B CD1 1 
ATOM   3824 C  CD2 . PHE B 1 140 ? -2.128  -2.136  -72.689  1.00 30.83 ? 140 PHE B CD2 1 
ATOM   3825 C  CE1 . PHE B 1 140 ? -3.813  -2.794  -70.573  1.00 26.07 ? 140 PHE B CE1 1 
ATOM   3826 C  CE2 . PHE B 1 140 ? -1.593  -2.664  -71.513  1.00 28.76 ? 140 PHE B CE2 1 
ATOM   3827 C  CZ  . PHE B 1 140 ? -2.440  -2.992  -70.459  1.00 29.51 ? 140 PHE B CZ  1 
ATOM   3828 N  N   . LEU B 1 141 ? -3.944  1.665   -72.683  1.00 18.59 ? 141 LEU B N   1 
ATOM   3829 C  CA  . LEU B 1 141 ? -3.136  2.688   -72.047  1.00 19.56 ? 141 LEU B CA  1 
ATOM   3830 C  C   . LEU B 1 141 ? -2.683  3.795   -72.981  1.00 19.98 ? 141 LEU B C   1 
ATOM   3831 O  O   . LEU B 1 141 ? -1.589  4.341   -72.836  1.00 18.60 ? 141 LEU B O   1 
ATOM   3832 C  CB  . LEU B 1 141 ? -1.906  2.027   -71.365  1.00 22.78 ? 141 LEU B CB  1 
ATOM   3833 C  CG  . LEU B 1 141 ? -2.138  0.896   -70.317  1.00 22.87 ? 141 LEU B CG  1 
ATOM   3834 C  CD1 . LEU B 1 141 ? -0.834  0.650   -69.603  1.00 20.83 ? 141 LEU B CD1 1 
ATOM   3835 C  CD2 . LEU B 1 141 ? -3.229  1.249   -69.311  1.00 21.44 ? 141 LEU B CD2 1 
ATOM   3836 N  N   . GLY B 1 142 ? -3.540  4.070   -73.982  1.00 20.75 ? 142 GLY B N   1 
ATOM   3837 C  CA  . GLY B 1 142 ? -3.341  5.059   -75.037  1.00 19.80 ? 142 GLY B CA  1 
ATOM   3838 C  C   . GLY B 1 142 ? -2.069  4.778   -75.820  1.00 22.73 ? 142 GLY B C   1 
ATOM   3839 O  O   . GLY B 1 142 ? -1.486  5.694   -76.386  1.00 24.07 ? 142 GLY B O   1 
ATOM   3840 N  N   . THR B 1 143 ? -1.569  3.545   -75.881  1.00 24.82 ? 143 THR B N   1 
ATOM   3841 C  CA  . THR B 1 143 ? -0.333  3.243   -76.589  1.00 27.83 ? 143 THR B CA  1 
ATOM   3842 C  C   . THR B 1 143 ? -0.460  2.174   -77.668  1.00 26.59 ? 143 THR B C   1 
ATOM   3843 O  O   . THR B 1 143 ? 0.201   2.291   -78.690  1.00 26.10 ? 143 THR B O   1 
ATOM   3844 C  CB  . THR B 1 143 ? 0.739   2.763   -75.614  1.00 25.12 ? 143 THR B CB  1 
ATOM   3845 O  OG1 . THR B 1 143 ? 0.018   1.858   -74.779  1.00 28.12 ? 143 THR B OG1 1 
ATOM   3846 C  CG2 . THR B 1 143 ? 1.461   3.847   -74.876  1.00 17.85 ? 143 THR B CG2 1 
ATOM   3847 N  N   . SER B 1 144 ? -1.198  1.108   -77.336  1.00 25.27 ? 144 SER B N   1 
ATOM   3848 C  CA  . SER B 1 144 ? -1.463  -0.061  -78.135  1.00 21.40 ? 144 SER B CA  1 
ATOM   3849 C  C   . SER B 1 144 ? -0.334  -0.529  -79.037  1.00 22.28 ? 144 SER B C   1 
ATOM   3850 O  O   . SER B 1 144 ? -0.573  -0.915  -80.180  1.00 28.21 ? 144 SER B O   1 
ATOM   3851 C  CB  . SER B 1 144 ? -2.714  0.240   -78.903  1.00 25.90 ? 144 SER B CB  1 
ATOM   3852 O  OG  . SER B 1 144 ? -3.840  0.168   -78.036  1.00 26.27 ? 144 SER B OG  1 
ATOM   3853 N  N   . THR B 1 145 ? 0.910   -0.602  -78.584  1.00 17.92 ? 145 THR B N   1 
ATOM   3854 C  CA  . THR B 1 145 ? 1.976   -1.003  -79.453  1.00 19.12 ? 145 THR B CA  1 
ATOM   3855 C  C   . THR B 1 145 ? 1.987   -2.450  -80.006  1.00 20.67 ? 145 THR B C   1 
ATOM   3856 O  O   . THR B 1 145 ? 3.030   -2.873  -80.502  1.00 21.22 ? 145 THR B O   1 
ATOM   3857 C  CB  . THR B 1 145 ? 3.278   -0.653  -78.707  1.00 17.18 ? 145 THR B CB  1 
ATOM   3858 O  OG1 . THR B 1 145 ? 3.383   -1.524  -77.602  1.00 25.67 ? 145 THR B OG1 1 
ATOM   3859 C  CG2 . THR B 1 145 ? 3.300   0.770   -78.207  1.00 17.20 ? 145 THR B CG2 1 
ATOM   3860 N  N   . PHE B 1 146 ? 0.980   -3.320  -79.979  1.00 21.84 ? 146 PHE B N   1 
ATOM   3861 C  CA  . PHE B 1 146 ? 1.101   -4.652  -80.590  1.00 28.12 ? 146 PHE B CA  1 
ATOM   3862 C  C   . PHE B 1 146 ? 0.429   -4.543  -81.987  1.00 33.30 ? 146 PHE B C   1 
ATOM   3863 O  O   . PHE B 1 146 ? -0.508  -5.265  -82.407  1.00 29.02 ? 146 PHE B O   1 
ATOM   3864 C  CB  . PHE B 1 146 ? 0.369   -5.693  -79.740  1.00 31.48 ? 146 PHE B CB  1 
ATOM   3865 C  CG  . PHE B 1 146 ? 1.042   -6.218  -78.473  1.00 35.13 ? 146 PHE B CG  1 
ATOM   3866 C  CD1 . PHE B 1 146 ? 2.411   -6.103  -78.244  1.00 35.03 ? 146 PHE B CD1 1 
ATOM   3867 C  CD2 . PHE B 1 146 ? 0.258   -6.902  -77.535  1.00 36.60 ? 146 PHE B CD2 1 
ATOM   3868 C  CE1 . PHE B 1 146 ? 2.975   -6.671  -77.092  1.00 32.66 ? 146 PHE B CE1 1 
ATOM   3869 C  CE2 . PHE B 1 146 ? 0.830   -7.464  -76.395  1.00 28.05 ? 146 PHE B CE2 1 
ATOM   3870 C  CZ  . PHE B 1 146 ? 2.188   -7.352  -76.173  1.00 26.76 ? 146 PHE B CZ  1 
ATOM   3871 N  N   . SER B 1 147 ? 0.935   -3.594  -82.764  1.00 33.43 ? 147 SER B N   1 
ATOM   3872 C  CA  . SER B 1 147 ? 0.381   -3.299  -84.069  1.00 34.08 ? 147 SER B CA  1 
ATOM   3873 C  C   . SER B 1 147 ? 1.552   -2.700  -84.798  1.00 31.81 ? 147 SER B C   1 
ATOM   3874 O  O   . SER B 1 147 ? 2.403   -2.093  -84.138  1.00 25.02 ? 147 SER B O   1 
ATOM   3875 C  CB  . SER B 1 147 ? -0.751  -2.279  -83.938  1.00 34.88 ? 147 SER B CB  1 
ATOM   3876 O  OG  . SER B 1 147 ? -1.526  -2.144  -85.117  1.00 35.44 ? 147 SER B OG  1 
ATOM   3877 N  N   . GLN B 1 148 ? 1.626   -2.895  -86.131  1.00 31.18 ? 148 GLN B N   1 
ATOM   3878 C  CA  . GLN B 1 148 ? 2.745   -2.340  -86.894  1.00 28.34 ? 148 GLN B CA  1 
ATOM   3879 C  C   . GLN B 1 148 ? 2.769   -0.812  -86.855  1.00 22.74 ? 148 GLN B C   1 
ATOM   3880 O  O   . GLN B 1 148 ? 3.816   -0.151  -86.917  1.00 19.92 ? 148 GLN B O   1 
ATOM   3881 C  CB  . GLN B 1 148 ? 2.656   -2.844  -88.333  1.00 35.12 ? 148 GLN B CB  1 
ATOM   3882 C  CG  . GLN B 1 148 ? 3.024   -4.324  -88.467  1.00 42.01 ? 148 GLN B CG  1 
ATOM   3883 C  CD  . GLN B 1 148 ? 2.460   -5.047  -89.688  1.00 44.94 ? 148 GLN B CD  1 
ATOM   3884 O  OE1 . GLN B 1 148 ? 1.496   -4.605  -90.300  1.00 41.87 ? 148 GLN B OE1 1 
ATOM   3885 N  NE2 . GLN B 1 148 ? 2.948   -6.214  -90.082  1.00 45.18 ? 148 GLN B NE2 1 
ATOM   3886 N  N   . TYR B 1 149 ? 1.594   -0.233  -86.711  1.00 21.57 ? 149 TYR B N   1 
ATOM   3887 C  CA  . TYR B 1 149 ? 1.445   1.201   -86.642  1.00 22.73 ? 149 TYR B CA  1 
ATOM   3888 C  C   . TYR B 1 149 ? 0.471   1.512   -85.518  1.00 21.93 ? 149 TYR B C   1 
ATOM   3889 O  O   . TYR B 1 149 ? -0.506  0.767   -85.334  1.00 21.43 ? 149 TYR B O   1 
ATOM   3890 C  CB  . TYR B 1 149 ? 0.861   1.728   -87.957  1.00 32.81 ? 149 TYR B CB  1 
ATOM   3891 C  CG  . TYR B 1 149 ? 1.829   1.819   -89.115  1.00 30.49 ? 149 TYR B CG  1 
ATOM   3892 C  CD1 . TYR B 1 149 ? 2.581   2.980   -89.211  1.00 34.63 ? 149 TYR B CD1 1 
ATOM   3893 C  CD2 . TYR B 1 149 ? 1.967   0.785   -90.046  1.00 33.77 ? 149 TYR B CD2 1 
ATOM   3894 C  CE1 . TYR B 1 149 ? 3.488   3.134   -90.250  1.00 43.19 ? 149 TYR B CE1 1 
ATOM   3895 C  CE2 . TYR B 1 149 ? 2.880   0.935   -91.093  1.00 38.85 ? 149 TYR B CE2 1 
ATOM   3896 C  CZ  . TYR B 1 149 ? 3.633   2.114   -91.185  1.00 41.85 ? 149 TYR B CZ  1 
ATOM   3897 O  OH  . TYR B 1 149 ? 4.537   2.316   -92.207  1.00 46.00 ? 149 TYR B OH  1 
ATOM   3898 N  N   . THR B 1 150 ? 0.660   2.575   -84.764  1.00 21.44 ? 150 THR B N   1 
ATOM   3899 C  CA  . THR B 1 150 ? -0.331  2.920   -83.737  1.00 23.70 ? 150 THR B CA  1 
ATOM   3900 C  C   . THR B 1 150 ? -0.388  4.438   -83.668  1.00 24.94 ? 150 THR B C   1 
ATOM   3901 O  O   . THR B 1 150 ? 0.558   5.161   -84.040  1.00 22.69 ? 150 THR B O   1 
ATOM   3902 C  CB  . THR B 1 150 ? 0.057   2.326   -82.303  1.00 24.74 ? 150 THR B CB  1 
ATOM   3903 O  OG1 . THR B 1 150 ? -1.069  2.539   -81.450  1.00 19.19 ? 150 THR B OG1 1 
ATOM   3904 C  CG2 . THR B 1 150 ? 1.352   2.943   -81.709  1.00 12.66 ? 150 THR B CG2 1 
ATOM   3905 N  N   . VAL B 1 151 ? -1.520  4.956   -83.235  1.00 29.37 ? 151 VAL B N   1 
ATOM   3906 C  CA  . VAL B 1 151 ? -1.606  6.406   -83.081  1.00 33.97 ? 151 VAL B CA  1 
ATOM   3907 C  C   . VAL B 1 151 ? -1.591  6.681   -81.562  1.00 33.58 ? 151 VAL B C   1 
ATOM   3908 O  O   . VAL B 1 151 ? -2.312  6.013   -80.798  1.00 34.13 ? 151 VAL B O   1 
ATOM   3909 C  CB  . VAL B 1 151 ? -2.910  6.969   -83.708  1.00 35.97 ? 151 VAL B CB  1 
ATOM   3910 C  CG1 . VAL B 1 151 ? -2.782  8.482   -83.765  1.00 34.35 ? 151 VAL B CG1 1 
ATOM   3911 C  CG2 . VAL B 1 151 ? -3.156  6.416   -85.096  1.00 33.15 ? 151 VAL B CG2 1 
ATOM   3912 N  N   . VAL B 1 152 ? -0.758  7.581   -81.050  1.00 29.76 ? 152 VAL B N   1 
ATOM   3913 C  CA  . VAL B 1 152 ? -0.755  7.872   -79.635  1.00 30.13 ? 152 VAL B CA  1 
ATOM   3914 C  C   . VAL B 1 152 ? -0.866  9.383   -79.464  1.00 28.23 ? 152 VAL B C   1 
ATOM   3915 O  O   . VAL B 1 152 ? -0.414  10.104  -80.351  1.00 25.31 ? 152 VAL B O   1 
ATOM   3916 C  CB  . VAL B 1 152 ? 0.560   7.368   -78.917  1.00 29.15 ? 152 VAL B CB  1 
ATOM   3917 C  CG1 . VAL B 1 152 ? 0.815   5.925   -79.315  1.00 30.86 ? 152 VAL B CG1 1 
ATOM   3918 C  CG2 . VAL B 1 152 ? 1.780   8.216   -79.276  1.00 30.40 ? 152 VAL B CG2 1 
ATOM   3919 N  N   . ASP B 1 153 ? -1.455  9.916   -78.382  1.00 27.81 ? 153 ASP B N   1 
ATOM   3920 C  CA  . ASP B 1 153 ? -1.501  11.360  -78.148  1.00 24.84 ? 153 ASP B CA  1 
ATOM   3921 C  C   . ASP B 1 153 ? -0.076  11.848  -77.986  1.00 22.62 ? 153 ASP B C   1 
ATOM   3922 O  O   . ASP B 1 153 ? 0.798   11.105  -77.537  1.00 23.29 ? 153 ASP B O   1 
ATOM   3923 C  CB  . ASP B 1 153 ? -2.241  11.713  -76.889  1.00 20.55 ? 153 ASP B CB  1 
ATOM   3924 C  CG  . ASP B 1 153 ? -3.741  11.527  -77.025  1.00 26.94 ? 153 ASP B CG  1 
ATOM   3925 O  OD1 . ASP B 1 153 ? -4.402  12.421  -77.575  1.00 29.78 ? 153 ASP B OD1 1 
ATOM   3926 O  OD2 . ASP B 1 153 ? -4.247  10.503  -76.559  1.00 26.28 ? 153 ASP B OD2 1 
ATOM   3927 N  N   . GLU B 1 154 ? 0.161   13.114  -78.272  1.00 25.22 ? 154 GLU B N   1 
ATOM   3928 C  CA  . GLU B 1 154 ? 1.494   13.700  -78.263  1.00 26.13 ? 154 GLU B CA  1 
ATOM   3929 C  C   . GLU B 1 154 ? 2.167   13.687  -76.907  1.00 26.11 ? 154 GLU B C   1 
ATOM   3930 O  O   . GLU B 1 154 ? 3.330   13.308  -76.796  1.00 30.11 ? 154 GLU B O   1 
ATOM   3931 C  CB  . GLU B 1 154 ? 1.383   15.132  -78.803  1.00 27.37 ? 154 GLU B CB  1 
ATOM   3932 C  CG  . GLU B 1 154 ? 2.723   15.803  -79.126  1.00 24.57 ? 154 GLU B CG  1 
ATOM   3933 C  CD  . GLU B 1 154 ? 2.665   17.312  -79.311  1.00 25.36 ? 154 GLU B CD  1 
ATOM   3934 O  OE1 . GLU B 1 154 ? 1.576   17.898  -79.381  1.00 27.70 ? 154 GLU B OE1 1 
ATOM   3935 O  OE2 . GLU B 1 154 ? 3.736   17.914  -79.375  1.00 23.17 ? 154 GLU B OE2 1 
ATOM   3936 N  N   . ASN B 1 155 ? 1.431   14.037  -75.837  1.00 26.67 ? 155 ASN B N   1 
ATOM   3937 C  CA  . ASN B 1 155 ? 1.967   14.070  -74.455  1.00 20.67 ? 155 ASN B CA  1 
ATOM   3938 C  C   . ASN B 1 155 ? 2.409   12.705  -73.928  1.00 23.61 ? 155 ASN B C   1 
ATOM   3939 O  O   . ASN B 1 155 ? 3.126   12.607  -72.927  1.00 30.17 ? 155 ASN B O   1 
ATOM   3940 C  CB  . ASN B 1 155 ? 0.934   14.636  -73.502  1.00 8.77  ? 155 ASN B CB  1 
ATOM   3941 C  CG  . ASN B 1 155 ? -0.380  13.896  -73.503  1.00 14.19 ? 155 ASN B CG  1 
ATOM   3942 O  OD1 . ASN B 1 155 ? -0.429  12.739  -73.899  1.00 17.52 ? 155 ASN B OD1 1 
ATOM   3943 N  ND2 . ASN B 1 155 ? -1.533  14.456  -73.146  1.00 4.29  ? 155 ASN B ND2 1 
ATOM   3944 N  N   . ALA B 1 156 ? 1.926   11.648  -74.592  1.00 18.95 ? 156 ALA B N   1 
ATOM   3945 C  CA  . ALA B 1 156 ? 2.225   10.272  -74.323  1.00 13.34 ? 156 ALA B CA  1 
ATOM   3946 C  C   . ALA B 1 156 ? 3.344   9.792   -75.262  1.00 18.31 ? 156 ALA B C   1 
ATOM   3947 O  O   . ALA B 1 156 ? 3.399   8.582   -75.532  1.00 16.17 ? 156 ALA B O   1 
ATOM   3948 C  CB  . ALA B 1 156 ? 0.947   9.484   -74.542  1.00 8.25  ? 156 ALA B CB  1 
ATOM   3949 N  N   . VAL B 1 157 ? 4.279   10.606  -75.793  1.00 19.64 ? 157 VAL B N   1 
ATOM   3950 C  CA  . VAL B 1 157 ? 5.300   10.084  -76.693  1.00 22.29 ? 157 VAL B CA  1 
ATOM   3951 C  C   . VAL B 1 157 ? 6.578   10.880  -76.493  1.00 23.63 ? 157 VAL B C   1 
ATOM   3952 O  O   . VAL B 1 157 ? 6.561   12.118  -76.424  1.00 24.34 ? 157 VAL B O   1 
ATOM   3953 C  CB  . VAL B 1 157 ? 4.736   10.150  -78.207  1.00 29.08 ? 157 VAL B CB  1 
ATOM   3954 C  CG1 . VAL B 1 157 ? 4.888   11.513  -78.871  1.00 29.62 ? 157 VAL B CG1 1 
ATOM   3955 C  CG2 . VAL B 1 157 ? 5.516   9.175   -79.067  1.00 24.81 ? 157 VAL B CG2 1 
ATOM   3956 N  N   . ALA B 1 158 ? 7.719   10.196  -76.396  1.00 24.33 ? 158 ALA B N   1 
ATOM   3957 C  CA  . ALA B 1 158 ? 8.961   10.900  -76.155  1.00 27.98 ? 158 ALA B CA  1 
ATOM   3958 C  C   . ALA B 1 158 ? 9.915   10.797  -77.316  1.00 33.19 ? 158 ALA B C   1 
ATOM   3959 O  O   . ALA B 1 158 ? 10.039  9.739   -77.945  1.00 36.06 ? 158 ALA B O   1 
ATOM   3960 C  CB  . ALA B 1 158 ? 9.679   10.343  -74.943  1.00 28.54 ? 158 ALA B CB  1 
ATOM   3961 N  N   . LYS B 1 159 ? 10.630  11.885  -77.569  1.00 35.39 ? 159 LYS B N   1 
ATOM   3962 C  CA  . LYS B 1 159 ? 11.570  11.891  -78.656  1.00 39.75 ? 159 LYS B CA  1 
ATOM   3963 C  C   . LYS B 1 159 ? 12.856  11.432  -78.007  1.00 39.77 ? 159 LYS B C   1 
ATOM   3964 O  O   . LYS B 1 159 ? 13.439  12.142  -77.179  1.00 39.48 ? 159 LYS B O   1 
ATOM   3965 C  CB  . LYS B 1 159 ? 11.709  13.303  -79.222  1.00 44.95 ? 159 LYS B CB  1 
ATOM   3966 C  CG  . LYS B 1 159 ? 12.442  13.259  -80.559  1.00 48.73 ? 159 LYS B CG  1 
ATOM   3967 C  CD  . LYS B 1 159 ? 13.669  14.159  -80.595  1.00 53.29 ? 159 LYS B CD  1 
ATOM   3968 C  CE  . LYS B 1 159 ? 13.280  15.631  -80.671  1.00 58.56 ? 159 LYS B CE  1 
ATOM   3969 N  NZ  . LYS B 1 159 ? 14.471  16.466  -80.642  1.00 59.57 ? 159 LYS B NZ  1 
ATOM   3970 N  N   . ILE B 1 160 ? 13.255  10.210  -78.310  1.00 41.33 ? 160 ILE B N   1 
ATOM   3971 C  CA  . ILE B 1 160 ? 14.476  9.702   -77.725  1.00 44.04 ? 160 ILE B CA  1 
ATOM   3972 C  C   . ILE B 1 160 ? 15.623  9.966   -78.678  1.00 49.63 ? 160 ILE B C   1 
ATOM   3973 O  O   . ILE B 1 160 ? 15.470  10.587  -79.733  1.00 50.97 ? 160 ILE B O   1 
ATOM   3974 C  CB  . ILE B 1 160 ? 14.317  8.193   -77.398  1.00 41.46 ? 160 ILE B CB  1 
ATOM   3975 C  CG1 . ILE B 1 160 ? 13.947  7.334   -78.573  1.00 42.90 ? 160 ILE B CG1 1 
ATOM   3976 C  CG2 . ILE B 1 160 ? 13.216  8.105   -76.360  1.00 40.94 ? 160 ILE B CG2 1 
ATOM   3977 C  CD1 . ILE B 1 160 ? 15.129  6.555   -79.141  1.00 45.61 ? 160 ILE B CD1 1 
ATOM   3978 N  N   . ASP B 1 161 ? 16.813  9.476   -78.354  1.00 55.66 ? 161 ASP B N   1 
ATOM   3979 C  CA  . ASP B 1 161 ? 17.989  9.728   -79.168  1.00 57.54 ? 161 ASP B CA  1 
ATOM   3980 C  C   . ASP B 1 161 ? 18.008  9.095   -80.561  1.00 56.80 ? 161 ASP B C   1 
ATOM   3981 O  O   . ASP B 1 161 ? 18.020  7.880   -80.757  1.00 56.17 ? 161 ASP B O   1 
ATOM   3982 C  CB  . ASP B 1 161 ? 19.218  9.284   -78.357  1.00 57.94 ? 161 ASP B CB  1 
ATOM   3983 C  CG  . ASP B 1 161 ? 20.542  9.629   -79.010  1.00 60.42 ? 161 ASP B CG  1 
ATOM   3984 O  OD1 . ASP B 1 161 ? 21.039  10.732  -78.791  1.00 64.08 ? 161 ASP B OD1 1 
ATOM   3985 O  OD2 . ASP B 1 161 ? 21.076  8.792   -79.733  1.00 61.93 ? 161 ASP B OD2 1 
ATOM   3986 N  N   . ALA B 1 162 ? 18.134  9.990   -81.537  1.00 56.45 ? 162 ALA B N   1 
ATOM   3987 C  CA  . ALA B 1 162 ? 18.226  9.669   -82.957  1.00 54.80 ? 162 ALA B CA  1 
ATOM   3988 C  C   . ALA B 1 162 ? 19.064  8.437   -83.330  1.00 53.43 ? 162 ALA B C   1 
ATOM   3989 O  O   . ALA B 1 162 ? 18.802  7.759   -84.320  1.00 53.06 ? 162 ALA B O   1 
ATOM   3990 C  CB  . ALA B 1 162 ? 18.794  10.886  -83.670  1.00 52.41 ? 162 ALA B CB  1 
ATOM   3991 N  N   . ALA B 1 163 ? 20.079  8.129   -82.536  1.00 50.81 ? 163 ALA B N   1 
ATOM   3992 C  CA  . ALA B 1 163 ? 20.937  7.000   -82.771  1.00 50.11 ? 163 ALA B CA  1 
ATOM   3993 C  C   . ALA B 1 163 ? 20.736  6.037   -81.600  1.00 52.41 ? 163 ALA B C   1 
ATOM   3994 O  O   . ALA B 1 163 ? 21.632  5.870   -80.763  1.00 53.43 ? 163 ALA B O   1 
ATOM   3995 C  CB  . ALA B 1 163 ? 22.356  7.523   -82.825  1.00 51.16 ? 163 ALA B CB  1 
ATOM   3996 N  N   . SER B 1 164 ? 19.558  5.430   -81.459  1.00 49.81 ? 164 SER B N   1 
ATOM   3997 C  CA  . SER B 1 164 ? 19.325  4.513   -80.363  1.00 47.59 ? 164 SER B CA  1 
ATOM   3998 C  C   . SER B 1 164 ? 18.965  3.131   -80.853  1.00 45.48 ? 164 SER B C   1 
ATOM   3999 O  O   . SER B 1 164 ? 18.169  3.019   -81.787  1.00 47.12 ? 164 SER B O   1 
ATOM   4000 C  CB  . SER B 1 164 ? 18.193  4.997   -79.481  1.00 47.25 ? 164 SER B CB  1 
ATOM   4001 O  OG  . SER B 1 164 ? 18.545  6.193   -78.823  1.00 48.05 ? 164 SER B OG  1 
ATOM   4002 N  N   . PRO B 1 165 ? 19.471  2.044   -80.262  1.00 43.26 ? 165 PRO B N   1 
ATOM   4003 C  CA  . PRO B 1 165 ? 19.173  0.687   -80.689  1.00 42.65 ? 165 PRO B CA  1 
ATOM   4004 C  C   . PRO B 1 165 ? 17.725  0.447   -80.324  1.00 44.73 ? 165 PRO B C   1 
ATOM   4005 O  O   . PRO B 1 165 ? 17.450  -0.017  -79.214  1.00 49.52 ? 165 PRO B O   1 
ATOM   4006 C  CB  . PRO B 1 165 ? 20.169  -0.166  -79.924  1.00 42.93 ? 165 PRO B CB  1 
ATOM   4007 C  CG  . PRO B 1 165 ? 21.258  0.806   -79.511  1.00 42.73 ? 165 PRO B CG  1 
ATOM   4008 C  CD  . PRO B 1 165 ? 20.459  2.057   -79.190  1.00 41.62 ? 165 PRO B CD  1 
ATOM   4009 N  N   . LEU B 1 166 ? 16.763  0.662   -81.209  1.00 43.30 ? 166 LEU B N   1 
ATOM   4010 C  CA  . LEU B 1 166 ? 15.354  0.516   -80.871  1.00 42.01 ? 166 LEU B CA  1 
ATOM   4011 C  C   . LEU B 1 166 ? 14.878  -0.845  -80.416  1.00 43.26 ? 166 LEU B C   1 
ATOM   4012 O  O   . LEU B 1 166 ? 13.755  -0.994  -79.935  1.00 41.36 ? 166 LEU B O   1 
ATOM   4013 C  CB  . LEU B 1 166 ? 14.495  0.946   -82.049  1.00 39.69 ? 166 LEU B CB  1 
ATOM   4014 C  CG  . LEU B 1 166 ? 14.673  2.354   -82.595  1.00 39.39 ? 166 LEU B CG  1 
ATOM   4015 C  CD1 . LEU B 1 166 ? 13.465  2.701   -83.446  1.00 38.93 ? 166 LEU B CD1 1 
ATOM   4016 C  CD2 . LEU B 1 166 ? 14.784  3.366   -81.467  1.00 40.32 ? 166 LEU B CD2 1 
ATOM   4017 N  N   . GLU B 1 167 ? 15.770  -1.825  -80.505  1.00 43.95 ? 167 GLU B N   1 
ATOM   4018 C  CA  . GLU B 1 167 ? 15.484  -3.200  -80.112  1.00 45.66 ? 167 GLU B CA  1 
ATOM   4019 C  C   . GLU B 1 167 ? 15.878  -3.442  -78.653  1.00 43.03 ? 167 GLU B C   1 
ATOM   4020 O  O   . GLU B 1 167 ? 15.578  -4.475  -78.054  1.00 41.25 ? 167 GLU B O   1 
ATOM   4021 C  CB  . GLU B 1 167 ? 16.271  -4.184  -80.992  1.00 48.80 ? 167 GLU B CB  1 
ATOM   4022 C  CG  . GLU B 1 167 ? 16.389  -3.893  -82.502  1.00 55.69 ? 167 GLU B CG  1 
ATOM   4023 C  CD  . GLU B 1 167 ? 17.293  -2.722  -82.912  1.00 57.31 ? 167 GLU B CD  1 
ATOM   4024 O  OE1 . GLU B 1 167 ? 18.318  -2.477  -82.257  1.00 56.69 ? 167 GLU B OE1 1 
ATOM   4025 O  OE2 . GLU B 1 167 ? 16.948  -2.055  -83.893  1.00 55.55 ? 167 GLU B OE2 1 
ATOM   4026 N  N   . LYS B 1 168 ? 16.671  -2.499  -78.142  1.00 38.94 ? 168 LYS B N   1 
ATOM   4027 C  CA  . LYS B 1 168 ? 17.170  -2.531  -76.794  1.00 36.97 ? 168 LYS B CA  1 
ATOM   4028 C  C   . LYS B 1 168 ? 16.381  -1.471  -76.032  1.00 39.28 ? 168 LYS B C   1 
ATOM   4029 O  O   . LYS B 1 168 ? 15.467  -1.777  -75.252  1.00 41.19 ? 168 LYS B O   1 
ATOM   4030 C  CB  . LYS B 1 168 ? 18.658  -2.225  -76.811  1.00 34.10 ? 168 LYS B CB  1 
ATOM   4031 C  CG  . LYS B 1 168 ? 19.433  -3.339  -77.484  1.00 35.58 ? 168 LYS B CG  1 
ATOM   4032 C  CD  . LYS B 1 168 ? 20.917  -3.167  -77.199  1.00 41.63 ? 168 LYS B CD  1 
ATOM   4033 C  CE  . LYS B 1 168 ? 21.788  -4.223  -77.881  1.00 45.09 ? 168 LYS B CE  1 
ATOM   4034 N  NZ  . LYS B 1 168 ? 21.336  -5.586  -77.624  1.00 51.38 ? 168 LYS B NZ  1 
ATOM   4035 N  N   . VAL B 1 169 ? 16.662  -0.199  -76.337  1.00 36.89 ? 169 VAL B N   1 
ATOM   4036 C  CA  . VAL B 1 169 ? 16.027  0.973   -75.757  1.00 32.65 ? 169 VAL B CA  1 
ATOM   4037 C  C   . VAL B 1 169 ? 14.517  0.806   -75.550  1.00 31.69 ? 169 VAL B C   1 
ATOM   4038 O  O   . VAL B 1 169 ? 13.985  1.466   -74.662  1.00 32.82 ? 169 VAL B O   1 
ATOM   4039 C  CB  . VAL B 1 169 ? 16.400  2.171   -76.715  1.00 33.50 ? 169 VAL B CB  1 
ATOM   4040 C  CG1 . VAL B 1 169 ? 15.552  3.399   -76.547  1.00 35.40 ? 169 VAL B CG1 1 
ATOM   4041 C  CG2 . VAL B 1 169 ? 17.779  2.682   -76.342  1.00 27.43 ? 169 VAL B CG2 1 
ATOM   4042 N  N   . CYS B 1 170 ? 13.747  -0.082  -76.194  1.00 31.30 ? 170 CYS B N   1 
ATOM   4043 C  CA  . CYS B 1 170 ? 12.324  -0.107  -75.915  1.00 30.75 ? 170 CYS B CA  1 
ATOM   4044 C  C   . CYS B 1 170 ? 11.975  -0.549  -74.493  1.00 32.88 ? 170 CYS B C   1 
ATOM   4045 O  O   . CYS B 1 170 ? 10.881  -0.245  -73.995  1.00 34.18 ? 170 CYS B O   1 
ATOM   4046 C  CB  . CYS B 1 170 ? 11.642  -0.985  -76.934  1.00 24.51 ? 170 CYS B CB  1 
ATOM   4047 S  SG  . CYS B 1 170 ? 12.008  -2.736  -77.006  1.00 35.88 ? 170 CYS B SG  1 
ATOM   4048 N  N   . LEU B 1 171 ? 12.889  -1.230  -73.778  1.00 33.05 ? 171 LEU B N   1 
ATOM   4049 C  CA  . LEU B 1 171 ? 12.650  -1.623  -72.385  1.00 30.91 ? 171 LEU B CA  1 
ATOM   4050 C  C   . LEU B 1 171 ? 12.468  -0.372  -71.505  1.00 23.15 ? 171 LEU B C   1 
ATOM   4051 O  O   . LEU B 1 171 ? 11.625  -0.374  -70.600  1.00 20.65 ? 171 LEU B O   1 
ATOM   4052 C  CB  . LEU B 1 171 ? 13.817  -2.474  -71.835  1.00 31.63 ? 171 LEU B CB  1 
ATOM   4053 C  CG  . LEU B 1 171 ? 14.013  -3.849  -72.449  1.00 31.91 ? 171 LEU B CG  1 
ATOM   4054 C  CD1 . LEU B 1 171 ? 14.978  -4.663  -71.613  1.00 32.53 ? 171 LEU B CD1 1 
ATOM   4055 C  CD2 . LEU B 1 171 ? 12.689  -4.582  -72.469  1.00 37.66 ? 171 LEU B CD2 1 
ATOM   4056 N  N   . ILE B 1 172 ? 13.164  0.718   -71.823  1.00 17.27 ? 172 ILE B N   1 
ATOM   4057 C  CA  . ILE B 1 172 ? 13.008  1.946   -71.096  1.00 20.54 ? 172 ILE B CA  1 
ATOM   4058 C  C   . ILE B 1 172 ? 11.563  2.452   -71.238  1.00 27.69 ? 172 ILE B C   1 
ATOM   4059 O  O   . ILE B 1 172 ? 11.074  3.178   -70.373  1.00 31.42 ? 172 ILE B O   1 
ATOM   4060 C  CB  . ILE B 1 172 ? 14.033  2.934   -71.622  1.00 15.29 ? 172 ILE B CB  1 
ATOM   4061 C  CG1 . ILE B 1 172 ? 15.402  2.313   -71.372  1.00 18.20 ? 172 ILE B CG1 1 
ATOM   4062 C  CG2 . ILE B 1 172 ? 13.925  4.292   -70.934  1.00 13.88 ? 172 ILE B CG2 1 
ATOM   4063 C  CD1 . ILE B 1 172 ? 16.588  3.302   -71.414  1.00 18.86 ? 172 ILE B CD1 1 
ATOM   4064 N  N   . GLY B 1 173 ? 10.783  2.058   -72.251  1.00 28.64 ? 173 GLY B N   1 
ATOM   4065 C  CA  . GLY B 1 173 ? 9.391   2.485   -72.343  1.00 28.16 ? 173 GLY B CA  1 
ATOM   4066 C  C   . GLY B 1 173 ? 8.547   2.035   -71.144  1.00 31.01 ? 173 GLY B C   1 
ATOM   4067 O  O   . GLY B 1 173 ? 7.525   2.659   -70.836  1.00 32.91 ? 173 GLY B O   1 
ATOM   4068 N  N   . CYS B 1 174 ? 8.884   0.933   -70.455  1.00 31.99 ? 174 CYS B N   1 
ATOM   4069 C  CA  . CYS B 1 174 ? 8.121   0.477   -69.293  1.00 32.18 ? 174 CYS B CA  1 
ATOM   4070 C  C   . CYS B 1 174 ? 9.121   -0.244  -68.368  1.00 33.52 ? 174 CYS B C   1 
ATOM   4071 O  O   . CYS B 1 174 ? 9.951   0.450   -67.764  1.00 34.93 ? 174 CYS B O   1 
ATOM   4072 C  CB  . CYS B 1 174 ? 6.932   -0.430  -69.754  1.00 28.77 ? 174 CYS B CB  1 
ATOM   4073 S  SG  . CYS B 1 174 ? 6.344   -1.478  -68.388  1.00 28.64 ? 174 CYS B SG  1 
ATOM   4074 N  N   . GLY B 1 175 ? 9.150   -1.577  -68.244  1.00 31.64 ? 175 GLY B N   1 
ATOM   4075 C  CA  . GLY B 1 175 ? 10.036  -2.369  -67.406  1.00 30.62 ? 175 GLY B CA  1 
ATOM   4076 C  C   . GLY B 1 175 ? 11.292  -1.743  -66.831  1.00 29.68 ? 175 GLY B C   1 
ATOM   4077 O  O   . GLY B 1 175 ? 11.371  -1.637  -65.611  1.00 29.94 ? 175 GLY B O   1 
ATOM   4078 N  N   . PHE B 1 176 ? 12.230  -1.237  -67.624  1.00 28.94 ? 176 PHE B N   1 
ATOM   4079 C  CA  . PHE B 1 176 ? 13.438  -0.705  -67.021  1.00 25.91 ? 176 PHE B CA  1 
ATOM   4080 C  C   . PHE B 1 176 ? 13.145  0.543   -66.222  1.00 31.64 ? 176 PHE B C   1 
ATOM   4081 O  O   . PHE B 1 176 ? 13.664  0.690   -65.109  1.00 35.56 ? 176 PHE B O   1 
ATOM   4082 C  CB  . PHE B 1 176 ? 14.500  -0.351  -68.051  1.00 12.87 ? 176 PHE B CB  1 
ATOM   4083 C  CG  . PHE B 1 176 ? 15.780  0.234   -67.434  1.00 9.43  ? 176 PHE B CG  1 
ATOM   4084 C  CD1 . PHE B 1 176 ? 16.732  -0.591  -66.850  1.00 10.07 ? 176 PHE B CD1 1 
ATOM   4085 C  CD2 . PHE B 1 176 ? 15.984  1.603   -67.413  1.00 9.83  ? 176 PHE B CD2 1 
ATOM   4086 C  CE1 . PHE B 1 176 ? 17.869  -0.052  -66.249  1.00 7.13  ? 176 PHE B CE1 1 
ATOM   4087 C  CE2 . PHE B 1 176 ? 17.120  2.137   -66.808  1.00 16.23 ? 176 PHE B CE2 1 
ATOM   4088 C  CZ  . PHE B 1 176 ? 18.067  1.314   -66.224  1.00 10.61 ? 176 PHE B CZ  1 
ATOM   4089 N  N   . SER B 1 177 ? 12.350  1.468   -66.741  1.00 32.59 ? 177 SER B N   1 
ATOM   4090 C  CA  . SER B 1 177 ? 12.086  2.695   -66.013  1.00 30.75 ? 177 SER B CA  1 
ATOM   4091 C  C   . SER B 1 177 ? 11.288  2.470   -64.745  1.00 27.47 ? 177 SER B C   1 
ATOM   4092 O  O   . SER B 1 177 ? 11.577  3.106   -63.733  1.00 22.39 ? 177 SER B O   1 
ATOM   4093 C  CB  . SER B 1 177 ? 11.383  3.630   -66.955  1.00 24.72 ? 177 SER B CB  1 
ATOM   4094 O  OG  . SER B 1 177 ? 12.504  3.938   -67.756  1.00 33.77 ? 177 SER B OG  1 
ATOM   4095 N  N   . THR B 1 178 ? 10.338  1.542   -64.795  1.00 26.11 ? 178 THR B N   1 
ATOM   4096 C  CA  . THR B 1 178 ? 9.549   1.221   -63.646  1.00 29.27 ? 178 THR B CA  1 
ATOM   4097 C  C   . THR B 1 178 ? 10.485  0.624   -62.595  1.00 31.78 ? 178 THR B C   1 
ATOM   4098 O  O   . THR B 1 178 ? 10.769  1.339   -61.625  1.00 36.12 ? 178 THR B O   1 
ATOM   4099 C  CB  . THR B 1 178 ? 8.472   0.271   -64.102  1.00 28.56 ? 178 THR B CB  1 
ATOM   4100 O  OG1 . THR B 1 178 ? 7.726   0.961   -65.101  1.00 31.26 ? 178 THR B OG1 1 
ATOM   4101 C  CG2 . THR B 1 178 ? 7.550   -0.133  -62.979  1.00 34.86 ? 178 THR B CG2 1 
ATOM   4102 N  N   . GLY B 1 179 ? 11.070  -0.564  -62.776  1.00 27.54 ? 179 GLY B N   1 
ATOM   4103 C  CA  . GLY B 1 179 ? 11.938  -1.167  -61.784  1.00 29.00 ? 179 GLY B CA  1 
ATOM   4104 C  C   . GLY B 1 179 ? 13.052  -0.255  -61.289  1.00 27.96 ? 179 GLY B C   1 
ATOM   4105 O  O   . GLY B 1 179 ? 13.161  0.023   -60.099  1.00 35.89 ? 179 GLY B O   1 
ATOM   4106 N  N   . TYR B 1 180 ? 13.861  0.287   -62.157  1.00 25.36 ? 180 TYR B N   1 
ATOM   4107 C  CA  . TYR B 1 180 ? 14.962  1.153   -61.770  1.00 23.17 ? 180 TYR B CA  1 
ATOM   4108 C  C   . TYR B 1 180 ? 14.480  2.370   -61.026  1.00 27.00 ? 180 TYR B C   1 
ATOM   4109 O  O   . TYR B 1 180 ? 15.069  2.753   -60.017  1.00 33.49 ? 180 TYR B O   1 
ATOM   4110 C  CB  . TYR B 1 180 ? 15.703  1.612   -63.007  1.00 14.25 ? 180 TYR B CB  1 
ATOM   4111 C  CG  . TYR B 1 180 ? 16.982  2.400   -62.828  1.00 6.56  ? 180 TYR B CG  1 
ATOM   4112 C  CD1 . TYR B 1 180 ? 18.198  1.734   -62.667  1.00 5.36  ? 180 TYR B CD1 1 
ATOM   4113 C  CD2 . TYR B 1 180 ? 16.940  3.788   -62.861  1.00 6.37  ? 180 TYR B CD2 1 
ATOM   4114 C  CE1 . TYR B 1 180 ? 19.374  2.479   -62.535  1.00 4.03  ? 180 TYR B CE1 1 
ATOM   4115 C  CE2 . TYR B 1 180 ? 18.112  4.538   -62.739  1.00 2.42  ? 180 TYR B CE2 1 
ATOM   4116 C  CZ  . TYR B 1 180 ? 19.313  3.868   -62.570  1.00 6.70  ? 180 TYR B CZ  1 
ATOM   4117 O  OH  . TYR B 1 180 ? 20.468  4.613   -62.439  1.00 22.96 ? 180 TYR B OH  1 
ATOM   4118 N  N   . GLY B 1 181 ? 13.429  3.002   -61.540  1.00 27.36 ? 181 GLY B N   1 
ATOM   4119 C  CA  . GLY B 1 181 ? 12.879  4.205   -60.976  1.00 23.73 ? 181 GLY B CA  1 
ATOM   4120 C  C   . GLY B 1 181 ? 12.312  3.960   -59.603  1.00 22.89 ? 181 GLY B C   1 
ATOM   4121 O  O   . GLY B 1 181 ? 12.555  4.760   -58.696  1.00 22.47 ? 181 GLY B O   1 
ATOM   4122 N  N   . SER B 1 182 ? 11.610  2.847   -59.427  1.00 19.83 ? 182 SER B N   1 
ATOM   4123 C  CA  . SER B 1 182 ? 11.045  2.502   -58.146  1.00 22.42 ? 182 SER B CA  1 
ATOM   4124 C  C   . SER B 1 182 ? 12.130  2.569   -57.091  1.00 24.43 ? 182 SER B C   1 
ATOM   4125 O  O   . SER B 1 182 ? 11.908  3.260   -56.106  1.00 27.05 ? 182 SER B O   1 
ATOM   4126 C  CB  . SER B 1 182 ? 10.466  1.125   -58.203  1.00 21.74 ? 182 SER B CB  1 
ATOM   4127 O  OG  . SER B 1 182 ? 9.363   1.190   -59.093  1.00 27.14 ? 182 SER B OG  1 
ATOM   4128 N  N   . ALA B 1 183 ? 13.322  2.033   -57.358  1.00 25.32 ? 183 ALA B N   1 
ATOM   4129 C  CA  . ALA B 1 183 ? 14.441  2.058   -56.440  1.00 26.12 ? 183 ALA B CA  1 
ATOM   4130 C  C   . ALA B 1 183 ? 15.006  3.440   -56.269  1.00 27.17 ? 183 ALA B C   1 
ATOM   4131 O  O   . ALA B 1 183 ? 14.847  4.034   -55.209  1.00 33.08 ? 183 ALA B O   1 
ATOM   4132 C  CB  . ALA B 1 183 ? 15.546  1.164   -56.938  1.00 25.09 ? 183 ALA B CB  1 
ATOM   4133 N  N   . VAL B 1 184 ? 15.610  4.003   -57.302  1.00 30.61 ? 184 VAL B N   1 
ATOM   4134 C  CA  . VAL B 1 184 ? 16.237  5.325   -57.299  1.00 28.11 ? 184 VAL B CA  1 
ATOM   4135 C  C   . VAL B 1 184 ? 15.345  6.533   -57.012  1.00 26.31 ? 184 VAL B C   1 
ATOM   4136 O  O   . VAL B 1 184 ? 15.780  7.470   -56.354  1.00 28.63 ? 184 VAL B O   1 
ATOM   4137 C  CB  . VAL B 1 184 ? 16.949  5.433   -58.682  1.00 30.23 ? 184 VAL B CB  1 
ATOM   4138 C  CG1 . VAL B 1 184 ? 17.250  6.884   -59.063  1.00 31.41 ? 184 VAL B CG1 1 
ATOM   4139 C  CG2 . VAL B 1 184 ? 18.270  4.652   -58.614  1.00 27.28 ? 184 VAL B CG2 1 
ATOM   4140 N  N   . ASN B 1 185 ? 14.100  6.547   -57.441  1.00 25.81 ? 185 ASN B N   1 
ATOM   4141 C  CA  . ASN B 1 185 ? 13.227  7.704   -57.268  1.00 28.55 ? 185 ASN B CA  1 
ATOM   4142 C  C   . ASN B 1 185 ? 12.100  7.514   -56.293  1.00 29.22 ? 185 ASN B C   1 
ATOM   4143 O  O   . ASN B 1 185 ? 11.764  8.475   -55.598  1.00 32.62 ? 185 ASN B O   1 
ATOM   4144 C  CB  . ASN B 1 185 ? 12.472  8.163   -58.530  1.00 33.34 ? 185 ASN B CB  1 
ATOM   4145 C  CG  . ASN B 1 185 ? 13.262  8.421   -59.801  1.00 38.47 ? 185 ASN B CG  1 
ATOM   4146 O  OD1 . ASN B 1 185 ? 14.242  9.172   -59.850  1.00 45.37 ? 185 ASN B OD1 1 
ATOM   4147 N  ND2 . ASN B 1 185 ? 12.870  7.781   -60.890  1.00 28.63 ? 185 ASN B ND2 1 
ATOM   4148 N  N   . VAL B 1 186 ? 11.446  6.353   -56.230  1.00 25.98 ? 186 VAL B N   1 
ATOM   4149 C  CA  . VAL B 1 186 ? 10.316  6.215   -55.310  1.00 27.50 ? 186 VAL B CA  1 
ATOM   4150 C  C   . VAL B 1 186 ? 10.807  5.831   -53.924  1.00 29.91 ? 186 VAL B C   1 
ATOM   4151 O  O   . VAL B 1 186 ? 10.665  6.615   -52.998  1.00 32.91 ? 186 VAL B O   1 
ATOM   4152 C  CB  . VAL B 1 186 ? 9.335   5.171   -55.867  1.00 24.44 ? 186 VAL B CB  1 
ATOM   4153 C  CG1 . VAL B 1 186 ? 8.092   5.036   -55.007  1.00 15.74 ? 186 VAL B CG1 1 
ATOM   4154 C  CG2 . VAL B 1 186 ? 8.971   5.607   -57.273  1.00 20.53 ? 186 VAL B CG2 1 
ATOM   4155 N  N   . ALA B 1 187 ? 11.389  4.652   -53.716  1.00 29.11 ? 187 ALA B N   1 
ATOM   4156 C  CA  . ALA B 1 187 ? 11.916  4.264   -52.418  1.00 28.20 ? 187 ALA B CA  1 
ATOM   4157 C  C   . ALA B 1 187 ? 13.020  5.205   -51.979  1.00 27.83 ? 187 ALA B C   1 
ATOM   4158 O  O   . ALA B 1 187 ? 13.108  5.572   -50.815  1.00 32.03 ? 187 ALA B O   1 
ATOM   4159 C  CB  . ALA B 1 187 ? 12.510  2.883   -52.463  1.00 26.30 ? 187 ALA B CB  1 
ATOM   4160 N  N   . LYS B 1 188 ? 13.862  5.604   -52.915  1.00 26.45 ? 188 LYS B N   1 
ATOM   4161 C  CA  . LYS B 1 188 ? 14.981  6.499   -52.688  1.00 26.63 ? 188 LYS B CA  1 
ATOM   4162 C  C   . LYS B 1 188 ? 16.033  5.838   -51.804  1.00 26.71 ? 188 LYS B C   1 
ATOM   4163 O  O   . LYS B 1 188 ? 16.566  6.428   -50.872  1.00 29.21 ? 188 LYS B O   1 
ATOM   4164 C  CB  . LYS B 1 188 ? 14.540  7.802   -52.028  1.00 28.78 ? 188 LYS B CB  1 
ATOM   4165 C  CG  . LYS B 1 188 ? 13.429  8.597   -52.695  1.00 31.99 ? 188 LYS B CG  1 
ATOM   4166 C  CD  . LYS B 1 188 ? 13.970  9.944   -53.164  1.00 34.41 ? 188 LYS B CD  1 
ATOM   4167 C  CE  . LYS B 1 188 ? 13.071  11.080  -52.681  1.00 38.69 ? 188 LYS B CE  1 
ATOM   4168 N  NZ  . LYS B 1 188 ? 11.673  10.881  -53.036  1.00 41.52 ? 188 LYS B NZ  1 
ATOM   4169 N  N   . VAL B 1 189 ? 16.384  4.601   -52.198  1.00 23.70 ? 189 VAL B N   1 
ATOM   4170 C  CA  . VAL B 1 189 ? 17.368  3.757   -51.552  1.00 19.40 ? 189 VAL B CA  1 
ATOM   4171 C  C   . VAL B 1 189 ? 18.605  4.528   -51.183  1.00 23.31 ? 189 VAL B C   1 
ATOM   4172 O  O   . VAL B 1 189 ? 19.181  5.283   -51.962  1.00 28.62 ? 189 VAL B O   1 
ATOM   4173 C  CB  . VAL B 1 189 ? 17.716  2.581   -52.478  1.00 21.55 ? 189 VAL B CB  1 
ATOM   4174 C  CG1 . VAL B 1 189 ? 18.843  1.702   -51.894  1.00 19.50 ? 189 VAL B CG1 1 
ATOM   4175 C  CG2 . VAL B 1 189 ? 16.445  1.740   -52.671  1.00 11.64 ? 189 VAL B CG2 1 
ATOM   4176 N  N   . THR B 1 190 ? 19.013  4.317   -49.952  1.00 26.64 ? 190 THR B N   1 
ATOM   4177 C  CA  . THR B 1 190 ? 20.130  5.033   -49.380  1.00 25.90 ? 190 THR B CA  1 
ATOM   4178 C  C   . THR B 1 190 ? 21.418  4.244   -49.505  1.00 24.24 ? 190 THR B C   1 
ATOM   4179 O  O   . THR B 1 190 ? 21.396  3.015   -49.536  1.00 23.65 ? 190 THR B O   1 
ATOM   4180 C  CB  . THR B 1 190 ? 19.759  5.331   -47.910  1.00 29.90 ? 190 THR B CB  1 
ATOM   4181 O  OG1 . THR B 1 190 ? 18.336  5.254   -47.784  1.00 37.09 ? 190 THR B OG1 1 
ATOM   4182 C  CG2 . THR B 1 190 ? 20.144  6.739   -47.489  1.00 36.04 ? 190 THR B CG2 1 
ATOM   4183 N  N   . PRO B 1 191 ? 22.586  4.862   -49.609  1.00 24.39 ? 191 PRO B N   1 
ATOM   4184 C  CA  . PRO B 1 191 ? 23.852  4.162   -49.625  1.00 27.76 ? 191 PRO B CA  1 
ATOM   4185 C  C   . PRO B 1 191 ? 23.964  3.299   -48.379  1.00 31.96 ? 191 PRO B C   1 
ATOM   4186 O  O   . PRO B 1 191 ? 23.528  3.658   -47.280  1.00 34.89 ? 191 PRO B O   1 
ATOM   4187 C  CB  . PRO B 1 191 ? 24.873  5.255   -49.687  1.00 27.44 ? 191 PRO B CB  1 
ATOM   4188 C  CG  . PRO B 1 191 ? 24.148  6.300   -50.511  1.00 27.32 ? 191 PRO B CG  1 
ATOM   4189 C  CD  . PRO B 1 191 ? 22.770  6.280   -49.889  1.00 25.72 ? 191 PRO B CD  1 
ATOM   4190 N  N   . GLY B 1 192 ? 24.503  2.115   -48.586  1.00 32.42 ? 192 GLY B N   1 
ATOM   4191 C  CA  . GLY B 1 192 ? 24.682  1.158   -47.526  1.00 30.81 ? 192 GLY B CA  1 
ATOM   4192 C  C   . GLY B 1 192 ? 23.373  0.511   -47.100  1.00 27.89 ? 192 GLY B C   1 
ATOM   4193 O  O   . GLY B 1 192 ? 23.460  -0.409  -46.296  1.00 25.70 ? 192 GLY B O   1 
ATOM   4194 N  N   . SER B 1 193 ? 22.165  0.831   -47.578  1.00 26.69 ? 193 SER B N   1 
ATOM   4195 C  CA  . SER B 1 193 ? 21.001  0.143   -47.070  1.00 23.39 ? 193 SER B CA  1 
ATOM   4196 C  C   . SER B 1 193 ? 20.902  -1.308  -47.478  1.00 21.43 ? 193 SER B C   1 
ATOM   4197 O  O   . SER B 1 193 ? 21.774  -1.840  -48.147  1.00 20.56 ? 193 SER B O   1 
ATOM   4198 C  CB  . SER B 1 193 ? 19.773  0.895   -47.506  1.00 30.47 ? 193 SER B CB  1 
ATOM   4199 O  OG  . SER B 1 193 ? 19.728  1.283   -48.865  1.00 39.73 ? 193 SER B OG  1 
ATOM   4200 N  N   . THR B 1 194 ? 19.854  -1.994  -47.084  1.00 20.94 ? 194 THR B N   1 
ATOM   4201 C  CA  . THR B 1 194 ? 19.640  -3.385  -47.392  1.00 18.40 ? 194 THR B CA  1 
ATOM   4202 C  C   . THR B 1 194 ? 18.263  -3.333  -48.015  1.00 21.57 ? 194 THR B C   1 
ATOM   4203 O  O   . THR B 1 194 ? 17.357  -2.711  -47.414  1.00 22.88 ? 194 THR B O   1 
ATOM   4204 C  CB  . THR B 1 194 ? 19.696  -4.163  -46.054  1.00 13.58 ? 194 THR B CB  1 
ATOM   4205 O  OG1 . THR B 1 194 ? 21.083  -4.387  -45.875  1.00 16.46 ? 194 THR B OG1 1 
ATOM   4206 C  CG2 . THR B 1 194 ? 18.956  -5.475  -45.989  1.00 6.93  ? 194 THR B CG2 1 
ATOM   4207 N  N   . CYS B 1 195 ? 18.093  -3.956  -49.184  1.00 22.24 ? 195 CYS B N   1 
ATOM   4208 C  CA  . CYS B 1 195 ? 16.816  -3.955  -49.878  1.00 20.14 ? 195 CYS B CA  1 
ATOM   4209 C  C   . CYS B 1 195 ? 16.530  -5.402  -50.202  1.00 18.80 ? 195 CYS B C   1 
ATOM   4210 O  O   . CYS B 1 195 ? 17.460  -6.224  -50.253  1.00 22.40 ? 195 CYS B O   1 
ATOM   4211 C  CB  . CYS B 1 195 ? 16.907  -3.175  -51.168  1.00 16.95 ? 195 CYS B CB  1 
ATOM   4212 S  SG  . CYS B 1 195 ? 17.965  -1.702  -51.091  1.00 23.02 ? 195 CYS B SG  1 
ATOM   4213 N  N   . ALA B 1 196 ? 15.252  -5.701  -50.338  1.00 15.29 ? 196 ALA B N   1 
ATOM   4214 C  CA  . ALA B 1 196 ? 14.761  -7.002  -50.738  1.00 19.89 ? 196 ALA B CA  1 
ATOM   4215 C  C   . ALA B 1 196 ? 13.919  -6.755  -52.017  1.00 21.78 ? 196 ALA B C   1 
ATOM   4216 O  O   . ALA B 1 196 ? 13.235  -5.721  -52.061  1.00 23.93 ? 196 ALA B O   1 
ATOM   4217 C  CB  . ALA B 1 196 ? 13.817  -7.621  -49.716  1.00 15.95 ? 196 ALA B CB  1 
ATOM   4218 N  N   . VAL B 1 197 ? 13.924  -7.594  -53.076  1.00 21.54 ? 197 VAL B N   1 
ATOM   4219 C  CA  . VAL B 1 197 ? 13.084  -7.402  -54.262  1.00 16.59 ? 197 VAL B CA  1 
ATOM   4220 C  C   . VAL B 1 197 ? 12.252  -8.673  -54.463  1.00 17.63 ? 197 VAL B C   1 
ATOM   4221 O  O   . VAL B 1 197 ? 12.787  -9.781  -54.515  1.00 20.02 ? 197 VAL B O   1 
ATOM   4222 C  CB  . VAL B 1 197 ? 13.960  -7.112  -55.503  1.00 11.89 ? 197 VAL B CB  1 
ATOM   4223 C  CG1 . VAL B 1 197 ? 13.001  -6.758  -56.591  1.00 10.78 ? 197 VAL B CG1 1 
ATOM   4224 C  CG2 . VAL B 1 197 ? 14.884  -5.878  -55.381  1.00 6.97  ? 197 VAL B CG2 1 
ATOM   4225 N  N   . PHE B 1 198 ? 10.930  -8.612  -54.526  1.00 17.62 ? 198 PHE B N   1 
ATOM   4226 C  CA  . PHE B 1 198 ? 10.109  -9.780  -54.706  1.00 21.36 ? 198 PHE B CA  1 
ATOM   4227 C  C   . PHE B 1 198 ? 9.676   -9.938  -56.148  1.00 28.67 ? 198 PHE B C   1 
ATOM   4228 O  O   . PHE B 1 198 ? 8.694   -9.294  -56.540  1.00 33.77 ? 198 PHE B O   1 
ATOM   4229 C  CB  . PHE B 1 198 ? 8.846   -9.705  -53.858  1.00 20.21 ? 198 PHE B CB  1 
ATOM   4230 C  CG  . PHE B 1 198 ? 9.039   -10.029 -52.394  1.00 22.40 ? 198 PHE B CG  1 
ATOM   4231 C  CD1 . PHE B 1 198 ? 9.799   -9.190  -51.582  1.00 18.94 ? 198 PHE B CD1 1 
ATOM   4232 C  CD2 . PHE B 1 198 ? 8.460   -11.185 -51.881  1.00 16.88 ? 198 PHE B CD2 1 
ATOM   4233 C  CE1 . PHE B 1 198 ? 9.983   -9.508  -50.251  1.00 13.77 ? 198 PHE B CE1 1 
ATOM   4234 C  CE2 . PHE B 1 198 ? 8.646   -11.490 -50.544  1.00 16.06 ? 198 PHE B CE2 1 
ATOM   4235 C  CZ  . PHE B 1 198 ? 9.407   -10.656 -49.738  1.00 18.40 ? 198 PHE B CZ  1 
ATOM   4236 N  N   . GLY B 1 199 ? 10.293  -10.804 -56.943  1.00 28.37 ? 199 GLY B N   1 
ATOM   4237 C  CA  . GLY B 1 199 ? 9.896   -10.984 -58.323  1.00 25.44 ? 199 GLY B CA  1 
ATOM   4238 C  C   . GLY B 1 199 ? 11.045  -10.509 -59.173  1.00 26.86 ? 199 GLY B C   1 
ATOM   4239 O  O   . GLY B 1 199 ? 11.507  -9.368  -59.094  1.00 24.92 ? 199 GLY B O   1 
ATOM   4240 N  N   . LEU B 1 200 ? 11.536  -11.404 -60.017  1.00 29.34 ? 200 LEU B N   1 
ATOM   4241 C  CA  . LEU B 1 200 ? 12.664  -11.078 -60.876  1.00 34.29 ? 200 LEU B CA  1 
ATOM   4242 C  C   . LEU B 1 200 ? 12.281  -11.335 -62.345  1.00 36.46 ? 200 LEU B C   1 
ATOM   4243 O  O   . LEU B 1 200 ? 12.597  -12.344 -62.982  1.00 38.50 ? 200 LEU B O   1 
ATOM   4244 C  CB  . LEU B 1 200 ? 13.880  -11.923 -60.428  1.00 33.01 ? 200 LEU B CB  1 
ATOM   4245 C  CG  . LEU B 1 200 ? 14.282  -11.757 -58.956  1.00 31.30 ? 200 LEU B CG  1 
ATOM   4246 C  CD1 . LEU B 1 200 ? 15.184  -12.908 -58.563  1.00 31.01 ? 200 LEU B CD1 1 
ATOM   4247 C  CD2 . LEU B 1 200 ? 14.883  -10.371 -58.739  1.00 22.74 ? 200 LEU B CD2 1 
ATOM   4248 N  N   . GLY B 1 201 ? 11.436  -10.429 -62.814  1.00 35.42 ? 201 GLY B N   1 
ATOM   4249 C  CA  . GLY B 1 201 ? 10.991  -10.410 -64.191  1.00 33.36 ? 201 GLY B CA  1 
ATOM   4250 C  C   . GLY B 1 201 ? 11.784  -9.250  -64.767  1.00 28.21 ? 201 GLY B C   1 
ATOM   4251 O  O   . GLY B 1 201 ? 12.833  -8.843  -64.234  1.00 27.73 ? 201 GLY B O   1 
ATOM   4252 N  N   . GLY B 1 202 ? 11.271  -8.612  -65.789  1.00 25.25 ? 202 GLY B N   1 
ATOM   4253 C  CA  . GLY B 1 202 ? 11.998  -7.510  -66.390  1.00 24.08 ? 202 GLY B CA  1 
ATOM   4254 C  C   . GLY B 1 202 ? 11.996  -6.320  -65.465  1.00 19.87 ? 202 GLY B C   1 
ATOM   4255 O  O   . GLY B 1 202 ? 13.029  -5.684  -65.243  1.00 16.78 ? 202 GLY B O   1 
ATOM   4256 N  N   . VAL B 1 203 ? 10.832  -6.045  -64.877  1.00 22.05 ? 203 VAL B N   1 
ATOM   4257 C  CA  . VAL B 1 203 ? 10.720  -4.934  -63.939  1.00 24.65 ? 203 VAL B CA  1 
ATOM   4258 C  C   . VAL B 1 203 ? 11.570  -5.199  -62.666  1.00 24.78 ? 203 VAL B C   1 
ATOM   4259 O  O   . VAL B 1 203 ? 12.405  -4.359  -62.265  1.00 22.82 ? 203 VAL B O   1 
ATOM   4260 C  CB  . VAL B 1 203 ? 9.248   -4.747  -63.587  1.00 28.11 ? 203 VAL B CB  1 
ATOM   4261 C  CG1 . VAL B 1 203 ? 9.135   -3.379  -62.928  1.00 26.27 ? 203 VAL B CG1 1 
ATOM   4262 C  CG2 . VAL B 1 203 ? 8.336   -4.806  -64.809  1.00 30.14 ? 203 VAL B CG2 1 
ATOM   4263 N  N   . GLY B 1 204 ? 11.437  -6.412  -62.095  1.00 22.01 ? 204 GLY B N   1 
ATOM   4264 C  CA  . GLY B 1 204 ? 12.155  -6.859  -60.912  1.00 24.57 ? 204 GLY B CA  1 
ATOM   4265 C  C   . GLY B 1 204 ? 13.664  -6.653  -60.960  1.00 28.73 ? 204 GLY B C   1 
ATOM   4266 O  O   . GLY B 1 204 ? 14.279  -5.953  -60.126  1.00 29.18 ? 204 GLY B O   1 
ATOM   4267 N  N   . LEU B 1 205 ? 14.303  -7.211  -61.989  1.00 28.39 ? 205 LEU B N   1 
ATOM   4268 C  CA  . LEU B 1 205 ? 15.747  -7.067  -62.093  1.00 27.58 ? 205 LEU B CA  1 
ATOM   4269 C  C   . LEU B 1 205 ? 16.171  -5.641  -62.359  1.00 22.49 ? 205 LEU B C   1 
ATOM   4270 O  O   . LEU B 1 205 ? 17.308  -5.255  -62.067  1.00 22.94 ? 205 LEU B O   1 
ATOM   4271 C  CB  . LEU B 1 205 ? 16.291  -7.961  -63.199  1.00 35.22 ? 205 LEU B CB  1 
ATOM   4272 C  CG  . LEU B 1 205 ? 16.075  -9.471  -63.096  1.00 34.77 ? 205 LEU B CG  1 
ATOM   4273 C  CD1 . LEU B 1 205 ? 16.521  -10.172 -64.359  1.00 29.04 ? 205 LEU B CD1 1 
ATOM   4274 C  CD2 . LEU B 1 205 ? 16.851  -9.976  -61.910  1.00 31.70 ? 205 LEU B CD2 1 
ATOM   4275 N  N   . SER B 1 206 ? 15.296  -4.803  -62.888  1.00 23.98 ? 206 SER B N   1 
ATOM   4276 C  CA  . SER B 1 206 ? 15.693  -3.412  -63.130  1.00 28.68 ? 206 SER B CA  1 
ATOM   4277 C  C   . SER B 1 206 ? 15.659  -2.719  -61.742  1.00 26.56 ? 206 SER B C   1 
ATOM   4278 O  O   . SER B 1 206 ? 16.422  -1.774  -61.500  1.00 24.95 ? 206 SER B O   1 
ATOM   4279 C  CB  . SER B 1 206 ? 14.711  -2.784  -64.143  1.00 31.85 ? 206 SER B CB  1 
ATOM   4280 O  OG  . SER B 1 206 ? 14.554  -3.505  -65.361  1.00 30.66 ? 206 SER B OG  1 
ATOM   4281 N  N   . ALA B 1 207 ? 14.784  -3.191  -60.813  1.00 24.46 ? 207 ALA B N   1 
ATOM   4282 C  CA  . ALA B 1 207 ? 14.729  -2.732  -59.409  1.00 19.23 ? 207 ALA B CA  1 
ATOM   4283 C  C   . ALA B 1 207 ? 16.041  -3.190  -58.751  1.00 17.37 ? 207 ALA B C   1 
ATOM   4284 O  O   . ALA B 1 207 ? 16.715  -2.338  -58.150  1.00 17.51 ? 207 ALA B O   1 
ATOM   4285 C  CB  . ALA B 1 207 ? 13.551  -3.365  -58.703  1.00 19.23 ? 207 ALA B CB  1 
ATOM   4286 N  N   . VAL B 1 208 ? 16.501  -4.467  -58.940  1.00 14.21 ? 208 VAL B N   1 
ATOM   4287 C  CA  . VAL B 1 208 ? 17.795  -4.932  -58.432  1.00 12.82 ? 208 VAL B CA  1 
ATOM   4288 C  C   . VAL B 1 208 ? 18.856  -3.961  -58.946  1.00 22.87 ? 208 VAL B C   1 
ATOM   4289 O  O   . VAL B 1 208 ? 19.611  -3.401  -58.146  1.00 28.95 ? 208 VAL B O   1 
ATOM   4290 C  CB  . VAL B 1 208 ? 18.138  -6.362  -58.936  1.00 13.34 ? 208 VAL B CB  1 
ATOM   4291 C  CG1 . VAL B 1 208 ? 19.532  -6.694  -58.482  1.00 12.06 ? 208 VAL B CG1 1 
ATOM   4292 C  CG2 . VAL B 1 208 ? 17.225  -7.454  -58.381  1.00 13.36 ? 208 VAL B CG2 1 
ATOM   4293 N  N   . MET B 1 209 ? 18.915  -3.669  -60.260  1.00 30.51 ? 209 MET B N   1 
ATOM   4294 C  CA  . MET B 1 209 ? 19.884  -2.720  -60.829  1.00 30.52 ? 209 MET B CA  1 
ATOM   4295 C  C   . MET B 1 209 ? 19.775  -1.347  -60.196  1.00 29.99 ? 209 MET B C   1 
ATOM   4296 O  O   . MET B 1 209 ? 20.802  -0.735  -59.915  1.00 32.28 ? 209 MET B O   1 
ATOM   4297 C  CB  . MET B 1 209 ? 19.696  -2.505  -62.329  1.00 34.15 ? 209 MET B CB  1 
ATOM   4298 C  CG  . MET B 1 209 ? 20.116  -3.650  -63.241  1.00 41.75 ? 209 MET B CG  1 
ATOM   4299 S  SD  . MET B 1 209 ? 20.086  -3.201  -65.005  1.00 46.54 ? 209 MET B SD  1 
ATOM   4300 C  CE  . MET B 1 209 ? 18.911  -4.440  -65.436  1.00 40.79 ? 209 MET B CE  1 
ATOM   4301 N  N   . GLY B 1 210 ? 18.567  -0.819  -59.952  1.00 30.19 ? 210 GLY B N   1 
ATOM   4302 C  CA  . GLY B 1 210 ? 18.384  0.478   -59.318  1.00 30.40 ? 210 GLY B CA  1 
ATOM   4303 C  C   . GLY B 1 210 ? 18.945  0.484   -57.890  1.00 31.18 ? 210 GLY B C   1 
ATOM   4304 O  O   . GLY B 1 210 ? 19.671  1.405   -57.497  1.00 26.06 ? 210 GLY B O   1 
ATOM   4305 N  N   . CYS B 1 211 ? 18.678  -0.553  -57.087  1.00 32.14 ? 211 CYS B N   1 
ATOM   4306 C  CA  . CYS B 1 211 ? 19.198  -0.617  -55.725  1.00 33.26 ? 211 CYS B CA  1 
ATOM   4307 C  C   . CYS B 1 211 ? 20.730  -0.647  -55.802  1.00 35.31 ? 211 CYS B C   1 
ATOM   4308 O  O   . CYS B 1 211 ? 21.408  0.065   -55.030  1.00 35.66 ? 211 CYS B O   1 
ATOM   4309 C  CB  . CYS B 1 211 ? 18.680  -1.874  -54.998  1.00 27.84 ? 211 CYS B CB  1 
ATOM   4310 S  SG  . CYS B 1 211 ? 16.875  -2.079  -54.898  1.00 30.29 ? 211 CYS B SG  1 
ATOM   4311 N  N   . LYS B 1 212 ? 21.321  -1.393  -56.758  1.00 34.18 ? 212 LYS B N   1 
ATOM   4312 C  CA  . LYS B 1 212 ? 22.771  -1.431  -56.865  1.00 35.22 ? 212 LYS B CA  1 
ATOM   4313 C  C   . LYS B 1 212 ? 23.279  -0.062  -57.268  1.00 34.13 ? 212 LYS B C   1 
ATOM   4314 O  O   . LYS B 1 212 ? 24.264  0.416   -56.718  1.00 35.68 ? 212 LYS B O   1 
ATOM   4315 C  CB  . LYS B 1 212 ? 23.223  -2.446  -57.893  1.00 39.66 ? 212 LYS B CB  1 
ATOM   4316 C  CG  . LYS B 1 212 ? 24.752  -2.584  -57.916  1.00 45.26 ? 212 LYS B CG  1 
ATOM   4317 C  CD  . LYS B 1 212 ? 25.224  -2.483  -59.372  1.00 49.14 ? 212 LYS B CD  1 
ATOM   4318 C  CE  . LYS B 1 212 ? 26.664  -1.989  -59.534  1.00 48.90 ? 212 LYS B CE  1 
ATOM   4319 N  NZ  . LYS B 1 212 ? 27.622  -2.972  -59.069  1.00 49.29 ? 212 LYS B NZ  1 
ATOM   4320 N  N   . ALA B 1 213 ? 22.569  0.618   -58.163  1.00 36.79 ? 213 ALA B N   1 
ATOM   4321 C  CA  . ALA B 1 213 ? 22.921  1.956   -58.621  1.00 37.10 ? 213 ALA B CA  1 
ATOM   4322 C  C   . ALA B 1 213 ? 22.774  2.995   -57.512  1.00 37.31 ? 213 ALA B C   1 
ATOM   4323 O  O   . ALA B 1 213 ? 23.450  4.026   -57.530  1.00 37.26 ? 213 ALA B O   1 
ATOM   4324 C  CB  . ALA B 1 213 ? 22.022  2.366   -59.764  1.00 36.54 ? 213 ALA B CB  1 
ATOM   4325 N  N   . ALA B 1 214 ? 21.885  2.719   -56.541  1.00 36.02 ? 214 ALA B N   1 
ATOM   4326 C  CA  . ALA B 1 214 ? 21.639  3.592   -55.404  1.00 34.69 ? 214 ALA B CA  1 
ATOM   4327 C  C   . ALA B 1 214 ? 22.673  3.382   -54.315  1.00 36.06 ? 214 ALA B C   1 
ATOM   4328 O  O   . ALA B 1 214 ? 22.889  4.227   -53.438  1.00 37.82 ? 214 ALA B O   1 
ATOM   4329 C  CB  . ALA B 1 214 ? 20.273  3.320   -54.820  1.00 33.04 ? 214 ALA B CB  1 
ATOM   4330 N  N   . GLY B 1 215 ? 23.325  2.226   -54.352  1.00 37.59 ? 215 GLY B N   1 
ATOM   4331 C  CA  . GLY B 1 215 ? 24.364  1.926   -53.382  1.00 36.35 ? 215 GLY B CA  1 
ATOM   4332 C  C   . GLY B 1 215 ? 23.894  1.034   -52.250  1.00 33.88 ? 215 GLY B C   1 
ATOM   4333 O  O   . GLY B 1 215 ? 24.457  1.103   -51.158  1.00 36.03 ? 215 GLY B O   1 
ATOM   4334 N  N   . ALA B 1 216 ? 22.874  0.199   -52.435  1.00 30.39 ? 216 ALA B N   1 
ATOM   4335 C  CA  . ALA B 1 216 ? 22.443  -0.687  -51.374  1.00 30.29 ? 216 ALA B CA  1 
ATOM   4336 C  C   . ALA B 1 216 ? 23.593  -1.632  -51.045  1.00 33.05 ? 216 ALA B C   1 
ATOM   4337 O  O   . ALA B 1 216 ? 24.296  -2.100  -51.942  1.00 35.57 ? 216 ALA B O   1 
ATOM   4338 C  CB  . ALA B 1 216 ? 21.262  -1.530  -51.807  1.00 22.50 ? 216 ALA B CB  1 
ATOM   4339 N  N   . ALA B 1 217 ? 23.883  -1.835  -49.762  1.00 33.59 ? 217 ALA B N   1 
ATOM   4340 C  CA  . ALA B 1 217 ? 24.923  -2.758  -49.370  1.00 30.48 ? 217 ALA B CA  1 
ATOM   4341 C  C   . ALA B 1 217 ? 24.397  -4.162  -49.582  1.00 29.65 ? 217 ALA B C   1 
ATOM   4342 O  O   . ALA B 1 217 ? 25.185  -5.029  -49.968  1.00 35.16 ? 217 ALA B O   1 
ATOM   4343 C  CB  . ALA B 1 217 ? 25.270  -2.613  -47.913  1.00 31.84 ? 217 ALA B CB  1 
ATOM   4344 N  N   . ARG B 1 218 ? 23.119  -4.449  -49.359  1.00 27.28 ? 218 ARG B N   1 
ATOM   4345 C  CA  . ARG B 1 218 ? 22.635  -5.797  -49.583  1.00 31.60 ? 218 ARG B CA  1 
ATOM   4346 C  C   . ARG B 1 218 ? 21.392  -5.773  -50.410  1.00 30.35 ? 218 ARG B C   1 
ATOM   4347 O  O   . ARG B 1 218 ? 20.567  -4.887  -50.198  1.00 29.72 ? 218 ARG B O   1 
ATOM   4348 C  CB  . ARG B 1 218 ? 22.269  -6.555  -48.295  1.00 36.24 ? 218 ARG B CB  1 
ATOM   4349 C  CG  . ARG B 1 218 ? 23.464  -7.307  -47.718  1.00 40.68 ? 218 ARG B CG  1 
ATOM   4350 C  CD  . ARG B 1 218 ? 23.087  -8.678  -47.183  1.00 42.08 ? 218 ARG B CD  1 
ATOM   4351 N  NE  . ARG B 1 218 ? 22.405  -8.629  -45.904  1.00 41.52 ? 218 ARG B NE  1 
ATOM   4352 C  CZ  . ARG B 1 218 ? 21.734  -9.677  -45.410  1.00 43.67 ? 218 ARG B CZ  1 
ATOM   4353 N  NH1 . ARG B 1 218 ? 21.634  -10.832 -46.046  1.00 40.16 ? 218 ARG B NH1 1 
ATOM   4354 N  NH2 . ARG B 1 218 ? 21.159  -9.589  -44.216  1.00 48.45 ? 218 ARG B NH2 1 
ATOM   4355 N  N   . ILE B 1 219 ? 21.255  -6.708  -51.357  1.00 29.77 ? 219 ILE B N   1 
ATOM   4356 C  CA  . ILE B 1 219 ? 20.070  -6.810  -52.195  1.00 28.49 ? 219 ILE B CA  1 
ATOM   4357 C  C   . ILE B 1 219 ? 19.692  -8.278  -52.197  1.00 28.57 ? 219 ILE B C   1 
ATOM   4358 O  O   . ILE B 1 219 ? 20.383  -9.128  -52.756  1.00 35.04 ? 219 ILE B O   1 
ATOM   4359 C  CB  . ILE B 1 219 ? 20.357  -6.308  -53.647  1.00 24.79 ? 219 ILE B CB  1 
ATOM   4360 C  CG1 . ILE B 1 219 ? 20.932  -4.896  -53.641  1.00 17.49 ? 219 ILE B CG1 1 
ATOM   4361 C  CG2 . ILE B 1 219 ? 19.053  -6.216  -54.408  1.00 24.84 ? 219 ILE B CG2 1 
ATOM   4362 C  CD1 . ILE B 1 219 ? 21.750  -4.454  -54.831  1.00 19.07 ? 219 ILE B CD1 1 
ATOM   4363 N  N   . ILE B 1 220 ? 18.626  -8.637  -51.518  1.00 26.56 ? 220 ILE B N   1 
ATOM   4364 C  CA  . ILE B 1 220 ? 18.161  -10.012 -51.443  1.00 24.81 ? 220 ILE B CA  1 
ATOM   4365 C  C   . ILE B 1 220 ? 17.103  -10.104 -52.534  1.00 26.06 ? 220 ILE B C   1 
ATOM   4366 O  O   . ILE B 1 220 ? 16.166  -9.293  -52.566  1.00 26.20 ? 220 ILE B O   1 
ATOM   4367 C  CB  . ILE B 1 220 ? 17.590  -10.227 -50.004  1.00 25.07 ? 220 ILE B CB  1 
ATOM   4368 C  CG1 . ILE B 1 220 ? 18.697  -9.926  -48.969  1.00 19.58 ? 220 ILE B CG1 1 
ATOM   4369 C  CG2 . ILE B 1 220 ? 17.060  -11.641 -49.842  1.00 17.03 ? 220 ILE B CG2 1 
ATOM   4370 C  CD1 . ILE B 1 220 ? 18.158  -9.870  -47.539  1.00 18.96 ? 220 ILE B CD1 1 
ATOM   4371 N  N   . ALA B 1 221 ? 17.190  -11.075 -53.433  1.00 25.91 ? 221 ALA B N   1 
ATOM   4372 C  CA  . ALA B 1 221 ? 16.261  -11.229 -54.544  1.00 23.20 ? 221 ALA B CA  1 
ATOM   4373 C  C   . ALA B 1 221 ? 15.387  -12.436 -54.270  1.00 22.33 ? 221 ALA B C   1 
ATOM   4374 O  O   . ALA B 1 221 ? 15.888  -13.539 -54.065  1.00 25.15 ? 221 ALA B O   1 
ATOM   4375 C  CB  . ALA B 1 221 ? 17.078  -11.414 -55.812  1.00 23.74 ? 221 ALA B CB  1 
ATOM   4376 N  N   . VAL B 1 222 ? 14.079  -12.302 -54.291  1.00 20.48 ? 222 VAL B N   1 
ATOM   4377 C  CA  . VAL B 1 222 ? 13.192  -13.382 -53.931  1.00 20.59 ? 222 VAL B CA  1 
ATOM   4378 C  C   . VAL B 1 222 ? 12.397  -13.792 -55.164  1.00 24.06 ? 222 VAL B C   1 
ATOM   4379 O  O   . VAL B 1 222 ? 11.808  -12.948 -55.861  1.00 22.61 ? 222 VAL B O   1 
ATOM   4380 C  CB  . VAL B 1 222 ? 12.256  -12.859 -52.761  1.00 20.31 ? 222 VAL B CB  1 
ATOM   4381 C  CG1 . VAL B 1 222 ? 11.377  -13.969 -52.197  1.00 15.26 ? 222 VAL B CG1 1 
ATOM   4382 C  CG2 . VAL B 1 222 ? 13.108  -12.304 -51.622  1.00 18.38 ? 222 VAL B CG2 1 
ATOM   4383 N  N   . ASP B 1 223 ? 12.325  -15.087 -55.450  1.00 24.43 ? 223 ASP B N   1 
ATOM   4384 C  CA  . ASP B 1 223 ? 11.569  -15.560 -56.580  1.00 22.21 ? 223 ASP B CA  1 
ATOM   4385 C  C   . ASP B 1 223 ? 11.375  -17.038 -56.421  1.00 21.73 ? 223 ASP B C   1 
ATOM   4386 O  O   . ASP B 1 223 ? 12.295  -17.760 -56.042  1.00 23.78 ? 223 ASP B O   1 
ATOM   4387 C  CB  . ASP B 1 223 ? 12.310  -15.336 -57.920  1.00 26.11 ? 223 ASP B CB  1 
ATOM   4388 C  CG  . ASP B 1 223 ? 11.385  -15.093 -59.120  1.00 27.07 ? 223 ASP B CG  1 
ATOM   4389 O  OD1 . ASP B 1 223 ? 10.394  -15.798 -59.332  1.00 21.44 ? 223 ASP B OD1 1 
ATOM   4390 O  OD2 . ASP B 1 223 ? 11.660  -14.147 -59.844  1.00 29.19 ? 223 ASP B OD2 1 
ATOM   4391 N  N   . ILE B 1 224 ? 10.166  -17.495 -56.713  1.00 21.29 ? 224 ILE B N   1 
ATOM   4392 C  CA  . ILE B 1 224 ? 9.899   -18.914 -56.705  1.00 23.88 ? 224 ILE B CA  1 
ATOM   4393 C  C   . ILE B 1 224 ? 10.536  -19.546 -57.940  1.00 29.77 ? 224 ILE B C   1 
ATOM   4394 O  O   . ILE B 1 224 ? 10.565  -20.779 -58.057  1.00 35.52 ? 224 ILE B O   1 
ATOM   4395 C  CB  . ILE B 1 224 ? 8.422   -19.251 -56.768  1.00 22.36 ? 224 ILE B CB  1 
ATOM   4396 C  CG1 . ILE B 1 224 ? 7.743   -18.596 -57.961  1.00 20.36 ? 224 ILE B CG1 1 
ATOM   4397 C  CG2 . ILE B 1 224 ? 7.841   -18.883 -55.414  1.00 25.17 ? 224 ILE B CG2 1 
ATOM   4398 C  CD1 . ILE B 1 224 ? 6.311   -19.158 -58.133  1.00 21.48 ? 224 ILE B CD1 1 
ATOM   4399 N  N   . ASN B 1 225 ? 10.988  -18.766 -58.936  1.00 31.14 ? 225 ASN B N   1 
ATOM   4400 C  CA  . ASN B 1 225 ? 11.624  -19.345 -60.088  1.00 30.63 ? 225 ASN B CA  1 
ATOM   4401 C  C   . ASN B 1 225 ? 13.114  -19.217 -59.915  1.00 30.22 ? 225 ASN B C   1 
ATOM   4402 O  O   . ASN B 1 225 ? 13.750  -18.177 -60.117  1.00 26.71 ? 225 ASN B O   1 
ATOM   4403 C  CB  . ASN B 1 225 ? 11.236  -18.670 -61.387  1.00 35.78 ? 225 ASN B CB  1 
ATOM   4404 C  CG  . ASN B 1 225 ? 11.969  -19.338 -62.555  1.00 39.89 ? 225 ASN B CG  1 
ATOM   4405 O  OD1 . ASN B 1 225 ? 12.929  -18.795 -63.095  1.00 45.13 ? 225 ASN B OD1 1 
ATOM   4406 N  ND2 . ASN B 1 225 ? 11.661  -20.563 -62.957  1.00 40.97 ? 225 ASN B ND2 1 
ATOM   4407 N  N   . LYS B 1 226 ? 13.635  -20.371 -59.529  1.00 31.87 ? 226 LYS B N   1 
ATOM   4408 C  CA  . LYS B 1 226 ? 15.060  -20.481 -59.304  1.00 38.25 ? 226 LYS B CA  1 
ATOM   4409 C  C   . LYS B 1 226 ? 15.946  -20.136 -60.492  1.00 38.19 ? 226 LYS B C   1 
ATOM   4410 O  O   . LYS B 1 226 ? 17.096  -19.746 -60.300  1.00 39.60 ? 226 LYS B O   1 
ATOM   4411 C  CB  . LYS B 1 226 ? 15.418  -21.899 -58.807  1.00 43.82 ? 226 LYS B CB  1 
ATOM   4412 C  CG  . LYS B 1 226 ? 14.454  -23.041 -59.154  1.00 51.31 ? 226 LYS B CG  1 
ATOM   4413 C  CD  . LYS B 1 226 ? 15.080  -24.433 -58.978  1.00 55.54 ? 226 LYS B CD  1 
ATOM   4414 C  CE  . LYS B 1 226 ? 16.139  -24.747 -60.052  1.00 61.25 ? 226 LYS B CE  1 
ATOM   4415 N  NZ  . LYS B 1 226 ? 15.590  -24.782 -61.405  1.00 62.16 ? 226 LYS B NZ  1 
ATOM   4416 N  N   . ASP B 1 227 ? 15.463  -20.173 -61.728  1.00 39.69 ? 227 ASP B N   1 
ATOM   4417 C  CA  . ASP B 1 227 ? 16.320  -19.848 -62.860  1.00 41.04 ? 227 ASP B CA  1 
ATOM   4418 C  C   . ASP B 1 227 ? 16.650  -18.359 -63.010  1.00 39.53 ? 227 ASP B C   1 
ATOM   4419 O  O   . ASP B 1 227 ? 17.672  -18.023 -63.627  1.00 40.57 ? 227 ASP B O   1 
ATOM   4420 C  CB  . ASP B 1 227 ? 15.660  -20.412 -64.131  1.00 42.67 ? 227 ASP B CB  1 
ATOM   4421 C  CG  . ASP B 1 227 ? 15.531  -21.946 -64.116  1.00 47.39 ? 227 ASP B CG  1 
ATOM   4422 O  OD1 . ASP B 1 227 ? 16.478  -22.623 -63.696  1.00 49.77 ? 227 ASP B OD1 1 
ATOM   4423 O  OD2 . ASP B 1 227 ? 14.485  -22.471 -64.512  1.00 44.69 ? 227 ASP B OD2 1 
ATOM   4424 N  N   . LYS B 1 228 ? 15.907  -17.430 -62.385  1.00 35.61 ? 228 LYS B N   1 
ATOM   4425 C  CA  . LYS B 1 228 ? 16.207  -16.000 -62.498  1.00 32.32 ? 228 LYS B CA  1 
ATOM   4426 C  C   . LYS B 1 228 ? 17.401  -15.504 -61.676  1.00 31.68 ? 228 LYS B C   1 
ATOM   4427 O  O   . LYS B 1 228 ? 18.025  -14.458 -61.944  1.00 30.52 ? 228 LYS B O   1 
ATOM   4428 C  CB  . LYS B 1 228 ? 14.969  -15.226 -62.098  1.00 32.86 ? 228 LYS B CB  1 
ATOM   4429 C  CG  . LYS B 1 228 ? 13.687  -15.564 -62.863  1.00 32.35 ? 228 LYS B CG  1 
ATOM   4430 C  CD  . LYS B 1 228 ? 13.742  -14.986 -64.275  1.00 29.67 ? 228 LYS B CD  1 
ATOM   4431 C  CE  . LYS B 1 228 ? 12.493  -15.393 -65.033  1.00 31.59 ? 228 LYS B CE  1 
ATOM   4432 N  NZ  . LYS B 1 228 ? 11.318  -14.684 -64.586  1.00 29.56 ? 228 LYS B NZ  1 
ATOM   4433 N  N   . PHE B 1 229 ? 17.799  -16.307 -60.682  1.00 33.46 ? 229 PHE B N   1 
ATOM   4434 C  CA  . PHE B 1 229 ? 18.871  -15.985 -59.736  1.00 30.54 ? 229 PHE B CA  1 
ATOM   4435 C  C   . PHE B 1 229 ? 20.226  -15.624 -60.305  1.00 32.72 ? 229 PHE B C   1 
ATOM   4436 O  O   . PHE B 1 229 ? 20.862  -14.665 -59.866  1.00 30.12 ? 229 PHE B O   1 
ATOM   4437 C  CB  . PHE B 1 229 ? 19.015  -17.155 -58.771  1.00 28.30 ? 229 PHE B CB  1 
ATOM   4438 C  CG  . PHE B 1 229 ? 17.779  -17.429 -57.876  1.00 26.11 ? 229 PHE B CG  1 
ATOM   4439 C  CD1 . PHE B 1 229 ? 16.719  -16.516 -57.771  1.00 23.66 ? 229 PHE B CD1 1 
ATOM   4440 C  CD2 . PHE B 1 229 ? 17.701  -18.637 -57.180  1.00 17.22 ? 229 PHE B CD2 1 
ATOM   4441 C  CE1 . PHE B 1 229 ? 15.595  -16.818 -56.992  1.00 25.21 ? 229 PHE B CE1 1 
ATOM   4442 C  CE2 . PHE B 1 229 ? 16.576  -18.926 -56.406  1.00 20.42 ? 229 PHE B CE2 1 
ATOM   4443 C  CZ  . PHE B 1 229 ? 15.515  -18.024 -56.309  1.00 21.49 ? 229 PHE B CZ  1 
ATOM   4444 N  N   . ALA B 1 230 ? 20.669  -16.332 -61.351  1.00 35.64 ? 230 ALA B N   1 
ATOM   4445 C  CA  . ALA B 1 230 ? 21.953  -16.061 -61.997  1.00 33.45 ? 230 ALA B CA  1 
ATOM   4446 C  C   . ALA B 1 230 ? 22.017  -14.652 -62.593  1.00 33.68 ? 230 ALA B C   1 
ATOM   4447 O  O   . ALA B 1 230 ? 22.998  -13.904 -62.510  1.00 30.84 ? 230 ALA B O   1 
ATOM   4448 C  CB  . ALA B 1 230 ? 22.144  -17.085 -63.080  1.00 38.45 ? 230 ALA B CB  1 
ATOM   4449 N  N   . LYS B 1 231 ? 20.885  -14.264 -63.169  1.00 35.83 ? 231 LYS B N   1 
ATOM   4450 C  CA  . LYS B 1 231 ? 20.756  -12.952 -63.743  1.00 35.67 ? 231 LYS B CA  1 
ATOM   4451 C  C   . LYS B 1 231 ? 20.760  -11.945 -62.615  1.00 34.39 ? 231 LYS B C   1 
ATOM   4452 O  O   . LYS B 1 231 ? 21.551  -11.008 -62.675  1.00 34.03 ? 231 LYS B O   1 
ATOM   4453 C  CB  . LYS B 1 231 ? 19.470  -12.906 -64.546  1.00 39.67 ? 231 LYS B CB  1 
ATOM   4454 C  CG  . LYS B 1 231 ? 19.747  -13.449 -65.942  1.00 44.70 ? 231 LYS B CG  1 
ATOM   4455 C  CD  . LYS B 1 231 ? 20.688  -12.486 -66.693  1.00 46.18 ? 231 LYS B CD  1 
ATOM   4456 C  CE  . LYS B 1 231 ? 21.186  -13.064 -68.006  1.00 47.93 ? 231 LYS B CE  1 
ATOM   4457 N  NZ  . LYS B 1 231 ? 20.084  -13.327 -68.915  1.00 51.02 ? 231 LYS B NZ  1 
ATOM   4458 N  N   . ALA B 1 232 ? 19.972  -12.166 -61.547  1.00 33.09 ? 232 ALA B N   1 
ATOM   4459 C  CA  . ALA B 1 232 ? 19.896  -11.261 -60.398  1.00 28.26 ? 232 ALA B CA  1 
ATOM   4460 C  C   . ALA B 1 232 ? 21.236  -11.015 -59.747  1.00 29.06 ? 232 ALA B C   1 
ATOM   4461 O  O   . ALA B 1 232 ? 21.614  -9.862  -59.484  1.00 29.17 ? 232 ALA B O   1 
ATOM   4462 C  CB  . ALA B 1 232 ? 18.985  -11.828 -59.360  1.00 28.14 ? 232 ALA B CB  1 
ATOM   4463 N  N   . LYS B 1 233 ? 21.983  -12.104 -59.571  1.00 30.40 ? 233 LYS B N   1 
ATOM   4464 C  CA  . LYS B 1 233 ? 23.308  -12.047 -58.992  1.00 34.69 ? 233 LYS B CA  1 
ATOM   4465 C  C   . LYS B 1 233 ? 24.172  -11.209 -59.907  1.00 37.85 ? 233 LYS B C   1 
ATOM   4466 O  O   . LYS B 1 233 ? 24.782  -10.243 -59.459  1.00 37.50 ? 233 LYS B O   1 
ATOM   4467 C  CB  . LYS B 1 233 ? 23.874  -13.450 -58.856  1.00 38.75 ? 233 LYS B CB  1 
ATOM   4468 C  CG  . LYS B 1 233 ? 23.098  -14.330 -57.861  1.00 44.59 ? 233 LYS B CG  1 
ATOM   4469 C  CD  . LYS B 1 233 ? 23.896  -15.598 -57.533  1.00 50.89 ? 233 LYS B CD  1 
ATOM   4470 C  CE  . LYS B 1 233 ? 23.090  -16.741 -56.881  1.00 51.02 ? 233 LYS B CE  1 
ATOM   4471 N  NZ  . LYS B 1 233 ? 22.341  -17.540 -57.840  1.00 43.78 ? 233 LYS B NZ  1 
ATOM   4472 N  N   . GLU B 1 234 ? 24.107  -11.501 -61.217  1.00 43.05 ? 234 GLU B N   1 
ATOM   4473 C  CA  . GLU B 1 234 ? 24.850  -10.810 -62.266  1.00 41.51 ? 234 GLU B CA  1 
ATOM   4474 C  C   . GLU B 1 234 ? 24.533  -9.326  -62.245  1.00 40.41 ? 234 GLU B C   1 
ATOM   4475 O  O   . GLU B 1 234 ? 25.429  -8.491  -62.373  1.00 41.19 ? 234 GLU B O   1 
ATOM   4476 C  CB  . GLU B 1 234 ? 24.454  -11.418 -63.602  1.00 46.83 ? 234 GLU B CB  1 
ATOM   4477 C  CG  . GLU B 1 234 ? 25.152  -10.995 -64.905  1.00 55.25 ? 234 GLU B CG  1 
ATOM   4478 C  CD  . GLU B 1 234 ? 24.467  -11.570 -66.151  1.00 57.93 ? 234 GLU B CD  1 
ATOM   4479 O  OE1 . GLU B 1 234 ? 24.565  -12.774 -66.406  1.00 58.91 ? 234 GLU B OE1 1 
ATOM   4480 O  OE2 . GLU B 1 234 ? 23.823  -10.811 -66.871  1.00 60.74 ? 234 GLU B OE2 1 
ATOM   4481 N  N   . LEU B 1 235 ? 23.258  -8.994  -62.049  1.00 37.11 ? 235 LEU B N   1 
ATOM   4482 C  CA  . LEU B 1 235 ? 22.823  -7.617  -62.021  1.00 36.10 ? 235 LEU B CA  1 
ATOM   4483 C  C   . LEU B 1 235 ? 22.968  -6.888  -60.683  1.00 37.10 ? 235 LEU B C   1 
ATOM   4484 O  O   . LEU B 1 235 ? 22.770  -5.671  -60.636  1.00 38.05 ? 235 LEU B O   1 
ATOM   4485 C  CB  . LEU B 1 235 ? 21.377  -7.607  -62.544  1.00 33.76 ? 235 LEU B CB  1 
ATOM   4486 C  CG  . LEU B 1 235 ? 21.235  -7.955  -64.060  1.00 32.65 ? 235 LEU B CG  1 
ATOM   4487 C  CD1 . LEU B 1 235 ? 19.779  -8.044  -64.497  1.00 23.97 ? 235 LEU B CD1 1 
ATOM   4488 C  CD2 . LEU B 1 235 ? 21.960  -6.886  -64.859  1.00 32.55 ? 235 LEU B CD2 1 
ATOM   4489 N  N   . GLY B 1 236 ? 23.307  -7.533  -59.565  1.00 36.02 ? 236 GLY B N   1 
ATOM   4490 C  CA  . GLY B 1 236 ? 23.507  -6.792  -58.322  1.00 34.94 ? 236 GLY B CA  1 
ATOM   4491 C  C   . GLY B 1 236 ? 23.005  -7.441  -57.037  1.00 32.31 ? 236 GLY B C   1 
ATOM   4492 O  O   . GLY B 1 236 ? 23.399  -7.000  -55.962  1.00 30.97 ? 236 GLY B O   1 
ATOM   4493 N  N   . ALA B 1 237 ? 22.122  -8.442  -57.078  1.00 31.01 ? 237 ALA B N   1 
ATOM   4494 C  CA  . ALA B 1 237 ? 21.614  -9.069  -55.884  1.00 30.24 ? 237 ALA B CA  1 
ATOM   4495 C  C   . ALA B 1 237 ? 22.717  -9.818  -55.163  1.00 33.33 ? 237 ALA B C   1 
ATOM   4496 O  O   . ALA B 1 237 ? 23.392  -10.677 -55.738  1.00 34.89 ? 237 ALA B O   1 
ATOM   4497 C  CB  . ALA B 1 237 ? 20.552  -10.079 -56.190  1.00 28.72 ? 237 ALA B CB  1 
ATOM   4498 N  N   . THR B 1 238 ? 22.911  -9.461  -53.895  1.00 31.00 ? 238 THR B N   1 
ATOM   4499 C  CA  . THR B 1 238 ? 23.892  -10.100 -53.058  1.00 27.48 ? 238 THR B CA  1 
ATOM   4500 C  C   . THR B 1 238 ? 23.369  -11.487 -52.681  1.00 27.23 ? 238 THR B C   1 
ATOM   4501 O  O   . THR B 1 238 ? 24.196  -12.314 -52.315  1.00 31.14 ? 238 THR B O   1 
ATOM   4502 C  CB  . THR B 1 238 ? 24.140  -9.238  -51.798  1.00 26.25 ? 238 THR B CB  1 
ATOM   4503 O  OG1 . THR B 1 238 ? 22.863  -8.960  -51.220  1.00 28.48 ? 238 THR B OG1 1 
ATOM   4504 C  CG2 . THR B 1 238 ? 24.856  -7.934  -52.106  1.00 21.79 ? 238 THR B CG2 1 
ATOM   4505 N  N   . GLU B 1 239 ? 22.069  -11.821 -52.673  1.00 21.64 ? 239 GLU B N   1 
ATOM   4506 C  CA  . GLU B 1 239 ? 21.611  -13.166 -52.330  1.00 20.28 ? 239 GLU B CA  1 
ATOM   4507 C  C   . GLU B 1 239 ? 20.303  -13.373 -53.009  1.00 17.95 ? 239 GLU B C   1 
ATOM   4508 O  O   . GLU B 1 239 ? 19.602  -12.387 -53.186  1.00 19.24 ? 239 GLU B O   1 
ATOM   4509 C  CB  . GLU B 1 239 ? 21.232  -13.427 -50.882  1.00 26.21 ? 239 GLU B CB  1 
ATOM   4510 C  CG  . GLU B 1 239 ? 22.293  -13.283 -49.839  1.00 31.82 ? 239 GLU B CG  1 
ATOM   4511 C  CD  . GLU B 1 239 ? 21.842  -12.293 -48.823  1.00 34.92 ? 239 GLU B CD  1 
ATOM   4512 O  OE1 . GLU B 1 239 ? 20.974  -12.648 -48.016  1.00 41.47 ? 239 GLU B OE1 1 
ATOM   4513 O  OE2 . GLU B 1 239 ? 22.353  -11.177 -48.879  1.00 35.35 ? 239 GLU B OE2 1 
ATOM   4514 N  N   . CYS B 1 240 ? 19.881  -14.611 -53.219  1.00 17.21 ? 240 CYS B N   1 
ATOM   4515 C  CA  . CYS B 1 240 ? 18.635  -14.883 -53.901  1.00 19.21 ? 240 CYS B CA  1 
ATOM   4516 C  C   . CYS B 1 240 ? 17.892  -15.813 -52.998  1.00 19.14 ? 240 CYS B C   1 
ATOM   4517 O  O   . CYS B 1 240 ? 18.574  -16.634 -52.399  1.00 24.02 ? 240 CYS B O   1 
ATOM   4518 C  CB  . CYS B 1 240 ? 18.909  -15.550 -55.239  1.00 21.66 ? 240 CYS B CB  1 
ATOM   4519 S  SG  . CYS B 1 240 ? 19.680  -14.423 -56.425  1.00 26.56 ? 240 CYS B SG  1 
ATOM   4520 N  N   . ILE B 1 241 ? 16.574  -15.860 -52.904  1.00 16.92 ? 241 ILE B N   1 
ATOM   4521 C  CA  . ILE B 1 241 ? 15.930  -16.683 -51.905  1.00 19.34 ? 241 ILE B CA  1 
ATOM   4522 C  C   . ILE B 1 241 ? 14.743  -17.268 -52.601  1.00 20.04 ? 241 ILE B C   1 
ATOM   4523 O  O   . ILE B 1 241 ? 14.033  -16.543 -53.280  1.00 25.10 ? 241 ILE B O   1 
ATOM   4524 C  CB  . ILE B 1 241 ? 15.448  -15.785 -50.651  1.00 21.23 ? 241 ILE B CB  1 
ATOM   4525 C  CG1 . ILE B 1 241 ? 16.620  -15.154 -49.917  1.00 20.99 ? 241 ILE B CG1 1 
ATOM   4526 C  CG2 . ILE B 1 241 ? 14.664  -16.600 -49.661  1.00 22.21 ? 241 ILE B CG2 1 
ATOM   4527 C  CD1 . ILE B 1 241 ? 17.703  -16.116 -49.416  1.00 20.04 ? 241 ILE B CD1 1 
ATOM   4528 N  N   . ASN B 1 242 ? 14.488  -18.546 -52.430  1.00 21.30 ? 242 ASN B N   1 
ATOM   4529 C  CA  . ASN B 1 242 ? 13.318  -19.122 -53.021  1.00 24.97 ? 242 ASN B CA  1 
ATOM   4530 C  C   . ASN B 1 242 ? 12.387  -19.495 -51.881  1.00 26.93 ? 242 ASN B C   1 
ATOM   4531 O  O   . ASN B 1 242 ? 12.702  -20.398 -51.096  1.00 25.78 ? 242 ASN B O   1 
ATOM   4532 C  CB  . ASN B 1 242 ? 13.641  -20.370 -53.804  1.00 23.16 ? 242 ASN B CB  1 
ATOM   4533 C  CG  . ASN B 1 242 ? 12.407  -20.933 -54.479  1.00 23.52 ? 242 ASN B CG  1 
ATOM   4534 O  OD1 . ASN B 1 242 ? 11.294  -21.084 -53.952  1.00 19.67 ? 242 ASN B OD1 1 
ATOM   4535 N  ND2 . ASN B 1 242 ? 12.637  -21.272 -55.732  1.00 30.32 ? 242 ASN B ND2 1 
ATOM   4536 N  N   . PRO B 1 243 ? 11.223  -18.857 -51.756  1.00 28.16 ? 243 PRO B N   1 
ATOM   4537 C  CA  . PRO B 1 243 ? 10.235  -19.152 -50.742  1.00 25.21 ? 243 PRO B CA  1 
ATOM   4538 C  C   . PRO B 1 243 ? 9.911   -20.610 -50.565  1.00 27.73 ? 243 PRO B C   1 
ATOM   4539 O  O   . PRO B 1 243 ? 9.527   -21.014 -49.476  1.00 32.47 ? 243 PRO B O   1 
ATOM   4540 C  CB  . PRO B 1 243 ? 9.043   -18.326 -51.155  1.00 22.51 ? 243 PRO B CB  1 
ATOM   4541 C  CG  . PRO B 1 243 ? 9.724   -17.074 -51.607  1.00 25.40 ? 243 PRO B CG  1 
ATOM   4542 C  CD  . PRO B 1 243 ? 10.862  -17.627 -52.462  1.00 28.98 ? 243 PRO B CD  1 
ATOM   4543 N  N   . GLN B 1 244 ? 10.014  -21.437 -51.590  1.00 30.91 ? 244 GLN B N   1 
ATOM   4544 C  CA  . GLN B 1 244 ? 9.684   -22.835 -51.423  1.00 32.82 ? 244 GLN B CA  1 
ATOM   4545 C  C   . GLN B 1 244 ? 10.732  -23.611 -50.655  1.00 29.47 ? 244 GLN B C   1 
ATOM   4546 O  O   . GLN B 1 244 ? 10.428  -24.667 -50.121  1.00 29.05 ? 244 GLN B O   1 
ATOM   4547 C  CB  . GLN B 1 244 ? 9.458   -23.478 -52.780  1.00 36.52 ? 244 GLN B CB  1 
ATOM   4548 C  CG  . GLN B 1 244 ? 7.973   -23.455 -53.135  1.00 44.66 ? 244 GLN B CG  1 
ATOM   4549 C  CD  . GLN B 1 244 ? 7.571   -22.419 -54.180  1.00 52.14 ? 244 GLN B CD  1 
ATOM   4550 O  OE1 . GLN B 1 244 ? 6.607   -21.673 -54.015  1.00 54.61 ? 244 GLN B OE1 1 
ATOM   4551 N  NE2 . GLN B 1 244 ? 8.261   -22.329 -55.312  1.00 53.76 ? 244 GLN B NE2 1 
ATOM   4552 N  N   . ASP B 1 245 ? 11.964  -23.127 -50.540  1.00 30.50 ? 245 ASP B N   1 
ATOM   4553 C  CA  . ASP B 1 245 ? 12.994  -23.831 -49.780  1.00 33.13 ? 245 ASP B CA  1 
ATOM   4554 C  C   . ASP B 1 245 ? 12.731  -23.814 -48.276  1.00 33.63 ? 245 ASP B C   1 
ATOM   4555 O  O   . ASP B 1 245 ? 13.450  -24.482 -47.531  1.00 36.43 ? 245 ASP B O   1 
ATOM   4556 C  CB  . ASP B 1 245 ? 14.379  -23.197 -49.967  1.00 31.14 ? 245 ASP B CB  1 
ATOM   4557 C  CG  . ASP B 1 245 ? 14.967  -23.195 -51.370  1.00 36.35 ? 245 ASP B CG  1 
ATOM   4558 O  OD1 . ASP B 1 245 ? 14.462  -23.919 -52.232  1.00 32.44 ? 245 ASP B OD1 1 
ATOM   4559 O  OD2 . ASP B 1 245 ? 15.943  -22.467 -51.596  1.00 38.97 ? 245 ASP B OD2 1 
ATOM   4560 N  N   . TYR B 1 246 ? 11.713  -23.118 -47.782  1.00 32.04 ? 246 TYR B N   1 
ATOM   4561 C  CA  . TYR B 1 246 ? 11.501  -22.957 -46.366  1.00 30.34 ? 246 TYR B CA  1 
ATOM   4562 C  C   . TYR B 1 246 ? 10.250  -23.519 -45.774  1.00 31.34 ? 246 TYR B C   1 
ATOM   4563 O  O   . TYR B 1 246 ? 9.274   -23.844 -46.456  1.00 31.85 ? 246 TYR B O   1 
ATOM   4564 C  CB  . TYR B 1 246 ? 11.534  -21.488 -46.020  1.00 22.46 ? 246 TYR B CB  1 
ATOM   4565 C  CG  . TYR B 1 246 ? 12.833  -20.842 -46.414  1.00 16.53 ? 246 TYR B CG  1 
ATOM   4566 C  CD1 . TYR B 1 246 ? 12.992  -20.268 -47.670  1.00 20.03 ? 246 TYR B CD1 1 
ATOM   4567 C  CD2 . TYR B 1 246 ? 13.853  -20.798 -45.502  1.00 19.19 ? 246 TYR B CD2 1 
ATOM   4568 C  CE1 . TYR B 1 246 ? 14.180  -19.634 -48.022  1.00 13.67 ? 246 TYR B CE1 1 
ATOM   4569 C  CE2 . TYR B 1 246 ? 15.048  -20.158 -45.841  1.00 24.93 ? 246 TYR B CE2 1 
ATOM   4570 C  CZ  . TYR B 1 246 ? 15.203  -19.588 -47.098  1.00 17.21 ? 246 TYR B CZ  1 
ATOM   4571 O  OH  . TYR B 1 246 ? 16.392  -18.966 -47.390  1.00 18.20 ? 246 TYR B OH  1 
ATOM   4572 N  N   . LYS B 1 247 ? 10.357  -23.594 -44.450  1.00 28.21 ? 247 LYS B N   1 
ATOM   4573 C  CA  . LYS B 1 247 ? 9.250   -24.047 -43.665  1.00 29.90 ? 247 LYS B CA  1 
ATOM   4574 C  C   . LYS B 1 247 ? 8.602   -22.850 -42.951  1.00 29.89 ? 247 LYS B C   1 
ATOM   4575 O  O   . LYS B 1 247 ? 7.429   -22.910 -42.573  1.00 30.11 ? 247 LYS B O   1 
ATOM   4576 C  CB  . LYS B 1 247 ? 9.798   -25.095 -42.727  1.00 34.15 ? 247 LYS B CB  1 
ATOM   4577 C  CG  . LYS B 1 247 ? 9.130   -26.431 -43.031  1.00 35.81 ? 247 LYS B CG  1 
ATOM   4578 C  CD  . LYS B 1 247 ? 9.700   -27.563 -42.208  1.00 36.33 ? 247 LYS B CD  1 
ATOM   4579 C  CE  . LYS B 1 247 ? 11.149  -27.742 -42.594  1.00 47.16 ? 247 LYS B CE  1 
ATOM   4580 N  NZ  . LYS B 1 247 ? 11.734  -28.972 -42.076  1.00 53.79 ? 247 LYS B NZ  1 
ATOM   4581 N  N   . LYS B 1 248 ? 9.280   -21.717 -42.750  1.00 29.10 ? 248 LYS B N   1 
ATOM   4582 C  CA  . LYS B 1 248 ? 8.636   -20.582 -42.103  1.00 35.10 ? 248 LYS B CA  1 
ATOM   4583 C  C   . LYS B 1 248 ? 8.367   -19.489 -43.163  1.00 36.93 ? 248 LYS B C   1 
ATOM   4584 O  O   . LYS B 1 248 ? 9.077   -19.434 -44.187  1.00 36.45 ? 248 LYS B O   1 
ATOM   4585 C  CB  . LYS B 1 248 ? 9.548   -20.084 -40.964  1.00 33.36 ? 248 LYS B CB  1 
ATOM   4586 C  CG  . LYS B 1 248 ? 10.805  -19.472 -41.474  1.00 35.92 ? 248 LYS B CG  1 
ATOM   4587 C  CD  . LYS B 1 248 ? 11.945  -19.441 -40.507  1.00 40.45 ? 248 LYS B CD  1 
ATOM   4588 C  CE  . LYS B 1 248 ? 11.590  -18.757 -39.218  1.00 44.89 ? 248 LYS B CE  1 
ATOM   4589 N  NZ  . LYS B 1 248 ? 12.845  -18.321 -38.678  1.00 45.25 ? 248 LYS B NZ  1 
ATOM   4590 N  N   . PRO B 1 249 ? 7.357   -18.605 -43.009  1.00 35.31 ? 249 PRO B N   1 
ATOM   4591 C  CA  . PRO B 1 249 ? 7.035   -17.559 -43.981  1.00 29.18 ? 249 PRO B CA  1 
ATOM   4592 C  C   . PRO B 1 249 ? 8.232   -16.672 -44.299  1.00 25.13 ? 249 PRO B C   1 
ATOM   4593 O  O   . PRO B 1 249 ? 9.058   -16.301 -43.453  1.00 24.93 ? 249 PRO B O   1 
ATOM   4594 C  CB  . PRO B 1 249 ? 5.888   -16.860 -43.331  1.00 30.68 ? 249 PRO B CB  1 
ATOM   4595 C  CG  . PRO B 1 249 ? 5.209   -17.957 -42.552  1.00 32.02 ? 249 PRO B CG  1 
ATOM   4596 C  CD  . PRO B 1 249 ? 6.417   -18.594 -41.891  1.00 33.39 ? 249 PRO B CD  1 
ATOM   4597 N  N   . ILE B 1 250 ? 8.324   -16.307 -45.569  1.00 24.57 ? 250 ILE B N   1 
ATOM   4598 C  CA  . ILE B 1 250 ? 9.448   -15.529 -46.080  1.00 20.61 ? 250 ILE B CA  1 
ATOM   4599 C  C   . ILE B 1 250 ? 9.717   -14.251 -45.311  1.00 18.22 ? 250 ILE B C   1 
ATOM   4600 O  O   . ILE B 1 250 ? 10.878  -13.864 -45.199  1.00 18.40 ? 250 ILE B O   1 
ATOM   4601 C  CB  . ILE B 1 250 ? 9.171   -15.333 -47.644  1.00 21.19 ? 250 ILE B CB  1 
ATOM   4602 C  CG1 . ILE B 1 250 ? 10.325  -14.644 -48.342  1.00 16.61 ? 250 ILE B CG1 1 
ATOM   4603 C  CG2 . ILE B 1 250 ? 7.886   -14.527 -47.841  1.00 25.16 ? 250 ILE B CG2 1 
ATOM   4604 C  CD1 . ILE B 1 250 ? 11.684  -15.381 -48.220  1.00 20.02 ? 250 ILE B CD1 1 
ATOM   4605 N  N   . GLN B 1 251 ? 8.733   -13.587 -44.697  1.00 22.02 ? 251 GLN B N   1 
ATOM   4606 C  CA  . GLN B 1 251 ? 9.039   -12.374 -43.922  1.00 23.16 ? 251 GLN B CA  1 
ATOM   4607 C  C   . GLN B 1 251 ? 9.913   -12.767 -42.747  1.00 23.45 ? 251 GLN B C   1 
ATOM   4608 O  O   . GLN B 1 251 ? 10.961  -12.158 -42.552  1.00 22.54 ? 251 GLN B O   1 
ATOM   4609 C  CB  . GLN B 1 251 ? 7.905   -11.699 -43.229  1.00 22.11 ? 251 GLN B CB  1 
ATOM   4610 C  CG  . GLN B 1 251 ? 6.635   -11.721 -43.939  1.00 24.07 ? 251 GLN B CG  1 
ATOM   4611 C  CD  . GLN B 1 251 ? 5.852   -12.958 -43.670  1.00 28.38 ? 251 GLN B CD  1 
ATOM   4612 O  OE1 . GLN B 1 251 ? 5.833   -13.852 -44.500  1.00 34.36 ? 251 GLN B OE1 1 
ATOM   4613 N  NE2 . GLN B 1 251 ? 5.204   -13.065 -42.528  1.00 35.04 ? 251 GLN B NE2 1 
ATOM   4614 N  N   . GLU B 1 252 ? 9.496   -13.820 -42.019  1.00 22.01 ? 252 GLU B N   1 
ATOM   4615 C  CA  . GLU B 1 252 ? 10.214  -14.304 -40.865  1.00 22.94 ? 252 GLU B CA  1 
ATOM   4616 C  C   . GLU B 1 252 ? 11.672  -14.595 -41.229  1.00 25.00 ? 252 GLU B C   1 
ATOM   4617 O  O   . GLU B 1 252 ? 12.593  -14.053 -40.597  1.00 26.44 ? 252 GLU B O   1 
ATOM   4618 C  CB  . GLU B 1 252 ? 9.494   -15.525 -40.372  1.00 25.02 ? 252 GLU B CB  1 
ATOM   4619 C  CG  . GLU B 1 252 ? 8.223   -15.171 -39.576  1.00 34.38 ? 252 GLU B CG  1 
ATOM   4620 C  CD  . GLU B 1 252 ? 7.661   -16.299 -38.670  1.00 42.51 ? 252 GLU B CD  1 
ATOM   4621 O  OE1 . GLU B 1 252 ? 8.300   -17.346 -38.450  1.00 41.81 ? 252 GLU B OE1 1 
ATOM   4622 O  OE2 . GLU B 1 252 ? 6.553   -16.122 -38.157  1.00 45.88 ? 252 GLU B OE2 1 
ATOM   4623 N  N   . VAL B 1 253 ? 11.903  -15.339 -42.327  1.00 23.16 ? 253 VAL B N   1 
ATOM   4624 C  CA  . VAL B 1 253 ? 13.247  -15.644 -42.816  1.00 19.56 ? 253 VAL B CA  1 
ATOM   4625 C  C   . VAL B 1 253 ? 14.006  -14.348 -43.084  1.00 22.54 ? 253 VAL B C   1 
ATOM   4626 O  O   . VAL B 1 253 ? 15.157  -14.176 -42.684  1.00 26.96 ? 253 VAL B O   1 
ATOM   4627 C  CB  . VAL B 1 253 ? 13.155  -16.474 -44.134  1.00 20.41 ? 253 VAL B CB  1 
ATOM   4628 C  CG1 . VAL B 1 253 ? 14.533  -16.693 -44.702  1.00 16.53 ? 253 VAL B CG1 1 
ATOM   4629 C  CG2 . VAL B 1 253 ? 12.560  -17.839 -43.881  1.00 9.69  ? 253 VAL B CG2 1 
ATOM   4630 N  N   . LEU B 1 254 ? 13.377  -13.394 -43.758  1.00 22.70 ? 254 LEU B N   1 
ATOM   4631 C  CA  . LEU B 1 254 ? 14.028  -12.149 -44.089  1.00 22.49 ? 254 LEU B CA  1 
ATOM   4632 C  C   . LEU B 1 254 ? 14.238  -11.259 -42.889  1.00 20.09 ? 254 LEU B C   1 
ATOM   4633 O  O   . LEU B 1 254 ? 15.309  -10.660 -42.796  1.00 17.89 ? 254 LEU B O   1 
ATOM   4634 C  CB  . LEU B 1 254 ? 13.196  -11.448 -45.155  1.00 29.90 ? 254 LEU B CB  1 
ATOM   4635 C  CG  . LEU B 1 254 ? 13.369  -11.804 -46.639  1.00 30.19 ? 254 LEU B CG  1 
ATOM   4636 C  CD1 . LEU B 1 254 ? 12.255  -11.222 -47.494  1.00 26.97 ? 254 LEU B CD1 1 
ATOM   4637 C  CD2 . LEU B 1 254 ? 14.683  -11.224 -47.095  1.00 30.21 ? 254 LEU B CD2 1 
ATOM   4638 N  N   . LYS B 1 255 ? 13.311  -11.204 -41.924  1.00 20.36 ? 255 LYS B N   1 
ATOM   4639 C  CA  . LYS B 1 255 ? 13.440  -10.399 -40.706  1.00 19.45 ? 255 LYS B CA  1 
ATOM   4640 C  C   . LYS B 1 255 ? 14.676  -10.877 -39.968  1.00 14.70 ? 255 LYS B C   1 
ATOM   4641 O  O   . LYS B 1 255 ? 15.596  -10.131 -39.600  1.00 15.46 ? 255 LYS B O   1 
ATOM   4642 C  CB  . LYS B 1 255 ? 12.229  -10.583 -39.814  1.00 21.40 ? 255 LYS B CB  1 
ATOM   4643 C  CG  . LYS B 1 255 ? 10.949  -9.841  -40.228  1.00 27.81 ? 255 LYS B CG  1 
ATOM   4644 C  CD  . LYS B 1 255 ? 9.973   -9.962  -39.052  1.00 31.13 ? 255 LYS B CD  1 
ATOM   4645 C  CE  . LYS B 1 255 ? 8.593   -9.299  -39.201  1.00 36.53 ? 255 LYS B CE  1 
ATOM   4646 N  NZ  . LYS B 1 255 ? 7.556   -10.198 -39.688  1.00 33.03 ? 255 LYS B NZ  1 
ATOM   4647 N  N   . GLU B 1 256 ? 14.733  -12.204 -39.882  1.00 15.02 ? 256 GLU B N   1 
ATOM   4648 C  CA  . GLU B 1 256 ? 15.846  -12.866 -39.251  1.00 18.27 ? 256 GLU B CA  1 
ATOM   4649 C  C   . GLU B 1 256 ? 17.182  -12.700 -39.915  1.00 17.90 ? 256 GLU B C   1 
ATOM   4650 O  O   . GLU B 1 256 ? 18.228  -12.527 -39.285  1.00 21.42 ? 256 GLU B O   1 
ATOM   4651 C  CB  . GLU B 1 256 ? 15.490  -14.308 -39.143  1.00 26.10 ? 256 GLU B CB  1 
ATOM   4652 C  CG  . GLU B 1 256 ? 14.521  -14.337 -37.960  1.00 34.64 ? 256 GLU B CG  1 
ATOM   4653 C  CD  . GLU B 1 256 ? 13.980  -15.703 -37.644  1.00 39.56 ? 256 GLU B CD  1 
ATOM   4654 O  OE1 . GLU B 1 256 ? 14.765  -16.650 -37.683  1.00 42.71 ? 256 GLU B OE1 1 
ATOM   4655 O  OE2 . GLU B 1 256 ? 12.778  -15.809 -37.372  1.00 46.06 ? 256 GLU B OE2 1 
ATOM   4656 N  N   . MET B 1 257 ? 17.138  -12.695 -41.227  1.00 19.84 ? 257 MET B N   1 
ATOM   4657 C  CA  . MET B 1 257 ? 18.317  -12.552 -42.052  1.00 22.52 ? 257 MET B CA  1 
ATOM   4658 C  C   . MET B 1 257 ? 18.867  -11.140 -41.982  1.00 24.90 ? 257 MET B C   1 
ATOM   4659 O  O   . MET B 1 257 ? 20.058  -10.898 -42.152  1.00 22.54 ? 257 MET B O   1 
ATOM   4660 C  CB  . MET B 1 257 ? 17.903  -12.912 -43.490  1.00 26.69 ? 257 MET B CB  1 
ATOM   4661 C  CG  . MET B 1 257 ? 19.026  -13.172 -44.491  1.00 30.51 ? 257 MET B CG  1 
ATOM   4662 S  SD  . MET B 1 257 ? 18.477  -13.758 -46.122  1.00 30.96 ? 257 MET B SD  1 
ATOM   4663 C  CE  . MET B 1 257 ? 17.307  -15.042 -45.756  1.00 13.53 ? 257 MET B CE  1 
ATOM   4664 N  N   . THR B 1 258 ? 17.987  -10.165 -41.752  1.00 30.02 ? 258 THR B N   1 
ATOM   4665 C  CA  . THR B 1 258 ? 18.414  -8.787  -41.781  1.00 31.16 ? 258 THR B CA  1 
ATOM   4666 C  C   . THR B 1 258 ? 18.307  -7.948  -40.537  1.00 36.22 ? 258 THR B C   1 
ATOM   4667 O  O   . THR B 1 258 ? 17.987  -6.763  -40.603  1.00 41.90 ? 258 THR B O   1 
ATOM   4668 C  CB  . THR B 1 258 ? 17.669  -8.118  -42.956  1.00 28.14 ? 258 THR B CB  1 
ATOM   4669 O  OG1 . THR B 1 258 ? 16.297  -8.446  -42.814  1.00 17.93 ? 258 THR B OG1 1 
ATOM   4670 C  CG2 . THR B 1 258 ? 18.173  -8.581  -44.313  1.00 27.71 ? 258 THR B CG2 1 
ATOM   4671 N  N   . ASP B 1 259 ? 18.505  -8.548  -39.367  1.00 39.05 ? 259 ASP B N   1 
ATOM   4672 C  CA  . ASP B 1 259 ? 18.558  -7.808  -38.107  1.00 39.47 ? 259 ASP B CA  1 
ATOM   4673 C  C   . ASP B 1 259 ? 17.245  -7.108  -37.795  1.00 33.93 ? 259 ASP B C   1 
ATOM   4674 O  O   . ASP B 1 259 ? 17.183  -5.985  -37.304  1.00 32.14 ? 259 ASP B O   1 
ATOM   4675 C  CB  . ASP B 1 259 ? 19.754  -6.829  -38.250  1.00 47.65 ? 259 ASP B CB  1 
ATOM   4676 C  CG  . ASP B 1 259 ? 20.480  -6.319  -37.018  1.00 56.04 ? 259 ASP B CG  1 
ATOM   4677 O  OD1 . ASP B 1 259 ? 20.034  -5.321  -36.437  1.00 59.72 ? 259 ASP B OD1 1 
ATOM   4678 O  OD2 . ASP B 1 259 ? 21.517  -6.909  -36.682  1.00 59.83 ? 259 ASP B OD2 1 
ATOM   4679 N  N   . GLY B 1 260 ? 16.137  -7.752  -38.088  1.00 28.36 ? 260 GLY B N   1 
ATOM   4680 C  CA  . GLY B 1 260 ? 14.889  -7.091  -37.791  1.00 25.71 ? 260 GLY B CA  1 
ATOM   4681 C  C   . GLY B 1 260 ? 14.145  -6.623  -39.020  1.00 24.70 ? 260 GLY B C   1 
ATOM   4682 O  O   . GLY B 1 260 ? 12.971  -6.244  -38.901  1.00 24.25 ? 260 GLY B O   1 
ATOM   4683 N  N   . GLY B 1 261 ? 14.805  -6.542  -40.171  1.00 24.40 ? 261 GLY B N   1 
ATOM   4684 C  CA  . GLY B 1 261 ? 14.106  -6.195  -41.385  1.00 22.49 ? 261 GLY B CA  1 
ATOM   4685 C  C   . GLY B 1 261 ? 14.975  -5.482  -42.398  1.00 20.76 ? 261 GLY B C   1 
ATOM   4686 O  O   . GLY B 1 261 ? 16.007  -4.858  -42.143  1.00 18.63 ? 261 GLY B O   1 
ATOM   4687 N  N   . VAL B 1 262 ? 14.416  -5.482  -43.578  1.00 16.39 ? 262 VAL B N   1 
ATOM   4688 C  CA  . VAL B 1 262 ? 15.095  -4.854  -44.691  1.00 16.42 ? 262 VAL B CA  1 
ATOM   4689 C  C   . VAL B 1 262 ? 14.798  -3.354  -44.614  1.00 14.41 ? 262 VAL B C   1 
ATOM   4690 O  O   . VAL B 1 262 ? 13.797  -2.904  -44.038  1.00 13.19 ? 262 VAL B O   1 
ATOM   4691 C  CB  . VAL B 1 262 ? 14.503  -5.728  -45.845  1.00 16.90 ? 262 VAL B CB  1 
ATOM   4692 C  CG1 . VAL B 1 262 ? 13.548  -4.953  -46.688  1.00 10.03 ? 262 VAL B CG1 1 
ATOM   4693 C  CG2 . VAL B 1 262 ? 15.658  -6.396  -46.537  1.00 12.85 ? 262 VAL B CG2 1 
ATOM   4694 N  N   . ASP B 1 263 ? 15.685  -2.531  -45.129  1.00 19.92 ? 263 ASP B N   1 
ATOM   4695 C  CA  . ASP B 1 263 ? 15.466  -1.095  -45.160  1.00 23.23 ? 263 ASP B CA  1 
ATOM   4696 C  C   . ASP B 1 263 ? 14.453  -0.678  -46.226  1.00 24.00 ? 263 ASP B C   1 
ATOM   4697 O  O   . ASP B 1 263 ? 13.692  0.281   -46.040  1.00 24.55 ? 263 ASP B O   1 
ATOM   4698 C  CB  . ASP B 1 263 ? 16.734  -0.353  -45.468  1.00 27.54 ? 263 ASP B CB  1 
ATOM   4699 C  CG  . ASP B 1 263 ? 17.708  -0.347  -44.320  1.00 33.17 ? 263 ASP B CG  1 
ATOM   4700 O  OD1 . ASP B 1 263 ? 17.330  0.134   -43.260  1.00 39.98 ? 263 ASP B OD1 1 
ATOM   4701 O  OD2 . ASP B 1 263 ? 18.837  -0.799  -44.483  1.00 33.96 ? 263 ASP B OD2 1 
ATOM   4702 N  N   . PHE B 1 264 ? 14.454  -1.386  -47.362  1.00 22.92 ? 264 PHE B N   1 
ATOM   4703 C  CA  . PHE B 1 264 ? 13.588  -1.095  -48.499  1.00 16.93 ? 264 PHE B CA  1 
ATOM   4704 C  C   . PHE B 1 264 ? 13.026  -2.371  -49.101  1.00 13.49 ? 264 PHE B C   1 
ATOM   4705 O  O   . PHE B 1 264 ? 13.841  -3.254  -49.396  1.00 14.48 ? 264 PHE B O   1 
ATOM   4706 C  CB  . PHE B 1 264 ? 14.430  -0.341  -49.517  1.00 9.50  ? 264 PHE B CB  1 
ATOM   4707 C  CG  . PHE B 1 264 ? 14.906  1.035   -49.023  1.00 2.20  ? 264 PHE B CG  1 
ATOM   4708 C  CD1 . PHE B 1 264 ? 14.012  2.090   -48.986  1.00 2.00  ? 264 PHE B CD1 1 
ATOM   4709 C  CD2 . PHE B 1 264 ? 16.237  1.257   -48.683  1.00 4.14  ? 264 PHE B CD2 1 
ATOM   4710 C  CE1 . PHE B 1 264 ? 14.447  3.359   -48.623  1.00 2.00  ? 264 PHE B CE1 1 
ATOM   4711 C  CE2 . PHE B 1 264 ? 16.671  2.533   -48.315  1.00 4.88  ? 264 PHE B CE2 1 
ATOM   4712 C  CZ  . PHE B 1 264 ? 15.769  3.588   -48.289  1.00 2.00  ? 264 PHE B CZ  1 
ATOM   4713 N  N   . SER B 1 265 ? 11.726  -2.643  -49.198  1.00 11.88 ? 265 SER B N   1 
ATOM   4714 C  CA  . SER B 1 265 ? 11.291  -3.859  -49.864  1.00 14.06 ? 265 SER B CA  1 
ATOM   4715 C  C   . SER B 1 265 ? 10.495  -3.429  -51.106  1.00 15.37 ? 265 SER B C   1 
ATOM   4716 O  O   . SER B 1 265 ? 9.872   -2.365  -51.095  1.00 13.19 ? 265 SER B O   1 
ATOM   4717 C  CB  . SER B 1 265 ? 10.419  -4.726  -48.959  1.00 11.68 ? 265 SER B CB  1 
ATOM   4718 O  OG  . SER B 1 265 ? 9.601   -3.990  -48.073  1.00 22.36 ? 265 SER B OG  1 
ATOM   4719 N  N   . PHE B 1 266 ? 10.556  -4.177  -52.224  1.00 15.51 ? 266 PHE B N   1 
ATOM   4720 C  CA  . PHE B 1 266 ? 9.843   -3.845  -53.473  1.00 10.89 ? 266 PHE B CA  1 
ATOM   4721 C  C   . PHE B 1 266 ? 8.979   -5.012  -53.858  1.00 6.39  ? 266 PHE B C   1 
ATOM   4722 O  O   . PHE B 1 266 ? 9.517   -6.108  -53.910  1.00 10.57 ? 266 PHE B O   1 
ATOM   4723 C  CB  . PHE B 1 266 ? 10.852  -3.580  -54.584  1.00 4.11  ? 266 PHE B CB  1 
ATOM   4724 C  CG  . PHE B 1 266 ? 11.763  -2.378  -54.271  1.00 6.62  ? 266 PHE B CG  1 
ATOM   4725 C  CD1 . PHE B 1 266 ? 11.375  -1.088  -54.638  1.00 2.00  ? 266 PHE B CD1 1 
ATOM   4726 C  CD2 . PHE B 1 266 ? 12.986  -2.570  -53.639  1.00 2.66  ? 266 PHE B CD2 1 
ATOM   4727 C  CE1 . PHE B 1 266 ? 12.219  -0.008  -54.374  1.00 2.00  ? 266 PHE B CE1 1 
ATOM   4728 C  CE2 . PHE B 1 266 ? 13.824  -1.486  -53.383  1.00 4.01  ? 266 PHE B CE2 1 
ATOM   4729 C  CZ  . PHE B 1 266 ? 13.454  -0.193  -53.749  1.00 2.00  ? 266 PHE B CZ  1 
ATOM   4730 N  N   . GLU B 1 267 ? 7.680   -4.974  -54.024  1.00 5.69  ? 267 GLU B N   1 
ATOM   4731 C  CA  . GLU B 1 267 ? 7.009   -6.161  -54.487  1.00 10.17 ? 267 GLU B CA  1 
ATOM   4732 C  C   . GLU B 1 267 ? 6.907   -5.957  -56.033  1.00 17.15 ? 267 GLU B C   1 
ATOM   4733 O  O   . GLU B 1 267 ? 6.175   -5.063  -56.489  1.00 15.93 ? 267 GLU B O   1 
ATOM   4734 C  CB  . GLU B 1 267 ? 5.658   -6.240  -53.892  1.00 9.99  ? 267 GLU B CB  1 
ATOM   4735 C  CG  . GLU B 1 267 ? 5.141   -7.616  -54.214  1.00 17.90 ? 267 GLU B CG  1 
ATOM   4736 C  CD  . GLU B 1 267 ? 4.098   -7.695  -55.306  1.00 25.41 ? 267 GLU B CD  1 
ATOM   4737 O  OE1 . GLU B 1 267 ? 4.115   -6.864  -56.204  1.00 32.79 ? 267 GLU B OE1 1 
ATOM   4738 O  OE2 . GLU B 1 267 ? 3.253   -8.589  -55.261  1.00 24.96 ? 267 GLU B OE2 1 
ATOM   4739 N  N   . VAL B 1 268 ? 7.552   -6.731  -56.922  1.00 14.73 ? 268 VAL B N   1 
ATOM   4740 C  CA  . VAL B 1 268 ? 7.440   -6.517  -58.352  1.00 16.28 ? 268 VAL B CA  1 
ATOM   4741 C  C   . VAL B 1 268 ? 6.866   -7.784  -58.991  1.00 15.49 ? 268 VAL B C   1 
ATOM   4742 O  O   . VAL B 1 268 ? 7.483   -8.393  -59.842  1.00 24.90 ? 268 VAL B O   1 
ATOM   4743 C  CB  . VAL B 1 268 ? 8.812   -6.193  -58.844  1.00 14.68 ? 268 VAL B CB  1 
ATOM   4744 C  CG1 . VAL B 1 268 ? 8.559   -5.516  -60.132  1.00 13.49 ? 268 VAL B CG1 1 
ATOM   4745 C  CG2 . VAL B 1 268 ? 9.631   -5.259  -57.955  1.00 17.11 ? 268 VAL B CG2 1 
ATOM   4746 N  N   . ILE B 1 269 ? 5.663   -8.187  -58.601  1.00 10.08 ? 269 ILE B N   1 
ATOM   4747 C  CA  . ILE B 1 269 ? 4.994   -9.388  -59.025  1.00 10.90 ? 269 ILE B CA  1 
ATOM   4748 C  C   . ILE B 1 269 ? 3.539   -9.028  -59.193  1.00 17.90 ? 269 ILE B C   1 
ATOM   4749 O  O   . ILE B 1 269 ? 2.991   -9.201  -60.270  1.00 26.30 ? 269 ILE B O   1 
ATOM   4750 C  CB  . ILE B 1 269 ? 5.006   -10.529 -57.974  1.00 13.14 ? 269 ILE B CB  1 
ATOM   4751 C  CG1 . ILE B 1 269 ? 6.404   -10.979 -57.761  1.00 18.64 ? 269 ILE B CG1 1 
ATOM   4752 C  CG2 . ILE B 1 269 ? 4.147   -11.722 -58.399  1.00 12.18 ? 269 ILE B CG2 1 
ATOM   4753 C  CD1 . ILE B 1 269 ? 6.515   -11.630 -56.379  1.00 14.47 ? 269 ILE B CD1 1 
ATOM   4754 N  N   . GLY B 1 270 ? 2.824   -8.626  -58.140  1.00 22.93 ? 270 GLY B N   1 
ATOM   4755 C  CA  . GLY B 1 270 ? 1.410   -8.266  -58.203  1.00 22.03 ? 270 GLY B CA  1 
ATOM   4756 C  C   . GLY B 1 270 ? 0.517   -9.242  -57.467  1.00 22.09 ? 270 GLY B C   1 
ATOM   4757 O  O   . GLY B 1 270 ? -0.648  -9.392  -57.803  1.00 28.07 ? 270 GLY B O   1 
ATOM   4758 N  N   . ARG B 1 271 ? 0.985   -9.998  -56.494  1.00 24.20 ? 271 ARG B N   1 
ATOM   4759 C  CA  . ARG B 1 271 ? 0.114   -10.916 -55.778  1.00 24.35 ? 271 ARG B CA  1 
ATOM   4760 C  C   . ARG B 1 271 ? -0.154  -10.280 -54.432  1.00 22.92 ? 271 ARG B C   1 
ATOM   4761 O  O   . ARG B 1 271 ? 0.690   -9.530  -53.920  1.00 22.72 ? 271 ARG B O   1 
ATOM   4762 C  CB  . ARG B 1 271 ? 0.802   -12.244 -55.572  1.00 26.65 ? 271 ARG B CB  1 
ATOM   4763 C  CG  . ARG B 1 271 ? 0.986   -13.083 -56.819  1.00 31.88 ? 271 ARG B CG  1 
ATOM   4764 C  CD  . ARG B 1 271 ? 1.693   -14.407 -56.590  1.00 33.01 ? 271 ARG B CD  1 
ATOM   4765 N  NE  . ARG B 1 271 ? 0.973   -15.148 -55.584  1.00 40.31 ? 271 ARG B NE  1 
ATOM   4766 C  CZ  . ARG B 1 271 ? 0.104   -16.116 -55.856  1.00 52.21 ? 271 ARG B CZ  1 
ATOM   4767 N  NH1 . ARG B 1 271 ? -0.115  -16.515 -57.108  1.00 61.10 ? 271 ARG B NH1 1 
ATOM   4768 N  NH2 . ARG B 1 271 ? -0.532  -16.746 -54.857  1.00 54.16 ? 271 ARG B NH2 1 
ATOM   4769 N  N   . LEU B 1 272 ? -1.278  -10.575 -53.807  1.00 22.98 ? 272 LEU B N   1 
ATOM   4770 C  CA  . LEU B 1 272 ? -1.554  -10.007 -52.491  1.00 24.40 ? 272 LEU B CA  1 
ATOM   4771 C  C   . LEU B 1 272 ? -0.607  -10.511 -51.402  1.00 26.65 ? 272 LEU B C   1 
ATOM   4772 O  O   . LEU B 1 272 ? -0.010  -9.711  -50.665  1.00 27.32 ? 272 LEU B O   1 
ATOM   4773 C  CB  . LEU B 1 272 ? -2.985  -10.308 -52.084  1.00 18.62 ? 272 LEU B CB  1 
ATOM   4774 C  CG  . LEU B 1 272 ? -4.082  -9.505  -52.778  1.00 15.86 ? 272 LEU B CG  1 
ATOM   4775 C  CD1 . LEU B 1 272 ? -5.391  -9.915  -52.138  1.00 22.17 ? 272 LEU B CD1 1 
ATOM   4776 C  CD2 . LEU B 1 272 ? -3.937  -8.038  -52.614  1.00 13.35 ? 272 LEU B CD2 1 
ATOM   4777 N  N   . ASP B 1 273 ? -0.349  -11.828 -51.365  1.00 27.23 ? 273 ASP B N   1 
ATOM   4778 C  CA  . ASP B 1 273 ? 0.537   -12.389 -50.361  1.00 24.99 ? 273 ASP B CA  1 
ATOM   4779 C  C   . ASP B 1 273 ? 1.918   -11.822 -50.398  1.00 24.37 ? 273 ASP B C   1 
ATOM   4780 O  O   . ASP B 1 273 ? 2.504   -11.560 -49.348  1.00 29.86 ? 273 ASP B O   1 
ATOM   4781 C  CB  . ASP B 1 273 ? 0.658   -13.898 -50.481  1.00 28.39 ? 273 ASP B CB  1 
ATOM   4782 C  CG  . ASP B 1 273 ? 0.860   -14.536 -51.848  1.00 31.80 ? 273 ASP B CG  1 
ATOM   4783 O  OD1 . ASP B 1 273 ? 1.779   -14.169 -52.576  1.00 36.59 ? 273 ASP B OD1 1 
ATOM   4784 O  OD2 . ASP B 1 273 ? 0.093   -15.440 -52.155  1.00 35.58 ? 273 ASP B OD2 1 
ATOM   4785 N  N   . THR B 1 274 ? 2.433   -11.584 -51.592  1.00 20.69 ? 274 THR B N   1 
ATOM   4786 C  CA  . THR B 1 274 ? 3.756   -11.019 -51.707  1.00 19.94 ? 274 THR B CA  1 
ATOM   4787 C  C   . THR B 1 274 ? 3.683   -9.566  -51.345  1.00 19.43 ? 274 THR B C   1 
ATOM   4788 O  O   . THR B 1 274 ? 4.702   -9.059  -50.894  1.00 24.50 ? 274 THR B O   1 
ATOM   4789 C  CB  . THR B 1 274 ? 4.325   -11.194 -53.156  1.00 22.03 ? 274 THR B CB  1 
ATOM   4790 O  OG1 . THR B 1 274 ? 3.271   -11.202 -54.140  1.00 19.30 ? 274 THR B OG1 1 
ATOM   4791 C  CG2 . THR B 1 274 ? 5.136   -12.452 -53.175  1.00 21.52 ? 274 THR B CG2 1 
ATOM   4792 N  N   . MET B 1 275 ? 2.567   -8.846  -51.529  1.00 19.78 ? 275 MET B N   1 
ATOM   4793 C  CA  . MET B 1 275 ? 2.516   -7.436  -51.116  1.00 22.22 ? 275 MET B CA  1 
ATOM   4794 C  C   . MET B 1 275 ? 2.636   -7.354  -49.575  1.00 17.05 ? 275 MET B C   1 
ATOM   4795 O  O   . MET B 1 275 ? 3.370   -6.531  -49.004  1.00 9.67  ? 275 MET B O   1 
ATOM   4796 C  CB  . MET B 1 275 ? 1.201   -6.796  -51.576  1.00 23.67 ? 275 MET B CB  1 
ATOM   4797 C  CG  . MET B 1 275 ? 1.196   -6.643  -53.075  1.00 24.49 ? 275 MET B CG  1 
ATOM   4798 S  SD  . MET B 1 275 ? -0.274  -5.930  -53.858  1.00 30.40 ? 275 MET B SD  1 
ATOM   4799 C  CE  . MET B 1 275 ? 0.836   -5.216  -55.051  1.00 28.27 ? 275 MET B CE  1 
ATOM   4800 N  N   . MET B 1 276 ? 1.938   -8.317  -48.949  1.00 17.63 ? 276 MET B N   1 
ATOM   4801 C  CA  . MET B 1 276 ? 1.956   -8.515  -47.518  1.00 19.58 ? 276 MET B CA  1 
ATOM   4802 C  C   . MET B 1 276 ? 3.351   -8.880  -47.028  1.00 21.02 ? 276 MET B C   1 
ATOM   4803 O  O   . MET B 1 276 ? 3.972   -8.118  -46.261  1.00 21.28 ? 276 MET B O   1 
ATOM   4804 C  CB  . MET B 1 276 ? 0.968   -9.592  -47.161  1.00 21.66 ? 276 MET B CB  1 
ATOM   4805 C  CG  . MET B 1 276 ? -0.350  -8.894  -46.808  1.00 33.66 ? 276 MET B CG  1 
ATOM   4806 S  SD  . MET B 1 276 ? -0.588  -8.147  -45.156  1.00 31.82 ? 276 MET B SD  1 
ATOM   4807 C  CE  . MET B 1 276 ? 0.621   -6.877  -44.973  1.00 31.50 ? 276 MET B CE  1 
ATOM   4808 N  N   . ALA B 1 277 ? 3.944   -9.968  -47.530  1.00 17.70 ? 277 ALA B N   1 
ATOM   4809 C  CA  . ALA B 1 277 ? 5.272   -10.351 -47.105  1.00 15.61 ? 277 ALA B CA  1 
ATOM   4810 C  C   . ALA B 1 277 ? 6.265   -9.259  -47.377  1.00 17.66 ? 277 ALA B C   1 
ATOM   4811 O  O   . ALA B 1 277 ? 7.284   -9.114  -46.694  1.00 23.38 ? 277 ALA B O   1 
ATOM   4812 C  CB  . ALA B 1 277 ? 5.724   -11.576 -47.838  1.00 20.63 ? 277 ALA B CB  1 
ATOM   4813 N  N   . SER B 1 278 ? 5.955   -8.434  -48.366  1.00 16.34 ? 278 SER B N   1 
ATOM   4814 C  CA  . SER B 1 278 ? 6.854   -7.371  -48.695  1.00 18.73 ? 278 SER B CA  1 
ATOM   4815 C  C   . SER B 1 278 ? 6.739   -6.280  -47.646  1.00 19.59 ? 278 SER B C   1 
ATOM   4816 O  O   . SER B 1 278 ? 7.786   -5.670  -47.330  1.00 15.81 ? 278 SER B O   1 
ATOM   4817 C  CB  . SER B 1 278 ? 6.525   -6.846  -50.087  1.00 17.11 ? 278 SER B CB  1 
ATOM   4818 O  OG  . SER B 1 278 ? 7.505   -5.871  -50.422  1.00 31.71 ? 278 SER B OG  1 
ATOM   4819 N  N   . LEU B 1 279 ? 5.518   -6.015  -47.113  1.00 16.74 ? 279 LEU B N   1 
ATOM   4820 C  CA  . LEU B 1 279 ? 5.372   -4.990  -46.071  1.00 16.72 ? 279 LEU B CA  1 
ATOM   4821 C  C   . LEU B 1 279 ? 6.078   -5.492  -44.781  1.00 19.22 ? 279 LEU B C   1 
ATOM   4822 O  O   . LEU B 1 279 ? 7.022   -4.892  -44.261  1.00 22.14 ? 279 LEU B O   1 
ATOM   4823 C  CB  . LEU B 1 279 ? 3.860   -4.726  -45.825  1.00 8.43  ? 279 LEU B CB  1 
ATOM   4824 C  CG  . LEU B 1 279 ? 3.527   -3.531  -44.901  1.00 11.37 ? 279 LEU B CG  1 
ATOM   4825 C  CD1 . LEU B 1 279 ? 4.268   -2.271  -45.330  1.00 3.29  ? 279 LEU B CD1 1 
ATOM   4826 C  CD2 . LEU B 1 279 ? 2.018   -3.386  -44.849  1.00 5.93  ? 279 LEU B CD2 1 
ATOM   4827 N  N   . LEU B 1 280 ? 5.705   -6.704  -44.363  1.00 16.73 ? 280 LEU B N   1 
ATOM   4828 C  CA  . LEU B 1 280 ? 6.231   -7.346  -43.184  1.00 15.24 ? 280 LEU B CA  1 
ATOM   4829 C  C   . LEU B 1 280 ? 7.738   -7.545  -43.085  1.00 18.48 ? 280 LEU B C   1 
ATOM   4830 O  O   . LEU B 1 280 ? 8.286   -7.512  -41.971  1.00 21.89 ? 280 LEU B O   1 
ATOM   4831 C  CB  . LEU B 1 280 ? 5.587   -8.683  -43.036  1.00 8.61  ? 280 LEU B CB  1 
ATOM   4832 C  CG  . LEU B 1 280 ? 4.074   -8.734  -42.919  1.00 7.70  ? 280 LEU B CG  1 
ATOM   4833 C  CD1 . LEU B 1 280 ? 3.630   -10.178 -42.936  1.00 2.00  ? 280 LEU B CD1 1 
ATOM   4834 C  CD2 . LEU B 1 280 ? 3.621   -8.043  -41.659  1.00 8.78  ? 280 LEU B CD2 1 
ATOM   4835 N  N   . CYS B 1 281 ? 8.485   -7.701  -44.172  1.00 13.97 ? 281 CYS B N   1 
ATOM   4836 C  CA  . CYS B 1 281 ? 9.893   -7.938  -43.993  1.00 8.02  ? 281 CYS B CA  1 
ATOM   4837 C  C   . CYS B 1 281 ? 10.690  -6.703  -43.883  1.00 6.40  ? 281 CYS B C   1 
ATOM   4838 O  O   . CYS B 1 281 ? 11.926  -6.814  -43.798  1.00 11.95 ? 281 CYS B O   1 
ATOM   4839 C  CB  . CYS B 1 281 ? 10.436  -8.765  -45.130  1.00 16.73 ? 281 CYS B CB  1 
ATOM   4840 S  SG  . CYS B 1 281 ? 10.568  -7.876  -46.695  1.00 22.59 ? 281 CYS B SG  1 
ATOM   4841 N  N   . CYS B 1 282 ? 10.115  -5.505  -43.965  1.00 8.36  ? 282 CYS B N   1 
ATOM   4842 C  CA  . CYS B 1 282 ? 11.005  -4.334  -43.816  1.00 14.25 ? 282 CYS B CA  1 
ATOM   4843 C  C   . CYS B 1 282 ? 10.785  -3.901  -42.377  1.00 13.19 ? 282 CYS B C   1 
ATOM   4844 O  O   . CYS B 1 282 ? 9.695   -4.041  -41.803  1.00 10.17 ? 282 CYS B O   1 
ATOM   4845 C  CB  . CYS B 1 282 ? 10.681  -3.137  -44.793  1.00 14.99 ? 282 CYS B CB  1 
ATOM   4846 S  SG  . CYS B 1 282 ? 8.947   -2.644  -44.819  1.00 22.67 ? 282 CYS B SG  1 
ATOM   4847 N  N   . HIS B 1 283 ? 11.883  -3.430  -41.796  1.00 15.43 ? 283 HIS B N   1 
ATOM   4848 C  CA  . HIS B 1 283 ? 11.923  -3.022  -40.416  1.00 15.30 ? 283 HIS B CA  1 
ATOM   4849 C  C   . HIS B 1 283 ? 10.749  -2.124  -40.045  1.00 20.89 ? 283 HIS B C   1 
ATOM   4850 O  O   . HIS B 1 283 ? 10.611  -1.044  -40.638  1.00 23.78 ? 283 HIS B O   1 
ATOM   4851 C  CB  . HIS B 1 283 ? 13.246  -2.331  -40.216  1.00 20.09 ? 283 HIS B CB  1 
ATOM   4852 C  CG  . HIS B 1 283 ? 13.666  -2.286  -38.752  1.00 31.15 ? 283 HIS B CG  1 
ATOM   4853 N  ND1 . HIS B 1 283 ? 14.718  -2.885  -38.209  1.00 35.19 ? 283 HIS B ND1 1 
ATOM   4854 C  CD2 . HIS B 1 283 ? 12.987  -1.644  -37.738  1.00 31.39 ? 283 HIS B CD2 1 
ATOM   4855 C  CE1 . HIS B 1 283 ? 14.692  -2.643  -36.927  1.00 37.83 ? 283 HIS B CE1 1 
ATOM   4856 N  NE2 . HIS B 1 283 ? 13.646  -1.894  -36.659  1.00 33.05 ? 283 HIS B NE2 1 
ATOM   4857 N  N   . GLU B 1 284 ? 9.972   -2.508  -39.007  1.00 21.89 ? 284 GLU B N   1 
ATOM   4858 C  CA  . GLU B 1 284 ? 8.801   -1.766  -38.498  1.00 17.26 ? 284 GLU B CA  1 
ATOM   4859 C  C   . GLU B 1 284 ? 8.977   -0.311  -38.102  1.00 11.54 ? 284 GLU B C   1 
ATOM   4860 O  O   . GLU B 1 284 ? 8.019   0.421   -37.866  1.00 10.58 ? 284 GLU B O   1 
ATOM   4861 C  CB  . GLU B 1 284 ? 8.208   -2.477  -37.266  1.00 22.55 ? 284 GLU B CB  1 
ATOM   4862 C  CG  . GLU B 1 284 ? 9.134   -2.476  -36.035  1.00 25.14 ? 284 GLU B CG  1 
ATOM   4863 C  CD  . GLU B 1 284 ? 8.671   -3.203  -34.757  1.00 27.63 ? 284 GLU B CD  1 
ATOM   4864 O  OE1 . GLU B 1 284 ? 7.543   -3.698  -34.673  1.00 25.68 ? 284 GLU B OE1 1 
ATOM   4865 O  OE2 . GLU B 1 284 ? 9.478   -3.280  -33.832  1.00 29.37 ? 284 GLU B OE2 1 
ATOM   4866 N  N   . ALA B 1 285 ? 10.214  0.137   -38.025  1.00 7.99  ? 285 ALA B N   1 
ATOM   4867 C  CA  . ALA B 1 285 ? 10.469  1.481   -37.577  1.00 12.99 ? 285 ALA B CA  1 
ATOM   4868 C  C   . ALA B 1 285 ? 11.305  2.336   -38.513  1.00 20.08 ? 285 ALA B C   1 
ATOM   4869 O  O   . ALA B 1 285 ? 11.690  3.481   -38.228  1.00 24.49 ? 285 ALA B O   1 
ATOM   4870 C  CB  . ALA B 1 285 ? 11.147  1.369   -36.233  1.00 8.00  ? 285 ALA B CB  1 
ATOM   4871 N  N   . CYS B 1 286 ? 11.703  1.742   -39.627  1.00 23.01 ? 286 CYS B N   1 
ATOM   4872 C  CA  . CYS B 1 286 ? 12.489  2.495   -40.565  1.00 23.88 ? 286 CYS B CA  1 
ATOM   4873 C  C   . CYS B 1 286 ? 12.438  1.920   -41.944  1.00 25.39 ? 286 CYS B C   1 
ATOM   4874 O  O   . CYS B 1 286 ? 13.160  2.458   -42.777  1.00 29.89 ? 286 CYS B O   1 
ATOM   4875 C  CB  . CYS B 1 286 ? 13.940  2.569   -40.137  1.00 26.75 ? 286 CYS B CB  1 
ATOM   4876 S  SG  . CYS B 1 286 ? 14.895  1.062   -39.916  1.00 30.56 ? 286 CYS B SG  1 
ATOM   4877 N  N   . GLY B 1 287 ? 11.639  0.896   -42.255  1.00 20.49 ? 287 GLY B N   1 
ATOM   4878 C  CA  . GLY B 1 287 ? 11.675  0.375   -43.590  1.00 21.47 ? 287 GLY B CA  1 
ATOM   4879 C  C   . GLY B 1 287 ? 10.601  0.982   -44.467  1.00 22.76 ? 287 GLY B C   1 
ATOM   4880 O  O   . GLY B 1 287 ? 9.524   1.345   -43.987  1.00 22.42 ? 287 GLY B O   1 
ATOM   4881 N  N   . THR B 1 288 ? 10.919  1.190   -45.739  1.00 22.93 ? 288 THR B N   1 
ATOM   4882 C  CA  . THR B 1 288 ? 9.935   1.645   -46.708  1.00 20.18 ? 288 THR B CA  1 
ATOM   4883 C  C   . THR B 1 288 ? 9.585   0.435   -47.562  1.00 17.62 ? 288 THR B C   1 
ATOM   4884 O  O   . THR B 1 288 ? 10.492  -0.306  -47.956  1.00 18.22 ? 288 THR B O   1 
ATOM   4885 C  CB  . THR B 1 288 ? 10.521  2.734   -47.580  1.00 22.55 ? 288 THR B CB  1 
ATOM   4886 O  OG1 . THR B 1 288 ? 10.758  3.850   -46.719  1.00 24.16 ? 288 THR B OG1 1 
ATOM   4887 C  CG2 . THR B 1 288 ? 9.599   3.081   -48.751  1.00 25.69 ? 288 THR B CG2 1 
ATOM   4888 N  N   . SER B 1 289 ? 8.322   0.174   -47.856  1.00 15.31 ? 289 SER B N   1 
ATOM   4889 C  CA  . SER B 1 289 ? 7.946   -0.942  -48.687  1.00 14.10 ? 289 SER B CA  1 
ATOM   4890 C  C   . SER B 1 289 ? 7.356   -0.274  -49.933  1.00 21.18 ? 289 SER B C   1 
ATOM   4891 O  O   . SER B 1 289 ? 6.509   0.627   -49.783  1.00 23.18 ? 289 SER B O   1 
ATOM   4892 C  CB  . SER B 1 289 ? 6.908   -1.727  -47.962  1.00 16.68 ? 289 SER B CB  1 
ATOM   4893 O  OG  . SER B 1 289 ? 6.557   -2.956  -48.556  1.00 20.65 ? 289 SER B OG  1 
ATOM   4894 N  N   . VAL B 1 290 ? 7.776   -0.605  -51.170  1.00 22.33 ? 290 VAL B N   1 
ATOM   4895 C  CA  . VAL B 1 290 ? 7.218   0.001   -52.366  1.00 18.64 ? 290 VAL B CA  1 
ATOM   4896 C  C   . VAL B 1 290 ? 6.458   -1.041  -53.173  1.00 15.04 ? 290 VAL B C   1 
ATOM   4897 O  O   . VAL B 1 290 ? 6.990   -2.111  -53.447  1.00 16.82 ? 290 VAL B O   1 
ATOM   4898 C  CB  . VAL B 1 290 ? 8.323   0.630   -53.239  1.00 18.35 ? 290 VAL B CB  1 
ATOM   4899 C  CG1 . VAL B 1 290 ? 7.658   1.341   -54.399  1.00 19.59 ? 290 VAL B CG1 1 
ATOM   4900 C  CG2 . VAL B 1 290 ? 9.097   1.708   -52.497  1.00 18.12 ? 290 VAL B CG2 1 
ATOM   4901 N  N   . ILE B 1 291 ? 5.180   -0.815  -53.447  1.00 14.00 ? 291 ILE B N   1 
ATOM   4902 C  CA  . ILE B 1 291 ? 4.337   -1.684  -54.270  1.00 17.95 ? 291 ILE B CA  1 
ATOM   4903 C  C   . ILE B 1 291 ? 4.652   -1.303  -55.748  1.00 23.13 ? 291 ILE B C   1 
ATOM   4904 O  O   . ILE B 1 291 ? 4.625   -0.114  -56.117  1.00 19.66 ? 291 ILE B O   1 
ATOM   4905 C  CB  . ILE B 1 291 ? 2.863   -1.398  -53.957  1.00 19.30 ? 291 ILE B CB  1 
ATOM   4906 C  CG1 . ILE B 1 291 ? 2.548   -1.909  -52.560  1.00 18.03 ? 291 ILE B CG1 1 
ATOM   4907 C  CG2 . ILE B 1 291 ? 1.965   -1.996  -55.044  1.00 16.07 ? 291 ILE B CG2 1 
ATOM   4908 C  CD1 . ILE B 1 291 ? 1.040   -1.913  -52.188  1.00 15.09 ? 291 ILE B CD1 1 
ATOM   4909 N  N   . VAL B 1 292 ? 5.025   -2.254  -56.615  1.00 25.55 ? 292 VAL B N   1 
ATOM   4910 C  CA  . VAL B 1 292 ? 5.326   -1.956  -58.028  1.00 24.49 ? 292 VAL B CA  1 
ATOM   4911 C  C   . VAL B 1 292 ? 4.453   -2.853  -58.907  1.00 25.96 ? 292 VAL B C   1 
ATOM   4912 O  O   . VAL B 1 292 ? 3.973   -2.455  -59.971  1.00 30.85 ? 292 VAL B O   1 
ATOM   4913 C  CB  . VAL B 1 292 ? 6.805   -2.219  -58.331  1.00 24.24 ? 292 VAL B CB  1 
ATOM   4914 C  CG1 . VAL B 1 292 ? 7.076   -1.809  -59.761  1.00 25.03 ? 292 VAL B CG1 1 
ATOM   4915 C  CG2 . VAL B 1 292 ? 7.727   -1.425  -57.395  1.00 20.08 ? 292 VAL B CG2 1 
ATOM   4916 N  N   . GLY B 1 293 ? 4.219   -4.096  -58.486  1.00 22.71 ? 293 GLY B N   1 
ATOM   4917 C  CA  . GLY B 1 293 ? 3.407   -5.050  -59.183  1.00 18.23 ? 293 GLY B CA  1 
ATOM   4918 C  C   . GLY B 1 293 ? 2.002   -4.528  -59.303  1.00 23.80 ? 293 GLY B C   1 
ATOM   4919 O  O   . GLY B 1 293 ? 1.677   -3.615  -58.561  1.00 26.89 ? 293 GLY B O   1 
ATOM   4920 N  N   . VAL B 1 294 ? 1.139   -5.057  -60.175  1.00 25.64 ? 294 VAL B N   1 
ATOM   4921 C  CA  . VAL B 1 294 ? -0.188  -4.504  -60.269  1.00 27.86 ? 294 VAL B CA  1 
ATOM   4922 C  C   . VAL B 1 294 ? -1.146  -5.529  -59.682  1.00 32.24 ? 294 VAL B C   1 
ATOM   4923 O  O   . VAL B 1 294 ? -1.093  -6.715  -60.031  1.00 34.09 ? 294 VAL B O   1 
ATOM   4924 C  CB  . VAL B 1 294 ? -0.492  -4.165  -61.755  1.00 23.11 ? 294 VAL B CB  1 
ATOM   4925 C  CG1 . VAL B 1 294 ? -1.905  -3.640  -61.917  1.00 25.82 ? 294 VAL B CG1 1 
ATOM   4926 C  CG2 . VAL B 1 294 ? 0.357   -3.002  -62.206  1.00 19.49 ? 294 VAL B CG2 1 
ATOM   4927 N  N   . PRO B 1 295 ? -2.003  -5.101  -58.752  1.00 33.97 ? 295 PRO B N   1 
ATOM   4928 C  CA  . PRO B 1 295 ? -2.906  -5.968  -58.008  1.00 34.70 ? 295 PRO B CA  1 
ATOM   4929 C  C   . PRO B 1 295 ? -4.004  -6.623  -58.818  1.00 35.18 ? 295 PRO B C   1 
ATOM   4930 O  O   . PRO B 1 295 ? -4.513  -5.991  -59.729  1.00 35.73 ? 295 PRO B O   1 
ATOM   4931 C  CB  . PRO B 1 295 ? -3.466  -5.077  -56.903  1.00 35.06 ? 295 PRO B CB  1 
ATOM   4932 C  CG  . PRO B 1 295 ? -2.553  -3.867  -56.844  1.00 34.80 ? 295 PRO B CG  1 
ATOM   4933 C  CD  . PRO B 1 295 ? -2.132  -3.717  -58.293  1.00 35.45 ? 295 PRO B CD  1 
ATOM   4934 N  N   . PRO B 1 296 ? -4.460  -7.843  -58.531  1.00 37.84 ? 296 PRO B N   1 
ATOM   4935 C  CA  . PRO B 1 296 ? -5.573  -8.454  -59.221  1.00 39.76 ? 296 PRO B CA  1 
ATOM   4936 C  C   . PRO B 1 296 ? -6.785  -7.564  -59.059  1.00 44.59 ? 296 PRO B C   1 
ATOM   4937 O  O   . PRO B 1 296 ? -6.919  -6.772  -58.113  1.00 47.80 ? 296 PRO B O   1 
ATOM   4938 C  CB  . PRO B 1 296 ? -5.741  -9.801  -58.577  1.00 38.73 ? 296 PRO B CB  1 
ATOM   4939 C  CG  . PRO B 1 296 ? -4.337  -10.108 -58.112  1.00 41.24 ? 296 PRO B CG  1 
ATOM   4940 C  CD  . PRO B 1 296 ? -3.920  -8.761  -57.535  1.00 38.68 ? 296 PRO B CD  1 
ATOM   4941 N  N   . ALA B 1 297 ? -7.664  -7.710  -60.030  1.00 47.69 ? 297 ALA B N   1 
ATOM   4942 C  CA  . ALA B 1 297 ? -8.886  -6.954  -60.057  1.00 48.97 ? 297 ALA B CA  1 
ATOM   4943 C  C   . ALA B 1 297 ? -9.703  -7.176  -58.784  1.00 49.36 ? 297 ALA B C   1 
ATOM   4944 O  O   . ALA B 1 297 ? -10.052 -8.312  -58.437  1.00 46.80 ? 297 ALA B O   1 
ATOM   4945 C  CB  . ALA B 1 297 ? -9.693  -7.376  -61.287  1.00 50.03 ? 297 ALA B CB  1 
ATOM   4946 N  N   . SER B 1 298 ? -9.824  -6.057  -58.048  1.00 51.33 ? 298 SER B N   1 
ATOM   4947 C  CA  . SER B 1 298 ? -10.610 -5.976  -56.826  1.00 53.75 ? 298 SER B CA  1 
ATOM   4948 C  C   . SER B 1 298 ? -10.301 -6.934  -55.668  1.00 54.47 ? 298 SER B C   1 
ATOM   4949 O  O   . SER B 1 298 ? -11.196 -7.546  -55.078  1.00 53.75 ? 298 SER B O   1 
ATOM   4950 C  CB  . SER B 1 298 ? -12.079 -6.109  -57.249  1.00 54.20 ? 298 SER B CB  1 
ATOM   4951 O  OG  . SER B 1 298 ? -12.375 -5.110  -58.219  1.00 58.84 ? 298 SER B OG  1 
ATOM   4952 N  N   . GLN B 1 299 ? -9.037  -7.099  -55.294  1.00 54.68 ? 299 GLN B N   1 
ATOM   4953 C  CA  . GLN B 1 299 ? -8.717  -7.969  -54.179  1.00 53.17 ? 299 GLN B CA  1 
ATOM   4954 C  C   . GLN B 1 299 ? -8.055  -7.091  -53.127  1.00 50.52 ? 299 GLN B C   1 
ATOM   4955 O  O   . GLN B 1 299 ? -7.219  -6.248  -53.466  1.00 53.20 ? 299 GLN B O   1 
ATOM   4956 C  CB  . GLN B 1 299 ? -7.795  -9.084  -54.668  1.00 56.91 ? 299 GLN B CB  1 
ATOM   4957 C  CG  . GLN B 1 299 ? -8.552  -10.102 -55.529  1.00 57.99 ? 299 GLN B CG  1 
ATOM   4958 C  CD  . GLN B 1 299 ? -7.885  -11.465 -55.692  1.00 60.70 ? 299 GLN B CD  1 
ATOM   4959 O  OE1 . GLN B 1 299 ? -8.554  -12.423 -56.058  1.00 63.92 ? 299 GLN B OE1 1 
ATOM   4960 N  NE2 . GLN B 1 299 ? -6.601  -11.732 -55.454  1.00 60.33 ? 299 GLN B NE2 1 
ATOM   4961 N  N   . ASN B 1 300 ? -8.455  -7.216  -51.861  1.00 45.81 ? 300 ASN B N   1 
ATOM   4962 C  CA  . ASN B 1 300 ? -7.908  -6.396  -50.776  1.00 38.52 ? 300 ASN B CA  1 
ATOM   4963 C  C   . ASN B 1 300 ? -7.064  -7.113  -49.766  1.00 34.75 ? 300 ASN B C   1 
ATOM   4964 O  O   . ASN B 1 300 ? -7.239  -8.292  -49.475  1.00 35.63 ? 300 ASN B O   1 
ATOM   4965 C  CB  . ASN B 1 300 ? -8.925  -5.759  -49.900  1.00 33.56 ? 300 ASN B CB  1 
ATOM   4966 C  CG  . ASN B 1 300 ? -10.098 -5.297  -50.684  1.00 36.33 ? 300 ASN B CG  1 
ATOM   4967 O  OD1 . ASN B 1 300 ? -11.041 -6.059  -50.795  1.00 38.64 ? 300 ASN B OD1 1 
ATOM   4968 N  ND2 . ASN B 1 300 ? -10.089 -4.104  -51.266  1.00 34.77 ? 300 ASN B ND2 1 
ATOM   4969 N  N   . LEU B 1 301 ? -6.204  -6.326  -49.160  1.00 33.32 ? 301 LEU B N   1 
ATOM   4970 C  CA  . LEU B 1 301 ? -5.339  -6.800  -48.116  1.00 31.37 ? 301 LEU B CA  1 
ATOM   4971 C  C   . LEU B 1 301 ? -5.915  -6.428  -46.755  1.00 29.51 ? 301 LEU B C   1 
ATOM   4972 O  O   . LEU B 1 301 ? -6.222  -5.249  -46.601  1.00 32.08 ? 301 LEU B O   1 
ATOM   4973 C  CB  . LEU B 1 301 ? -3.980  -6.157  -48.250  1.00 26.18 ? 301 LEU B CB  1 
ATOM   4974 C  CG  . LEU B 1 301 ? -3.087  -6.700  -49.304  1.00 25.95 ? 301 LEU B CG  1 
ATOM   4975 C  CD1 . LEU B 1 301 ? -1.744  -6.022  -49.264  1.00 22.82 ? 301 LEU B CD1 1 
ATOM   4976 C  CD2 . LEU B 1 301 ? -2.869  -8.154  -49.036  1.00 30.55 ? 301 LEU B CD2 1 
ATOM   4977 N  N   . SER B 1 302 ? -6.152  -7.310  -45.790  1.00 26.36 ? 302 SER B N   1 
ATOM   4978 C  CA  . SER B 1 302 ? -6.584  -6.918  -44.453  1.00 26.28 ? 302 SER B CA  1 
ATOM   4979 C  C   . SER B 1 302 ? -5.314  -6.591  -43.701  1.00 25.92 ? 302 SER B C   1 
ATOM   4980 O  O   . SER B 1 302 ? -4.533  -7.518  -43.460  1.00 28.56 ? 302 SER B O   1 
ATOM   4981 C  CB  . SER B 1 302 ? -7.278  -8.044  -43.725  1.00 23.70 ? 302 SER B CB  1 
ATOM   4982 O  OG  . SER B 1 302 ? -8.491  -8.326  -44.417  1.00 32.93 ? 302 SER B OG  1 
ATOM   4983 N  N   . ILE B 1 303 ? -4.981  -5.332  -43.405  1.00 24.66 ? 303 ILE B N   1 
ATOM   4984 C  CA  . ILE B 1 303 ? -3.774  -5.048  -42.655  1.00 24.78 ? 303 ILE B CA  1 
ATOM   4985 C  C   . ILE B 1 303 ? -4.033  -4.416  -41.290  1.00 27.75 ? 303 ILE B C   1 
ATOM   4986 O  O   . ILE B 1 303 ? -5.095  -3.842  -40.992  1.00 30.09 ? 303 ILE B O   1 
ATOM   4987 C  CB  . ILE B 1 303 ? -2.800  -4.110  -43.398  1.00 24.32 ? 303 ILE B CB  1 
ATOM   4988 C  CG1 . ILE B 1 303 ? -3.342  -2.718  -43.599  1.00 20.06 ? 303 ILE B CG1 1 
ATOM   4989 C  CG2 . ILE B 1 303 ? -2.461  -4.783  -44.704  1.00 30.06 ? 303 ILE B CG2 1 
ATOM   4990 C  CD1 . ILE B 1 303 ? -2.172  -1.749  -43.232  1.00 23.26 ? 303 ILE B CD1 1 
ATOM   4991 N  N   . ASN B 1 304 ? -3.026  -4.534  -40.429  1.00 25.45 ? 304 ASN B N   1 
ATOM   4992 C  CA  . ASN B 1 304 ? -3.118  -3.998  -39.095  1.00 19.25 ? 304 ASN B CA  1 
ATOM   4993 C  C   . ASN B 1 304 ? -2.372  -2.680  -39.086  1.00 17.65 ? 304 ASN B C   1 
ATOM   4994 O  O   . ASN B 1 304 ? -1.155  -2.680  -39.373  1.00 17.04 ? 304 ASN B O   1 
ATOM   4995 C  CB  . ASN B 1 304 ? -2.491  -4.947  -38.087  1.00 25.55 ? 304 ASN B CB  1 
ATOM   4996 C  CG  . ASN B 1 304 ? -2.819  -4.503  -36.675  1.00 28.54 ? 304 ASN B CG  1 
ATOM   4997 O  OD1 . ASN B 1 304 ? -2.367  -3.459  -36.180  1.00 29.65 ? 304 ASN B OD1 1 
ATOM   4998 N  ND2 . ASN B 1 304 ? -3.624  -5.300  -36.007  1.00 26.96 ? 304 ASN B ND2 1 
ATOM   4999 N  N   . PRO B 1 305 ? -3.044  -1.550  -38.747  1.00 9.35  ? 305 PRO B N   1 
ATOM   5000 C  CA  . PRO B 1 305 ? -2.443  -0.245  -38.810  1.00 7.40  ? 305 PRO B CA  1 
ATOM   5001 C  C   . PRO B 1 305 ? -1.281  -0.050  -37.894  1.00 14.06 ? 305 PRO B C   1 
ATOM   5002 O  O   . PRO B 1 305 ? -0.458  0.849   -38.127  1.00 15.88 ? 305 PRO B O   1 
ATOM   5003 C  CB  . PRO B 1 305 ? -3.566  0.695   -38.580  1.00 12.75 ? 305 PRO B CB  1 
ATOM   5004 C  CG  . PRO B 1 305 ? -4.779  -0.115  -38.139  1.00 9.77  ? 305 PRO B CG  1 
ATOM   5005 C  CD  . PRO B 1 305 ? -4.490  -1.502  -38.588  1.00 7.89  ? 305 PRO B CD  1 
ATOM   5006 N  N   . MET B 1 306 ? -1.115  -0.945  -36.900  1.00 18.46 ? 306 MET B N   1 
ATOM   5007 C  CA  . MET B 1 306 ? 0.049   -0.865  -36.026  1.00 16.56 ? 306 MET B CA  1 
ATOM   5008 C  C   . MET B 1 306 ? 1.294   -1.076  -36.856  1.00 13.43 ? 306 MET B C   1 
ATOM   5009 O  O   . MET B 1 306 ? 2.359   -0.504  -36.553  1.00 19.07 ? 306 MET B O   1 
ATOM   5010 C  CB  . MET B 1 306 ? 0.012   -1.931  -34.935  1.00 23.08 ? 306 MET B CB  1 
ATOM   5011 C  CG  . MET B 1 306 ? -0.675  -1.544  -33.630  1.00 25.74 ? 306 MET B CG  1 
ATOM   5012 S  SD  . MET B 1 306 ? 0.027   -0.021  -32.946  1.00 29.81 ? 306 MET B SD  1 
ATOM   5013 C  CE  . MET B 1 306 ? 1.698   -0.478  -32.592  1.00 22.56 ? 306 MET B CE  1 
ATOM   5014 N  N   . LEU B 1 307 ? 1.180   -1.862  -37.946  1.00 10.91 ? 307 LEU B N   1 
ATOM   5015 C  CA  . LEU B 1 307 ? 2.328   -2.101  -38.840  1.00 8.73  ? 307 LEU B CA  1 
ATOM   5016 C  C   . LEU B 1 307 ? 2.887   -0.786  -39.395  1.00 4.92  ? 307 LEU B C   1 
ATOM   5017 O  O   . LEU B 1 307 ? 4.077   -0.630  -39.544  1.00 5.88  ? 307 LEU B O   1 
ATOM   5018 C  CB  . LEU B 1 307 ? 1.878   -3.017  -39.946  1.00 12.73 ? 307 LEU B CB  1 
ATOM   5019 C  CG  . LEU B 1 307 ? 1.429   -4.406  -39.463  1.00 14.27 ? 307 LEU B CG  1 
ATOM   5020 C  CD1 . LEU B 1 307 ? 0.909   -5.227  -40.619  1.00 17.21 ? 307 LEU B CD1 1 
ATOM   5021 C  CD2 . LEU B 1 307 ? 2.603   -5.146  -38.895  1.00 16.39 ? 307 LEU B CD2 1 
ATOM   5022 N  N   . LEU B 1 308 ? 2.099   0.271   -39.582  1.00 8.03  ? 308 LEU B N   1 
ATOM   5023 C  CA  . LEU B 1 308 ? 2.594   1.545   -40.083  1.00 10.05 ? 308 LEU B CA  1 
ATOM   5024 C  C   . LEU B 1 308 ? 2.914   2.478   -38.946  1.00 12.52 ? 308 LEU B C   1 
ATOM   5025 O  O   . LEU B 1 308 ? 3.920   3.187   -39.013  1.00 11.92 ? 308 LEU B O   1 
ATOM   5026 C  CB  . LEU B 1 308 ? 1.538   2.196   -40.970  1.00 15.60 ? 308 LEU B CB  1 
ATOM   5027 C  CG  . LEU B 1 308 ? 1.039   1.334   -42.129  1.00 11.21 ? 308 LEU B CG  1 
ATOM   5028 C  CD1 . LEU B 1 308 ? -0.277  1.822   -42.548  1.00 6.61  ? 308 LEU B CD1 1 
ATOM   5029 C  CD2 . LEU B 1 308 ? 2.046   1.349   -43.258  1.00 9.57  ? 308 LEU B CD2 1 
ATOM   5030 N  N   . LEU B 1 309 ? 2.083   2.473   -37.871  1.00 15.75 ? 309 LEU B N   1 
ATOM   5031 C  CA  . LEU B 1 309 ? 2.272   3.353   -36.717  1.00 13.14 ? 309 LEU B CA  1 
ATOM   5032 C  C   . LEU B 1 309 ? 3.635   3.284   -36.089  1.00 13.75 ? 309 LEU B C   1 
ATOM   5033 O  O   . LEU B 1 309 ? 4.152   4.290   -35.599  1.00 19.00 ? 309 LEU B O   1 
ATOM   5034 C  CB  . LEU B 1 309 ? 1.247   3.055   -35.664  1.00 17.50 ? 309 LEU B CB  1 
ATOM   5035 C  CG  . LEU B 1 309 ? 1.218   3.889   -34.381  1.00 18.88 ? 309 LEU B CG  1 
ATOM   5036 C  CD1 . LEU B 1 309 ? 0.710   5.294   -34.632  1.00 20.57 ? 309 LEU B CD1 1 
ATOM   5037 C  CD2 . LEU B 1 309 ? 0.264   3.226   -33.417  1.00 22.10 ? 309 LEU B CD2 1 
ATOM   5038 N  N   . THR B 1 310 ? 4.314   2.152   -36.164  1.00 18.02 ? 310 THR B N   1 
ATOM   5039 C  CA  . THR B 1 310 ? 5.637   2.072   -35.578  1.00 19.25 ? 310 THR B CA  1 
ATOM   5040 C  C   . THR B 1 310 ? 6.640   2.879   -36.352  1.00 19.67 ? 310 THR B C   1 
ATOM   5041 O  O   . THR B 1 310 ? 7.686   3.258   -35.829  1.00 21.44 ? 310 THR B O   1 
ATOM   5042 C  CB  . THR B 1 310 ? 5.976   0.581   -35.465  1.00 24.93 ? 310 THR B CB  1 
ATOM   5043 O  OG1 . THR B 1 310 ? 5.461   -0.189  -36.549  1.00 34.95 ? 310 THR B OG1 1 
ATOM   5044 C  CG2 . THR B 1 310 ? 5.252   0.053   -34.225  1.00 28.78 ? 310 THR B CG2 1 
ATOM   5045 N  N   . GLY B 1 311 ? 6.323   3.215   -37.600  1.00 24.27 ? 311 GLY B N   1 
ATOM   5046 C  CA  . GLY B 1 311 ? 7.210   4.039   -38.398  1.00 20.49 ? 311 GLY B CA  1 
ATOM   5047 C  C   . GLY B 1 311 ? 7.537   3.493   -39.771  1.00 19.99 ? 311 GLY B C   1 
ATOM   5048 O  O   . GLY B 1 311 ? 8.514   3.980   -40.355  1.00 22.57 ? 311 GLY B O   1 
ATOM   5049 N  N   . ARG B 1 312 ? 6.891   2.476   -40.331  1.00 18.56 ? 312 ARG B N   1 
ATOM   5050 C  CA  . ARG B 1 312 ? 7.296   2.118   -41.669  1.00 22.72 ? 312 ARG B CA  1 
ATOM   5051 C  C   . ARG B 1 312 ? 6.359   2.764   -42.692  1.00 25.68 ? 312 ARG B C   1 
ATOM   5052 O  O   . ARG B 1 312 ? 5.157   2.971   -42.482  1.00 27.09 ? 312 ARG B O   1 
ATOM   5053 C  CB  . ARG B 1 312 ? 7.347   0.580   -41.859  1.00 20.56 ? 312 ARG B CB  1 
ATOM   5054 C  CG  . ARG B 1 312 ? 6.168   -0.275  -41.621  1.00 18.65 ? 312 ARG B CG  1 
ATOM   5055 C  CD  . ARG B 1 312 ? 6.483   -1.632  -42.220  1.00 22.72 ? 312 ARG B CD  1 
ATOM   5056 N  NE  . ARG B 1 312 ? 7.108   -2.706  -41.449  1.00 29.35 ? 312 ARG B NE  1 
ATOM   5057 C  CZ  . ARG B 1 312 ? 6.491   -3.386  -40.457  1.00 28.14 ? 312 ARG B CZ  1 
ATOM   5058 N  NH1 . ARG B 1 312 ? 5.250   -3.140  -40.025  1.00 30.42 ? 312 ARG B NH1 1 
ATOM   5059 N  NH2 . ARG B 1 312 ? 7.097   -4.439  -39.936  1.00 17.97 ? 312 ARG B NH2 1 
ATOM   5060 N  N   . THR B 1 313 ? 6.991   3.233   -43.762  1.00 25.76 ? 313 THR B N   1 
ATOM   5061 C  CA  . THR B 1 313 ? 6.339   3.873   -44.900  1.00 21.17 ? 313 THR B CA  1 
ATOM   5062 C  C   . THR B 1 313 ? 5.849   2.819   -45.912  1.00 21.85 ? 313 THR B C   1 
ATOM   5063 O  O   . THR B 1 313 ? 6.581   1.852   -46.205  1.00 20.11 ? 313 THR B O   1 
ATOM   5064 C  CB  . THR B 1 313 ? 7.385   4.768   -45.517  1.00 22.06 ? 313 THR B CB  1 
ATOM   5065 O  OG1 . THR B 1 313 ? 7.807   5.666   -44.508  1.00 26.98 ? 313 THR B OG1 1 
ATOM   5066 C  CG2 . THR B 1 313 ? 6.872   5.520   -46.709  1.00 27.03 ? 313 THR B CG2 1 
ATOM   5067 N  N   . TRP B 1 314 ? 4.662   2.955   -46.506  1.00 23.08 ? 314 TRP B N   1 
ATOM   5068 C  CA  . TRP B 1 314 ? 4.125   2.054   -47.535  1.00 21.96 ? 314 TRP B CA  1 
ATOM   5069 C  C   . TRP B 1 314 ? 3.732   2.967   -48.707  1.00 22.63 ? 314 TRP B C   1 
ATOM   5070 O  O   . TRP B 1 314 ? 2.903   3.860   -48.547  1.00 18.27 ? 314 TRP B O   1 
ATOM   5071 C  CB  . TRP B 1 314 ? 2.869   1.330   -47.081  1.00 17.45 ? 314 TRP B CB  1 
ATOM   5072 C  CG  . TRP B 1 314 ? 2.558   -0.006  -47.759  1.00 8.50  ? 314 TRP B CG  1 
ATOM   5073 C  CD1 . TRP B 1 314 ? 3.428   -0.667  -48.608  1.00 11.02 ? 314 TRP B CD1 1 
ATOM   5074 C  CD2 . TRP B 1 314 ? 1.392   -0.691  -47.597  1.00 5.04  ? 314 TRP B CD2 1 
ATOM   5075 N  NE1 . TRP B 1 314 ? 2.810   -1.768  -48.983  1.00 6.68  ? 314 TRP B NE1 1 
ATOM   5076 C  CE2 . TRP B 1 314 ? 1.595   -1.821  -48.410  1.00 7.44  ? 314 TRP B CE2 1 
ATOM   5077 C  CE3 . TRP B 1 314 ? 0.215   -0.529  -46.895  1.00 6.88  ? 314 TRP B CE3 1 
ATOM   5078 C  CZ2 . TRP B 1 314 ? 0.621   -2.803  -48.529  1.00 8.14  ? 314 TRP B CZ2 1 
ATOM   5079 C  CZ3 . TRP B 1 314 ? -0.768  -1.517  -47.015  1.00 11.57 ? 314 TRP B CZ3 1 
ATOM   5080 C  CH2 . TRP B 1 314 ? -0.569  -2.644  -47.822  1.00 13.60 ? 314 TRP B CH2 1 
ATOM   5081 N  N   . LYS B 1 315 ? 4.308   2.825   -49.896  1.00 24.87 ? 315 LYS B N   1 
ATOM   5082 C  CA  . LYS B 1 315 ? 3.988   3.664   -51.047  1.00 23.83 ? 315 LYS B CA  1 
ATOM   5083 C  C   . LYS B 1 315 ? 3.965   2.854   -52.316  1.00 26.24 ? 315 LYS B C   1 
ATOM   5084 O  O   . LYS B 1 315 ? 4.555   1.780   -52.391  1.00 29.93 ? 315 LYS B O   1 
ATOM   5085 C  CB  . LYS B 1 315 ? 5.013   4.799   -51.242  1.00 17.32 ? 315 LYS B CB  1 
ATOM   5086 C  CG  . LYS B 1 315 ? 6.407   4.320   -51.004  1.00 17.51 ? 315 LYS B CG  1 
ATOM   5087 C  CD  . LYS B 1 315 ? 7.562   5.255   -51.251  1.00 14.01 ? 315 LYS B CD  1 
ATOM   5088 C  CE  . LYS B 1 315 ? 7.389   6.687   -50.834  1.00 19.12 ? 315 LYS B CE  1 
ATOM   5089 N  NZ  . LYS B 1 315 ? 8.735   7.258   -50.832  1.00 20.50 ? 315 LYS B NZ  1 
ATOM   5090 N  N   . GLY B 1 316 ? 3.219   3.296   -53.306  1.00 30.64 ? 316 GLY B N   1 
ATOM   5091 C  CA  . GLY B 1 316 ? 3.176   2.677   -54.621  1.00 30.17 ? 316 GLY B CA  1 
ATOM   5092 C  C   . GLY B 1 316 ? 3.637   3.749   -55.599  1.00 30.62 ? 316 GLY B C   1 
ATOM   5093 O  O   . GLY B 1 316 ? 3.856   4.921   -55.248  1.00 32.48 ? 316 GLY B O   1 
ATOM   5094 N  N   . ALA B 1 317 ? 3.879   3.375   -56.832  1.00 31.97 ? 317 ALA B N   1 
ATOM   5095 C  CA  . ALA B 1 317 ? 4.252   4.334   -57.858  1.00 31.53 ? 317 ALA B CA  1 
ATOM   5096 C  C   . ALA B 1 317 ? 4.098   3.636   -59.187  1.00 30.25 ? 317 ALA B C   1 
ATOM   5097 O  O   . ALA B 1 317 ? 4.194   2.407   -59.338  1.00 26.11 ? 317 ALA B O   1 
ATOM   5098 C  CB  . ALA B 1 317 ? 5.695   4.782   -57.797  1.00 28.91 ? 317 ALA B CB  1 
ATOM   5099 N  N   . VAL B 1 318 ? 3.764   4.503   -60.127  1.00 30.55 ? 318 VAL B N   1 
ATOM   5100 C  CA  . VAL B 1 318 ? 3.601   4.125   -61.511  1.00 28.43 ? 318 VAL B CA  1 
ATOM   5101 C  C   . VAL B 1 318 ? 4.847   4.670   -62.184  1.00 25.49 ? 318 VAL B C   1 
ATOM   5102 O  O   . VAL B 1 318 ? 5.445   5.633   -61.705  1.00 22.19 ? 318 VAL B O   1 
ATOM   5103 C  CB  . VAL B 1 318 ? 2.312   4.760   -62.021  1.00 27.58 ? 318 VAL B CB  1 
ATOM   5104 C  CG1 . VAL B 1 318 ? 2.159   4.675   -63.514  1.00 30.57 ? 318 VAL B CG1 1 
ATOM   5105 C  CG2 . VAL B 1 318 ? 1.182   3.977   -61.403  1.00 22.34 ? 318 VAL B CG2 1 
ATOM   5106 N  N   . TYR B 1 319 ? 5.353   4.010   -63.228  1.00 28.95 ? 319 TYR B N   1 
ATOM   5107 C  CA  . TYR B 1 319 ? 6.516   4.461   -63.984  1.00 31.57 ? 319 TYR B CA  1 
ATOM   5108 C  C   . TYR B 1 319 ? 7.794   4.763   -63.244  1.00 30.56 ? 319 TYR B C   1 
ATOM   5109 O  O   . TYR B 1 319 ? 8.613   5.577   -63.700  1.00 34.31 ? 319 TYR B O   1 
ATOM   5110 C  CB  . TYR B 1 319 ? 6.141   5.710   -64.791  1.00 37.62 ? 319 TYR B CB  1 
ATOM   5111 C  CG  . TYR B 1 319 ? 6.161   5.512   -66.294  1.00 45.87 ? 319 TYR B CG  1 
ATOM   5112 C  CD1 . TYR B 1 319 ? 7.297   5.041   -66.985  1.00 46.95 ? 319 TYR B CD1 1 
ATOM   5113 C  CD2 . TYR B 1 319 ? 5.005   5.842   -66.989  1.00 50.13 ? 319 TYR B CD2 1 
ATOM   5114 C  CE1 . TYR B 1 319 ? 7.263   4.892   -68.375  1.00 49.53 ? 319 TYR B CE1 1 
ATOM   5115 C  CE2 . TYR B 1 319 ? 4.973   5.699   -68.376  1.00 53.79 ? 319 TYR B CE2 1 
ATOM   5116 C  CZ  . TYR B 1 319 ? 6.085   5.221   -69.059  1.00 51.37 ? 319 TYR B CZ  1 
ATOM   5117 O  OH  . TYR B 1 319 ? 5.929   5.068   -70.428  1.00 45.04 ? 319 TYR B OH  1 
ATOM   5118 N  N   . GLY B 1 320 ? 7.977   4.154   -62.071  1.00 27.79 ? 320 GLY B N   1 
ATOM   5119 C  CA  . GLY B 1 320 ? 9.187   4.389   -61.301  1.00 18.58 ? 320 GLY B CA  1 
ATOM   5120 C  C   . GLY B 1 320 ? 9.347   5.852   -60.952  1.00 14.39 ? 320 GLY B C   1 
ATOM   5121 O  O   . GLY B 1 320 ? 10.455  6.364   -60.763  1.00 9.63  ? 320 GLY B O   1 
ATOM   5122 N  N   . GLY B 1 321 ? 8.186   6.512   -60.857  1.00 13.59 ? 321 GLY B N   1 
ATOM   5123 C  CA  . GLY B 1 321 ? 8.119   7.912   -60.503  1.00 16.42 ? 321 GLY B CA  1 
ATOM   5124 C  C   . GLY B 1 321 ? 8.834   8.847   -61.448  1.00 20.49 ? 321 GLY B C   1 
ATOM   5125 O  O   . GLY B 1 321 ? 9.241   9.932   -61.041  1.00 24.61 ? 321 GLY B O   1 
ATOM   5126 N  N   . PHE B 1 322 ? 9.020   8.490   -62.722  1.00 26.72 ? 322 PHE B N   1 
ATOM   5127 C  CA  . PHE B 1 322 ? 9.673   9.371   -63.694  1.00 23.95 ? 322 PHE B CA  1 
ATOM   5128 C  C   . PHE B 1 322 ? 8.574   10.197  -64.301  1.00 25.19 ? 322 PHE B C   1 
ATOM   5129 O  O   . PHE B 1 322 ? 7.499   9.628   -64.506  1.00 25.91 ? 322 PHE B O   1 
ATOM   5130 C  CB  . PHE B 1 322 ? 10.307  8.589   -64.813  1.00 23.83 ? 322 PHE B CB  1 
ATOM   5131 C  CG  . PHE B 1 322 ? 11.595  7.895   -64.438  1.00 16.75 ? 322 PHE B CG  1 
ATOM   5132 C  CD1 . PHE B 1 322 ? 12.741  8.650   -64.236  1.00 21.53 ? 322 PHE B CD1 1 
ATOM   5133 C  CD2 . PHE B 1 322 ? 11.636  6.509   -64.333  1.00 17.51 ? 322 PHE B CD2 1 
ATOM   5134 C  CE1 . PHE B 1 322 ? 13.956  8.023   -63.927  1.00 23.88 ? 322 PHE B CE1 1 
ATOM   5135 C  CE2 . PHE B 1 322 ? 12.848  5.886   -64.028  1.00 18.12 ? 322 PHE B CE2 1 
ATOM   5136 C  CZ  . PHE B 1 322 ? 14.011  6.638   -63.822  1.00 20.53 ? 322 PHE B CZ  1 
ATOM   5137 N  N   . LYS B 1 323 ? 8.705   11.516  -64.531  1.00 28.10 ? 323 LYS B N   1 
ATOM   5138 C  CA  . LYS B 1 323 ? 7.668   12.294  -65.246  1.00 26.86 ? 323 LYS B CA  1 
ATOM   5139 C  C   . LYS B 1 323 ? 7.932   11.658  -66.629  1.00 27.49 ? 323 LYS B C   1 
ATOM   5140 O  O   . LYS B 1 323 ? 9.089   11.769  -67.083  1.00 26.36 ? 323 LYS B O   1 
ATOM   5141 C  CB  . LYS B 1 323 ? 8.027   13.779  -65.261  1.00 26.10 ? 323 LYS B CB  1 
ATOM   5142 C  CG  . LYS B 1 323 ? 7.920   14.624  -63.986  1.00 20.97 ? 323 LYS B CG  1 
ATOM   5143 C  CD  . LYS B 1 323 ? 6.472   14.883  -63.667  1.00 19.72 ? 323 LYS B CD  1 
ATOM   5144 C  CE  . LYS B 1 323 ? 6.305   15.926  -62.574  1.00 20.35 ? 323 LYS B CE  1 
ATOM   5145 N  NZ  . LYS B 1 323 ? 4.880   16.182  -62.388  1.00 19.63 ? 323 LYS B NZ  1 
ATOM   5146 N  N   . SER B 1 324 ? 6.992   10.998  -67.323  1.00 24.87 ? 324 SER B N   1 
ATOM   5147 C  CA  . SER B 1 324 ? 7.302   10.269  -68.550  1.00 26.36 ? 324 SER B CA  1 
ATOM   5148 C  C   . SER B 1 324 ? 7.961   10.906  -69.781  1.00 31.31 ? 324 SER B C   1 
ATOM   5149 O  O   . SER B 1 324 ? 8.998   10.444  -70.301  1.00 28.80 ? 324 SER B O   1 
ATOM   5150 C  CB  . SER B 1 324 ? 6.013   9.577   -68.957  1.00 23.63 ? 324 SER B CB  1 
ATOM   5151 O  OG  . SER B 1 324 ? 4.923   10.477  -68.929  1.00 27.56 ? 324 SER B OG  1 
ATOM   5152 N  N   . LYS B 1 325 ? 7.379   12.004  -70.230  1.00 35.65 ? 325 LYS B N   1 
ATOM   5153 C  CA  . LYS B 1 325 ? 7.883   12.693  -71.391  1.00 40.57 ? 325 LYS B CA  1 
ATOM   5154 C  C   . LYS B 1 325 ? 9.267   13.277  -71.138  1.00 43.16 ? 325 LYS B C   1 
ATOM   5155 O  O   . LYS B 1 325 ? 10.106  13.298  -72.046  1.00 43.76 ? 325 LYS B O   1 
ATOM   5156 C  CB  . LYS B 1 325 ? 6.882   13.774  -71.769  1.00 42.19 ? 325 LYS B CB  1 
ATOM   5157 C  CG  . LYS B 1 325 ? 7.055   14.146  -73.201  1.00 40.23 ? 325 LYS B CG  1 
ATOM   5158 C  CD  . LYS B 1 325 ? 5.949   15.061  -73.659  1.00 44.42 ? 325 LYS B CD  1 
ATOM   5159 C  CE  . LYS B 1 325 ? 5.943   15.063  -75.191  1.00 47.33 ? 325 LYS B CE  1 
ATOM   5160 N  NZ  . LYS B 1 325 ? 7.273   15.301  -75.719  1.00 47.17 ? 325 LYS B NZ  1 
ATOM   5161 N  N   . GLU B 1 326 ? 9.520   13.753  -69.916  1.00 43.02 ? 326 GLU B N   1 
ATOM   5162 C  CA  . GLU B 1 326 ? 10.818  14.316  -69.582  1.00 41.71 ? 326 GLU B CA  1 
ATOM   5163 C  C   . GLU B 1 326 ? 11.830  13.270  -69.161  1.00 41.39 ? 326 GLU B C   1 
ATOM   5164 O  O   . GLU B 1 326 ? 13.034  13.397  -69.400  1.00 42.05 ? 326 GLU B O   1 
ATOM   5165 C  CB  . GLU B 1 326 ? 10.710  15.286  -68.439  1.00 44.55 ? 326 GLU B CB  1 
ATOM   5166 C  CG  . GLU B 1 326 ? 9.782   16.445  -68.696  1.00 51.33 ? 326 GLU B CG  1 
ATOM   5167 C  CD  . GLU B 1 326 ? 9.798   17.474  -67.577  1.00 57.86 ? 326 GLU B CD  1 
ATOM   5168 O  OE1 . GLU B 1 326 ? 9.429   17.126  -66.455  1.00 57.11 ? 326 GLU B OE1 1 
ATOM   5169 O  OE2 . GLU B 1 326 ? 10.173  18.624  -67.835  1.00 61.92 ? 326 GLU B OE2 1 
ATOM   5170 N  N   . GLY B 1 327 ? 11.322  12.208  -68.539  1.00 41.78 ? 327 GLY B N   1 
ATOM   5171 C  CA  . GLY B 1 327 ? 12.132  11.146  -67.983  1.00 39.45 ? 327 GLY B CA  1 
ATOM   5172 C  C   . GLY B 1 327 ? 12.720  10.122  -68.924  1.00 38.77 ? 327 GLY B C   1 
ATOM   5173 O  O   . GLY B 1 327 ? 13.945  9.961   -68.962  1.00 37.45 ? 327 GLY B O   1 
ATOM   5174 N  N   . ILE B 1 328 ? 11.884  9.436   -69.709  1.00 40.11 ? 328 ILE B N   1 
ATOM   5175 C  CA  . ILE B 1 328 ? 12.382  8.384   -70.586  1.00 43.84 ? 328 ILE B CA  1 
ATOM   5176 C  C   . ILE B 1 328 ? 13.483  8.900   -71.506  1.00 44.91 ? 328 ILE B C   1 
ATOM   5177 O  O   . ILE B 1 328 ? 14.526  8.247   -71.532  1.00 46.29 ? 328 ILE B O   1 
ATOM   5178 C  CB  . ILE B 1 328 ? 11.160  7.772   -71.347  1.00 47.35 ? 328 ILE B CB  1 
ATOM   5179 C  CG1 . ILE B 1 328 ? 10.473  6.730   -70.473  1.00 50.40 ? 328 ILE B CG1 1 
ATOM   5180 C  CG2 . ILE B 1 328 ? 11.596  7.045   -72.604  1.00 47.17 ? 328 ILE B CG2 1 
ATOM   5181 C  CD1 . ILE B 1 328 ? 9.903   7.210   -69.126  1.00 53.61 ? 328 ILE B CD1 1 
ATOM   5182 N  N   . PRO B 1 329 ? 13.436  10.033  -72.208  1.00 45.94 ? 329 PRO B N   1 
ATOM   5183 C  CA  . PRO B 1 329 ? 14.571  10.536  -72.954  1.00 47.15 ? 329 PRO B CA  1 
ATOM   5184 C  C   . PRO B 1 329 ? 15.846  10.689  -72.144  1.00 49.28 ? 329 PRO B C   1 
ATOM   5185 O  O   . PRO B 1 329 ? 16.864  10.174  -72.616  1.00 53.19 ? 329 PRO B O   1 
ATOM   5186 C  CB  . PRO B 1 329 ? 14.096  11.834  -73.539  1.00 48.37 ? 329 PRO B CB  1 
ATOM   5187 C  CG  . PRO B 1 329 ? 12.859  12.189  -72.759  1.00 49.25 ? 329 PRO B CG  1 
ATOM   5188 C  CD  . PRO B 1 329 ? 12.255  10.820  -72.535  1.00 47.21 ? 329 PRO B CD  1 
ATOM   5189 N  N   . LYS B 1 330 ? 15.857  11.274  -70.932  1.00 48.97 ? 330 LYS B N   1 
ATOM   5190 C  CA  . LYS B 1 330 ? 17.079  11.453  -70.133  1.00 45.16 ? 330 LYS B CA  1 
ATOM   5191 C  C   . LYS B 1 330 ? 17.737  10.115  -69.825  1.00 39.98 ? 330 LYS B C   1 
ATOM   5192 O  O   . LYS B 1 330 ? 18.962  9.986   -69.740  1.00 38.29 ? 330 LYS B O   1 
ATOM   5193 C  CB  . LYS B 1 330 ? 16.706  12.191  -68.858  1.00 51.08 ? 330 LYS B CB  1 
ATOM   5194 C  CG  . LYS B 1 330 ? 17.787  12.569  -67.817  1.00 60.34 ? 330 LYS B CG  1 
ATOM   5195 C  CD  . LYS B 1 330 ? 18.150  11.448  -66.822  1.00 65.34 ? 330 LYS B CD  1 
ATOM   5196 C  CE  . LYS B 1 330 ? 16.929  10.838  -66.130  1.00 66.70 ? 330 LYS B CE  1 
ATOM   5197 N  NZ  . LYS B 1 330 ? 17.284  9.577   -65.507  1.00 67.65 ? 330 LYS B NZ  1 
ATOM   5198 N  N   . LEU B 1 331 ? 16.913  9.091   -69.680  1.00 37.15 ? 331 LEU B N   1 
ATOM   5199 C  CA  . LEU B 1 331 ? 17.414  7.755   -69.439  1.00 35.92 ? 331 LEU B CA  1 
ATOM   5200 C  C   . LEU B 1 331 ? 17.989  7.186   -70.705  1.00 36.94 ? 331 LEU B C   1 
ATOM   5201 O  O   . LEU B 1 331 ? 19.023  6.526   -70.633  1.00 35.12 ? 331 LEU B O   1 
ATOM   5202 C  CB  . LEU B 1 331 ? 16.329  6.817   -68.994  1.00 33.64 ? 331 LEU B CB  1 
ATOM   5203 C  CG  . LEU B 1 331 ? 15.901  6.780   -67.557  1.00 30.29 ? 331 LEU B CG  1 
ATOM   5204 C  CD1 . LEU B 1 331 ? 14.579  6.073   -67.493  1.00 25.57 ? 331 LEU B CD1 1 
ATOM   5205 C  CD2 . LEU B 1 331 ? 16.928  6.051   -66.714  1.00 33.32 ? 331 LEU B CD2 1 
ATOM   5206 N  N   . VAL B 1 332 ? 17.346  7.422   -71.866  1.00 41.52 ? 332 VAL B N   1 
ATOM   5207 C  CA  . VAL B 1 332 ? 17.841  6.921   -73.149  1.00 43.37 ? 332 VAL B CA  1 
ATOM   5208 C  C   . VAL B 1 332 ? 19.200  7.554   -73.338  1.00 45.69 ? 332 VAL B C   1 
ATOM   5209 O  O   . VAL B 1 332 ? 20.147  6.862   -73.707  1.00 46.52 ? 332 VAL B O   1 
ATOM   5210 C  CB  . VAL B 1 332 ? 16.889  7.299   -74.296  1.00 42.85 ? 332 VAL B CB  1 
ATOM   5211 C  CG1 . VAL B 1 332 ? 17.510  7.052   -75.658  1.00 39.47 ? 332 VAL B CG1 1 
ATOM   5212 C  CG2 . VAL B 1 332 ? 15.673  6.384   -74.205  1.00 41.06 ? 332 VAL B CG2 1 
ATOM   5213 N  N   . ALA B 1 333 ? 19.318  8.829   -72.975  1.00 45.29 ? 333 ALA B N   1 
ATOM   5214 C  CA  . ALA B 1 333 ? 20.577  9.533   -73.020  1.00 47.28 ? 333 ALA B CA  1 
ATOM   5215 C  C   . ALA B 1 333 ? 21.560  8.776   -72.129  1.00 50.53 ? 333 ALA B C   1 
ATOM   5216 O  O   . ALA B 1 333 ? 22.632  8.421   -72.621  1.00 52.08 ? 333 ALA B O   1 
ATOM   5217 C  CB  . ALA B 1 333 ? 20.405  10.943  -72.482  1.00 48.85 ? 333 ALA B CB  1 
ATOM   5218 N  N   . ASP B 1 334 ? 21.211  8.432   -70.873  1.00 51.18 ? 334 ASP B N   1 
ATOM   5219 C  CA  . ASP B 1 334 ? 22.103  7.703   -69.977  1.00 51.18 ? 334 ASP B CA  1 
ATOM   5220 C  C   . ASP B 1 334 ? 22.495  6.358   -70.574  1.00 50.73 ? 334 ASP B C   1 
ATOM   5221 O  O   . ASP B 1 334 ? 23.658  5.963   -70.450  1.00 50.02 ? 334 ASP B O   1 
ATOM   5222 C  CB  . ASP B 1 334 ? 21.452  7.448   -68.606  1.00 54.50 ? 334 ASP B CB  1 
ATOM   5223 C  CG  . ASP B 1 334 ? 21.002  8.653   -67.767  1.00 57.77 ? 334 ASP B CG  1 
ATOM   5224 O  OD1 . ASP B 1 334 ? 21.574  9.742   -67.880  1.00 57.46 ? 334 ASP B OD1 1 
ATOM   5225 O  OD2 . ASP B 1 334 ? 20.063  8.494   -66.982  1.00 57.13 ? 334 ASP B OD2 1 
ATOM   5226 N  N   . PHE B 1 335 ? 21.588  5.632   -71.241  1.00 51.09 ? 335 PHE B N   1 
ATOM   5227 C  CA  . PHE B 1 335 ? 21.884  4.356   -71.891  1.00 52.01 ? 335 PHE B CA  1 
ATOM   5228 C  C   . PHE B 1 335 ? 22.931  4.656   -72.959  1.00 55.89 ? 335 PHE B C   1 
ATOM   5229 O  O   . PHE B 1 335 ? 24.031  4.092   -72.952  1.00 58.58 ? 335 PHE B O   1 
ATOM   5230 C  CB  . PHE B 1 335 ? 20.627  3.797   -72.538  1.00 51.39 ? 335 PHE B CB  1 
ATOM   5231 C  CG  . PHE B 1 335 ? 20.785  2.558   -73.423  1.00 54.75 ? 335 PHE B CG  1 
ATOM   5232 C  CD1 . PHE B 1 335 ? 20.778  1.274   -72.864  1.00 54.50 ? 335 PHE B CD1 1 
ATOM   5233 C  CD2 . PHE B 1 335 ? 20.892  2.697   -74.814  1.00 54.05 ? 335 PHE B CD2 1 
ATOM   5234 C  CE1 . PHE B 1 335 ? 20.868  0.149   -73.689  1.00 54.02 ? 335 PHE B CE1 1 
ATOM   5235 C  CE2 . PHE B 1 335 ? 20.981  1.571   -75.627  1.00 50.96 ? 335 PHE B CE2 1 
ATOM   5236 C  CZ  . PHE B 1 335 ? 20.967  0.298   -75.070  1.00 52.74 ? 335 PHE B CZ  1 
ATOM   5237 N  N   . MET B 1 336 ? 22.626  5.638   -73.809  1.00 55.87 ? 336 MET B N   1 
ATOM   5238 C  CA  . MET B 1 336 ? 23.493  6.075   -74.879  1.00 55.29 ? 336 MET B CA  1 
ATOM   5239 C  C   . MET B 1 336 ? 24.828  6.528   -74.336  1.00 55.84 ? 336 MET B C   1 
ATOM   5240 O  O   . MET B 1 336 ? 25.844  6.351   -75.009  1.00 60.13 ? 336 MET B O   1 
ATOM   5241 C  CB  . MET B 1 336 ? 22.851  7.217   -75.643  1.00 56.46 ? 336 MET B CB  1 
ATOM   5242 C  CG  . MET B 1 336 ? 22.726  6.902   -77.116  1.00 59.18 ? 336 MET B CG  1 
ATOM   5243 S  SD  . MET B 1 336 ? 21.830  5.358   -77.419  1.00 65.61 ? 336 MET B SD  1 
ATOM   5244 C  CE  . MET B 1 336 ? 23.148  4.360   -78.055  1.00 66.84 ? 336 MET B CE  1 
ATOM   5245 N  N   . ALA B 1 337 ? 24.893  7.052   -73.118  1.00 53.83 ? 337 ALA B N   1 
ATOM   5246 C  CA  . ALA B 1 337 ? 26.152  7.481   -72.539  1.00 53.34 ? 337 ALA B CA  1 
ATOM   5247 C  C   . ALA B 1 337 ? 26.817  6.356   -71.748  1.00 52.81 ? 337 ALA B C   1 
ATOM   5248 O  O   . ALA B 1 337 ? 27.607  6.598   -70.828  1.00 53.80 ? 337 ALA B O   1 
ATOM   5249 C  CB  . ALA B 1 337 ? 25.916  8.676   -71.617  1.00 54.41 ? 337 ALA B CB  1 
ATOM   5250 N  N   . LYS B 1 338 ? 26.491  5.108   -72.108  1.00 52.66 ? 338 LYS B N   1 
ATOM   5251 C  CA  . LYS B 1 338 ? 27.031  3.888   -71.517  1.00 54.66 ? 338 LYS B CA  1 
ATOM   5252 C  C   . LYS B 1 338 ? 26.818  3.700   -70.019  1.00 54.72 ? 338 LYS B C   1 
ATOM   5253 O  O   . LYS B 1 338 ? 27.646  3.094   -69.329  1.00 57.01 ? 338 LYS B O   1 
ATOM   5254 C  CB  . LYS B 1 338 ? 28.541  3.790   -71.815  1.00 56.30 ? 338 LYS B CB  1 
ATOM   5255 C  CG  . LYS B 1 338 ? 28.932  3.451   -73.233  1.00 58.86 ? 338 LYS B CG  1 
ATOM   5256 C  CD  . LYS B 1 338 ? 28.540  2.015   -73.538  1.00 62.39 ? 338 LYS B CD  1 
ATOM   5257 C  CE  . LYS B 1 338 ? 28.919  1.679   -74.979  1.00 66.51 ? 338 LYS B CE  1 
ATOM   5258 N  NZ  . LYS B 1 338 ? 30.356  1.772   -75.194  1.00 67.59 ? 338 LYS B NZ  1 
ATOM   5259 N  N   . LYS B 1 339 ? 25.697  4.166   -69.474  1.00 52.26 ? 339 LYS B N   1 
ATOM   5260 C  CA  . LYS B 1 339 ? 25.460  3.990   -68.052  1.00 49.95 ? 339 LYS B CA  1 
ATOM   5261 C  C   . LYS B 1 339 ? 25.005  2.596   -67.647  1.00 47.11 ? 339 LYS B C   1 
ATOM   5262 O  O   . LYS B 1 339 ? 25.416  2.102   -66.606  1.00 48.32 ? 339 LYS B O   1 
ATOM   5263 C  CB  . LYS B 1 339 ? 24.414  4.978   -67.556  1.00 49.85 ? 339 LYS B CB  1 
ATOM   5264 C  CG  . LYS B 1 339 ? 24.974  6.215   -66.884  1.00 51.05 ? 339 LYS B CG  1 
ATOM   5265 C  CD  . LYS B 1 339 ? 25.813  7.032   -67.836  1.00 56.17 ? 339 LYS B CD  1 
ATOM   5266 C  CE  . LYS B 1 339 ? 26.421  8.204   -67.087  1.00 62.36 ? 339 LYS B CE  1 
ATOM   5267 N  NZ  . LYS B 1 339 ? 27.388  8.884   -67.931  1.00 66.96 ? 339 LYS B NZ  1 
ATOM   5268 N  N   . PHE B 1 340 ? 24.206  1.890   -68.432  1.00 43.34 ? 340 PHE B N   1 
ATOM   5269 C  CA  . PHE B 1 340 ? 23.709  0.598   -68.020  1.00 40.10 ? 340 PHE B CA  1 
ATOM   5270 C  C   . PHE B 1 340 ? 23.517  -0.321  -69.211  1.00 41.27 ? 340 PHE B C   1 
ATOM   5271 O  O   . PHE B 1 340 ? 23.715  0.117   -70.345  1.00 45.28 ? 340 PHE B O   1 
ATOM   5272 C  CB  . PHE B 1 340 ? 22.394  0.823   -67.276  1.00 36.70 ? 340 PHE B CB  1 
ATOM   5273 C  CG  . PHE B 1 340 ? 21.329  1.685   -67.964  1.00 32.30 ? 340 PHE B CG  1 
ATOM   5274 C  CD1 . PHE B 1 340 ? 20.380  1.109   -68.811  1.00 31.88 ? 340 PHE B CD1 1 
ATOM   5275 C  CD2 . PHE B 1 340 ? 21.289  3.057   -67.709  1.00 31.44 ? 340 PHE B CD2 1 
ATOM   5276 C  CE1 . PHE B 1 340 ? 19.403  1.911   -69.391  1.00 29.89 ? 340 PHE B CE1 1 
ATOM   5277 C  CE2 . PHE B 1 340 ? 20.313  3.862   -68.283  1.00 28.65 ? 340 PHE B CE2 1 
ATOM   5278 C  CZ  . PHE B 1 340 ? 19.374  3.285   -69.123  1.00 32.76 ? 340 PHE B CZ  1 
ATOM   5279 N  N   . SER B 1 341 ? 23.117  -1.574  -69.057  1.00 38.62 ? 341 SER B N   1 
ATOM   5280 C  CA  . SER B 1 341 ? 22.943  -2.432  -70.202  1.00 39.34 ? 341 SER B CA  1 
ATOM   5281 C  C   . SER B 1 341 ? 21.686  -3.244  -69.986  1.00 42.36 ? 341 SER B C   1 
ATOM   5282 O  O   . SER B 1 341 ? 21.507  -3.931  -68.967  1.00 44.64 ? 341 SER B O   1 
ATOM   5283 C  CB  . SER B 1 341 ? 24.125  -3.372  -70.353  1.00 39.67 ? 341 SER B CB  1 
ATOM   5284 O  OG  . SER B 1 341 ? 25.362  -2.674  -70.245  1.00 43.10 ? 341 SER B OG  1 
ATOM   5285 N  N   . LEU B 1 342 ? 20.821  -3.171  -70.999  1.00 36.75 ? 342 LEU B N   1 
ATOM   5286 C  CA  . LEU B 1 342 ? 19.564  -3.884  -70.971  1.00 34.13 ? 342 LEU B CA  1 
ATOM   5287 C  C   . LEU B 1 342 ? 19.702  -5.307  -71.469  1.00 34.77 ? 342 LEU B C   1 
ATOM   5288 O  O   . LEU B 1 342 ? 18.779  -6.122  -71.396  1.00 38.17 ? 342 LEU B O   1 
ATOM   5289 C  CB  . LEU B 1 342 ? 18.560  -3.126  -71.826  1.00 35.96 ? 342 LEU B CB  1 
ATOM   5290 C  CG  . LEU B 1 342 ? 18.335  -1.651  -71.515  1.00 35.49 ? 342 LEU B CG  1 
ATOM   5291 C  CD1 . LEU B 1 342 ? 17.642  -0.978  -72.679  1.00 33.18 ? 342 LEU B CD1 1 
ATOM   5292 C  CD2 . LEU B 1 342 ? 17.506  -1.528  -70.256  1.00 38.57 ? 342 LEU B CD2 1 
ATOM   5293 N  N   . ASP B 1 343 ? 20.896  -5.653  -71.921  1.00 35.11 ? 343 ASP B N   1 
ATOM   5294 C  CA  . ASP B 1 343 ? 21.138  -6.956  -72.497  1.00 36.07 ? 343 ASP B CA  1 
ATOM   5295 C  C   . ASP B 1 343 ? 20.715  -8.152  -71.702  1.00 35.59 ? 343 ASP B C   1 
ATOM   5296 O  O   . ASP B 1 343 ? 19.957  -8.953  -72.234  1.00 36.20 ? 343 ASP B O   1 
ATOM   5297 C  CB  . ASP B 1 343 ? 22.609  -7.056  -72.851  1.00 40.02 ? 343 ASP B CB  1 
ATOM   5298 C  CG  . ASP B 1 343 ? 22.851  -6.447  -74.234  1.00 47.20 ? 343 ASP B CG  1 
ATOM   5299 O  OD1 . ASP B 1 343 ? 22.292  -6.993  -75.190  1.00 51.50 ? 343 ASP B OD1 1 
ATOM   5300 O  OD2 . ASP B 1 343 ? 23.567  -5.440  -74.355  1.00 45.73 ? 343 ASP B OD2 1 
ATOM   5301 N  N   . ALA B 1 344 ? 21.059  -8.190  -70.408  1.00 34.51 ? 344 ALA B N   1 
ATOM   5302 C  CA  . ALA B 1 344 ? 20.700  -9.312  -69.548  1.00 30.21 ? 344 ALA B CA  1 
ATOM   5303 C  C   . ALA B 1 344 ? 19.213  -9.604  -69.460  1.00 30.86 ? 344 ALA B C   1 
ATOM   5304 O  O   . ALA B 1 344 ? 18.780  -10.732 -69.182  1.00 31.02 ? 344 ALA B O   1 
ATOM   5305 C  CB  . ALA B 1 344 ? 21.195  -9.050  -68.148  1.00 33.92 ? 344 ALA B CB  1 
ATOM   5306 N  N   . LEU B 1 345 ? 18.450  -8.542  -69.702  1.00 29.74 ? 345 LEU B N   1 
ATOM   5307 C  CA  . LEU B 1 345 ? 17.013  -8.608  -69.624  1.00 31.47 ? 345 LEU B CA  1 
ATOM   5308 C  C   . LEU B 1 345 ? 16.393  -9.108  -70.895  1.00 31.40 ? 345 LEU B C   1 
ATOM   5309 O  O   . LEU B 1 345 ? 15.391  -9.843  -70.823  1.00 27.82 ? 345 LEU B O   1 
ATOM   5310 C  CB  . LEU B 1 345 ? 16.478  -7.234  -69.290  1.00 37.36 ? 345 LEU B CB  1 
ATOM   5311 C  CG  . LEU B 1 345 ? 16.939  -6.617  -67.971  1.00 35.88 ? 345 LEU B CG  1 
ATOM   5312 C  CD1 . LEU B 1 345 ? 16.762  -5.123  -68.029  1.00 37.74 ? 345 LEU B CD1 1 
ATOM   5313 C  CD2 . LEU B 1 345 ? 16.171  -7.242  -66.837  1.00 36.95 ? 345 LEU B CD2 1 
ATOM   5314 N  N   . ILE B 1 346 ? 16.977  -8.713  -72.046  1.00 34.63 ? 346 ILE B N   1 
ATOM   5315 C  CA  . ILE B 1 346 ? 16.458  -9.134  -73.347  1.00 36.04 ? 346 ILE B CA  1 
ATOM   5316 C  C   . ILE B 1 346 ? 16.979  -10.551 -73.448  1.00 35.83 ? 346 ILE B C   1 
ATOM   5317 O  O   . ILE B 1 346 ? 18.162  -10.850 -73.539  1.00 37.39 ? 346 ILE B O   1 
ATOM   5318 C  CB  . ILE B 1 346 ? 17.007  -8.288  -74.490  1.00 38.54 ? 346 ILE B CB  1 
ATOM   5319 C  CG1 . ILE B 1 346 ? 16.844  -6.783  -74.305  1.00 40.70 ? 346 ILE B CG1 1 
ATOM   5320 C  CG2 . ILE B 1 346 ? 16.162  -8.663  -75.681  1.00 43.66 ? 346 ILE B CG2 1 
ATOM   5321 C  CD1 . ILE B 1 346 ? 18.068  -5.984  -74.800  1.00 40.06 ? 346 ILE B CD1 1 
ATOM   5322 N  N   . THR B 1 347 ? 16.016  -11.419 -73.270  1.00 36.89 ? 347 THR B N   1 
ATOM   5323 C  CA  . THR B 1 347 ? 16.230  -12.836 -73.235  1.00 35.82 ? 347 THR B CA  1 
ATOM   5324 C  C   . THR B 1 347 ? 15.898  -13.503 -74.567  1.00 38.48 ? 347 THR B C   1 
ATOM   5325 O  O   . THR B 1 347 ? 16.532  -14.486 -74.948  1.00 40.96 ? 347 THR B O   1 
ATOM   5326 C  CB  . THR B 1 347 ? 15.366  -13.275 -72.031  1.00 33.61 ? 347 THR B CB  1 
ATOM   5327 O  OG1 . THR B 1 347 ? 15.562  -14.620 -71.669  1.00 32.90 ? 347 THR B OG1 1 
ATOM   5328 C  CG2 . THR B 1 347 ? 13.931  -13.291 -72.429  1.00 34.40 ? 347 THR B CG2 1 
ATOM   5329 N  N   . HIS B 1 348 ? 14.871  -13.097 -75.309  1.00 41.23 ? 348 HIS B N   1 
ATOM   5330 C  CA  . HIS B 1 348 ? 14.480  -13.718 -76.562  1.00 40.82 ? 348 HIS B CA  1 
ATOM   5331 C  C   . HIS B 1 348 ? 14.017  -12.600 -77.453  1.00 42.24 ? 348 HIS B C   1 
ATOM   5332 O  O   . HIS B 1 348 ? 13.480  -11.626 -76.923  1.00 43.70 ? 348 HIS B O   1 
ATOM   5333 C  CB  . HIS B 1 348 ? 13.290  -14.634 -76.443  1.00 40.04 ? 348 HIS B CB  1 
ATOM   5334 C  CG  . HIS B 1 348 ? 13.391  -15.727 -75.407  1.00 42.54 ? 348 HIS B CG  1 
ATOM   5335 N  ND1 . HIS B 1 348 ? 14.401  -16.159 -74.668  1.00 43.56 ? 348 HIS B ND1 1 
ATOM   5336 C  CD2 . HIS B 1 348 ? 12.302  -16.476 -75.060  1.00 43.87 ? 348 HIS B CD2 1 
ATOM   5337 C  CE1 . HIS B 1 348 ? 13.968  -17.120 -73.898  1.00 44.98 ? 348 HIS B CE1 1 
ATOM   5338 N  NE2 . HIS B 1 348 ? 12.700  -17.305 -74.144  1.00 43.84 ? 348 HIS B NE2 1 
ATOM   5339 N  N   . VAL B 1 349 ? 14.247  -12.681 -78.765  1.00 44.12 ? 349 VAL B N   1 
ATOM   5340 C  CA  . VAL B 1 349 ? 13.755  -11.669 -79.690  1.00 42.60 ? 349 VAL B CA  1 
ATOM   5341 C  C   . VAL B 1 349 ? 12.980  -12.529 -80.664  1.00 39.97 ? 349 VAL B C   1 
ATOM   5342 O  O   . VAL B 1 349 ? 13.453  -13.585 -81.065  1.00 38.89 ? 349 VAL B O   1 
ATOM   5343 C  CB  . VAL B 1 349 ? 14.883  -10.918 -80.423  1.00 42.52 ? 349 VAL B CB  1 
ATOM   5344 C  CG1 . VAL B 1 349 ? 14.253  -9.780  -81.227  1.00 40.65 ? 349 VAL B CG1 1 
ATOM   5345 C  CG2 . VAL B 1 349 ? 15.867  -10.289 -79.441  1.00 41.68 ? 349 VAL B CG2 1 
ATOM   5346 N  N   . LEU B 1 350 ? 11.762  -12.182 -80.989  1.00 41.95 ? 350 LEU B N   1 
ATOM   5347 C  CA  . LEU B 1 350 ? 10.962  -12.964 -81.911  1.00 45.34 ? 350 LEU B CA  1 
ATOM   5348 C  C   . LEU B 1 350 ? 10.364  -12.053 -82.986  1.00 48.27 ? 350 LEU B C   1 
ATOM   5349 O  O   . LEU B 1 350 ? 10.293  -10.833 -82.797  1.00 47.66 ? 350 LEU B O   1 
ATOM   5350 C  CB  . LEU B 1 350 ? 9.798   -13.649 -81.197  1.00 42.40 ? 350 LEU B CB  1 
ATOM   5351 C  CG  . LEU B 1 350 ? 10.007  -14.628 -80.082  1.00 42.27 ? 350 LEU B CG  1 
ATOM   5352 C  CD1 . LEU B 1 350 ? 8.676   -15.271 -79.711  1.00 37.75 ? 350 LEU B CD1 1 
ATOM   5353 C  CD2 . LEU B 1 350 ? 10.998  -15.677 -80.533  1.00 47.79 ? 350 LEU B CD2 1 
ATOM   5354 N  N   . PRO B 1 351 ? 9.929   -12.550 -84.146  1.00 52.12 ? 351 PRO B N   1 
ATOM   5355 C  CA  . PRO B 1 351 ? 9.190   -11.752 -85.114  1.00 52.28 ? 351 PRO B CA  1 
ATOM   5356 C  C   . PRO B 1 351 ? 7.814   -11.553 -84.492  1.00 50.76 ? 351 PRO B C   1 
ATOM   5357 O  O   . PRO B 1 351 ? 7.228   -12.512 -83.985  1.00 51.49 ? 351 PRO B O   1 
ATOM   5358 C  CB  . PRO B 1 351 ? 9.190   -12.605 -86.368  1.00 53.27 ? 351 PRO B CB  1 
ATOM   5359 C  CG  . PRO B 1 351 ? 9.237   -14.034 -85.848  1.00 52.81 ? 351 PRO B CG  1 
ATOM   5360 C  CD  . PRO B 1 351 ? 10.231  -13.884 -84.691  1.00 54.31 ? 351 PRO B CD  1 
ATOM   5361 N  N   . PHE B 1 352 ? 7.257   -10.354 -84.518  1.00 49.74 ? 352 PHE B N   1 
ATOM   5362 C  CA  . PHE B 1 352 ? 5.943   -10.055 -83.966  1.00 48.73 ? 352 PHE B CA  1 
ATOM   5363 C  C   . PHE B 1 352 ? 4.869   -11.117 -84.227  1.00 48.95 ? 352 PHE B C   1 
ATOM   5364 O  O   . PHE B 1 352 ? 4.019   -11.371 -83.377  1.00 48.61 ? 352 PHE B O   1 
ATOM   5365 C  CB  . PHE B 1 352 ? 5.554   -8.664  -84.532  1.00 49.20 ? 352 PHE B CB  1 
ATOM   5366 C  CG  . PHE B 1 352 ? 4.069   -8.318  -84.527  1.00 51.23 ? 352 PHE B CG  1 
ATOM   5367 C  CD1 . PHE B 1 352 ? 3.417   -7.998  -83.335  1.00 49.41 ? 352 PHE B CD1 1 
ATOM   5368 C  CD2 . PHE B 1 352 ? 3.349   -8.384  -85.727  1.00 49.45 ? 352 PHE B CD2 1 
ATOM   5369 C  CE1 . PHE B 1 352 ? 2.046   -7.758  -83.357  1.00 50.22 ? 352 PHE B CE1 1 
ATOM   5370 C  CE2 . PHE B 1 352 ? 1.980   -8.141  -85.735  1.00 47.48 ? 352 PHE B CE2 1 
ATOM   5371 C  CZ  . PHE B 1 352 ? 1.327   -7.830  -84.550  1.00 48.51 ? 352 PHE B CZ  1 
ATOM   5372 N  N   . GLU B 1 353 ? 4.915   -11.836 -85.353  1.00 50.76 ? 353 GLU B N   1 
ATOM   5373 C  CA  . GLU B 1 353 ? 3.895   -12.823 -85.681  1.00 50.75 ? 353 GLU B CA  1 
ATOM   5374 C  C   . GLU B 1 353 ? 3.897   -13.990 -84.735  1.00 50.40 ? 353 GLU B C   1 
ATOM   5375 O  O   . GLU B 1 353 ? 2.952   -14.772 -84.712  1.00 52.14 ? 353 GLU B O   1 
ATOM   5376 C  CB  . GLU B 1 353 ? 4.065   -13.378 -87.087  1.00 52.52 ? 353 GLU B CB  1 
ATOM   5377 C  CG  . GLU B 1 353 ? 3.895   -12.360 -88.211  1.00 54.71 ? 353 GLU B CG  1 
ATOM   5378 C  CD  . GLU B 1 353 ? 5.085   -11.429 -88.441  1.00 58.45 ? 353 GLU B CD  1 
ATOM   5379 O  OE1 . GLU B 1 353 ? 6.236   -11.889 -88.369  1.00 61.07 ? 353 GLU B OE1 1 
ATOM   5380 O  OE2 . GLU B 1 353 ? 4.849   -10.244 -88.702  1.00 58.20 ? 353 GLU B OE2 1 
ATOM   5381 N  N   . LYS B 1 354 ? 4.956   -14.125 -83.954  1.00 49.52 ? 354 LYS B N   1 
ATOM   5382 C  CA  . LYS B 1 354 ? 5.061   -15.177 -82.965  1.00 50.05 ? 354 LYS B CA  1 
ATOM   5383 C  C   . LYS B 1 354 ? 4.660   -14.673 -81.568  1.00 49.32 ? 354 LYS B C   1 
ATOM   5384 O  O   . LYS B 1 354 ? 4.997   -15.307 -80.563  1.00 49.84 ? 354 LYS B O   1 
ATOM   5385 C  CB  . LYS B 1 354 ? 6.500   -15.685 -82.973  1.00 51.37 ? 354 LYS B CB  1 
ATOM   5386 C  CG  . LYS B 1 354 ? 6.940   -16.370 -84.265  1.00 55.30 ? 354 LYS B CG  1 
ATOM   5387 C  CD  . LYS B 1 354 ? 6.598   -17.861 -84.305  1.00 57.03 ? 354 LYS B CD  1 
ATOM   5388 C  CE  . LYS B 1 354 ? 5.117   -18.220 -84.479  1.00 59.15 ? 354 LYS B CE  1 
ATOM   5389 N  NZ  . LYS B 1 354 ? 4.922   -19.651 -84.330  1.00 61.92 ? 354 LYS B NZ  1 
ATOM   5390 N  N   . ILE B 1 355 ? 3.890   -13.588 -81.436  1.00 45.79 ? 355 ILE B N   1 
ATOM   5391 C  CA  . ILE B 1 355 ? 3.521   -13.022 -80.156  1.00 44.22 ? 355 ILE B CA  1 
ATOM   5392 C  C   . ILE B 1 355 ? 2.941   -14.047 -79.185  1.00 44.84 ? 355 ILE B C   1 
ATOM   5393 O  O   . ILE B 1 355 ? 3.435   -14.086 -78.048  1.00 45.69 ? 355 ILE B O   1 
ATOM   5394 C  CB  . ILE B 1 355 ? 2.556   -11.800 -80.438  1.00 42.94 ? 355 ILE B CB  1 
ATOM   5395 C  CG1 . ILE B 1 355 ? 2.446   -11.001 -79.152  1.00 38.08 ? 355 ILE B CG1 1 
ATOM   5396 C  CG2 . ILE B 1 355 ? 1.191   -12.233 -80.980  1.00 37.88 ? 355 ILE B CG2 1 
ATOM   5397 C  CD1 . ILE B 1 355 ? 1.515   -9.796  -79.240  1.00 37.95 ? 355 ILE B CD1 1 
ATOM   5398 N  N   . ASN B 1 356 ? 2.032   -14.959 -79.555  1.00 42.28 ? 356 ASN B N   1 
ATOM   5399 C  CA  . ASN B 1 356 ? 1.522   -15.935 -78.583  1.00 44.49 ? 356 ASN B CA  1 
ATOM   5400 C  C   . ASN B 1 356 ? 2.646   -16.823 -78.069  1.00 44.88 ? 356 ASN B C   1 
ATOM   5401 O  O   . ASN B 1 356 ? 2.627   -17.258 -76.928  1.00 46.97 ? 356 ASN B O   1 
ATOM   5402 C  CB  . ASN B 1 356 ? 0.457   -16.868 -79.163  1.00 46.12 ? 356 ASN B CB  1 
ATOM   5403 C  CG  . ASN B 1 356 ? -0.736  -16.163 -79.805  1.00 53.84 ? 356 ASN B CG  1 
ATOM   5404 O  OD1 . ASN B 1 356 ? -0.606  -15.068 -80.343  1.00 58.64 ? 356 ASN B OD1 1 
ATOM   5405 N  ND2 . ASN B 1 356 ? -1.942  -16.703 -79.833  1.00 50.29 ? 356 ASN B ND2 1 
ATOM   5406 N  N   . GLU B 1 357 ? 3.690   -17.048 -78.853  1.00 46.38 ? 357 GLU B N   1 
ATOM   5407 C  CA  . GLU B 1 357 ? 4.830   -17.859 -78.467  1.00 48.41 ? 357 GLU B CA  1 
ATOM   5408 C  C   . GLU B 1 357 ? 5.553   -17.127 -77.363  1.00 47.21 ? 357 GLU B C   1 
ATOM   5409 O  O   . GLU B 1 357 ? 5.998   -17.741 -76.394  1.00 50.28 ? 357 GLU B O   1 
ATOM   5410 C  CB  . GLU B 1 357 ? 5.825   -18.044 -79.609  1.00 51.79 ? 357 GLU B CB  1 
ATOM   5411 C  CG  . GLU B 1 357 ? 6.018   -19.471 -80.074  1.00 59.93 ? 357 GLU B CG  1 
ATOM   5412 C  CD  . GLU B 1 357 ? 7.455   -19.733 -80.514  1.00 66.04 ? 357 GLU B CD  1 
ATOM   5413 O  OE1 . GLU B 1 357 ? 8.324   -19.819 -79.640  1.00 66.58 ? 357 GLU B OE1 1 
ATOM   5414 O  OE2 . GLU B 1 357 ? 7.708   -19.853 -81.719  1.00 67.37 ? 357 GLU B OE2 1 
ATOM   5415 N  N   . GLY B 1 358 ? 5.653   -15.805 -77.516  1.00 45.27 ? 358 GLY B N   1 
ATOM   5416 C  CA  . GLY B 1 358 ? 6.315   -14.932 -76.563  1.00 43.51 ? 358 GLY B CA  1 
ATOM   5417 C  C   . GLY B 1 358 ? 5.601   -14.937 -75.210  1.00 41.84 ? 358 GLY B C   1 
ATOM   5418 O  O   . GLY B 1 358 ? 6.221   -14.901 -74.144  1.00 39.29 ? 358 GLY B O   1 
ATOM   5419 N  N   . PHE B 1 359 ? 4.276   -14.945 -75.217  1.00 41.82 ? 359 PHE B N   1 
ATOM   5420 C  CA  . PHE B 1 359 ? 3.547   -14.996 -73.981  1.00 41.55 ? 359 PHE B CA  1 
ATOM   5421 C  C   . PHE B 1 359 ? 3.751   -16.375 -73.370  1.00 44.84 ? 359 PHE B C   1 
ATOM   5422 O  O   . PHE B 1 359 ? 3.794   -16.468 -72.138  1.00 48.58 ? 359 PHE B O   1 
ATOM   5423 C  CB  . PHE B 1 359 ? 2.088   -14.735 -74.245  1.00 40.14 ? 359 PHE B CB  1 
ATOM   5424 C  CG  . PHE B 1 359 ? 1.754   -13.250 -74.245  1.00 41.63 ? 359 PHE B CG  1 
ATOM   5425 C  CD1 . PHE B 1 359 ? 2.329   -12.382 -75.174  1.00 44.08 ? 359 PHE B CD1 1 
ATOM   5426 C  CD2 . PHE B 1 359 ? 0.860   -12.747 -73.300  1.00 43.23 ? 359 PHE B CD2 1 
ATOM   5427 C  CE1 . PHE B 1 359 ? 2.018   -11.023 -75.157  1.00 43.43 ? 359 PHE B CE1 1 
ATOM   5428 C  CE2 . PHE B 1 359 ? 0.548   -11.389 -73.282  1.00 45.80 ? 359 PHE B CE2 1 
ATOM   5429 C  CZ  . PHE B 1 359 ? 1.128   -10.528 -74.211  1.00 47.21 ? 359 PHE B CZ  1 
ATOM   5430 N  N   . ASP B 1 360 ? 3.881   -17.467 -74.140  1.00 44.89 ? 360 ASP B N   1 
ATOM   5431 C  CA  . ASP B 1 360 ? 4.121   -18.814 -73.595  1.00 43.59 ? 360 ASP B CA  1 
ATOM   5432 C  C   . ASP B 1 360 ? 5.477   -18.851 -72.908  1.00 40.20 ? 360 ASP B C   1 
ATOM   5433 O  O   . ASP B 1 360 ? 5.606   -19.443 -71.845  1.00 41.43 ? 360 ASP B O   1 
ATOM   5434 C  CB  . ASP B 1 360 ? 4.175   -19.920 -74.652  1.00 46.32 ? 360 ASP B CB  1 
ATOM   5435 C  CG  . ASP B 1 360 ? 2.975   -20.076 -75.571  1.00 51.24 ? 360 ASP B CG  1 
ATOM   5436 O  OD1 . ASP B 1 360 ? 1.854   -19.737 -75.183  1.00 55.51 ? 360 ASP B OD1 1 
ATOM   5437 O  OD2 . ASP B 1 360 ? 3.179   -20.543 -76.694  1.00 54.18 ? 360 ASP B OD2 1 
ATOM   5438 N  N   . LEU B 1 361 ? 6.499   -18.218 -73.460  1.00 35.65 ? 361 LEU B N   1 
ATOM   5439 C  CA  . LEU B 1 361 ? 7.796   -18.180 -72.823  1.00 37.64 ? 361 LEU B CA  1 
ATOM   5440 C  C   . LEU B 1 361 ? 7.726   -17.537 -71.440  1.00 39.59 ? 361 LEU B C   1 
ATOM   5441 O  O   . LEU B 1 361 ? 8.400   -17.990 -70.494  1.00 40.98 ? 361 LEU B O   1 
ATOM   5442 C  CB  . LEU B 1 361 ? 8.757   -17.417 -73.718  1.00 36.23 ? 361 LEU B CB  1 
ATOM   5443 C  CG  . LEU B 1 361 ? 9.070   -18.227 -74.944  1.00 39.36 ? 361 LEU B CG  1 
ATOM   5444 C  CD1 . LEU B 1 361 ? 9.334   -17.300 -76.101  1.00 41.86 ? 361 LEU B CD1 1 
ATOM   5445 C  CD2 . LEU B 1 361 ? 10.189  -19.211 -74.593  1.00 38.93 ? 361 LEU B CD2 1 
ATOM   5446 N  N   . LEU B 1 362 ? 6.943   -16.446 -71.335  1.00 39.79 ? 362 LEU B N   1 
ATOM   5447 C  CA  . LEU B 1 362 ? 6.732   -15.747 -70.070  1.00 38.51 ? 362 LEU B CA  1 
ATOM   5448 C  C   . LEU B 1 362 ? 6.031   -16.727 -69.145  1.00 34.66 ? 362 LEU B C   1 
ATOM   5449 O  O   . LEU B 1 362 ? 6.567   -17.051 -68.082  1.00 37.89 ? 362 LEU B O   1 
ATOM   5450 C  CB  . LEU B 1 362 ? 5.844   -14.515 -70.228  1.00 37.25 ? 362 LEU B CB  1 
ATOM   5451 C  CG  . LEU B 1 362 ? 5.843   -13.491 -69.085  1.00 30.83 ? 362 LEU B CG  1 
ATOM   5452 C  CD1 . LEU B 1 362 ? 7.220   -12.811 -68.909  1.00 24.67 ? 362 LEU B CD1 1 
ATOM   5453 C  CD2 . LEU B 1 362 ? 4.796   -12.456 -69.424  1.00 23.21 ? 362 LEU B CD2 1 
ATOM   5454 N  N   . HIS B 1 363 ? 4.933   -17.328 -69.583  1.00 26.16 ? 363 HIS B N   1 
ATOM   5455 C  CA  . HIS B 1 363 ? 4.195   -18.310 -68.799  1.00 26.78 ? 363 HIS B CA  1 
ATOM   5456 C  C   . HIS B 1 363 ? 5.001   -19.583 -68.475  1.00 29.92 ? 363 HIS B C   1 
ATOM   5457 O  O   . HIS B 1 363 ? 4.393   -20.624 -68.187  1.00 31.69 ? 363 HIS B O   1 
ATOM   5458 C  CB  . HIS B 1 363 ? 2.941   -18.784 -69.529  1.00 24.45 ? 363 HIS B CB  1 
ATOM   5459 C  CG  . HIS B 1 363 ? 1.899   -17.756 -69.919  1.00 29.63 ? 363 HIS B CG  1 
ATOM   5460 N  ND1 . HIS B 1 363 ? 0.766   -18.027 -70.556  1.00 34.04 ? 363 HIS B ND1 1 
ATOM   5461 C  CD2 . HIS B 1 363 ? 1.912   -16.411 -69.640  1.00 32.41 ? 363 HIS B CD2 1 
ATOM   5462 C  CE1 . HIS B 1 363 ? 0.088   -16.911 -70.667  1.00 35.44 ? 363 HIS B CE1 1 
ATOM   5463 N  NE2 . HIS B 1 363 ? 0.785   -15.943 -70.114  1.00 35.63 ? 363 HIS B NE2 1 
ATOM   5464 N  N   . SER B 1 364 ? 6.332   -19.621 -68.562  1.00 30.70 ? 364 SER B N   1 
ATOM   5465 C  CA  . SER B 1 364 ? 7.120   -20.787 -68.254  1.00 32.06 ? 364 SER B CA  1 
ATOM   5466 C  C   . SER B 1 364 ? 8.483   -20.373 -67.722  1.00 33.07 ? 364 SER B C   1 
ATOM   5467 O  O   . SER B 1 364 ? 9.403   -21.174 -67.725  1.00 36.68 ? 364 SER B O   1 
ATOM   5468 C  CB  . SER B 1 364 ? 7.257   -21.625 -69.531  1.00 34.01 ? 364 SER B CB  1 
ATOM   5469 O  OG  . SER B 1 364 ? 6.006   -22.115 -70.020  1.00 33.24 ? 364 SER B OG  1 
ATOM   5470 N  N   . GLY B 1 365 ? 8.737   -19.134 -67.310  1.00 34.23 ? 365 GLY B N   1 
ATOM   5471 C  CA  . GLY B 1 365 ? 10.021  -18.725 -66.737  1.00 36.94 ? 365 GLY B CA  1 
ATOM   5472 C  C   . GLY B 1 365 ? 11.259  -18.860 -67.604  1.00 40.81 ? 365 GLY B C   1 
ATOM   5473 O  O   . GLY B 1 365 ? 12.402  -18.892 -67.113  1.00 43.18 ? 365 GLY B O   1 
ATOM   5474 N  N   . LYS B 1 366 ? 11.027  -18.978 -68.912  1.00 41.58 ? 366 LYS B N   1 
ATOM   5475 C  CA  . LYS B 1 366 ? 12.141  -19.074 -69.836  1.00 41.22 ? 366 LYS B CA  1 
ATOM   5476 C  C   . LYS B 1 366 ? 12.680  -17.686 -70.101  1.00 37.99 ? 366 LYS B C   1 
ATOM   5477 O  O   . LYS B 1 366 ? 13.870  -17.412 -70.290  1.00 38.20 ? 366 LYS B O   1 
ATOM   5478 C  CB  . LYS B 1 366 ? 11.707  -19.661 -71.159  1.00 44.84 ? 366 LYS B CB  1 
ATOM   5479 C  CG  . LYS B 1 366 ? 11.764  -21.178 -71.293  1.00 51.89 ? 366 LYS B CG  1 
ATOM   5480 C  CD  . LYS B 1 366 ? 10.428  -21.854 -71.022  1.00 55.51 ? 366 LYS B CD  1 
ATOM   5481 C  CE  . LYS B 1 366 ? 10.441  -23.191 -71.773  1.00 57.85 ? 366 LYS B CE  1 
ATOM   5482 N  NZ  . LYS B 1 366 ? 9.210   -23.941 -71.606  1.00 58.38 ? 366 LYS B NZ  1 
ATOM   5483 N  N   . SER B 1 367 ? 11.699  -16.806 -70.217  1.00 36.56 ? 367 SER B N   1 
ATOM   5484 C  CA  . SER B 1 367 ? 11.964  -15.419 -70.507  1.00 32.34 ? 367 SER B CA  1 
ATOM   5485 C  C   . SER B 1 367 ? 11.905  -14.498 -69.321  1.00 30.15 ? 367 SER B C   1 
ATOM   5486 O  O   . SER B 1 367 ? 11.185  -14.761 -68.362  1.00 29.62 ? 367 SER B O   1 
ATOM   5487 C  CB  . SER B 1 367 ? 10.962  -14.918 -71.518  1.00 29.43 ? 367 SER B CB  1 
ATOM   5488 O  OG  . SER B 1 367 ? 9.715   -15.587 -71.329  1.00 27.48 ? 367 SER B OG  1 
ATOM   5489 N  N   . ILE B 1 368 ? 12.796  -13.533 -69.420  1.00 27.59 ? 368 ILE B N   1 
ATOM   5490 C  CA  . ILE B 1 368 ? 12.826  -12.398 -68.540  1.00 28.81 ? 368 ILE B CA  1 
ATOM   5491 C  C   . ILE B 1 368 ? 12.110  -11.462 -69.546  1.00 31.53 ? 368 ILE B C   1 
ATOM   5492 O  O   . ILE B 1 368 ? 10.878  -11.422 -69.524  1.00 31.68 ? 368 ILE B O   1 
ATOM   5493 C  CB  . ILE B 1 368 ? 14.261  -12.004 -68.270  1.00 26.18 ? 368 ILE B CB  1 
ATOM   5494 C  CG1 . ILE B 1 368 ? 14.980  -13.125 -67.530  1.00 26.15 ? 368 ILE B CG1 1 
ATOM   5495 C  CG2 . ILE B 1 368 ? 14.239  -10.684 -67.513  1.00 22.28 ? 368 ILE B CG2 1 
ATOM   5496 C  CD1 . ILE B 1 368 ? 16.448  -12.813 -67.206  1.00 27.23 ? 368 ILE B CD1 1 
ATOM   5497 N  N   . ARG B 1 369 ? 12.764  -10.768 -70.495  1.00 33.77 ? 369 ARG B N   1 
ATOM   5498 C  CA  . ARG B 1 369 ? 12.058  -9.940  -71.485  1.00 36.05 ? 369 ARG B CA  1 
ATOM   5499 C  C   . ARG B 1 369 ? 12.144  -10.433 -72.939  1.00 38.10 ? 369 ARG B C   1 
ATOM   5500 O  O   . ARG B 1 369 ? 13.251  -10.581 -73.482  1.00 37.53 ? 369 ARG B O   1 
ATOM   5501 C  CB  . ARG B 1 369 ? 12.578  -8.487  -71.505  1.00 28.97 ? 369 ARG B CB  1 
ATOM   5502 C  CG  . ARG B 1 369 ? 11.864  -7.521  -70.599  1.00 27.68 ? 369 ARG B CG  1 
ATOM   5503 C  CD  . ARG B 1 369 ? 10.359  -7.397  -70.904  1.00 28.65 ? 369 ARG B CD  1 
ATOM   5504 N  NE  . ARG B 1 369 ? 9.876   -6.185  -70.271  1.00 28.93 ? 369 ARG B NE  1 
ATOM   5505 C  CZ  . ARG B 1 369 ? 9.098   -6.167  -69.175  1.00 31.71 ? 369 ARG B CZ  1 
ATOM   5506 N  NH1 . ARG B 1 369 ? 8.684   -7.277  -68.565  1.00 30.35 ? 369 ARG B NH1 1 
ATOM   5507 N  NH2 . ARG B 1 369 ? 8.748   -4.993  -68.663  1.00 28.67 ? 369 ARG B NH2 1 
ATOM   5508 N  N   . THR B 1 370 ? 11.041  -10.787 -73.589  1.00 40.23 ? 370 THR B N   1 
ATOM   5509 C  CA  . THR B 1 370 ? 11.025  -11.153 -75.006  1.00 39.76 ? 370 THR B CA  1 
ATOM   5510 C  C   . THR B 1 370 ? 10.766  -9.847  -75.785  1.00 41.04 ? 370 THR B C   1 
ATOM   5511 O  O   . THR B 1 370 ? 9.839   -9.098  -75.430  1.00 41.66 ? 370 THR B O   1 
ATOM   5512 C  CB  . THR B 1 370 ? 9.888   -12.135 -75.357  1.00 36.20 ? 370 THR B CB  1 
ATOM   5513 O  OG1 . THR B 1 370 ? 10.133  -13.377 -74.709  1.00 40.45 ? 370 THR B OG1 1 
ATOM   5514 C  CG2 . THR B 1 370 ? 9.811   -12.380 -76.842  1.00 37.95 ? 370 THR B CG2 1 
ATOM   5515 N  N   . VAL B 1 371 ? 11.582  -9.517  -76.796  1.00 40.81 ? 371 VAL B N   1 
ATOM   5516 C  CA  . VAL B 1 371 ? 11.365  -8.353  -77.648  1.00 40.78 ? 371 VAL B CA  1 
ATOM   5517 C  C   . VAL B 1 371 ? 10.758  -8.884  -78.955  1.00 41.30 ? 371 VAL B C   1 
ATOM   5518 O  O   . VAL B 1 371 ? 11.202  -9.883  -79.521  1.00 42.46 ? 371 VAL B O   1 
ATOM   5519 C  CB  . VAL B 1 371 ? 12.684  -7.630  -77.933  1.00 38.00 ? 371 VAL B CB  1 
ATOM   5520 C  CG1 . VAL B 1 371 ? 12.498  -6.578  -79.001  1.00 36.51 ? 371 VAL B CG1 1 
ATOM   5521 C  CG2 . VAL B 1 371 ? 13.141  -6.920  -76.674  1.00 37.13 ? 371 VAL B CG2 1 
ATOM   5522 N  N   . LEU B 1 372 ? 9.703   -8.264  -79.440  1.00 41.87 ? 372 LEU B N   1 
ATOM   5523 C  CA  . LEU B 1 372 ? 9.008   -8.625  -80.653  1.00 41.64 ? 372 LEU B CA  1 
ATOM   5524 C  C   . LEU B 1 372 ? 9.518   -7.592  -81.642  1.00 42.19 ? 372 LEU B C   1 
ATOM   5525 O  O   . LEU B 1 372 ? 9.492   -6.384  -81.382  1.00 41.21 ? 372 LEU B O   1 
ATOM   5526 C  CB  . LEU B 1 372 ? 7.513   -8.459  -80.526  1.00 35.88 ? 372 LEU B CB  1 
ATOM   5527 C  CG  . LEU B 1 372 ? 6.688   -9.325  -79.614  1.00 34.38 ? 372 LEU B CG  1 
ATOM   5528 C  CD1 . LEU B 1 372 ? 5.258   -8.808  -79.682  1.00 33.39 ? 372 LEU B CD1 1 
ATOM   5529 C  CD2 . LEU B 1 372 ? 6.745   -10.791 -80.022  1.00 33.73 ? 372 LEU B CD2 1 
ATOM   5530 N  N   . THR B 1 373 ? 10.035  -8.053  -82.765  1.00 44.14 ? 373 THR B N   1 
ATOM   5531 C  CA  . THR B 1 373 ? 10.562  -7.164  -83.776  1.00 47.91 ? 373 THR B CA  1 
ATOM   5532 C  C   . THR B 1 373 ? 9.670   -7.140  -85.002  1.00 48.43 ? 373 THR B C   1 
ATOM   5533 O  O   . THR B 1 373 ? 8.782   -7.992  -85.201  1.00 45.03 ? 373 THR B O   1 
ATOM   5534 C  CB  . THR B 1 373 ? 11.986  -7.611  -84.141  1.00 48.24 ? 373 THR B CB  1 
ATOM   5535 O  OG1 . THR B 1 373 ? 12.141  -9.003  -83.809  1.00 51.59 ? 373 THR B OG1 1 
ATOM   5536 C  CG2 . THR B 1 373 ? 13.001  -6.726  -83.435  1.00 46.07 ? 373 THR B CG2 1 
ATOM   5537 N  N   . PHE B 1 374 ? 9.874   -6.043  -85.702  1.00 52.82 ? 374 PHE B N   1 
ATOM   5538 C  CA  . PHE B 1 374 ? 9.202   -5.751  -86.947  1.00 57.83 ? 374 PHE B CA  1 
ATOM   5539 C  C   . PHE B 1 374 ? 10.359  -5.486  -87.934  1.00 60.68 ? 374 PHE B C   1 
ATOM   5540 O  O   . PHE B 1 374 ? 10.228  -5.884  -89.096  1.00 63.28 ? 374 PHE B O   1 
ATOM   5541 C  CB  . PHE B 1 374 ? 8.316   -4.512  -86.785  1.00 57.52 ? 374 PHE B CB  1 
ATOM   5542 C  CG  . PHE B 1 374 ? 7.238   -4.638  -85.714  1.00 59.25 ? 374 PHE B CG  1 
ATOM   5543 C  CD1 . PHE B 1 374 ? 7.560   -4.459  -84.360  1.00 60.20 ? 374 PHE B CD1 1 
ATOM   5544 C  CD2 . PHE B 1 374 ? 5.925   -4.933  -86.086  1.00 58.29 ? 374 PHE B CD2 1 
ATOM   5545 C  CE1 . PHE B 1 374 ? 6.569   -4.578  -83.388  1.00 60.32 ? 374 PHE B CE1 1 
ATOM   5546 C  CE2 . PHE B 1 374 ? 4.939   -5.048  -85.105  1.00 60.39 ? 374 PHE B CE2 1 
ATOM   5547 C  CZ  . PHE B 1 374 ? 5.259   -4.872  -83.758  1.00 60.90 ? 374 PHE B CZ  1 
ATOM   5548 O  OXT . PHE B 1 374 ? 11.408  -4.952  -87.524  1.00 60.08 ? 374 PHE B OXT 1 
HETATM 5549 ZN ZN  . ZN  C 2 .   ? 17.420  2.551   -29.149  1.00 35.98 ? 375 ZN  A ZN  1 
HETATM 5550 ZN ZN  . ZN  D 2 .   ? 0.265   10.258  -25.347  0.75 26.72 ? 376 ZN  A ZN  1 
HETATM 5551 P  PA  . NAD E 3 .   ? -8.382  13.214  -27.882  1.00 22.35 ? 377 NAD A PA  1 
HETATM 5552 O  O1A . NAD E 3 .   ? -9.440  12.364  -27.259  1.00 9.35  ? 377 NAD A O1A 1 
HETATM 5553 O  O2A . NAD E 3 .   ? -8.349  14.474  -27.106  1.00 25.51 ? 377 NAD A O2A 1 
HETATM 5554 O  O5B . NAD E 3 .   ? -8.836  13.505  -29.401  1.00 32.86 ? 377 NAD A O5B 1 
HETATM 5555 C  C5B . NAD E 3 .   ? -9.797  12.661  -30.130  1.00 20.88 ? 377 NAD A C5B 1 
HETATM 5556 C  C4B . NAD E 3 .   ? -10.630 13.604  -30.930  1.00 15.85 ? 377 NAD A C4B 1 
HETATM 5557 O  O4B . NAD E 3 .   ? -11.129 12.910  -32.053  1.00 15.70 ? 377 NAD A O4B 1 
HETATM 5558 C  C3B . NAD E 3 .   ? -11.814 14.103  -30.126  1.00 14.24 ? 377 NAD A C3B 1 
HETATM 5559 O  O3B . NAD E 3 .   ? -11.910 15.490  -30.303  1.00 19.67 ? 377 NAD A O3B 1 
HETATM 5560 C  C2B . NAD E 3 .   ? -12.980 13.478  -30.794  1.00 18.32 ? 377 NAD A C2B 1 
HETATM 5561 O  O2B . NAD E 3 .   ? -14.040 14.434  -30.768  1.00 23.87 ? 377 NAD A O2B 1 
HETATM 5562 C  C1B . NAD E 3 .   ? -12.458 13.297  -32.221  1.00 20.91 ? 377 NAD A C1B 1 
HETATM 5563 N  N9A . NAD E 3 .   ? -13.201 12.245  -32.877  1.00 23.47 ? 377 NAD A N9A 1 
HETATM 5564 C  C8A . NAD E 3 .   ? -13.776 11.200  -32.295  1.00 22.76 ? 377 NAD A C8A 1 
HETATM 5565 N  N7A . NAD E 3 .   ? -14.477 10.444  -33.120  1.00 22.62 ? 377 NAD A N7A 1 
HETATM 5566 C  C5A . NAD E 3 .   ? -14.327 11.057  -34.258  1.00 23.92 ? 377 NAD A C5A 1 
HETATM 5567 C  C6A . NAD E 3 .   ? -14.913 10.749  -35.465  1.00 21.38 ? 377 NAD A C6A 1 
HETATM 5568 N  N6A . NAD E 3 .   ? -15.646 9.622   -35.624  1.00 21.56 ? 377 NAD A N6A 1 
HETATM 5569 N  N1A . NAD E 3 .   ? -14.678 11.584  -36.454  1.00 17.99 ? 377 NAD A N1A 1 
HETATM 5570 C  C2A . NAD E 3 .   ? -13.896 12.678  -36.285  1.00 18.00 ? 377 NAD A C2A 1 
HETATM 5571 N  N3A . NAD E 3 .   ? -13.312 12.990  -35.128  1.00 21.41 ? 377 NAD A N3A 1 
HETATM 5572 C  C4A . NAD E 3 .   ? -13.551 12.154  -34.124  1.00 23.72 ? 377 NAD A C4A 1 
HETATM 5573 O  O3  . NAD E 3 .   ? -7.022  12.448  -27.893  1.00 2.00  ? 377 NAD A O3  1 
HETATM 5574 P  PN  . NAD E 3 .   ? -5.560  12.885  -28.149  1.00 15.63 ? 377 NAD A PN  1 
HETATM 5575 O  O1N . NAD E 3 .   ? -4.776  12.867  -26.892  1.00 29.64 ? 377 NAD A O1N 1 
HETATM 5576 O  O2N . NAD E 3 .   ? -5.291  14.178  -28.809  1.00 23.08 ? 377 NAD A O2N 1 
HETATM 5577 O  O5D . NAD E 3 .   ? -4.893  11.757  -29.029  1.00 20.40 ? 377 NAD A O5D 1 
HETATM 5578 C  C5D . NAD E 3 .   ? -5.716  11.062  -30.014  1.00 10.94 ? 377 NAD A C5D 1 
HETATM 5579 C  C4D . NAD E 3 .   ? -4.973  9.898   -30.579  1.00 5.70  ? 377 NAD A C4D 1 
HETATM 5580 O  O4D . NAD E 3 .   ? -3.549  10.086  -30.701  1.00 11.39 ? 377 NAD A O4D 1 
HETATM 5581 C  C3D . NAD E 3 .   ? -5.197  8.807   -29.614  1.00 12.03 ? 377 NAD A C3D 1 
HETATM 5582 O  O3D . NAD E 3 .   ? -5.588  7.724   -30.417  1.00 12.28 ? 377 NAD A O3D 1 
HETATM 5583 C  C2D . NAD E 3 .   ? -3.808  8.602   -29.010  1.00 12.81 ? 377 NAD A C2D 1 
HETATM 5584 O  O2D . NAD E 3 .   ? -3.818  7.219   -28.665  1.00 16.11 ? 377 NAD A O2D 1 
HETATM 5585 C  C1D . NAD E 3 .   ? -2.905  8.925   -30.211  1.00 13.69 ? 377 NAD A C1D 1 
HETATM 5586 N  N1N . NAD E 3 .   ? -1.522  9.289   -29.879  1.00 14.20 ? 377 NAD A N1N 1 
HETATM 5587 C  C2N . NAD E 3 .   ? -0.584  8.754   -30.627  1.00 9.42  ? 377 NAD A C2N 1 
HETATM 5588 C  C3N . NAD E 3 .   ? 0.705   9.020   -30.408  1.00 17.12 ? 377 NAD A C3N 1 
HETATM 5589 C  C7N . NAD E 3 .   ? 1.648   8.469   -31.196  1.00 21.64 ? 377 NAD A C7N 1 
HETATM 5590 O  O7N . NAD E 3 .   ? 2.824   8.768   -30.970  1.00 17.30 ? 377 NAD A O7N 1 
HETATM 5591 N  N7N . NAD E 3 .   ? 1.375   8.060   -32.458  1.00 16.24 ? 377 NAD A N7N 1 
HETATM 5592 C  C4N . NAD E 3 .   ? 1.083   9.853   -29.407  1.00 15.15 ? 377 NAD A C4N 1 
HETATM 5593 C  C5N . NAD E 3 .   ? 0.157   10.415  -28.624  1.00 16.08 ? 377 NAD A C5N 1 
HETATM 5594 C  C6N . NAD E 3 .   ? -1.193  10.109  -28.884  1.00 16.04 ? 377 NAD A C6N 1 
HETATM 5595 ZN ZN  . ZN  F 2 .   ? -0.932  15.784  -66.565  1.00 29.65 ? 375 ZN  B ZN  1 
HETATM 5596 ZN ZN  . ZN  G 2 .   ? 4.469   -2.456  -68.470  0.66 34.00 ? 376 ZN  B ZN  1 
HETATM 5597 CL CL  . CL  H 4 .   ? -14.868 5.784   -82.145  1.00 42.59 ? 601 CL  B CL  1 
HETATM 5598 P  PA  . NAD I 3 .   ? 7.168   -10.922 -64.996  1.00 21.78 ? 377 NAD B PA  1 
HETATM 5599 O  O1A . NAD I 3 .   ? 6.112   -11.978 -65.134  1.00 8.97  ? 377 NAD B O1A 1 
HETATM 5600 O  O2A . NAD I 3 .   ? 8.227   -11.176 -65.996  1.00 26.67 ? 377 NAD B O2A 1 
HETATM 5601 O  O5B . NAD I 3 .   ? 7.928   -11.134 -63.556  1.00 38.39 ? 377 NAD B O5B 1 
HETATM 5602 C  C5B . NAD I 3 .   ? 7.217   -11.557 -62.307  1.00 34.59 ? 377 NAD B C5B 1 
HETATM 5603 C  C4B . NAD I 3 .   ? 8.065   -12.477 -61.458  1.00 29.61 ? 377 NAD B C4B 1 
HETATM 5604 O  O4B . NAD I 3 .   ? 7.298   -12.852 -60.312  1.00 30.99 ? 377 NAD B O4B 1 
HETATM 5605 C  C3B . NAD I 3 .   ? 8.410   -13.788 -62.188  1.00 23.97 ? 377 NAD B C3B 1 
HETATM 5606 O  O3B . NAD I 3 .   ? 9.803   -13.945 -62.094  1.00 15.02 ? 377 NAD B O3B 1 
HETATM 5607 C  C2B . NAD I 3 .   ? 7.731   -14.840 -61.324  1.00 25.80 ? 377 NAD B C2B 1 
HETATM 5608 O  O2B . NAD I 3 .   ? 8.570   -15.990 -61.312  1.00 29.14 ? 377 NAD B O2B 1 
HETATM 5609 C  C1B . NAD I 3 .   ? 7.761   -14.146 -59.935  1.00 29.10 ? 377 NAD B C1B 1 
HETATM 5610 N  N9A . NAD I 3 .   ? 6.807   -14.753 -59.018  1.00 23.11 ? 377 NAD B N9A 1 
HETATM 5611 C  C8A . NAD I 3 .   ? 5.625   -15.257 -59.353  1.00 24.25 ? 377 NAD B C8A 1 
HETATM 5612 N  N7A . NAD I 3 .   ? 4.914   -15.728 -58.343  1.00 25.31 ? 377 NAD B N7A 1 
HETATM 5613 C  C5A . NAD I 3 .   ? 5.703   -15.497 -57.329  1.00 23.49 ? 377 NAD B C5A 1 
HETATM 5614 C  C6A . NAD I 3 .   ? 5.445   -15.747 -55.989  1.00 20.43 ? 377 NAD B C6A 1 
HETATM 5615 N  N6A . NAD I 3 .   ? 4.274   -16.302 -55.603  1.00 19.00 ? 377 NAD B N6A 1 
HETATM 5616 N  N1A . NAD I 3 .   ? 6.381   -15.374 -55.127  1.00 15.86 ? 377 NAD B N1A 1 
HETATM 5617 C  C2A . NAD I 3 .   ? 7.531   -14.791 -55.563  1.00 20.88 ? 377 NAD B C2A 1 
HETATM 5618 N  N3A . NAD I 3 .   ? 7.802   -14.533 -56.862  1.00 18.82 ? 377 NAD B N3A 1 
HETATM 5619 C  C4A . NAD I 3 .   ? 6.861   -14.906 -57.727  1.00 21.27 ? 377 NAD B C4A 1 
HETATM 5620 O  O3  . NAD I 3 .   ? 6.507   -9.490  -65.110  1.00 13.43 ? 377 NAD B O3  1 
HETATM 5621 P  PN  . NAD I 3 .   ? 7.220   -8.058  -65.042  1.00 24.74 ? 377 NAD B PN  1 
HETATM 5622 O  O1N . NAD I 3 .   ? 6.964   -7.334  -66.306  1.00 36.62 ? 377 NAD B O1N 1 
HETATM 5623 O  O2N . NAD I 3 .   ? 8.699   -8.019  -64.814  1.00 16.63 ? 377 NAD B O2N 1 
HETATM 5624 O  O5D . NAD I 3 .   ? 6.480   -7.156  -63.941  1.00 27.92 ? 377 NAD B O5D 1 
HETATM 5625 C  C5D . NAD I 3 .   ? 5.565   -7.779  -63.006  1.00 25.46 ? 377 NAD B C5D 1 
HETATM 5626 C  C4D . NAD I 3 .   ? 4.678   -6.779  -62.338  1.00 25.93 ? 377 NAD B C4D 1 
HETATM 5627 O  O4D . NAD I 3 .   ? 5.011   -5.380  -62.475  1.00 29.53 ? 377 NAD B O4D 1 
HETATM 5628 C  C3D . NAD I 3 .   ? 3.412   -6.983  -63.057  1.00 26.45 ? 377 NAD B C3D 1 
HETATM 5629 O  O3D . NAD I 3 .   ? 2.445   -7.156  -62.041  1.00 19.96 ? 377 NAD B O3D 1 
HETATM 5630 C  C2D . NAD I 3 .   ? 3.217   -5.650  -63.791  1.00 28.63 ? 377 NAD B C2D 1 
HETATM 5631 O  O2D . NAD I 3 .   ? 1.802   -5.541  -63.839  1.00 36.18 ? 377 NAD B O2D 1 
HETATM 5632 C  C1D . NAD I 3 .   ? 3.851   -4.639  -62.844  1.00 29.48 ? 377 NAD B C1D 1 
HETATM 5633 N  N1N . NAD I 3 .   ? 4.279   -3.366  -63.469  1.00 37.01 ? 377 NAD B N1N 1 
HETATM 5634 C  C2N . NAD I 3 .   ? 3.971   -2.234  -62.857  1.00 37.52 ? 377 NAD B C2N 1 
HETATM 5635 C  C3N . NAD I 3 .   ? 4.367   -1.047  -63.348  1.00 40.26 ? 377 NAD B C3N 1 
HETATM 5636 C  C7N . NAD I 3 .   ? 4.061   0.108   -62.732  1.00 42.29 ? 377 NAD B C7N 1 
HETATM 5637 O  O7N . NAD I 3 .   ? 4.451   1.165   -63.223  1.00 38.79 ? 377 NAD B O7N 1 
HETATM 5638 N  N7N . NAD I 3 .   ? 3.677   0.167   -61.453  1.00 42.82 ? 377 NAD B N7N 1 
HETATM 5639 C  C4N . NAD I 3 .   ? 5.089   -0.995  -64.476  1.00 37.43 ? 377 NAD B C4N 1 
HETATM 5640 C  C5N . NAD I 3 .   ? 5.418   -2.108  -65.126  1.00 36.35 ? 377 NAD B C5N 1 
HETATM 5641 C  C6N . NAD I 3 .   ? 4.989   -3.321  -64.591  1.00 38.54 ? 377 NAD B C6N 1 
HETATM 5642 O  O   . HOH J 5 .   ? -0.198  11.140  -19.716  1.00 20.42 ? 378 HOH A O   1 
HETATM 5643 O  O   . HOH J 5 .   ? -7.215  -2.165  -21.784  1.00 23.31 ? 379 HOH A O   1 
HETATM 5644 O  O   . HOH J 5 .   ? -6.889  15.671  -21.680  1.00 5.22  ? 380 HOH A O   1 
HETATM 5645 O  O   . HOH J 5 .   ? -6.726  15.888  -25.551  1.00 20.71 ? 381 HOH A O   1 
HETATM 5646 O  O   . HOH J 5 .   ? -10.204 16.379  -26.610  1.00 26.88 ? 382 HOH A O   1 
HETATM 5647 O  O   . HOH J 5 .   ? -13.923 16.277  -28.481  1.00 25.76 ? 383 HOH A O   1 
HETATM 5648 O  O   . HOH J 5 .   ? -6.300  14.535  -31.414  1.00 17.13 ? 384 HOH A O   1 
HETATM 5649 O  O   . HOH J 5 .   ? -10.009 8.686   -29.791  1.00 38.34 ? 385 HOH A O   1 
HETATM 5650 O  O   . HOH J 5 .   ? -11.018 6.093   -30.098  1.00 22.72 ? 386 HOH A O   1 
HETATM 5651 O  O   . HOH J 5 .   ? -12.252 1.405   -34.974  1.00 30.94 ? 387 HOH A O   1 
HETATM 5652 O  O   . HOH J 5 .   ? -4.784  6.562   -42.516  1.00 5.69  ? 388 HOH A O   1 
HETATM 5653 O  O   . HOH J 5 .   ? 2.842   14.370  -50.501  1.00 35.27 ? 389 HOH A O   1 
HETATM 5654 O  O   . HOH J 5 .   ? 13.482  8.103   -29.724  1.00 11.42 ? 390 HOH A O   1 
HETATM 5655 O  O   . HOH J 5 .   ? 7.896   4.041   -14.718  1.00 8.47  ? 391 HOH A O   1 
HETATM 5656 O  O   . HOH J 5 .   ? 3.371   -0.341  -21.403  1.00 35.03 ? 392 HOH A O   1 
HETATM 5657 O  O   . HOH J 5 .   ? 6.514   -0.025  -18.997  1.00 20.48 ? 393 HOH A O   1 
HETATM 5658 O  O   . HOH J 5 .   ? 11.290  -2.106  -21.471  1.00 33.31 ? 394 HOH A O   1 
HETATM 5659 O  O   . HOH J 5 .   ? 11.695  3.397   -21.334  1.00 21.00 ? 395 HOH A O   1 
HETATM 5660 O  O   . HOH J 5 .   ? 9.608   4.964   -21.943  1.00 20.79 ? 396 HOH A O   1 
HETATM 5661 O  O   . HOH J 5 .   ? 8.513   2.651   -24.070  1.00 33.46 ? 397 HOH A O   1 
HETATM 5662 O  O   . HOH J 5 .   ? -8.659  9.636   -27.231  1.00 31.59 ? 398 HOH A O   1 
HETATM 5663 O  O   . HOH J 5 .   ? 11.742  3.732   -18.241  1.00 31.39 ? 399 HOH A O   1 
HETATM 5664 O  O   . HOH J 5 .   ? 1.000   7.914   -26.791  1.00 36.13 ? 400 HOH A O   1 
HETATM 5665 O  O   . HOH J 5 .   ? 3.677   10.559  -34.772  1.00 17.83 ? 401 HOH A O   1 
HETATM 5666 O  O   . HOH J 5 .   ? -7.419  11.731  -55.839  1.00 32.41 ? 402 HOH A O   1 
HETATM 5667 O  O   . HOH J 5 .   ? 10.240  1.315   -22.347  1.00 38.80 ? 403 HOH A O   1 
HETATM 5668 O  O   . HOH J 5 .   ? 4.409   -8.337  -16.730  1.00 44.31 ? 404 HOH A O   1 
HETATM 5669 O  O   . HOH J 5 .   ? 15.563  7.097   -31.623  1.00 22.25 ? 405 HOH A O   1 
HETATM 5670 O  O   . HOH J 5 .   ? -9.915  7.076   -26.583  1.00 47.76 ? 406 HOH A O   1 
HETATM 5671 O  O   . HOH J 5 .   ? -11.757 0.647   -8.952   1.00 40.43 ? 407 HOH A O   1 
HETATM 5672 O  O   . HOH J 5 .   ? 6.175   12.990  -20.920  1.00 19.26 ? 408 HOH A O   1 
HETATM 5673 O  O   . HOH J 5 .   ? 19.052  18.638  -27.346  1.00 38.49 ? 409 HOH A O   1 
HETATM 5674 O  O   . HOH J 5 .   ? -9.217  16.010  -20.530  1.00 18.10 ? 410 HOH A O   1 
HETATM 5675 O  O   . HOH J 5 .   ? 15.572  -0.693  -5.911   1.00 32.87 ? 411 HOH A O   1 
HETATM 5676 O  O   . HOH J 5 .   ? 27.193  14.425  -13.879  1.00 35.85 ? 412 HOH A O   1 
HETATM 5677 O  O   . HOH J 5 .   ? -16.176 26.074  -32.253  1.00 30.11 ? 413 HOH A O   1 
HETATM 5678 O  O   . HOH J 5 .   ? -11.661 6.803   -52.761  0.75 39.23 ? 414 HOH A O   1 
HETATM 5679 O  O   . HOH J 5 .   ? 4.603   7.803   -54.046  1.00 20.10 ? 415 HOH A O   1 
HETATM 5680 O  O   . HOH J 5 .   ? 2.528   28.338  -23.554  1.00 45.74 ? 416 HOH A O   1 
HETATM 5681 O  O   . HOH J 5 .   ? 18.671  3.803   -19.354  1.00 22.64 ? 417 HOH A O   1 
HETATM 5682 O  O   . HOH J 5 .   ? -3.525  4.179   -13.614  1.00 23.10 ? 418 HOH A O   1 
HETATM 5683 O  O   . HOH J 5 .   ? -0.279  -7.507  -9.044   1.00 34.98 ? 419 HOH A O   1 
HETATM 5684 O  O   . HOH J 5 .   ? -15.205 26.500  -40.859  1.00 30.69 ? 420 HOH A O   1 
HETATM 5685 O  O   . HOH J 5 .   ? -12.579 -7.758  -44.510  0.80 34.77 ? 421 HOH A O   1 
HETATM 5686 O  O   . HOH J 5 .   ? 6.275   -3.118  -32.079  1.00 40.14 ? 422 HOH A O   1 
HETATM 5687 O  O   . HOH K 5 .   ? -10.327 -7.165  -42.601  1.00 39.60 ? 602 HOH B O   1 
HETATM 5688 O  O   . HOH K 5 .   ? 4.357   -3.956  -74.059  1.00 26.30 ? 603 HOH B O   1 
HETATM 5689 O  O   . HOH K 5 .   ? 9.050   -10.716 -71.503  1.00 32.65 ? 604 HOH B O   1 
HETATM 5690 O  O   . HOH K 5 .   ? 8.844   -10.026 -68.382  1.00 33.28 ? 605 HOH B O   1 
HETATM 5691 O  O   . HOH K 5 .   ? 10.033  -13.115 -66.253  1.00 17.49 ? 606 HOH B O   1 
HETATM 5692 O  O   . HOH K 5 .   ? 9.812   -16.885 -63.980  1.00 40.62 ? 607 HOH B O   1 
HETATM 5693 O  O   . HOH K 5 .   ? 9.572   -8.336  -62.086  1.00 11.53 ? 608 HOH B O   1 
HETATM 5694 O  O   . HOH K 5 .   ? 2.834   -11.144 -62.407  0.75 36.22 ? 609 HOH B O   1 
HETATM 5695 O  O   . HOH K 5 .   ? -3.515  -12.059 -55.108  1.00 28.56 ? 610 HOH B O   1 
HETATM 5696 O  O   . HOH K 5 .   ? 4.744   -3.967  -50.529  1.00 24.45 ? 611 HOH B O   1 
HETATM 5697 O  O   . HOH K 5 .   ? 13.148  3.055   -45.363  1.00 24.56 ? 612 HOH B O   1 
HETATM 5698 O  O   . HOH K 5 .   ? 4.050   11.329  -66.276  1.00 18.29 ? 613 HOH B O   1 
HETATM 5699 O  O   . HOH K 5 .   ? -2.670  4.019   -79.142  1.00 25.44 ? 614 HOH B O   1 
HETATM 5700 O  O   . HOH K 5 .   ? -6.430  1.077   -71.210  1.00 26.90 ? 615 HOH B O   1 
HETATM 5701 O  O   . HOH K 5 .   ? -6.085  3.979   -74.036  1.00 22.69 ? 616 HOH B O   1 
HETATM 5702 O  O   . HOH K 5 .   ? -7.271  8.606   -72.142  1.00 29.04 ? 617 HOH B O   1 
HETATM 5703 O  O   . HOH K 5 .   ? 17.413  0.820   -84.151  1.00 33.08 ? 618 HOH B O   1 
HETATM 5704 O  O   . HOH K 5 .   ? -2.622  8.610   -73.271  1.00 35.06 ? 619 HOH B O   1 
HETATM 5705 O  O   . HOH K 5 .   ? -0.306  7.117   -72.544  1.00 26.12 ? 620 HOH B O   1 
HETATM 5706 O  O   . HOH K 5 .   ? 3.630   -11.132 -65.181  1.00 38.09 ? 621 HOH B O   1 
HETATM 5707 O  O   . HOH K 5 .   ? -2.087  8.228   -76.009  1.00 24.96 ? 622 HOH B O   1 
HETATM 5708 O  O   . HOH K 5 .   ? 2.506   -1.151  -66.449  1.00 32.81 ? 623 HOH B O   1 
HETATM 5709 O  O   . HOH K 5 .   ? 6.774   2.304   -60.095  1.00 40.01 ? 624 HOH B O   1 
HETATM 5710 O  O   . HOH K 5 .   ? 10.760  -5.265  -37.632  1.00 43.83 ? 625 HOH B O   1 
HETATM 5711 O  O   . HOH K 5 .   ? -4.480  7.913   -71.571  1.00 21.97 ? 626 HOH B O   1 
HETATM 5712 O  O   . HOH K 5 .   ? -9.083  -1.149  -73.508  1.00 30.42 ? 627 HOH B O   1 
HETATM 5713 O  O   . HOH K 5 .   ? 10.087  4.914   -42.800  1.00 34.12 ? 628 HOH B O   1 
HETATM 5714 O  O   . HOH K 5 .   ? -4.383  -8.253  -36.141  1.00 35.46 ? 629 HOH B O   1 
HETATM 5715 O  O   . HOH K 5 .   ? -10.478 -5.860  -90.747  1.00 42.42 ? 630 HOH B O   1 
HETATM 5716 O  O   . HOH K 5 .   ? -13.152 -2.930  -90.908  1.00 33.50 ? 631 HOH B O   1 
HETATM 5717 O  O   . HOH K 5 .   ? -6.857  14.901  -80.860  1.00 27.13 ? 632 HOH B O   1 
HETATM 5718 O  O   . HOH K 5 .   ? -9.179  -13.870 -79.326  0.66 40.02 ? 633 HOH B O   1 
HETATM 5719 O  O   . HOH K 5 .   ? -3.187  -7.643  -40.811  1.00 40.87 ? 634 HOH B O   1 
HETATM 5720 O  O   . HOH K 5 .   ? 2.080   -22.667 -68.803  1.00 33.29 ? 635 HOH B O   1 
HETATM 5721 O  O   . HOH K 5 .   ? -11.369 -15.528 -79.665  1.00 42.22 ? 636 HOH B O   1 
HETATM 5722 O  O   . HOH K 5 .   ? -1.546  -10.792 -59.924  0.75 36.82 ? 637 HOH B O   1 
HETATM 5723 O  O   . HOH K 5 .   ? -0.228  19.303  -55.204  1.00 31.91 ? 638 HOH B O   1 
HETATM 5724 O  O   . HOH K 5 .   ? 9.703   16.622  -74.705  1.00 43.07 ? 639 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   CYS 9   9   9   CYS CYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 CYS 100 100 100 CYS CYS A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 CYS 132 132 132 CYS CYS A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ASN 155 155 155 ASN ASN A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 CYS 170 170 170 CYS CYS A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 CYS 174 174 174 CYS CYS A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 MET 209 209 209 MET MET A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 CYS 211 211 211 CYS CYS A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 CYS 240 240 240 CYS CYS A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 MET 257 257 257 MET MET A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 MET 275 275 275 MET MET A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 SER 278 278 278 SER SER A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 CYS 282 282 282 CYS CYS A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 CYS 286 286 286 CYS CYS A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 PRO 296 296 296 PRO PRO A . n 
A 1 297 ALA 297 297 297 ALA ALA A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 GLN 299 299 299 GLN GLN A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 PRO 305 305 305 PRO PRO A . n 
A 1 306 MET 306 306 306 MET MET A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 ARG 312 312 312 ARG ARG A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 TRP 314 314 314 TRP TRP A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 ALA 317 317 317 ALA ALA A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 GLY 321 321 321 GLY GLY A . n 
A 1 322 PHE 322 322 322 PHE PHE A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 SER 324 324 324 SER SER A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 GLU 326 326 326 GLU GLU A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 ILE 328 328 328 ILE ILE A . n 
A 1 329 PRO 329 329 329 PRO PRO A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 LEU 331 331 331 LEU LEU A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ASP 334 334 334 ASP ASP A . n 
A 1 335 PHE 335 335 335 PHE PHE A . n 
A 1 336 MET 336 336 336 MET MET A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 LYS 338 338 338 LYS LYS A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 SER 341 341 341 SER SER A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 ILE 346 346 346 ILE ILE A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 HIS 348 348 348 HIS HIS A . n 
A 1 349 VAL 349 349 349 VAL VAL A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 GLU 353 353 353 GLU GLU A . n 
A 1 354 LYS 354 354 354 LYS LYS A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 ASN 356 356 356 ASN ASN A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 GLY 358 358 358 GLY GLY A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 ASP 360 360 360 ASP ASP A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 HIS 363 363 363 HIS HIS A . n 
A 1 364 SER 364 364 364 SER SER A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 SER 367 367 367 SER SER A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 ARG 369 369 369 ARG ARG A . n 
A 1 370 THR 370 370 370 THR THR A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 PHE 374 374 374 PHE PHE A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   THR 2   2   2   THR THR B . n 
B 1 3   ALA 3   3   3   ALA ALA B . n 
B 1 4   GLY 4   4   4   GLY GLY B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   ILE 7   7   7   ILE ILE B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   CYS 9   9   9   CYS CYS B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ALA 12  12  12  ALA ALA B . n 
B 1 13  VAL 13  13  13  VAL VAL B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  TRP 15  15  15  TRP TRP B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  VAL 17  17  17  VAL VAL B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  PHE 21  21  21  PHE PHE B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ASP 25  25  25  ASP ASP B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  PRO 30  30  30  PRO PRO B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  GLU 35  35  35  GLU GLU B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  ILE 38  38  38  ILE ILE B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  MET 40  40  40  MET MET B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  CYS 46  46  46  CYS CYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  HIS 51  51  51  HIS HIS B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  ASN 56  56  56  ASN ASN B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  PRO 60  60  60  PRO PRO B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  ILE 72  72  72  ILE ILE B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  GLU 74  74  74  GLU GLU B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  THR 81  81  81  THR THR B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  PRO 85  85  85  PRO PRO B . n 
B 1 86  GLY 86  86  86  GLY GLY B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ILE 90  90  90  ILE ILE B . n 
B 1 91  PRO 91  91  91  PRO PRO B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  GLN 96  96  96  GLN GLN B . n 
B 1 97  CYS 97  97  97  CYS CYS B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 CYS 100 100 100 CYS CYS B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 CYS 103 103 103 CYS CYS B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 CYS 111 111 111 CYS CYS B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 ASP 115 115 115 ASP ASP B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 PRO 119 119 119 PRO PRO B . n 
B 1 120 ARG 120 120 120 ARG ARG B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 LEU 123 123 123 LEU LEU B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 ASP 125 125 125 ASP ASP B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 ARG 129 129 129 ARG ARG B . n 
B 1 130 PHE 130 130 130 PHE PHE B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 CYS 132 132 132 CYS CYS B . n 
B 1 133 ARG 133 133 133 ARG ARG B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 LYS 135 135 135 LYS LYS B . n 
B 1 136 PRO 136 136 136 PRO PRO B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 HIS 138 138 138 HIS HIS B . n 
B 1 139 HIS 139 139 139 HIS HIS B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 SER 144 144 144 SER SER B . n 
B 1 145 THR 145 145 145 THR THR B . n 
B 1 146 PHE 146 146 146 PHE PHE B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 GLN 148 148 148 GLN GLN B . n 
B 1 149 TYR 149 149 149 TYR TYR B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 GLU 154 154 154 GLU GLU B . n 
B 1 155 ASN 155 155 155 ASN ASN B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 LYS 168 168 168 LYS LYS B . n 
B 1 169 VAL 169 169 169 VAL VAL B . n 
B 1 170 CYS 170 170 170 CYS CYS B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 CYS 174 174 174 CYS CYS B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 PHE 176 176 176 PHE PHE B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 THR 178 178 178 THR THR B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 TYR 180 180 180 TYR TYR B . n 
B 1 181 GLY 181 181 181 GLY GLY B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 VAL 189 189 189 VAL VAL B . n 
B 1 190 THR 190 190 190 THR THR B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 CYS 195 195 195 CYS CYS B . n 
B 1 196 ALA 196 196 196 ALA ALA B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 PHE 198 198 198 PHE PHE B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 SER 206 206 206 SER SER B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 MET 209 209 209 MET MET B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 CYS 211 211 211 CYS CYS B . n 
B 1 212 LYS 212 212 212 LYS LYS B . n 
B 1 213 ALA 213 213 213 ALA ALA B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 ILE 220 220 220 ILE ILE B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 VAL 222 222 222 VAL VAL B . n 
B 1 223 ASP 223 223 223 ASP ASP B . n 
B 1 224 ILE 224 224 224 ILE ILE B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 PHE 229 229 229 PHE PHE B . n 
B 1 230 ALA 230 230 230 ALA ALA B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 GLU 234 234 234 GLU GLU B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 GLY 236 236 236 GLY GLY B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 CYS 240 240 240 CYS CYS B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 PRO 243 243 243 PRO PRO B . n 
B 1 244 GLN 244 244 244 GLN GLN B . n 
B 1 245 ASP 245 245 245 ASP ASP B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 LYS 248 248 248 LYS LYS B . n 
B 1 249 PRO 249 249 249 PRO PRO B . n 
B 1 250 ILE 250 250 250 ILE ILE B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 GLU 252 252 252 GLU GLU B . n 
B 1 253 VAL 253 253 253 VAL VAL B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 LYS 255 255 255 LYS LYS B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 MET 257 257 257 MET MET B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 GLY 260 260 260 GLY GLY B . n 
B 1 261 GLY 261 261 261 GLY GLY B . n 
B 1 262 VAL 262 262 262 VAL VAL B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 PHE 264 264 264 PHE PHE B . n 
B 1 265 SER 265 265 265 SER SER B . n 
B 1 266 PHE 266 266 266 PHE PHE B . n 
B 1 267 GLU 267 267 267 GLU GLU B . n 
B 1 268 VAL 268 268 268 VAL VAL B . n 
B 1 269 ILE 269 269 269 ILE ILE B . n 
B 1 270 GLY 270 270 270 GLY GLY B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 LEU 272 272 272 LEU LEU B . n 
B 1 273 ASP 273 273 273 ASP ASP B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 MET 275 275 275 MET MET B . n 
B 1 276 MET 276 276 276 MET MET B . n 
B 1 277 ALA 277 277 277 ALA ALA B . n 
B 1 278 SER 278 278 278 SER SER B . n 
B 1 279 LEU 279 279 279 LEU LEU B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 CYS 281 281 281 CYS CYS B . n 
B 1 282 CYS 282 282 282 CYS CYS B . n 
B 1 283 HIS 283 283 283 HIS HIS B . n 
B 1 284 GLU 284 284 284 GLU GLU B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 CYS 286 286 286 CYS CYS B . n 
B 1 287 GLY 287 287 287 GLY GLY B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 SER 289 289 289 SER SER B . n 
B 1 290 VAL 290 290 290 VAL VAL B . n 
B 1 291 ILE 291 291 291 ILE ILE B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 GLY 293 293 293 GLY GLY B . n 
B 1 294 VAL 294 294 294 VAL VAL B . n 
B 1 295 PRO 295 295 295 PRO PRO B . n 
B 1 296 PRO 296 296 296 PRO PRO B . n 
B 1 297 ALA 297 297 297 ALA ALA B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 GLN 299 299 299 GLN GLN B . n 
B 1 300 ASN 300 300 300 ASN ASN B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 ILE 303 303 303 ILE ILE B . n 
B 1 304 ASN 304 304 304 ASN ASN B . n 
B 1 305 PRO 305 305 305 PRO PRO B . n 
B 1 306 MET 306 306 306 MET MET B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 THR 310 310 310 THR THR B . n 
B 1 311 GLY 311 311 311 GLY GLY B . n 
B 1 312 ARG 312 312 312 ARG ARG B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 TRP 314 314 314 TRP TRP B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 GLY 316 316 316 GLY GLY B . n 
B 1 317 ALA 317 317 317 ALA ALA B . n 
B 1 318 VAL 318 318 318 VAL VAL B . n 
B 1 319 TYR 319 319 319 TYR TYR B . n 
B 1 320 GLY 320 320 320 GLY GLY B . n 
B 1 321 GLY 321 321 321 GLY GLY B . n 
B 1 322 PHE 322 322 322 PHE PHE B . n 
B 1 323 LYS 323 323 323 LYS LYS B . n 
B 1 324 SER 324 324 324 SER SER B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 GLU 326 326 326 GLU GLU B . n 
B 1 327 GLY 327 327 327 GLY GLY B . n 
B 1 328 ILE 328 328 328 ILE ILE B . n 
B 1 329 PRO 329 329 329 PRO PRO B . n 
B 1 330 LYS 330 330 330 LYS LYS B . n 
B 1 331 LEU 331 331 331 LEU LEU B . n 
B 1 332 VAL 332 332 332 VAL VAL B . n 
B 1 333 ALA 333 333 333 ALA ALA B . n 
B 1 334 ASP 334 334 334 ASP ASP B . n 
B 1 335 PHE 335 335 335 PHE PHE B . n 
B 1 336 MET 336 336 336 MET MET B . n 
B 1 337 ALA 337 337 337 ALA ALA B . n 
B 1 338 LYS 338 338 338 LYS LYS B . n 
B 1 339 LYS 339 339 339 LYS LYS B . n 
B 1 340 PHE 340 340 340 PHE PHE B . n 
B 1 341 SER 341 341 341 SER SER B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 ASP 343 343 343 ASP ASP B . n 
B 1 344 ALA 344 344 344 ALA ALA B . n 
B 1 345 LEU 345 345 345 LEU LEU B . n 
B 1 346 ILE 346 346 346 ILE ILE B . n 
B 1 347 THR 347 347 347 THR THR B . n 
B 1 348 HIS 348 348 348 HIS HIS B . n 
B 1 349 VAL 349 349 349 VAL VAL B . n 
B 1 350 LEU 350 350 350 LEU LEU B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 PHE 352 352 352 PHE PHE B . n 
B 1 353 GLU 353 353 353 GLU GLU B . n 
B 1 354 LYS 354 354 354 LYS LYS B . n 
B 1 355 ILE 355 355 355 ILE ILE B . n 
B 1 356 ASN 356 356 356 ASN ASN B . n 
B 1 357 GLU 357 357 357 GLU GLU B . n 
B 1 358 GLY 358 358 358 GLY GLY B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 ASP 360 360 360 ASP ASP B . n 
B 1 361 LEU 361 361 361 LEU LEU B . n 
B 1 362 LEU 362 362 362 LEU LEU B . n 
B 1 363 HIS 363 363 363 HIS HIS B . n 
B 1 364 SER 364 364 364 SER SER B . n 
B 1 365 GLY 365 365 365 GLY GLY B . n 
B 1 366 LYS 366 366 366 LYS LYS B . n 
B 1 367 SER 367 367 367 SER SER B . n 
B 1 368 ILE 368 368 368 ILE ILE B . n 
B 1 369 ARG 369 369 369 ARG ARG B . n 
B 1 370 THR 370 370 370 THR THR B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 LEU 372 372 372 LEU LEU B . n 
B 1 373 THR 373 373 373 THR THR B . n 
B 1 374 PHE 374 374 374 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  375 375 ZN  ZN  A . 
D 2 ZN  1  376 376 ZN  ZN  A . 
E 3 NAD 1  377 377 NAD NAD A . 
F 2 ZN  1  375 375 ZN  ZN  B . 
G 2 ZN  1  376 376 ZN  ZN  B . 
H 4 CL  1  601 601 CL  CL  B . 
I 3 NAD 1  377 377 NAD NAD B . 
J 5 HOH 1  378 401 HOH HOH A . 
J 5 HOH 2  379 402 HOH HOH A . 
J 5 HOH 3  380 403 HOH HOH A . 
J 5 HOH 4  381 404 HOH HOH A . 
J 5 HOH 5  382 405 HOH HOH A . 
J 5 HOH 6  383 406 HOH HOH A . 
J 5 HOH 7  384 407 HOH HOH A . 
J 5 HOH 8  385 408 HOH HOH A . 
J 5 HOH 9  386 409 HOH HOH A . 
J 5 HOH 10 387 410 HOH HOH A . 
J 5 HOH 11 388 412 HOH HOH A . 
J 5 HOH 12 389 414 HOH HOH A . 
J 5 HOH 13 390 416 HOH HOH A . 
J 5 HOH 14 391 417 HOH HOH A . 
J 5 HOH 15 392 418 HOH HOH A . 
J 5 HOH 16 393 419 HOH HOH A . 
J 5 HOH 17 394 420 HOH HOH A . 
J 5 HOH 18 395 423 HOH HOH A . 
J 5 HOH 19 396 424 HOH HOH A . 
J 5 HOH 20 397 425 HOH HOH A . 
J 5 HOH 21 398 426 HOH HOH A . 
J 5 HOH 22 399 471 HOH HOH A . 
J 5 HOH 23 400 472 HOH HOH A . 
J 5 HOH 24 401 473 HOH HOH A . 
J 5 HOH 25 402 474 HOH HOH A . 
J 5 HOH 26 403 475 HOH HOH A . 
J 5 HOH 27 404 503 HOH HOH A . 
J 5 HOH 28 405 507 HOH HOH A . 
J 5 HOH 29 406 513 HOH HOH A . 
J 5 HOH 30 407 521 HOH HOH A . 
J 5 HOH 31 408 523 HOH HOH A . 
J 5 HOH 32 409 525 HOH HOH A . 
J 5 HOH 33 410 528 HOH HOH A . 
J 5 HOH 34 411 580 HOH HOH A . 
J 5 HOH 35 412 581 HOH HOH A . 
J 5 HOH 36 413 582 HOH HOH A . 
J 5 HOH 37 414 583 HOH HOH A . 
J 5 HOH 38 415 584 HOH HOH A . 
J 5 HOH 39 416 585 HOH HOH A . 
J 5 HOH 40 417 586 HOH HOH A . 
J 5 HOH 41 418 587 HOH HOH A . 
J 5 HOH 42 419 588 HOH HOH A . 
J 5 HOH 43 420 589 HOH HOH A . 
J 5 HOH 44 421 413 HOH HOH A . 
J 5 HOH 45 422 680 HOH HOH A . 
K 5 HOH 1  602 413 HOH HOH B . 
K 5 HOH 2  603 401 HOH HOH B . 
K 5 HOH 3  604 403 HOH HOH B . 
K 5 HOH 4  605 404 HOH HOH B . 
K 5 HOH 5  606 405 HOH HOH B . 
K 5 HOH 6  607 406 HOH HOH B . 
K 5 HOH 7  608 407 HOH HOH B . 
K 5 HOH 8  609 408 HOH HOH B . 
K 5 HOH 9  610 410 HOH HOH B . 
K 5 HOH 10 611 412 HOH HOH B . 
K 5 HOH 11 612 414 HOH HOH B . 
K 5 HOH 12 613 416 HOH HOH B . 
K 5 HOH 13 614 417 HOH HOH B . 
K 5 HOH 14 615 418 HOH HOH B . 
K 5 HOH 15 616 419 HOH HOH B . 
K 5 HOH 16 617 420 HOH HOH B . 
K 5 HOH 17 618 421 HOH HOH B . 
K 5 HOH 18 619 423 HOH HOH B . 
K 5 HOH 19 620 424 HOH HOH B . 
K 5 HOH 20 621 426 HOH HOH B . 
K 5 HOH 21 622 471 HOH HOH B . 
K 5 HOH 22 623 472 HOH HOH B . 
K 5 HOH 23 624 473 HOH HOH B . 
K 5 HOH 24 625 474 HOH HOH B . 
K 5 HOH 25 626 475 HOH HOH B . 
K 5 HOH 26 627 617 HOH HOH B . 
K 5 HOH 27 628 624 HOH HOH B . 
K 5 HOH 28 629 681 HOH HOH B . 
K 5 HOH 29 630 682 HOH HOH B . 
K 5 HOH 30 631 683 HOH HOH B . 
K 5 HOH 31 632 684 HOH HOH B . 
K 5 HOH 32 633 685 HOH HOH B . 
K 5 HOH 33 634 686 HOH HOH B . 
K 5 HOH 34 635 687 HOH HOH B . 
K 5 HOH 35 636 688 HOH HOH B . 
K 5 HOH 36 637 689 HOH HOH B . 
K 5 HOH 37 638 690 HOH HOH B . 
K 5 HOH 38 639 691 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6100  ? 
1 MORE         -124  ? 
1 'SSA (A^2)'  25910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 97  ? A CYS 97  ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 100 ? A CYS 100 ? 1_555 109.9 ? 
2  SG  ? A CYS 97  ? A CYS 97  ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 111 ? A CYS 111 ? 1_555 105.5 ? 
3  SG  ? A CYS 100 ? A CYS 100 ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 111 ? A CYS 111 ? 1_555 111.2 ? 
4  SG  ? A CYS 97  ? A CYS 97  ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 103 ? A CYS 103 ? 1_555 111.2 ? 
5  SG  ? A CYS 100 ? A CYS 100 ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 103 ? A CYS 103 ? 1_555 111.7 ? 
6  SG  ? A CYS 111 ? A CYS 111 ? 1_555 ZN ? C ZN . ? A ZN 375 ? 1_555 SG ? A CYS 103 ? A CYS 103 ? 1_555 107.2 ? 
7  NE2 ? A HIS 67  ? A HIS 67  ? 1_555 ZN ? D ZN . ? A ZN 376 ? 1_555 SG ? A CYS 174 ? A CYS 174 ? 1_555 112.0 ? 
8  NE2 ? A HIS 67  ? A HIS 67  ? 1_555 ZN ? D ZN . ? A ZN 376 ? 1_555 SG ? A CYS 46  ? A CYS 46  ? 1_555 116.4 ? 
9  SG  ? A CYS 174 ? A CYS 174 ? 1_555 ZN ? D ZN . ? A ZN 376 ? 1_555 SG ? A CYS 46  ? A CYS 46  ? 1_555 117.4 ? 
10 SG  ? B CYS 97  ? B CYS 97  ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 100 ? B CYS 100 ? 1_555 108.9 ? 
11 SG  ? B CYS 97  ? B CYS 97  ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 103 ? B CYS 103 ? 1_555 114.5 ? 
12 SG  ? B CYS 100 ? B CYS 100 ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 103 ? B CYS 103 ? 1_555 109.4 ? 
13 SG  ? B CYS 97  ? B CYS 97  ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 111 ? B CYS 111 ? 1_555 101.6 ? 
14 SG  ? B CYS 100 ? B CYS 100 ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 111 ? B CYS 111 ? 1_555 110.8 ? 
15 SG  ? B CYS 103 ? B CYS 103 ? 1_555 ZN ? F ZN . ? B ZN 375 ? 1_555 SG ? B CYS 111 ? B CYS 111 ? 1_555 111.5 ? 
16 NE2 ? B HIS 67  ? B HIS 67  ? 1_555 ZN ? G ZN . ? B ZN 376 ? 1_555 SG ? B CYS 174 ? B CYS 174 ? 1_555 118.1 ? 
17 NE2 ? B HIS 67  ? B HIS 67  ? 1_555 ZN ? G ZN . ? B ZN 376 ? 1_555 SG ? B CYS 46  ? B CYS 46  ? 1_555 116.7 ? 
18 SG  ? B CYS 174 ? B CYS 174 ? 1_555 ZN ? G ZN . ? B ZN 376 ? 1_555 SG ? B CYS 46  ? B CYS 46  ? 1_555 90.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 NE2 A HIS 51  ? ? CD2 A HIS 51  ? ? 1.303 1.373 -0.070 0.011 N 
2  1 NE2 A HIS 67  ? ? CD2 A HIS 67  ? ? 1.300 1.373 -0.073 0.011 N 
3  1 NE2 A HIS 138 ? ? CD2 A HIS 138 ? ? 1.300 1.373 -0.073 0.011 N 
4  1 NE2 A HIS 283 ? ? CD2 A HIS 283 ? ? 1.300 1.373 -0.073 0.011 N 
5  1 NE2 A HIS 348 ? ? CD2 A HIS 348 ? ? 1.302 1.373 -0.071 0.011 N 
6  1 NE2 A HIS 363 ? ? CD2 A HIS 363 ? ? 1.304 1.373 -0.069 0.011 N 
7  1 NE2 B HIS 67  ? ? CD2 B HIS 67  ? ? 1.293 1.373 -0.080 0.011 N 
8  1 NE2 B HIS 139 ? ? CD2 B HIS 139 ? ? 1.306 1.373 -0.067 0.011 N 
9  1 NE2 B HIS 283 ? ? CD2 B HIS 283 ? ? 1.289 1.373 -0.084 0.011 N 
10 1 NE2 B HIS 348 ? ? CD2 B HIS 348 ? ? 1.298 1.373 -0.075 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 15  ? ? CG  A TRP 15  ? ? CD2 A TRP 15  ? ? 112.36 106.30 6.06   0.80 N 
2  1 CE2 A TRP 15  ? ? CD2 A TRP 15  ? ? CG  A TRP 15  ? ? 101.00 107.30 -6.30  0.80 N 
3  1 CG  A TRP 15  ? ? CD2 A TRP 15  ? ? CE3 A TRP 15  ? ? 139.39 133.90 5.49   0.90 N 
4  1 NE  A ARG 37  ? ? CZ  A ARG 37  ? ? NH2 A ARG 37  ? ? 116.34 120.30 -3.96  0.50 N 
5  1 CB  A HIS 51  ? ? CG  A HIS 51  ? ? CD2 A HIS 51  ? ? 119.62 129.70 -10.08 1.60 N 
6  1 CE1 A HIS 67  ? ? NE2 A HIS 67  ? ? CD2 A HIS 67  ? ? 113.47 109.00 4.47   0.70 N 
7  1 NE  A ARG 101 ? ? CZ  A ARG 101 ? ? NH2 A ARG 101 ? ? 117.09 120.30 -3.21  0.50 N 
8  1 CD1 A TRP 314 ? ? CG  A TRP 314 ? ? CD2 A TRP 314 ? ? 112.99 106.30 6.69   0.80 N 
9  1 CE2 A TRP 314 ? ? CD2 A TRP 314 ? ? CG  A TRP 314 ? ? 102.26 107.30 -5.04  0.80 N 
10 1 CB  A TYR 319 ? ? CG  A TYR 319 ? ? CD2 A TYR 319 ? ? 116.42 121.00 -4.58  0.60 N 
11 1 N   A ILE 368 ? ? CA  A ILE 368 ? ? C   A ILE 368 ? ? 92.47  111.00 -18.53 2.70 N 
12 1 NE  A ARG 369 ? ? CZ  A ARG 369 ? ? NH1 A ARG 369 ? ? 123.81 120.30 3.51   0.50 N 
13 1 CD1 B TRP 15  ? ? CG  B TRP 15  ? ? CD2 B TRP 15  ? ? 112.65 106.30 6.35   0.80 N 
14 1 CE2 B TRP 15  ? ? CD2 B TRP 15  ? ? CG  B TRP 15  ? ? 101.40 107.30 -5.90  0.80 N 
15 1 NE  B ARG 37  ? ? CZ  B ARG 37  ? ? NH2 B ARG 37  ? ? 116.18 120.30 -4.12  0.50 N 
16 1 N   B VAL 89  ? ? CA  B VAL 89  ? ? CB  B VAL 89  ? ? 97.92  111.50 -13.58 2.20 N 
17 1 CB  B TYR 149 ? ? CG  B TYR 149 ? ? CD1 B TYR 149 ? ? 116.78 121.00 -4.22  0.60 N 
18 1 CG  B MET 275 ? ? SD  B MET 275 ? ? CE  B MET 275 ? ? 86.65  100.20 -13.55 1.60 N 
19 1 NE  B ARG 312 ? ? CZ  B ARG 312 ? ? NH1 B ARG 312 ? ? 124.63 120.30 4.33   0.50 N 
20 1 CD1 B TRP 314 ? ? CG  B TRP 314 ? ? CD2 B TRP 314 ? ? 111.78 106.30 5.48   0.80 N 
21 1 CE2 B TRP 314 ? ? CD2 B TRP 314 ? ? CG  B TRP 314 ? ? 102.22 107.30 -5.08  0.80 N 
22 1 CB  B TYR 319 ? ? CG  B TYR 319 ? ? CD2 B TYR 319 ? ? 117.01 121.00 -3.99  0.60 N 
23 1 N   B ILE 368 ? ? CA  B ILE 368 ? ? C   B ILE 368 ? ? 94.01  111.00 -16.99 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 3   ? ? -50.24  107.01  
2  1 LEU A 65  ? ? -78.93  -165.04 
3  1 HIS A 67  ? ? -158.19 -8.84   
4  1 VAL A 80  ? ? -54.53  109.04  
5  1 ARG A 129 ? ? -150.61 10.45   
6  1 LEU A 141 ? ? 47.72   27.83   
7  1 CYS A 174 ? ? -152.71 -81.79  
8  1 LEU A 200 ? ? -117.24 59.05   
9  1 ASP A 259 ? ? 71.65   52.73   
10 1 ILE A 269 ? ? -133.53 -58.71  
11 1 ALA A 297 ? ? -34.79  130.41  
12 1 SER A 298 ? ? 56.04   19.87   
13 1 ILE A 368 ? ? -100.90 -97.28  
14 1 ALA B 3   ? ? -34.20  150.25  
15 1 HIS B 67  ? ? -161.43 -3.57   
16 1 GLU B 74  ? ? -86.04  -80.71  
17 1 CYS B 97  ? ? -51.59  -3.36   
18 1 SER B 144 ? ? 35.01   45.11   
19 1 THR B 145 ? ? -65.88  13.87   
20 1 PHE B 146 ? ? -98.41  56.30   
21 1 ALA B 162 ? ? -39.53  -29.86  
22 1 ALA B 163 ? ? -115.56 66.94   
23 1 PRO B 165 ? ? -69.76  93.78   
24 1 LYS B 168 ? ? -106.25 -70.98  
25 1 VAL B 169 ? ? -39.82  -21.08  
26 1 CYS B 174 ? ? -150.10 -105.80 
27 1 SER B 193 ? ? -69.60  -178.31 
28 1 ILE B 269 ? ? -141.03 -63.07  
29 1 CYS B 286 ? ? -158.66 5.88    
30 1 HIS B 363 ? ? -62.83  18.10   
31 1 SER B 364 ? ? -149.40 15.03   
32 1 ILE B 368 ? ? -99.69  -86.40  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                        ZN  
3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
4 'CHLORIDE ION'                    CL  
5 water                             HOH 
#