data_1HGU
# 
_entry.id   1HGU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HGU         
WWPDB D_1000173848 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HGU 
_pdbx_database_status.recvd_initial_deposition_date   1995-05-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chantalat, L.'   1 
'Jones, N.'       2 
'Korber, F.'      3 
'Navaza, J.'      4 
'Pavlovsky, A.G.' 5 
# 
_citation.id                        primary 
_citation.title                     'THE CRYSTAL-STRUCTURE OF WILD-TYPE GROWTH-HORMONE AT 2.5 ANGSTROM RESOLUTION.' 
_citation.journal_abbrev            'Protein Pept.Lett.' 
_citation.journal_volume            2 
_citation.page_first                333 
_citation.page_last                 340 
_citation.year                      1995 
_citation.journal_id_ASTM           PPELEN 
_citation.country                   NE 
_citation.journal_id_ISSN           0929-8665 
_citation.journal_id_CSD            2077 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chantalat, L.'   1 ? 
primary 'Jones, N.D.'     2 ? 
primary 'Korber, F.'      3 ? 
primary 'Navaza, J.'      4 ? 
primary 'Pavlovsky, A.G.' 5 ? 
# 
_cell.entry_id           1HGU 
_cell.length_a           57.020 
_cell.length_b           57.020 
_cell.length_c           130.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HGU 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'HUMAN GROWTH HORMONE' 21902.771 1  ? ? ? ? 
2 water   nat water                  18.015    81 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN SOMATOTROPIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISL
LLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNY
GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISL
LLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNY
GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   PRO n 
1 3   THR n 
1 4   ILE n 
1 5   PRO n 
1 6   LEU n 
1 7   SER n 
1 8   ARG n 
1 9   LEU n 
1 10  PHE n 
1 11  GLN n 
1 12  ASN n 
1 13  ALA n 
1 14  MET n 
1 15  LEU n 
1 16  ARG n 
1 17  ALA n 
1 18  HIS n 
1 19  ARG n 
1 20  LEU n 
1 21  HIS n 
1 22  GLN n 
1 23  LEU n 
1 24  ALA n 
1 25  PHE n 
1 26  ASP n 
1 27  THR n 
1 28  TYR n 
1 29  GLU n 
1 30  GLU n 
1 31  PHE n 
1 32  GLU n 
1 33  GLU n 
1 34  ALA n 
1 35  TYR n 
1 36  ILE n 
1 37  PRO n 
1 38  LYS n 
1 39  GLU n 
1 40  GLN n 
1 41  LYS n 
1 42  TYR n 
1 43  SER n 
1 44  PHE n 
1 45  LEU n 
1 46  GLN n 
1 47  ALA n 
1 48  PRO n 
1 49  GLN n 
1 50  ALA n 
1 51  SER n 
1 52  LEU n 
1 53  CYS n 
1 54  PHE n 
1 55  SER n 
1 56  GLU n 
1 57  SER n 
1 58  ILE n 
1 59  PRO n 
1 60  THR n 
1 61  PRO n 
1 62  SER n 
1 63  ASN n 
1 64  ARG n 
1 65  GLU n 
1 66  GLN n 
1 67  ALA n 
1 68  GLN n 
1 69  GLN n 
1 70  LYS n 
1 71  SER n 
1 72  ASN n 
1 73  LEU n 
1 74  GLN n 
1 75  LEU n 
1 76  LEU n 
1 77  ARG n 
1 78  ILE n 
1 79  SER n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  ILE n 
1 84  GLN n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  GLU n 
1 89  PRO n 
1 90  VAL n 
1 91  GLY n 
1 92  PHE n 
1 93  LEU n 
1 94  ARG n 
1 95  SER n 
1 96  VAL n 
1 97  PHE n 
1 98  ALA n 
1 99  ASN n 
1 100 SER n 
1 101 LEU n 
1 102 VAL n 
1 103 TYR n 
1 104 GLY n 
1 105 ALA n 
1 106 SER n 
1 107 ASP n 
1 108 SER n 
1 109 ASP n 
1 110 VAL n 
1 111 TYR n 
1 112 ASP n 
1 113 LEU n 
1 114 LEU n 
1 115 LYS n 
1 116 ASP n 
1 117 LEU n 
1 118 GLU n 
1 119 GLU n 
1 120 GLY n 
1 121 ILE n 
1 122 GLN n 
1 123 THR n 
1 124 LEU n 
1 125 MET n 
1 126 GLY n 
1 127 ARG n 
1 128 LEU n 
1 129 GLU n 
1 130 ASP n 
1 131 GLY n 
1 132 SER n 
1 133 PRO n 
1 134 ARG n 
1 135 THR n 
1 136 GLY n 
1 137 GLN n 
1 138 ALA n 
1 139 PHE n 
1 140 LYS n 
1 141 GLN n 
1 142 THR n 
1 143 TYR n 
1 144 ALA n 
1 145 LYS n 
1 146 PHE n 
1 147 ASP n 
1 148 ALA n 
1 149 ASN n 
1 150 SER n 
1 151 HIS n 
1 152 ASN n 
1 153 ASP n 
1 154 ASP n 
1 155 ALA n 
1 156 LEU n 
1 157 LEU n 
1 158 LYS n 
1 159 ASN n 
1 160 TYR n 
1 161 GLY n 
1 162 LEU n 
1 163 LEU n 
1 164 TYR n 
1 165 CYS n 
1 166 PHE n 
1 167 ARG n 
1 168 LYS n 
1 169 ASP n 
1 170 MET n 
1 171 ASP n 
1 172 LYS n 
1 173 VAL n 
1 174 GLU n 
1 175 THR n 
1 176 PHE n 
1 177 LEU n 
1 178 ARG n 
1 179 ILE n 
1 180 VAL n 
1 181 GLN n 
1 182 CYS n 
1 183 ARG n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 GLY n 
1 188 SER n 
1 189 CYS n 
1 190 GLY n 
1 191 PHE n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SOMA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01241 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCF
SESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPR
TGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HGU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 191 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01241 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  217 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       191 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1HGU GLN A 11  ? UNP P01241 ASP 37  CONFLICT 11  1  
1 1HGU GLU A 29  ? UNP P01241 GLN 55  CONFLICT 29  2  
1 1HGU ALA A 47  ? UNP P01241 ASN 73  CONFLICT 47  3  
1 1HGU ALA A 50  ? UNP P01241 THR 76  CONFLICT 50  4  
1 1HGU GLN A 66  ? UNP P01241 GLU 92  CONFLICT 66  5  
1 1HGU ALA A 67  ? UNP P01241 THR 93  CONFLICT 67  6  
1 1HGU GLN A 74  ? UNP P01241 GLU 100 CONFLICT 74  7  
1 1HGU GLY A 91  ? UNP P01241 GLN 117 CONFLICT 91  8  
1 1HGU ASP A 109 ? UNP P01241 ASN 135 CONFLICT 109 9  
1 1HGU ALA A 138 ? UNP P01241 ILE 164 CONFLICT 138 10 
1 1HGU ALA A 144 ? UNP P01241 SER 170 CONFLICT 144 11 
1 1HGU ALA A 148 ? UNP P01241 THR 174 CONFLICT 148 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HGU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.04 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1HGU 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.0747 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1HGU 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.212 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               34. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1HGU 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1495 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             81 
_refine_hist.number_atoms_total               1576 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.025 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.6   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1HGU 
_struct.title                     'HUMAN GROWTH HORMONE' 
_struct.pdbx_descriptor           'HUMAN GROWTH HORMONE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HGU 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            HORMONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 LEU A 6   ? ILE A 36  ? LEU A 6   ILE A 36  1 ? 31 
HELX_P HELX_P2 HA LYS A 41  ? PRO A 48  ? LYS A 41  PRO A 48  1 ? 8  
HELX_P HELX_P3 H2 ASN A 72  ? PRO A 89  ? ASN A 72  PRO A 89  1 ? 18 
HELX_P HELX_P4 H3 LEU A 113 ? LEU A 128 ? LEU A 113 LEU A 128 1 ? 16 
HELX_P HELX_P5 H4 ASP A 154 ? SER A 184 ? ASP A 154 SER A 184 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 53  SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 53  A CYS 165 1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf2 disulf ? ? A CYS 182 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 182 A CYS 189 1_555 ? ? ? ? ? ? ? 2.017 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HGU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HGU 
_atom_sites.fract_transf_matrix[1][1]   0.017538 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017538 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007685 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO      37'                                                                                           
2 'ALA      67  - GLN      68               OMEGA = 215.88 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
3 'GLN      68  - GLN      69               OMEGA = 226.17 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
4 'ASP     107  - SER     108               OMEGA = 238.99 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
5 'SER     108  - ASP     109               OMEGA = 269.60 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
6 'ASN     149  - SER     150               OMEGA = 137.02 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
7 'ASP     153  - ASP     154               OMEGA = 141.53 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 2   ? 29.114 58.211 59.211 1.00 21.97 ? 2   PRO A N   1 
ATOM   2    C CA  . PRO A 1 2   ? 28.768 57.103 60.080 1.00 22.63 ? 2   PRO A CA  1 
ATOM   3    C C   . PRO A 1 2   ? 29.801 56.033 59.821 1.00 23.70 ? 2   PRO A C   1 
ATOM   4    O O   . PRO A 1 2   ? 30.932 56.499 59.888 1.00 24.04 ? 2   PRO A O   1 
ATOM   5    C CB  . PRO A 1 2   ? 27.359 56.800 59.695 1.00 23.22 ? 2   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 2   ? 26.837 58.254 59.745 1.00 22.99 ? 2   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 2   ? 28.004 59.122 59.303 1.00 21.78 ? 2   PRO A CD  1 
ATOM   8    N N   . THR A 1 3   ? 29.683 54.748 59.493 1.00 25.14 ? 3   THR A N   1 
ATOM   9    C CA  . THR A 1 3   ? 30.864 53.863 59.340 1.00 28.07 ? 3   THR A CA  1 
ATOM   10   C C   . THR A 1 3   ? 31.608 54.135 58.023 1.00 28.18 ? 3   THR A C   1 
ATOM   11   O O   . THR A 1 3   ? 32.046 53.226 57.293 1.00 27.48 ? 3   THR A O   1 
ATOM   12   C CB  . THR A 1 3   ? 30.430 52.322 59.396 1.00 29.94 ? 3   THR A CB  1 
ATOM   13   O OG1 . THR A 1 3   ? 29.061 52.257 59.862 1.00 31.70 ? 3   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 3   ? 31.317 51.492 60.343 1.00 29.54 ? 3   THR A CG2 1 
ATOM   15   N N   . ILE A 1 4   ? 31.612 55.599 58.010 1.00 27.95 ? 4   ILE A N   1 
ATOM   16   C CA  . ILE A 1 4   ? 32.123 55.762 56.652 1.00 28.68 ? 4   ILE A CA  1 
ATOM   17   C C   . ILE A 1 4   ? 33.612 55.995 56.670 1.00 28.68 ? 4   ILE A C   1 
ATOM   18   O O   . ILE A 1 4   ? 34.316 55.704 55.703 1.00 28.69 ? 4   ILE A O   1 
ATOM   19   C CB  . ILE A 1 4   ? 31.464 56.963 55.957 1.00 28.58 ? 4   ILE A CB  1 
ATOM   20   C CG1 . ILE A 1 4   ? 31.692 58.313 56.653 1.00 29.84 ? 4   ILE A CG1 1 
ATOM   21   C CG2 . ILE A 1 4   ? 29.954 56.822 55.869 1.00 28.45 ? 4   ILE A CG2 1 
ATOM   22   C CD1 . ILE A 1 4   ? 30.770 59.417 56.112 1.00 29.18 ? 4   ILE A CD1 1 
ATOM   23   N N   . PRO A 1 5   ? 34.279 56.395 57.754 1.00 29.26 ? 5   PRO A N   1 
ATOM   24   C CA  . PRO A 1 5   ? 35.632 56.791 57.583 1.00 29.19 ? 5   PRO A CA  1 
ATOM   25   C C   . PRO A 1 5   ? 36.346 55.651 56.972 1.00 28.99 ? 5   PRO A C   1 
ATOM   26   O O   . PRO A 1 5   ? 36.309 54.513 57.525 1.00 29.83 ? 5   PRO A O   1 
ATOM   27   C CB  . PRO A 1 5   ? 36.057 56.973 59.038 1.00 28.55 ? 5   PRO A CB  1 
ATOM   28   C CG  . PRO A 1 5   ? 34.913 56.436 59.874 1.00 29.12 ? 5   PRO A CG  1 
ATOM   29   C CD  . PRO A 1 5   ? 33.704 56.565 59.049 1.00 29.44 ? 5   PRO A CD  1 
ATOM   30   N N   . LEU A 1 6   ? 36.995 56.113 55.946 1.00 27.82 ? 6   LEU A N   1 
ATOM   31   C CA  . LEU A 1 6   ? 37.631 55.338 54.895 1.00 27.08 ? 6   LEU A CA  1 
ATOM   32   C C   . LEU A 1 6   ? 38.930 54.731 55.390 1.00 27.92 ? 6   LEU A C   1 
ATOM   33   O O   . LEU A 1 6   ? 39.267 53.590 55.042 1.00 28.76 ? 6   LEU A O   1 
ATOM   34   C CB  . LEU A 1 6   ? 37.834 56.333 53.745 1.00 25.36 ? 6   LEU A CB  1 
ATOM   35   C CG  . LEU A 1 6   ? 38.053 55.733 52.367 1.00 25.15 ? 6   LEU A CG  1 
ATOM   36   C CD1 . LEU A 1 6   ? 37.490 56.619 51.250 1.00 24.51 ? 6   LEU A CD1 1 
ATOM   37   C CD2 . LEU A 1 6   ? 39.536 55.569 52.050 1.00 25.35 ? 6   LEU A CD2 1 
ATOM   38   N N   . SER A 1 7   ? 39.412 55.365 56.344 1.00 28.46 ? 7   SER A N   1 
ATOM   39   C CA  . SER A 1 7   ? 40.594 54.895 57.057 1.00 26.36 ? 7   SER A CA  1 
ATOM   40   C C   . SER A 1 7   ? 40.344 53.508 57.673 1.00 26.54 ? 7   SER A C   1 
ATOM   41   O O   . SER A 1 7   ? 41.185 52.610 57.571 1.00 25.50 ? 7   SER A O   1 
ATOM   42   C CB  . SER A 1 7   ? 40.922 55.936 58.114 0.00 27.10 ? 7   SER A CB  1 
ATOM   43   O OG  . SER A 1 7   ? 40.645 57.250 57.626 0.00 26.71 ? 7   SER A OG  1 
ATOM   44   N N   . ARG A 1 8   ? 39.125 53.254 58.193 1.00 26.41 ? 8   ARG A N   1 
ATOM   45   C CA  . ARG A 1 8   ? 38.684 51.965 58.748 1.00 26.38 ? 8   ARG A CA  1 
ATOM   46   C C   . ARG A 1 8   ? 38.806 50.827 57.739 1.00 27.39 ? 8   ARG A C   1 
ATOM   47   O O   . ARG A 1 8   ? 38.868 49.658 58.142 1.00 29.87 ? 8   ARG A O   1 
ATOM   48   C CB  . ARG A 1 8   ? 37.201 51.953 59.223 1.00 23.42 ? 8   ARG A CB  1 
ATOM   49   C CG  . ARG A 1 8   ? 36.859 52.016 60.720 1.00 18.71 ? 8   ARG A CG  1 
ATOM   50   C CD  . ARG A 1 8   ? 37.155 53.388 61.371 1.00 17.77 ? 8   ARG A CD  1 
ATOM   51   N NE  . ARG A 1 8   ? 38.583 53.590 61.597 1.00 16.22 ? 8   ARG A NE  1 
ATOM   52   C CZ  . ARG A 1 8   ? 39.176 54.774 61.829 1.00 15.02 ? 8   ARG A CZ  1 
ATOM   53   N NH1 . ARG A 1 8   ? 38.556 55.961 61.894 1.00 11.54 ? 8   ARG A NH1 1 
ATOM   54   N NH2 . ARG A 1 8   ? 40.491 54.741 61.978 1.00 13.90 ? 8   ARG A NH2 1 
ATOM   55   N N   . LEU A 1 9   ? 38.888 51.115 56.435 1.00 26.25 ? 9   LEU A N   1 
ATOM   56   C CA  . LEU A 1 9   ? 39.055 50.097 55.436 1.00 22.86 ? 9   LEU A CA  1 
ATOM   57   C C   . LEU A 1 9   ? 40.479 49.671 55.556 1.00 20.98 ? 9   LEU A C   1 
ATOM   58   O O   . LEU A 1 9   ? 40.737 48.537 55.929 1.00 20.02 ? 9   LEU A O   1 
ATOM   59   C CB  . LEU A 1 9   ? 38.682 50.743 54.143 1.00 24.85 ? 9   LEU A CB  1 
ATOM   60   C CG  . LEU A 1 9   ? 37.383 50.275 53.462 1.00 28.23 ? 9   LEU A CG  1 
ATOM   61   C CD1 . LEU A 1 9   ? 36.414 49.711 54.552 1.00 29.01 ? 9   LEU A CD1 1 
ATOM   62   C CD2 . LEU A 1 9   ? 36.790 51.424 52.590 1.00 26.87 ? 9   LEU A CD2 1 
ATOM   63   N N   . PHE A 1 10  ? 41.367 50.629 55.445 1.00 19.69 ? 10  PHE A N   1 
ATOM   64   C CA  . PHE A 1 10  ? 42.769 50.352 55.663 1.00 20.93 ? 10  PHE A CA  1 
ATOM   65   C C   . PHE A 1 10  ? 42.962 49.639 57.003 1.00 21.36 ? 10  PHE A C   1 
ATOM   66   O O   . PHE A 1 10  ? 43.712 48.678 57.095 1.00 19.64 ? 10  PHE A O   1 
ATOM   67   C CB  . PHE A 1 10  ? 43.573 51.626 55.712 1.00 20.32 ? 10  PHE A CB  1 
ATOM   68   C CG  . PHE A 1 10  ? 43.472 52.524 54.508 1.00 19.37 ? 10  PHE A CG  1 
ATOM   69   C CD1 . PHE A 1 10  ? 44.282 52.308 53.434 1.00 18.21 ? 10  PHE A CD1 1 
ATOM   70   C CD2 . PHE A 1 10  ? 42.520 53.515 54.513 1.00 19.60 ? 10  PHE A CD2 1 
ATOM   71   C CE1 . PHE A 1 10  ? 44.112 53.115 52.347 1.00 17.96 ? 10  PHE A CE1 1 
ATOM   72   C CE2 . PHE A 1 10  ? 42.360 54.316 53.421 1.00 17.16 ? 10  PHE A CE2 1 
ATOM   73   C CZ  . PHE A 1 10  ? 43.159 54.111 52.327 1.00 17.82 ? 10  PHE A CZ  1 
ATOM   74   N N   . GLN A 1 11  ? 42.170 50.006 58.017 1.00 22.46 ? 11  GLN A N   1 
ATOM   75   C CA  . GLN A 1 11  ? 42.247 49.378 59.348 1.00 23.35 ? 11  GLN A CA  1 
ATOM   76   C C   . GLN A 1 11  ? 41.883 47.933 59.184 1.00 21.84 ? 11  GLN A C   1 
ATOM   77   O O   . GLN A 1 11  ? 42.799 47.129 59.289 1.00 22.14 ? 11  GLN A O   1 
ATOM   78   C CB  . GLN A 1 11  ? 41.254 49.881 60.450 1.00 24.38 ? 11  GLN A CB  1 
ATOM   79   C CG  . GLN A 1 11  ? 41.816 49.950 61.862 1.00 25.62 ? 11  GLN A CG  1 
ATOM   80   C CD  . GLN A 1 11  ? 42.469 51.304 62.148 1.00 27.67 ? 11  GLN A CD  1 
ATOM   81   O OE1 . GLN A 1 11  ? 42.212 51.912 63.194 1.00 30.39 ? 11  GLN A OE1 1 
ATOM   82   N NE2 . GLN A 1 11  ? 43.335 51.883 61.313 1.00 28.10 ? 11  GLN A NE2 1 
ATOM   83   N N   . ASN A 1 12  ? 40.612 47.630 58.915 1.00 20.70 ? 12  ASN A N   1 
ATOM   84   C CA  . ASN A 1 12  ? 40.115 46.275 58.818 1.00 20.81 ? 12  ASN A CA  1 
ATOM   85   C C   . ASN A 1 12  ? 41.086 45.347 58.138 1.00 20.74 ? 12  ASN A C   1 
ATOM   86   O O   . ASN A 1 12  ? 41.486 44.344 58.731 1.00 21.35 ? 12  ASN A O   1 
ATOM   87   C CB  . ASN A 1 12  ? 38.796 46.284 58.074 1.00 21.06 ? 12  ASN A CB  1 
ATOM   88   C CG  . ASN A 1 12  ? 38.337 44.914 57.611 1.00 20.55 ? 12  ASN A CG  1 
ATOM   89   O OD1 . ASN A 1 12  ? 38.868 44.302 56.678 1.00 18.33 ? 12  ASN A OD1 1 
ATOM   90   N ND2 . ASN A 1 12  ? 37.327 44.440 58.318 1.00 19.02 ? 12  ASN A ND2 1 
ATOM   91   N N   . ALA A 1 13  ? 41.528 45.731 56.969 1.00 21.22 ? 13  ALA A N   1 
ATOM   92   C CA  . ALA A 1 13  ? 42.492 44.891 56.306 1.00 23.02 ? 13  ALA A CA  1 
ATOM   93   C C   . ALA A 1 13  ? 43.772 44.769 57.135 1.00 23.25 ? 13  ALA A C   1 
ATOM   94   O O   . ALA A 1 13  ? 44.235 43.664 57.394 1.00 24.84 ? 13  ALA A O   1 
ATOM   95   C CB  . ALA A 1 13  ? 42.827 45.481 54.962 1.00 23.84 ? 13  ALA A CB  1 
ATOM   96   N N   . MET A 1 14  ? 44.296 45.847 57.685 1.00 23.47 ? 14  MET A N   1 
ATOM   97   C CA  . MET A 1 14  ? 45.495 45.809 58.471 1.00 23.52 ? 14  MET A CA  1 
ATOM   98   C C   . MET A 1 14  ? 45.355 44.946 59.699 1.00 22.19 ? 14  MET A C   1 
ATOM   99   O O   . MET A 1 14  ? 46.225 44.098 59.852 1.00 22.71 ? 14  MET A O   1 
ATOM   100  C CB  . MET A 1 14  ? 45.850 47.209 58.857 1.00 28.08 ? 14  MET A CB  1 
ATOM   101  C CG  . MET A 1 14  ? 47.157 47.529 58.198 1.00 31.11 ? 14  MET A CG  1 
ATOM   102  S SD  . MET A 1 14  ? 48.410 47.590 59.499 1.00 35.66 ? 14  MET A SD  1 
ATOM   103  C CE  . MET A 1 14  ? 49.609 46.628 58.613 1.00 33.81 ? 14  MET A CE  1 
ATOM   104  N N   . LEU A 1 15  ? 44.370 45.082 60.598 1.00 21.76 ? 15  LEU A N   1 
ATOM   105  C CA  . LEU A 1 15  ? 44.183 44.180 61.762 1.00 20.13 ? 15  LEU A CA  1 
ATOM   106  C C   . LEU A 1 15  ? 44.192 42.760 61.179 1.00 20.39 ? 15  LEU A C   1 
ATOM   107  O O   . LEU A 1 15  ? 45.108 41.999 61.526 1.00 21.79 ? 15  LEU A O   1 
ATOM   108  C CB  . LEU A 1 15  ? 42.797 44.293 62.496 1.00 15.38 ? 15  LEU A CB  1 
ATOM   109  C CG  . LEU A 1 15  ? 42.388 44.841 63.869 1.00 13.33 ? 15  LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 15  ? 41.662 46.176 63.807 1.00 10.81 ? 15  LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 15  ? 41.374 43.885 64.424 1.00 10.42 ? 15  LEU A CD2 1 
ATOM   112  N N   . ARG A 1 16  ? 43.299 42.403 60.234 1.00 19.23 ? 16  ARG A N   1 
ATOM   113  C CA  . ARG A 1 16  ? 43.257 41.034 59.764 1.00 19.55 ? 16  ARG A CA  1 
ATOM   114  C C   . ARG A 1 16  ? 44.502 40.647 59.015 1.00 21.47 ? 16  ARG A C   1 
ATOM   115  O O   . ARG A 1 16  ? 44.868 39.481 59.102 1.00 21.03 ? 16  ARG A O   1 
ATOM   116  C CB  . ARG A 1 16  ? 42.111 40.718 58.801 1.00 18.28 ? 16  ARG A CB  1 
ATOM   117  C CG  . ARG A 1 16  ? 40.644 40.752 59.267 1.00 15.23 ? 16  ARG A CG  1 
ATOM   118  C CD  . ARG A 1 16  ? 40.093 41.607 58.159 1.00 14.15 ? 16  ARG A CD  1 
ATOM   119  N NE  . ARG A 1 16  ? 38.695 41.838 57.880 0.50 10.29 ? 16  ARG A NE  1 
ATOM   120  C CZ  . ARG A 1 16  ? 37.601 41.308 58.395 0.50 9.51  ? 16  ARG A CZ  1 
ATOM   121  N NH1 . ARG A 1 16  ? 37.525 40.383 59.331 0.50 5.75  ? 16  ARG A NH1 1 
ATOM   122  N NH2 . ARG A 1 16  ? 36.493 41.770 57.845 0.50 12.11 ? 16  ARG A NH2 1 
ATOM   123  N N   . ALA A 1 17  ? 45.275 41.488 58.343 1.00 22.88 ? 17  ALA A N   1 
ATOM   124  C CA  . ALA A 1 17  ? 46.434 40.963 57.630 1.00 24.84 ? 17  ALA A CA  1 
ATOM   125  C C   . ALA A 1 17  ? 47.578 40.694 58.626 1.00 26.93 ? 17  ALA A C   1 
ATOM   126  O O   . ALA A 1 17  ? 48.401 39.784 58.374 1.00 27.91 ? 17  ALA A O   1 
ATOM   127  C CB  . ALA A 1 17  ? 46.860 41.946 56.540 1.00 23.61 ? 17  ALA A CB  1 
ATOM   128  N N   . HIS A 1 18  ? 47.715 41.362 59.818 1.00 27.30 ? 18  HIS A N   1 
ATOM   129  C CA  . HIS A 1 18  ? 48.761 40.875 60.677 1.00 27.26 ? 18  HIS A CA  1 
ATOM   130  C C   . HIS A 1 18  ? 48.187 39.759 61.431 1.00 27.25 ? 18  HIS A C   1 
ATOM   131  O O   . HIS A 1 18  ? 48.857 38.744 61.462 1.00 27.14 ? 18  HIS A O   1 
ATOM   132  C CB  . HIS A 1 18  ? 49.380 41.936 61.547 1.00 28.89 ? 18  HIS A CB  1 
ATOM   133  C CG  . HIS A 1 18  ? 50.634 42.234 60.668 1.00 33.59 ? 18  HIS A CG  1 
ATOM   134  N ND1 . HIS A 1 18  ? 51.230 41.417 59.752 1.00 34.72 ? 18  HIS A ND1 1 
ATOM   135  C CD2 . HIS A 1 18  ? 51.372 43.422 60.615 1.00 34.33 ? 18  HIS A CD2 1 
ATOM   136  C CE1 . HIS A 1 18  ? 52.241 42.043 59.192 1.00 35.05 ? 18  HIS A CE1 1 
ATOM   137  N NE2 . HIS A 1 18  ? 52.321 43.245 59.708 1.00 35.45 ? 18  HIS A NE2 1 
ATOM   138  N N   . ARG A 1 19  ? 46.900 39.793 61.707 1.00 27.52 ? 19  ARG A N   1 
ATOM   139  C CA  . ARG A 1 19  ? 46.229 38.632 62.276 1.00 29.01 ? 19  ARG A CA  1 
ATOM   140  C C   . ARG A 1 19  ? 46.438 37.411 61.396 1.00 29.17 ? 19  ARG A C   1 
ATOM   141  O O   . ARG A 1 19  ? 46.387 36.267 61.826 1.00 29.59 ? 19  ARG A O   1 
ATOM   142  C CB  . ARG A 1 19  ? 44.703 38.883 62.428 1.00 28.86 ? 19  ARG A CB  1 
ATOM   143  C CG  . ARG A 1 19  ? 44.039 37.889 63.410 0.00 28.28 ? 19  ARG A CG  1 
ATOM   144  C CD  . ARG A 1 19  ? 44.682 37.958 64.808 0.00 28.94 ? 19  ARG A CD  1 
ATOM   145  N NE  . ARG A 1 19  ? 44.124 37.030 65.782 0.00 29.26 ? 19  ARG A NE  1 
ATOM   146  C CZ  . ARG A 1 19  ? 44.156 37.272 67.102 0.00 30.01 ? 19  ARG A CZ  1 
ATOM   147  N NH1 . ARG A 1 19  ? 44.697 38.383 67.603 0.00 30.20 ? 19  ARG A NH1 1 
ATOM   148  N NH2 . ARG A 1 19  ? 43.669 36.377 67.955 0.00 30.20 ? 19  ARG A NH2 1 
ATOM   149  N N   . LEU A 1 20  ? 46.717 37.710 60.140 1.00 30.22 ? 20  LEU A N   1 
ATOM   150  C CA  . LEU A 1 20  ? 47.037 36.734 59.147 1.00 32.06 ? 20  LEU A CA  1 
ATOM   151  C C   . LEU A 1 20  ? 48.527 36.464 59.022 1.00 31.92 ? 20  LEU A C   1 
ATOM   152  O O   . LEU A 1 20  ? 48.827 35.288 58.788 1.00 33.26 ? 20  LEU A O   1 
ATOM   153  C CB  . LEU A 1 20  ? 46.456 37.192 57.825 1.00 34.56 ? 20  LEU A CB  1 
ATOM   154  C CG  . LEU A 1 20  ? 45.544 36.141 57.209 1.00 38.12 ? 20  LEU A CG  1 
ATOM   155  C CD1 . LEU A 1 20  ? 44.596 36.739 56.170 1.00 39.01 ? 20  LEU A CD1 1 
ATOM   156  C CD2 . LEU A 1 20  ? 46.457 35.063 56.626 1.00 38.71 ? 20  LEU A CD2 1 
ATOM   157  N N   . HIS A 1 21  ? 49.526 37.356 59.174 1.00 30.00 ? 21  HIS A N   1 
ATOM   158  C CA  . HIS A 1 21  ? 50.915 36.898 59.084 1.00 27.86 ? 21  HIS A CA  1 
ATOM   159  C C   . HIS A 1 21  ? 51.072 35.849 60.170 1.00 28.12 ? 21  HIS A C   1 
ATOM   160  O O   . HIS A 1 21  ? 51.572 34.765 59.893 1.00 29.11 ? 21  HIS A O   1 
ATOM   161  C CB  . HIS A 1 21  ? 51.904 38.000 59.359 1.00 24.87 ? 21  HIS A CB  1 
ATOM   162  C CG  . HIS A 1 21  ? 53.334 37.726 58.935 1.00 22.87 ? 21  HIS A CG  1 
ATOM   163  N ND1 . HIS A 1 21  ? 54.194 38.611 58.440 1.00 23.86 ? 21  HIS A ND1 1 
ATOM   164  C CD2 . HIS A 1 21  ? 54.014 36.531 58.970 1.00 22.82 ? 21  HIS A CD2 1 
ATOM   165  C CE1 . HIS A 1 21  ? 55.346 37.997 58.185 1.00 22.87 ? 21  HIS A CE1 1 
ATOM   166  N NE2 . HIS A 1 21  ? 55.224 36.741 58.508 1.00 22.52 ? 21  HIS A NE2 1 
ATOM   167  N N   . GLN A 1 22  ? 50.468 36.132 61.338 1.00 27.63 ? 22  GLN A N   1 
ATOM   168  C CA  . GLN A 1 22  ? 50.660 35.389 62.587 1.00 26.12 ? 22  GLN A CA  1 
ATOM   169  C C   . GLN A 1 22  ? 50.258 33.980 62.653 1.00 25.59 ? 22  GLN A C   1 
ATOM   170  O O   . GLN A 1 22  ? 50.933 33.238 63.373 1.00 26.86 ? 22  GLN A O   1 
ATOM   171  C CB  . GLN A 1 22  ? 49.964 36.017 63.772 1.00 25.24 ? 22  GLN A CB  1 
ATOM   172  C CG  . GLN A 1 22  ? 50.904 36.921 64.521 1.00 22.04 ? 22  GLN A CG  1 
ATOM   173  C CD  . GLN A 1 22  ? 50.211 38.130 65.108 1.00 20.24 ? 22  GLN A CD  1 
ATOM   174  O OE1 . GLN A 1 22  ? 50.843 39.168 65.059 1.00 19.55 ? 22  GLN A OE1 1 
ATOM   175  N NE2 . GLN A 1 22  ? 48.991 38.143 65.654 1.00 18.46 ? 22  GLN A NE2 1 
ATOM   176  N N   . LEU A 1 23  ? 49.179 33.656 61.957 1.00 23.97 ? 23  LEU A N   1 
ATOM   177  C CA  . LEU A 1 23  ? 48.840 32.266 61.962 1.00 24.70 ? 23  LEU A CA  1 
ATOM   178  C C   . LEU A 1 23  ? 49.672 31.576 60.943 1.00 23.98 ? 23  LEU A C   1 
ATOM   179  O O   . LEU A 1 23  ? 49.908 30.392 61.116 1.00 24.48 ? 23  LEU A O   1 
ATOM   180  C CB  . LEU A 1 23  ? 47.548 31.863 61.472 1.00 25.49 ? 23  LEU A CB  1 
ATOM   181  C CG  . LEU A 1 23  ? 46.429 32.337 62.165 1.00 27.69 ? 23  LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 23  ? 45.743 33.385 61.314 1.00 25.90 ? 23  LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 23  ? 45.663 31.089 62.578 1.00 27.67 ? 23  LEU A CD2 1 
ATOM   184  N N   . ALA A 1 24  ? 50.051 32.232 59.854 1.00 22.67 ? 24  ALA A N   1 
ATOM   185  C CA  . ALA A 1 24  ? 50.742 31.501 58.834 1.00 22.53 ? 24  ALA A CA  1 
ATOM   186  C C   . ALA A 1 24  ? 52.096 31.218 59.434 1.00 23.45 ? 24  ALA A C   1 
ATOM   187  O O   . ALA A 1 24  ? 52.458 30.046 59.459 1.00 22.21 ? 24  ALA A O   1 
ATOM   188  C CB  . ALA A 1 24  ? 50.830 32.354 57.626 1.00 22.60 ? 24  ALA A CB  1 
ATOM   189  N N   . PHE A 1 25  ? 52.781 32.204 60.049 1.00 25.37 ? 25  PHE A N   1 
ATOM   190  C CA  . PHE A 1 25  ? 54.034 32.017 60.799 1.00 28.54 ? 25  PHE A CA  1 
ATOM   191  C C   . PHE A 1 25  ? 53.857 31.277 62.151 1.00 29.31 ? 25  PHE A C   1 
ATOM   192  O O   . PHE A 1 25  ? 54.880 30.746 62.609 1.00 31.37 ? 25  PHE A O   1 
ATOM   193  C CB  . PHE A 1 25  ? 54.707 33.404 61.034 1.00 29.18 ? 25  PHE A CB  1 
ATOM   194  C CG  . PHE A 1 25  ? 56.035 33.486 61.812 1.00 30.36 ? 25  PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 25  ? 56.055 33.453 63.206 1.00 30.92 ? 25  PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 25  ? 57.232 33.619 61.124 1.00 32.26 ? 25  PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 25  ? 57.250 33.548 63.891 1.00 31.10 ? 25  PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 25  ? 58.430 33.718 61.819 1.00 32.51 ? 25  PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 25  ? 58.439 33.681 63.199 1.00 33.04 ? 25  PHE A CZ  1 
ATOM   200  N N   . ASP A 1 26  ? 52.723 31.187 62.890 1.00 28.75 ? 26  ASP A N   1 
ATOM   201  C CA  . ASP A 1 26  ? 52.615 30.289 64.039 1.00 26.83 ? 26  ASP A CA  1 
ATOM   202  C C   . ASP A 1 26  ? 52.890 28.905 63.453 1.00 26.17 ? 26  ASP A C   1 
ATOM   203  O O   . ASP A 1 26  ? 53.907 28.264 63.746 1.00 26.67 ? 26  ASP A O   1 
ATOM   204  C CB  . ASP A 1 26  ? 51.206 30.368 64.631 1.00 26.82 ? 26  ASP A CB  1 
ATOM   205  C CG  . ASP A 1 26  ? 50.365 29.085 64.854 1.00 28.08 ? 26  ASP A CG  1 
ATOM   206  O OD1 . ASP A 1 26  ? 50.860 28.057 65.330 1.00 24.83 ? 26  ASP A OD1 1 
ATOM   207  O OD2 . ASP A 1 26  ? 49.176 29.114 64.542 1.00 29.66 ? 26  ASP A OD2 1 
ATOM   208  N N   . THR A 1 27  ? 51.963 28.539 62.553 1.00 24.63 ? 27  THR A N   1 
ATOM   209  C CA  . THR A 1 27  ? 51.921 27.290 61.835 1.00 24.19 ? 27  THR A CA  1 
ATOM   210  C C   . THR A 1 27  ? 53.250 26.996 61.152 1.00 24.31 ? 27  THR A C   1 
ATOM   211  O O   . THR A 1 27  ? 53.703 25.848 61.134 1.00 23.42 ? 27  THR A O   1 
ATOM   212  C CB  . THR A 1 27  ? 50.758 27.416 60.841 1.00 23.48 ? 27  THR A CB  1 
ATOM   213  O OG1 . THR A 1 27  ? 49.581 27.794 61.563 1.00 25.22 ? 27  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 27  ? 50.512 26.120 60.121 1.00 23.45 ? 27  THR A CG2 1 
ATOM   215  N N   . TYR A 1 28  ? 53.894 28.018 60.593 1.00 23.86 ? 28  TYR A N   1 
ATOM   216  C CA  . TYR A 1 28  ? 55.162 27.763 60.000 1.00 24.96 ? 28  TYR A CA  1 
ATOM   217  C C   . TYR A 1 28  ? 56.108 27.253 61.077 1.00 26.57 ? 28  TYR A C   1 
ATOM   218  O O   . TYR A 1 28  ? 56.574 26.109 60.966 1.00 26.65 ? 28  TYR A O   1 
ATOM   219  C CB  . TYR A 1 28  ? 55.774 29.008 59.369 1.00 25.62 ? 28  TYR A CB  1 
ATOM   220  C CG  . TYR A 1 28  ? 57.121 28.601 58.797 1.00 26.79 ? 28  TYR A CG  1 
ATOM   221  C CD1 . TYR A 1 28  ? 57.213 27.441 58.013 1.00 27.10 ? 28  TYR A CD1 1 
ATOM   222  C CD2 . TYR A 1 28  ? 58.262 29.265 59.185 1.00 26.86 ? 28  TYR A CD2 1 
ATOM   223  C CE1 . TYR A 1 28  ? 58.447 26.945 57.623 1.00 28.42 ? 28  TYR A CE1 1 
ATOM   224  C CE2 . TYR A 1 28  ? 59.494 28.777 58.797 1.00 27.99 ? 28  TYR A CE2 1 
ATOM   225  C CZ  . TYR A 1 28  ? 59.580 27.620 58.042 1.00 28.79 ? 28  TYR A CZ  1 
ATOM   226  O OH  . TYR A 1 28  ? 60.822 27.126 57.698 1.00 30.01 ? 28  TYR A OH  1 
ATOM   227  N N   . GLU A 1 29  ? 56.246 28.046 62.162 1.00 28.69 ? 29  GLU A N   1 
ATOM   228  C CA  . GLU A 1 29  ? 57.255 27.814 63.199 1.00 29.53 ? 29  GLU A CA  1 
ATOM   229  C C   . GLU A 1 29  ? 57.390 26.444 63.777 1.00 30.84 ? 29  GLU A C   1 
ATOM   230  O O   . GLU A 1 29  ? 58.462 25.840 63.678 1.00 32.15 ? 29  GLU A O   1 
ATOM   231  C CB  . GLU A 1 29  ? 57.107 28.762 64.404 1.00 28.41 ? 29  GLU A CB  1 
ATOM   232  C CG  . GLU A 1 29  ? 57.947 30.023 64.180 1.00 28.20 ? 29  GLU A CG  1 
ATOM   233  C CD  . GLU A 1 29  ? 59.274 29.891 63.391 1.00 28.77 ? 29  GLU A CD  1 
ATOM   234  O OE1 . GLU A 1 29  ? 59.995 28.883 63.472 1.00 27.42 ? 29  GLU A OE1 1 
ATOM   235  O OE2 . GLU A 1 29  ? 59.603 30.813 62.647 1.00 30.69 ? 29  GLU A OE2 1 
ATOM   236  N N   . GLU A 1 30  ? 56.274 25.943 64.293 1.00 31.30 ? 30  GLU A N   1 
ATOM   237  C CA  . GLU A 1 30  ? 56.262 24.600 64.842 1.00 32.15 ? 30  GLU A CA  1 
ATOM   238  C C   . GLU A 1 30  ? 56.465 23.544 63.775 1.00 32.17 ? 30  GLU A C   1 
ATOM   239  O O   . GLU A 1 30  ? 57.323 22.672 64.018 1.00 32.63 ? 30  GLU A O   1 
ATOM   240  C CB  . GLU A 1 30  ? 54.956 24.312 65.582 1.00 32.50 ? 30  GLU A CB  1 
ATOM   241  C CG  . GLU A 1 30  ? 53.785 24.822 64.753 1.00 32.73 ? 30  GLU A CG  1 
ATOM   242  C CD  . GLU A 1 30  ? 52.497 24.863 65.504 1.00 33.17 ? 30  GLU A CD  1 
ATOM   243  O OE1 . GLU A 1 30  ? 52.241 25.871 66.178 1.00 32.21 ? 30  GLU A OE1 1 
ATOM   244  O OE2 . GLU A 1 30  ? 51.791 23.868 65.371 1.00 32.75 ? 30  GLU A OE2 1 
ATOM   245  N N   . PHE A 1 31  ? 55.813 23.683 62.598 1.00 30.91 ? 31  PHE A N   1 
ATOM   246  C CA  . PHE A 1 31  ? 55.820 22.678 61.561 1.00 30.01 ? 31  PHE A CA  1 
ATOM   247  C C   . PHE A 1 31  ? 57.187 22.232 61.117 1.00 30.15 ? 31  PHE A C   1 
ATOM   248  O O   . PHE A 1 31  ? 57.407 21.058 60.832 1.00 29.30 ? 31  PHE A O   1 
ATOM   249  C CB  . PHE A 1 31  ? 55.109 23.187 60.393 1.00 30.62 ? 31  PHE A CB  1 
ATOM   250  C CG  . PHE A 1 31  ? 54.964 22.118 59.331 1.00 34.20 ? 31  PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 31  ? 53.929 21.218 59.435 1.00 34.36 ? 31  PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 31  ? 55.835 22.071 58.232 1.00 35.00 ? 31  PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 31  ? 53.776 20.289 58.423 1.00 35.36 ? 31  PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 31  ? 55.665 21.130 57.233 1.00 35.34 ? 31  PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 31  ? 54.626 20.236 57.328 1.00 35.40 ? 31  PHE A CZ  1 
ATOM   256  N N   . GLU A 1 32  ? 58.104 23.172 61.005 1.00 31.19 ? 32  GLU A N   1 
ATOM   257  C CA  . GLU A 1 32  ? 59.432 22.827 60.556 1.00 32.60 ? 32  GLU A CA  1 
ATOM   258  C C   . GLU A 1 32  ? 60.072 22.039 61.643 1.00 32.28 ? 32  GLU A C   1 
ATOM   259  O O   . GLU A 1 32  ? 60.680 21.050 61.261 1.00 33.42 ? 32  GLU A O   1 
ATOM   260  C CB  . GLU A 1 32  ? 60.359 24.002 60.307 1.00 35.26 ? 32  GLU A CB  1 
ATOM   261  C CG  . GLU A 1 32  ? 60.237 24.992 61.453 1.00 38.49 ? 32  GLU A CG  1 
ATOM   262  C CD  . GLU A 1 32  ? 61.449 25.839 61.700 1.00 40.78 ? 32  GLU A CD  1 
ATOM   263  O OE1 . GLU A 1 32  ? 61.744 26.667 60.829 1.00 42.59 ? 32  GLU A OE1 1 
ATOM   264  O OE2 . GLU A 1 32  ? 62.055 25.674 62.768 1.00 41.22 ? 32  GLU A OE2 1 
ATOM   265  N N   . GLU A 1 33  ? 59.910 22.357 62.942 1.00 31.74 ? 33  GLU A N   1 
ATOM   266  C CA  . GLU A 1 33  ? 60.619 21.577 63.949 1.00 31.15 ? 33  GLU A CA  1 
ATOM   267  C C   . GLU A 1 33  ? 60.056 20.194 63.908 1.00 30.93 ? 33  GLU A C   1 
ATOM   268  O O   . GLU A 1 33  ? 60.871 19.292 63.729 1.00 29.45 ? 33  GLU A O   1 
ATOM   269  C CB  . GLU A 1 33  ? 60.456 22.010 65.408 1.00 31.66 ? 33  GLU A CB  1 
ATOM   270  C CG  . GLU A 1 33  ? 60.954 23.402 65.783 1.00 33.26 ? 33  GLU A CG  1 
ATOM   271  C CD  . GLU A 1 33  ? 60.062 24.000 66.862 1.00 33.80 ? 33  GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 33  ? 58.843 23.804 66.778 1.00 33.68 ? 33  GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 33  ? 60.577 24.651 67.783 1.00 32.34 ? 33  GLU A OE2 1 
ATOM   274  N N   . ALA A 1 34  ? 58.720 20.035 63.904 1.00 31.56 ? 34  ALA A N   1 
ATOM   275  C CA  . ALA A 1 34  ? 58.094 18.710 63.948 1.00 33.31 ? 34  ALA A CA  1 
ATOM   276  C C   . ALA A 1 34  ? 58.338 17.772 62.751 1.00 34.98 ? 34  ALA A C   1 
ATOM   277  O O   . ALA A 1 34  ? 57.796 16.654 62.695 1.00 35.35 ? 34  ALA A O   1 
ATOM   278  C CB  . ALA A 1 34  ? 56.579 18.908 64.157 1.00 31.27 ? 34  ALA A CB  1 
ATOM   279  N N   . TYR A 1 35  ? 59.162 18.237 61.780 1.00 36.28 ? 35  TYR A N   1 
ATOM   280  C CA  . TYR A 1 35  ? 59.547 17.542 60.557 1.00 35.36 ? 35  TYR A CA  1 
ATOM   281  C C   . TYR A 1 35  ? 61.022 17.666 60.147 1.00 36.00 ? 35  TYR A C   1 
ATOM   282  O O   . TYR A 1 35  ? 61.776 16.685 60.169 1.00 36.26 ? 35  TYR A O   1 
ATOM   283  C CB  . TYR A 1 35  ? 58.668 18.053 59.446 1.00 33.44 ? 35  TYR A CB  1 
ATOM   284  C CG  . TYR A 1 35  ? 57.309 17.403 59.509 1.00 33.32 ? 35  TYR A CG  1 
ATOM   285  C CD1 . TYR A 1 35  ? 57.206 16.057 59.221 1.00 33.87 ? 35  TYR A CD1 1 
ATOM   286  C CD2 . TYR A 1 35  ? 56.185 18.126 59.796 1.00 33.44 ? 35  TYR A CD2 1 
ATOM   287  C CE1 . TYR A 1 35  ? 55.981 15.423 59.188 1.00 33.07 ? 35  TYR A CE1 1 
ATOM   288  C CE2 . TYR A 1 35  ? 54.956 17.493 59.761 1.00 33.77 ? 35  TYR A CE2 1 
ATOM   289  C CZ  . TYR A 1 35  ? 54.854 16.152 59.453 1.00 32.77 ? 35  TYR A CZ  1 
ATOM   290  O OH  . TYR A 1 35  ? 53.614 15.554 59.294 1.00 32.84 ? 35  TYR A OH  1 
ATOM   291  N N   . ILE A 1 36  ? 61.505 18.846 59.764 1.00 36.14 ? 36  ILE A N   1 
ATOM   292  C CA  . ILE A 1 36  ? 62.844 18.920 59.264 1.00 36.94 ? 36  ILE A CA  1 
ATOM   293  C C   . ILE A 1 36  ? 63.864 19.357 60.332 1.00 37.74 ? 36  ILE A C   1 
ATOM   294  O O   . ILE A 1 36  ? 64.280 20.528 60.300 1.00 39.72 ? 36  ILE A O   1 
ATOM   295  C CB  . ILE A 1 36  ? 62.791 19.884 58.038 1.00 36.46 ? 36  ILE A CB  1 
ATOM   296  C CG1 . ILE A 1 36  ? 61.591 19.767 57.102 0.00 29.02 ? 36  ILE A CG1 1 
ATOM   297  C CG2 . ILE A 1 36  ? 64.052 19.518 57.266 0.00 28.99 ? 36  ILE A CG2 1 
ATOM   298  C CD1 . ILE A 1 36  ? 60.630 20.945 57.365 0.00 29.30 ? 36  ILE A CD1 1 
ATOM   299  N N   . PRO A 1 37  ? 64.379 18.544 61.274 1.00 38.32 ? 37  PRO A N   1 
ATOM   300  N N   . GLN A 1 40  ? 68.079 21.817 59.767 1.00 43.48 ? 40  GLN A N   1 
ATOM   301  C CA  . GLN A 1 40  ? 68.280 20.888 58.666 1.00 44.55 ? 40  GLN A CA  1 
ATOM   302  C C   . GLN A 1 40  ? 67.603 21.197 57.328 1.00 44.52 ? 40  GLN A C   1 
ATOM   303  O O   . GLN A 1 40  ? 67.658 20.447 56.339 1.00 43.60 ? 40  GLN A O   1 
ATOM   304  C CB  . GLN A 1 40  ? 67.903 19.484 59.142 1.00 46.13 ? 40  GLN A CB  1 
ATOM   305  C CG  . GLN A 1 40  ? 69.249 18.738 59.040 1.00 48.77 ? 40  GLN A CG  1 
ATOM   306  C CD  . GLN A 1 40  ? 69.350 17.299 59.552 1.00 48.82 ? 40  GLN A CD  1 
ATOM   307  O OE1 . GLN A 1 40  ? 70.175 16.518 59.085 1.00 49.27 ? 40  GLN A OE1 1 
ATOM   308  N NE2 . GLN A 1 40  ? 68.585 16.848 60.523 1.00 49.00 ? 40  GLN A NE2 1 
ATOM   309  N N   . LYS A 1 41  ? 67.022 22.398 57.302 1.00 44.42 ? 41  LYS A N   1 
ATOM   310  C CA  . LYS A 1 41  ? 66.504 22.977 56.091 1.00 44.03 ? 41  LYS A CA  1 
ATOM   311  C C   . LYS A 1 41  ? 67.739 23.328 55.230 1.00 43.78 ? 41  LYS A C   1 
ATOM   312  O O   . LYS A 1 41  ? 67.926 22.810 54.126 1.00 44.59 ? 41  LYS A O   1 
ATOM   313  C CB  . LYS A 1 41  ? 65.647 24.183 56.508 1.00 43.45 ? 41  LYS A CB  1 
ATOM   314  C CG  . LYS A 1 41  ? 64.374 23.746 57.253 1.00 41.58 ? 41  LYS A CG  1 
ATOM   315  C CD  . LYS A 1 41  ? 63.347 24.830 57.567 1.00 39.89 ? 41  LYS A CD  1 
ATOM   316  C CE  . LYS A 1 41  ? 63.762 25.724 58.735 1.00 37.56 ? 41  LYS A CE  1 
ATOM   317  N NZ  . LYS A 1 41  ? 64.270 27.020 58.327 1.00 36.42 ? 41  LYS A NZ  1 
ATOM   318  N N   . TYR A 1 42  ? 68.734 24.067 55.696 1.00 43.06 ? 42  TYR A N   1 
ATOM   319  C CA  . TYR A 1 42  ? 69.917 24.305 54.894 1.00 41.90 ? 42  TYR A CA  1 
ATOM   320  C C   . TYR A 1 42  ? 70.830 23.034 55.013 1.00 42.33 ? 42  TYR A C   1 
ATOM   321  O O   . TYR A 1 42  ? 72.067 23.165 55.067 1.00 42.19 ? 42  TYR A O   1 
ATOM   322  C CB  . TYR A 1 42  ? 70.477 25.639 55.463 1.00 41.17 ? 42  TYR A CB  1 
ATOM   323  C CG  . TYR A 1 42  ? 71.877 26.141 55.102 0.00 31.86 ? 42  TYR A CG  1 
ATOM   324  C CD1 . TYR A 1 42  ? 72.418 25.987 53.839 0.00 31.67 ? 42  TYR A CD1 1 
ATOM   325  C CD2 . TYR A 1 42  ? 72.601 26.799 56.079 0.00 31.56 ? 42  TYR A CD2 1 
ATOM   326  C CE1 . TYR A 1 42  ? 73.673 26.492 53.552 0.00 31.30 ? 42  TYR A CE1 1 
ATOM   327  C CE2 . TYR A 1 42  ? 73.852 27.306 55.799 0.00 31.36 ? 42  TYR A CE2 1 
ATOM   328  C CZ  . TYR A 1 42  ? 74.377 27.152 54.535 0.00 31.28 ? 42  TYR A CZ  1 
ATOM   329  O OH  . TYR A 1 42  ? 75.617 27.697 54.254 0.00 30.73 ? 42  TYR A OH  1 
ATOM   330  N N   . SER A 1 43  ? 70.358 21.757 55.091 1.00 41.09 ? 43  SER A N   1 
ATOM   331  C CA  . SER A 1 43  ? 71.316 20.648 55.088 1.00 40.46 ? 43  SER A CA  1 
ATOM   332  C C   . SER A 1 43  ? 71.836 20.715 53.640 1.00 40.77 ? 43  SER A C   1 
ATOM   333  O O   . SER A 1 43  ? 73.037 20.865 53.428 1.00 39.96 ? 43  SER A O   1 
ATOM   334  C CB  . SER A 1 43  ? 70.627 19.298 55.434 1.00 41.64 ? 43  SER A CB  1 
ATOM   335  O OG  . SER A 1 43  ? 69.837 18.550 54.503 1.00 42.74 ? 43  SER A OG  1 
ATOM   336  N N   . PHE A 1 44  ? 70.886 20.691 52.677 1.00 39.95 ? 44  PHE A N   1 
ATOM   337  C CA  . PHE A 1 44  ? 71.045 21.091 51.285 1.00 37.82 ? 44  PHE A CA  1 
ATOM   338  C C   . PHE A 1 44  ? 69.643 21.251 50.670 1.00 38.07 ? 44  PHE A C   1 
ATOM   339  O O   . PHE A 1 44  ? 69.555 21.339 49.445 1.00 38.20 ? 44  PHE A O   1 
ATOM   340  C CB  . PHE A 1 44  ? 71.907 20.082 50.401 1.00 35.41 ? 44  PHE A CB  1 
ATOM   341  C CG  . PHE A 1 44  ? 71.750 18.556 50.465 1.00 34.24 ? 44  PHE A CG  1 
ATOM   342  C CD1 . PHE A 1 44  ? 70.606 17.895 50.893 1.00 33.52 ? 44  PHE A CD1 1 
ATOM   343  C CD2 . PHE A 1 44  ? 72.845 17.794 50.102 1.00 33.00 ? 44  PHE A CD2 1 
ATOM   344  C CE1 . PHE A 1 44  ? 70.596 16.504 50.950 1.00 32.47 ? 44  PHE A CE1 1 
ATOM   345  C CE2 . PHE A 1 44  ? 72.824 16.402 50.164 1.00 32.10 ? 44  PHE A CE2 1 
ATOM   346  C CZ  . PHE A 1 44  ? 71.697 15.749 50.591 1.00 31.91 ? 44  PHE A CZ  1 
ATOM   347  N N   . LEU A 1 45  ? 68.533 21.422 51.459 1.00 37.87 ? 45  LEU A N   1 
ATOM   348  C CA  . LEU A 1 45  ? 67.124 21.670 50.982 1.00 38.26 ? 45  LEU A CA  1 
ATOM   349  C C   . LEU A 1 45  ? 66.801 22.941 50.155 1.00 38.34 ? 45  LEU A C   1 
ATOM   350  O O   . LEU A 1 45  ? 65.828 22.962 49.410 1.00 38.11 ? 45  LEU A O   1 
ATOM   351  C CB  . LEU A 1 45  ? 66.011 21.822 52.064 1.00 37.21 ? 45  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 45  ? 65.557 20.981 53.245 1.00 35.96 ? 45  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 45  ? 64.187 21.520 53.673 1.00 35.26 ? 45  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 45  ? 65.428 19.524 52.900 1.00 35.47 ? 45  LEU A CD2 1 
ATOM   355  N N   . GLN A 1 46  ? 67.556 24.043 50.231 1.00 38.71 ? 46  GLN A N   1 
ATOM   356  C CA  . GLN A 1 46  ? 67.255 25.327 49.559 1.00 38.26 ? 46  GLN A CA  1 
ATOM   357  C C   . GLN A 1 46  ? 67.354 25.360 48.019 1.00 38.40 ? 46  GLN A C   1 
ATOM   358  O O   . GLN A 1 46  ? 66.315 25.556 47.364 1.00 39.83 ? 46  GLN A O   1 
ATOM   359  C CB  . GLN A 1 46  ? 68.162 26.442 50.043 1.00 38.68 ? 46  GLN A CB  1 
ATOM   360  C CG  . GLN A 1 46  ? 69.107 26.100 51.199 1.00 39.96 ? 46  GLN A CG  1 
ATOM   361  C CD  . GLN A 1 46  ? 70.484 26.694 51.022 1.00 40.69 ? 46  GLN A CD  1 
ATOM   362  O OE1 . GLN A 1 46  ? 71.465 26.026 50.685 1.00 40.00 ? 46  GLN A OE1 1 
ATOM   363  N NE2 . GLN A 1 46  ? 70.535 27.989 51.246 1.00 39.58 ? 46  GLN A NE2 1 
ATOM   364  N N   . ALA A 1 47  ? 68.539 25.211 47.368 1.00 36.84 ? 47  ALA A N   1 
ATOM   365  C CA  . ALA A 1 47  ? 68.654 25.199 45.889 1.00 35.14 ? 47  ALA A CA  1 
ATOM   366  C C   . ALA A 1 47  ? 67.815 24.133 45.194 1.00 33.31 ? 47  ALA A C   1 
ATOM   367  O O   . ALA A 1 47  ? 66.961 24.527 44.412 1.00 32.99 ? 47  ALA A O   1 
ATOM   368  C CB  . ALA A 1 47  ? 70.118 24.997 45.380 1.00 35.07 ? 47  ALA A CB  1 
ATOM   369  N N   . PRO A 1 48  ? 67.883 22.822 45.436 1.00 33.31 ? 48  PRO A N   1 
ATOM   370  C CA  . PRO A 1 48  ? 66.905 21.845 44.923 1.00 33.18 ? 48  PRO A CA  1 
ATOM   371  C C   . PRO A 1 48  ? 65.417 22.043 45.179 1.00 32.63 ? 48  PRO A C   1 
ATOM   372  O O   . PRO A 1 48  ? 64.605 21.226 44.721 1.00 31.33 ? 48  PRO A O   1 
ATOM   373  C CB  . PRO A 1 48  ? 67.409 20.529 45.482 1.00 34.29 ? 48  PRO A CB  1 
ATOM   374  C CG  . PRO A 1 48  ? 68.227 20.890 46.730 1.00 34.19 ? 48  PRO A CG  1 
ATOM   375  C CD  . PRO A 1 48  ? 68.922 22.148 46.238 1.00 33.83 ? 48  PRO A CD  1 
ATOM   376  N N   . GLN A 1 49  ? 65.041 23.072 45.957 1.00 33.13 ? 49  GLN A N   1 
ATOM   377  C CA  . GLN A 1 49  ? 63.646 23.439 46.198 1.00 33.93 ? 49  GLN A CA  1 
ATOM   378  C C   . GLN A 1 49  ? 63.471 24.904 45.860 1.00 33.75 ? 49  GLN A C   1 
ATOM   379  O O   . GLN A 1 49  ? 62.730 25.677 46.449 1.00 34.45 ? 49  GLN A O   1 
ATOM   380  C CB  . GLN A 1 49  ? 63.240 23.209 47.645 1.00 34.13 ? 49  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 49  ? 63.103 21.732 48.022 1.00 34.61 ? 49  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 49  ? 62.587 21.535 49.440 1.00 35.38 ? 49  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 49  ? 63.194 20.896 50.288 1.00 35.89 ? 49  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 49  ? 61.429 22.054 49.792 1.00 35.50 ? 49  GLN A NE2 1 
ATOM   385  N N   . ALA A 1 50  ? 64.208 25.238 44.827 1.00 34.64 ? 50  ALA A N   1 
ATOM   386  C CA  . ALA A 1 50  ? 64.281 26.510 44.168 1.00 35.97 ? 50  ALA A CA  1 
ATOM   387  C C   . ALA A 1 50  ? 63.207 27.593 44.074 1.00 36.37 ? 50  ALA A C   1 
ATOM   388  O O   . ALA A 1 50  ? 62.686 27.861 42.982 1.00 36.30 ? 50  ALA A O   1 
ATOM   389  C CB  . ALA A 1 50  ? 64.747 26.194 42.731 1.00 37.54 ? 50  ALA A CB  1 
ATOM   390  N N   . SER A 1 51  ? 63.003 28.338 45.171 1.00 37.34 ? 51  SER A N   1 
ATOM   391  C CA  . SER A 1 51  ? 62.121 29.519 45.312 1.00 38.34 ? 51  SER A CA  1 
ATOM   392  C C   . SER A 1 51  ? 60.579 29.456 45.117 1.00 38.46 ? 51  SER A C   1 
ATOM   393  O O   . SER A 1 51  ? 59.940 28.571 45.690 1.00 38.41 ? 51  SER A O   1 
ATOM   394  C CB  . SER A 1 51  ? 62.749 30.632 44.413 1.00 38.16 ? 51  SER A CB  1 
ATOM   395  O OG  . SER A 1 51  ? 62.345 31.992 44.609 1.00 37.05 ? 51  SER A OG  1 
ATOM   396  N N   . LEU A 1 52  ? 59.942 30.390 44.384 1.00 37.90 ? 52  LEU A N   1 
ATOM   397  C CA  . LEU A 1 52  ? 58.513 30.604 44.214 1.00 38.09 ? 52  LEU A CA  1 
ATOM   398  C C   . LEU A 1 52  ? 58.208 31.485 45.439 1.00 38.45 ? 52  LEU A C   1 
ATOM   399  O O   . LEU A 1 52  ? 59.066 32.324 45.771 1.00 39.36 ? 52  LEU A O   1 
ATOM   400  C CB  . LEU A 1 52  ? 57.566 29.335 44.272 1.00 39.05 ? 52  LEU A CB  1 
ATOM   401  C CG  . LEU A 1 52  ? 56.374 29.175 43.238 1.00 40.14 ? 52  LEU A CG  1 
ATOM   402  C CD1 . LEU A 1 52  ? 55.290 28.238 43.815 1.00 36.90 ? 52  LEU A CD1 1 
ATOM   403  C CD2 . LEU A 1 52  ? 55.972 30.589 42.751 1.00 39.36 ? 52  LEU A CD2 1 
ATOM   404  N N   . CYS A 1 53  ? 57.043 31.391 46.137 1.00 38.03 ? 53  CYS A N   1 
ATOM   405  C CA  . CYS A 1 53  ? 56.590 32.346 47.157 1.00 37.24 ? 53  CYS A CA  1 
ATOM   406  C C   . CYS A 1 53  ? 56.342 33.691 46.390 1.00 35.64 ? 53  CYS A C   1 
ATOM   407  O O   . CYS A 1 53  ? 56.382 33.649 45.146 1.00 35.05 ? 53  CYS A O   1 
ATOM   408  C CB  . CYS A 1 53  ? 57.678 32.448 48.352 1.00 38.16 ? 53  CYS A CB  1 
ATOM   409  S SG  . CYS A 1 53  ? 57.991 31.083 49.567 1.00 38.76 ? 53  CYS A SG  1 
ATOM   410  N N   . PHE A 1 54  ? 55.996 34.905 46.855 1.00 34.31 ? 54  PHE A N   1 
ATOM   411  C CA  . PHE A 1 54  ? 55.884 35.982 45.883 1.00 33.03 ? 54  PHE A CA  1 
ATOM   412  C C   . PHE A 1 54  ? 57.004 36.939 46.070 1.00 31.74 ? 54  PHE A C   1 
ATOM   413  O O   . PHE A 1 54  ? 56.870 38.153 46.110 1.00 30.24 ? 54  PHE A O   1 
ATOM   414  C CB  . PHE A 1 54  ? 54.603 36.730 45.985 1.00 35.64 ? 54  PHE A CB  1 
ATOM   415  C CG  . PHE A 1 54  ? 53.665 36.458 44.801 1.00 37.52 ? 54  PHE A CG  1 
ATOM   416  C CD1 . PHE A 1 54  ? 53.086 35.203 44.614 1.00 37.73 ? 54  PHE A CD1 1 
ATOM   417  C CD2 . PHE A 1 54  ? 53.378 37.482 43.869 1.00 38.40 ? 54  PHE A CD2 1 
ATOM   418  C CE1 . PHE A 1 54  ? 52.232 35.019 43.532 1.00 37.36 ? 54  PHE A CE1 1 
ATOM   419  C CE2 . PHE A 1 54  ? 52.509 37.262 42.787 1.00 35.53 ? 54  PHE A CE2 1 
ATOM   420  C CZ  . PHE A 1 54  ? 51.935 36.021 42.620 1.00 35.98 ? 54  PHE A CZ  1 
ATOM   421  N N   . SER A 1 55  ? 58.130 36.237 46.021 1.00 30.66 ? 55  SER A N   1 
ATOM   422  C CA  . SER A 1 55  ? 59.466 36.791 46.109 1.00 30.04 ? 55  SER A CA  1 
ATOM   423  C C   . SER A 1 55  ? 59.911 37.565 44.829 1.00 30.82 ? 55  SER A C   1 
ATOM   424  O O   . SER A 1 55  ? 60.824 38.415 44.849 1.00 30.04 ? 55  SER A O   1 
ATOM   425  C CB  . SER A 1 55  ? 60.349 35.596 46.417 1.00 28.29 ? 55  SER A CB  1 
ATOM   426  O OG  . SER A 1 55  ? 59.604 34.683 47.222 1.00 25.80 ? 55  SER A OG  1 
ATOM   427  N N   . GLU A 1 56  ? 59.194 37.240 43.718 1.00 31.31 ? 56  GLU A N   1 
ATOM   428  C CA  . GLU A 1 56  ? 59.311 37.807 42.394 1.00 29.98 ? 56  GLU A CA  1 
ATOM   429  C C   . GLU A 1 56  ? 58.107 38.733 42.159 1.00 32.18 ? 56  GLU A C   1 
ATOM   430  O O   . GLU A 1 56  ? 57.042 38.254 41.761 1.00 32.15 ? 56  GLU A O   1 
ATOM   431  C CB  . GLU A 1 56  ? 59.323 36.685 41.321 1.00 26.36 ? 56  GLU A CB  1 
ATOM   432  C CG  . GLU A 1 56  ? 59.438 35.197 41.726 1.00 22.41 ? 56  GLU A CG  1 
ATOM   433  C CD  . GLU A 1 56  ? 58.112 34.453 41.898 1.00 20.85 ? 56  GLU A CD  1 
ATOM   434  O OE1 . GLU A 1 56  ? 57.059 35.091 41.982 1.00 21.21 ? 56  GLU A OE1 1 
ATOM   435  O OE2 . GLU A 1 56  ? 58.131 33.221 41.938 1.00 18.97 ? 56  GLU A OE2 1 
ATOM   436  N N   . SER A 1 57  ? 58.237 40.032 42.465 1.00 34.40 ? 57  SER A N   1 
ATOM   437  C CA  . SER A 1 57  ? 57.215 41.063 42.230 1.00 37.58 ? 57  SER A CA  1 
ATOM   438  C C   . SER A 1 57  ? 57.981 42.435 42.087 1.00 38.53 ? 57  SER A C   1 
ATOM   439  O O   . SER A 1 57  ? 58.283 42.919 40.991 1.00 38.50 ? 57  SER A O   1 
ATOM   440  C CB  . SER A 1 57  ? 56.205 40.958 43.445 1.00 38.37 ? 57  SER A CB  1 
ATOM   441  O OG  . SER A 1 57  ? 56.685 41.301 44.762 1.00 39.69 ? 57  SER A OG  1 
ATOM   442  N N   . ILE A 1 58  ? 58.320 43.141 43.157 1.00 39.47 ? 58  ILE A N   1 
ATOM   443  C CA  . ILE A 1 58  ? 59.343 44.183 43.181 1.00 41.86 ? 58  ILE A CA  1 
ATOM   444  C C   . ILE A 1 58  ? 59.940 43.438 44.358 1.00 44.10 ? 58  ILE A C   1 
ATOM   445  O O   . ILE A 1 58  ? 59.279 43.492 45.417 1.00 45.20 ? 58  ILE A O   1 
ATOM   446  C CB  . ILE A 1 58  ? 59.122 45.527 43.878 1.00 41.99 ? 58  ILE A CB  1 
ATOM   447  C CG1 . ILE A 1 58  ? 57.664 45.776 44.192 1.00 42.04 ? 58  ILE A CG1 1 
ATOM   448  C CG2 . ILE A 1 58  ? 59.865 46.547 43.038 1.00 43.43 ? 58  ILE A CG2 1 
ATOM   449  C CD1 . ILE A 1 58  ? 57.573 46.756 45.351 1.00 41.44 ? 58  ILE A CD1 1 
ATOM   450  N N   . PRO A 1 59  ? 61.018 42.621 44.277 1.00 45.45 ? 59  PRO A N   1 
ATOM   451  C CA  . PRO A 1 59  ? 61.366 41.645 45.343 1.00 45.17 ? 59  PRO A CA  1 
ATOM   452  C C   . PRO A 1 59  ? 61.504 42.324 46.713 1.00 45.28 ? 59  PRO A C   1 
ATOM   453  O O   . PRO A 1 59  ? 62.244 43.289 46.857 1.00 44.02 ? 59  PRO A O   1 
ATOM   454  C CB  . PRO A 1 59  ? 62.639 40.997 44.848 1.00 44.99 ? 59  PRO A CB  1 
ATOM   455  C CG  . PRO A 1 59  ? 62.488 41.082 43.344 1.00 45.03 ? 59  PRO A CG  1 
ATOM   456  C CD  . PRO A 1 59  ? 61.939 42.511 43.140 1.00 45.11 ? 59  PRO A CD  1 
ATOM   457  N N   . THR A 1 60  ? 60.639 41.912 47.643 1.00 46.50 ? 60  THR A N   1 
ATOM   458  C CA  . THR A 1 60  ? 60.451 42.504 48.968 1.00 48.65 ? 60  THR A CA  1 
ATOM   459  C C   . THR A 1 60  ? 61.164 43.759 49.440 1.00 50.53 ? 60  THR A C   1 
ATOM   460  O O   . THR A 1 60  ? 62.360 43.839 49.712 1.00 51.20 ? 60  THR A O   1 
ATOM   461  C CB  . THR A 1 60  ? 60.651 41.355 49.978 1.00 48.09 ? 60  THR A CB  1 
ATOM   462  O OG1 . THR A 1 60  ? 59.290 41.009 50.108 1.00 48.44 ? 60  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 60  ? 61.248 41.572 51.369 1.00 47.16 ? 60  THR A CG2 1 
ATOM   464  N N   . PRO A 1 61  ? 60.335 44.792 49.424 1.00 52.17 ? 61  PRO A N   1 
ATOM   465  C CA  . PRO A 1 61  ? 60.473 45.959 50.298 1.00 53.18 ? 61  PRO A CA  1 
ATOM   466  C C   . PRO A 1 61  ? 60.161 45.782 51.749 0.00 38.41 ? 61  PRO A C   1 
ATOM   467  O O   . PRO A 1 61  ? 59.071 46.168 52.198 0.00 38.01 ? 61  PRO A O   1 
ATOM   468  C CB  . PRO A 1 61  ? 59.592 47.049 49.712 1.00 53.62 ? 61  PRO A CB  1 
ATOM   469  C CG  . PRO A 1 61  ? 58.981 46.524 48.431 1.00 53.91 ? 61  PRO A CG  1 
ATOM   470  C CD  . PRO A 1 61  ? 59.739 45.200 48.147 1.00 53.23 ? 61  PRO A CD  1 
ATOM   471  N N   . SER A 1 62  ? 61.159 44.290 52.507 0.00 38.63 ? 62  SER A N   1 
ATOM   472  C CA  . SER A 1 62  ? 60.825 44.999 53.735 1.00 55.29 ? 62  SER A CA  1 
ATOM   473  C C   . SER A 1 62  ? 62.013 44.983 54.692 1.00 55.65 ? 62  SER A C   1 
ATOM   474  O O   . SER A 1 62  ? 62.443 43.920 55.164 1.00 56.67 ? 62  SER A O   1 
ATOM   475  C CB  . SER A 1 62  ? 59.759 44.135 54.423 0.00 38.18 ? 62  SER A CB  1 
ATOM   476  O OG  . SER A 1 62  ? 58.614 44.881 54.741 0.00 37.32 ? 62  SER A OG  1 
ATOM   477  N N   . ASN A 1 63  ? 62.470 46.140 54.909 1.00 55.10 ? 63  ASN A N   1 
ATOM   478  C CA  . ASN A 1 63  ? 63.493 46.594 55.855 1.00 53.38 ? 63  ASN A CA  1 
ATOM   479  C C   . ASN A 1 63  ? 63.033 47.960 55.988 1.00 51.78 ? 63  ASN A C   1 
ATOM   480  O O   . ASN A 1 63  ? 62.393 48.492 55.075 1.00 52.51 ? 63  ASN A O   1 
ATOM   481  C CB  . ASN A 1 63  ? 64.928 46.423 55.438 1.00 53.47 ? 63  ASN A CB  1 
ATOM   482  C CG  . ASN A 1 63  ? 65.803 46.596 56.688 1.00 53.99 ? 63  ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 63  ? 66.714 47.417 56.701 1.00 53.50 ? 63  ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 63  ? 65.548 45.879 57.773 1.00 53.95 ? 63  ASN A ND2 1 
ATOM   485  N N   . ARG A 1 64  ? 63.294 48.783 56.927 1.00 50.71 ? 64  ARG A N   1 
ATOM   486  C CA  . ARG A 1 64  ? 62.314 49.796 56.942 1.00 48.75 ? 64  ARG A CA  1 
ATOM   487  C C   . ARG A 1 64  ? 62.710 50.913 56.088 1.00 47.15 ? 64  ARG A C   1 
ATOM   488  O O   . ARG A 1 64  ? 63.633 51.667 56.388 1.00 47.56 ? 64  ARG A O   1 
ATOM   489  C CB  . ARG A 1 64  ? 62.497 50.526 58.285 1.00 49.10 ? 64  ARG A CB  1 
ATOM   490  C CG  . ARG A 1 64  ? 61.488 50.231 59.355 1.00 49.42 ? 64  ARG A CG  1 
ATOM   491  C CD  . ARG A 1 64  ? 62.101 49.575 60.585 1.00 48.47 ? 64  ARG A CD  1 
ATOM   492  N NE  . ARG A 1 64  ? 61.258 48.491 61.034 1.00 47.80 ? 64  ARG A NE  1 
ATOM   493  C CZ  . ARG A 1 64  ? 61.154 47.339 60.386 1.00 46.34 ? 64  ARG A CZ  1 
ATOM   494  N NH1 . ARG A 1 64  ? 61.877 47.090 59.286 1.00 45.82 ? 64  ARG A NH1 1 
ATOM   495  N NH2 . ARG A 1 64  ? 60.327 46.355 60.760 1.00 45.66 ? 64  ARG A NH2 1 
ATOM   496  N N   . GLU A 1 65  ? 61.855 50.759 55.108 1.00 44.52 ? 65  GLU A N   1 
ATOM   497  C CA  . GLU A 1 65  ? 61.684 51.519 53.928 1.00 42.69 ? 65  GLU A CA  1 
ATOM   498  C C   . GLU A 1 65  ? 60.226 51.310 53.496 1.00 42.24 ? 65  GLU A C   1 
ATOM   499  O O   . GLU A 1 65  ? 59.681 50.199 53.591 1.00 42.22 ? 65  GLU A O   1 
ATOM   500  C CB  . GLU A 1 65  ? 62.739 51.073 52.915 1.00 41.12 ? 65  GLU A CB  1 
ATOM   501  C CG  . GLU A 1 65  ? 62.329 51.271 51.466 1.00 36.78 ? 65  GLU A CG  1 
ATOM   502  C CD  . GLU A 1 65  ? 61.871 49.970 50.827 1.00 35.35 ? 65  GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 65  ? 62.727 49.039 50.582 1.00 33.99 ? 65  GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 65  ? 60.628 49.805 50.547 1.00 33.05 ? 65  GLU A OE2 1 
ATOM   505  N N   . GLN A 1 66  ? 59.688 52.376 53.085 1.00 42.14 ? 66  GLN A N   1 
ATOM   506  C CA  . GLN A 1 66  ? 58.367 52.532 52.533 1.00 41.41 ? 66  GLN A CA  1 
ATOM   507  C C   . GLN A 1 66  ? 58.465 52.155 51.060 1.00 43.20 ? 66  GLN A C   1 
ATOM   508  O O   . GLN A 1 66  ? 59.514 52.390 50.427 1.00 43.05 ? 66  GLN A O   1 
ATOM   509  C CB  . GLN A 1 66  ? 57.993 54.016 52.668 1.00 37.67 ? 66  GLN A CB  1 
ATOM   510  C CG  . GLN A 1 66  ? 56.536 54.279 53.035 1.00 35.38 ? 66  GLN A CG  1 
ATOM   511  C CD  . GLN A 1 66  ? 56.202 55.778 53.062 1.00 34.98 ? 66  GLN A CD  1 
ATOM   512  O OE1 . GLN A 1 66  ? 57.053 56.609 52.740 1.00 34.88 ? 66  GLN A OE1 1 
ATOM   513  N NE2 . GLN A 1 66  ? 55.002 56.183 53.430 1.00 34.62 ? 66  GLN A NE2 1 
ATOM   514  N N   . ALA A 1 67  ? 58.048 51.215 50.413 1.00 44.89 ? 67  ALA A N   1 
ATOM   515  C CA  . ALA A 1 67  ? 58.213 50.705 49.044 1.00 45.39 ? 67  ALA A CA  1 
ATOM   516  C C   . ALA A 1 67  ? 58.319 51.843 48.050 1.00 45.46 ? 67  ALA A C   1 
ATOM   517  O O   . ALA A 1 67  ? 57.554 52.814 48.096 1.00 44.46 ? 67  ALA A O   1 
ATOM   518  C CB  . ALA A 1 67  ? 57.026 49.832 48.636 1.00 45.58 ? 67  ALA A CB  1 
ATOM   519  N N   . GLN A 1 68  ? 59.212 51.700 47.142 1.00 46.13 ? 68  GLN A N   1 
ATOM   520  C CA  . GLN A 1 68  ? 60.001 52.829 46.612 1.00 47.80 ? 68  GLN A CA  1 
ATOM   521  C C   . GLN A 1 68  ? 59.241 53.187 45.453 1.00 48.96 ? 68  GLN A C   1 
ATOM   522  O O   . GLN A 1 68  ? 58.616 52.356 44.815 1.00 49.70 ? 68  GLN A O   1 
ATOM   523  C CB  . GLN A 1 68  ? 61.445 52.351 46.353 0.00 37.67 ? 68  GLN A CB  1 
ATOM   524  C CG  . GLN A 1 68  ? 61.537 51.093 45.473 0.00 36.17 ? 68  GLN A CG  1 
ATOM   525  C CD  . GLN A 1 68  ? 61.282 49.769 46.217 0.00 35.36 ? 68  GLN A CD  1 
ATOM   526  O OE1 . GLN A 1 68  ? 61.000 49.766 47.414 0.00 35.06 ? 68  GLN A OE1 1 
ATOM   527  N NE2 . GLN A 1 68  ? 61.361 48.620 45.566 0.00 35.07 ? 68  GLN A NE2 1 
ATOM   528  N N   . GLN A 1 69  ? 59.296 54.394 45.010 1.00 49.64 ? 69  GLN A N   1 
ATOM   529  C CA  . GLN A 1 69  ? 58.061 55.027 44.672 1.00 49.49 ? 69  GLN A CA  1 
ATOM   530  C C   . GLN A 1 69  ? 57.674 54.722 43.260 1.00 48.24 ? 69  GLN A C   1 
ATOM   531  O O   . GLN A 1 69  ? 58.402 55.017 42.318 1.00 46.75 ? 69  GLN A O   1 
ATOM   532  C CB  . GLN A 1 69  ? 58.465 56.519 44.883 1.00 51.26 ? 69  GLN A CB  1 
ATOM   533  C CG  . GLN A 1 69  ? 57.396 57.581 44.731 1.00 53.90 ? 69  GLN A CG  1 
ATOM   534  C CD  . GLN A 1 69  ? 57.811 58.704 43.766 1.00 55.77 ? 69  GLN A CD  1 
ATOM   535  O OE1 . GLN A 1 69  ? 57.149 59.738 43.716 1.00 56.53 ? 69  GLN A OE1 1 
ATOM   536  N NE2 . GLN A 1 69  ? 58.847 58.541 42.964 1.00 55.68 ? 69  GLN A NE2 1 
ATOM   537  N N   . LYS A 1 70  ? 56.515 54.213 43.586 1.00 47.24 ? 70  LYS A N   1 
ATOM   538  C CA  . LYS A 1 70  ? 55.515 53.319 43.036 1.00 46.50 ? 70  LYS A CA  1 
ATOM   539  C C   . LYS A 1 70  ? 54.208 54.035 43.197 1.00 45.83 ? 70  LYS A C   1 
ATOM   540  O O   . LYS A 1 70  ? 54.189 55.220 43.416 1.00 46.14 ? 70  LYS A O   1 
ATOM   541  C CB  . LYS A 1 70  ? 55.456 51.953 43.732 1.00 46.79 ? 70  LYS A CB  1 
ATOM   542  C CG  . LYS A 1 70  ? 56.787 51.215 43.796 1.00 47.15 ? 70  LYS A CG  1 
ATOM   543  C CD  . LYS A 1 70  ? 56.667 49.723 43.465 1.00 47.59 ? 70  LYS A CD  1 
ATOM   544  C CE  . LYS A 1 70  ? 57.615 49.291 42.346 1.00 47.88 ? 70  LYS A CE  1 
ATOM   545  N NZ  . LYS A 1 70  ? 59.015 49.645 42.617 1.00 47.92 ? 70  LYS A NZ  1 
ATOM   546  N N   . SER A 1 71  ? 53.242 53.382 42.817 1.00 44.60 ? 71  SER A N   1 
ATOM   547  C CA  . SER A 1 71  ? 51.857 53.853 42.601 1.00 42.91 ? 71  SER A CA  1 
ATOM   548  C C   . SER A 1 71  ? 50.965 53.281 43.703 1.00 41.28 ? 71  SER A C   1 
ATOM   549  O O   . SER A 1 71  ? 50.999 52.070 43.980 1.00 41.10 ? 71  SER A O   1 
ATOM   550  C CB  . SER A 1 71  ? 51.286 53.381 41.264 1.00 43.23 ? 71  SER A CB  1 
ATOM   551  O OG  . SER A 1 71  ? 49.876 53.604 41.245 1.00 43.48 ? 71  SER A OG  1 
ATOM   552  N N   . ASN A 1 72  ? 50.321 54.057 44.460 1.00 38.88 ? 72  ASN A N   1 
ATOM   553  C CA  . ASN A 1 72  ? 49.532 53.584 45.554 1.00 37.34 ? 72  ASN A CA  1 
ATOM   554  C C   . ASN A 1 72  ? 48.641 52.455 45.141 1.00 35.71 ? 72  ASN A C   1 
ATOM   555  O O   . ASN A 1 72  ? 48.407 51.548 45.934 1.00 35.56 ? 72  ASN A O   1 
ATOM   556  C CB  . ASN A 1 72  ? 48.733 54.725 46.092 1.00 40.62 ? 72  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 72  ? 49.547 55.569 47.084 1.00 42.88 ? 72  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 72  ? 50.461 55.100 47.769 1.00 43.39 ? 72  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 72  ? 49.316 56.875 47.198 1.00 43.78 ? 72  ASN A ND2 1 
ATOM   560  N N   . LEU A 1 73  ? 48.318 52.419 43.839 1.00 33.59 ? 73  LEU A N   1 
ATOM   561  C CA  . LEU A 1 73  ? 47.441 51.403 43.274 1.00 31.75 ? 73  LEU A CA  1 
ATOM   562  C C   . LEU A 1 73  ? 48.042 50.065 42.800 1.00 30.08 ? 73  LEU A C   1 
ATOM   563  O O   . LEU A 1 73  ? 47.286 49.093 42.626 1.00 29.88 ? 73  LEU A O   1 
ATOM   564  C CB  . LEU A 1 73  ? 46.657 52.081 42.142 1.00 30.82 ? 73  LEU A CB  1 
ATOM   565  C CG  . LEU A 1 73  ? 45.547 51.237 41.542 1.00 29.89 ? 73  LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 73  ? 44.596 50.720 42.622 1.00 27.65 ? 73  LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 73  ? 44.824 52.095 40.527 0.00 29.16 ? 73  LEU A CD2 1 
ATOM   568  N N   . GLN A 1 74  ? 49.363 49.895 42.655 1.00 28.48 ? 74  GLN A N   1 
ATOM   569  C CA  . GLN A 1 74  ? 49.874 48.556 42.332 1.00 27.26 ? 74  GLN A CA  1 
ATOM   570  C C   . GLN A 1 74  ? 50.225 47.747 43.566 1.00 26.32 ? 74  GLN A C   1 
ATOM   571  O O   . GLN A 1 74  ? 50.158 46.537 43.515 1.00 25.19 ? 74  GLN A O   1 
ATOM   572  C CB  . GLN A 1 74  ? 51.125 48.544 41.473 1.00 28.04 ? 74  GLN A CB  1 
ATOM   573  C CG  . GLN A 1 74  ? 50.784 48.347 40.007 1.00 26.48 ? 74  GLN A CG  1 
ATOM   574  C CD  . GLN A 1 74  ? 50.261 49.672 39.613 1.00 25.70 ? 74  GLN A CD  1 
ATOM   575  O OE1 . GLN A 1 74  ? 49.115 50.042 39.846 1.00 24.06 ? 74  GLN A OE1 1 
ATOM   576  N NE2 . GLN A 1 74  ? 51.246 50.423 39.152 1.00 25.74 ? 74  GLN A NE2 1 
ATOM   577  N N   . LEU A 1 75  ? 50.583 48.323 44.718 1.00 25.82 ? 75  LEU A N   1 
ATOM   578  C CA  . LEU A 1 75  ? 50.797 47.513 45.922 1.00 24.92 ? 75  LEU A CA  1 
ATOM   579  C C   . LEU A 1 75  ? 49.409 46.929 46.265 1.00 23.96 ? 75  LEU A C   1 
ATOM   580  O O   . LEU A 1 75  ? 49.345 45.816 46.735 1.00 22.60 ? 75  LEU A O   1 
ATOM   581  C CB  . LEU A 1 75  ? 51.339 48.398 47.042 1.00 26.12 ? 75  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 75  ? 52.733 49.072 47.078 1.00 26.30 ? 75  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 75  ? 53.113 50.001 45.894 1.00 23.94 ? 75  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 75  ? 52.636 49.892 48.376 1.00 27.41 ? 75  LEU A CD2 1 
ATOM   585  N N   . LEU A 1 76  ? 48.251 47.580 46.015 1.00 23.30 ? 76  LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 46.969 46.934 46.152 1.00 24.40 ? 76  LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 46.866 46.046 44.899 1.00 26.49 ? 76  LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 46.881 44.872 45.275 1.00 27.74 ? 76  LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 45.790 47.962 46.233 1.00 22.85 ? 76  LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 45.701 48.995 47.422 1.00 21.96 ? 76  LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 44.880 50.231 47.082 1.00 19.60 ? 76  LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 44.846 48.452 48.538 1.00 22.08 ? 76  LEU A CD2 1 
ATOM   593  N N   . ARG A 1 77  ? 46.851 46.279 43.523 1.00 27.97 ? 77  ARG A N   1 
ATOM   594  C CA  . ARG A 1 77  ? 46.669 45.173 42.543 1.00 26.39 ? 77  ARG A CA  1 
ATOM   595  C C   . ARG A 1 77  ? 47.754 44.127 42.770 1.00 26.32 ? 77  ARG A C   1 
ATOM   596  O O   . ARG A 1 77  ? 47.348 42.994 43.053 1.00 24.28 ? 77  ARG A O   1 
ATOM   597  C CB  . ARG A 1 77  ? 46.756 45.552 41.011 1.00 33.53 ? 77  ARG A CB  1 
ATOM   598  C CG  . ARG A 1 77  ? 46.839 44.291 40.041 1.00 36.01 ? 77  ARG A CG  1 
ATOM   599  C CD  . ARG A 1 77  ? 46.164 44.129 38.598 1.00 39.34 ? 77  ARG A CD  1 
ATOM   600  N NE  . ARG A 1 77  ? 44.704 43.818 38.558 1.00 37.84 ? 77  ARG A NE  1 
ATOM   601  C CZ  . ARG A 1 77  ? 43.862 43.982 37.502 1.00 36.33 ? 77  ARG A CZ  1 
ATOM   602  N NH1 . ARG A 1 77  ? 44.261 44.426 36.333 1.00 36.91 ? 77  ARG A NH1 1 
ATOM   603  N NH2 . ARG A 1 77  ? 42.567 43.675 37.599 1.00 35.76 ? 77  ARG A NH2 1 
ATOM   604  N N   . ILE A 1 78  ? 49.076 44.434 42.704 1.00 27.55 ? 78  ILE A N   1 
ATOM   605  C CA  . ILE A 1 78  ? 50.196 43.472 42.922 1.00 26.53 ? 78  ILE A CA  1 
ATOM   606  C C   . ILE A 1 78  ? 50.044 42.729 44.252 1.00 26.37 ? 78  ILE A C   1 
ATOM   607  O O   . ILE A 1 78  ? 50.558 41.610 44.401 1.00 25.43 ? 78  ILE A O   1 
ATOM   608  C CB  . ILE A 1 78  ? 51.664 44.181 42.838 1.00 24.94 ? 78  ILE A CB  1 
ATOM   609  C CG1 . ILE A 1 78  ? 51.935 44.868 41.498 1.00 23.50 ? 78  ILE A CG1 1 
ATOM   610  C CG2 . ILE A 1 78  ? 52.760 43.116 42.850 1.00 24.66 ? 78  ILE A CG2 1 
ATOM   611  C CD1 . ILE A 1 78  ? 53.318 45.529 41.356 0.00 30.34 ? 78  ILE A CD1 1 
ATOM   612  N N   . SER A 1 79  ? 49.258 43.297 45.187 1.00 26.29 ? 79  SER A N   1 
ATOM   613  C CA  . SER A 1 79  ? 48.907 42.527 46.368 1.00 26.63 ? 79  SER A CA  1 
ATOM   614  C C   . SER A 1 79  ? 47.884 41.505 45.895 1.00 26.98 ? 79  SER A C   1 
ATOM   615  O O   . SER A 1 79  ? 48.353 40.416 45.511 1.00 28.02 ? 79  SER A O   1 
ATOM   616  C CB  . SER A 1 79  ? 48.254 43.323 47.521 1.00 25.07 ? 79  SER A CB  1 
ATOM   617  O OG  . SER A 1 79  ? 49.135 43.499 48.621 0.00 26.74 ? 79  SER A OG  1 
ATOM   618  N N   . LEU A 1 80  ? 46.570 41.861 45.768 1.00 26.53 ? 80  LEU A N   1 
ATOM   619  C CA  . LEU A 1 80  ? 45.453 40.932 45.617 1.00 26.02 ? 80  LEU A CA  1 
ATOM   620  C C   . LEU A 1 80  ? 45.729 39.628 44.877 1.00 27.67 ? 80  LEU A C   1 
ATOM   621  O O   . LEU A 1 80  ? 45.060 38.667 45.237 1.00 29.42 ? 80  LEU A O   1 
ATOM   622  C CB  . LEU A 1 80  ? 44.252 41.682 44.988 1.00 22.94 ? 80  LEU A CB  1 
ATOM   623  C CG  . LEU A 1 80  ? 42.871 40.975 45.036 1.00 21.44 ? 80  LEU A CG  1 
ATOM   624  C CD1 . LEU A 1 80  ? 42.244 41.185 46.372 1.00 19.59 ? 80  LEU A CD1 1 
ATOM   625  C CD2 . LEU A 1 80  ? 41.786 41.667 44.211 1.00 21.48 ? 80  LEU A CD2 1 
ATOM   626  N N   . LEU A 1 81  ? 46.707 39.465 43.968 1.00 28.78 ? 81  LEU A N   1 
ATOM   627  C CA  . LEU A 1 81  ? 47.105 38.173 43.406 1.00 28.50 ? 81  LEU A CA  1 
ATOM   628  C C   . LEU A 1 81  ? 47.696 37.297 44.507 1.00 28.94 ? 81  LEU A C   1 
ATOM   629  O O   . LEU A 1 81  ? 47.319 36.120 44.607 1.00 27.88 ? 81  LEU A O   1 
ATOM   630  C CB  . LEU A 1 81  ? 48.178 38.299 42.336 1.00 29.33 ? 81  LEU A CB  1 
ATOM   631  C CG  . LEU A 1 81  ? 47.955 39.022 41.013 1.00 29.85 ? 81  LEU A CG  1 
ATOM   632  C CD1 . LEU A 1 81  ? 46.561 38.728 40.458 1.00 30.43 ? 81  LEU A CD1 1 
ATOM   633  C CD2 . LEU A 1 81  ? 48.114 40.511 41.236 1.00 30.88 ? 81  LEU A CD2 1 
ATOM   634  N N   . LEU A 1 82  ? 48.598 37.829 45.350 1.00 29.22 ? 82  LEU A N   1 
ATOM   635  C CA  . LEU A 1 82  ? 49.174 37.100 46.488 1.00 30.81 ? 82  LEU A CA  1 
ATOM   636  C C   . LEU A 1 82  ? 48.163 36.528 47.479 1.00 31.67 ? 82  LEU A C   1 
ATOM   637  O O   . LEU A 1 82  ? 48.478 35.610 48.234 1.00 30.54 ? 82  LEU A O   1 
ATOM   638  C CB  . LEU A 1 82  ? 50.080 37.960 47.350 1.00 29.33 ? 82  LEU A CB  1 
ATOM   639  C CG  . LEU A 1 82  ? 51.436 38.450 46.918 1.00 28.19 ? 82  LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 82  ? 51.520 39.966 46.823 1.00 26.38 ? 82  LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 82  ? 52.398 38.059 48.005 1.00 25.26 ? 82  LEU A CD2 1 
ATOM   642  N N   . ILE A 1 83  ? 46.939 37.065 47.517 1.00 33.50 ? 83  ILE A N   1 
ATOM   643  C CA  . ILE A 1 83  ? 45.946 36.536 48.430 1.00 35.27 ? 83  ILE A CA  1 
ATOM   644  C C   . ILE A 1 83  ? 44.995 35.610 47.697 1.00 36.46 ? 83  ILE A C   1 
ATOM   645  O O   . ILE A 1 83  ? 44.768 34.492 48.143 1.00 38.36 ? 83  ILE A O   1 
ATOM   646  C CB  . ILE A 1 83  ? 45.186 37.696 49.102 1.00 35.08 ? 83  ILE A CB  1 
ATOM   647  C CG1 . ILE A 1 83  ? 44.686 37.144 50.412 1.00 35.28 ? 83  ILE A CG1 1 
ATOM   648  C CG2 . ILE A 1 83  ? 43.981 38.202 48.337 1.00 34.78 ? 83  ILE A CG2 1 
ATOM   649  C CD1 . ILE A 1 83  ? 45.551 37.667 51.557 0.00 33.01 ? 83  ILE A CD1 1 
ATOM   650  N N   . GLN A 1 84  ? 44.496 36.048 46.549 1.00 37.56 ? 84  GLN A N   1 
ATOM   651  C CA  . GLN A 1 84  ? 43.647 35.308 45.661 1.00 39.33 ? 84  GLN A CA  1 
ATOM   652  C C   . GLN A 1 84  ? 44.292 34.000 45.226 1.00 40.45 ? 84  GLN A C   1 
ATOM   653  O O   . GLN A 1 84  ? 43.569 33.025 44.981 1.00 41.91 ? 84  GLN A O   1 
ATOM   654  C CB  . GLN A 1 84  ? 43.345 36.197 44.486 1.00 39.25 ? 84  GLN A CB  1 
ATOM   655  C CG  . GLN A 1 84  ? 42.323 37.279 44.760 1.00 40.81 ? 84  GLN A CG  1 
ATOM   656  C CD  . GLN A 1 84  ? 41.040 36.868 44.077 1.00 42.12 ? 84  GLN A CD  1 
ATOM   657  O OE1 . GLN A 1 84  ? 40.108 36.455 44.753 1.00 44.48 ? 84  GLN A OE1 1 
ATOM   658  N NE2 . GLN A 1 84  ? 40.917 36.863 42.754 1.00 41.67 ? 84  GLN A NE2 1 
ATOM   659  N N   . SER A 1 85  ? 45.630 33.945 45.139 1.00 41.14 ? 85  SER A N   1 
ATOM   660  C CA  . SER A 1 85  ? 46.343 32.695 44.872 1.00 41.86 ? 85  SER A CA  1 
ATOM   661  C C   . SER A 1 85  ? 46.078 31.731 46.047 1.00 42.14 ? 85  SER A C   1 
ATOM   662  O O   . SER A 1 85  ? 45.582 30.641 45.761 1.00 42.97 ? 85  SER A O   1 
ATOM   663  C CB  . SER A 1 85  ? 47.864 32.997 44.707 1.00 42.25 ? 85  SER A CB  1 
ATOM   664  O OG  . SER A 1 85  ? 48.778 31.898 44.625 1.00 41.17 ? 85  SER A OG  1 
ATOM   665  N N   . TRP A 1 86  ? 46.296 32.028 47.355 1.00 42.05 ? 86  TRP A N   1 
ATOM   666  C CA  . TRP A 1 86  ? 46.006 31.107 48.454 1.00 41.25 ? 86  TRP A CA  1 
ATOM   667  C C   . TRP A 1 86  ? 44.554 30.752 48.518 1.00 41.11 ? 86  TRP A C   1 
ATOM   668  O O   . TRP A 1 86  ? 44.212 29.676 49.002 1.00 41.20 ? 86  TRP A O   1 
ATOM   669  C CB  . TRP A 1 86  ? 46.325 31.673 49.813 1.00 43.28 ? 86  TRP A CB  1 
ATOM   670  C CG  . TRP A 1 86  ? 47.800 31.659 50.148 1.00 45.80 ? 86  TRP A CG  1 
ATOM   671  C CD1 . TRP A 1 86  ? 48.460 32.835 50.334 1.00 46.23 ? 86  TRP A CD1 1 
ATOM   672  C CD2 . TRP A 1 86  ? 48.603 30.552 50.308 1.00 46.36 ? 86  TRP A CD2 1 
ATOM   673  N NE1 . TRP A 1 86  ? 49.682 32.475 50.610 1.00 48.36 ? 86  TRP A NE1 1 
ATOM   674  C CE2 . TRP A 1 86  ? 49.814 31.143 50.585 1.00 47.06 ? 86  TRP A CE2 1 
ATOM   675  C CE3 . TRP A 1 86  ? 48.505 29.180 50.231 1.00 46.36 ? 86  TRP A CE3 1 
ATOM   676  C CZ2 . TRP A 1 86  ? 50.925 30.389 50.827 1.00 47.07 ? 86  TRP A CZ2 1 
ATOM   677  C CZ3 . TRP A 1 86  ? 49.627 28.417 50.459 1.00 46.16 ? 86  TRP A CZ3 1 
ATOM   678  C CH2 . TRP A 1 86  ? 50.823 29.027 50.760 1.00 47.29 ? 86  TRP A CH2 1 
ATOM   679  N N   . LEU A 1 87  ? 43.726 31.681 48.039 1.00 39.63 ? 87  LEU A N   1 
ATOM   680  C CA  . LEU A 1 87  ? 42.305 31.476 47.936 1.00 38.56 ? 87  LEU A CA  1 
ATOM   681  C C   . LEU A 1 87  ? 41.987 30.308 47.034 1.00 38.73 ? 87  LEU A C   1 
ATOM   682  O O   . LEU A 1 87  ? 40.896 29.782 47.208 1.00 37.46 ? 87  LEU A O   1 
ATOM   683  C CB  . LEU A 1 87  ? 41.623 32.751 47.430 1.00 38.63 ? 87  LEU A CB  1 
ATOM   684  C CG  . LEU A 1 87  ? 41.760 34.073 48.223 1.00 38.14 ? 87  LEU A CG  1 
ATOM   685  C CD1 . LEU A 1 87  ? 40.947 35.123 47.532 1.00 36.17 ? 87  LEU A CD1 1 
ATOM   686  C CD2 . LEU A 1 87  ? 41.219 33.976 49.613 1.00 37.90 ? 87  LEU A CD2 1 
ATOM   687  N N   . GLU A 1 88  ? 42.874 29.825 46.138 1.00 40.64 ? 88  GLU A N   1 
ATOM   688  C CA  . GLU A 1 88  ? 42.598 28.594 45.415 1.00 42.51 ? 88  GLU A CA  1 
ATOM   689  C C   . GLU A 1 88  ? 42.684 27.442 46.369 1.00 41.50 ? 88  GLU A C   1 
ATOM   690  O O   . GLU A 1 88  ? 41.800 26.596 46.218 1.00 42.47 ? 88  GLU A O   1 
ATOM   691  C CB  . GLU A 1 88  ? 43.560 28.225 44.291 1.00 46.86 ? 88  GLU A CB  1 
ATOM   692  C CG  . GLU A 1 88  ? 43.035 27.057 43.379 1.00 51.72 ? 88  GLU A CG  1 
ATOM   693  C CD  . GLU A 1 88  ? 43.304 25.570 43.743 1.00 54.67 ? 88  GLU A CD  1 
ATOM   694  O OE1 . GLU A 1 88  ? 44.439 25.100 43.572 1.00 56.53 ? 88  GLU A OE1 1 
ATOM   695  O OE2 . GLU A 1 88  ? 42.368 24.862 44.158 1.00 55.67 ? 88  GLU A OE2 1 
ATOM   696  N N   . PRO A 1 89  ? 43.637 27.249 47.302 1.00 40.54 ? 89  PRO A N   1 
ATOM   697  C CA  . PRO A 1 89  ? 43.408 26.324 48.376 1.00 40.54 ? 89  PRO A CA  1 
ATOM   698  C C   . PRO A 1 89  ? 42.131 26.829 49.057 1.00 41.06 ? 89  PRO A C   1 
ATOM   699  O O   . PRO A 1 89  ? 41.030 26.430 48.646 1.00 40.46 ? 89  PRO A O   1 
ATOM   700  C CB  . PRO A 1 89  ? 44.649 26.394 49.225 1.00 38.84 ? 89  PRO A CB  1 
ATOM   701  C CG  . PRO A 1 89  ? 45.769 26.923 48.386 1.00 38.79 ? 89  PRO A CG  1 
ATOM   702  C CD  . PRO A 1 89  ? 45.062 27.558 47.195 1.00 40.06 ? 89  PRO A CD  1 
ATOM   703  N N   . VAL A 1 90  ? 42.221 27.847 49.910 1.00 41.48 ? 90  VAL A N   1 
ATOM   704  C CA  . VAL A 1 90  ? 41.162 28.131 50.884 1.00 42.38 ? 90  VAL A CA  1 
ATOM   705  C C   . VAL A 1 90  ? 39.697 28.478 50.452 1.00 44.00 ? 90  VAL A C   1 
ATOM   706  O O   . VAL A 1 90  ? 39.085 29.534 50.706 1.00 43.70 ? 90  VAL A O   1 
ATOM   707  C CB  . VAL A 1 90  ? 41.833 29.205 51.866 1.00 41.35 ? 90  VAL A CB  1 
ATOM   708  C CG1 . VAL A 1 90  ? 43.249 28.732 52.321 1.00 39.53 ? 90  VAL A CG1 1 
ATOM   709  C CG2 . VAL A 1 90  ? 41.930 30.543 51.205 1.00 41.45 ? 90  VAL A CG2 1 
ATOM   710  N N   . GLY A 1 91  ? 39.105 27.337 50.002 1.00 45.64 ? 91  GLY A N   1 
ATOM   711  C CA  . GLY A 1 91  ? 37.771 27.161 49.414 1.00 46.90 ? 91  GLY A CA  1 
ATOM   712  C C   . GLY A 1 91  ? 37.141 25.782 49.706 1.00 47.59 ? 91  GLY A C   1 
ATOM   713  O O   . GLY A 1 91  ? 35.963 25.688 50.065 1.00 47.07 ? 91  GLY A O   1 
ATOM   714  N N   . PHE A 1 92  ? 37.855 24.661 49.573 1.00 49.09 ? 92  PHE A N   1 
ATOM   715  C CA  . PHE A 1 92  ? 37.333 23.334 49.960 1.00 51.17 ? 92  PHE A CA  1 
ATOM   716  C C   . PHE A 1 92  ? 38.350 22.622 50.878 1.00 51.34 ? 92  PHE A C   1 
ATOM   717  O O   . PHE A 1 92  ? 38.060 21.764 51.721 1.00 51.66 ? 92  PHE A O   1 
ATOM   718  C CB  . PHE A 1 92  ? 37.079 22.433 48.711 1.00 53.19 ? 92  PHE A CB  1 
ATOM   719  C CG  . PHE A 1 92  ? 36.226 21.164 48.958 1.00 55.76 ? 92  PHE A CG  1 
ATOM   720  C CD1 . PHE A 1 92  ? 34.837 21.219 48.869 1.00 55.60 ? 92  PHE A CD1 1 
ATOM   721  C CD2 . PHE A 1 92  ? 36.819 19.932 49.260 1.00 56.84 ? 92  PHE A CD2 1 
ATOM   722  C CE1 . PHE A 1 92  ? 34.071 20.078 49.072 1.00 55.93 ? 92  PHE A CE1 1 
ATOM   723  C CE2 . PHE A 1 92  ? 36.037 18.798 49.463 1.00 57.35 ? 92  PHE A CE2 1 
ATOM   724  C CZ  . PHE A 1 92  ? 34.661 18.864 49.368 1.00 56.18 ? 92  PHE A CZ  1 
ATOM   725  N N   . LEU A 1 93  ? 39.606 22.957 50.609 1.00 50.89 ? 93  LEU A N   1 
ATOM   726  C CA  . LEU A 1 93  ? 40.759 22.405 51.281 1.00 50.74 ? 93  LEU A CA  1 
ATOM   727  C C   . LEU A 1 93  ? 40.693 22.800 52.755 1.00 50.99 ? 93  LEU A C   1 
ATOM   728  O O   . LEU A 1 93  ? 40.603 23.993 53.097 1.00 51.60 ? 93  LEU A O   1 
ATOM   729  C CB  . LEU A 1 93  ? 42.026 22.959 50.606 1.00 49.39 ? 93  LEU A CB  1 
ATOM   730  C CG  . LEU A 1 93  ? 43.287 22.113 50.562 1.00 47.37 ? 93  LEU A CG  1 
ATOM   731  C CD1 . LEU A 1 93  ? 43.001 20.876 49.727 1.00 46.79 ? 93  LEU A CD1 1 
ATOM   732  C CD2 . LEU A 1 93  ? 44.448 22.962 50.074 1.00 46.79 ? 93  LEU A CD2 1 
ATOM   733  N N   . ARG A 1 94  ? 40.705 21.687 53.517 1.00 50.78 ? 94  ARG A N   1 
ATOM   734  C CA  . ARG A 1 94  ? 40.590 21.634 54.970 1.00 49.37 ? 94  ARG A CA  1 
ATOM   735  C C   . ARG A 1 94  ? 41.942 21.663 55.668 1.00 48.20 ? 94  ARG A C   1 
ATOM   736  O O   . ARG A 1 94  ? 43.045 21.675 55.095 1.00 47.35 ? 94  ARG A O   1 
ATOM   737  C CB  . ARG A 1 94  ? 39.807 20.344 55.355 1.00 48.94 ? 94  ARG A CB  1 
ATOM   738  C CG  . ARG A 1 94  ? 38.467 20.524 56.121 1.00 47.79 ? 94  ARG A CG  1 
ATOM   739  C CD  . ARG A 1 94  ? 38.456 20.240 57.657 1.00 46.18 ? 94  ARG A CD  1 
ATOM   740  N NE  . ARG A 1 94  ? 37.191 19.627 58.079 1.00 43.41 ? 94  ARG A NE  1 
ATOM   741  C CZ  . ARG A 1 94  ? 36.523 19.931 59.201 1.00 42.36 ? 94  ARG A CZ  1 
ATOM   742  N NH1 . ARG A 1 94  ? 36.956 20.845 60.066 1.00 41.96 ? 94  ARG A NH1 1 
ATOM   743  N NH2 . ARG A 1 94  ? 35.394 19.275 59.466 1.00 40.40 ? 94  ARG A NH2 1 
ATOM   744  N N   . SER A 1 95  ? 41.754 21.594 56.977 1.00 47.26 ? 95  SER A N   1 
ATOM   745  C CA  . SER A 1 95  ? 42.833 21.620 57.916 1.00 48.39 ? 95  SER A CA  1 
ATOM   746  C C   . SER A 1 95  ? 43.778 20.444 57.772 1.00 48.46 ? 95  SER A C   1 
ATOM   747  O O   . SER A 1 95  ? 44.935 20.706 58.054 1.00 48.85 ? 95  SER A O   1 
ATOM   748  C CB  . SER A 1 95  ? 42.298 21.614 59.330 1.00 48.26 ? 95  SER A CB  1 
ATOM   749  O OG  . SER A 1 95  ? 41.525 20.422 59.460 1.00 49.13 ? 95  SER A OG  1 
ATOM   750  N N   . VAL A 1 96  ? 43.450 19.194 57.366 1.00 39.90 ? 96  VAL A N   1 
ATOM   751  C CA  . VAL A 1 96  ? 44.420 18.074 57.317 1.00 45.62 ? 96  VAL A CA  1 
ATOM   752  C C   . VAL A 1 96  ? 45.788 18.472 56.712 1.00 45.73 ? 96  VAL A C   1 
ATOM   753  O O   . VAL A 1 96  ? 46.813 17.836 56.971 1.00 46.43 ? 96  VAL A O   1 
ATOM   754  C CB  . VAL A 1 96  ? 43.844 16.817 56.531 1.00 44.91 ? 96  VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 96  ? 44.090 15.601 57.416 1.00 45.49 ? 96  VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 96  ? 42.339 16.846 56.291 1.00 43.78 ? 96  VAL A CG2 1 
ATOM   757  N N   . PHE A 1 97  ? 45.812 19.572 55.939 1.00 44.79 ? 97  PHE A N   1 
ATOM   758  C CA  . PHE A 1 97  ? 47.028 20.232 55.505 1.00 43.45 ? 97  PHE A CA  1 
ATOM   759  C C   . PHE A 1 97  ? 47.576 21.097 56.688 1.00 42.97 ? 97  PHE A C   1 
ATOM   760  O O   . PHE A 1 97  ? 48.611 20.834 57.321 1.00 41.82 ? 97  PHE A O   1 
ATOM   761  C CB  . PHE A 1 97  ? 46.617 21.061 54.265 1.00 41.91 ? 97  PHE A CB  1 
ATOM   762  C CG  . PHE A 1 97  ? 47.600 22.048 53.602 1.00 42.18 ? 97  PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 97  ? 48.967 22.063 53.867 1.00 40.58 ? 97  PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 97  ? 47.094 22.950 52.664 1.00 41.95 ? 97  PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 97  ? 49.799 22.944 53.198 1.00 40.65 ? 97  PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 97  ? 47.933 23.829 52.006 1.00 41.27 ? 97  PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 97  ? 49.286 23.827 52.270 1.00 41.15 ? 97  PHE A CZ  1 
ATOM   768  N N   . ALA A 1 98  ? 46.825 22.165 57.003 1.00 41.59 ? 98  ALA A N   1 
ATOM   769  C CA  . ALA A 1 98  ? 47.250 23.193 57.934 1.00 38.57 ? 98  ALA A CA  1 
ATOM   770  C C   . ALA A 1 98  ? 46.497 23.121 59.227 1.00 37.37 ? 98  ALA A C   1 
ATOM   771  O O   . ALA A 1 98  ? 46.003 24.129 59.711 1.00 38.01 ? 98  ALA A O   1 
ATOM   772  C CB  . ALA A 1 98  ? 47.022 24.558 57.304 1.00 37.95 ? 98  ALA A CB  1 
ATOM   773  N N   . ASN A 1 99  ? 46.324 21.939 59.782 1.00 36.09 ? 99  ASN A N   1 
ATOM   774  C CA  . ASN A 1 99  ? 45.565 21.795 61.001 1.00 35.17 ? 99  ASN A CA  1 
ATOM   775  C C   . ASN A 1 99  ? 46.424 22.443 62.083 1.00 34.59 ? 99  ASN A C   1 
ATOM   776  O O   . ASN A 1 99  ? 47.638 22.254 62.146 1.00 34.75 ? 99  ASN A O   1 
ATOM   777  C CB  . ASN A 1 99  ? 45.296 20.283 61.098 1.00 34.60 ? 99  ASN A CB  1 
ATOM   778  C CG  . ASN A 1 99  ? 45.326 19.651 62.465 1.00 34.47 ? 99  ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 99  ? 45.156 20.285 63.498 1.00 34.12 ? 99  ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 99  ? 45.532 18.355 62.429 1.00 34.16 ? 99  ASN A ND2 1 
ATOM   781  N N   . SER A 1 100 ? 45.773 23.332 62.828 1.00 35.28 ? 100 SER A N   1 
ATOM   782  C CA  . SER A 1 100 ? 46.428 24.181 63.807 1.00 36.26 ? 100 SER A CA  1 
ATOM   783  C C   . SER A 1 100 ? 46.623 23.529 65.156 1.00 35.97 ? 100 SER A C   1 
ATOM   784  O O   . SER A 1 100 ? 45.726 23.447 66.007 1.00 34.60 ? 100 SER A O   1 
ATOM   785  C CB  . SER A 1 100 ? 45.640 25.500 64.025 1.00 37.20 ? 100 SER A CB  1 
ATOM   786  O OG  . SER A 1 100 ? 45.935 26.626 63.188 1.00 38.44 ? 100 SER A OG  1 
ATOM   787  N N   . LEU A 1 101 ? 48.114 23.010 65.172 1.00 36.32 ? 101 LEU A N   1 
ATOM   788  C CA  . LEU A 1 101 ? 48.467 22.599 66.537 1.00 37.11 ? 101 LEU A CA  1 
ATOM   789  C C   . LEU A 1 101 ? 48.393 23.804 67.466 1.00 38.03 ? 101 LEU A C   1 
ATOM   790  O O   . LEU A 1 101 ? 47.898 23.713 68.599 1.00 38.50 ? 101 LEU A O   1 
ATOM   791  C CB  . LEU A 1 101 ? 49.870 22.013 66.579 1.00 36.12 ? 101 LEU A CB  1 
ATOM   792  C CG  . LEU A 1 101 ? 50.238 21.207 65.335 1.00 36.28 ? 101 LEU A CG  1 
ATOM   793  C CD1 . LEU A 1 101 ? 51.331 20.174 65.613 1.00 34.77 ? 101 LEU A CD1 1 
ATOM   794  C CD2 . LEU A 1 101 ? 49.058 20.430 64.743 1.00 36.41 ? 101 LEU A CD2 1 
ATOM   795  N N   . VAL A 1 102 ? 48.933 24.984 66.987 1.00 38.25 ? 102 VAL A N   1 
ATOM   796  C CA  . VAL A 1 102 ? 48.782 26.286 67.742 1.00 38.70 ? 102 VAL A CA  1 
ATOM   797  C C   . VAL A 1 102 ? 47.681 27.133 67.091 1.00 38.35 ? 102 VAL A C   1 
ATOM   798  O O   . VAL A 1 102 ? 47.763 27.504 65.925 1.00 37.00 ? 102 VAL A O   1 
ATOM   799  C CB  . VAL A 1 102 ? 49.994 27.181 67.819 1.00 36.14 ? 102 VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 102 ? 49.628 28.527 68.466 0.00 36.13 ? 102 VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 102 ? 51.118 26.609 68.673 0.00 36.22 ? 102 VAL A CG2 1 
ATOM   802  N N   . TYR A 1 103 ? 46.725 27.289 67.904 1.00 38.71 ? 103 TYR A N   1 
ATOM   803  C CA  . TYR A 1 103 ? 45.388 27.812 67.638 1.00 39.78 ? 103 TYR A CA  1 
ATOM   804  C C   . TYR A 1 103 ? 44.818 28.294 68.889 1.00 39.66 ? 103 TYR A C   1 
ATOM   805  O O   . TYR A 1 103 ? 45.289 27.917 69.980 1.00 39.61 ? 103 TYR A O   1 
ATOM   806  C CB  . TYR A 1 103 ? 44.564 26.273 67.789 1.00 41.29 ? 103 TYR A CB  1 
ATOM   807  C CG  . TYR A 1 103 ? 44.707 25.135 69.186 1.00 42.81 ? 103 TYR A CG  1 
ATOM   808  C CD1 . TYR A 1 103 ? 45.866 24.812 70.072 1.00 42.96 ? 103 TYR A CD1 1 
ATOM   809  C CD2 . TYR A 1 103 ? 43.601 24.238 69.683 1.00 43.32 ? 103 TYR A CD2 1 
ATOM   810  C CE1 . TYR A 1 103 ? 45.931 23.856 71.234 1.00 43.48 ? 103 TYR A CE1 1 
ATOM   811  C CE2 . TYR A 1 103 ? 43.661 23.262 70.855 1.00 43.51 ? 103 TYR A CE2 1 
ATOM   812  C CZ  . TYR A 1 103 ? 44.835 23.050 71.678 1.00 43.52 ? 103 TYR A CZ  1 
ATOM   813  O OH  . TYR A 1 103 ? 44.800 22.181 72.723 1.00 43.67 ? 103 TYR A OH  1 
ATOM   814  N N   . GLY A 1 104 ? 43.961 29.010 68.536 1.00 39.81 ? 104 GLY A N   1 
ATOM   815  C CA  . GLY A 1 104 ? 42.910 29.539 69.251 1.00 41.09 ? 104 GLY A CA  1 
ATOM   816  C C   . GLY A 1 104 ? 41.895 29.440 68.169 1.00 42.11 ? 104 GLY A C   1 
ATOM   817  O O   . GLY A 1 104 ? 42.231 29.277 66.980 1.00 41.91 ? 104 GLY A O   1 
ATOM   818  N N   . ALA A 1 105 ? 40.682 29.067 68.403 1.00 42.36 ? 105 ALA A N   1 
ATOM   819  C CA  . ALA A 1 105 ? 39.911 29.569 67.258 1.00 43.35 ? 105 ALA A CA  1 
ATOM   820  C C   . ALA A 1 105 ? 39.581 31.038 67.466 1.00 44.53 ? 105 ALA A C   1 
ATOM   821  O O   . ALA A 1 105 ? 38.542 31.382 68.049 1.00 45.09 ? 105 ALA A O   1 
ATOM   822  C CB  . ALA A 1 105 ? 38.614 28.772 67.113 1.00 43.06 ? 105 ALA A CB  1 
ATOM   823  N N   . SER A 1 106 ? 40.524 31.836 66.967 1.00 44.79 ? 106 SER A N   1 
ATOM   824  C CA  . SER A 1 106 ? 40.496 33.312 67.019 1.00 43.44 ? 106 SER A CA  1 
ATOM   825  C C   . SER A 1 106 ? 39.260 33.820 66.280 1.00 43.91 ? 106 SER A C   1 
ATOM   826  O O   . SER A 1 106 ? 38.219 34.094 66.891 1.00 44.09 ? 106 SER A O   1 
ATOM   827  C CB  . SER A 1 106 ? 41.765 33.861 66.363 1.00 41.80 ? 106 SER A CB  1 
ATOM   828  O OG  . SER A 1 106 ? 42.894 33.110 66.795 1.00 41.40 ? 106 SER A OG  1 
ATOM   829  N N   . ASP A 1 107 ? 39.420 33.952 64.982 1.00 43.89 ? 107 ASP A N   1 
ATOM   830  C CA  . ASP A 1 107 ? 38.314 34.292 64.085 1.00 43.49 ? 107 ASP A CA  1 
ATOM   831  C C   . ASP A 1 107 ? 38.103 33.109 63.219 1.00 43.07 ? 107 ASP A C   1 
ATOM   832  O O   . ASP A 1 107 ? 37.927 31.984 63.740 1.00 41.13 ? 107 ASP A O   1 
ATOM   833  C CB  . ASP A 1 107 ? 38.599 35.472 63.299 1.00 44.59 ? 107 ASP A CB  1 
ATOM   834  C CG  . ASP A 1 107 ? 37.348 36.245 63.245 1.00 45.40 ? 107 ASP A CG  1 
ATOM   835  O OD1 . ASP A 1 107 ? 36.217 35.651 63.066 1.00 45.89 ? 107 ASP A OD1 1 
ATOM   836  O OD2 . ASP A 1 107 ? 37.390 37.527 63.372 1.00 45.55 ? 107 ASP A OD2 1 
ATOM   837  N N   . SER A 1 108 ? 37.977 33.100 61.909 1.00 44.00 ? 108 SER A N   1 
ATOM   838  C CA  . SER A 1 108 ? 36.758 32.562 61.254 1.00 44.64 ? 108 SER A CA  1 
ATOM   839  C C   . SER A 1 108 ? 37.030 31.340 60.254 1.00 44.36 ? 108 SER A C   1 
ATOM   840  O O   . SER A 1 108 ? 36.950 31.442 59.044 1.00 44.56 ? 108 SER A O   1 
ATOM   841  C CB  . SER A 1 108 ? 36.082 33.651 60.406 1.00 45.46 ? 108 SER A CB  1 
ATOM   842  O OG  . SER A 1 108 ? 34.745 33.862 60.838 1.00 43.87 ? 108 SER A OG  1 
ATOM   843  N N   . ASP A 1 109 ? 37.333 30.064 60.644 1.00 44.62 ? 109 ASP A N   1 
ATOM   844  C CA  . ASP A 1 109 ? 38.662 29.380 60.909 1.00 44.56 ? 109 ASP A CA  1 
ATOM   845  C C   . ASP A 1 109 ? 39.992 29.807 60.138 1.00 42.36 ? 109 ASP A C   1 
ATOM   846  O O   . ASP A 1 109 ? 40.930 30.376 60.699 1.00 42.38 ? 109 ASP A O   1 
ATOM   847  C CB  . ASP A 1 109 ? 38.657 27.866 60.469 1.00 48.35 ? 109 ASP A CB  1 
ATOM   848  C CG  . ASP A 1 109 ? 37.294 27.093 60.450 1.00 50.40 ? 109 ASP A CG  1 
ATOM   849  O OD1 . ASP A 1 109 ? 36.235 27.629 60.954 1.00 52.04 ? 109 ASP A OD1 1 
ATOM   850  O OD2 . ASP A 1 109 ? 37.241 25.909 59.942 1.00 51.30 ? 109 ASP A OD2 1 
ATOM   851  N N   . VAL A 1 110 ? 40.160 29.538 58.813 1.00 38.54 ? 110 VAL A N   1 
ATOM   852  C CA  . VAL A 1 110 ? 41.216 30.247 57.980 1.00 35.93 ? 110 VAL A CA  1 
ATOM   853  C C   . VAL A 1 110 ? 40.721 30.765 56.637 1.00 34.74 ? 110 VAL A C   1 
ATOM   854  O O   . VAL A 1 110 ? 41.464 31.494 55.944 1.00 33.84 ? 110 VAL A O   1 
ATOM   855  C CB  . VAL A 1 110 ? 42.359 29.255 57.720 1.00 35.51 ? 110 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 110 ? 43.606 29.536 58.561 1.00 34.50 ? 110 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 110 ? 41.973 27.805 58.045 1.00 35.79 ? 110 VAL A CG2 1 
ATOM   858  N N   . TYR A 1 111 ? 39.743 30.468 56.400 1.00 32.88 ? 111 TYR A N   1 
ATOM   859  C CA  . TYR A 1 111 ? 39.381 30.977 55.101 1.00 30.82 ? 111 TYR A CA  1 
ATOM   860  C C   . TYR A 1 111 ? 38.973 32.398 55.419 1.00 29.56 ? 111 TYR A C   1 
ATOM   861  O O   . TYR A 1 111 ? 39.815 33.279 55.321 1.00 27.25 ? 111 TYR A O   1 
ATOM   862  C CB  . TYR A 1 111 ? 38.153 30.344 54.400 1.00 32.05 ? 111 TYR A CB  1 
ATOM   863  C CG  . TYR A 1 111 ? 37.991 28.855 54.100 1.00 34.02 ? 111 TYR A CG  1 
ATOM   864  C CD1 . TYR A 1 111 ? 38.441 27.859 54.974 0.00 32.69 ? 111 TYR A CD1 1 
ATOM   865  C CD2 . TYR A 1 111 ? 37.281 28.469 52.979 0.00 33.70 ? 111 TYR A CD2 1 
ATOM   866  C CE1 . TYR A 1 111 ? 38.136 26.534 54.804 0.00 33.48 ? 111 TYR A CE1 1 
ATOM   867  C CE2 . TYR A 1 111 ? 37.014 27.138 52.772 0.00 33.32 ? 111 TYR A CE2 1 
ATOM   868  C CZ  . TYR A 1 111 ? 37.433 26.184 53.683 0.00 32.95 ? 111 TYR A CZ  1 
ATOM   869  O OH  . TYR A 1 111 ? 37.124 24.855 53.500 0.00 33.22 ? 111 TYR A OH  1 
ATOM   870  N N   . ASP A 1 112 ? 37.760 32.650 55.905 1.00 28.40 ? 112 ASP A N   1 
ATOM   871  C CA  . ASP A 1 112 ? 37.260 33.994 56.107 1.00 27.68 ? 112 ASP A CA  1 
ATOM   872  C C   . ASP A 1 112 ? 38.031 35.176 56.705 1.00 25.13 ? 112 ASP A C   1 
ATOM   873  O O   . ASP A 1 112 ? 37.414 36.223 56.867 1.00 23.33 ? 112 ASP A O   1 
ATOM   874  C CB  . ASP A 1 112 ? 35.942 33.814 56.828 1.00 30.57 ? 112 ASP A CB  1 
ATOM   875  C CG  . ASP A 1 112 ? 34.856 33.838 55.759 1.00 33.77 ? 112 ASP A CG  1 
ATOM   876  O OD1 . ASP A 1 112 ? 34.536 32.774 55.203 1.00 36.33 ? 112 ASP A OD1 1 
ATOM   877  O OD2 . ASP A 1 112 ? 34.348 34.938 55.474 1.00 35.55 ? 112 ASP A OD2 1 
ATOM   878  N N   . LEU A 1 113 ? 39.352 35.060 56.961 1.00 24.67 ? 113 LEU A N   1 
ATOM   879  C CA  . LEU A 1 113 ? 40.346 36.044 57.428 1.00 22.68 ? 113 LEU A CA  1 
ATOM   880  C C   . LEU A 1 113 ? 41.091 36.321 56.142 1.00 21.84 ? 113 LEU A C   1 
ATOM   881  O O   . LEU A 1 113 ? 41.289 37.458 55.744 1.00 19.96 ? 113 LEU A O   1 
ATOM   882  C CB  . LEU A 1 113 ? 41.181 35.317 58.447 1.00 22.44 ? 113 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 113 ? 41.849 35.955 59.638 1.00 22.92 ? 113 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 113 ? 40.891 36.697 60.563 1.00 22.82 ? 113 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 113 ? 42.470 34.815 60.402 1.00 20.42 ? 113 LEU A CD2 1 
ATOM   886  N N   . LEU A 1 114 ? 41.495 35.233 55.483 1.00 22.30 ? 114 LEU A N   1 
ATOM   887  C CA  . LEU A 1 114 ? 41.953 35.297 54.102 1.00 23.34 ? 114 LEU A CA  1 
ATOM   888  C C   . LEU A 1 114 ? 40.733 35.791 53.321 1.00 24.53 ? 114 LEU A C   1 
ATOM   889  O O   . LEU A 1 114 ? 40.824 36.937 52.862 1.00 24.96 ? 114 LEU A O   1 
ATOM   890  C CB  . LEU A 1 114 ? 42.425 33.912 53.553 1.00 20.82 ? 114 LEU A CB  1 
ATOM   891  C CG  . LEU A 1 114 ? 43.828 33.351 53.962 1.00 20.56 ? 114 LEU A CG  1 
ATOM   892  C CD1 . LEU A 1 114 ? 44.058 31.938 53.500 1.00 19.50 ? 114 LEU A CD1 1 
ATOM   893  C CD2 . LEU A 1 114 ? 44.940 34.061 53.220 1.00 20.43 ? 114 LEU A CD2 1 
ATOM   894  N N   . LYS A 1 115 ? 39.575 35.117 53.167 1.00 25.51 ? 115 LYS A N   1 
ATOM   895  C CA  . LYS A 1 115 ? 38.433 35.672 52.396 1.00 27.16 ? 115 LYS A CA  1 
ATOM   896  C C   . LYS A 1 115 ? 38.057 37.107 52.796 1.00 26.99 ? 115 LYS A C   1 
ATOM   897  O O   . LYS A 1 115 ? 38.125 37.932 51.902 1.00 29.47 ? 115 LYS A O   1 
ATOM   898  C CB  . LYS A 1 115 ? 37.145 34.798 52.501 1.00 27.68 ? 115 LYS A CB  1 
ATOM   899  C CG  . LYS A 1 115 ? 37.201 33.348 51.978 1.00 29.17 ? 115 LYS A CG  1 
ATOM   900  C CD  . LYS A 1 115 ? 36.664 33.199 50.569 1.00 29.78 ? 115 LYS A CD  1 
ATOM   901  C CE  . LYS A 1 115 ? 36.879 31.744 50.128 1.00 31.29 ? 115 LYS A CE  1 
ATOM   902  N NZ  . LYS A 1 115 ? 36.006 31.340 49.017 1.00 31.38 ? 115 LYS A NZ  1 
ATOM   903  N N   . ASP A 1 116 ? 37.723 37.594 53.990 1.00 27.50 ? 116 ASP A N   1 
ATOM   904  C CA  . ASP A 1 116 ? 37.422 39.009 54.200 1.00 27.91 ? 116 ASP A CA  1 
ATOM   905  C C   . ASP A 1 116 ? 38.444 40.042 53.788 1.00 28.14 ? 116 ASP A C   1 
ATOM   906  O O   . ASP A 1 116 ? 38.053 41.122 53.373 1.00 28.16 ? 116 ASP A O   1 
ATOM   907  C CB  . ASP A 1 116 ? 37.142 39.272 55.632 1.00 30.10 ? 116 ASP A CB  1 
ATOM   908  C CG  . ASP A 1 116 ? 35.661 39.139 55.904 1.00 32.86 ? 116 ASP A CG  1 
ATOM   909  O OD1 . ASP A 1 116 ? 35.127 38.010 55.832 1.00 33.81 ? 116 ASP A OD1 1 
ATOM   910  O OD2 . ASP A 1 116 ? 35.054 40.180 56.174 1.00 33.33 ? 116 ASP A OD2 1 
ATOM   911  N N   . LEU A 1 117 ? 39.741 39.726 53.859 1.00 28.56 ? 117 LEU A N   1 
ATOM   912  C CA  . LEU A 1 117 ? 40.844 40.607 53.464 1.00 27.89 ? 117 LEU A CA  1 
ATOM   913  C C   . LEU A 1 117 ? 40.781 40.810 51.973 1.00 29.11 ? 117 LEU A C   1 
ATOM   914  O O   . LEU A 1 117 ? 41.042 41.938 51.617 1.00 29.59 ? 117 LEU A O   1 
ATOM   915  C CB  . LEU A 1 117 ? 42.237 40.006 53.794 1.00 25.28 ? 117 LEU A CB  1 
ATOM   916  C CG  . LEU A 1 117 ? 43.549 40.712 53.532 1.00 23.32 ? 117 LEU A CG  1 
ATOM   917  C CD1 . LEU A 1 117 ? 43.577 42.107 54.078 1.00 22.76 ? 117 LEU A CD1 1 
ATOM   918  C CD2 . LEU A 1 117 ? 44.610 39.949 54.260 1.00 23.08 ? 117 LEU A CD2 1 
ATOM   919  N N   . GLU A 1 118 ? 40.435 39.862 51.078 1.00 29.67 ? 118 GLU A N   1 
ATOM   920  C CA  . GLU A 1 118 ? 40.393 40.162 49.659 1.00 29.84 ? 118 GLU A CA  1 
ATOM   921  C C   . GLU A 1 118 ? 39.078 40.844 49.311 1.00 29.19 ? 118 GLU A C   1 
ATOM   922  O O   . GLU A 1 118 ? 39.088 41.721 48.453 1.00 29.45 ? 118 GLU A O   1 
ATOM   923  C CB  . GLU A 1 118 ? 40.603 38.882 48.854 1.00 32.25 ? 118 GLU A CB  1 
ATOM   924  C CG  . GLU A 1 118 ? 39.654 37.755 49.147 1.00 35.80 ? 118 GLU A CG  1 
ATOM   925  C CD  . GLU A 1 118 ? 38.506 37.561 48.143 1.00 38.56 ? 118 GLU A CD  1 
ATOM   926  O OE1 . GLU A 1 118 ? 38.134 38.490 47.400 1.00 40.42 ? 118 GLU A OE1 1 
ATOM   927  O OE2 . GLU A 1 118 ? 37.970 36.446 48.114 1.00 40.10 ? 118 GLU A OE2 1 
ATOM   928  N N   . GLU A 1 119 ? 37.980 40.510 49.989 1.00 27.19 ? 119 GLU A N   1 
ATOM   929  C CA  . GLU A 1 119 ? 36.690 41.158 49.861 1.00 25.89 ? 119 GLU A CA  1 
ATOM   930  C C   . GLU A 1 119 ? 36.861 42.648 50.227 1.00 26.66 ? 119 GLU A C   1 
ATOM   931  O O   . GLU A 1 119 ? 36.717 43.536 49.396 1.00 25.93 ? 119 GLU A O   1 
ATOM   932  C CB  . GLU A 1 119 ? 35.809 40.341 50.780 1.00 28.38 ? 119 GLU A CB  1 
ATOM   933  C CG  . GLU A 1 119 ? 35.653 38.891 50.313 0.00 28.30 ? 119 GLU A CG  1 
ATOM   934  C CD  . GLU A 1 119 ? 34.867 38.695 49.031 0.00 28.41 ? 119 GLU A CD  1 
ATOM   935  O OE1 . GLU A 1 119 ? 35.328 39.015 47.926 0.00 28.57 ? 119 GLU A OE1 1 
ATOM   936  O OE2 . GLU A 1 119 ? 33.781 38.174 49.158 0.00 28.54 ? 119 GLU A OE2 1 
ATOM   937  N N   . GLY A 1 120 ? 37.357 43.020 51.418 1.00 27.75 ? 120 GLY A N   1 
ATOM   938  C CA  . GLY A 1 120 ? 37.628 44.391 51.880 1.00 28.68 ? 120 GLY A CA  1 
ATOM   939  C C   . GLY A 1 120 ? 38.719 45.089 51.095 1.00 28.87 ? 120 GLY A C   1 
ATOM   940  O O   . GLY A 1 120 ? 38.614 46.286 50.813 1.00 30.08 ? 120 GLY A O   1 
ATOM   941  N N   . ILE A 1 121 ? 39.752 44.372 50.647 1.00 28.98 ? 121 ILE A N   1 
ATOM   942  C CA  . ILE A 1 121 ? 40.794 44.948 49.810 1.00 29.06 ? 121 ILE A CA  1 
ATOM   943  C C   . ILE A 1 121 ? 40.307 45.045 48.353 1.00 30.40 ? 121 ILE A C   1 
ATOM   944  O O   . ILE A 1 121 ? 40.993 45.490 47.431 1.00 27.99 ? 121 ILE A O   1 
ATOM   945  C CB  . ILE A 1 121 ? 42.041 44.026 50.118 1.00 29.57 ? 121 ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 121 ? 43.292 44.831 50.428 1.00 29.15 ? 121 ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 121 ? 42.241 43.061 48.995 1.00 28.57 ? 121 ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 121 ? 44.126 45.247 49.197 1.00 29.56 ? 121 ILE A CD1 1 
ATOM   949  N N   . GLN A 1 122 ? 39.083 44.615 48.094 1.00 32.54 ? 122 GLN A N   1 
ATOM   950  C CA  . GLN A 1 122 ? 38.488 44.913 46.815 1.00 35.57 ? 122 GLN A CA  1 
ATOM   951  C C   . GLN A 1 122 ? 38.037 46.357 46.931 1.00 36.17 ? 122 GLN A C   1 
ATOM   952  O O   . GLN A 1 122 ? 38.597 47.148 46.174 1.00 37.84 ? 122 GLN A O   1 
ATOM   953  C CB  . GLN A 1 122 ? 37.285 44.036 46.495 1.00 38.02 ? 122 GLN A CB  1 
ATOM   954  C CG  . GLN A 1 122 ? 37.703 42.624 46.109 1.00 40.03 ? 122 GLN A CG  1 
ATOM   955  C CD  . GLN A 1 122 ? 37.058 42.116 44.845 1.00 40.50 ? 122 GLN A CD  1 
ATOM   956  O OE1 . GLN A 1 122 ? 35.862 42.247 44.631 1.00 41.65 ? 122 GLN A OE1 1 
ATOM   957  N NE2 . GLN A 1 122 ? 37.773 41.508 43.917 1.00 41.24 ? 122 GLN A NE2 1 
ATOM   958  N N   . THR A 1 123 ? 37.190 46.813 47.866 1.00 36.35 ? 123 THR A N   1 
ATOM   959  C CA  . THR A 1 123 ? 36.702 48.192 47.938 1.00 36.37 ? 123 THR A CA  1 
ATOM   960  C C   . THR A 1 123 ? 37.678 49.389 47.849 1.00 36.56 ? 123 THR A C   1 
ATOM   961  O O   . THR A 1 123 ? 37.248 50.549 47.743 1.00 36.70 ? 123 THR A O   1 
ATOM   962  C CB  . THR A 1 123 ? 35.847 48.193 49.224 1.00 36.97 ? 123 THR A CB  1 
ATOM   963  O OG1 . THR A 1 123 ? 34.701 48.992 48.964 1.00 36.20 ? 123 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 123 ? 36.632 48.657 50.432 1.00 37.14 ? 123 THR A CG2 1 
ATOM   965  N N   . LEU A 1 124 ? 38.997 49.153 47.817 1.00 36.00 ? 124 LEU A N   1 
ATOM   966  C CA  . LEU A 1 124 ? 39.984 50.206 47.755 1.00 35.11 ? 124 LEU A CA  1 
ATOM   967  C C   . LEU A 1 124 ? 40.617 50.371 46.371 1.00 36.08 ? 124 LEU A C   1 
ATOM   968  O O   . LEU A 1 124 ? 41.380 51.305 46.167 1.00 36.99 ? 124 LEU A O   1 
ATOM   969  C CB  . LEU A 1 124 ? 41.053 49.908 48.800 1.00 33.93 ? 124 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 124 ? 40.695 49.587 50.239 1.00 31.79 ? 124 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 124 ? 41.948 49.572 51.078 1.00 31.56 ? 124 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 124 ? 39.783 50.645 50.778 1.00 30.71 ? 124 LEU A CD2 1 
ATOM   973  N N   . MET A 1 125 ? 40.385 49.519 45.348 1.00 36.29 ? 125 MET A N   1 
ATOM   974  C CA  . MET A 1 125 ? 40.891 49.738 43.964 1.00 34.52 ? 125 MET A CA  1 
ATOM   975  C C   . MET A 1 125 ? 39.789 50.306 43.129 1.00 33.80 ? 125 MET A C   1 
ATOM   976  O O   . MET A 1 125 ? 40.000 51.250 42.362 1.00 32.63 ? 125 MET A O   1 
ATOM   977  C CB  . MET A 1 125 ? 41.298 48.539 43.140 1.00 33.24 ? 125 MET A CB  1 
ATOM   978  C CG  . MET A 1 125 ? 40.772 47.247 43.601 1.00 32.10 ? 125 MET A CG  1 
ATOM   979  S SD  . MET A 1 125 ? 42.316 46.599 44.216 1.00 33.16 ? 125 MET A SD  1 
ATOM   980  C CE  . MET A 1 125 ? 42.135 45.035 43.404 1.00 31.31 ? 125 MET A CE  1 
ATOM   981  N N   . GLY A 1 126 ? 38.597 49.735 43.308 1.00 33.16 ? 126 GLY A N   1 
ATOM   982  C CA  . GLY A 1 126 ? 37.408 50.297 42.736 1.00 33.62 ? 126 GLY A CA  1 
ATOM   983  C C   . GLY A 1 126 ? 37.375 51.759 43.144 1.00 34.25 ? 126 GLY A C   1 
ATOM   984  O O   . GLY A 1 126 ? 36.845 52.559 42.414 1.00 34.16 ? 126 GLY A O   1 
ATOM   985  N N   . ARG A 1 127 ? 38.021 52.188 44.236 1.00 35.75 ? 127 ARG A N   1 
ATOM   986  C CA  . ARG A 1 127 ? 38.073 53.596 44.596 1.00 36.93 ? 127 ARG A CA  1 
ATOM   987  C C   . ARG A 1 127 ? 39.297 54.412 44.093 1.00 37.04 ? 127 ARG A C   1 
ATOM   988  O O   . ARG A 1 127 ? 39.462 55.598 44.435 1.00 38.31 ? 127 ARG A O   1 
ATOM   989  C CB  . ARG A 1 127 ? 37.946 53.655 46.115 1.00 36.40 ? 127 ARG A CB  1 
ATOM   990  C CG  . ARG A 1 127 ? 36.748 54.535 46.374 1.00 39.14 ? 127 ARG A CG  1 
ATOM   991  C CD  . ARG A 1 127 ? 36.645 55.094 47.788 1.00 41.08 ? 127 ARG A CD  1 
ATOM   992  N NE  . ARG A 1 127 ? 35.484 54.536 48.473 1.00 43.73 ? 127 ARG A NE  1 
ATOM   993  C CZ  . ARG A 1 127 ? 34.262 55.103 48.487 1.00 44.11 ? 127 ARG A CZ  1 
ATOM   994  N NH1 . ARG A 1 127 ? 33.961 56.220 47.818 1.00 43.82 ? 127 ARG A NH1 1 
ATOM   995  N NH2 . ARG A 1 127 ? 33.286 54.487 49.150 1.00 43.71 ? 127 ARG A NH2 1 
ATOM   996  N N   . LEU A 1 128 ? 40.174 53.860 43.242 1.00 35.20 ? 128 LEU A N   1 
ATOM   997  C CA  . LEU A 1 128 ? 41.400 54.527 42.778 1.00 33.99 ? 128 LEU A CA  1 
ATOM   998  C C   . LEU A 1 128 ? 41.733 54.331 41.270 1.00 35.74 ? 128 LEU A C   1 
ATOM   999  O O   . LEU A 1 128 ? 42.580 54.982 40.649 1.00 36.74 ? 128 LEU A O   1 
ATOM   1000 C CB  . LEU A 1 128 ? 42.541 54.013 43.690 1.00 29.54 ? 128 LEU A CB  1 
ATOM   1001 C CG  . LEU A 1 128 ? 42.841 54.657 45.052 1.00 25.19 ? 128 LEU A CG  1 
ATOM   1002 C CD1 . LEU A 1 128 ? 43.121 53.586 46.061 1.00 21.22 ? 128 LEU A CD1 1 
ATOM   1003 C CD2 . LEU A 1 128 ? 44.088 55.532 44.981 1.00 22.08 ? 128 LEU A CD2 1 
ATOM   1004 N N   . GLU A 1 129 ? 40.957 53.419 40.674 1.00 35.78 ? 129 GLU A N   1 
ATOM   1005 C CA  . GLU A 1 129 ? 40.904 53.030 39.271 1.00 36.03 ? 129 GLU A CA  1 
ATOM   1006 C C   . GLU A 1 129 ? 41.406 53.789 38.017 1.00 37.66 ? 129 GLU A C   1 
ATOM   1007 O O   . GLU A 1 129 ? 42.009 53.169 37.127 1.00 38.14 ? 129 GLU A O   1 
ATOM   1008 C CB  . GLU A 1 129 ? 39.416 52.626 39.002 1.00 34.62 ? 129 GLU A CB  1 
ATOM   1009 C CG  . GLU A 1 129 ? 39.308 51.518 37.922 0.50 30.99 ? 129 GLU A CG  1 
ATOM   1010 C CD  . GLU A 1 129 ? 37.936 51.193 37.324 0.50 28.83 ? 129 GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1 129 ? 37.351 52.062 36.686 0.50 24.72 ? 129 GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1 129 ? 37.463 50.062 37.466 0.50 25.17 ? 129 GLU A OE2 1 
ATOM   1013 N N   . ASP A 1 130 ? 41.121 55.095 37.850 1.00 38.03 ? 130 ASP A N   1 
ATOM   1014 C CA  . ASP A 1 130 ? 41.333 55.763 36.559 1.00 38.67 ? 130 ASP A CA  1 
ATOM   1015 C C   . ASP A 1 130 ? 42.518 56.697 36.398 1.00 39.94 ? 130 ASP A C   1 
ATOM   1016 O O   . ASP A 1 130 ? 43.313 56.490 35.498 1.00 39.98 ? 130 ASP A O   1 
ATOM   1017 C CB  . ASP A 1 130 ? 40.072 56.574 36.140 0.50 34.61 ? 130 ASP A CB  1 
ATOM   1018 C CG  . ASP A 1 130 ? 38.784 55.780 35.863 0.50 30.48 ? 130 ASP A CG  1 
ATOM   1019 O OD1 . ASP A 1 130 ? 38.778 54.547 35.933 0.50 26.14 ? 130 ASP A OD1 1 
ATOM   1020 O OD2 . ASP A 1 130 ? 37.764 56.414 35.586 0.50 26.64 ? 130 ASP A OD2 1 
ATOM   1021 N N   . GLY A 1 131 ? 42.666 57.755 37.201 1.00 41.03 ? 131 GLY A N   1 
ATOM   1022 C CA  . GLY A 1 131 ? 43.786 58.698 37.110 1.00 42.21 ? 131 GLY A CA  1 
ATOM   1023 C C   . GLY A 1 131 ? 45.194 58.090 37.013 1.00 43.41 ? 131 GLY A C   1 
ATOM   1024 O O   . GLY A 1 131 ? 46.081 58.706 36.416 1.00 43.81 ? 131 GLY A O   1 
ATOM   1025 N N   . SER A 1 132 ? 45.432 56.903 37.611 1.00 43.84 ? 132 SER A N   1 
ATOM   1026 C CA  . SER A 1 132 ? 46.712 56.196 37.559 1.00 42.51 ? 132 SER A CA  1 
ATOM   1027 C C   . SER A 1 132 ? 46.462 54.690 37.504 1.00 42.29 ? 132 SER A C   1 
ATOM   1028 O O   . SER A 1 132 ? 46.586 54.037 38.553 1.00 42.50 ? 132 SER A O   1 
ATOM   1029 C CB  . SER A 1 132 ? 47.586 56.507 38.776 0.50 41.70 ? 132 SER A CB  1 
ATOM   1030 O OG  . SER A 1 132 ? 48.338 57.698 38.579 0.50 42.29 ? 132 SER A OG  1 
ATOM   1031 N N   . PRO A 1 133 ? 46.081 54.167 36.292 1.00 41.63 ? 133 PRO A N   1 
ATOM   1032 C CA  . PRO A 1 133 ? 45.739 52.772 35.976 1.00 40.25 ? 133 PRO A CA  1 
ATOM   1033 C C   . PRO A 1 133 ? 46.779 52.012 35.119 1.00 38.60 ? 133 PRO A C   1 
ATOM   1034 O O   . PRO A 1 133 ? 47.981 52.266 35.179 1.00 36.74 ? 133 PRO A O   1 
ATOM   1035 C CB  . PRO A 1 133 ? 44.374 52.951 35.319 1.00 39.97 ? 133 PRO A CB  1 
ATOM   1036 C CG  . PRO A 1 133 ? 44.667 54.096 34.344 1.00 40.58 ? 133 PRO A CG  1 
ATOM   1037 C CD  . PRO A 1 133 ? 45.750 54.939 35.078 1.00 41.00 ? 133 PRO A CD  1 
ATOM   1038 N N   . ARG A 1 134 ? 46.262 51.159 34.233 1.00 38.01 ? 134 ARG A N   1 
ATOM   1039 C CA  . ARG A 1 134 ? 46.997 50.263 33.354 1.00 39.08 ? 134 ARG A CA  1 
ATOM   1040 C C   . ARG A 1 134 ? 47.569 49.235 34.339 1.00 37.96 ? 134 ARG A C   1 
ATOM   1041 O O   . ARG A 1 134 ? 48.746 48.929 34.487 1.00 37.35 ? 134 ARG A O   1 
ATOM   1042 C CB  . ARG A 1 134 ? 48.130 51.014 32.519 1.00 40.99 ? 134 ARG A CB  1 
ATOM   1043 C CG  . ARG A 1 134 ? 48.762 50.168 31.390 1.00 42.61 ? 134 ARG A CG  1 
ATOM   1044 C CD  . ARG A 1 134 ? 50.199 50.575 30.942 1.00 44.36 ? 134 ARG A CD  1 
ATOM   1045 N NE  . ARG A 1 134 ? 50.949 49.406 30.411 1.00 46.13 ? 134 ARG A NE  1 
ATOM   1046 C CZ  . ARG A 1 134 ? 51.660 49.342 29.244 1.00 45.75 ? 134 ARG A CZ  1 
ATOM   1047 N NH1 . ARG A 1 134 ? 51.811 50.365 28.374 1.00 44.48 ? 134 ARG A NH1 1 
ATOM   1048 N NH2 . ARG A 1 134 ? 52.175 48.158 28.898 1.00 44.62 ? 134 ARG A NH2 1 
ATOM   1049 N N   . THR A 1 135 ? 46.648 48.593 35.019 1.00 37.15 ? 135 THR A N   1 
ATOM   1050 C CA  . THR A 1 135 ? 47.043 47.671 36.052 1.00 37.72 ? 135 THR A CA  1 
ATOM   1051 C C   . THR A 1 135 ? 47.348 46.300 35.460 1.00 36.23 ? 135 THR A C   1 
ATOM   1052 O O   . THR A 1 135 ? 46.457 45.531 35.136 1.00 36.12 ? 135 THR A O   1 
ATOM   1053 C CB  . THR A 1 135 ? 45.864 47.820 37.037 1.00 39.72 ? 135 THR A CB  1 
ATOM   1054 O OG1 . THR A 1 135 ? 46.243 47.058 38.155 1.00 41.57 ? 135 THR A OG1 1 
ATOM   1055 C CG2 . THR A 1 135 ? 44.484 47.452 36.463 1.00 41.51 ? 135 THR A CG2 1 
ATOM   1056 N N   . GLY A 1 136 ? 48.649 46.075 35.264 1.00 35.55 ? 136 GLY A N   1 
ATOM   1057 C CA  . GLY A 1 136 ? 49.279 44.898 34.624 1.00 36.51 ? 136 GLY A CA  1 
ATOM   1058 C C   . GLY A 1 136 ? 48.644 43.489 34.476 1.00 35.82 ? 136 GLY A C   1 
ATOM   1059 O O   . GLY A 1 136 ? 49.255 42.640 33.818 1.00 35.30 ? 136 GLY A O   1 
ATOM   1060 N N   . GLN A 1 137 ? 47.863 43.081 34.822 1.00 35.64 ? 137 GLN A N   1 
ATOM   1061 C CA  . GLN A 1 137 ? 47.035 41.895 34.552 1.00 36.88 ? 137 GLN A CA  1 
ATOM   1062 C C   . GLN A 1 137 ? 45.655 42.327 34.069 1.00 38.18 ? 137 GLN A C   1 
ATOM   1063 O O   . GLN A 1 137 ? 44.940 43.077 34.750 1.00 37.47 ? 137 GLN A O   1 
ATOM   1064 C CB  . GLN A 1 137 ? 46.841 41.089 35.856 1.00 32.10 ? 137 GLN A CB  1 
ATOM   1065 C CG  . GLN A 1 137 ? 45.861 39.914 35.708 1.00 41.18 ? 137 GLN A CG  1 
ATOM   1066 C CD  . GLN A 1 137 ? 44.906 39.735 36.904 1.00 43.64 ? 137 GLN A CD  1 
ATOM   1067 O OE1 . GLN A 1 137 ? 44.461 40.715 37.500 1.00 43.19 ? 137 GLN A OE1 1 
ATOM   1068 N NE2 . GLN A 1 137 ? 44.552 38.521 37.297 1.00 43.31 ? 137 GLN A NE2 1 
ATOM   1069 N N   . ALA A 1 138 ? 45.220 41.875 32.903 1.00 39.42 ? 138 ALA A N   1 
ATOM   1070 C CA  . ALA A 1 138 ? 43.857 42.232 32.442 1.00 39.39 ? 138 ALA A CA  1 
ATOM   1071 C C   . ALA A 1 138 ? 43.307 41.262 31.390 1.00 39.56 ? 138 ALA A C   1 
ATOM   1072 O O   . ALA A 1 138 ? 43.651 41.351 30.207 1.00 39.78 ? 138 ALA A O   1 
ATOM   1073 C CB  . ALA A 1 138 ? 43.817 43.636 31.866 1.00 36.79 ? 138 ALA A CB  1 
ATOM   1074 N N   . PHE A 1 139 ? 42.471 40.446 31.945 1.00 38.64 ? 139 PHE A N   1 
ATOM   1075 C CA  . PHE A 1 139 ? 41.684 39.370 31.341 1.00 38.66 ? 139 PHE A CA  1 
ATOM   1076 C C   . PHE A 1 139 ? 41.868 38.230 32.320 1.00 38.91 ? 139 PHE A C   1 
ATOM   1077 O O   . PHE A 1 139 ? 42.661 38.303 33.262 1.00 38.51 ? 139 PHE A O   1 
ATOM   1078 C CB  . PHE A 1 139 ? 42.007 39.094 29.863 1.00 39.30 ? 139 PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 139 ? 40.882 38.229 29.261 1.00 40.37 ? 139 PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 139 ? 39.540 38.577 29.462 1.00 40.43 ? 139 PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 139 ? 41.199 37.040 28.590 1.00 40.72 ? 139 PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 139 ? 38.518 37.732 29.010 1.00 41.66 ? 139 PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 139 ? 40.176 36.199 28.130 1.00 42.15 ? 139 PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 139 ? 38.836 36.542 28.346 1.00 43.34 ? 139 PHE A CZ  1 
ATOM   1085 N N   . LYS A 1 140 ? 41.173 37.157 32.184 1.00 37.66 ? 140 LYS A N   1 
ATOM   1086 C CA  . LYS A 1 140 ? 41.249 36.196 33.267 1.00 38.97 ? 140 LYS A CA  1 
ATOM   1087 C C   . LYS A 1 140 ? 42.461 35.311 33.262 1.00 40.20 ? 140 LYS A C   1 
ATOM   1088 O O   . LYS A 1 140 ? 42.743 34.634 32.255 1.00 42.25 ? 140 LYS A O   1 
ATOM   1089 C CB  . LYS A 1 140 ? 40.056 35.232 33.289 1.00 36.78 ? 140 LYS A CB  1 
ATOM   1090 C CG  . LYS A 1 140 ? 39.001 35.514 32.227 1.00 36.25 ? 140 LYS A CG  1 
ATOM   1091 C CD  . LYS A 1 140 ? 37.624 34.959 32.603 1.00 34.86 ? 140 LYS A CD  1 
ATOM   1092 C CE  . LYS A 1 140 ? 36.572 36.054 32.781 1.00 35.74 ? 140 LYS A CE  1 
ATOM   1093 N NZ  . LYS A 1 140 ? 36.215 36.289 34.188 1.00 34.35 ? 140 LYS A NZ  1 
ATOM   1094 N N   . GLN A 1 141 ? 43.041 35.383 34.438 1.00 40.01 ? 141 GLN A N   1 
ATOM   1095 C CA  . GLN A 1 141 ? 44.241 34.676 34.822 1.00 40.31 ? 141 GLN A CA  1 
ATOM   1096 C C   . GLN A 1 141 ? 44.107 34.163 36.257 1.00 40.31 ? 141 GLN A C   1 
ATOM   1097 O O   . GLN A 1 141 ? 44.371 34.895 37.223 1.00 41.27 ? 141 GLN A O   1 
ATOM   1098 C CB  . GLN A 1 141 ? 45.432 35.630 34.743 1.00 40.26 ? 141 GLN A CB  1 
ATOM   1099 C CG  . GLN A 1 141 ? 45.140 36.875 33.900 1.00 39.56 ? 141 GLN A CG  1 
ATOM   1100 C CD  . GLN A 1 141 ? 45.768 36.810 32.508 1.00 40.74 ? 141 GLN A CD  1 
ATOM   1101 O OE1 . GLN A 1 141 ? 46.171 37.837 31.966 1.00 40.39 ? 141 GLN A OE1 1 
ATOM   1102 N NE2 . GLN A 1 141 ? 45.879 35.649 31.890 1.00 39.33 ? 141 GLN A NE2 1 
ATOM   1103 N N   . THR A 1 142 ? 44.303 32.719 36.452 1.00 37.66 ? 142 THR A N   1 
ATOM   1104 C CA  . THR A 1 142 ? 44.280 32.225 37.844 1.00 35.09 ? 142 THR A CA  1 
ATOM   1105 C C   . THR A 1 142 ? 45.690 32.175 38.478 1.00 35.70 ? 142 THR A C   1 
ATOM   1106 O O   . THR A 1 142 ? 46.676 32.091 37.740 1.00 35.76 ? 142 THR A O   1 
ATOM   1107 C CB  . THR A 1 142 ? 43.501 30.853 37.765 1.00 32.82 ? 142 THR A CB  1 
ATOM   1108 O OG1 . THR A 1 142 ? 42.865 30.688 39.043 1.00 29.07 ? 142 THR A OG1 1 
ATOM   1109 C CG2 . THR A 1 142 ? 44.370 29.665 37.365 1.00 31.79 ? 142 THR A CG2 1 
ATOM   1110 N N   . TYR A 1 143 ? 45.883 32.292 39.803 1.00 35.70 ? 143 TYR A N   1 
ATOM   1111 C CA  . TYR A 1 143 ? 47.251 32.291 40.362 1.00 36.40 ? 143 TYR A CA  1 
ATOM   1112 C C   . TYR A 1 143 ? 47.640 31.152 41.336 1.00 38.03 ? 143 TYR A C   1 
ATOM   1113 O O   . TYR A 1 143 ? 48.791 31.206 41.909 1.00 39.76 ? 143 TYR A O   1 
ATOM   1114 C CB  . TYR A 1 143 ? 47.490 33.671 41.016 1.00 34.75 ? 143 TYR A CB  1 
ATOM   1115 C CG  . TYR A 1 143 ? 48.051 34.760 40.158 1.00 34.10 ? 143 TYR A CG  1 
ATOM   1116 C CD1 . TYR A 1 143 ? 47.431 35.154 38.981 1.00 34.99 ? 143 TYR A CD1 1 
ATOM   1117 C CD2 . TYR A 1 143 ? 49.204 35.446 40.529 1.00 35.02 ? 143 TYR A CD2 1 
ATOM   1118 C CE1 . TYR A 1 143 ? 47.944 36.188 38.205 1.00 36.38 ? 143 TYR A CE1 1 
ATOM   1119 C CE2 . TYR A 1 143 ? 49.757 36.485 39.787 1.00 35.10 ? 143 TYR A CE2 1 
ATOM   1120 C CZ  . TYR A 1 143 ? 49.122 36.851 38.607 1.00 36.69 ? 143 TYR A CZ  1 
ATOM   1121 O OH  . TYR A 1 143 ? 49.640 37.871 37.823 1.00 35.87 ? 143 TYR A OH  1 
ATOM   1122 N N   . ALA A 1 144 ? 46.869 30.122 41.687 1.00 36.64 ? 144 ALA A N   1 
ATOM   1123 C CA  . ALA A 1 144 ? 46.858 28.932 42.556 1.00 34.82 ? 144 ALA A CA  1 
ATOM   1124 C C   . ALA A 1 144 ? 48.271 28.450 42.795 1.00 34.93 ? 144 ALA A C   1 
ATOM   1125 O O   . ALA A 1 144 ? 48.984 28.061 41.846 1.00 34.98 ? 144 ALA A O   1 
ATOM   1126 C CB  . ALA A 1 144 ? 46.126 27.802 41.874 1.00 33.39 ? 144 ALA A CB  1 
ATOM   1127 N N   . LYS A 1 145 ? 48.720 28.466 44.056 1.00 35.96 ? 145 LYS A N   1 
ATOM   1128 C CA  . LYS A 1 145 ? 50.100 28.094 44.205 1.00 33.03 ? 145 LYS A CA  1 
ATOM   1129 C C   . LYS A 1 145 ? 50.298 26.640 43.768 1.00 35.30 ? 145 LYS A C   1 
ATOM   1130 O O   . LYS A 1 145 ? 50.708 26.367 42.638 1.00 36.38 ? 145 LYS A O   1 
ATOM   1131 C CB  . LYS A 1 145 ? 50.460 28.216 45.692 1.00 26.83 ? 145 LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 145 ? 50.166 29.606 46.261 1.00 22.01 ? 145 LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 145 ? 51.314 30.581 46.019 1.00 17.73 ? 145 LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 145 ? 52.640 30.085 46.598 1.00 14.89 ? 145 LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 145 ? 53.681 29.894 45.577 1.00 12.58 ? 145 LYS A NZ  1 
ATOM   1136 N N   . PHE A 1 146 ? 49.954 25.587 44.705 1.00 36.68 ? 146 PHE A N   1 
ATOM   1137 C CA  . PHE A 1 146 ? 49.883 24.217 44.176 1.00 38.24 ? 146 PHE A CA  1 
ATOM   1138 C C   . PHE A 1 146 ? 48.524 23.591 44.504 1.00 39.23 ? 146 PHE A C   1 
ATOM   1139 O O   . PHE A 1 146 ? 47.691 23.369 43.614 1.00 40.31 ? 146 PHE A O   1 
ATOM   1140 C CB  . PHE A 1 146 ? 51.025 23.372 44.778 1.00 38.42 ? 146 PHE A CB  1 
ATOM   1141 C CG  . PHE A 1 146 ? 52.287 23.253 43.883 1.00 39.64 ? 146 PHE A CG  1 
ATOM   1142 C CD1 . PHE A 1 146 ? 52.883 24.390 43.304 1.00 39.20 ? 146 PHE A CD1 1 
ATOM   1143 C CD2 . PHE A 1 146 ? 52.864 21.993 43.645 1.00 39.88 ? 146 PHE A CD2 1 
ATOM   1144 C CE1 . PHE A 1 146 ? 54.031 24.266 42.504 1.00 38.21 ? 146 PHE A CE1 1 
ATOM   1145 C CE2 . PHE A 1 146 ? 54.012 21.873 42.845 1.00 40.01 ? 146 PHE A CE2 1 
ATOM   1146 C CZ  . PHE A 1 146 ? 54.595 23.008 42.276 1.00 39.04 ? 146 PHE A CZ  1 
ATOM   1147 N N   . ASP A 1 147 ? 48.479 23.379 45.852 1.00 39.80 ? 147 ASP A N   1 
ATOM   1148 C CA  . ASP A 1 147 ? 47.359 22.520 46.420 1.00 39.13 ? 147 ASP A CA  1 
ATOM   1149 C C   . ASP A 1 147 ? 47.918 21.702 47.633 1.00 39.67 ? 147 ASP A C   1 
ATOM   1150 O O   . ASP A 1 147 ? 49.123 21.405 47.703 1.00 38.86 ? 147 ASP A O   1 
ATOM   1151 C CB  . ASP A 1 147 ? 46.606 21.607 45.502 1.00 36.26 ? 147 ASP A CB  1 
ATOM   1152 C CG  . ASP A 1 147 ? 45.224 21.355 46.149 1.00 33.00 ? 147 ASP A CG  1 
ATOM   1153 O OD1 . ASP A 1 147 ? 45.143 21.044 47.409 1.00 29.77 ? 147 ASP A OD1 1 
ATOM   1154 O OD2 . ASP A 1 147 ? 44.144 21.480 45.464 1.00 30.66 ? 147 ASP A OD2 1 
ATOM   1155 N N   . ALA A 1 148 ? 47.219 21.221 48.648 1.00 40.81 ? 148 ALA A N   1 
ATOM   1156 C CA  . ALA A 1 148 ? 47.997 20.298 49.555 1.00 43.41 ? 148 ALA A CA  1 
ATOM   1157 C C   . ALA A 1 148 ? 47.256 19.090 50.108 1.00 44.58 ? 148 ALA A C   1 
ATOM   1158 C CB  . ALA A 1 148 ? 48.417 21.037 50.796 1.00 38.75 ? 148 ALA A CB  1 
ATOM   1159 N N   . ASN A 1 149 ? 47.822 17.866 50.054 1.00 44.55 ? 149 ASN A N   1 
ATOM   1160 C CA  . ASN A 1 149 ? 47.076 16.900 50.816 1.00 44.62 ? 149 ASN A CA  1 
ATOM   1161 C C   . ASN A 1 149 ? 47.597 15.681 51.488 1.00 43.71 ? 149 ASN A C   1 
ATOM   1162 O O   . ASN A 1 149 ? 47.598 14.577 50.930 1.00 43.30 ? 149 ASN A O   1 
ATOM   1163 C CB  . ASN A 1 149 ? 46.614 15.879 49.722 1.00 44.92 ? 149 ASN A CB  1 
ATOM   1164 C CG  . ASN A 1 149 ? 47.565 15.731 48.520 1.00 45.72 ? 149 ASN A CG  1 
ATOM   1165 O OD1 . ASN A 1 149 ? 48.194 14.684 48.350 1.00 46.25 ? 149 ASN A OD1 1 
ATOM   1166 N ND2 . ASN A 1 149 ? 47.703 16.716 47.651 1.00 43.83 ? 149 ASN A ND2 1 
ATOM   1167 N N   . SER A 1 150 ? 48.152 15.480 52.671 1.00 43.89 ? 150 SER A N   1 
ATOM   1168 C CA  . SER A 1 150 ? 47.739 14.301 53.459 1.00 45.00 ? 150 SER A CA  1 
ATOM   1169 C C   . SER A 1 150 ? 49.018 13.654 53.837 1.00 45.20 ? 150 SER A C   1 
ATOM   1170 O O   . SER A 1 150 ? 50.099 14.066 53.399 1.00 44.96 ? 150 SER A O   1 
ATOM   1171 C CB  . SER A 1 150 ? 46.220 13.904 53.343 1.00 44.94 ? 150 SER A CB  1 
ATOM   1172 O OG  . SER A 1 150 ? 45.954 13.336 52.070 1.00 44.69 ? 150 SER A OG  1 
ATOM   1173 N N   . HIS A 1 151 ? 48.933 12.681 54.611 1.00 45.15 ? 151 HIS A N   1 
ATOM   1174 C CA  . HIS A 1 151 ? 50.124 11.981 54.956 1.00 45.16 ? 151 HIS A CA  1 
ATOM   1175 C C   . HIS A 1 151 ? 50.057 10.502 54.555 1.00 44.75 ? 151 HIS A C   1 
ATOM   1176 O O   . HIS A 1 151 ? 49.110 9.781  54.875 1.00 45.86 ? 151 HIS A O   1 
ATOM   1177 C CB  . HIS A 1 151 ? 50.062 11.878 56.375 1.00 44.37 ? 151 HIS A CB  1 
ATOM   1178 C CG  . HIS A 1 151 ? 48.826 11.060 56.745 1.00 43.96 ? 151 HIS A CG  1 
ATOM   1179 N ND1 . HIS A 1 151 ? 48.904 9.710  57.068 1.00 43.12 ? 151 HIS A ND1 1 
ATOM   1180 C CD2 . HIS A 1 151 ? 47.510 11.394 56.812 1.00 42.26 ? 151 HIS A CD2 1 
ATOM   1181 C CE1 . HIS A 1 151 ? 47.681 9.276  57.312 1.00 42.01 ? 151 HIS A CE1 1 
ATOM   1182 N NE2 . HIS A 1 151 ? 46.838 10.267 57.164 1.00 42.26 ? 151 HIS A NE2 1 
ATOM   1183 N N   . ASN A 1 152 ? 51.967 10.713 54.021 1.00 44.21 ? 152 ASN A N   1 
ATOM   1184 C CA  . ASN A 1 152 ? 53.064 9.885  53.358 1.00 42.83 ? 152 ASN A CA  1 
ATOM   1185 C C   . ASN A 1 152 ? 54.473 10.195 54.054 1.00 41.20 ? 152 ASN A C   1 
ATOM   1186 O O   . ASN A 1 152 ? 54.541 10.952 55.033 1.00 40.39 ? 152 ASN A O   1 
ATOM   1187 C CB  . ASN A 1 152 ? 53.097 10.224 51.852 1.00 42.45 ? 152 ASN A CB  1 
ATOM   1188 C CG  . ASN A 1 152 ? 52.176 9.318  51.018 1.00 42.86 ? 152 ASN A CG  1 
ATOM   1189 O OD1 . ASN A 1 152 ? 52.484 9.010  49.866 1.00 42.98 ? 152 ASN A OD1 1 
ATOM   1190 N ND2 . ASN A 1 152 ? 51.051 8.858  51.537 1.00 40.97 ? 152 ASN A ND2 1 
ATOM   1191 N N   . ASP A 1 153 ? 55.544 9.653  53.528 1.00 39.28 ? 153 ASP A N   1 
ATOM   1192 C CA  . ASP A 1 153 ? 56.863 10.216 53.971 1.00 37.12 ? 153 ASP A CA  1 
ATOM   1193 C C   . ASP A 1 153 ? 57.635 10.913 52.817 1.00 36.05 ? 153 ASP A C   1 
ATOM   1194 O O   . ASP A 1 153 ? 58.169 12.047 52.992 1.00 35.43 ? 153 ASP A O   1 
ATOM   1195 C CB  . ASP A 1 153 ? 57.877 9.134  54.290 1.00 36.74 ? 153 ASP A CB  1 
ATOM   1196 C CG  . ASP A 1 153 ? 59.320 9.584  53.945 1.00 38.38 ? 153 ASP A CG  1 
ATOM   1197 O OD1 . ASP A 1 153 ? 59.787 10.673 54.453 1.00 38.78 ? 153 ASP A OD1 1 
ATOM   1198 O OD2 . ASP A 1 153 ? 60.087 8.885  53.152 1.00 39.30 ? 153 ASP A OD2 1 
ATOM   1199 N N   . ASP A 1 154 ? 57.132 11.794 51.429 1.00 33.73 ? 154 ASP A N   1 
ATOM   1200 C CA  . ASP A 1 154 ? 57.627 12.979 50.730 1.00 32.52 ? 154 ASP A CA  1 
ATOM   1201 C C   . ASP A 1 154 ? 56.555 14.072 50.859 1.00 30.52 ? 154 ASP A C   1 
ATOM   1202 O O   . ASP A 1 154 ? 56.846 15.158 51.356 1.00 28.72 ? 154 ASP A O   1 
ATOM   1203 C CB  . ASP A 1 154 ? 57.930 12.679 49.246 1.00 31.80 ? 154 ASP A CB  1 
ATOM   1204 C CG  . ASP A 1 154 ? 59.032 13.605 48.741 1.00 31.10 ? 154 ASP A CG  1 
ATOM   1205 O OD1 . ASP A 1 154 ? 60.187 13.400 49.103 1.00 30.47 ? 154 ASP A OD1 1 
ATOM   1206 O OD2 . ASP A 1 154 ? 58.761 14.529 47.989 1.00 30.57 ? 154 ASP A OD2 1 
ATOM   1207 N N   . ALA A 1 155 ? 55.294 13.715 50.544 1.00 27.20 ? 155 ALA A N   1 
ATOM   1208 C CA  . ALA A 1 155 ? 54.098 14.552 50.510 1.00 25.99 ? 155 ALA A CA  1 
ATOM   1209 C C   . ALA A 1 155 ? 54.141 15.776 51.342 1.00 24.85 ? 155 ALA A C   1 
ATOM   1210 O O   . ALA A 1 155 ? 53.764 16.838 50.889 1.00 23.64 ? 155 ALA A O   1 
ATOM   1211 C CB  . ALA A 1 155 ? 52.837 13.839 50.972 1.00 25.07 ? 155 ALA A CB  1 
ATOM   1212 N N   . LEU A 1 156 ? 54.661 15.633 52.546 1.00 24.93 ? 156 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 156 ? 54.719 16.755 53.466 1.00 24.87 ? 156 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 156 ? 55.800 17.702 53.027 1.00 25.60 ? 156 LEU A C   1 
ATOM   1215 O O   . LEU A 1 156 ? 55.541 18.875 53.214 1.00 26.21 ? 156 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 156 ? 55.028 16.392 54.927 1.00 23.56 ? 156 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 156 ? 55.464 14.999 55.251 1.00 23.71 ? 156 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 156 ? 56.831 15.087 55.952 1.00 23.03 ? 156 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 156 ? 54.261 14.276 55.900 1.00 22.54 ? 156 LEU A CD2 1 
ATOM   1220 N N   . LEU A 1 157 ? 56.990 17.377 52.507 1.00 25.22 ? 157 LEU A N   1 
ATOM   1221 C CA  . LEU A 1 157 ? 57.830 18.414 51.944 1.00 24.41 ? 157 LEU A CA  1 
ATOM   1222 C C   . LEU A 1 157 ? 57.210 18.952 50.653 1.00 25.00 ? 157 LEU A C   1 
ATOM   1223 O O   . LEU A 1 157 ? 57.687 19.979 50.148 1.00 25.85 ? 157 LEU A O   1 
ATOM   1224 C CB  . LEU A 1 157 ? 59.218 17.873 51.689 1.00 23.19 ? 157 LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 157 ? 60.139 18.144 52.850 1.00 22.60 ? 157 LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 157 ? 61.489 17.566 52.545 1.00 20.88 ? 157 LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 157 ? 60.341 19.612 53.055 1.00 20.24 ? 157 LEU A CD2 1 
ATOM   1228 N N   . LYS A 1 158 ? 56.154 18.308 50.092 1.00 24.54 ? 158 LYS A N   1 
ATOM   1229 C CA  . LYS A 1 158 ? 55.386 18.992 49.033 1.00 24.12 ? 158 LYS A CA  1 
ATOM   1230 C C   . LYS A 1 158 ? 54.772 20.119 49.870 1.00 24.06 ? 158 LYS A C   1 
ATOM   1231 O O   . LYS A 1 158 ? 55.186 21.259 49.665 1.00 23.30 ? 158 LYS A O   1 
ATOM   1232 C CB  . LYS A 1 158 ? 54.201 18.148 48.341 1.00 23.04 ? 158 LYS A CB  1 
ATOM   1233 C CG  . LYS A 1 158 ? 54.349 17.262 47.037 1.00 20.54 ? 158 LYS A CG  1 
ATOM   1234 C CD  . LYS A 1 158 ? 55.489 16.205 47.081 1.00 20.23 ? 158 LYS A CD  1 
ATOM   1235 C CE  . LYS A 1 158 ? 55.508 15.013 46.074 1.00 19.62 ? 158 LYS A CE  1 
ATOM   1236 N NZ  . LYS A 1 158 ? 56.767 14.244 46.179 1.00 16.92 ? 158 LYS A NZ  1 
ATOM   1237 N N   . ASN A 1 159 ? 54.030 19.721 50.941 1.00 24.68 ? 159 ASN A N   1 
ATOM   1238 C CA  . ASN A 1 159 ? 53.321 20.540 51.945 1.00 25.68 ? 159 ASN A CA  1 
ATOM   1239 C C   . ASN A 1 159 ? 53.949 21.708 52.664 1.00 25.02 ? 159 ASN A C   1 
ATOM   1240 O O   . ASN A 1 159 ? 53.448 22.824 52.605 1.00 24.08 ? 159 ASN A O   1 
ATOM   1241 C CB  . ASN A 1 159 ? 52.815 19.657 53.000 1.00 28.04 ? 159 ASN A CB  1 
ATOM   1242 C CG  . ASN A 1 159 ? 51.428 19.272 52.610 1.00 32.61 ? 159 ASN A CG  1 
ATOM   1243 O OD1 . ASN A 1 159 ? 50.558 20.038 52.994 1.00 34.36 ? 159 ASN A OD1 1 
ATOM   1244 N ND2 . ASN A 1 159 ? 51.098 18.219 51.829 1.00 33.55 ? 159 ASN A ND2 1 
ATOM   1245 N N   . TYR A 1 160 ? 55.115 21.445 53.239 1.00 26.05 ? 160 TYR A N   1 
ATOM   1246 C CA  . TYR A 1 160 ? 56.015 22.349 53.904 1.00 27.29 ? 160 TYR A CA  1 
ATOM   1247 C C   . TYR A 1 160 ? 56.021 23.661 53.180 1.00 25.30 ? 160 TYR A C   1 
ATOM   1248 O O   . TYR A 1 160 ? 55.609 24.677 53.710 1.00 25.83 ? 160 TYR A O   1 
ATOM   1249 C CB  . TYR A 1 160 ? 57.423 21.727 53.904 1.00 30.83 ? 160 TYR A CB  1 
ATOM   1250 C CG  . TYR A 1 160 ? 58.721 22.535 53.658 1.00 35.34 ? 160 TYR A CG  1 
ATOM   1251 C CD1 . TYR A 1 160 ? 59.203 22.773 52.373 1.00 37.11 ? 160 TYR A CD1 1 
ATOM   1252 C CD2 . TYR A 1 160 ? 59.511 22.946 54.724 1.00 36.62 ? 160 TYR A CD2 1 
ATOM   1253 C CE1 . TYR A 1 160 ? 60.434 23.391 52.186 1.00 37.94 ? 160 TYR A CE1 1 
ATOM   1254 C CE2 . TYR A 1 160 ? 60.742 23.568 54.537 1.00 37.50 ? 160 TYR A CE2 1 
ATOM   1255 C CZ  . TYR A 1 160 ? 61.206 23.784 53.263 1.00 38.03 ? 160 TYR A CZ  1 
ATOM   1256 O OH  . TYR A 1 160 ? 62.436 24.370 53.055 1.00 37.80 ? 160 TYR A OH  1 
ATOM   1257 N N   . GLY A 1 161 ? 56.381 23.564 51.907 1.00 24.07 ? 161 GLY A N   1 
ATOM   1258 C CA  . GLY A 1 161 ? 56.527 24.717 51.067 1.00 24.69 ? 161 GLY A CA  1 
ATOM   1259 C C   . GLY A 1 161 ? 55.385 25.723 51.224 1.00 24.81 ? 161 GLY A C   1 
ATOM   1260 O O   . GLY A 1 161 ? 55.670 26.869 51.561 1.00 25.47 ? 161 GLY A O   1 
ATOM   1261 N N   . LEU A 1 162 ? 54.110 25.359 51.079 1.00 22.33 ? 162 LEU A N   1 
ATOM   1262 C CA  . LEU A 1 162 ? 53.121 26.392 51.138 1.00 21.04 ? 162 LEU A CA  1 
ATOM   1263 C C   . LEU A 1 162 ? 53.122 26.964 52.537 1.00 21.31 ? 162 LEU A C   1 
ATOM   1264 O O   . LEU A 1 162 ? 53.222 28.180 52.651 1.00 20.00 ? 162 LEU A O   1 
ATOM   1265 C CB  . LEU A 1 162 ? 51.783 25.783 50.677 1.00 19.81 ? 162 LEU A CB  1 
ATOM   1266 C CG  . LEU A 1 162 ? 51.307 25.690 49.161 1.00 17.87 ? 162 LEU A CG  1 
ATOM   1267 C CD1 . LEU A 1 162 ? 52.296 26.349 48.189 1.00 13.40 ? 162 LEU A CD1 1 
ATOM   1268 C CD2 . LEU A 1 162 ? 51.071 24.196 48.839 1.00 17.40 ? 162 LEU A CD2 1 
ATOM   1269 N N   . LEU A 1 163 ? 53.285 26.127 53.560 1.00 22.99 ? 163 LEU A N   1 
ATOM   1270 C CA  . LEU A 1 163 ? 53.359 26.564 54.964 1.00 24.39 ? 163 LEU A CA  1 
ATOM   1271 C C   . LEU A 1 163 ? 54.625 27.325 55.257 1.00 25.94 ? 163 LEU A C   1 
ATOM   1272 O O   . LEU A 1 163 ? 54.781 27.845 56.371 1.00 26.88 ? 163 LEU A O   1 
ATOM   1273 C CB  . LEU A 1 163 ? 53.334 25.409 56.033 1.00 22.60 ? 163 LEU A CB  1 
ATOM   1274 C CG  . LEU A 1 163 ? 52.044 25.269 56.819 1.00 21.20 ? 163 LEU A CG  1 
ATOM   1275 C CD1 . LEU A 1 163 ? 51.433 26.650 57.047 1.00 21.31 ? 163 LEU A CD1 1 
ATOM   1276 C CD2 . LEU A 1 163 ? 50.984 24.547 56.019 1.00 19.90 ? 163 LEU A CD2 1 
ATOM   1277 N N   . TYR A 1 164 ? 55.567 27.318 54.314 1.00 25.66 ? 164 TYR A N   1 
ATOM   1278 C CA  . TYR A 1 164 ? 56.663 28.222 54.476 1.00 26.96 ? 164 TYR A CA  1 
ATOM   1279 C C   . TYR A 1 164 ? 56.217 29.463 53.693 1.00 28.38 ? 164 TYR A C   1 
ATOM   1280 O O   . TYR A 1 164 ? 56.118 30.500 54.341 1.00 28.87 ? 164 TYR A O   1 
ATOM   1281 C CB  . TYR A 1 164 ? 57.975 27.701 53.900 1.00 23.95 ? 164 TYR A CB  1 
ATOM   1282 C CG  . TYR A 1 164 ? 59.165 28.541 54.349 1.00 21.74 ? 164 TYR A CG  1 
ATOM   1283 C CD1 . TYR A 1 164 ? 59.068 29.898 54.640 1.00 21.32 ? 164 TYR A CD1 1 
ATOM   1284 C CD2 . TYR A 1 164 ? 60.360 27.901 54.509 1.00 20.63 ? 164 TYR A CD2 1 
ATOM   1285 C CE1 . TYR A 1 164 ? 60.153 30.620 55.074 1.00 21.88 ? 164 TYR A CE1 1 
ATOM   1286 C CE2 . TYR A 1 164 ? 61.454 28.614 54.941 1.00 22.23 ? 164 TYR A CE2 1 
ATOM   1287 C CZ  . TYR A 1 164 ? 61.350 29.961 55.227 1.00 22.68 ? 164 TYR A CZ  1 
ATOM   1288 O OH  . TYR A 1 164 ? 62.480 30.632 55.648 1.00 23.63 ? 164 TYR A OH  1 
ATOM   1289 N N   . CYS A 1 165 ? 55.988 29.461 52.365 1.00 30.74 ? 165 CYS A N   1 
ATOM   1290 C CA  . CYS A 1 165 ? 55.587 30.609 51.562 1.00 30.76 ? 165 CYS A CA  1 
ATOM   1291 C C   . CYS A 1 165 ? 54.463 31.389 52.195 1.00 29.93 ? 165 CYS A C   1 
ATOM   1292 O O   . CYS A 1 165 ? 54.600 32.589 52.049 1.00 31.18 ? 165 CYS A O   1 
ATOM   1293 C CB  . CYS A 1 165 ? 55.142 30.203 50.145 1.00 33.51 ? 165 CYS A CB  1 
ATOM   1294 S SG  . CYS A 1 165 ? 56.545 29.760 49.082 1.00 36.68 ? 165 CYS A SG  1 
ATOM   1295 N N   . PHE A 1 166 ? 53.442 30.922 52.963 1.00 27.42 ? 166 PHE A N   1 
ATOM   1296 C CA  . PHE A 1 166 ? 52.396 31.752 53.586 1.00 24.32 ? 166 PHE A CA  1 
ATOM   1297 C C   . PHE A 1 166 ? 53.042 32.627 54.691 1.00 24.63 ? 166 PHE A C   1 
ATOM   1298 O O   . PHE A 1 166 ? 52.425 33.460 55.329 1.00 25.43 ? 166 PHE A O   1 
ATOM   1299 C CB  . PHE A 1 166 ? 51.366 30.721 54.014 1.00 19.03 ? 166 PHE A CB  1 
ATOM   1300 C CG  . PHE A 1 166 ? 49.959 30.977 54.543 1.00 17.81 ? 166 PHE A CG  1 
ATOM   1301 C CD1 . PHE A 1 166 ? 49.179 32.080 54.276 1.00 19.58 ? 166 PHE A CD1 1 
ATOM   1302 C CD2 . PHE A 1 166 ? 49.463 30.013 55.429 1.00 16.95 ? 166 PHE A CD2 1 
ATOM   1303 C CE1 . PHE A 1 166 ? 47.934 32.163 54.932 1.00 19.26 ? 166 PHE A CE1 1 
ATOM   1304 C CE2 . PHE A 1 166 ? 48.248 30.090 56.068 1.00 14.40 ? 166 PHE A CE2 1 
ATOM   1305 C CZ  . PHE A 1 166 ? 47.469 31.186 55.817 1.00 16.80 ? 166 PHE A CZ  1 
ATOM   1306 N N   . ARG A 1 167 ? 54.363 32.565 54.874 1.00 25.17 ? 167 ARG A N   1 
ATOM   1307 C CA  . ARG A 1 167 ? 55.187 33.461 55.679 1.00 25.51 ? 167 ARG A CA  1 
ATOM   1308 C C   . ARG A 1 167 ? 55.661 34.509 54.661 1.00 25.60 ? 167 ARG A C   1 
ATOM   1309 O O   . ARG A 1 167 ? 55.299 35.691 54.694 1.00 25.91 ? 167 ARG A O   1 
ATOM   1310 C CB  . ARG A 1 167 ? 56.336 32.579 56.305 1.00 25.47 ? 167 ARG A CB  1 
ATOM   1311 C CG  . ARG A 1 167 ? 57.501 33.038 57.182 1.00 26.64 ? 167 ARG A CG  1 
ATOM   1312 C CD  . ARG A 1 167 ? 58.908 33.354 56.584 1.00 29.19 ? 167 ARG A CD  1 
ATOM   1313 N NE  . ARG A 1 167 ? 58.944 34.440 55.598 1.00 31.29 ? 167 ARG A NE  1 
ATOM   1314 C CZ  . ARG A 1 167 ? 59.967 35.280 55.350 1.00 31.75 ? 167 ARG A CZ  1 
ATOM   1315 N NH1 . ARG A 1 167 ? 61.144 35.267 55.988 1.00 30.78 ? 167 ARG A NH1 1 
ATOM   1316 N NH2 . ARG A 1 167 ? 59.776 36.193 54.396 1.00 33.93 ? 167 ARG A NH2 1 
ATOM   1317 N N   . LYS A 1 168 ? 56.434 34.024 53.678 1.00 24.45 ? 168 LYS A N   1 
ATOM   1318 C CA  . LYS A 1 168 ? 57.138 34.793 52.654 1.00 23.35 ? 168 LYS A CA  1 
ATOM   1319 C C   . LYS A 1 168 ? 56.224 35.337 51.567 1.00 22.81 ? 168 LYS A C   1 
ATOM   1320 O O   . LYS A 1 168 ? 56.718 35.991 50.650 1.00 23.99 ? 168 LYS A O   1 
ATOM   1321 C CB  . LYS A 1 168 ? 58.256 33.899 52.029 1.00 23.69 ? 168 LYS A CB  1 
ATOM   1322 C CG  . LYS A 1 168 ? 59.268 34.426 50.920 1.00 23.71 ? 168 LYS A CG  1 
ATOM   1323 C CD  . LYS A 1 168 ? 60.286 33.354 50.440 1.00 18.12 ? 168 LYS A CD  1 
ATOM   1324 C CE  . LYS A 1 168 ? 61.401 34.012 49.662 1.00 17.67 ? 168 LYS A CE  1 
ATOM   1325 N NZ  . LYS A 1 168 ? 62.367 34.737 50.468 1.00 15.68 ? 168 LYS A NZ  1 
ATOM   1326 N N   . ASP A 1 169 ? 54.906 35.109 51.560 1.00 21.22 ? 169 ASP A N   1 
ATOM   1327 C CA  . ASP A 1 169 ? 54.016 35.732 50.613 1.00 19.37 ? 169 ASP A CA  1 
ATOM   1328 C C   . ASP A 1 169 ? 52.831 36.210 51.422 1.00 20.25 ? 169 ASP A C   1 
ATOM   1329 O O   . ASP A 1 169 ? 51.664 36.151 51.084 1.00 19.43 ? 169 ASP A O   1 
ATOM   1330 C CB  . ASP A 1 169 ? 53.755 34.692 49.519 1.00 18.19 ? 169 ASP A CB  1 
ATOM   1331 C CG  . ASP A 1 169 ? 52.544 33.795 49.489 1.00 17.35 ? 169 ASP A CG  1 
ATOM   1332 O OD1 . ASP A 1 169 ? 51.449 34.300 49.325 1.00 15.04 ? 169 ASP A OD1 1 
ATOM   1333 O OD2 . ASP A 1 169 ? 52.693 32.584 49.523 1.00 18.62 ? 169 ASP A OD2 1 
ATOM   1334 N N   . MET A 1 170 ? 53.239 36.821 52.539 1.00 23.02 ? 170 MET A N   1 
ATOM   1335 C CA  . MET A 1 170 ? 52.353 37.452 53.526 1.00 24.90 ? 170 MET A CA  1 
ATOM   1336 C C   . MET A 1 170 ? 53.163 38.570 54.152 1.00 24.60 ? 170 MET A C   1 
ATOM   1337 O O   . MET A 1 170 ? 52.548 39.611 54.423 1.00 24.19 ? 170 MET A O   1 
ATOM   1338 C CB  . MET A 1 170 ? 51.915 36.553 54.708 1.00 26.42 ? 170 MET A CB  1 
ATOM   1339 C CG  . MET A 1 170 ? 50.418 36.509 54.953 1.00 27.45 ? 170 MET A CG  1 
ATOM   1340 S SD  . MET A 1 170 ? 49.557 35.439 53.773 1.00 31.21 ? 170 MET A SD  1 
ATOM   1341 C CE  . MET A 1 170 ? 47.966 36.195 53.576 1.00 30.33 ? 170 MET A CE  1 
ATOM   1342 N N   . ASP A 1 171 ? 54.511 38.500 54.356 1.00 23.89 ? 171 ASP A N   1 
ATOM   1343 C CA  . ASP A 1 171 ? 55.283 39.673 54.848 1.00 22.65 ? 171 ASP A CA  1 
ATOM   1344 C C   . ASP A 1 171 ? 54.973 40.829 53.907 1.00 20.53 ? 171 ASP A C   1 
ATOM   1345 O O   . ASP A 1 171 ? 55.040 41.964 54.344 1.00 19.30 ? 171 ASP A O   1 
ATOM   1346 C CB  . ASP A 1 171 ? 56.851 39.379 54.910 1.00 24.57 ? 171 ASP A CB  1 
ATOM   1347 C CG  . ASP A 1 171 ? 57.959 40.457 54.832 1.00 26.77 ? 171 ASP A CG  1 
ATOM   1348 O OD1 . ASP A 1 171 ? 57.668 41.637 55.048 1.00 28.16 ? 171 ASP A OD1 1 
ATOM   1349 O OD2 . ASP A 1 171 ? 59.125 40.104 54.540 1.00 26.63 ? 171 ASP A OD2 1 
ATOM   1350 N N   . LYS A 1 172 ? 54.479 40.513 52.703 1.00 17.94 ? 172 LYS A N   1 
ATOM   1351 C CA  . LYS A 1 172 ? 54.048 41.501 51.752 1.00 17.38 ? 172 LYS A CA  1 
ATOM   1352 C C   . LYS A 1 172 ? 52.541 41.884 51.691 1.00 18.24 ? 172 LYS A C   1 
ATOM   1353 O O   . LYS A 1 172 ? 52.276 43.056 51.403 1.00 18.24 ? 172 LYS A O   1 
ATOM   1354 C CB  . LYS A 1 172 ? 54.555 40.995 50.463 1.00 13.20 ? 172 LYS A CB  1 
ATOM   1355 C CG  . LYS A 1 172 ? 56.091 41.056 50.519 1.00 10.47 ? 172 LYS A CG  1 
ATOM   1356 C CD  . LYS A 1 172 ? 56.650 40.416 49.301 1.00 5.74  ? 172 LYS A CD  1 
ATOM   1357 C CE  . LYS A 1 172 ? 56.680 38.929 49.647 1.00 7.50  ? 172 LYS A CE  1 
ATOM   1358 N NZ  . LYS A 1 172 ? 58.053 38.557 49.966 1.00 9.08  ? 172 LYS A NZ  1 
ATOM   1359 N N   . VAL A 1 173 ? 51.477 41.107 52.044 1.00 19.19 ? 173 VAL A N   1 
ATOM   1360 C CA  . VAL A 1 173 ? 50.080 41.571 51.843 1.00 17.56 ? 173 VAL A CA  1 
ATOM   1361 C C   . VAL A 1 173 ? 49.746 42.581 52.918 1.00 18.97 ? 173 VAL A C   1 
ATOM   1362 O O   . VAL A 1 173 ? 48.853 43.405 52.786 1.00 19.32 ? 173 VAL A O   1 
ATOM   1363 C CB  . VAL A 1 173 ? 48.977 40.507 51.989 1.00 14.33 ? 173 VAL A CB  1 
ATOM   1364 C CG1 . VAL A 1 173 ? 47.815 40.945 51.143 1.00 13.17 ? 173 VAL A CG1 1 
ATOM   1365 C CG2 . VAL A 1 173 ? 49.449 39.123 51.599 1.00 15.88 ? 173 VAL A CG2 1 
ATOM   1366 N N   . GLU A 1 174 ? 50.510 42.562 53.997 1.00 20.00 ? 174 GLU A N   1 
ATOM   1367 C CA  . GLU A 1 174 ? 50.210 43.380 55.157 1.00 20.49 ? 174 GLU A CA  1 
ATOM   1368 C C   . GLU A 1 174 ? 51.233 44.456 55.393 1.00 20.46 ? 174 GLU A C   1 
ATOM   1369 O O   . GLU A 1 174 ? 50.868 45.589 55.704 1.00 21.86 ? 174 GLU A O   1 
ATOM   1370 C CB  . GLU A 1 174 ? 50.153 42.584 56.436 0.00 27.03 ? 174 GLU A CB  1 
ATOM   1371 C CG  . GLU A 1 174 ? 50.965 41.306 56.361 0.00 27.80 ? 174 GLU A CG  1 
ATOM   1372 C CD  . GLU A 1 174 ? 50.165 40.052 56.055 0.00 28.31 ? 174 GLU A CD  1 
ATOM   1373 O OE1 . GLU A 1 174 ? 49.295 40.019 55.181 0.00 28.97 ? 174 GLU A OE1 1 
ATOM   1374 O OE2 . GLU A 1 174 ? 50.464 39.070 56.713 0.00 28.99 ? 174 GLU A OE2 1 
ATOM   1375 N N   . THR A 1 175 ? 52.522 44.117 55.328 1.00 19.34 ? 175 THR A N   1 
ATOM   1376 C CA  . THR A 1 175 ? 53.517 45.117 55.510 1.00 17.29 ? 175 THR A CA  1 
ATOM   1377 C C   . THR A 1 175 ? 53.340 46.002 54.306 1.00 18.08 ? 175 THR A C   1 
ATOM   1378 O O   . THR A 1 175 ? 53.120 47.180 54.553 1.00 15.62 ? 175 THR A O   1 
ATOM   1379 C CB  . THR A 1 175 ? 54.834 44.390 55.584 1.00 17.13 ? 175 THR A CB  1 
ATOM   1380 O OG1 . THR A 1 175 ? 54.794 43.476 56.699 1.00 15.56 ? 175 THR A OG1 1 
ATOM   1381 C CG2 . THR A 1 175 ? 55.966 45.366 55.731 1.00 17.89 ? 175 THR A CG2 1 
ATOM   1382 N N   . PHE A 1 176 ? 53.280 45.434 53.072 1.00 21.18 ? 176 PHE A N   1 
ATOM   1383 C CA  . PHE A 1 176 ? 52.979 46.210 51.860 1.00 22.14 ? 176 PHE A CA  1 
ATOM   1384 C C   . PHE A 1 176 ? 51.547 46.681 51.742 1.00 22.72 ? 176 PHE A C   1 
ATOM   1385 O O   . PHE A 1 176 ? 51.250 47.458 50.815 1.00 25.04 ? 176 PHE A O   1 
ATOM   1386 C CB  . PHE A 1 176 ? 53.174 45.525 50.551 1.00 21.57 ? 176 PHE A CB  1 
ATOM   1387 C CG  . PHE A 1 176 ? 54.586 45.155 50.270 1.00 22.42 ? 176 PHE A CG  1 
ATOM   1388 C CD1 . PHE A 1 176 ? 55.633 45.718 50.994 1.00 21.63 ? 176 PHE A CD1 1 
ATOM   1389 C CD2 . PHE A 1 176 ? 54.789 44.203 49.286 1.00 22.48 ? 176 PHE A CD2 1 
ATOM   1390 C CE1 . PHE A 1 176 ? 56.905 45.288 50.666 1.00 22.97 ? 176 PHE A CE1 1 
ATOM   1391 C CE2 . PHE A 1 176 ? 56.062 43.804 48.989 1.00 22.38 ? 176 PHE A CE2 1 
ATOM   1392 C CZ  . PHE A 1 176 ? 57.113 44.328 49.684 1.00 22.76 ? 176 PHE A CZ  1 
ATOM   1393 N N   . LEU A 1 177 ? 50.596 46.235 52.559 1.00 21.83 ? 177 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 177 ? 49.447 47.089 52.597 1.00 20.79 ? 177 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 177 ? 49.681 48.082 53.744 1.00 22.74 ? 177 LEU A C   1 
ATOM   1396 O O   . LEU A 1 177 ? 49.118 49.195 53.730 1.00 23.88 ? 177 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 177 ? 48.206 46.313 52.807 1.00 17.55 ? 177 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 177 ? 47.539 45.916 51.538 1.00 15.92 ? 177 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 177 ? 46.329 45.070 51.860 1.00 13.47 ? 177 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 177 ? 47.110 47.138 50.813 1.00 14.57 ? 177 LEU A CD2 1 
ATOM   1401 N N   . ARG A 1 178 ? 50.598 47.821 54.688 1.00 23.13 ? 178 ARG A N   1 
ATOM   1402 C CA  . ARG A 1 178 ? 50.812 48.724 55.797 1.00 23.37 ? 178 ARG A CA  1 
ATOM   1403 C C   . ARG A 1 178 ? 51.354 49.950 55.147 1.00 22.94 ? 178 ARG A C   1 
ATOM   1404 O O   . ARG A 1 178 ? 50.868 51.015 55.539 1.00 23.11 ? 178 ARG A O   1 
ATOM   1405 C CB  . ARG A 1 178 ? 51.866 48.350 56.804 1.00 25.09 ? 178 ARG A CB  1 
ATOM   1406 C CG  . ARG A 1 178 ? 51.921 49.344 57.986 1.00 26.68 ? 178 ARG A CG  1 
ATOM   1407 C CD  . ARG A 1 178 ? 53.169 49.233 58.818 1.00 27.21 ? 178 ARG A CD  1 
ATOM   1408 N NE  . ARG A 1 178 ? 53.268 47.840 59.195 1.00 28.36 ? 178 ARG A NE  1 
ATOM   1409 C CZ  . ARG A 1 178 ? 54.364 47.144 58.899 1.00 30.21 ? 178 ARG A CZ  1 
ATOM   1410 N NH1 . ARG A 1 178 ? 55.406 47.717 58.270 1.00 30.79 ? 178 ARG A NH1 1 
ATOM   1411 N NH2 . ARG A 1 178 ? 54.369 45.833 59.155 1.00 28.65 ? 178 ARG A NH2 1 
ATOM   1412 N N   . ILE A 1 179 ? 52.202 49.830 54.104 1.00 22.17 ? 179 ILE A N   1 
ATOM   1413 C CA  . ILE A 1 179 ? 52.742 51.022 53.473 1.00 21.57 ? 179 ILE A CA  1 
ATOM   1414 C C   . ILE A 1 179 ? 51.610 51.893 52.990 1.00 23.16 ? 179 ILE A C   1 
ATOM   1415 O O   . ILE A 1 179 ? 51.565 53.029 53.445 1.00 24.22 ? 179 ILE A O   1 
ATOM   1416 C CB  . ILE A 1 179 ? 53.621 50.731 52.300 1.00 20.10 ? 179 ILE A CB  1 
ATOM   1417 C CG1 . ILE A 1 179 ? 54.434 49.475 52.325 1.00 17.17 ? 179 ILE A CG1 1 
ATOM   1418 C CG2 . ILE A 1 179 ? 54.719 51.700 52.513 1.00 19.82 ? 179 ILE A CG2 1 
ATOM   1419 C CD1 . ILE A 1 179 ? 54.968 49.088 50.971 0.00 17.64 ? 179 ILE A CD1 1 
ATOM   1420 N N   . VAL A 1 180 ? 50.613 51.360 52.278 1.00 23.45 ? 180 VAL A N   1 
ATOM   1421 C CA  . VAL A 1 180 ? 49.543 52.213 51.778 1.00 24.08 ? 180 VAL A CA  1 
ATOM   1422 C C   . VAL A 1 180 ? 48.715 52.732 52.954 1.00 27.67 ? 180 VAL A C   1 
ATOM   1423 O O   . VAL A 1 180 ? 48.189 53.839 52.800 1.00 29.33 ? 180 VAL A O   1 
ATOM   1424 C CB  . VAL A 1 180 ? 48.604 51.478 50.618 1.00 22.61 ? 180 VAL A CB  1 
ATOM   1425 C CG1 . VAL A 1 180 ? 49.100 50.066 50.333 1.00 20.95 ? 180 VAL A CG1 1 
ATOM   1426 C CG2 . VAL A 1 180 ? 47.120 51.415 50.971 1.00 20.78 ? 180 VAL A CG2 1 
ATOM   1427 N N   . GLN A 1 181 ? 48.859 51.743 54.441 1.00 30.14 ? 181 GLN A N   1 
ATOM   1428 C CA  . GLN A 1 181 ? 47.995 52.664 55.178 1.00 31.59 ? 181 GLN A CA  1 
ATOM   1429 C C   . GLN A 1 181 ? 48.830 53.756 55.862 1.00 33.43 ? 181 GLN A C   1 
ATOM   1430 O O   . GLN A 1 181 ? 48.290 54.713 56.435 1.00 33.89 ? 181 GLN A O   1 
ATOM   1431 C CB  . GLN A 1 181 ? 47.119 51.902 56.211 1.00 32.47 ? 181 GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 181 ? 47.880 51.251 57.379 1.00 32.47 ? 181 GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 181 ? 46.953 50.797 58.534 1.00 32.63 ? 181 GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 181 ? 45.732 50.720 58.369 1.00 31.86 ? 181 GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 181 ? 47.460 50.488 59.715 1.00 32.34 ? 181 GLN A NE2 1 
ATOM   1436 N N   . CYS A 1 182 ? 50.159 53.695 55.844 1.00 35.88 ? 182 CYS A N   1 
ATOM   1437 C CA  . CYS A 1 182 ? 50.996 54.749 56.433 1.00 40.15 ? 182 CYS A CA  1 
ATOM   1438 C C   . CYS A 1 182 ? 51.745 55.443 55.290 1.00 39.82 ? 182 CYS A C   1 
ATOM   1439 O O   . CYS A 1 182 ? 52.976 55.586 55.333 1.00 38.67 ? 182 CYS A O   1 
ATOM   1440 C CB  . CYS A 1 182 ? 51.955 54.143 57.460 1.00 44.82 ? 182 CYS A CB  1 
ATOM   1441 S SG  . CYS A 1 182 ? 51.287 52.597 58.253 1.00 48.77 ? 182 CYS A SG  1 
ATOM   1442 N N   . ARG A 1 183 ? 50.921 55.824 54.322 1.00 40.23 ? 183 ARG A N   1 
ATOM   1443 C CA  . ARG A 1 183 ? 51.315 56.499 53.063 1.00 40.47 ? 183 ARG A CA  1 
ATOM   1444 C C   . ARG A 1 183 ? 50.094 57.246 52.521 1.00 40.00 ? 183 ARG A C   1 
ATOM   1445 O O   . ARG A 1 183 ? 50.129 58.456 52.284 1.00 40.42 ? 183 ARG A O   1 
ATOM   1446 C CB  . ARG A 1 183 ? 51.727 55.440 52.019 1.00 40.29 ? 183 ARG A CB  1 
ATOM   1447 C CG  . ARG A 1 183 ? 52.748 55.882 50.931 1.00 42.06 ? 183 ARG A CG  1 
ATOM   1448 C CD  . ARG A 1 183 ? 53.493 54.647 50.385 1.00 43.72 ? 183 ARG A CD  1 
ATOM   1449 N NE  . ARG A 1 183 ? 54.090 54.803 49.050 1.00 46.90 ? 183 ARG A NE  1 
ATOM   1450 C CZ  . ARG A 1 183 ? 54.431 53.760 48.265 1.00 49.10 ? 183 ARG A CZ  1 
ATOM   1451 N NH1 . ARG A 1 183 ? 54.216 52.494 48.661 1.00 49.25 ? 183 ARG A NH1 1 
ATOM   1452 N NH2 . ARG A 1 183 ? 55.006 53.876 47.060 1.00 49.41 ? 183 ARG A NH2 1 
ATOM   1453 N N   . SER A 1 184 ? 48.812 56.527 52.740 1.00 39.47 ? 184 SER A N   1 
ATOM   1454 C CA  . SER A 1 184 ? 47.567 57.132 52.274 1.00 39.66 ? 184 SER A CA  1 
ATOM   1455 C C   . SER A 1 184 ? 46.623 57.687 53.360 1.00 40.89 ? 184 SER A C   1 
ATOM   1456 O O   . SER A 1 184 ? 45.506 58.125 53.037 1.00 39.34 ? 184 SER A O   1 
ATOM   1457 C CB  . SER A 1 184 ? 46.820 56.105 51.380 1.00 39.28 ? 184 SER A CB  1 
ATOM   1458 O OG  . SER A 1 184 ? 47.509 55.662 50.194 1.00 37.76 ? 184 SER A OG  1 
ATOM   1459 N N   . VAL A 1 185 ? 47.010 57.674 54.654 1.00 43.24 ? 185 VAL A N   1 
ATOM   1460 C CA  . VAL A 1 185 ? 46.296 58.386 55.732 1.00 46.22 ? 185 VAL A CA  1 
ATOM   1461 C C   . VAL A 1 185 ? 47.340 58.989 56.671 1.00 47.46 ? 185 VAL A C   1 
ATOM   1462 O O   . VAL A 1 185 ? 48.559 58.782 56.522 1.00 49.32 ? 185 VAL A O   1 
ATOM   1463 C CB  . VAL A 1 185 ? 45.365 57.589 56.760 1.00 47.20 ? 185 VAL A CB  1 
ATOM   1464 C CG1 . VAL A 1 185 ? 43.989 57.313 56.145 1.00 47.68 ? 185 VAL A CG1 1 
ATOM   1465 C CG2 . VAL A 1 185 ? 46.085 56.339 57.238 1.00 48.17 ? 185 VAL A CG2 1 
ATOM   1466 N N   . GLU A 1 186 ? 46.814 59.700 57.679 1.00 47.25 ? 186 GLU A N   1 
ATOM   1467 C CA  . GLU A 1 186 ? 47.604 60.421 58.648 1.00 45.73 ? 186 GLU A CA  1 
ATOM   1468 C C   . GLU A 1 186 ? 47.658 59.701 60.002 1.00 44.72 ? 186 GLU A C   1 
ATOM   1469 O O   . GLU A 1 186 ? 46.638 59.267 60.522 1.00 43.76 ? 186 GLU A O   1 
ATOM   1470 C CB  . GLU A 1 186 ? 46.981 61.828 58.686 1.00 45.35 ? 186 GLU A CB  1 
ATOM   1471 C CG  . GLU A 1 186 ? 45.438 61.938 58.729 1.00 45.06 ? 186 GLU A CG  1 
ATOM   1472 C CD  . GLU A 1 186 ? 44.782 61.668 60.076 1.00 45.02 ? 186 GLU A CD  1 
ATOM   1473 O OE1 . GLU A 1 186 ? 45.368 62.038 61.097 1.00 44.29 ? 186 GLU A OE1 1 
ATOM   1474 O OE2 . GLU A 1 186 ? 43.689 61.106 60.099 1.00 44.48 ? 186 GLU A OE2 1 
ATOM   1475 N N   . GLY A 1 187 ? 48.859 59.526 60.539 1.00 44.50 ? 187 GLY A N   1 
ATOM   1476 C CA  . GLY A 1 187 ? 49.096 58.892 61.821 1.00 44.58 ? 187 GLY A CA  1 
ATOM   1477 C C   . GLY A 1 187 ? 48.776 57.398 61.943 1.00 45.66 ? 187 GLY A C   1 
ATOM   1478 O O   . GLY A 1 187 ? 48.398 56.648 61.032 1.00 44.05 ? 187 GLY A O   1 
ATOM   1479 N N   . SER A 1 188 ? 49.057 57.036 63.196 1.00 46.85 ? 188 SER A N   1 
ATOM   1480 C CA  . SER A 1 188 ? 48.782 55.749 63.833 1.00 49.00 ? 188 SER A CA  1 
ATOM   1481 C C   . SER A 1 188 ? 49.319 54.440 63.231 1.00 49.52 ? 188 SER A C   1 
ATOM   1482 O O   . SER A 1 188 ? 48.656 53.427 62.975 1.00 49.09 ? 188 SER A O   1 
ATOM   1483 C CB  . SER A 1 188 ? 47.241 55.671 64.050 1.00 49.46 ? 188 SER A CB  1 
ATOM   1484 O OG  . SER A 1 188 ? 46.722 56.723 64.892 1.00 47.79 ? 188 SER A OG  1 
ATOM   1485 N N   . CYS A 1 189 ? 50.636 54.553 63.157 1.00 50.01 ? 189 CYS A N   1 
ATOM   1486 C CA  . CYS A 1 189 ? 51.647 53.517 62.863 1.00 50.74 ? 189 CYS A CA  1 
ATOM   1487 C C   . CYS A 1 189 ? 52.674 54.418 63.517 1.00 51.29 ? 189 CYS A C   1 
ATOM   1488 O O   . CYS A 1 189 ? 52.676 54.490 64.748 1.00 51.91 ? 189 CYS A O   1 
ATOM   1489 C CB  . CYS A 1 189 ? 52.054 53.318 61.357 1.00 51.02 ? 189 CYS A CB  1 
ATOM   1490 S SG  . CYS A 1 189 ? 50.988 52.362 60.234 1.00 51.04 ? 189 CYS A SG  1 
ATOM   1491 N N   . GLY A 1 190 ? 53.366 55.243 62.734 1.00 51.71 ? 190 GLY A N   1 
ATOM   1492 C CA  . GLY A 1 190 ? 54.136 56.308 63.294 1.00 52.96 ? 190 GLY A CA  1 
ATOM   1493 C C   . GLY A 1 190 ? 53.195 57.523 63.270 1.00 52.82 ? 190 GLY A C   1 
ATOM   1494 O O   . GLY A 1 190 ? 53.696 58.641 63.400 1.00 53.00 ? 190 GLY A O   1 
HETATM 1495 O O   . HOH B 2 .   ? 59.324 38.114 63.769 1.00 20.59 ? 192 HOH A O   1 
HETATM 1496 O O   . HOH B 2 .   ? 55.015 57.901 57.180 1.00 8.04  ? 193 HOH A O   1 
HETATM 1497 O O   . HOH B 2 .   ? 57.420 57.901 52.348 1.00 2.89  ? 194 HOH A O   1 
HETATM 1498 O O   . HOH B 2 .   ? 63.409 43.762 58.460 1.00 47.99 ? 195 HOH A O   1 
HETATM 1499 O O   . HOH B 2 .   ? 35.129 53.062 31.063 1.00 22.22 ? 196 HOH A O   1 
HETATM 1500 O O   . HOH B 2 .   ? 36.156 48.174 25.033 1.00 39.19 ? 197 HOH A O   1 
HETATM 1501 O O   . HOH B 2 .   ? 33.684 45.157 27.954 1.00 29.58 ? 198 HOH A O   1 
HETATM 1502 O O   . HOH B 2 .   ? 35.423 42.865 24.054 1.00 21.57 ? 199 HOH A O   1 
HETATM 1503 O O   . HOH B 2 .   ? 36.166 49.363 29.854 1.00 6.98  ? 200 HOH A O   1 
HETATM 1504 O O   . HOH B 2 .   ? 42.161 24.099 34.421 1.00 58.90 ? 201 HOH A O   1 
HETATM 1505 O O   . HOH B 2 .   ? 37.071 19.883 40.413 1.00 2.00  ? 202 HOH A O   1 
HETATM 1506 O O   . HOH B 2 .   ? 36.453 23.810 36.503 1.00 20.65 ? 203 HOH A O   1 
HETATM 1507 O O   . HOH B 2 .   ? 31.994 21.080 30.221 1.00 31.63 ? 204 HOH A O   1 
HETATM 1508 O O   . HOH B 2 .   ? 59.499 57.619 61.062 1.00 16.70 ? 205 HOH A O   1 
HETATM 1509 O O   . HOH B 2 .   ? 64.473 47.159 60.440 1.00 42.93 ? 206 HOH A O   1 
HETATM 1510 O O   . HOH B 2 .   ? 33.853 23.160 38.340 1.00 6.57  ? 207 HOH A O   1 
HETATM 1511 O O   . HOH B 2 .   ? 53.406 61.411 45.624 1.00 19.98 ? 208 HOH A O   1 
HETATM 1512 O O   . HOH B 2 .   ? 56.225 62.293 35.885 1.00 18.52 ? 209 HOH A O   1 
HETATM 1513 O O   . HOH B 2 .   ? 59.655 7.582  48.894 1.00 48.05 ? 210 HOH A O   1 
HETATM 1514 O O   . HOH B 2 .   ? 55.423 65.607 30.629 0.50 13.90 ? 211 HOH A O   1 
HETATM 1515 O O   . HOH B 2 .   ? 75.003 20.549 65.727 1.00 31.97 ? 212 HOH A O   1 
HETATM 1516 O O   . HOH B 2 .   ? 69.144 27.417 68.508 1.00 12.76 ? 213 HOH A O   1 
HETATM 1517 O O   . HOH B 2 .   ? 73.680 21.246 70.803 1.00 51.57 ? 214 HOH A O   1 
HETATM 1518 O O   . HOH B 2 .   ? 39.984 17.009 39.999 1.00 30.15 ? 215 HOH A O   1 
HETATM 1519 O O   . HOH B 2 .   ? 58.413 62.555 49.870 1.00 43.36 ? 216 HOH A O   1 
HETATM 1520 O O   . HOH B 2 .   ? 31.609 30.527 62.662 1.00 59.99 ? 217 HOH A O   1 
HETATM 1521 O O   . HOH B 2 .   ? 48.996 61.314 62.574 1.00 28.97 ? 218 HOH A O   1 
HETATM 1522 O O   . HOH B 2 .   ? 66.797 41.496 63.811 1.00 20.52 ? 219 HOH A O   1 
HETATM 1523 O O   . HOH B 2 .   ? 54.437 21.134 35.590 1.00 7.76  ? 220 HOH A O   1 
HETATM 1524 O O   . HOH B 2 .   ? 39.407 53.835 31.054 1.00 48.17 ? 221 HOH A O   1 
HETATM 1525 O O   . HOH B 2 .   ? 37.827 51.461 28.447 1.00 47.15 ? 222 HOH A O   1 
HETATM 1526 O O   . HOH B 2 .   ? 35.055 47.193 36.234 1.00 8.40  ? 223 HOH A O   1 
HETATM 1527 O O   . HOH B 2 .   ? 32.229 47.530 35.941 1.00 14.70 ? 224 HOH A O   1 
HETATM 1528 O O   . HOH B 2 .   ? 72.454 13.985 62.861 1.00 56.65 ? 225 HOH A O   1 
HETATM 1529 O O   . HOH B 2 .   ? 38.296 17.158 44.444 1.00 20.17 ? 226 HOH A O   1 
HETATM 1530 O O   . HOH B 2 .   ? 62.535 63.008 43.732 1.00 64.44 ? 227 HOH A O   1 
HETATM 1531 O O   . HOH B 2 .   ? 38.151 17.032 59.477 1.00 66.61 ? 228 HOH A O   1 
HETATM 1532 O O   . HOH B 2 .   ? 51.939 8.382  42.433 1.00 21.48 ? 229 HOH A O   1 
HETATM 1533 O O   . HOH B 2 .   ? 42.903 61.366 66.273 1.00 27.66 ? 230 HOH A O   1 
HETATM 1534 O O   . HOH B 2 .   ? 44.435 50.623 27.402 1.00 18.36 ? 231 HOH A O   1 
HETATM 1535 O O   . HOH B 2 .   ? 30.356 31.301 59.015 1.00 22.85 ? 232 HOH A O   1 
HETATM 1536 O O   . HOH B 2 .   ? 55.773 14.844 37.840 1.00 35.35 ? 233 HOH A O   1 
HETATM 1537 O O   . HOH B 2 .   ? 74.780 25.351 68.758 1.00 28.11 ? 234 HOH A O   1 
HETATM 1538 O O   . HOH B 2 .   ? 60.173 12.972 59.035 1.00 48.51 ? 235 HOH A O   1 
HETATM 1539 O O   . HOH B 2 .   ? 58.822 13.640 61.061 1.00 39.09 ? 236 HOH A O   1 
HETATM 1540 O O   . HOH B 2 .   ? 50.331 60.088 54.737 1.00 58.88 ? 237 HOH A O   1 
HETATM 1541 O O   . HOH B 2 .   ? 41.244 57.801 65.608 1.00 39.48 ? 238 HOH A O   1 
HETATM 1542 O O   . HOH B 2 .   ? 42.617 57.046 69.105 1.00 24.65 ? 239 HOH A O   1 
HETATM 1543 O O   . HOH B 2 .   ? 39.421 58.091 62.401 1.00 39.21 ? 240 HOH A O   1 
HETATM 1544 O O   . HOH B 2 .   ? 57.784 61.794 63.336 1.00 24.29 ? 241 HOH A O   1 
HETATM 1545 O O   . HOH B 2 .   ? 58.373 64.586 61.608 1.00 34.27 ? 242 HOH A O   1 
HETATM 1546 O O   . HOH B 2 .   ? 56.845 52.905 57.583 1.00 42.32 ? 243 HOH A O   1 
HETATM 1547 O O   . HOH B 2 .   ? 57.277 50.328 61.623 1.00 36.55 ? 244 HOH A O   1 
HETATM 1548 O O   . HOH B 2 .   ? 68.028 50.366 56.423 1.00 37.85 ? 245 HOH A O   1 
HETATM 1549 O O   . HOH B 2 .   ? 67.879 52.911 53.813 1.00 23.57 ? 246 HOH A O   1 
HETATM 1550 O O   . HOH B 2 .   ? 65.651 56.767 55.266 1.00 47.79 ? 247 HOH A O   1 
HETATM 1551 O O   . HOH B 2 .   ? 64.767 56.028 60.484 1.00 52.58 ? 248 HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 63.923 58.917 56.924 1.00 35.39 ? 249 HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? 48.478 62.824 49.341 1.00 48.69 ? 250 HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 50.406 63.985 53.295 1.00 54.06 ? 251 HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 46.887 64.453 54.002 1.00 49.40 ? 252 HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 57.990 58.121 49.340 1.00 44.34 ? 253 HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 61.124 59.679 51.369 1.00 68.78 ? 254 HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 56.867 62.960 42.684 1.00 48.67 ? 255 HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 61.134 60.813 41.399 1.00 64.75 ? 256 HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 52.000 9.666  44.386 1.00 49.18 ? 257 HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 55.218 67.797 61.529 1.00 64.46 ? 258 HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? 55.820 70.340 65.618 1.00 70.54 ? 259 HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? 34.461 28.754 57.719 1.00 68.75 ? 260 HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 57.031 15.684 66.814 1.00 42.17 ? 261 HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 55.544 11.639 63.978 1.00 69.83 ? 262 HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 64.488 12.601 51.409 1.00 44.09 ? 263 HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 24.303 57.339 57.745 1.00 36.11 ? 264 HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 56.518 66.630 61.108 1.00 61.81 ? 265 HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 39.877 23.622 41.627 1.00 32.98 ? 266 HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 47.193 46.457 65.732 1.00 69.56 ? 267 HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 50.235 47.713 63.535 1.00 50.16 ? 268 HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 41.619 58.047 32.133 1.00 27.20 ? 269 HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? 42.592 50.872 30.684 1.00 43.92 ? 270 HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 35.473 56.724 34.113 1.00 33.21 ? 271 HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 31.467 49.487 28.706 1.00 34.46 ? 272 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LYS 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  ?   ?   ?   A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 CYS 165 165 165 CYS CYS A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 MET 170 170 170 MET MET A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 PHE 191 191 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  192 1  HOH HOH A . 
B 2 HOH 2  193 2  HOH HOH A . 
B 2 HOH 3  194 3  HOH HOH A . 
B 2 HOH 4  195 4  HOH HOH A . 
B 2 HOH 5  196 5  HOH HOH A . 
B 2 HOH 6  197 6  HOH HOH A . 
B 2 HOH 7  198 7  HOH HOH A . 
B 2 HOH 8  199 8  HOH HOH A . 
B 2 HOH 9  200 9  HOH HOH A . 
B 2 HOH 10 201 10 HOH HOH A . 
B 2 HOH 11 202 11 HOH HOH A . 
B 2 HOH 12 203 12 HOH HOH A . 
B 2 HOH 13 204 13 HOH HOH A . 
B 2 HOH 14 205 14 HOH HOH A . 
B 2 HOH 15 206 15 HOH HOH A . 
B 2 HOH 16 207 16 HOH HOH A . 
B 2 HOH 17 208 17 HOH HOH A . 
B 2 HOH 18 209 18 HOH HOH A . 
B 2 HOH 19 210 19 HOH HOH A . 
B 2 HOH 20 211 20 HOH HOH A . 
B 2 HOH 21 212 21 HOH HOH A . 
B 2 HOH 22 213 22 HOH HOH A . 
B 2 HOH 23 214 23 HOH HOH A . 
B 2 HOH 24 215 24 HOH HOH A . 
B 2 HOH 25 216 25 HOH HOH A . 
B 2 HOH 26 217 26 HOH HOH A . 
B 2 HOH 27 218 27 HOH HOH A . 
B 2 HOH 28 219 28 HOH HOH A . 
B 2 HOH 29 220 29 HOH HOH A . 
B 2 HOH 30 221 30 HOH HOH A . 
B 2 HOH 31 222 31 HOH HOH A . 
B 2 HOH 32 223 32 HOH HOH A . 
B 2 HOH 33 224 33 HOH HOH A . 
B 2 HOH 34 225 34 HOH HOH A . 
B 2 HOH 35 226 35 HOH HOH A . 
B 2 HOH 36 227 36 HOH HOH A . 
B 2 HOH 37 228 37 HOH HOH A . 
B 2 HOH 38 229 38 HOH HOH A . 
B 2 HOH 39 230 39 HOH HOH A . 
B 2 HOH 40 231 40 HOH HOH A . 
B 2 HOH 41 232 41 HOH HOH A . 
B 2 HOH 42 233 42 HOH HOH A . 
B 2 HOH 43 234 43 HOH HOH A . 
B 2 HOH 44 235 44 HOH HOH A . 
B 2 HOH 45 236 45 HOH HOH A . 
B 2 HOH 46 237 46 HOH HOH A . 
B 2 HOH 47 238 47 HOH HOH A . 
B 2 HOH 48 239 48 HOH HOH A . 
B 2 HOH 49 240 49 HOH HOH A . 
B 2 HOH 50 241 50 HOH HOH A . 
B 2 HOH 51 242 51 HOH HOH A . 
B 2 HOH 52 243 52 HOH HOH A . 
B 2 HOH 53 244 53 HOH HOH A . 
B 2 HOH 54 245 54 HOH HOH A . 
B 2 HOH 55 246 55 HOH HOH A . 
B 2 HOH 56 247 56 HOH HOH A . 
B 2 HOH 57 248 57 HOH HOH A . 
B 2 HOH 58 249 58 HOH HOH A . 
B 2 HOH 59 250 59 HOH HOH A . 
B 2 HOH 60 251 60 HOH HOH A . 
B 2 HOH 61 252 61 HOH HOH A . 
B 2 HOH 62 253 62 HOH HOH A . 
B 2 HOH 63 254 63 HOH HOH A . 
B 2 HOH 64 255 64 HOH HOH A . 
B 2 HOH 65 256 65 HOH HOH A . 
B 2 HOH 66 257 66 HOH HOH A . 
B 2 HOH 67 258 67 HOH HOH A . 
B 2 HOH 68 259 68 HOH HOH A . 
B 2 HOH 69 260 69 HOH HOH A . 
B 2 HOH 70 261 70 HOH HOH A . 
B 2 HOH 71 262 71 HOH HOH A . 
B 2 HOH 72 263 72 HOH HOH A . 
B 2 HOH 73 264 73 HOH HOH A . 
B 2 HOH 74 265 74 HOH HOH A . 
B 2 HOH 75 266 75 HOH HOH A . 
B 2 HOH 76 267 76 HOH HOH A . 
B 2 HOH 77 268 77 HOH HOH A . 
B 2 HOH 78 269 78 HOH HOH A . 
B 2 HOH 79 270 79 HOH HOH A . 
B 2 HOH 80 271 80 HOH HOH A . 
B 2 HOH 81 272 81 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-12-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-17 
5 'Structure model' 1 4 2019-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' Other                       
6 4 'Structure model' 'Refinement description'    
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status         
2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3 4 'Structure model' software                     
4 5 'Structure model' software                     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site' 
2 4 'Structure model' '_software.classification'           
3 4 'Structure model' '_software.name'                     
4 5 'Structure model' '_software.classification'           
5 5 'Structure model' '_software.name'                     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' . ? 1 
X-PLOR 'model building'  . ? 2 
PROLSQ refinement        . ? 3 
X-PLOR refinement        . ? 4 
XENGEN 'data reduction'  . ? 5 
X-PLOR phasing           . ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLN 66  ? ? O A HOH 194 ? ? 1.40 
2 1 O   A GLY 136 ? ? N A GLN 137 ? ? 1.77 
3 1 O   A HOH 258 ? ? O A HOH 265 ? ? 1.80 
4 1 NH1 A ARG 77  ? ? O A GLN 137 ? ? 2.19 
5 1 O   A PRO 2   ? ? N A ILE 4   ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 267 ? ? 1_555 O A HOH 267 ? ? 7_556 1.70 
2 1 O A HOH 203 ? ? 1_555 O A HOH 204 ? ? 8_665 2.12 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C   A SER 100 ? ? N   A LEU 101 ? ? 1.579 1.336 0.243  0.023 Y 
2  1 CA  A TYR 103 ? ? CB  A TYR 103 ? ? 1.752 1.535 0.217  0.022 N 
3  1 CB  A TYR 103 ? ? CG  A TYR 103 ? ? 1.808 1.512 0.296  0.015 N 
4  1 CG  A TYR 103 ? ? CD2 A TYR 103 ? ? 1.508 1.387 0.121  0.013 N 
5  1 CG  A TYR 103 ? ? CD1 A TYR 103 ? ? 1.494 1.387 0.107  0.013 N 
6  1 CD1 A TYR 103 ? ? CE1 A TYR 103 ? ? 1.506 1.389 0.117  0.015 N 
7  1 CE2 A TYR 103 ? ? CD2 A TYR 103 ? ? 1.526 1.389 0.137  0.015 N 
8  1 C   A TYR 103 ? ? N   A GLY 104 ? ? 1.171 1.336 -0.165 0.023 Y 
9  1 C   A VAL 110 ? ? N   A TYR 111 ? ? 1.049 1.336 -0.287 0.023 Y 
10 1 C   A GLY 136 ? ? N   A GLN 137 ? ? 0.947 1.336 -0.389 0.023 Y 
11 1 C   A ARG 183 ? ? N   A SER 184 ? ? 1.486 1.336 0.150  0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  A PRO 2   ? ? C   A PRO 2   ? ? N   A THR 3   ? ? 131.73 117.20 14.53  2.20 Y 
2  1 CA  A THR 3   ? ? C   A THR 3   ? ? N   A ILE 4   ? ? 100.71 117.20 -16.49 2.20 Y 
3  1 O   A THR 3   ? ? C   A THR 3   ? ? N   A ILE 4   ? ? 136.36 122.70 13.66  1.60 Y 
4  1 C   A THR 3   ? ? N   A ILE 4   ? ? CA  A ILE 4   ? ? 96.94  121.70 -24.76 2.50 Y 
5  1 O   A PRO 5   ? ? C   A PRO 5   ? ? N   A LEU 6   ? ? 132.80 122.70 10.10  1.60 Y 
6  1 NE  A ARG 8   ? ? CZ  A ARG 8   ? ? NH1 A ARG 8   ? ? 125.74 120.30 5.44   0.50 N 
7  1 NE  A ARG 8   ? ? CZ  A ARG 8   ? ? NH2 A ARG 8   ? ? 115.83 120.30 -4.47  0.50 N 
8  1 CA  A LEU 15  ? ? CB  A LEU 15  ? ? CG  A LEU 15  ? ? 132.73 115.30 17.43  2.30 N 
9  1 CG  A ARG 16  ? ? CD  A ARG 16  ? ? NE  A ARG 16  ? ? 126.01 111.80 14.21  2.10 N 
10 1 NE  A ARG 16  ? ? CZ  A ARG 16  ? ? NH1 A ARG 16  ? ? 127.34 120.30 7.04   0.50 N 
11 1 NE  A ARG 16  ? ? CZ  A ARG 16  ? ? NH2 A ARG 16  ? ? 113.10 120.30 -7.20  0.50 N 
12 1 CA  A HIS 18  ? ? CB  A HIS 18  ? ? CG  A HIS 18  ? ? 98.02  113.60 -15.58 1.70 N 
13 1 CB  A LEU 23  ? ? CA  A LEU 23  ? ? C   A LEU 23  ? ? 98.00  110.20 -12.20 1.90 N 
14 1 CB  A LEU 45  ? ? CA  A LEU 45  ? ? C   A LEU 45  ? ? 98.13  110.20 -12.07 1.90 N 
15 1 CA  A LEU 45  ? ? CB  A LEU 45  ? ? CG  A LEU 45  ? ? 134.31 115.30 19.01  2.30 N 
16 1 N   A ALA 50  ? ? CA  A ALA 50  ? ? C   A ALA 50  ? ? 128.39 111.00 17.39  2.70 N 
17 1 CA  A CYS 53  ? ? CB  A CYS 53  ? ? SG  A CYS 53  ? ? 123.41 114.20 9.21   1.10 N 
18 1 O   A CYS 53  ? ? C   A CYS 53  ? ? N   A PHE 54  ? ? 112.58 122.70 -10.12 1.60 Y 
19 1 CB  A ILE 58  ? ? CA  A ILE 58  ? ? C   A ILE 58  ? ? 97.75  111.60 -13.85 2.00 N 
20 1 N   A ILE 58  ? ? CA  A ILE 58  ? ? C   A ILE 58  ? ? 86.44  111.00 -24.56 2.70 N 
21 1 CA  A THR 60  ? ? CB  A THR 60  ? ? CG2 A THR 60  ? ? 122.71 112.40 10.31  1.40 N 
22 1 O   A ASN 63  ? ? C   A ASN 63  ? ? N   A ARG 64  ? ? 111.85 122.70 -10.85 1.60 Y 
23 1 CB  A ARG 64  ? ? CA  A ARG 64  ? ? C   A ARG 64  ? ? 96.61  110.40 -13.79 2.00 N 
24 1 NE  A ARG 64  ? ? CZ  A ARG 64  ? ? NH2 A ARG 64  ? ? 123.41 120.30 3.11   0.50 N 
25 1 CA  A ARG 64  ? ? C   A ARG 64  ? ? N   A GLU 65  ? ? 99.82  117.20 -17.38 2.20 Y 
26 1 O   A ARG 64  ? ? C   A ARG 64  ? ? N   A GLU 65  ? ? 138.17 122.70 15.47  1.60 Y 
27 1 CA  A GLN 66  ? ? C   A GLN 66  ? ? N   A ALA 67  ? ? 133.17 117.20 15.97  2.20 Y 
28 1 O   A GLN 66  ? ? C   A GLN 66  ? ? N   A ALA 67  ? ? 99.45  122.70 -23.25 1.60 Y 
29 1 N   A GLN 69  ? ? CA  A GLN 69  ? ? CB  A GLN 69  ? ? 99.67  110.60 -10.93 1.80 N 
30 1 CA  A GLN 69  ? ? C   A GLN 69  ? ? N   A LYS 70  ? ? 94.21  117.20 -22.99 2.20 Y 
31 1 O   A GLN 69  ? ? C   A GLN 69  ? ? N   A LYS 70  ? ? 144.24 122.70 21.54  1.60 Y 
32 1 C   A GLN 69  ? ? N   A LYS 70  ? ? CA  A LYS 70  ? ? 139.21 121.70 17.51  2.50 Y 
33 1 CA  A LEU 76  ? ? C   A LEU 76  ? ? O   A LEU 76  ? ? 107.48 120.10 -12.62 2.10 N 
34 1 CA  A LEU 76  ? ? C   A LEU 76  ? ? N   A ARG 77  ? ? 134.99 117.20 17.79  2.20 Y 
35 1 CB  A ARG 77  ? ? CG  A ARG 77  ? ? CD  A ARG 77  ? ? 127.36 111.60 15.76  2.60 N 
36 1 CD1 A TRP 86  ? ? CG  A TRP 86  ? ? CD2 A TRP 86  ? ? 113.32 106.30 7.02   0.80 N 
37 1 CE2 A TRP 86  ? ? CD2 A TRP 86  ? ? CG  A TRP 86  ? ? 101.03 107.30 -6.27  0.80 N 
38 1 CB  A TYR 103 ? ? CA  A TYR 103 ? ? C   A TYR 103 ? ? 91.87  110.40 -18.53 2.00 N 
39 1 N   A TYR 103 ? ? CA  A TYR 103 ? ? CB  A TYR 103 ? ? 95.76  110.60 -14.84 1.80 N 
40 1 CA  A TYR 103 ? ? CB  A TYR 103 ? ? CG  A TYR 103 ? ? 125.62 113.40 12.22  1.90 N 
41 1 CB  A TYR 103 ? ? CG  A TYR 103 ? ? CD2 A TYR 103 ? ? 124.83 121.00 3.83   0.60 N 
42 1 CD1 A TYR 103 ? ? CG  A TYR 103 ? ? CD2 A TYR 103 ? ? 104.17 117.90 -13.73 1.10 N 
43 1 CB  A TYR 103 ? ? CG  A TYR 103 ? ? CD1 A TYR 103 ? ? 130.98 121.00 9.98   0.60 N 
44 1 CG  A TYR 103 ? ? CD1 A TYR 103 ? ? CE1 A TYR 103 ? ? 128.92 121.30 7.62   0.80 N 
45 1 CG  A TYR 103 ? ? CD2 A TYR 103 ? ? CE2 A TYR 103 ? ? 127.19 121.30 5.89   0.80 N 
46 1 CA  A TYR 103 ? ? C   A TYR 103 ? ? N   A GLY 104 ? ? 103.28 116.20 -12.92 2.00 Y 
47 1 O   A TYR 103 ? ? C   A TYR 103 ? ? N   A GLY 104 ? ? 136.47 123.20 13.27  1.70 Y 
48 1 N   A GLY 104 ? ? CA  A GLY 104 ? ? C   A GLY 104 ? ? 96.75  113.10 -16.35 2.50 N 
49 1 O   A GLY 104 ? ? C   A GLY 104 ? ? N   A ALA 105 ? ? 112.87 122.70 -9.83  1.60 Y 
50 1 C   A GLY 104 ? ? N   A ALA 105 ? ? CA  A ALA 105 ? ? 104.67 121.70 -17.03 2.50 Y 
51 1 O   A SER 108 ? ? C   A SER 108 ? ? N   A ASP 109 ? ? 112.09 122.70 -10.61 1.60 Y 
52 1 CB  A ASP 109 ? ? CA  A ASP 109 ? ? C   A ASP 109 ? ? 97.17  110.40 -13.23 2.00 N 
53 1 CA  A TYR 111 ? ? CB  A TYR 111 ? ? CG  A TYR 111 ? ? 124.84 113.40 11.44  1.90 N 
54 1 NE  A ARG 127 ? ? CZ  A ARG 127 ? ? NH1 A ARG 127 ? ? 123.43 120.30 3.13   0.50 N 
55 1 N   A GLU 129 ? ? CA  A GLU 129 ? ? C   A GLU 129 ? ? 129.56 111.00 18.56  2.70 N 
56 1 NE  A ARG 134 ? ? CZ  A ARG 134 ? ? NH1 A ARG 134 ? ? 124.88 120.30 4.58   0.50 N 
57 1 CA  A GLY 136 ? ? C   A GLY 136 ? ? N   A GLN 137 ? ? 133.93 117.20 16.73  2.20 Y 
58 1 O   A GLY 136 ? ? C   A GLY 136 ? ? N   A GLN 137 ? ? 107.84 122.70 -14.86 1.60 Y 
59 1 C   A GLY 136 ? ? N   A GLN 137 ? ? CA  A GLN 137 ? ? 138.12 121.70 16.42  2.50 Y 
60 1 C   A TYR 143 ? ? N   A ALA 144 ? ? CA  A ALA 144 ? ? 141.56 121.70 19.86  2.50 Y 
61 1 O   A ASP 147 ? ? C   A ASP 147 ? ? N   A ALA 148 ? ? 112.47 122.70 -10.23 1.60 Y 
62 1 CB  A ASN 149 ? ? CA  A ASN 149 ? ? C   A ASN 149 ? ? 83.37  110.40 -27.03 2.00 N 
63 1 N   A ASN 149 ? ? CA  A ASN 149 ? ? C   A ASN 149 ? ? 127.47 111.00 16.47  2.70 N 
64 1 CA  A ASN 149 ? ? C   A ASN 149 ? ? N   A SER 150 ? ? 132.56 117.20 15.36  2.20 Y 
65 1 O   A ASN 149 ? ? C   A ASN 149 ? ? N   A SER 150 ? ? 105.52 122.70 -17.18 1.60 Y 
66 1 CB  A SER 150 ? ? CA  A SER 150 ? ? C   A SER 150 ? ? 137.84 110.10 27.74  1.90 N 
67 1 CB  A ASP 153 ? ? CA  A ASP 153 ? ? C   A ASP 153 ? ? 98.28  110.40 -12.12 2.00 N 
68 1 CB  A TYR 164 ? ? CG  A TYR 164 ? ? CD2 A TYR 164 ? ? 117.36 121.00 -3.64  0.60 N 
69 1 CB  A PHE 166 ? ? CG  A PHE 166 ? ? CD2 A PHE 166 ? ? 115.52 120.80 -5.28  0.70 N 
70 1 CB  A PHE 166 ? ? CG  A PHE 166 ? ? CD1 A PHE 166 ? ? 126.15 120.80 5.35   0.70 N 
71 1 CA  A ARG 167 ? ? CB  A ARG 167 ? ? CG  A ARG 167 ? ? 127.93 113.40 14.53  2.20 N 
72 1 NE  A ARG 167 ? ? CZ  A ARG 167 ? ? NH1 A ARG 167 ? ? 125.03 120.30 4.73   0.50 N 
73 1 NE  A ARG 167 ? ? CZ  A ARG 167 ? ? NH2 A ARG 167 ? ? 116.73 120.30 -3.57  0.50 N 
74 1 CB  A PHE 176 ? ? CG  A PHE 176 ? ? CD2 A PHE 176 ? ? 116.42 120.80 -4.38  0.70 N 
75 1 NE  A ARG 183 ? ? CZ  A ARG 183 ? ? NH2 A ARG 183 ? ? 124.38 120.30 4.08   0.50 N 
76 1 N   A CYS 189 ? ? CA  A CYS 189 ? ? C   A CYS 189 ? ? 87.76  111.00 -23.24 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 3   ? ? -75.46  43.58   
2  1 GLN A 11  ? ? -63.11  -70.81  
3  1 ALA A 34  ? ? -64.27  2.67    
4  1 TYR A 35  ? ? -138.58 -67.11  
5  1 TYR A 42  ? ? -80.08  36.27   
6  1 PHE A 44  ? ? -165.16 19.61   
7  1 PRO A 48  ? ? -53.70  -4.56   
8  1 ALA A 50  ? ? -27.36  75.91   
9  1 SER A 51  ? ? 62.30   -134.43 
10 1 LEU A 52  ? ? 85.52   -144.05 
11 1 CYS A 53  ? ? 65.41   -175.62 
12 1 PHE A 54  ? ? -109.38 53.91   
13 1 SER A 57  ? ? -153.92 -84.36  
14 1 THR A 60  ? ? 4.57    104.27  
15 1 ALA A 67  ? ? -36.57  137.62  
16 1 SER A 79  ? ? -73.87  -82.13  
17 1 LEU A 80  ? ? -32.01  -25.14  
18 1 PRO A 89  ? ? -57.21  -80.12  
19 1 VAL A 90  ? ? -60.75  72.99   
20 1 ALA A 98  ? ? -108.06 44.80   
21 1 SER A 106 ? ? -60.48  -85.11  
22 1 ASP A 107 ? ? -113.99 -131.88 
23 1 ASP A 109 ? ? -30.03  -70.25  
24 1 TYR A 111 ? ? -81.69  -80.58  
25 1 ASP A 112 ? ? -43.08  7.64    
26 1 THR A 123 ? ? -48.72  -5.55   
27 1 GLU A 129 ? ? -19.24  -46.87  
28 1 PRO A 133 ? ? -108.46 -143.50 
29 1 PHE A 139 ? ? 135.06  171.56  
30 1 ALA A 144 ? ? -26.68  117.53  
31 1 LYS A 145 ? ? -63.70  -80.66  
32 1 PHE A 146 ? ? -125.71 -69.40  
33 1 ASP A 147 ? ? 144.92  154.97  
34 1 ASN A 149 ? ? -151.43 84.78   
35 1 SER A 150 ? ? 129.40  174.30  
36 1 ALA A 155 ? ? -23.28  -42.61  
37 1 TYR A 164 ? ? -93.03  -62.88  
38 1 PHE A 166 ? ? -67.85  2.93    
39 1 ARG A 167 ? ? -93.33  -63.44  
40 1 MET A 170 ? ? -150.96 -33.77  
41 1 CYS A 182 ? ? -113.04 51.32   
42 1 ARG A 183 ? ? -157.46 -36.60  
43 1 CYS A 189 ? ? -159.63 -93.66  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ALA A 67  ? ? GLN A 68  ? ? -144.12 
2 1 GLN A 68  ? ? GLN A 69  ? ? -133.83 
3 1 ASP A 107 ? ? SER A 108 ? ? -121.01 
4 1 SER A 108 ? ? ASP A 109 ? ? -90.40  
5 1 ASN A 149 ? ? SER A 150 ? ? 137.02  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 GLN A 66  ? ? 22.62  
2 1 GLY A 104 ? ? 13.28  
3 1 GLN A 141 ? ? -14.88 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A PRO 61  ? ? N A SER 62  ? ? 1.95 
2 1 C A TYR 103 ? ? N A GLY 104 ? ? 1.17 
3 1 C A VAL 110 ? ? N A TYR 111 ? ? 1.05 
4 1 C A GLY 136 ? ? N A GLN 137 ? ? 0.95 
5 1 C A HIS 151 ? ? N A ASN 152 ? ? 1.99 
6 1 C A ASP 153 ? ? N A ASP 154 ? ? 1.72 
7 1 C A VAL 180 ? ? N A GLN 181 ? ? 1.79 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A PRO 37  ? CA ? A PRO 37  CA 
2 1 Y 1 A PRO 37  ? C  ? A PRO 37  C  
3 1 Y 1 A PRO 37  ? O  ? A PRO 37  O  
4 1 Y 1 A PRO 37  ? CB ? A PRO 37  CB 
5 1 Y 1 A PRO 37  ? CG ? A PRO 37  CG 
6 1 Y 1 A PRO 37  ? CD ? A PRO 37  CD 
7 1 Y 1 A ALA 148 ? O  ? A ALA 148 O  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PHE 1   ? A PHE 1   
2 1 Y 1 A LYS 38  ? A LYS 38  
3 1 Y 1 A GLU 39  ? A GLU 39  
4 1 Y 1 A PHE 191 ? A PHE 191 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#