data_1HGV
# 
_entry.id   1HGV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HGV         
PDBE  EBI-5667     
WWPDB D_1290005667 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1IFP unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF3 MAJOR COATPROTEIN ASSEMBLY'            
PDB 1QL1 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY'           
PDB 1QL2 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY'           
PDB 1HGZ unspecified 'FILAMENTOUS BACTERIOPHAGE PH75'                                                        
PDB 1HH0 unspecified 'FILAMENTOUS BACTERIOPHAGE PH75'                                                        
PDB 2IFM unspecified .                                                                                       
PDB 1IFN unspecified .                                                                                       
PDB 2IFN unspecified .                                                                                       
PDB 3IFM unspecified .                                                                                       
PDB 4IFM unspecified .                                                                                       
PDB 1PFI unspecified 'PDB PDB ENTRIES 1IFI THROUGH 1IFP ARE ALL RELATED INOVIRUS FIBER DIFFRACTION STUDIES.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HGV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-12-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pederson, D.M.' 1 
'Welsh, L.C.'    2 
'Marvin, D.A.'   3 
'Sampson, M.'    4 
'Perham, R.N.'   5 
'Yu, M.'         6 
'Slater, M.R.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus' J.Mol.Biol.                309 401 ? 2001 
JMOBAK UK 0022-2836 0070 ? 11371161 10.1006/JMBI.2001.4685         
1       'The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1' 
'Acta Crystallogr.,Sect.D' 56  137 ? 2000 ABCRE6 DK 0907-4449 0766 ? 10666593 10.1107/S0907444999015334      
2       'Structure of the Capsid of Pf3 Filamentous Phage Determined from X-Ray Fibre Diffraction Data at 3.1 A Resolution' 
J.Mol.Biol.                283 155 ? 1998 JMOBAK UK 0022-2836 0070 ? 9761681  10.1006/JMBI.1998.2081         
3       
;Pf1 Filamentous Bacteriophage: Refinement of a Molecular Model by Simulated Annealing Using 3.3 Angstroms Resolution X-Ray Fibre Diffraction Data
;
'Acta Crystallogr.,Sect.D' 51  792 ? 1995 ABCRE6 DK 0907-4449 0766 ? 15299811 10.1107/S0907444995003027      
4       'Model-Building Studies of Inovirus: Genetic Variations on a Geometric Theme' Int.J.Biol.Macromol.       12  125 ? 1990 
IJBMDR UK 0141-8130 0708 ? 2078529  '10.1016/0141-8130(90)90064-H' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pederson, D.M.'   1  
primary 'Welsh, L.C.'      2  
primary 'Marvin, D.A.'     3  
primary 'Sampson, M.'      4  
primary 'Perham, R.N.'     5  
primary 'Yu, M.'           6  
primary 'Slater, M.R.'     7  
1       'Welsh, L.C.'      8  
1       'Symmons, M.F.'    9  
1       'Marvin, D.A.'     10 
2       'Welsh, L.C.'      11 
2       'Symmons, M.F.'    12 
2       'Sturtevant, J.M.' 13 
2       'Marvin, D.A.'     14 
2       'Perham, R.N.'     15 
3       'Gonzalez, A.'     16 
3       'Nave, C.'         17 
3       'Marvin, D.A.'     18 
4       'Marvin, D.A.'     19 
# 
_cell.entry_id           1HGV 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HGV 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PH75 INOVIRUS MAJOR COAT PROTEIN' 
_entity.formula_weight             4816.578 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'MAJOR COAT PROTEIN ASSEMBLY' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PH75 BACTERIOPHAGE MAJOR COAT PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 
_entity_poly.pdbx_seq_one_letter_code_can   MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  PHE n 
1 4  ASN n 
1 5  PRO n 
1 6  SER n 
1 7  GLU n 
1 8  VAL n 
1 9  ALA n 
1 10 SER n 
1 11 GLN n 
1 12 VAL n 
1 13 THR n 
1 14 ASN n 
1 15 TYR n 
1 16 ILE n 
1 17 GLN n 
1 18 ALA n 
1 19 ILE n 
1 20 ALA n 
1 21 ALA n 
1 22 ALA n 
1 23 GLY n 
1 24 VAL n 
1 25 GLY n 
1 26 VAL n 
1 27 LEU n 
1 28 ALA n 
1 29 LEU n 
1 30 ALA n 
1 31 ILE n 
1 32 GLY n 
1 33 LEU n 
1 34 SER n 
1 35 ALA n 
1 36 ALA n 
1 37 TRP n 
1 38 LYS n 
1 39 TYR n 
1 40 ALA n 
1 41 LYS n 
1 42 ARG n 
1 43 PHE n 
1 44 LEU n 
1 45 LYS n 
1 46 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'INOVIRUS PH75' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'BACTERIOPHAGE PH75' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     144736 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'THERMUS THERMOPHILUS HB8' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     300852 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GROWN IN THERMUS THERMOPHILUS' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAT_BPH75 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P82889 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HGV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P82889 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  46 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HGV 
_exptl.method            'FIBER DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           
'THE DATA IS DERIVED FROM CONTINUOUS TRANSFORM DATA AND THEREFORE THE NUMBER OF UNIQUE REFLECTIONS IS A MEANINGLESS NUMBER.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-02-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX7.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX7.2 
_diffrn_source.pdbx_wavelength             1.488 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1HGV 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
# 
_refine.pdbx_refine_id                           'FIBER DIFFRACTION' 
_refine.entry_id                                 1HGV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50. 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22 
_refine.ls_R_factor_R_free                       0.40 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'THE MODEL WAS DERIVED FROM PDB ENTRY 1IFN, REFERENCE 1, BY MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1IFN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'FIBER DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        340 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               340 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.019 ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg             1.7   ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d      23    ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d      ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
# 
_struct.entry_id                  1HGV 
_struct.title                     'Filamentous Bacteriophage PH75' 
_struct.pdbx_descriptor           'PH75 INOVIRUS MAJOR COAT PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HGV 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            
;VIRUS, VIRUS COAT PROTEIN, HELICAL VIRUS COAT PROTEIN, SSDNA VIRUSES, INOVIRUS, FILAMENTOUS BACTERIOPHAGE, THERMOPHILES, MEMBRANE PROTEINS, ICOSAHEDRAL VIRUS
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        5 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        46 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         5 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         46 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   42 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HGV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HGV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N    . MET A 1 1  ? 1.941   -24.893 41.364  1.00 4.00   ? 1  MET A N    1 
ATOM 2   C CA   . MET A 1 1  ? 2.740   -25.986 41.979  1.00 4.00   ? 1  MET A CA   1 
ATOM 3   C C    . MET A 1 1  ? 2.374   -27.279 41.295  1.00 4.00   ? 1  MET A C    1 
ATOM 4   O O    . MET A 1 1  ? 1.240   -27.408 40.886  1.00 4.00   ? 1  MET A O    1 
ATOM 5   C CB   . MET A 1 1  ? 2.448   -26.112 43.497  1.00 4.00   ? 1  MET A CB   1 
ATOM 6   C CG   . MET A 1 1  ? 3.518   -26.894 44.265  1.00 4.00   ? 1  MET A CG   1 
ATOM 7   S SD   . MET A 1 1  ? 4.248   -25.919 45.630  1.00 4.00   ? 1  MET A SD   1 
ATOM 8   C CE   . MET A 1 1  ? 2.919   -25.879 46.853  1.00 4.00   ? 1  MET A CE   1 
ATOM 9   H H1   . MET A 1 1  ? 1.092   -25.331 40.952  1.00 77.77  ? 1  MET A H1   1 
ATOM 10  H H2   . MET A 1 1  ? 1.689   -24.226 42.118  1.00 77.77  ? 1  MET A H2   1 
ATOM 11  H H3   . MET A 1 1  ? 2.528   -24.444 40.636  1.00 77.77  ? 1  MET A H3   1 
ATOM 12  H HA   . MET A 1 1  ? 3.789   -25.780 41.825  1.00 77.77  ? 1  MET A HA   1 
ATOM 13  H HB2  . MET A 1 1  ? 2.381   -25.122 43.922  1.00 77.77  ? 1  MET A HB2  1 
ATOM 14  H HB3  . MET A 1 1  ? 1.502   -26.616 43.627  1.00 77.77  ? 1  MET A HB3  1 
ATOM 15  H HG2  . MET A 1 1  ? 3.069   -27.786 44.676  1.00 77.77  ? 1  MET A HG2  1 
ATOM 16  H HG3  . MET A 1 1  ? 4.305   -27.175 43.580  1.00 77.77  ? 1  MET A HG3  1 
ATOM 17  H HE1  . MET A 1 1  ? 2.117   -26.531 46.540  1.00 77.77  ? 1  MET A HE1  1 
ATOM 18  H HE2  . MET A 1 1  ? 3.301   -26.214 47.806  1.00 77.77  ? 1  MET A HE2  1 
ATOM 19  H HE3  . MET A 1 1  ? 2.547   -24.871 46.951  1.00 77.77  ? 1  MET A HE3  1 
ATOM 20  N N    . ASP A 1 2  ? 3.360   -28.193 41.194  1.00 58.08  ? 2  ASP A N    1 
ATOM 21  C CA   . ASP A 1 2  ? 3.273   -29.560 40.555  1.00 58.08  ? 2  ASP A CA   1 
ATOM 22  C C    . ASP A 1 2  ? 2.677   -29.580 39.043  1.00 58.08  ? 2  ASP A C    1 
ATOM 23  O O    . ASP A 1 2  ? 3.143   -28.867 38.137  1.00 58.08  ? 2  ASP A O    1 
ATOM 24  C CB   . ASP A 1 2  ? 2.566   -30.595 41.531  1.00 4.00   ? 2  ASP A CB   1 
ATOM 25  C CG   . ASP A 1 2  ? 2.985   -32.075 41.308  1.00 4.00   ? 2  ASP A CG   1 
ATOM 26  O OD1  . ASP A 1 2  ? 4.197   -32.340 41.140  1.00 4.00   ? 2  ASP A OD1  1 
ATOM 27  O OD2  . ASP A 1 2  ? 2.104   -32.967 41.352  1.00 4.00   ? 2  ASP A OD2  1 
ATOM 28  H H    . ASP A 1 2  ? 4.231   -27.946 41.576  1.00 79.13  ? 2  ASP A H    1 
ATOM 29  H HA   . ASP A 1 2  ? 4.303   -29.882 40.463  1.00 79.13  ? 2  ASP A HA   1 
ATOM 30  H HB2  . ASP A 1 2  ? 2.811   -30.338 42.552  1.00 79.13  ? 2  ASP A HB2  1 
ATOM 31  H HB3  . ASP A 1 2  ? 1.494   -30.523 41.403  1.00 79.13  ? 2  ASP A HB3  1 
ATOM 32  N N    . PHE A 1 3  ? 1.670   -30.449 38.845  1.00 4.00   ? 3  PHE A N    1 
ATOM 33  C CA   . PHE A 1 3  ? 0.958   -30.715 37.600  1.00 4.00   ? 3  PHE A CA   1 
ATOM 34  C C    . PHE A 1 3  ? -0.355  -29.850 37.462  1.00 4.00   ? 3  PHE A C    1 
ATOM 35  O O    . PHE A 1 3  ? -1.442  -30.398 37.293  1.00 4.00   ? 3  PHE A O    1 
ATOM 36  C CB   . PHE A 1 3  ? 0.611   -32.224 37.686  1.00 4.00   ? 3  PHE A CB   1 
ATOM 37  C CG   . PHE A 1 3  ? 1.801   -33.160 37.986  1.00 4.00   ? 3  PHE A CG   1 
ATOM 38  C CD1  . PHE A 1 3  ? 3.095   -32.667 38.183  1.00 4.00   ? 3  PHE A CD1  1 
ATOM 39  C CD2  . PHE A 1 3  ? 1.624   -34.550 38.009  1.00 4.00   ? 3  PHE A CD2  1 
ATOM 40  C CE1  . PHE A 1 3  ? 4.169   -33.529 38.394  1.00 4.00   ? 3  PHE A CE1  1 
ATOM 41  C CE2  . PHE A 1 3  ? 2.700   -35.409 38.205  1.00 4.00   ? 3  PHE A CE2  1 
ATOM 42  C CZ   . PHE A 1 3  ? 3.970   -34.899 38.395  1.00 4.00   ? 3  PHE A CZ   1 
ATOM 43  H H    . PHE A 1 3  ? 1.392   -30.978 39.621  1.00 77.24  ? 3  PHE A H    1 
ATOM 44  H HA   . PHE A 1 3  ? 1.615   -30.537 36.765  1.00 77.24  ? 3  PHE A HA   1 
ATOM 45  H HB2  . PHE A 1 3  ? -0.117  -32.364 38.476  1.00 77.24  ? 3  PHE A HB2  1 
ATOM 46  H HB3  . PHE A 1 3  ? 0.173   -32.538 36.753  1.00 77.24  ? 3  PHE A HB3  1 
ATOM 47  H HD1  . PHE A 1 3  ? 3.260   -31.600 38.187  1.00 77.24  ? 3  PHE A HD1  1 
ATOM 48  H HD2  . PHE A 1 3  ? 0.635   -34.958 37.869  1.00 77.24  ? 3  PHE A HD2  1 
ATOM 49  H HE1  . PHE A 1 3  ? 5.161   -33.129 38.553  1.00 77.24  ? 3  PHE A HE1  1 
ATOM 50  H HE2  . PHE A 1 3  ? 2.540   -36.478 38.235  1.00 77.24  ? 3  PHE A HE2  1 
ATOM 51  H HZ   . PHE A 1 3  ? 4.804   -35.566 38.557  1.00 77.24  ? 3  PHE A HZ   1 
ATOM 52  N N    . ASN A 1 4  ? -0.254  -28.512 37.632  1.00 4.69   ? 4  ASN A N    1 
ATOM 53  C CA   . ASN A 1 4  ? -1.460  -27.602 37.652  1.00 4.69   ? 4  ASN A CA   1 
ATOM 54  C C    . ASN A 1 4  ? -1.359  -26.495 36.635  1.00 4.69   ? 4  ASN A C    1 
ATOM 55  O O    . ASN A 1 4  ? -2.357  -26.075 36.120  1.00 4.69   ? 4  ASN A O    1 
ATOM 56  C CB   . ASN A 1 4  ? -1.651  -26.955 39.118  1.00 4.00   ? 4  ASN A CB   1 
ATOM 57  C CG   . ASN A 1 4  ? -3.110  -26.681 39.582  1.00 4.00   ? 4  ASN A CG   1 
ATOM 58  O OD1  . ASN A 1 4  ? -3.881  -27.598 39.863  1.00 4.00   ? 4  ASN A OD1  1 
ATOM 59  N ND2  . ASN A 1 4  ? -3.481  -25.415 39.705  1.00 4.00   ? 4  ASN A ND2  1 
ATOM 60  H H    . ASN A 1 4  ? 0.622   -28.140 37.835  1.00 82.97  ? 4  ASN A H    1 
ATOM 61  H HA   . ASN A 1 4  ? -2.327  -28.201 37.423  1.00 82.97  ? 4  ASN A HA   1 
ATOM 62  H HB2  . ASN A 1 4  ? -1.206  -27.616 39.844  1.00 82.97  ? 4  ASN A HB2  1 
ATOM 63  H HB3  . ASN A 1 4  ? -1.113  -26.014 39.144  1.00 82.97  ? 4  ASN A HB3  1 
ATOM 64  H HD21 . ASN A 1 4  ? -2.828  -24.719 39.500  1.00 82.97  ? 4  ASN A HD21 1 
ATOM 65  H HD22 . ASN A 1 4  ? -4.405  -25.232 39.978  1.00 82.97  ? 4  ASN A HD22 1 
ATOM 66  N N    . PRO A 1 5  ? -0.164  -26.010 36.327  1.00 4.00   ? 5  PRO A N    1 
ATOM 67  C CA   . PRO A 1 5  ? 0.030   -24.997 35.310  1.00 4.00   ? 5  PRO A CA   1 
ATOM 68  C C    . PRO A 1 5  ? -0.080  -25.625 33.843  1.00 4.00   ? 5  PRO A C    1 
ATOM 69  O O    . PRO A 1 5  ? 0.177   -24.970 32.845  1.00 4.00   ? 5  PRO A O    1 
ATOM 70  C CB   . PRO A 1 5  ? 1.417   -24.416 35.644  1.00 5.70   ? 5  PRO A CB   1 
ATOM 71  C CG   . PRO A 1 5  ? 1.966   -25.229 36.766  1.00 5.70   ? 5  PRO A CG   1 
ATOM 72  C CD   . PRO A 1 5  ? 1.115   -26.454 36.855  1.00 5.70   ? 5  PRO A CD   1 
ATOM 73  H HA   . PRO A 1 5  ? -0.717  -24.220 35.407  1.00 85.70  ? 5  PRO A HA   1 
ATOM 74  H HB2  . PRO A 1 5  ? 2.050   -24.480 34.773  1.00 85.70  ? 5  PRO A HB2  1 
ATOM 75  H HB3  . PRO A 1 5  ? 1.309   -23.381 35.933  1.00 85.70  ? 5  PRO A HB3  1 
ATOM 76  H HG2  . PRO A 1 5  ? 2.991   -25.499 36.553  1.00 85.70  ? 5  PRO A HG2  1 
ATOM 77  H HG3  . PRO A 1 5  ? 1.912   -24.668 37.686  1.00 85.70  ? 5  PRO A HG3  1 
ATOM 78  H HD2  . PRO A 1 5  ? 1.528   -27.244 36.244  1.00 85.70  ? 5  PRO A HD2  1 
ATOM 79  H HD3  . PRO A 1 5  ? 1.021   -26.774 37.876  1.00 85.70  ? 5  PRO A HD3  1 
ATOM 80  N N    . SER A 1 6  ? -0.461  -26.926 33.801  1.00 6.19   ? 6  SER A N    1 
ATOM 81  C CA   . SER A 1 6  ? -0.654  -27.735 32.589  1.00 6.19   ? 6  SER A CA   1 
ATOM 82  C C    . SER A 1 6  ? -1.952  -27.360 31.888  1.00 6.19   ? 6  SER A C    1 
ATOM 83  O O    . SER A 1 6  ? -2.061  -27.525 30.675  1.00 6.19   ? 6  SER A O    1 
ATOM 84  C CB   . SER A 1 6  ? -0.697  -29.234 32.930  1.00 6.18   ? 6  SER A CB   1 
ATOM 85  O OG   . SER A 1 6  ? 0.472   -29.661 33.613  1.00 6.18   ? 6  SER A OG   1 
ATOM 86  H H    . SER A 1 6  ? -0.631  -27.365 34.660  1.00 86.18  ? 6  SER A H    1 
ATOM 87  H HA   . SER A 1 6  ? 0.175   -27.546 31.923  1.00 86.18  ? 6  SER A HA   1 
ATOM 88  H HB2  . SER A 1 6  ? -1.554  -29.432 33.555  1.00 86.18  ? 6  SER A HB2  1 
ATOM 89  H HB3  . SER A 1 6  ? -0.788  -29.799 32.012  1.00 86.18  ? 6  SER A HB3  1 
ATOM 90  H HG   . SER A 1 6  ? 0.874   -30.387 33.126  1.00 86.18  ? 6  SER A HG   1 
ATOM 91  N N    . GLU A 1 7  ? -2.944  -26.885 32.697  1.00 14.52  ? 7  GLU A N    1 
ATOM 92  C CA   . GLU A 1 7  ? -4.288  -26.477 32.205  1.00 14.52  ? 7  GLU A CA   1 
ATOM 93  C C    . GLU A 1 7  ? -4.201  -25.230 31.303  1.00 14.52  ? 7  GLU A C    1 
ATOM 94  O O    . GLU A 1 7  ? -4.926  -25.107 30.308  1.00 14.52  ? 7  GLU A O    1 
ATOM 95  C CB   . GLU A 1 7  ? -5.322  -26.230 33.360  1.00 8.42   ? 7  GLU A CB   1 
ATOM 96  C CG   . GLU A 1 7  ? -5.902  -27.514 33.979  1.00 8.42   ? 7  GLU A CG   1 
ATOM 97  C CD   . GLU A 1 7  ? -7.179  -27.315 34.814  1.00 8.42   ? 7  GLU A CD   1 
ATOM 98  O OE1  . GLU A 1 7  ? -8.158  -26.695 34.320  1.00 8.42   ? 7  GLU A OE1  1 
ATOM 99  O OE2  . GLU A 1 7  ? -7.211  -27.825 35.949  1.00 8.42   ? 7  GLU A OE2  1 
ATOM 100 H H    . GLU A 1 7  ? -2.763  -26.817 33.658  1.00 88.42  ? 7  GLU A H    1 
ATOM 101 H HA   . GLU A 1 7  ? -4.652  -27.294 31.594  1.00 88.42  ? 7  GLU A HA   1 
ATOM 102 H HB2  . GLU A 1 7  ? -4.838  -25.671 34.144  1.00 88.42  ? 7  GLU A HB2  1 
ATOM 103 H HB3  . GLU A 1 7  ? -6.143  -25.645 32.971  1.00 88.42  ? 7  GLU A HB3  1 
ATOM 104 H HG2  . GLU A 1 7  ? -6.128  -28.205 33.183  1.00 88.42  ? 7  GLU A HG2  1 
ATOM 105 H HG3  . GLU A 1 7  ? -5.147  -27.951 34.618  1.00 88.42  ? 7  GLU A HG3  1 
ATOM 106 N N    . VAL A 1 8  ? -3.287  -24.314 31.627  1.00 17.77  ? 8  VAL A N    1 
ATOM 107 C CA   . VAL A 1 8  ? -3.091  -23.136 30.782  1.00 17.77  ? 8  VAL A CA   1 
ATOM 108 C C    . VAL A 1 8  ? -2.672  -23.666 29.467  1.00 17.77  ? 8  VAL A C    1 
ATOM 109 O O    . VAL A 1 8  ? -3.027  -23.158 28.427  1.00 17.77  ? 8  VAL A O    1 
ATOM 110 C CB   . VAL A 1 8  ? -2.015  -22.132 31.344  1.00 24.35  ? 8  VAL A CB   1 
ATOM 111 C CG1  . VAL A 1 8  ? -1.529  -21.184 30.277  1.00 24.35  ? 8  VAL A CG1  1 
ATOM 112 C CG2  . VAL A 1 8  ? -2.603  -21.285 32.455  1.00 24.35  ? 8  VAL A CG2  1 
ATOM 113 H H    . VAL A 1 8  ? -2.709  -24.458 32.406  1.00 100.00 ? 8  VAL A H    1 
ATOM 114 H HA   . VAL A 1 8  ? -4.038  -22.624 30.678  1.00 100.00 ? 8  VAL A HA   1 
ATOM 115 H HB   . VAL A 1 8  ? -1.175  -22.687 31.735  1.00 100.00 ? 8  VAL A HB   1 
ATOM 116 H HG11 . VAL A 1 8  ? -1.725  -21.606 29.304  1.00 100.00 ? 8  VAL A HG11 1 
ATOM 117 H HG12 . VAL A 1 8  ? -2.045  -20.240 30.373  1.00 100.00 ? 8  VAL A HG12 1 
ATOM 118 H HG13 . VAL A 1 8  ? -0.465  -21.027 30.395  1.00 100.00 ? 8  VAL A HG13 1 
ATOM 119 H HG21 . VAL A 1 8  ? -3.681  -21.320 32.403  1.00 100.00 ? 8  VAL A HG21 1 
ATOM 120 H HG22 . VAL A 1 8  ? -2.275  -21.662 33.412  1.00 100.00 ? 8  VAL A HG22 1 
ATOM 121 H HG23 . VAL A 1 8  ? -2.272  -20.262 32.340  1.00 100.00 ? 8  VAL A HG23 1 
ATOM 122 N N    . ALA A 1 9  ? -1.927  -24.741 29.569  1.00 23.80  ? 9  ALA A N    1 
ATOM 123 C CA   . ALA A 1 9  ? -1.424  -25.425 28.427  1.00 23.80  ? 9  ALA A CA   1 
ATOM 124 C C    . ALA A 1 9  ? -2.553  -26.169 27.707  1.00 23.80  ? 9  ALA A C    1 
ATOM 125 O O    . ALA A 1 9  ? -2.712  -26.052 26.473  1.00 23.80  ? 9  ALA A O    1 
ATOM 126 C CB   . ALA A 1 9  ? -0.354  -26.423 28.921  1.00 11.19  ? 9  ALA A CB   1 
ATOM 127 H H    . ALA A 1 9  ? -1.716  -25.090 30.456  1.00 91.19  ? 9  ALA A H    1 
ATOM 128 H HA   . ALA A 1 9  ? -0.959  -24.715 27.763  1.00 91.19  ? 9  ALA A HA   1 
ATOM 129 H HB1  . ALA A 1 9  ? 0.061   -26.074 29.857  1.00 91.19  ? 9  ALA A HB1  1 
ATOM 130 H HB2  . ALA A 1 9  ? -0.805  -27.393 29.072  1.00 91.19  ? 9  ALA A HB2  1 
ATOM 131 H HB3  . ALA A 1 9  ? 0.433   -26.502 28.187  1.00 91.19  ? 9  ALA A HB3  1 
ATOM 132 N N    . SER A 1 10 ? -3.327  -26.946 28.483  1.00 37.23  ? 10 SER A N    1 
ATOM 133 C CA   . SER A 1 10 ? -4.405  -27.731 27.912  1.00 37.23  ? 10 SER A CA   1 
ATOM 134 C C    . SER A 1 10 ? -5.668  -26.899 27.539  1.00 37.23  ? 10 SER A C    1 
ATOM 135 O O    . SER A 1 10 ? -6.181  -26.987 26.415  1.00 37.23  ? 10 SER A O    1 
ATOM 136 C CB   . SER A 1 10 ? -4.743  -28.854 28.921  1.00 22.46  ? 10 SER A CB   1 
ATOM 137 O OG   . SER A 1 10 ? -3.592  -29.650 29.219  1.00 22.46  ? 10 SER A OG   1 
ATOM 138 H H    . SER A 1 10 ? -3.142  -27.006 29.441  1.00 100.00 ? 10 SER A H    1 
ATOM 139 H HA   . SER A 1 10 ? -4.027  -28.192 27.014  1.00 100.00 ? 10 SER A HA   1 
ATOM 140 H HB2  . SER A 1 10 ? -5.103  -28.414 29.838  1.00 100.00 ? 10 SER A HB2  1 
ATOM 141 H HB3  . SER A 1 10 ? -5.507  -29.494 28.504  1.00 100.00 ? 10 SER A HB3  1 
ATOM 142 H HG   . SER A 1 10 ? -3.380  -30.202 28.461  1.00 100.00 ? 10 SER A HG   1 
ATOM 143 N N    . GLN A 1 11 ? -6.150  -26.100 28.461  1.00 12.57  ? 11 GLN A N    1 
ATOM 144 C CA   . GLN A 1 11 ? -7.359  -25.303 28.263  1.00 12.57  ? 11 GLN A CA   1 
ATOM 145 C C    . GLN A 1 11 ? -7.284  -24.327 27.094  1.00 12.57  ? 11 GLN A C    1 
ATOM 146 O O    . GLN A 1 11 ? -8.206  -24.197 26.294  1.00 12.57  ? 11 GLN A O    1 
ATOM 147 C CB   . GLN A 1 11 ? -7.639  -24.492 29.548  1.00 4.69   ? 11 GLN A CB   1 
ATOM 148 C CG   . GLN A 1 11 ? -8.159  -25.315 30.708  1.00 4.69   ? 11 GLN A CG   1 
ATOM 149 C CD   . GLN A 1 11 ? -9.637  -25.081 30.986  1.00 4.69   ? 11 GLN A CD   1 
ATOM 150 O OE1  . GLN A 1 11 ? -10.252 -25.747 31.834  1.00 4.69   ? 11 GLN A OE1  1 
ATOM 151 N NE2  . GLN A 1 11 ? -10.220 -24.122 30.282  1.00 4.69   ? 11 GLN A NE2  1 
ATOM 152 H H    . GLN A 1 11 ? -5.708  -26.072 29.320  1.00 84.69  ? 11 GLN A H    1 
ATOM 153 H HA   . GLN A 1 11 ? -8.181  -25.979 28.102  1.00 84.69  ? 11 GLN A HA   1 
ATOM 154 H HB2  . GLN A 1 11 ? -6.722  -24.018 29.861  1.00 84.69  ? 11 GLN A HB2  1 
ATOM 155 H HB3  . GLN A 1 11 ? -8.364  -23.727 29.322  1.00 84.69  ? 11 GLN A HB3  1 
ATOM 156 H HG2  . GLN A 1 11 ? -8.012  -26.359 30.483  1.00 84.69  ? 11 GLN A HG2  1 
ATOM 157 H HG3  . GLN A 1 11 ? -7.596  -25.056 31.592  1.00 84.69  ? 11 GLN A HG3  1 
ATOM 158 H HE21 . GLN A 1 11 ? -9.682  -23.625 29.634  1.00 84.69  ? 11 GLN A HE21 1 
ATOM 159 H HE22 . GLN A 1 11 ? -11.173 -23.954 30.435  1.00 84.69  ? 11 GLN A HE22 1 
ATOM 160 N N    . VAL A 1 12 ? -6.231  -23.581 27.059  1.00 4.00   ? 12 VAL A N    1 
ATOM 161 C CA   . VAL A 1 12 ? -6.065  -22.567 26.070  1.00 4.00   ? 12 VAL A CA   1 
ATOM 162 C C    . VAL A 1 12 ? -5.681  -23.029 24.659  1.00 4.00   ? 12 VAL A C    1 
ATOM 163 O O    . VAL A 1 12 ? -6.217  -22.536 23.645  1.00 4.00   ? 12 VAL A O    1 
ATOM 164 C CB   . VAL A 1 12 ? -5.046  -21.560 26.544  1.00 4.00   ? 12 VAL A CB   1 
ATOM 165 C CG1  . VAL A 1 12 ? -4.584  -20.695 25.369  1.00 4.00   ? 12 VAL A CG1  1 
ATOM 166 C CG2  . VAL A 1 12 ? -5.640  -20.712 27.649  1.00 4.00   ? 12 VAL A CG2  1 
ATOM 167 H H    . VAL A 1 12 ? -5.554  -23.680 27.761  1.00 83.20  ? 12 VAL A H    1 
ATOM 168 H HA   . VAL A 1 12 ? -7.007  -22.046 26.000  1.00 83.20  ? 12 VAL A HA   1 
ATOM 169 H HB   . VAL A 1 12 ? -4.192  -22.091 26.939  1.00 83.20  ? 12 VAL A HB   1 
ATOM 170 H HG11 . VAL A 1 12 ? -5.331  -20.717 24.591  1.00 83.20  ? 12 VAL A HG11 1 
ATOM 171 H HG12 . VAL A 1 12 ? -4.444  -19.677 25.705  1.00 83.20  ? 12 VAL A HG12 1 
ATOM 172 H HG13 . VAL A 1 12 ? -3.649  -21.078 24.984  1.00 83.20  ? 12 VAL A HG13 1 
ATOM 173 H HG21 . VAL A 1 12 ? -6.682  -20.964 27.774  1.00 83.20  ? 12 VAL A HG21 1 
ATOM 174 H HG22 . VAL A 1 12 ? -5.110  -20.896 28.570  1.00 83.20  ? 12 VAL A HG22 1 
ATOM 175 H HG23 . VAL A 1 12 ? -5.553  -19.665 27.386  1.00 83.20  ? 12 VAL A HG23 1 
ATOM 176 N N    . THR A 1 13 ? -4.685  -23.890 24.573  1.00 4.00   ? 13 THR A N    1 
ATOM 177 C CA   . THR A 1 13 ? -4.155  -24.231 23.263  1.00 4.00   ? 13 THR A CA   1 
ATOM 178 C C    . THR A 1 13 ? -5.251  -24.669 22.374  1.00 4.00   ? 13 THR A C    1 
ATOM 179 O O    . THR A 1 13 ? -5.465  -24.081 21.342  1.00 4.00   ? 13 THR A O    1 
ATOM 180 C CB   . THR A 1 13 ? -3.225  -25.444 23.472  1.00 31.64  ? 13 THR A CB   1 
ATOM 181 O OG1  . THR A 1 13 ? -2.119  -25.114 24.299  1.00 31.64  ? 13 THR A OG1  1 
ATOM 182 C CG2  . THR A 1 13 ? -2.704  -26.075 22.198  1.00 31.64  ? 13 THR A CG2  1 
ATOM 183 H H    . THR A 1 13 ? -4.227  -24.202 25.383  1.00 100.00 ? 13 THR A H    1 
ATOM 184 H HA   . THR A 1 13 ? -3.612  -23.402 22.841  1.00 100.00 ? 13 THR A HA   1 
ATOM 185 H HB   . THR A 1 13 ? -3.793  -26.205 23.991  1.00 100.00 ? 13 THR A HB   1 
ATOM 186 H HG1  . THR A 1 13 ? -1.993  -25.806 24.950  1.00 100.00 ? 13 THR A HG1  1 
ATOM 187 H HG21 . THR A 1 13 ? -2.581  -25.317 21.440  1.00 100.00 ? 13 THR A HG21 1 
ATOM 188 H HG22 . THR A 1 13 ? -1.749  -26.545 22.396  1.00 100.00 ? 13 THR A HG22 1 
ATOM 189 H HG23 . THR A 1 13 ? -3.404  -26.821 21.855  1.00 100.00 ? 13 THR A HG23 1 
ATOM 190 N N    . ASN A 1 14 ? -6.007  -25.580 22.882  1.00 11.26  ? 14 ASN A N    1 
ATOM 191 C CA   . ASN A 1 14 ? -7.174  -26.117 22.263  1.00 11.26  ? 14 ASN A CA   1 
ATOM 192 C C    . ASN A 1 14 ? -8.208  -25.036 21.857  1.00 11.26  ? 14 ASN A C    1 
ATOM 193 O O    . ASN A 1 14 ? -9.035  -25.311 21.001  1.00 11.26  ? 14 ASN A O    1 
ATOM 194 C CB   . ASN A 1 14 ? -7.715  -27.340 23.024  1.00 4.00   ? 14 ASN A CB   1 
ATOM 195 C CG   . ASN A 1 14 ? -6.861  -28.597 22.724  1.00 4.00   ? 14 ASN A CG   1 
ATOM 196 O OD1  . ASN A 1 14 ? -5.642  -28.540 22.694  1.00 4.00   ? 14 ASN A OD1  1 
ATOM 197 N ND2  . ASN A 1 14 ? -7.488  -29.739 22.507  1.00 4.00   ? 14 ASN A ND2  1 
ATOM 198 H H    . ASN A 1 14 ? -5.791  -25.894 23.790  1.00 74.75  ? 14 ASN A H    1 
ATOM 199 H HA   . ASN A 1 14 ? -6.803  -26.500 21.322  1.00 74.75  ? 14 ASN A HA   1 
ATOM 200 H HB2  . ASN A 1 14 ? -7.690  -27.144 24.087  1.00 74.75  ? 14 ASN A HB2  1 
ATOM 201 H HB3  . ASN A 1 14 ? -8.731  -27.534 22.717  1.00 74.75  ? 14 ASN A HB3  1 
ATOM 202 H HD21 . ASN A 1 14 ? -8.464  -29.749 22.544  1.00 74.75  ? 14 ASN A HD21 1 
ATOM 203 H HD22 . ASN A 1 14 ? -6.944  -30.533 22.315  1.00 74.75  ? 14 ASN A HD22 1 
ATOM 204 N N    . TYR A 1 15 ? -8.241  -23.856 22.523  1.00 24.27  ? 15 TYR A N    1 
ATOM 205 C CA   . TYR A 1 15 ? -9.280  -22.822 22.245  1.00 24.27  ? 15 TYR A CA   1 
ATOM 206 C C    . TYR A 1 15 ? -9.357  -22.465 20.743  1.00 24.27  ? 15 TYR A C    1 
ATOM 207 O O    . TYR A 1 15 ? -10.498 -22.417 20.188  1.00 24.27  ? 15 TYR A O    1 
ATOM 208 C CB   . TYR A 1 15 ? -8.897  -21.533 22.975  1.00 4.00   ? 15 TYR A CB   1 
ATOM 209 C CG   . TYR A 1 15 ? -9.714  -21.166 24.174  1.00 4.00   ? 15 TYR A CG   1 
ATOM 210 C CD1  . TYR A 1 15 ? -9.565  -21.840 25.393  1.00 4.00   ? 15 TYR A CD1  1 
ATOM 211 C CD2  . TYR A 1 15 ? -10.558 -20.074 24.122  1.00 4.00   ? 15 TYR A CD2  1 
ATOM 212 C CE1  . TYR A 1 15 ? -10.241 -21.415 26.548  1.00 4.00   ? 15 TYR A CE1  1 
ATOM 213 C CE2  . TYR A 1 15 ? -11.257 -19.653 25.244  1.00 4.00   ? 15 TYR A CE2  1 
ATOM 214 C CZ   . TYR A 1 15 ? -11.092 -20.315 26.471  1.00 4.00   ? 15 TYR A CZ   1 
ATOM 215 O OH   . TYR A 1 15 ? -11.744 -19.853 27.605  1.00 4.00   ? 15 TYR A OH   1 
ATOM 216 H H    . TYR A 1 15 ? -7.607  -23.704 23.256  1.00 79.06  ? 15 TYR A H    1 
ATOM 217 H HA   . TYR A 1 15 ? -10.238 -23.173 22.596  1.00 79.06  ? 15 TYR A HA   1 
ATOM 218 H HB2  . TYR A 1 15 ? -7.875  -21.618 23.302  1.00 79.06  ? 15 TYR A HB2  1 
ATOM 219 H HB3  . TYR A 1 15 ? -8.967  -20.715 22.275  1.00 79.06  ? 15 TYR A HB3  1 
ATOM 220 H HD1  . TYR A 1 15 ? -8.907  -22.693 25.441  1.00 79.06  ? 15 TYR A HD1  1 
ATOM 221 H HD2  . TYR A 1 15 ? -10.693 -19.562 23.185  1.00 79.06  ? 15 TYR A HD2  1 
ATOM 222 H HE1  . TYR A 1 15 ? -10.114 -21.947 27.480  1.00 79.06  ? 15 TYR A HE1  1 
ATOM 223 H HE2  . TYR A 1 15 ? -11.916 -18.800 25.173  1.00 79.06  ? 15 TYR A HE2  1 
ATOM 224 H HH   . TYR A 1 15 ? -11.302 -20.190 28.389  1.00 79.06  ? 15 TYR A HH   1 
ATOM 225 N N    . ILE A 1 16 ? -8.131  -22.282 20.097  1.00 58.98  ? 16 ILE A N    1 
ATOM 226 C CA   . ILE A 1 16 ? -7.899  -21.998 18.591  1.00 58.98  ? 16 ILE A CA   1 
ATOM 227 C C    . ILE A 1 16 ? -8.076  -23.138 17.619  1.00 58.98  ? 16 ILE A C    1 
ATOM 228 O O    . ILE A 1 16 ? -8.237  -22.857 16.451  1.00 58.98  ? 16 ILE A O    1 
ATOM 229 C CB   . ILE A 1 16 ? -6.533  -21.368 18.210  1.00 4.06   ? 16 ILE A CB   1 
ATOM 230 C CG1  . ILE A 1 16 ? -6.534  -19.904 18.492  1.00 4.06   ? 16 ILE A CG1  1 
ATOM 231 C CG2  . ILE A 1 16 ? -6.125  -21.649 16.783  1.00 4.06   ? 16 ILE A CG2  1 
ATOM 232 C CD1  . ILE A 1 16 ? -7.730  -19.214 17.897  1.00 4.06   ? 16 ILE A CD1  1 
ATOM 233 H H    . ILE A 1 16 ? -7.329  -22.394 20.652  1.00 84.06  ? 16 ILE A H    1 
ATOM 234 H HA   . ILE A 1 16 ? -8.645  -21.260 18.328  1.00 84.06  ? 16 ILE A HA   1 
ATOM 235 H HB   . ILE A 1 16 ? -5.787  -21.826 18.840  1.00 84.06  ? 16 ILE A HB   1 
ATOM 236 H HG12 . ILE A 1 16 ? -6.545  -19.745 19.554  1.00 84.06  ? 16 ILE A HG12 1 
ATOM 237 H HG13 . ILE A 1 16 ? -5.646  -19.456 18.068  1.00 84.06  ? 16 ILE A HG13 1 
ATOM 238 H HG21 . ILE A 1 16 ? -6.911  -21.333 16.114  1.00 84.06  ? 16 ILE A HG21 1 
ATOM 239 H HG22 . ILE A 1 16 ? -5.219  -21.106 16.553  1.00 84.06  ? 16 ILE A HG22 1 
ATOM 240 H HG23 . ILE A 1 16 ? -5.950  -22.708 16.659  1.00 84.06  ? 16 ILE A HG23 1 
ATOM 241 H HD11 . ILE A 1 16 ? -7.971  -19.670 16.948  1.00 84.06  ? 16 ILE A HD11 1 
ATOM 242 H HD12 . ILE A 1 16 ? -8.571  -19.313 18.566  1.00 84.06  ? 16 ILE A HD12 1 
ATOM 243 H HD13 . ILE A 1 16 ? -7.506  -18.168 17.748  1.00 84.06  ? 16 ILE A HD13 1 
ATOM 244 N N    . GLN A 1 17 ? -7.877  -24.384 18.024  1.00 4.00   ? 17 GLN A N    1 
ATOM 245 C CA   . GLN A 1 17 ? -7.818  -25.477 17.060  1.00 4.00   ? 17 GLN A CA   1 
ATOM 246 C C    . GLN A 1 17 ? -9.040  -25.532 16.098  1.00 4.00   ? 17 GLN A C    1 
ATOM 247 O O    . GLN A 1 17 ? -8.862  -25.591 14.898  1.00 4.00   ? 17 GLN A O    1 
ATOM 248 C CB   . GLN A 1 17 ? -7.635  -26.788 17.844  1.00 9.76   ? 17 GLN A CB   1 
ATOM 249 C CG   . GLN A 1 17 ? -6.251  -26.923 18.462  1.00 9.76   ? 17 GLN A CG   1 
ATOM 250 C CD   . GLN A 1 17 ? -5.751  -28.355 18.499  1.00 9.76   ? 17 GLN A CD   1 
ATOM 251 O OE1  . GLN A 1 17 ? -6.358  -29.220 19.149  1.00 9.76   ? 17 GLN A OE1  1 
ATOM 252 N NE2  . GLN A 1 17 ? -4.641  -28.622 17.778  1.00 9.76   ? 17 GLN A NE2  1 
ATOM 253 H H    . GLN A 1 17 ? -7.622  -24.550 18.954  1.00 89.76  ? 17 GLN A H    1 
ATOM 254 H HA   . GLN A 1 17 ? -6.933  -25.321 16.460  1.00 89.76  ? 17 GLN A HA   1 
ATOM 255 H HB2  . GLN A 1 17 ? -8.369  -26.830 18.635  1.00 89.76  ? 17 GLN A HB2  1 
ATOM 256 H HB3  . GLN A 1 17 ? -7.788  -27.622 17.174  1.00 89.76  ? 17 GLN A HB3  1 
ATOM 257 H HG2  . GLN A 1 17 ? -5.554  -26.332 17.886  1.00 89.76  ? 17 GLN A HG2  1 
ATOM 258 H HG3  . GLN A 1 17 ? -6.289  -26.545 19.474  1.00 89.76  ? 17 GLN A HG3  1 
ATOM 259 H HE21 . GLN A 1 17 ? -4.227  -27.891 17.277  1.00 89.76  ? 17 GLN A HE21 1 
ATOM 260 H HE22 . GLN A 1 17 ? -4.296  -29.540 17.783  1.00 89.76  ? 17 GLN A HE22 1 
ATOM 261 N N    . ALA A 1 18 ? -10.235 -25.435 16.613  1.00 5.16   ? 18 ALA A N    1 
ATOM 262 C CA   . ALA A 1 18 ? -11.423 -25.362 15.788  1.00 5.16   ? 18 ALA A CA   1 
ATOM 263 C C    . ALA A 1 18 ? -11.497 -23.974 15.212  1.00 5.16   ? 18 ALA A C    1 
ATOM 264 O O    . ALA A 1 18 ? -12.171 -23.712 14.252  1.00 5.16   ? 18 ALA A O    1 
ATOM 265 C CB   . ALA A 1 18 ? -12.668 -25.656 16.577  1.00 4.00   ? 18 ALA A CB   1 
ATOM 266 H H    . ALA A 1 18 ? -10.323 -25.332 17.582  1.00 81.39  ? 18 ALA A H    1 
ATOM 267 H HA   . ALA A 1 18 ? -11.332 -26.085 14.986  1.00 81.39  ? 18 ALA A HA   1 
ATOM 268 H HB1  . ALA A 1 18 ? -13.050 -26.627 16.298  1.00 81.39  ? 18 ALA A HB1  1 
ATOM 269 H HB2  . ALA A 1 18 ? -12.437 -25.646 17.630  1.00 81.39  ? 18 ALA A HB2  1 
ATOM 270 H HB3  . ALA A 1 18 ? -13.412 -24.902 16.363  1.00 81.39  ? 18 ALA A HB3  1 
ATOM 271 N N    . ILE A 1 19 ? -10.915 -23.057 15.967  1.00 9.23   ? 19 ILE A N    1 
ATOM 272 C CA   . ILE A 1 19 ? -10.966 -21.628 15.682  1.00 9.23   ? 19 ILE A CA   1 
ATOM 273 C C    . ILE A 1 19 ? -10.171 -21.209 14.476  1.00 9.23   ? 19 ILE A C    1 
ATOM 274 O O    . ILE A 1 19 ? -10.617 -20.300 13.842  1.00 9.23   ? 19 ILE A O    1 
ATOM 275 C CB   . ILE A 1 19 ? -10.488 -20.747 16.883  1.00 12.67  ? 19 ILE A CB   1 
ATOM 276 C CG1  . ILE A 1 19 ? -11.479 -20.778 18.071  1.00 12.67  ? 19 ILE A CG1  1 
ATOM 277 C CG2  . ILE A 1 19 ? -10.307 -19.322 16.416  1.00 12.67  ? 19 ILE A CG2  1 
ATOM 278 C CD1  . ILE A 1 19 ? -11.311 -19.633 19.068  1.00 12.67  ? 19 ILE A CD1  1 
ATOM 279 H H    . ILE A 1 19 ? -10.496 -23.346 16.798  1.00 92.67  ? 19 ILE A H    1 
ATOM 280 H HA   . ILE A 1 19 ? -12.000 -21.382 15.497  1.00 92.67  ? 19 ILE A HA   1 
ATOM 281 H HB   . ILE A 1 19 ? -9.529  -21.116 17.208  1.00 92.67  ? 19 ILE A HB   1 
ATOM 282 H HG12 . ILE A 1 19 ? -12.488 -20.730 17.692  1.00 92.67  ? 19 ILE A HG12 1 
ATOM 283 H HG13 . ILE A 1 19 ? -11.353 -21.705 18.613  1.00 92.67  ? 19 ILE A HG13 1 
ATOM 284 H HG21 . ILE A 1 19 ? -11.133 -19.046 15.778  1.00 92.67  ? 19 ILE A HG21 1 
ATOM 285 H HG22 . ILE A 1 19 ? -10.275 -18.665 17.272  1.00 92.67  ? 19 ILE A HG22 1 
ATOM 286 H HG23 . ILE A 1 19 ? -9.383  -19.241 15.864  1.00 92.67  ? 19 ILE A HG23 1 
ATOM 287 H HD11 . ILE A 1 19 ? -10.272 -19.339 19.106  1.00 92.67  ? 19 ILE A HD11 1 
ATOM 288 H HD12 . ILE A 1 19 ? -11.911 -18.793 18.753  1.00 92.67  ? 19 ILE A HD12 1 
ATOM 289 H HD13 . ILE A 1 19 ? -11.631 -19.957 20.047  1.00 92.67  ? 19 ILE A HD13 1 
ATOM 290 N N    . ALA A 1 20 ? -8.983  -21.838 14.214  1.00 4.00   ? 20 ALA A N    1 
ATOM 291 C CA   . ALA A 1 20 ? -8.061  -21.491 13.048  1.00 4.00   ? 20 ALA A CA   1 
ATOM 292 C C    . ALA A 1 20 ? -8.600  -22.013 11.719  1.00 4.00   ? 20 ALA A C    1 
ATOM 293 O O    . ALA A 1 20 ? -8.784  -21.269 10.777  1.00 4.00   ? 20 ALA A O    1 
ATOM 294 C CB   . ALA A 1 20 ? -6.651  -22.027 13.241  1.00 31.78  ? 20 ALA A CB   1 
ATOM 295 H H    . ALA A 1 20 ? -8.700  -22.545 14.830  1.00 100.00 ? 20 ALA A H    1 
ATOM 296 H HA   . ALA A 1 20 ? -8.004  -20.419 12.989  1.00 100.00 ? 20 ALA A HA   1 
ATOM 297 H HB1  . ALA A 1 20 ? -6.549  -22.427 14.239  1.00 100.00 ? 20 ALA A HB1  1 
ATOM 298 H HB2  . ALA A 1 20 ? -5.940  -21.227 13.097  1.00 100.00 ? 20 ALA A HB2  1 
ATOM 299 H HB3  . ALA A 1 20 ? -6.463  -22.808 12.517  1.00 100.00 ? 20 ALA A HB3  1 
ATOM 300 N N    . ALA A 1 21 ? -8.955  -23.258 11.752  1.00 4.00   ? 21 ALA A N    1 
ATOM 301 C CA   . ALA A 1 21 ? -9.604  -23.901 10.687  1.00 4.00   ? 21 ALA A CA   1 
ATOM 302 C C    . ALA A 1 21 ? -10.848 -23.066 10.363  1.00 4.00   ? 21 ALA A C    1 
ATOM 303 O O    . ALA A 1 21 ? -11.349 -22.998 9.224   1.00 4.00   ? 21 ALA A O    1 
ATOM 304 C CB   . ALA A 1 21 ? -9.973  -25.298 11.155  1.00 4.00   ? 21 ALA A CB   1 
ATOM 305 H H    . ALA A 1 21 ? -8.852  -23.751 12.593  1.00 83.47  ? 21 ALA A H    1 
ATOM 306 H HA   . ALA A 1 21 ? -8.945  -23.957 9.835   1.00 83.47  ? 21 ALA A HA   1 
ATOM 307 H HB1  . ALA A 1 21 ? -10.441 -25.836 10.344  1.00 83.47  ? 21 ALA A HB1  1 
ATOM 308 H HB2  . ALA A 1 21 ? -10.662 -25.230 11.983  1.00 83.47  ? 21 ALA A HB2  1 
ATOM 309 H HB3  . ALA A 1 21 ? -9.082  -25.820 11.469  1.00 83.47  ? 21 ALA A HB3  1 
ATOM 310 N N    . ALA A 1 22 ? -11.327 -22.419 11.414  1.00 15.68  ? 22 ALA A N    1 
ATOM 311 C CA   . ALA A 1 22 ? -12.494 -21.540 11.358  1.00 15.68  ? 22 ALA A CA   1 
ATOM 312 C C    . ALA A 1 22 ? -12.123 -20.227 10.699  1.00 15.68  ? 22 ALA A C    1 
ATOM 313 O O    . ALA A 1 22 ? -12.950 -19.555 10.137  1.00 15.68  ? 22 ALA A O    1 
ATOM 314 C CB   . ALA A 1 22 ? -13.081 -21.288 12.765  1.00 4.01   ? 22 ALA A CB   1 
ATOM 315 H H    . ALA A 1 22 ? -10.870 -22.525 12.272  1.00 84.01  ? 22 ALA A H    1 
ATOM 316 H HA   . ALA A 1 22 ? -13.249 -22.030 10.759  1.00 84.01  ? 22 ALA A HA   1 
ATOM 317 H HB1  . ALA A 1 22 ? -12.394 -21.650 13.515  1.00 84.01  ? 22 ALA A HB1  1 
ATOM 318 H HB2  . ALA A 1 22 ? -14.024 -21.806 12.862  1.00 84.01  ? 22 ALA A HB2  1 
ATOM 319 H HB3  . ALA A 1 22 ? -13.238 -20.228 12.906  1.00 84.01  ? 22 ALA A HB3  1 
ATOM 320 N N    . GLY A 1 23 ? -10.890 -19.829 10.819  1.00 4.03   ? 23 GLY A N    1 
ATOM 321 C CA   . GLY A 1 23 ? -10.515 -18.601 10.237  1.00 4.03   ? 23 GLY A CA   1 
ATOM 322 C C    . GLY A 1 23 ? -10.378 -18.758 8.782   1.00 4.03   ? 23 GLY A C    1 
ATOM 323 O O    . GLY A 1 23 ? -10.898 -17.994 7.997   1.00 4.03   ? 23 GLY A O    1 
ATOM 324 H H    . GLY A 1 23 ? -10.246 -20.368 11.318  1.00 82.58  ? 23 GLY A H    1 
ATOM 325 H HA2  . GLY A 1 23 ? -11.270 -17.859 10.449  1.00 82.58  ? 23 GLY A HA2  1 
ATOM 326 H HA3  . GLY A 1 23 ? -9.571  -18.281 10.649  1.00 82.58  ? 23 GLY A HA3  1 
ATOM 327 N N    . VAL A 1 24 ? -9.651  -19.777 8.434   1.00 7.19   ? 24 VAL A N    1 
ATOM 328 C CA   . VAL A 1 24 ? -9.364  -20.079 7.075   1.00 7.19   ? 24 VAL A CA   1 
ATOM 329 C C    . VAL A 1 24 ? -10.603 -20.311 6.242   1.00 7.19   ? 24 VAL A C    1 
ATOM 330 O O    . VAL A 1 24 ? -10.654 -19.914 5.128   1.00 7.19   ? 24 VAL A O    1 
ATOM 331 C CB   . VAL A 1 24 ? -8.414  -21.244 6.968   1.00 4.00   ? 24 VAL A CB   1 
ATOM 332 C CG1  . VAL A 1 24 ? -8.451  -21.818 5.554   1.00 4.00   ? 24 VAL A CG1  1 
ATOM 333 C CG2  . VAL A 1 24 ? -7.017  -20.781 7.320   1.00 4.00   ? 24 VAL A CG2  1 
ATOM 334 H H    . VAL A 1 24 ? -9.266  -20.341 9.138   1.00 70.63  ? 24 VAL A H    1 
ATOM 335 H HA   . VAL A 1 24 ? -8.854  -19.218 6.669   1.00 70.63  ? 24 VAL A HA   1 
ATOM 336 H HB   . VAL A 1 24 ? -8.714  -22.006 7.668   1.00 70.63  ? 24 VAL A HB   1 
ATOM 337 H HG11 . VAL A 1 24 ? -9.473  -22.036 5.282   1.00 70.63  ? 24 VAL A HG11 1 
ATOM 338 H HG12 . VAL A 1 24 ? -8.042  -21.096 4.863   1.00 70.63  ? 24 VAL A HG12 1 
ATOM 339 H HG13 . VAL A 1 24 ? -7.866  -22.725 5.515   1.00 70.63  ? 24 VAL A HG13 1 
ATOM 340 H HG21 . VAL A 1 24 ? -6.837  -19.813 6.872   1.00 70.63  ? 24 VAL A HG21 1 
ATOM 341 H HG22 . VAL A 1 24 ? -6.924  -20.705 8.391   1.00 70.63  ? 24 VAL A HG22 1 
ATOM 342 H HG23 . VAL A 1 24 ? -6.298  -21.490 6.944   1.00 70.63  ? 24 VAL A HG23 1 
ATOM 343 N N    . GLY A 1 25 ? -11.633 -20.847 6.776   1.00 4.00   ? 25 GLY A N    1 
ATOM 344 C CA   . GLY A 1 25 ? -12.818 -20.996 5.970   1.00 4.00   ? 25 GLY A CA   1 
ATOM 345 C C    . GLY A 1 25 ? -13.176 -19.658 5.380   1.00 4.00   ? 25 GLY A C    1 
ATOM 346 O O    . GLY A 1 25 ? -13.846 -19.603 4.397   1.00 4.00   ? 25 GLY A O    1 
ATOM 347 H H    . GLY A 1 25 ? -11.627 -21.110 7.718   1.00 83.29  ? 25 GLY A H    1 
ATOM 348 H HA2  . GLY A 1 25 ? -12.628 -21.705 5.176   1.00 83.29  ? 25 GLY A HA2  1 
ATOM 349 H HA3  . GLY A 1 25 ? -13.631 -21.349 6.583   1.00 83.29  ? 25 GLY A HA3  1 
ATOM 350 N N    . VAL A 1 26 ? -12.789 -18.590 6.076   1.00 4.00   ? 26 VAL A N    1 
ATOM 351 C CA   . VAL A 1 26 ? -13.071 -17.209 5.699   1.00 4.00   ? 26 VAL A CA   1 
ATOM 352 C C    . VAL A 1 26 ? -12.176 -16.667 4.508   1.00 4.00   ? 26 VAL A C    1 
ATOM 353 O O    . VAL A 1 26 ? -12.657 -15.927 3.661   1.00 4.00   ? 26 VAL A O    1 
ATOM 354 C CB   . VAL A 1 26 ? -13.011 -16.328 6.982   1.00 4.00   ? 26 VAL A CB   1 
ATOM 355 C CG1  . VAL A 1 26 ? -13.226 -14.847 6.713   1.00 4.00   ? 26 VAL A CG1  1 
ATOM 356 C CG2  . VAL A 1 26 ? -14.057 -16.807 7.962   1.00 4.00   ? 26 VAL A CG2  1 
ATOM 357 H H    . VAL A 1 26 ? -12.303 -18.743 6.910   1.00 82.74  ? 26 VAL A H    1 
ATOM 358 H HA   . VAL A 1 26 ? -14.095 -17.192 5.356   1.00 82.74  ? 26 VAL A HA   1 
ATOM 359 H HB   . VAL A 1 26 ? -12.044 -16.454 7.440   1.00 82.74  ? 26 VAL A HB   1 
ATOM 360 H HG11 . VAL A 1 26 ? -13.048 -14.641 5.667   1.00 82.74  ? 26 VAL A HG11 1 
ATOM 361 H HG12 . VAL A 1 26 ? -14.242 -14.580 6.965   1.00 82.74  ? 26 VAL A HG12 1 
ATOM 362 H HG13 . VAL A 1 26 ? -12.542 -14.267 7.316   1.00 82.74  ? 26 VAL A HG13 1 
ATOM 363 H HG21 . VAL A 1 26 ? -14.553 -17.677 7.562   1.00 82.74  ? 26 VAL A HG21 1 
ATOM 364 H HG22 . VAL A 1 26 ? -13.583 -17.061 8.897   1.00 82.74  ? 26 VAL A HG22 1 
ATOM 365 H HG23 . VAL A 1 26 ? -14.782 -16.024 8.126   1.00 82.74  ? 26 VAL A HG23 1 
ATOM 366 N N    . LEU A 1 27 ? -10.895 -17.056 4.433   1.00 4.00   ? 27 LEU A N    1 
ATOM 367 C CA   . LEU A 1 27 ? -10.032 -16.655 3.326   1.00 4.00   ? 27 LEU A CA   1 
ATOM 368 C C    . LEU A 1 27 ? -10.329 -17.421 2.059   1.00 4.00   ? 27 LEU A C    1 
ATOM 369 O O    . LEU A 1 27 ? -10.143 -16.923 0.987   1.00 4.00   ? 27 LEU A O    1 
ATOM 370 C CB   . LEU A 1 27 ? -8.556  -16.721 3.593   1.00 4.00   ? 27 LEU A CB   1 
ATOM 371 C CG   . LEU A 1 27 ? -8.036  -15.576 4.402   1.00 4.00   ? 27 LEU A CG   1 
ATOM 372 C CD1  . LEU A 1 27 ? -7.591  -14.456 3.495   1.00 4.00   ? 27 LEU A CD1  1 
ATOM 373 C CD2  . LEU A 1 27 ? -9.104  -15.100 5.347   1.00 4.00   ? 27 LEU A CD2  1 
ATOM 374 H H    . LEU A 1 27 ? -10.546 -17.665 5.117   1.00 63.82  ? 27 LEU A H    1 
ATOM 375 H HA   . LEU A 1 27 ? -10.278 -15.621 3.130   1.00 63.82  ? 27 LEU A HA   1 
ATOM 376 H HB2  . LEU A 1 27 ? -8.340  -17.639 4.117   1.00 63.82  ? 27 LEU A HB2  1 
ATOM 377 H HB3  . LEU A 1 27 ? -8.035  -16.731 2.648   1.00 63.82  ? 27 LEU A HB3  1 
ATOM 378 H HG   . LEU A 1 27 ? -7.189  -15.900 4.984   1.00 63.82  ? 27 LEU A HG   1 
ATOM 379 H HD11 . LEU A 1 27 ? -7.089  -14.870 2.634   1.00 63.82  ? 27 LEU A HD11 1 
ATOM 380 H HD12 . LEU A 1 27 ? -8.452  -13.891 3.173   1.00 63.82  ? 27 LEU A HD12 1 
ATOM 381 H HD13 . LEU A 1 27 ? -6.914  -13.809 4.027   1.00 63.82  ? 27 LEU A HD13 1 
ATOM 382 H HD21 . LEU A 1 27 ? -10.069 -15.180 4.869   1.00 63.82  ? 27 LEU A HD21 1 
ATOM 383 H HD22 . LEU A 1 27 ? -9.092  -15.709 6.238   1.00 63.82  ? 27 LEU A HD22 1 
ATOM 384 H HD23 . LEU A 1 27 ? -8.918  -14.073 5.610   1.00 63.82  ? 27 LEU A HD23 1 
ATOM 385 N N    . ALA A 1 28 ? -10.808 -18.622 2.158   1.00 26.87  ? 28 ALA A N    1 
ATOM 386 C CA   . ALA A 1 28 ? -11.090 -19.324 0.963   1.00 26.87  ? 28 ALA A CA   1 
ATOM 387 C C    . ALA A 1 28 ? -11.969 -18.391 0.224   1.00 26.87  ? 28 ALA A C    1 
ATOM 388 O O    . ALA A 1 28 ? -11.814 -18.128 -0.977  1.00 26.87  ? 28 ALA A O    1 
ATOM 389 C CB   . ALA A 1 28 ? -11.814 -20.644 1.237   1.00 4.00   ? 28 ALA A CB   1 
ATOM 390 H H    . ALA A 1 28 ? -10.975 -19.027 3.035   1.00 83.08  ? 28 ALA A H    1 
ATOM 391 H HA   . ALA A 1 28 ? -10.174 -19.503 0.418   1.00 83.08  ? 28 ALA A HA   1 
ATOM 392 H HB1  . ALA A 1 28 ? -12.768 -20.442 1.703   1.00 83.08  ? 28 ALA A HB1  1 
ATOM 393 H HB2  . ALA A 1 28 ? -11.217 -21.257 1.892   1.00 83.08  ? 28 ALA A HB2  1 
ATOM 394 H HB3  . ALA A 1 28 ? -11.977 -21.167 0.305   1.00 83.08  ? 28 ALA A HB3  1 
ATOM 395 N N    . LEU A 1 29 ? -12.879 -17.865 0.961   1.00 10.07  ? 29 LEU A N    1 
ATOM 396 C CA   . LEU A 1 29 ? -13.791 -16.910 0.443   1.00 10.07  ? 29 LEU A CA   1 
ATOM 397 C C    . LEU A 1 29 ? -13.129 -15.504 0.273   1.00 10.07  ? 29 LEU A C    1 
ATOM 398 O O    . LEU A 1 29 ? -13.492 -14.726 -0.581  1.00 10.07  ? 29 LEU A O    1 
ATOM 399 C CB   . LEU A 1 29 ? -15.092 -17.000 1.267   1.00 4.35   ? 29 LEU A CB   1 
ATOM 400 C CG   . LEU A 1 29 ? -15.781 -18.390 1.135   1.00 4.35   ? 29 LEU A CG   1 
ATOM 401 C CD1  . LEU A 1 29 ? -16.184 -18.951 2.491   1.00 4.35   ? 29 LEU A CD1  1 
ATOM 402 C CD2  . LEU A 1 29 ? -16.994 -18.334 0.189   1.00 4.35   ? 29 LEU A CD2  1 
ATOM 403 H H    . LEU A 1 29 ? -12.925 -18.108 1.907   1.00 84.35  ? 29 LEU A H    1 
ATOM 404 H HA   . LEU A 1 29 ? -14.029 -17.251 -0.559  1.00 84.35  ? 29 LEU A HA   1 
ATOM 405 H HB2  . LEU A 1 29 ? -14.856 -16.820 2.308   1.00 84.35  ? 29 LEU A HB2  1 
ATOM 406 H HB3  . LEU A 1 29 ? -15.779 -16.244 0.924   1.00 84.35  ? 29 LEU A HB3  1 
ATOM 407 H HG   . LEU A 1 29 ? -15.069 -19.082 0.708   1.00 84.35  ? 29 LEU A HG   1 
ATOM 408 H HD11 . LEU A 1 29 ? -16.502 -18.146 3.134   1.00 84.35  ? 29 LEU A HD11 1 
ATOM 409 H HD12 . LEU A 1 29 ? -16.998 -19.651 2.362   1.00 84.35  ? 29 LEU A HD12 1 
ATOM 410 H HD13 . LEU A 1 29 ? -15.342 -19.459 2.936   1.00 84.35  ? 29 LEU A HD13 1 
ATOM 411 H HD21 . LEU A 1 29 ? -17.464 -17.364 0.258   1.00 84.35  ? 29 LEU A HD21 1 
ATOM 412 H HD22 . LEU A 1 29 ? -16.667 -18.504 -0.827  1.00 84.35  ? 29 LEU A HD22 1 
ATOM 413 H HD23 . LEU A 1 29 ? -17.705 -19.097 0.467   1.00 84.35  ? 29 LEU A HD23 1 
ATOM 414 N N    . ALA A 1 30 ? -12.158 -15.177 1.065   1.00 4.01   ? 30 ALA A N    1 
ATOM 415 C CA   . ALA A 1 30 ? -11.502 -13.875 0.926   1.00 4.01   ? 30 ALA A CA   1 
ATOM 416 C C    . ALA A 1 30 ? -10.527 -13.790 -0.281  1.00 4.01   ? 30 ALA A C    1 
ATOM 417 O O    . ALA A 1 30 ? -10.284 -12.738 -0.791  1.00 4.01   ? 30 ALA A O    1 
ATOM 418 C CB   . ALA A 1 30 ? -10.807 -13.488 2.238   1.00 13.66  ? 30 ALA A CB   1 
ATOM 419 H H    . ALA A 1 30 ? -11.860 -15.803 1.752   1.00 93.66  ? 30 ALA A H    1 
ATOM 420 H HA   . ALA A 1 30 ? -12.288 -13.152 0.760   1.00 93.66  ? 30 ALA A HA   1 
ATOM 421 H HB1  . ALA A 1 30 ? -10.947 -14.274 2.965   1.00 93.66  ? 30 ALA A HB1  1 
ATOM 422 H HB2  . ALA A 1 30 ? -9.750  -13.349 2.060   1.00 93.66  ? 30 ALA A HB2  1 
ATOM 423 H HB3  . ALA A 1 30 ? -11.232 -12.570 2.615   1.00 93.66  ? 30 ALA A HB3  1 
ATOM 424 N N    . ILE A 1 31 ? -9.930  -14.911 -0.665  1.00 4.00   ? 31 ILE A N    1 
ATOM 425 C CA   . ILE A 1 31 ? -8.936  -15.001 -1.748  1.00 4.00   ? 31 ILE A CA   1 
ATOM 426 C C    . ILE A 1 31 ? -9.564  -14.912 -3.109  1.00 4.00   ? 31 ILE A C    1 
ATOM 427 O O    . ILE A 1 31 ? -9.024  -14.338 -4.040  1.00 4.00   ? 31 ILE A O    1 
ATOM 428 C CB   . ILE A 1 31 ? -8.223  -16.347 -1.746  1.00 4.00   ? 31 ILE A CB   1 
ATOM 429 C CG1  . ILE A 1 31 ? -7.469  -16.650 -0.409  1.00 4.00   ? 31 ILE A CG1  1 
ATOM 430 C CG2  . ILE A 1 31 ? -7.339  -16.459 -2.982  1.00 4.00   ? 31 ILE A CG2  1 
ATOM 431 C CD1  . ILE A 1 31 ? -6.920  -15.453 0.352   1.00 4.00   ? 31 ILE A CD1  1 
ATOM 432 H H    . ILE A 1 31 ? -10.137 -15.725 -0.170  1.00 80.61  ? 31 ILE A H    1 
ATOM 433 H HA   . ILE A 1 31 ? -8.210  -14.222 -1.623  1.00 80.61  ? 31 ILE A HA   1 
ATOM 434 H HB   . ILE A 1 31 ? -8.995  -17.094 -1.864  1.00 80.61  ? 31 ILE A HB   1 
ATOM 435 H HG12 . ILE A 1 31 ? -8.142  -17.166 0.257   1.00 80.61  ? 31 ILE A HG12 1 
ATOM 436 H HG13 . ILE A 1 31 ? -6.637  -17.303 -0.630  1.00 80.61  ? 31 ILE A HG13 1 
ATOM 437 H HG21 . ILE A 1 31 ? -7.149  -15.472 -3.376  1.00 80.61  ? 31 ILE A HG21 1 
ATOM 438 H HG22 . ILE A 1 31 ? -6.405  -16.927 -2.715  1.00 80.61  ? 31 ILE A HG22 1 
ATOM 439 H HG23 . ILE A 1 31 ? -7.840  -17.052 -3.729  1.00 80.61  ? 31 ILE A HG23 1 
ATOM 440 H HD11 . ILE A 1 31 ? -7.065  -14.557 -0.234  1.00 80.61  ? 31 ILE A HD11 1 
ATOM 441 H HD12 . ILE A 1 31 ? -7.438  -15.356 1.293   1.00 80.61  ? 31 ILE A HD12 1 
ATOM 442 H HD13 . ILE A 1 31 ? -5.866  -15.595 0.535   1.00 80.61  ? 31 ILE A HD13 1 
ATOM 443 N N    . GLY A 1 32 ? -10.686 -15.571 -3.186  1.00 4.25   ? 32 GLY A N    1 
ATOM 444 C CA   . GLY A 1 32 ? -11.426 -15.668 -4.389  1.00 4.25   ? 32 GLY A CA   1 
ATOM 445 C C    . GLY A 1 32 ? -12.144 -14.401 -4.705  1.00 4.25   ? 32 GLY A C    1 
ATOM 446 O O    . GLY A 1 32 ? -12.246 -14.044 -5.891  1.00 4.25   ? 32 GLY A O    1 
ATOM 447 H H    . GLY A 1 32 ? -11.004 -16.041 -2.390  1.00 83.49  ? 32 GLY A H    1 
ATOM 448 H HA2  . GLY A 1 32 ? -10.755 -15.910 -5.196  1.00 83.49  ? 32 GLY A HA2  1 
ATOM 449 H HA3  . GLY A 1 32 ? -12.150 -16.461 -4.289  1.00 83.49  ? 32 GLY A HA3  1 
ATOM 450 N N    . LEU A 1 33 ? -12.651 -13.715 -3.631  1.00 22.39  ? 33 LEU A N    1 
ATOM 451 C CA   . LEU A 1 33 ? -13.416 -12.466 -3.809  1.00 22.39  ? 33 LEU A CA   1 
ATOM 452 C C    . LEU A 1 33 ? -12.645 -11.417 -4.622  1.00 22.39  ? 33 LEU A C    1 
ATOM 453 O O    . LEU A 1 33 ? -13.150 -10.995 -5.631  1.00 22.39  ? 33 LEU A O    1 
ATOM 454 C CB   . LEU A 1 33 ? -13.901 -11.910 -2.474  1.00 7.47   ? 33 LEU A CB   1 
ATOM 455 C CG   . LEU A 1 33 ? -15.131 -12.619 -1.867  1.00 7.47   ? 33 LEU A CG   1 
ATOM 456 C CD1  . LEU A 1 33 ? -15.173 -14.095 -2.246  1.00 7.47   ? 33 LEU A CD1  1 
ATOM 457 C CD2  . LEU A 1 33 ? -15.148 -12.458 -0.340  1.00 7.47   ? 33 LEU A CD2  1 
ATOM 458 H H    . LEU A 1 33 ? -12.529 -14.079 -2.729  1.00 87.47  ? 33 LEU A H    1 
ATOM 459 H HA   . LEU A 1 33 ? -14.289 -12.732 -4.389  1.00 87.47  ? 33 LEU A HA   1 
ATOM 460 H HB2  . LEU A 1 33 ? -13.087 -11.978 -1.766  1.00 87.47  ? 33 LEU A HB2  1 
ATOM 461 H HB3  . LEU A 1 33 ? -14.148 -10.868 -2.612  1.00 87.47  ? 33 LEU A HB3  1 
ATOM 462 H HG   . LEU A 1 33 ? -16.027 -12.156 -2.254  1.00 87.47  ? 33 LEU A HG   1 
ATOM 463 H HD11 . LEU A 1 33 ? -14.168 -14.456 -2.404  1.00 87.47  ? 33 LEU A HD11 1 
ATOM 464 H HD12 . LEU A 1 33 ? -15.636 -14.657 -1.447  1.00 87.47  ? 33 LEU A HD12 1 
ATOM 465 H HD13 . LEU A 1 33 ? -15.748 -14.218 -3.150  1.00 87.47  ? 33 LEU A HD13 1 
ATOM 466 H HD21 . LEU A 1 33 ? -15.072 -11.411 -0.087  1.00 87.47  ? 33 LEU A HD21 1 
ATOM 467 H HD22 . LEU A 1 33 ? -16.073 -12.857 0.051   1.00 87.47  ? 33 LEU A HD22 1 
ATOM 468 H HD23 . LEU A 1 33 ? -14.315 -12.995 0.088   1.00 87.47  ? 33 LEU A HD23 1 
ATOM 469 N N    . SER A 1 34 ? -11.401 -11.095 -4.333  1.00 4.00   ? 34 SER A N    1 
ATOM 470 C CA   . SER A 1 34 ? -10.715 -10.236 -5.267  1.00 4.00   ? 34 SER A CA   1 
ATOM 471 C C    . SER A 1 34 ? -10.503 -11.095 -6.442  1.00 4.00   ? 34 SER A C    1 
ATOM 472 O O    . SER A 1 34 ? -10.535 -10.673 -7.597  1.00 4.00   ? 34 SER A O    1 
ATOM 473 C CB   . SER A 1 34 ? -9.369  -9.687  -4.814  1.00 12.18  ? 34 SER A CB   1 
ATOM 474 O OG   . SER A 1 34 ? -9.515  -8.622  -3.917  1.00 12.18  ? 34 SER A OG   1 
ATOM 475 H H    . SER A 1 34 ? -10.926 -11.516 -3.590  1.00 92.18  ? 34 SER A H    1 
ATOM 476 H HA   . SER A 1 34 ? -11.378 -9.425  -5.537  1.00 92.18  ? 34 SER A HA   1 
ATOM 477 H HB2  . SER A 1 34 ? -8.809  -10.473 -4.331  1.00 92.18  ? 34 SER A HB2  1 
ATOM 478 H HB3  . SER A 1 34 ? -8.822  -9.339  -5.680  1.00 92.18  ? 34 SER A HB3  1 
ATOM 479 H HG   . SER A 1 34 ? -9.659  -7.807  -4.407  1.00 92.18  ? 34 SER A HG   1 
ATOM 480 N N    . ALA A 1 35 ? -10.313 -12.316 -6.125  1.00 4.00   ? 35 ALA A N    1 
ATOM 481 C CA   . ALA A 1 35 ? -10.124 -13.261 -7.102  1.00 4.00   ? 35 ALA A CA   1 
ATOM 482 C C    . ALA A 1 35 ? -11.281 -13.207 -8.043  1.00 4.00   ? 35 ALA A C    1 
ATOM 483 O O    . ALA A 1 35 ? -11.139 -13.570 -9.180  1.00 4.00   ? 35 ALA A O    1 
ATOM 484 C CB   . ALA A 1 35 ? -9.969  -14.613 -6.497  1.00 17.89  ? 35 ALA A CB   1 
ATOM 485 H H    . ALA A 1 35 ? -10.320 -12.586 -5.183  1.00 97.89  ? 35 ALA A H    1 
ATOM 486 H HA   . ALA A 1 35 ? -9.221  -13.016 -7.632  1.00 97.89  ? 35 ALA A HA   1 
ATOM 487 H HB1  . ALA A 1 35 ? -10.032 -14.529 -5.427  1.00 97.89  ? 35 ALA A HB1  1 
ATOM 488 H HB2  . ALA A 1 35 ? -10.754 -15.259 -6.852  1.00 97.89  ? 35 ALA A HB2  1 
ATOM 489 H HB3  . ALA A 1 35 ? -9.007  -15.022 -6.769  1.00 97.89  ? 35 ALA A HB3  1 
ATOM 490 N N    . ALA A 1 36 ? -12.440 -12.799 -7.546  1.00 8.67   ? 36 ALA A N    1 
ATOM 491 C CA   . ALA A 1 36 ? -13.665 -12.766 -8.356  1.00 8.67   ? 36 ALA A CA   1 
ATOM 492 C C    . ALA A 1 36 ? -13.652 -11.715 -9.534  1.00 8.67   ? 36 ALA A C    1 
ATOM 493 O O    . ALA A 1 36 ? -13.921 -12.042 -10.687 1.00 8.67   ? 36 ALA A O    1 
ATOM 494 C CB   . ALA A 1 36 ? -14.852 -12.547 -7.420  1.00 13.96  ? 36 ALA A CB   1 
ATOM 495 H H    . ALA A 1 36 ? -12.487 -12.551 -6.604  1.00 93.96  ? 36 ALA A H    1 
ATOM 496 H HA   . ALA A 1 36 ? -13.780 -13.748 -8.788  1.00 93.96  ? 36 ALA A HA   1 
ATOM 497 H HB1  . ALA A 1 36 ? -14.581 -12.848 -6.418  1.00 93.96  ? 36 ALA A HB1  1 
ATOM 498 H HB2  . ALA A 1 36 ? -15.691 -13.139 -7.756  1.00 93.96  ? 36 ALA A HB2  1 
ATOM 499 H HB3  . ALA A 1 36 ? -15.125 -11.503 -7.419  1.00 93.96  ? 36 ALA A HB3  1 
ATOM 500 N N    . TRP A 1 37 ? -13.292 -10.475 -9.271  1.00 4.33   ? 37 TRP A N    1 
ATOM 501 C CA   . TRP A 1 37 ? -13.205 -9.508  -10.331 1.00 4.33   ? 37 TRP A CA   1 
ATOM 502 C C    . TRP A 1 37 ? -11.909 -9.818  -11.132 1.00 4.33   ? 37 TRP A C    1 
ATOM 503 O O    . TRP A 1 37 ? -11.850 -9.573  -12.295 1.00 4.33   ? 37 TRP A O    1 
ATOM 504 C CB   . TRP A 1 37 ? -13.334 -8.045  -9.825  1.00 13.26  ? 37 TRP A CB   1 
ATOM 505 C CG   . TRP A 1 37 ? -14.704 -7.693  -9.228  1.00 13.26  ? 37 TRP A CG   1 
ATOM 506 C CD1  . TRP A 1 37 ? -15.500 -8.526  -8.521  1.00 13.26  ? 37 TRP A CD1  1 
ATOM 507 C CD2  . TRP A 1 37 ? -15.395 -6.384  -9.202  1.00 13.26  ? 37 TRP A CD2  1 
ATOM 508 N NE1  . TRP A 1 37 ? -16.601 -7.846  -8.023  1.00 13.26  ? 37 TRP A NE1  1 
ATOM 509 C CE2  . TRP A 1 37 ? -16.562 -6.536  -8.421  1.00 13.26  ? 37 TRP A CE2  1 
ATOM 510 C CE3  . TRP A 1 37 ? -15.133 -5.109  -9.730  1.00 13.26  ? 37 TRP A CE3  1 
ATOM 511 C CZ2  . TRP A 1 37 ? -17.450 -5.474  -8.152  1.00 13.26  ? 37 TRP A CZ2  1 
ATOM 512 C CZ3  . TRP A 1 37 ? -16.011 -4.056  -9.461  1.00 13.26  ? 37 TRP A CZ3  1 
ATOM 513 C CH2  . TRP A 1 37 ? -17.154 -4.246  -8.676  1.00 13.26  ? 37 TRP A CH2  1 
ATOM 514 H H    . TRP A 1 37 ? -13.040 -10.222 -8.358  1.00 93.26  ? 37 TRP A H    1 
ATOM 515 H HA   . TRP A 1 37 ? -14.042 -9.706  -10.990 1.00 93.26  ? 37 TRP A HA   1 
ATOM 516 H HB2  . TRP A 1 37 ? -12.590 -7.874  -9.062  1.00 93.26  ? 37 TRP A HB2  1 
ATOM 517 H HB3  . TRP A 1 37 ? -13.150 -7.374  -10.652 1.00 93.26  ? 37 TRP A HB3  1 
ATOM 518 H HD1  . TRP A 1 37 ? -15.284 -9.571  -8.359  1.00 93.26  ? 37 TRP A HD1  1 
ATOM 519 H HE1  . TRP A 1 37 ? -17.298 -8.241  -7.460  1.00 93.26  ? 37 TRP A HE1  1 
ATOM 520 H HE3  . TRP A 1 37 ? -14.270 -4.945  -10.338 1.00 93.26  ? 37 TRP A HE3  1 
ATOM 521 H HZ2  . TRP A 1 37 ? -18.333 -5.609  -7.544  1.00 93.26  ? 37 TRP A HZ2  1 
ATOM 522 H HZ3  . TRP A 1 37 ? -15.806 -3.070  -9.856  1.00 93.26  ? 37 TRP A HZ3  1 
ATOM 523 H HH2  . TRP A 1 37 ? -17.803 -3.403  -8.493  1.00 93.26  ? 37 TRP A HH2  1 
ATOM 524 N N    . LYS A 1 38 ? -10.880 -10.403 -10.498 1.00 4.00   ? 38 LYS A N    1 
ATOM 525 C CA   . LYS A 1 38 ? -9.692  -10.754 -11.228 1.00 4.00   ? 38 LYS A CA   1 
ATOM 526 C C    . LYS A 1 38 ? -10.237 -11.573 -12.304 1.00 4.00   ? 38 LYS A C    1 
ATOM 527 O O    . LYS A 1 38 ? -9.761  -11.615 -13.370 1.00 4.00   ? 38 LYS A O    1 
ATOM 528 C CB   . LYS A 1 38 ? -8.693  -11.721 -10.536 1.00 4.00   ? 38 LYS A CB   1 
ATOM 529 C CG   . LYS A 1 38 ? -8.096  -11.370 -9.163  1.00 4.00   ? 38 LYS A CG   1 
ATOM 530 C CD   . LYS A 1 38 ? -6.992  -12.379 -8.751  1.00 4.00   ? 38 LYS A CD   1 
ATOM 531 C CE   . LYS A 1 38 ? -7.512  -13.808 -8.569  1.00 4.00   ? 38 LYS A CE   1 
ATOM 532 N NZ   . LYS A 1 38 ? -6.422  -14.799 -8.340  1.00 4.00   ? 38 LYS A NZ   1 
ATOM 533 H H    . LYS A 1 38 ? -10.955 -10.629 -9.547  1.00 74.86  ? 38 LYS A H    1 
ATOM 534 H HA   . LYS A 1 38 ? -9.202  -9.874  -11.613 1.00 74.86  ? 38 LYS A HA   1 
ATOM 535 H HB2  . LYS A 1 38 ? -9.188  -12.669 -10.421 1.00 74.86  ? 38 LYS A HB2  1 
ATOM 536 H HB3  . LYS A 1 38 ? -7.865  -11.865 -11.217 1.00 74.86  ? 38 LYS A HB3  1 
ATOM 537 H HG2  . LYS A 1 38 ? -7.666  -10.380 -9.208  1.00 74.86  ? 38 LYS A HG2  1 
ATOM 538 H HG3  . LYS A 1 38 ? -8.881  -11.392 -8.422  1.00 74.86  ? 38 LYS A HG3  1 
ATOM 539 H HD2  . LYS A 1 38 ? -6.232  -12.388 -9.515  1.00 74.86  ? 38 LYS A HD2  1 
ATOM 540 H HD3  . LYS A 1 38 ? -6.553  -12.048 -7.821  1.00 74.86  ? 38 LYS A HD3  1 
ATOM 541 H HE2  . LYS A 1 38 ? -8.168  -13.828 -7.718  1.00 74.86  ? 38 LYS A HE2  1 
ATOM 542 H HE3  . LYS A 1 38 ? -8.062  -14.092 -9.451  1.00 74.86  ? 38 LYS A HE3  1 
ATOM 543 H HZ1  . LYS A 1 38 ? -5.696  -14.392 -7.716  1.00 74.86  ? 38 LYS A HZ1  1 
ATOM 544 H HZ2  . LYS A 1 38 ? -6.805  -15.654 -7.894  1.00 74.86  ? 38 LYS A HZ2  1 
ATOM 545 H HZ3  . LYS A 1 38 ? -5.980  -15.058 -9.241  1.00 74.86  ? 38 LYS A HZ3  1 
ATOM 546 N N    . TYR A 1 39 ? -11.230 -12.298 -11.984 1.00 4.00   ? 39 TYR A N    1 
ATOM 547 C CA   . TYR A 1 39 ? -11.795 -13.202 -12.941 1.00 4.00   ? 39 TYR A CA   1 
ATOM 548 C C    . TYR A 1 39 ? -12.659 -12.515 -14.037 1.00 4.00   ? 39 TYR A C    1 
ATOM 549 O O    . TYR A 1 39 ? -12.618 -12.892 -15.203 1.00 4.00   ? 39 TYR A O    1 
ATOM 550 C CB   . TYR A 1 39 ? -12.552 -14.306 -12.187 1.00 11.24  ? 39 TYR A CB   1 
ATOM 551 C CG   . TYR A 1 39 ? -11.622 -15.331 -11.536 1.00 11.24  ? 39 TYR A CG   1 
ATOM 552 C CD1  . TYR A 1 39 ? -10.228 -15.254 -11.712 1.00 11.24  ? 39 TYR A CD1  1 
ATOM 553 C CD2  . TYR A 1 39 ? -12.134 -16.418 -10.810 1.00 11.24  ? 39 TYR A CD2  1 
ATOM 554 C CE1  . TYR A 1 39 ? -9.383  -16.220 -11.182 1.00 11.24  ? 39 TYR A CE1  1 
ATOM 555 C CE2  . TYR A 1 39 ? -11.291 -17.396 -10.285 1.00 11.24  ? 39 TYR A CE2  1 
ATOM 556 C CZ   . TYR A 1 39 ? -9.920  -17.295 -10.470 1.00 11.24  ? 39 TYR A CZ   1 
ATOM 557 O OH   . TYR A 1 39 ? -9.089  -18.289 -9.986  1.00 11.24  ? 39 TYR A OH   1 
ATOM 558 H H    . TYR A 1 39 ? -11.570 -12.280 -11.067 1.00 91.24  ? 39 TYR A H    1 
ATOM 559 H HA   . TYR A 1 39 ? -10.961 -13.668 -13.444 1.00 91.24  ? 39 TYR A HA   1 
ATOM 560 H HB2  . TYR A 1 39 ? -13.156 -13.860 -11.415 1.00 91.24  ? 39 TYR A HB2  1 
ATOM 561 H HB3  . TYR A 1 39 ? -13.193 -14.833 -12.882 1.00 91.24  ? 39 TYR A HB3  1 
ATOM 562 H HD1  . TYR A 1 39 ? -9.815  -14.423 -12.267 1.00 91.24  ? 39 TYR A HD1  1 
ATOM 563 H HD2  . TYR A 1 39 ? -13.202 -16.495 -10.661 1.00 91.24  ? 39 TYR A HD2  1 
ATOM 564 H HE1  . TYR A 1 39 ? -8.314  -16.140 -11.328 1.00 91.24  ? 39 TYR A HE1  1 
ATOM 565 H HE2  . TYR A 1 39 ? -11.705 -18.222 -9.725  1.00 91.24  ? 39 TYR A HE2  1 
ATOM 566 H HH   . TYR A 1 39 ? -9.618  -18.975 -9.567  1.00 91.24  ? 39 TYR A HH   1 
ATOM 567 N N    . ALA A 1 40 ? -13.448 -11.526 -13.692 1.00 5.69   ? 40 ALA A N    1 
ATOM 568 C CA   . ALA A 1 40 ? -14.263 -10.893 -14.705 1.00 5.69   ? 40 ALA A CA   1 
ATOM 569 C C    . ALA A 1 40 ? -13.380 -10.109 -15.675 1.00 5.69   ? 40 ALA A C    1 
ATOM 570 O O    . ALA A 1 40 ? -13.502 -10.294 -16.863 1.00 5.69   ? 40 ALA A O    1 
ATOM 571 C CB   . ALA A 1 40 ? -15.327 -10.014 -14.056 1.00 10.33  ? 40 ALA A CB   1 
ATOM 572 H H    . ALA A 1 40 ? -13.489 -11.227 -12.760 1.00 90.33  ? 40 ALA A H    1 
ATOM 573 H HA   . ALA A 1 40 ? -14.763 -11.676 -15.256 1.00 90.33  ? 40 ALA A HA   1 
ATOM 574 H HB1  . ALA A 1 40 ? -15.110 -8.975  -14.260 1.00 90.33  ? 40 ALA A HB1  1 
ATOM 575 H HB2  . ALA A 1 40 ? -15.328 -10.179 -12.988 1.00 90.33  ? 40 ALA A HB2  1 
ATOM 576 H HB3  . ALA A 1 40 ? -16.295 -10.266 -14.459 1.00 90.33  ? 40 ALA A HB3  1 
ATOM 577 N N    . LYS A 1 41 ? -12.480 -9.282  -15.110 1.00 4.00   ? 41 LYS A N    1 
ATOM 578 C CA   . LYS A 1 41 ? -11.498 -8.449  -15.820 1.00 4.00   ? 41 LYS A CA   1 
ATOM 579 C C    . LYS A 1 41 ? -10.412 -9.287  -16.519 1.00 4.00   ? 41 LYS A C    1 
ATOM 580 O O    . LYS A 1 41 ? -9.823  -8.827  -17.466 1.00 4.00   ? 41 LYS A O    1 
ATOM 581 C CB   . LYS A 1 41 ? -10.834 -7.360  -14.937 1.00 6.79   ? 41 LYS A CB   1 
ATOM 582 C CG   . LYS A 1 41 ? -11.419 -5.934  -15.110 1.00 6.79   ? 41 LYS A CG   1 
ATOM 583 C CD   . LYS A 1 41 ? -10.426 -4.839  -14.662 1.00 6.79   ? 41 LYS A CD   1 
ATOM 584 C CE   . LYS A 1 41 ? -11.076 -3.459  -14.516 1.00 6.79   ? 41 LYS A CE   1 
ATOM 585 N NZ   . LYS A 1 41 ? -10.211 -2.494  -13.744 1.00 6.79   ? 41 LYS A NZ   1 
ATOM 586 H H    . LYS A 1 41 ? -12.463 -9.251  -14.128 1.00 86.79  ? 41 LYS A H    1 
ATOM 587 H HA   . LYS A 1 41 ? -12.053 -7.942  -16.596 1.00 86.79  ? 41 LYS A HA   1 
ATOM 588 H HB2  . LYS A 1 41 ? -10.948 -7.643  -13.901 1.00 86.79  ? 41 LYS A HB2  1 
ATOM 589 H HB3  . LYS A 1 41 ? -9.782  -7.321  -15.172 1.00 86.79  ? 41 LYS A HB3  1 
ATOM 590 H HG2  . LYS A 1 41 ? -11.658 -5.782  -16.149 1.00 86.79  ? 41 LYS A HG2  1 
ATOM 591 H HG3  . LYS A 1 41 ? -12.320 -5.852  -14.519 1.00 86.79  ? 41 LYS A HG3  1 
ATOM 592 H HD2  . LYS A 1 41 ? -10.005 -5.119  -13.710 1.00 86.79  ? 41 LYS A HD2  1 
ATOM 593 H HD3  . LYS A 1 41 ? -9.632  -4.773  -15.394 1.00 86.79  ? 41 LYS A HD3  1 
ATOM 594 H HE2  . LYS A 1 41 ? -11.251 -3.055  -15.499 1.00 86.79  ? 41 LYS A HE2  1 
ATOM 595 H HE3  . LYS A 1 41 ? -12.017 -3.573  -14.003 1.00 86.79  ? 41 LYS A HE3  1 
ATOM 596 H HZ1  . LYS A 1 41 ? -9.829  -2.954  -12.893 1.00 86.79  ? 41 LYS A HZ1  1 
ATOM 597 H HZ2  . LYS A 1 41 ? -9.419  -2.172  -14.336 1.00 86.79  ? 41 LYS A HZ2  1 
ATOM 598 H HZ3  . LYS A 1 41 ? -10.769 -1.665  -13.456 1.00 86.79  ? 41 LYS A HZ3  1 
ATOM 599 N N    . ARG A 1 42 ? -10.084 -10.483 -16.034 1.00 13.60  ? 42 ARG A N    1 
ATOM 600 C CA   . ARG A 1 42 ? -9.025  -11.318 -16.694 1.00 13.60  ? 42 ARG A CA   1 
ATOM 601 C C    . ARG A 1 42 ? -9.469  -11.635 -18.135 1.00 13.60  ? 42 ARG A C    1 
ATOM 602 O O    . ARG A 1 42 ? -8.691  -11.756 -19.076 1.00 13.60  ? 42 ARG A O    1 
ATOM 603 C CB   . ARG A 1 42 ? -8.713  -12.673 -15.918 1.00 5.23   ? 42 ARG A CB   1 
ATOM 604 C CG   . ARG A 1 42 ? -7.823  -12.576 -14.639 1.00 5.23   ? 42 ARG A CG   1 
ATOM 605 C CD   . ARG A 1 42 ? -6.496  -11.949 -14.959 1.00 5.23   ? 42 ARG A CD   1 
ATOM 606 N NE   . ARG A 1 42 ? -5.814  -11.405 -13.815 1.00 5.23   ? 42 ARG A NE   1 
ATOM 607 C CZ   . ARG A 1 42 ? -5.022  -10.360 -13.926 1.00 5.23   ? 42 ARG A CZ   1 
ATOM 608 N NH1  . ARG A 1 42 ? -5.092  -9.607  -15.043 1.00 5.23   ? 42 ARG A NH1  1 
ATOM 609 N NH2  . ARG A 1 42 ? -4.189  -10.035 -12.932 1.00 5.23   ? 42 ARG A NH2  1 
ATOM 610 H H    . ARG A 1 42 ? -10.536 -10.822 -15.232 1.00 85.23  ? 42 ARG A H    1 
ATOM 611 H HA   . ARG A 1 42 ? -8.123  -10.719 -16.739 1.00 85.23  ? 42 ARG A HA   1 
ATOM 612 H HB2  . ARG A 1 42 ? -9.653  -13.111 -15.618 1.00 85.23  ? 42 ARG A HB2  1 
ATOM 613 H HB3  . ARG A 1 42 ? -8.230  -13.351 -16.605 1.00 85.23  ? 42 ARG A HB3  1 
ATOM 614 H HG2  . ARG A 1 42 ? -8.304  -11.979 -13.900 1.00 85.23  ? 42 ARG A HG2  1 
ATOM 615 H HG3  . ARG A 1 42 ? -7.657  -13.571 -14.249 1.00 85.23  ? 42 ARG A HG3  1 
ATOM 616 H HD2  . ARG A 1 42 ? -5.863  -12.700 -15.400 1.00 85.23  ? 42 ARG A HD2  1 
ATOM 617 H HD3  . ARG A 1 42 ? -6.656  -11.156 -15.674 1.00 85.23  ? 42 ARG A HD3  1 
ATOM 618 H HE   . ARG A 1 42 ? -5.865  -11.889 -12.965 1.00 85.23  ? 42 ARG A HE   1 
ATOM 619 H HH11 . ARG A 1 42 ? -5.739  -9.846  -15.767 1.00 85.23  ? 42 ARG A HH11 1 
ATOM 620 H HH12 . ARG A 1 42 ? -4.500  -8.809  -15.147 1.00 85.23  ? 42 ARG A HH12 1 
ATOM 621 H HH21 . ARG A 1 42 ? -4.167  -10.588 -12.098 1.00 85.23  ? 42 ARG A HH21 1 
ATOM 622 H HH22 . ARG A 1 42 ? -3.592  -9.238  -13.018 1.00 85.23  ? 42 ARG A HH22 1 
ATOM 623 N N    . PHE A 1 43 ? -10.736 -11.778 -18.249 1.00 22.98  ? 43 PHE A N    1 
ATOM 624 C CA   . PHE A 1 43 ? -11.407 -12.087 -19.485 1.00 22.98  ? 43 PHE A CA   1 
ATOM 625 C C    . PHE A 1 43 ? -11.534 -10.898 -20.492 1.00 22.98  ? 43 PHE A C    1 
ATOM 626 O O    . PHE A 1 43 ? -11.695 -11.130 -21.633 1.00 22.98  ? 43 PHE A O    1 
ATOM 627 C CB   . PHE A 1 43 ? -12.665 -12.847 -19.108 1.00 4.00   ? 43 PHE A CB   1 
ATOM 628 C CG   . PHE A 1 43 ? -12.186 -14.102 -18.450 1.00 4.00   ? 43 PHE A CG   1 
ATOM 629 C CD1  . PHE A 1 43 ? -11.695 -14.043 -17.191 1.00 4.00   ? 43 PHE A CD1  1 
ATOM 630 C CD2  . PHE A 1 43 ? -12.016 -15.275 -19.161 1.00 4.00   ? 43 PHE A CD2  1 
ATOM 631 C CE1  . PHE A 1 43 ? -11.095 -15.126 -16.610 1.00 4.00   ? 43 PHE A CE1  1 
ATOM 632 C CE2  . PHE A 1 43 ? -11.391 -16.367 -18.597 1.00 4.00   ? 43 PHE A CE2  1 
ATOM 633 C CZ   . PHE A 1 43 ? -10.942 -16.291 -17.309 1.00 4.00   ? 43 PHE A CZ   1 
ATOM 634 H H    . PHE A 1 43 ? -11.284 -11.678 -17.443 1.00 81.06  ? 43 PHE A H    1 
ATOM 635 H HA   . PHE A 1 43 ? -10.762 -12.804 -19.973 1.00 81.06  ? 43 PHE A HA   1 
ATOM 636 H HB2  . PHE A 1 43 ? -13.260 -12.278 -18.407 1.00 81.06  ? 43 PHE A HB2  1 
ATOM 637 H HB3  . PHE A 1 43 ? -13.236 -13.103 -19.985 1.00 81.06  ? 43 PHE A HB3  1 
ATOM 638 H HD1  . PHE A 1 43 ? -11.792 -13.126 -16.641 1.00 81.06  ? 43 PHE A HD1  1 
ATOM 639 H HD2  . PHE A 1 43 ? -12.400 -15.341 -20.170 1.00 81.06  ? 43 PHE A HD2  1 
ATOM 640 H HE1  . PHE A 1 43 ? -10.741 -15.059 -15.591 1.00 81.06  ? 43 PHE A HE1  1 
ATOM 641 H HE2  . PHE A 1 43 ? -11.262 -17.275 -19.167 1.00 81.06  ? 43 PHE A HE2  1 
ATOM 642 H HZ   . PHE A 1 43 ? -10.451 -17.138 -16.854 1.00 81.06  ? 43 PHE A HZ   1 
ATOM 643 N N    . LEU A 1 44 ? -11.564 -9.638  -20.035 1.00 20.02  ? 44 LEU A N    1 
ATOM 644 C CA   . LEU A 1 44 ? -11.767 -8.426  -20.914 1.00 20.02  ? 44 LEU A CA   1 
ATOM 645 C C    . LEU A 1 44 ? -10.744 -8.043  -21.999 1.00 20.02  ? 44 LEU A C    1 
ATOM 646 O O    . LEU A 1 44 ? -11.138 -7.604  -23.107 1.00 20.02  ? 44 LEU A O    1 
ATOM 647 C CB   . LEU A 1 44 ? -11.725 -7.164  -20.053 1.00 4.00   ? 44 LEU A CB   1 
ATOM 648 C CG   . LEU A 1 44 ? -12.934 -6.864  -19.256 1.00 4.00   ? 44 LEU A CG   1 
ATOM 649 C CD1  . LEU A 1 44 ? -13.563 -5.606  -19.781 1.00 4.00   ? 44 LEU A CD1  1 
ATOM 650 C CD2  . LEU A 1 44 ? -13.862 -8.035  -19.319 1.00 4.00   ? 44 LEU A CD2  1 
ATOM 651 H H    . LEU A 1 44 ? -11.501 -9.502  -19.069 1.00 83.97  ? 44 LEU A H    1 
ATOM 652 H HA   . LEU A 1 44 ? -12.747 -8.489  -21.354 1.00 83.97  ? 44 LEU A HA   1 
ATOM 653 H HB2  . LEU A 1 44 ? -10.894 -7.252  -19.374 1.00 83.97  ? 44 LEU A HB2  1 
ATOM 654 H HB3  . LEU A 1 44 ? -11.539 -6.324  -20.706 1.00 83.97  ? 44 LEU A HB3  1 
ATOM 655 H HG   . LEU A 1 44 ? -12.659 -6.702  -18.224 1.00 83.97  ? 44 LEU A HG   1 
ATOM 656 H HD11 . LEU A 1 44 ? -12.818 -5.021  -20.299 1.00 83.97  ? 44 LEU A HD11 1 
ATOM 657 H HD12 . LEU A 1 44 ? -14.361 -5.861  -20.465 1.00 83.97  ? 44 LEU A HD12 1 
ATOM 658 H HD13 . LEU A 1 44 ? -13.965 -5.033  -18.960 1.00 83.97  ? 44 LEU A HD13 1 
ATOM 659 H HD21 . LEU A 1 44 ? -13.948 -8.373  -20.341 1.00 83.97  ? 44 LEU A HD21 1 
ATOM 660 H HD22 . LEU A 1 44 ? -13.480 -8.834  -18.704 1.00 83.97  ? 44 LEU A HD22 1 
ATOM 661 H HD23 . LEU A 1 44 ? -14.818 -7.738  -18.964 1.00 83.97  ? 44 LEU A HD23 1 
ATOM 662 N N    . LYS A 1 45 ? -9.468  -7.998  -21.604 1.00 16.11  ? 45 LYS A N    1 
ATOM 663 C CA   . LYS A 1 45 ? -8.422  -7.396  -22.462 1.00 16.11  ? 45 LYS A CA   1 
ATOM 664 C C    . LYS A 1 45 ? -8.303  -7.938  -23.927 1.00 16.11  ? 45 LYS A C    1 
ATOM 665 O O    . LYS A 1 45 ? -8.281  -7.127  -24.868 1.00 16.11  ? 45 LYS A O    1 
ATOM 666 C CB   . LYS A 1 45 ? -7.076  -7.429  -21.723 1.00 4.00   ? 45 LYS A CB   1 
ATOM 667 C CG   . LYS A 1 45 ? -6.939  -6.348  -20.642 1.00 4.00   ? 45 LYS A CG   1 
ATOM 668 C CD   . LYS A 1 45 ? -8.245  -5.595  -20.381 1.00 4.00   ? 45 LYS A CD   1 
ATOM 669 C CE   . LYS A 1 45 ? -7.987  -4.281  -19.658 1.00 4.00   ? 45 LYS A CE   1 
ATOM 670 N NZ   . LYS A 1 45 ? -8.843  -3.163  -20.157 1.00 4.00   ? 45 LYS A NZ   1 
ATOM 671 H H    . LYS A 1 45 ? -9.257  -8.207  -20.675 1.00 83.00  ? 45 LYS A H    1 
ATOM 672 H HA   . LYS A 1 45 ? -8.697  -6.356  -22.553 1.00 83.00  ? 45 LYS A HA   1 
ATOM 673 H HB2  . LYS A 1 45 ? -6.956  -8.394  -21.255 1.00 83.00  ? 45 LYS A HB2  1 
ATOM 674 H HB3  . LYS A 1 45 ? -6.280  -7.287  -22.442 1.00 83.00  ? 45 LYS A HB3  1 
ATOM 675 H HG2  . LYS A 1 45 ? -6.623  -6.817  -19.721 1.00 83.00  ? 45 LYS A HG2  1 
ATOM 676 H HG3  . LYS A 1 45 ? -6.185  -5.640  -20.956 1.00 83.00  ? 45 LYS A HG3  1 
ATOM 677 H HD2  . LYS A 1 45 ? -8.726  -5.387  -21.324 1.00 83.00  ? 45 LYS A HD2  1 
ATOM 678 H HD3  . LYS A 1 45 ? -8.890  -6.210  -19.773 1.00 83.00  ? 45 LYS A HD3  1 
ATOM 679 H HE2  . LYS A 1 45 ? -8.181  -4.423  -18.605 1.00 83.00  ? 45 LYS A HE2  1 
ATOM 680 H HE3  . LYS A 1 45 ? -6.949  -4.012  -19.792 1.00 83.00  ? 45 LYS A HE3  1 
ATOM 681 H HZ1  . LYS A 1 45 ? -9.847  -3.427  -20.099 1.00 83.00  ? 45 LYS A HZ1  1 
ATOM 682 H HZ2  . LYS A 1 45 ? -8.687  -2.308  -19.584 1.00 83.00  ? 45 LYS A HZ2  1 
ATOM 683 H HZ3  . LYS A 1 45 ? -8.608  -2.947  -21.147 1.00 83.00  ? 45 LYS A HZ3  1 
ATOM 684 N N    . GLY A 1 46 ? -8.263  -9.246  -24.120 1.00 25.10  ? 46 GLY A N    1 
ATOM 685 C CA   . GLY A 1 46 ? -8.228  -9.778  -25.457 1.00 25.10  ? 46 GLY A CA   1 
ATOM 686 C C    . GLY A 1 46 ? -9.615  -9.652  -26.046 1.00 25.10  ? 46 GLY A C    1 
ATOM 687 O O    . GLY A 1 46 ? -10.517 -9.194  -25.267 1.00 25.10  ? 46 GLY A O    1 
ATOM 688 O OXT  . GLY A 1 46 ? -9.820  -10.018 -27.257 1.00 23.08  ? 46 GLY A OXT  1 
ATOM 689 H H    . GLY A 1 46 ? -8.321  -9.849  -23.357 1.00 100.00 ? 46 GLY A H    1 
ATOM 690 H HA2  . GLY A 1 46 ? -7.520  -9.213  -26.051 1.00 100.00 ? 46 GLY A HA2  1 
ATOM 691 H HA3  . GLY A 1 46 ? -7.941  -10.817 -25.430 1.00 100.00 ? 46 GLY A HA3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  PHE 3  3  3  PHE PHE A . n 
A 1 4  ASN 4  4  4  ASN ASN A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  ALA 9  9  9  ALA ALA A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 GLN 17 17 17 GLN GLN A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 LEU 27 27 27 LEU LEU A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 ILE 31 31 31 ILE ILE A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 TYR 39 39 39 TYR TYR A . n 
A 1 40 ALA 40 40 40 ALA ALA A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 ARG 42 42 42 ARG ARG A . n 
A 1 43 PHE 43 43 43 PHE PHE A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'representative helical assembly'            ? helical   35 
2 'helical asymmetric unit'                    ? monomeric 1  
3 'helical asymmetric unit, std helical frame' ? monomeric 1  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-35)' A 
2 1        A 
3 H        A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
H  'transform to helical frame' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000   
1  'helical symmetry operation' ? ? 0.59707926  0.80218225  0.00000000 0.00000 -0.80218225 0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -49.30000 
2  'helical symmetry operation' ? ? 0.97306633  -0.23052529 0.00000000 0.00000 0.23052529  0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -46.40000 
3  'helical symmetry operation' ? ? 0.17373412  -0.98479260 0.00000000 0.00000 0.98479260  0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -43.50000 
4  'helical symmetry operation' ? ? -0.83544305 -0.54957703 0.00000000 0.00000 0.54957703  -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -40.60000 
5  'helical symmetry operation' ? ? -0.83552937 0.54944579  0.00000000 0.00000 -0.54944579 -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -37.70000 
6  'helical symmetry operation' ? ? 0.17357942  0.98481987  0.00000000 0.00000 -0.98481987 0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -34.80000 
7  'helical symmetry operation' ? ? 0.97303011  0.23067814  0.00000000 0.00000 -0.23067814 0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -31.90000 
8  'helical symmetry operation' ? ? 0.59720526  -0.80208845 0.00000000 0.00000 0.80208845  0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -29.00000 
9  'helical symmetry operation' ? ? -0.49995465 -0.86605158 0.00000000 0.00000 0.86605158  -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -26.10000 
10 'helical symmetry operation' ? ? -0.99324376 0.11604669  0.00000000 0.00000 -0.11604669 -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -23.20000 
11 'helical symmetry operation' ? ? -0.28684225 0.95797783  0.00000000 0.00000 -0.95797783 -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -20.30000 
12 'helical symmetry operation' ? ? 0.76602201  0.64281435  0.00000000 0.00000 -0.64281435 0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -17.40000 
13 'helical symmetry operation' ? ? 0.89364569  -0.44877319 0.00000000 0.00000 0.44877319  0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -14.50000 
14 'helical symmetry operation' ? ? -0.05812160 -0.99830951 0.00000000 0.00000 0.99830951  -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -11.60000 
15 'helical symmetry operation' ? ? -0.93968665 -0.34203654 0.00000000 0.00000 0.34203654  -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -8.70000  
16 'helical symmetry operation' ? ? -0.68625010 0.72736566  0.00000000 0.00000 -0.72736566 -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -5.80000  
17 'helical symmetry operation' ? ? 0.39607442  0.91821841  0.00000000 0.00000 -0.91821841 0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -2.90000  
18 'helical symmetry operation' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -0.00000  
19 'helical symmetry operation' ? ? 0.39607442  -0.91821841 0.00000000 0.00000 0.91821841  0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 2.90000   
20 'helical symmetry operation' ? ? -0.68625010 -0.72736566 0.00000000 0.00000 0.72736566  -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 5.80000   
21 'helical symmetry operation' ? ? -0.93968665 0.34203654  0.00000000 0.00000 -0.34203654 -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 8.70000   
22 'helical symmetry operation' ? ? -0.05812160 0.99830951  0.00000000 0.00000 -0.99830951 -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 11.60000  
23 'helical symmetry operation' ? ? 0.89364569  0.44877319  0.00000000 0.00000 -0.44877319 0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 14.50000  
24 'helical symmetry operation' ? ? 0.76602201  -0.64281435 0.00000000 0.00000 0.64281435  0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 17.40000  
25 'helical symmetry operation' ? ? -0.28684225 -0.95797783 0.00000000 0.00000 0.95797783  -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 20.30000  
26 'helical symmetry operation' ? ? -0.99324376 -0.11604669 0.00000000 0.00000 0.11604669  -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 23.20000  
27 'helical symmetry operation' ? ? -0.49995465 0.86605158  0.00000000 0.00000 -0.86605158 -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 26.10000  
28 'helical symmetry operation' ? ? 0.59720526  0.80208845  0.00000000 0.00000 -0.80208845 0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 29.00000  
29 'helical symmetry operation' ? ? 0.97303011  -0.23067814 0.00000000 0.00000 0.23067814  0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 31.90000  
30 'helical symmetry operation' ? ? 0.17357942  -0.98481987 0.00000000 0.00000 0.98481987  0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 34.80000  
31 'helical symmetry operation' ? ? -0.83552937 -0.54944579 0.00000000 0.00000 0.54944579  -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 37.70000  
32 'helical symmetry operation' ? ? -0.83544305 0.54957703  0.00000000 0.00000 -0.54957703 -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 40.60000  
33 'helical symmetry operation' ? ? 0.17373412  0.98479260  0.00000000 0.00000 -0.98479260 0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 43.50000  
34 'helical symmetry operation' ? ? 0.97306633  0.23052529  0.00000000 0.00000 -0.23052529 0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 46.40000  
35 'helical symmetry operation' ? ? 0.59707926  -0.80218225 0.00000000 0.00000 0.80218225  0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 49.30000  
# 
_pdbx_helical_symmetry.entry_id                  1HGV 
_pdbx_helical_symmetry.number_of_operations      35 
_pdbx_helical_symmetry.rotation_per_n_subunits   66.667000 
_pdbx_helical_symmetry.rise_per_n_subunits       2.900000 
_pdbx_helical_symmetry.n_subunits_divisor        1 
_pdbx_helical_symmetry.dyad_axis                 no 
_pdbx_helical_symmetry.circular_symmetry         1 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-01 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
FXPLOR        refinement       .          ? 1 
CCP13         'data reduction' '(LSQINT)' ? 2 
CCP13-FDSCALE 'data scaling'   .          ? 3 
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
;  THE ANALOGUE OF THE CRYSTALLOGRAPHIC SPACE GROUP FOR                
  HELICAL STRUCTURES IS THE LINE GROUP (A.KLUG, F.H.C.CRICK,          
  H.W.WYCKOFF, ACTA CRYSTALLOG. V.11, 199, 1958).  THE                
  LINE GROUP OF PF1 IS S.  THE UNIT CELL DIMENSIONS ARE THE           
  HELIX PARAMETERS (UNIT TWIST TAU, UNIT HEIGHT P).                   
                                                                      
  THE INDEXING OF UNITS ALONG THE BASIC HELIX IS ILLUSTRATED          
  IN REFERENCE 4.  TO GENERATE COORDINATES X(K), Y(K), Z(K)           
  OF UNIT K FROM THE GIVEN COORDINATES X(0), Y(0), Z(0) OF            
  UNIT 0 IN A UNIT CELL WITH HELIX PARAMETERS                         
         (TAU, P) = (66.667, 2.90),                                   
  APPLY THE MATRIX AND VECTOR:                                        
                                                                      
     |    COS(TAU*K)   -SIN(TAU*K)   0 |    |   0         |           
     |    SIN(TAU*K)   COS(TAU*K)    0 | +  |   0         |           
     |    0            0             1 |    |   P*K       |           
                                                                      
  THE NEIGHBORS IN CONTACT WITH UNIT 0 ARE UNITS                      
         K = +/-1, +/-5, +/-6, +/-11 AND +/-17.                       
  THESE SYMMETRY-RELATED COPIES ARE USED TO DETERMINE INTERCHAIN      
  NON-BONDED CONTACTS DURING THE REFINEMENT.                          

;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HA A ALA 35 ? ? HE2 A LYS 38 ? ? 1.33 
2 1 O  A GLU 7  ? ? H   A GLN 11 ? ? 1.59 
3 1 O  A LYS 38 ? ? HG2 A ARG 42 ? ? 1.59 
4 1 O  A GLY 32 ? ? N   A ALA 36 ? ? 2.08 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 2 ? ? 51.80  -128.49 
2 1 PHE A 3 ? ? -93.89 52.01   
#