data_1HGZ
# 
_entry.id   1HGZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HGZ         
PDBE  EBI-5700     
WWPDB D_1290005700 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1IFP unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF3 MAJOR COATPROTEIN ASSEMBLY' 
PDB 1QL1 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY' 
PDB 1QL2 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY' 
PDB 2IFM unspecified . 
PDB 1IFN unspecified . 
PDB 2IFN unspecified . 
PDB 3IFM unspecified . 
PDB 4IFM unspecified . 
PDB 1PFI unspecified . 
PDB 1HH0 unspecified 'FILAMENTOUS BACTERIOPHAGE PH75' 
PDB 1HGV unspecified 
'FILAMENTOUS BACTERIOPHAGE PH75 PDB PDB ENTRIES 1IFI THROUGH 1IFP ARE ALL RELATED INOVIRUS FIBER DIFFRACTION STUDIES.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HGZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-12-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pederson, D.M.' 1 
'Welsh, L.C.'    2 
'Marvin, D.A.'   3 
'Sampson, M.'    4 
'Perham, R.N.'   5 
'Yu, M.'         6 
'Slater, M.R.'   7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus' J.Mol.Biol.                309 401 ? 2001 
JMOBAK UK 0022-2836 0070 ? 11371161 10.1006/JMBI.2001.4685         
1       'The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1' 
'Acta Crystallogr.,Sect.D' 56  137 ? 2000 ABCRE6 DK 0907-4449 0766 ? 10666593 10.1107/S0907444999015334      
2       'Structure of the Capsid of Pf3 Filamentous Phage Determined from X-Ray Fibre Diffraction Data at 3.1 A Resolution' 
J.Mol.Biol.                283 155 ? 1998 JMOBAK UK 0022-2836 0070 ? 9761681  10.1006/JMBI.1998.2081         
3       
;Pf1 Filamentous Bacteriophage: Refinement of a Molecular Model by Simulated Annealing Using 3.3 Angstroms Resolution X-Ray Fibre Diffraction Data
;
'Acta Crystallogr.,Sect.D' 51  792 ? 1995 ABCRE6 DK 0907-4449 0766 ? 15299811 10.1107/S0907444995003027      
4       'Model-Building Studies of Inovirus: Genetic Variations on a Geometric Theme' Int.J.Biol.Macromol.       12  125 ? 1990 
IJBMDR UK 0141-8130 0708 ? 2078529  '10.1016/0141-8130(90)90064-H' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pederson, D.M.'   1  
primary 'Welsh, L.C.'      2  
primary 'Marvin, D.A.'     3  
primary 'Sampson, M.'      4  
primary 'Perham, R.N.'     5  
primary 'Yu, M.'           6  
primary 'Slater, M.R.'     7  
1       'Welsh, L.C.'      8  
1       'Symmons, M.F.'    9  
1       'Marvin, D.A.'     10 
2       'Welsh, L.C.'      11 
2       'Symmons, M.F.'    12 
2       'Sturtevant, J.M.' 13 
2       'Marvin, D.A.'     14 
2       'Perham, R.N.'     15 
3       'Gonzalez, A.'     16 
3       'Nave, C.'         17 
3       'Marvin, D.A.'     18 
4       'Marvin, D.A.'     19 
# 
_cell.entry_id           1HGZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HGZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PH75 INOVIRUS MAJOR COAT PROTEIN' 
_entity.formula_weight             4816.578 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'MAJOR COAT PROTEIN ASSEMBLY' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PH75 BACTERIOPHAGE MAJOR COAT PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 
_entity_poly.pdbx_seq_one_letter_code_can   MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  PHE n 
1 4  ASN n 
1 5  PRO n 
1 6  SER n 
1 7  GLU n 
1 8  VAL n 
1 9  ALA n 
1 10 SER n 
1 11 GLN n 
1 12 VAL n 
1 13 THR n 
1 14 ASN n 
1 15 TYR n 
1 16 ILE n 
1 17 GLN n 
1 18 ALA n 
1 19 ILE n 
1 20 ALA n 
1 21 ALA n 
1 22 ALA n 
1 23 GLY n 
1 24 VAL n 
1 25 GLY n 
1 26 VAL n 
1 27 LEU n 
1 28 ALA n 
1 29 LEU n 
1 30 ALA n 
1 31 ILE n 
1 32 GLY n 
1 33 LEU n 
1 34 SER n 
1 35 ALA n 
1 36 ALA n 
1 37 TRP n 
1 38 LYS n 
1 39 TYR n 
1 40 ALA n 
1 41 LYS n 
1 42 ARG n 
1 43 PHE n 
1 44 LEU n 
1 45 LYS n 
1 46 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'INOVIRUS PH75' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'BACTERIOPHAGE PH75' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     144736 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'THERMUS THERMOPHILUS HB8' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     300852 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GROWN IN THERMUS THERMOPHILUS' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAT_BPH75 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P82889 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HGZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P82889 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  46 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HGZ 
_exptl.method            'FIBER DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           
;THE DATA IS DERIVED FROM CONTINUOUS TRANSFORM DATA AND THEREFORE THE NUMBER OF UNIQUE REFLECTIONS IS A MEANINGLESS NUMBER. THE STRUCTURE WAS REFINED AGAI THE SAME STRUCTURE FACTORS AS PDB ENTRY 1HGV, USING DIFFERENT REFINEMENT PROTOCOL. THEREFORE, THE STRUCT FACTORS FOR 1HGZ, CAN BE TAKEN FROM R1HGVSF
;
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-02-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX7.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX7.2 
_diffrn_source.pdbx_wavelength             1.488 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1HGZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
# 
_refine.pdbx_refine_id                           'FIBER DIFFRACTION' 
_refine.entry_id                                 1HGZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50. 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22 
_refine.ls_R_factor_R_free                       0.40 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'THE MODEL WAS DERIVED FROM PDB ENTRY 1IFN, REFERENCE 1, BY MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1IFN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'FIBER DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        340 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               340 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.022 ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg             1.9   ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d      19    ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d      ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'FIBER DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'FIBER DIFFRACTION' ? 
# 
_struct.entry_id                  1HGZ 
_struct.title                     'Filamentous Bacteriophage PH75' 
_struct.pdbx_descriptor           'PH75 INOVIRUS MAJOR COAT PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HGZ 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            
;VIRUS, VIRUS COAT PROTEIN, HELICAL VIRUS COAT PROTEIN, SSDNA VIRUSES, INOVIRUS, FILAMENTOUS BACTERIOPHAGE, THERMOPHILES, MEMBRANE PROTEINS, HELICAL VIRUS
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        5 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        46 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         5 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         46 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   42 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HGZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HGZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N    . MET A 1 1  ? -1.806  -26.502 43.098  1.00 4.35   ? 1  MET A N    1 
ATOM 2   C CA   . MET A 1 1  ? -2.248  -26.636 41.692  1.00 4.35   ? 1  MET A CA   1 
ATOM 3   C C    . MET A 1 1  ? -1.354  -25.753 40.771  1.00 4.35   ? 1  MET A C    1 
ATOM 4   O O    . MET A 1 1  ? -1.599  -24.556 40.610  1.00 4.35   ? 1  MET A O    1 
ATOM 5   C CB   . MET A 1 1  ? -3.761  -26.255 41.570  1.00 11.26  ? 1  MET A CB   1 
ATOM 6   C CG   . MET A 1 1  ? -4.758  -27.351 42.022  1.00 11.26  ? 1  MET A CG   1 
ATOM 7   S SD   . MET A 1 1  ? -6.499  -26.846 41.993  1.00 11.26  ? 1  MET A SD   1 
ATOM 8   C CE   . MET A 1 1  ? -7.297  -28.336 42.567  1.00 11.26  ? 1  MET A CE   1 
ATOM 9   H H1   . MET A 1 1  ? -1.027  -25.814 43.114  1.00 91.26  ? 1  MET A H1   1 
ATOM 10  H H2   . MET A 1 1  ? -2.613  -26.156 43.654  1.00 91.26  ? 1  MET A H2   1 
ATOM 11  H H3   . MET A 1 1  ? -1.491  -27.437 43.428  1.00 91.26  ? 1  MET A H3   1 
ATOM 12  H HA   . MET A 1 1  ? -2.116  -27.671 41.397  1.00 91.26  ? 1  MET A HA   1 
ATOM 13  H HB2  . MET A 1 1  ? -3.937  -25.381 42.168  1.00 91.26  ? 1  MET A HB2  1 
ATOM 14  H HB3  . MET A 1 1  ? -3.964  -26.015 40.531  1.00 91.26  ? 1  MET A HB3  1 
ATOM 15  H HG2  . MET A 1 1  ? -4.633  -28.207 41.373  1.00 91.26  ? 1  MET A HG2  1 
ATOM 16  H HG3  . MET A 1 1  ? -4.523  -27.633 43.026  1.00 91.26  ? 1  MET A HG3  1 
ATOM 17  H HE1  . MET A 1 1  ? -6.590  -29.148 42.554  1.00 91.26  ? 1  MET A HE1  1 
ATOM 18  H HE2  . MET A 1 1  ? -7.637  -28.164 43.568  1.00 91.26  ? 1  MET A HE2  1 
ATOM 19  H HE3  . MET A 1 1  ? -8.143  -28.582 41.933  1.00 91.26  ? 1  MET A HE3  1 
ATOM 20  N N    . ASP A 1 2  ? -0.304  -26.377 40.182  1.00 4.07   ? 2  ASP A N    1 
ATOM 21  C CA   . ASP A 1 2  ? 0.651   -25.689 39.289  1.00 4.07   ? 2  ASP A CA   1 
ATOM 22  C C    . ASP A 1 2  ? 0.728   -26.377 37.918  1.00 4.07   ? 2  ASP A C    1 
ATOM 23  O O    . ASP A 1 2  ? 0.828   -25.668 36.912  1.00 4.07   ? 2  ASP A O    1 
ATOM 24  C CB   . ASP A 1 2  ? 2.035   -25.625 39.898  1.00 4.00   ? 2  ASP A CB   1 
ATOM 25  C CG   . ASP A 1 2  ? 3.043   -24.975 38.988  1.00 4.00   ? 2  ASP A CG   1 
ATOM 26  O OD1  . ASP A 1 2  ? 3.603   -25.678 38.140  1.00 4.00   ? 2  ASP A OD1  1 
ATOM 27  O OD2  . ASP A 1 2  ? 3.266   -23.764 39.119  1.00 4.00   ? 2  ASP A OD2  1 
ATOM 28  H H    . ASP A 1 2  ? -0.168  -27.327 40.360  1.00 79.27  ? 2  ASP A H    1 
ATOM 29  H HA   . ASP A 1 2  ? 0.289   -24.678 39.147  1.00 79.27  ? 2  ASP A HA   1 
ATOM 30  H HB2  . ASP A 1 2  ? 1.991   -25.060 40.819  1.00 79.27  ? 2  ASP A HB2  1 
ATOM 31  H HB3  . ASP A 1 2  ? 2.368   -26.630 40.117  1.00 79.27  ? 2  ASP A HB3  1 
ATOM 32  N N    . PHE A 1 3  ? 0.614   -27.780 37.908  1.00 20.23  ? 3  PHE A N    1 
ATOM 33  C CA   . PHE A 1 3  ? 0.585   -28.668 36.640  1.00 20.23  ? 3  PHE A CA   1 
ATOM 34  C C    . PHE A 1 3  ? -0.648  -28.216 35.777  1.00 20.23  ? 3  PHE A C    1 
ATOM 35  O O    . PHE A 1 3  ? -0.688  -28.410 34.557  1.00 20.23  ? 3  PHE A O    1 
ATOM 36  C CB   . PHE A 1 3  ? 0.381   -30.223 37.004  1.00 4.00   ? 3  PHE A CB   1 
ATOM 37  C CG   . PHE A 1 3  ? 1.538   -31.296 36.940  1.00 4.00   ? 3  PHE A CG   1 
ATOM 38  C CD1  . PHE A 1 3  ? 2.891   -31.008 37.123  1.00 4.00   ? 3  PHE A CD1  1 
ATOM 39  C CD2  . PHE A 1 3  ? 1.192   -32.656 36.831  1.00 4.00   ? 3  PHE A CD2  1 
ATOM 40  C CE1  . PHE A 1 3  ? 3.846   -32.029 37.176  1.00 4.00   ? 3  PHE A CE1  1 
ATOM 41  C CE2  . PHE A 1 3  ? 2.145   -33.656 36.876  1.00 4.00   ? 3  PHE A CE2  1 
ATOM 42  C CZ   . PHE A 1 3  ? 3.470   -33.340 37.048  1.00 4.00   ? 3  PHE A CZ   1 
ATOM 43  H H    . PHE A 1 3  ? 0.498   -28.230 38.773  1.00 82.43  ? 3  PHE A H    1 
ATOM 44  H HA   . PHE A 1 3  ? 1.501   -28.526 36.086  1.00 82.43  ? 3  PHE A HA   1 
ATOM 45  H HB2  . PHE A 1 3  ? 0.007   -30.265 38.016  1.00 82.43  ? 3  PHE A HB2  1 
ATOM 46  H HB3  . PHE A 1 3  ? -0.407  -30.595 36.359  1.00 82.43  ? 3  PHE A HB3  1 
ATOM 47  H HD1  . PHE A 1 3  ? 3.204   -29.981 37.222  1.00 82.43  ? 3  PHE A HD1  1 
ATOM 48  H HD2  . PHE A 1 3  ? 0.154   -32.922 36.703  1.00 82.43  ? 3  PHE A HD2  1 
ATOM 49  H HE1  . PHE A 1 3  ? 4.890   -31.783 37.317  1.00 82.43  ? 3  PHE A HE1  1 
ATOM 50  H HE2  . PHE A 1 3  ? 1.848   -34.688 36.774  1.00 82.43  ? 3  PHE A HE2  1 
ATOM 51  H HZ   . PHE A 1 3  ? 4.213   -34.123 37.085  1.00 82.43  ? 3  PHE A HZ   1 
ATOM 52  N N    . ASN A 1 4  ? -1.647  -27.634 36.496  1.00 4.00   ? 4  ASN A N    1 
ATOM 53  C CA   . ASN A 1 4  ? -2.937  -27.132 35.979  1.00 4.00   ? 4  ASN A CA   1 
ATOM 54  C C    . ASN A 1 4  ? -2.731  -26.138 34.824  1.00 4.00   ? 4  ASN A C    1 
ATOM 55  O O    . ASN A 1 4  ? -3.169  -26.384 33.690  1.00 4.00   ? 4  ASN A O    1 
ATOM 56  C CB   . ASN A 1 4  ? -3.761  -26.437 37.132  1.00 4.27   ? 4  ASN A CB   1 
ATOM 57  C CG   . ASN A 1 4  ? -4.456  -27.378 38.172  1.00 4.27   ? 4  ASN A CG   1 
ATOM 58  O OD1  . ASN A 1 4  ? -3.876  -28.333 38.725  1.00 4.27   ? 4  ASN A OD1  1 
ATOM 59  N ND2  . ASN A 1 4  ? -5.691  -27.069 38.476  1.00 4.27   ? 4  ASN A ND2  1 
ATOM 60  H H    . ASN A 1 4  ? -1.501  -27.554 37.459  1.00 84.27  ? 4  ASN A H    1 
ATOM 61  H HA   . ASN A 1 4  ? -3.501  -27.974 35.617  1.00 84.27  ? 4  ASN A HA   1 
ATOM 62  H HB2  . ASN A 1 4  ? -3.096  -25.795 37.687  1.00 84.27  ? 4  ASN A HB2  1 
ATOM 63  H HB3  . ASN A 1 4  ? -4.526  -25.817 36.676  1.00 84.27  ? 4  ASN A HB3  1 
ATOM 64  H HD21 . ASN A 1 4  ? -6.096  -26.277 38.056  1.00 84.27  ? 4  ASN A HD21 1 
ATOM 65  H HD22 . ASN A 1 4  ? -6.164  -27.650 39.100  1.00 84.27  ? 4  ASN A HD22 1 
ATOM 66  N N    . PRO A 1 5  ? -2.103  -24.972 35.115  1.00 25.07  ? 5  PRO A N    1 
ATOM 67  C CA   . PRO A 1 5  ? -1.897  -23.910 34.112  1.00 25.07  ? 5  PRO A CA   1 
ATOM 68  C C    . PRO A 1 5  ? -1.169  -24.364 32.796  1.00 25.07  ? 5  PRO A C    1 
ATOM 69  O O    . PRO A 1 5  ? -1.408  -23.755 31.745  1.00 25.07  ? 5  PRO A O    1 
ATOM 70  C CB   . PRO A 1 5  ? -1.086  -22.873 34.922  1.00 9.71   ? 5  PRO A CB   1 
ATOM 71  C CG   . PRO A 1 5  ? -1.536  -23.060 36.318  1.00 9.71   ? 5  PRO A CG   1 
ATOM 72  C CD   . PRO A 1 5  ? -1.634  -24.540 36.457  1.00 9.71   ? 5  PRO A CD   1 
ATOM 73  H HA   . PRO A 1 5  ? -2.844  -23.469 33.839  1.00 89.71  ? 5  PRO A HA   1 
ATOM 74  H HB2  . PRO A 1 5  ? -0.030  -23.072 34.817  1.00 89.71  ? 5  PRO A HB2  1 
ATOM 75  H HB3  . PRO A 1 5  ? -1.311  -21.878 34.564  1.00 89.71  ? 5  PRO A HB3  1 
ATOM 76  H HG2  . PRO A 1 5  ? -0.809  -22.655 37.006  1.00 89.71  ? 5  PRO A HG2  1 
ATOM 77  H HG3  . PRO A 1 5  ? -2.504  -22.601 36.467  1.00 89.71  ? 5  PRO A HG3  1 
ATOM 78  H HD2  . PRO A 1 5  ? -0.674  -24.957 36.689  1.00 89.71  ? 5  PRO A HD2  1 
ATOM 79  H HD3  . PRO A 1 5  ? -2.351  -24.794 37.221  1.00 89.71  ? 5  PRO A HD3  1 
ATOM 80  N N    . SER A 1 6  ? -0.299  -25.425 32.857  1.00 21.96  ? 6  SER A N    1 
ATOM 81  C CA   . SER A 1 6  ? 0.407   -25.994 31.659  1.00 21.96  ? 6  SER A CA   1 
ATOM 82  C C    . SER A 1 6  ? -0.543  -26.890 30.773  1.00 21.96  ? 6  SER A C    1 
ATOM 83  O O    . SER A 1 6  ? -0.626  -26.734 29.537  1.00 21.96  ? 6  SER A O    1 
ATOM 84  C CB   . SER A 1 6  ? 1.663   -26.777 32.092  1.00 15.77  ? 6  SER A CB   1 
ATOM 85  O OG   . SER A 1 6  ? 2.553   -25.957 32.852  1.00 15.77  ? 6  SER A OG   1 
ATOM 86  H H    . SER A 1 6  ? -0.164  -25.863 33.722  1.00 95.77  ? 6  SER A H    1 
ATOM 87  H HA   . SER A 1 6  ? 0.724   -25.153 31.053  1.00 95.77  ? 6  SER A HA   1 
ATOM 88  H HB2  . SER A 1 6  ? 1.369   -27.622 32.695  1.00 95.77  ? 6  SER A HB2  1 
ATOM 89  H HB3  . SER A 1 6  ? 2.187   -27.129 31.214  1.00 95.77  ? 6  SER A HB3  1 
ATOM 90  H HG   . SER A 1 6  ? 2.890   -26.456 33.599  1.00 95.77  ? 6  SER A HG   1 
ATOM 91  N N    . GLU A 1 7  ? -1.250  -27.822 31.448  1.00 5.49   ? 7  GLU A N    1 
ATOM 92  C CA   . GLU A 1 7  ? -2.200  -28.755 30.846  1.00 5.49   ? 7  GLU A CA   1 
ATOM 93  C C    . GLU A 1 7  ? -3.180  -27.944 30.107  1.00 5.49   ? 7  GLU A C    1 
ATOM 94  O O    . GLU A 1 7  ? -3.745  -28.407 29.151  1.00 5.49   ? 7  GLU A O    1 
ATOM 95  C CB   . GLU A 1 7  ? -2.993  -29.521 31.886  1.00 8.86   ? 7  GLU A CB   1 
ATOM 96  C CG   . GLU A 1 7  ? -2.180  -30.315 32.912  1.00 8.86   ? 7  GLU A CG   1 
ATOM 97  C CD   . GLU A 1 7  ? -3.014  -31.381 33.551  1.00 8.86   ? 7  GLU A CD   1 
ATOM 98  O OE1  . GLU A 1 7  ? -4.194  -31.125 33.810  1.00 8.86   ? 7  GLU A OE1  1 
ATOM 99  O OE2  . GLU A 1 7  ? -2.492  -32.473 33.778  1.00 8.86   ? 7  GLU A OE2  1 
ATOM 100 H H    . GLU A 1 7  ? -1.123  -27.872 32.417  1.00 88.86  ? 7  GLU A H    1 
ATOM 101 H HA   . GLU A 1 7  ? -1.682  -29.433 30.173  1.00 88.86  ? 7  GLU A HA   1 
ATOM 102 H HB2  . GLU A 1 7  ? -3.605  -28.817 32.426  1.00 88.86  ? 7  GLU A HB2  1 
ATOM 103 H HB3  . GLU A 1 7  ? -3.645  -30.213 31.370  1.00 88.86  ? 7  GLU A HB3  1 
ATOM 104 H HG2  . GLU A 1 7  ? -1.343  -30.784 32.417  1.00 88.86  ? 7  GLU A HG2  1 
ATOM 105 H HG3  . GLU A 1 7  ? -1.823  -29.643 33.675  1.00 88.86  ? 7  GLU A HG3  1 
ATOM 106 N N    . VAL A 1 8  ? -3.353  -26.719 30.616  1.00 4.00   ? 8  VAL A N    1 
ATOM 107 C CA   . VAL A 1 8  ? -4.245  -25.672 30.076  1.00 4.00   ? 8  VAL A CA   1 
ATOM 108 C C    . VAL A 1 8  ? -3.719  -25.134 28.781  1.00 4.00   ? 8  VAL A C    1 
ATOM 109 O O    . VAL A 1 8  ? -4.470  -24.634 28.006  1.00 4.00   ? 8  VAL A O    1 
ATOM 110 C CB   . VAL A 1 8  ? -4.518  -24.467 30.980  1.00 14.38  ? 8  VAL A CB   1 
ATOM 111 C CG1  . VAL A 1 8  ? -5.093  -23.300 30.147  1.00 14.38  ? 8  VAL A CG1  1 
ATOM 112 C CG2  . VAL A 1 8  ? -5.474  -24.858 32.109  1.00 14.38  ? 8  VAL A CG2  1 
ATOM 113 H H    . VAL A 1 8  ? -2.831  -26.493 31.407  1.00 94.38  ? 8  VAL A H    1 
ATOM 114 H HA   . VAL A 1 8  ? -5.195  -26.149 29.867  1.00 94.38  ? 8  VAL A HA   1 
ATOM 115 H HB   . VAL A 1 8  ? -3.583  -24.147 31.412  1.00 94.38  ? 8  VAL A HB   1 
ATOM 116 H HG11 . VAL A 1 8  ? -4.410  -23.057 29.346  1.00 94.38  ? 8  VAL A HG11 1 
ATOM 117 H HG12 . VAL A 1 8  ? -6.048  -23.588 29.730  1.00 94.38  ? 8  VAL A HG12 1 
ATOM 118 H HG13 . VAL A 1 8  ? -5.222  -22.436 30.781  1.00 94.38  ? 8  VAL A HG13 1 
ATOM 119 H HG21 . VAL A 1 8  ? -6.164  -25.612 31.752  1.00 94.38  ? 8  VAL A HG21 1 
ATOM 120 H HG22 . VAL A 1 8  ? -4.909  -25.253 32.938  1.00 94.38  ? 8  VAL A HG22 1 
ATOM 121 H HG23 . VAL A 1 8  ? -6.027  -23.988 32.430  1.00 94.38  ? 8  VAL A HG23 1 
ATOM 122 N N    . ALA A 1 9  ? -2.443  -25.178 28.557  1.00 4.00   ? 9  ALA A N    1 
ATOM 123 C CA   . ALA A 1 9  ? -1.981  -24.663 27.330  1.00 4.00   ? 9  ALA A CA   1 
ATOM 124 C C    . ALA A 1 9  ? -2.816  -25.411 26.297  1.00 4.00   ? 9  ALA A C    1 
ATOM 125 O O    . ALA A 1 9  ? -3.173  -24.865 25.268  1.00 4.00   ? 9  ALA A O    1 
ATOM 126 C CB   . ALA A 1 9  ? -0.497  -24.883 27.142  1.00 4.00   ? 9  ALA A CB   1 
ATOM 127 H H    . ALA A 1 9  ? -1.823  -25.550 29.215  1.00 80.43  ? 9  ALA A H    1 
ATOM 128 H HA   . ALA A 1 9  ? -2.207  -23.604 27.296  1.00 80.43  ? 9  ALA A HA   1 
ATOM 129 H HB1  . ALA A 1 9  ? -0.002  -23.931 27.032  1.00 80.43  ? 9  ALA A HB1  1 
ATOM 130 H HB2  . ALA A 1 9  ? -0.098  -25.399 28.002  1.00 80.43  ? 9  ALA A HB2  1 
ATOM 131 H HB3  . ALA A 1 9  ? -0.335  -25.479 26.259  1.00 80.43  ? 9  ALA A HB3  1 
ATOM 132 N N    . SER A 1 10 ? -3.236  -26.643 26.646  1.00 4.00   ? 10 SER A N    1 
ATOM 133 C CA   . SER A 1 10 ? -4.139  -27.422 25.785  1.00 4.00   ? 10 SER A CA   1 
ATOM 134 C C    . SER A 1 10 ? -5.507  -26.699 25.614  1.00 4.00   ? 10 SER A C    1 
ATOM 135 O O    . SER A 1 10 ? -6.162  -26.891 24.631  1.00 4.00   ? 10 SER A O    1 
ATOM 136 C CB   . SER A 1 10 ? -4.386  -28.869 26.304  1.00 4.00   ? 10 SER A CB   1 
ATOM 137 O OG   . SER A 1 10 ? -3.207  -29.689 26.337  1.00 4.00   ? 10 SER A OG   1 
ATOM 138 H H    . SER A 1 10 ? -2.994  -27.000 27.530  1.00 83.39  ? 10 SER A H    1 
ATOM 139 H HA   . SER A 1 10 ? -3.670  -27.481 24.818  1.00 83.39  ? 10 SER A HA   1 
ATOM 140 H HB2  . SER A 1 10 ? -4.781  -28.812 27.311  1.00 83.39  ? 10 SER A HB2  1 
ATOM 141 H HB3  . SER A 1 10 ? -5.114  -29.353 25.675  1.00 83.39  ? 10 SER A HB3  1 
ATOM 142 H HG   . SER A 1 10 ? -3.100  -30.047 27.234  1.00 83.39  ? 10 SER A HG   1 
ATOM 143 N N    . GLN A 1 11 ? -5.957  -25.902 26.591  1.00 4.00   ? 11 GLN A N    1 
ATOM 144 C CA   . GLN A 1 11 ? -7.283  -25.180 26.529  1.00 4.00   ? 11 GLN A CA   1 
ATOM 145 C C    . GLN A 1 11 ? -7.333  -23.958 25.539  1.00 4.00   ? 11 GLN A C    1 
ATOM 146 O O    . GLN A 1 11 ? -8.370  -23.722 24.956  1.00 4.00   ? 11 GLN A O    1 
ATOM 147 C CB   . GLN A 1 11 ? -7.825  -24.743 27.960  1.00 13.42  ? 11 GLN A CB   1 
ATOM 148 C CG   . GLN A 1 11 ? -8.470  -25.853 28.837  1.00 13.42  ? 11 GLN A CG   1 
ATOM 149 C CD   . GLN A 1 11 ? -9.887  -26.290 28.390  1.00 13.42  ? 11 GLN A CD   1 
ATOM 150 O OE1  . GLN A 1 11 ? -10.099 -27.429 28.015  1.00 13.42  ? 11 GLN A OE1  1 
ATOM 151 N NE2  . GLN A 1 11 ? -10.867 -25.397 28.454  1.00 13.42  ? 11 GLN A NE2  1 
ATOM 152 H H    . GLN A 1 11 ? -5.414  -25.803 27.386  1.00 93.42  ? 11 GLN A H    1 
ATOM 153 H HA   . GLN A 1 11 ? -7.983  -25.906 26.139  1.00 93.42  ? 11 GLN A HA   1 
ATOM 154 H HB2  . GLN A 1 11 ? -7.000  -24.329 28.520  1.00 93.42  ? 11 GLN A HB2  1 
ATOM 155 H HB3  . GLN A 1 11 ? -8.562  -23.962 27.819  1.00 93.42  ? 11 GLN A HB3  1 
ATOM 156 H HG2  . GLN A 1 11 ? -7.832  -26.722 28.816  1.00 93.42  ? 11 GLN A HG2  1 
ATOM 157 H HG3  . GLN A 1 11 ? -8.531  -25.488 29.855  1.00 93.42  ? 11 GLN A HG3  1 
ATOM 158 H HE21 . GLN A 1 11 ? -10.654 -24.497 28.779  1.00 93.42  ? 11 GLN A HE21 1 
ATOM 159 H HE22 . GLN A 1 11 ? -11.767 -25.680 28.182  1.00 93.42  ? 11 GLN A HE22 1 
ATOM 160 N N    . VAL A 1 12 ? -6.281  -23.161 25.345  1.00 4.00   ? 12 VAL A N    1 
ATOM 161 C CA   . VAL A 1 12 ? -6.381  -22.046 24.351  1.00 4.00   ? 12 VAL A CA   1 
ATOM 162 C C    . VAL A 1 12 ? -6.264  -22.648 22.907  1.00 4.00   ? 12 VAL A C    1 
ATOM 163 O O    . VAL A 1 12 ? -7.024  -22.387 21.958  1.00 4.00   ? 12 VAL A O    1 
ATOM 164 C CB   . VAL A 1 12 ? -5.266  -20.941 24.494  1.00 4.00   ? 12 VAL A CB   1 
ATOM 165 C CG1  . VAL A 1 12 ? -5.495  -19.840 23.476  1.00 4.00   ? 12 VAL A CG1  1 
ATOM 166 C CG2  . VAL A 1 12 ? -5.159  -20.323 25.893  1.00 4.00   ? 12 VAL A CG2  1 
ATOM 167 H H    . VAL A 1 12 ? -5.441  -23.326 25.827  1.00 83.57  ? 12 VAL A H    1 
ATOM 168 H HA   . VAL A 1 12 ? -7.353  -21.580 24.468  1.00 83.57  ? 12 VAL A HA   1 
ATOM 169 H HB   . VAL A 1 12 ? -4.317  -21.403 24.264  1.00 83.57  ? 12 VAL A HB   1 
ATOM 170 H HG11 . VAL A 1 12 ? -6.417  -20.029 22.945  1.00 83.57  ? 12 VAL A HG11 1 
ATOM 171 H HG12 . VAL A 1 12 ? -5.560  -18.890 23.984  1.00 83.57  ? 12 VAL A HG12 1 
ATOM 172 H HG13 . VAL A 1 12 ? -4.674  -19.821 22.779  1.00 83.57  ? 12 VAL A HG13 1 
ATOM 173 H HG21 . VAL A 1 12 ? -6.082  -20.481 26.429  1.00 83.57  ? 12 VAL A HG21 1 
ATOM 174 H HG22 . VAL A 1 12 ? -4.343  -20.785 26.431  1.00 83.57  ? 12 VAL A HG22 1 
ATOM 175 H HG23 . VAL A 1 12 ? -4.972  -19.262 25.804  1.00 83.57  ? 12 VAL A HG23 1 
ATOM 176 N N    . THR A 1 13 ? -5.235  -23.451 22.808  1.00 11.78  ? 13 THR A N    1 
ATOM 177 C CA   . THR A 1 13 ? -4.806  -24.117 21.619  1.00 11.78  ? 13 THR A CA   1 
ATOM 178 C C    . THR A 1 13 ? -5.916  -24.983 20.904  1.00 11.78  ? 13 THR A C    1 
ATOM 179 O O    . THR A 1 13 ? -6.044  -24.965 19.644  1.00 11.78  ? 13 THR A O    1 
ATOM 180 C CB   . THR A 1 13 ? -3.571  -24.904 22.086  1.00 4.00   ? 13 THR A CB   1 
ATOM 181 O OG1  . THR A 1 13 ? -2.558  -24.020 22.508  1.00 4.00   ? 13 THR A OG1  1 
ATOM 182 C CG2  . THR A 1 13 ? -2.947  -25.810 21.074  1.00 4.00   ? 13 THR A CG2  1 
ATOM 183 H H    . THR A 1 13 ? -4.684  -23.576 23.613  1.00 76.49  ? 13 THR A H    1 
ATOM 184 H HA   . THR A 1 13 ? -4.479  -23.358 20.935  1.00 76.49  ? 13 THR A HA   1 
ATOM 185 H HB   . THR A 1 13 ? -3.856  -25.509 22.938  1.00 76.49  ? 13 THR A HB   1 
ATOM 186 H HG1  . THR A 1 13 ? -2.292  -24.249 23.408  1.00 76.49  ? 13 THR A HG1  1 
ATOM 187 H HG21 . THR A 1 13 ? -3.213  -25.483 20.082  1.00 76.49  ? 13 THR A HG21 1 
ATOM 188 H HG22 . THR A 1 13 ? -1.872  -25.784 21.189  1.00 76.49  ? 13 THR A HG22 1 
ATOM 189 H HG23 . THR A 1 13 ? -3.302  -26.819 21.229  1.00 76.49  ? 13 THR A HG23 1 
ATOM 190 N N    . ASN A 1 14 ? -6.747  -25.704 21.650  1.00 20.55  ? 14 ASN A N    1 
ATOM 191 C CA   . ASN A 1 14 ? -7.827  -26.468 21.027  1.00 20.55  ? 14 ASN A CA   1 
ATOM 192 C C    . ASN A 1 14 ? -8.926  -25.483 20.607  1.00 20.55  ? 14 ASN A C    1 
ATOM 193 O O    . ASN A 1 14 ? -9.637  -25.740 19.637  1.00 20.55  ? 14 ASN A O    1 
ATOM 194 C CB   . ASN A 1 14 ? -8.389  -27.660 21.881  1.00 20.47  ? 14 ASN A CB   1 
ATOM 195 C CG   . ASN A 1 14 ? -7.528  -28.978 21.924  1.00 20.47  ? 14 ASN A CG   1 
ATOM 196 O OD1  . ASN A 1 14 ? -6.384  -29.007 22.364  1.00 20.47  ? 14 ASN A OD1  1 
ATOM 197 N ND2  . ASN A 1 14 ? -8.117  -30.106 21.513  1.00 20.47  ? 14 ASN A ND2  1 
ATOM 198 H H    . ASN A 1 14 ? -6.661  -25.692 22.630  1.00 100.00 ? 14 ASN A H    1 
ATOM 199 H HA   . ASN A 1 14 ? -7.411  -26.880 20.117  1.00 100.00 ? 14 ASN A HA   1 
ATOM 200 H HB2  . ASN A 1 14 ? -8.506  -27.319 22.901  1.00 100.00 ? 14 ASN A HB2  1 
ATOM 201 H HB3  . ASN A 1 14 ? -9.367  -27.916 21.498  1.00 100.00 ? 14 ASN A HB3  1 
ATOM 202 H HD21 . ASN A 1 14 ? -9.044  -30.060 21.205  1.00 100.00 ? 14 ASN A HD21 1 
ATOM 203 H HD22 . ASN A 1 14 ? -7.595  -30.935 21.546  1.00 100.00 ? 14 ASN A HD22 1 
ATOM 204 N N    . TYR A 1 15 ? -9.047  -24.343 21.325  1.00 10.99  ? 15 TYR A N    1 
ATOM 205 C CA   . TYR A 1 15 ? -10.037 -23.308 20.987  1.00 10.99  ? 15 TYR A CA   1 
ATOM 206 C C    . TYR A 1 15 ? -9.574  -22.623 19.650  1.00 10.99  ? 15 TYR A C    1 
ATOM 207 O O    . TYR A 1 15 ? -10.362 -22.141 18.865  1.00 10.99  ? 15 TYR A O    1 
ATOM 208 C CB   . TYR A 1 15 ? -10.179 -22.256 22.152  1.00 4.00   ? 15 TYR A CB   1 
ATOM 209 C CG   . TYR A 1 15 ? -11.127 -22.563 23.380  1.00 4.00   ? 15 TYR A CG   1 
ATOM 210 C CD1  . TYR A 1 15 ? -11.404 -23.858 23.866  1.00 4.00   ? 15 TYR A CD1  1 
ATOM 211 C CD2  . TYR A 1 15 ? -11.723 -21.497 24.098  1.00 4.00   ? 15 TYR A CD2  1 
ATOM 212 C CE1  . TYR A 1 15 ? -12.252 -24.064 24.975  1.00 4.00   ? 15 TYR A CE1  1 
ATOM 213 C CE2  . TYR A 1 15 ? -12.557 -21.707 25.210  1.00 4.00   ? 15 TYR A CE2  1 
ATOM 214 C CZ   . TYR A 1 15 ? -12.819 -22.985 25.633  1.00 4.00   ? 15 TYR A CZ   1 
ATOM 215 O OH   . TYR A 1 15 ? -13.693 -23.191 26.668  1.00 4.00   ? 15 TYR A OH   1 
ATOM 216 H H    . TYR A 1 15 ? -8.442  -24.191 22.080  1.00 79.78  ? 15 TYR A H    1 
ATOM 217 H HA   . TYR A 1 15 ? -10.990 -23.793 20.827  1.00 79.78  ? 15 TYR A HA   1 
ATOM 218 H HB2  . TYR A 1 15 ? -9.200  -22.076 22.560  1.00 79.78  ? 15 TYR A HB2  1 
ATOM 219 H HB3  . TYR A 1 15 ? -10.535 -21.335 21.713  1.00 79.78  ? 15 TYR A HB3  1 
ATOM 220 H HD1  . TYR A 1 15 ? -10.972 -24.706 23.359  1.00 79.78  ? 15 TYR A HD1  1 
ATOM 221 H HD2  . TYR A 1 15 ? -11.523 -20.485 23.779  1.00 79.78  ? 15 TYR A HD2  1 
ATOM 222 H HE1  . TYR A 1 15 ? -12.442 -25.069 25.325  1.00 79.78  ? 15 TYR A HE1  1 
ATOM 223 H HE2  . TYR A 1 15 ? -12.994 -20.862 25.722  1.00 79.78  ? 15 TYR A HE2  1 
ATOM 224 H HH   . TYR A 1 15 ? -13.635 -22.463 27.285  1.00 79.78  ? 15 TYR A HH   1 
ATOM 225 N N    . ILE A 1 16 ? -8.265  -22.586 19.425  1.00 11.37  ? 16 ILE A N    1 
ATOM 226 C CA   . ILE A 1 16 ? -7.629  -21.976 18.233  1.00 11.37  ? 16 ILE A CA   1 
ATOM 227 C C    . ILE A 1 16 ? -7.658  -22.721 16.871  1.00 11.37  ? 16 ILE A C    1 
ATOM 228 O O    . ILE A 1 16 ? -7.545  -22.041 15.823  1.00 11.37  ? 16 ILE A O    1 
ATOM 229 C CB   . ILE A 1 16 ? -6.156  -21.648 18.541  1.00 4.00   ? 16 ILE A CB   1 
ATOM 230 C CG1  . ILE A 1 16 ? -6.051  -20.633 19.681  1.00 4.00   ? 16 ILE A CG1  1 
ATOM 231 C CG2  . ILE A 1 16 ? -5.439  -21.122 17.343  1.00 4.00   ? 16 ILE A CG2  1 
ATOM 232 C CD1  . ILE A 1 16 ? -7.023  -19.483 19.576  1.00 4.00   ? 16 ILE A CD1  1 
ATOM 233 H H    . ILE A 1 16 ? -7.679  -22.978 20.106  1.00 81.43  ? 16 ILE A H    1 
ATOM 234 H HA   . ILE A 1 16 ? -8.118  -21.026 18.087  1.00 81.43  ? 16 ILE A HA   1 
ATOM 235 H HB   . ILE A 1 16 ? -5.668  -22.557 18.844  1.00 81.43  ? 16 ILE A HB   1 
ATOM 236 H HG12 . ILE A 1 16 ? -6.235  -21.135 20.616  1.00 81.43  ? 16 ILE A HG12 1 
ATOM 237 H HG13 . ILE A 1 16 ? -5.052  -20.222 19.690  1.00 81.43  ? 16 ILE A HG13 1 
ATOM 238 H HG21 . ILE A 1 16 ? -5.978  -20.277 16.945  1.00 81.43  ? 16 ILE A HG21 1 
ATOM 239 H HG22 . ILE A 1 16 ? -4.444  -20.813 17.626  1.00 81.43  ? 16 ILE A HG22 1 
ATOM 240 H HG23 . ILE A 1 16 ? -5.376  -21.894 16.593  1.00 81.43  ? 16 ILE A HG23 1 
ATOM 241 H HD11 . ILE A 1 16 ? -7.112  -19.185 18.542  1.00 81.43  ? 16 ILE A HD11 1 
ATOM 242 H HD12 . ILE A 1 16 ? -7.988  -19.794 19.944  1.00 81.43  ? 16 ILE A HD12 1 
ATOM 243 H HD13 . ILE A 1 16 ? -6.663  -18.649 20.161  1.00 81.43  ? 16 ILE A HD13 1 
ATOM 244 N N    . GLN A 1 17 ? -7.653  -24.090 16.780  1.00 18.00  ? 17 GLN A N    1 
ATOM 245 C CA   . GLN A 1 17 ? -7.478  -24.687 15.375  1.00 18.00  ? 17 GLN A CA   1 
ATOM 246 C C    . GLN A 1 17 ? -8.462  -24.190 14.386  1.00 18.00  ? 17 GLN A C    1 
ATOM 247 O O    . GLN A 1 17 ? -8.073  -23.735 13.389  1.00 18.00  ? 17 GLN A O    1 
ATOM 248 C CB   . GLN A 1 17 ? -7.719  -26.232 15.272  1.00 12.45  ? 17 GLN A CB   1 
ATOM 249 C CG   . GLN A 1 17 ? -6.633  -27.194 15.763  1.00 12.45  ? 17 GLN A CG   1 
ATOM 250 C CD   . GLN A 1 17 ? -7.173  -28.623 16.080  1.00 12.45  ? 17 GLN A CD   1 
ATOM 251 O OE1  . GLN A 1 17 ? -6.413  -29.556 16.339  1.00 12.45  ? 17 GLN A OE1  1 
ATOM 252 N NE2  . GLN A 1 17 ? -8.483  -28.801 16.062  1.00 12.45  ? 17 GLN A NE2  1 
ATOM 253 H H    . GLN A 1 17 ? -7.627  -24.651 17.582  1.00 92.45  ? 17 GLN A H    1 
ATOM 254 H HA   . GLN A 1 17 ? -6.480  -24.471 15.025  1.00 92.45  ? 17 GLN A HA   1 
ATOM 255 H HB2  . GLN A 1 17 ? -8.611  -26.461 15.825  1.00 92.45  ? 17 GLN A HB2  1 
ATOM 256 H HB3  . GLN A 1 17 ? -7.908  -26.462 14.229  1.00 92.45  ? 17 GLN A HB3  1 
ATOM 257 H HG2  . GLN A 1 17 ? -5.875  -27.277 14.989  1.00 92.45  ? 17 GLN A HG2  1 
ATOM 258 H HG3  . GLN A 1 17 ? -6.188  -26.792 16.655  1.00 92.45  ? 17 GLN A HG3  1 
ATOM 259 H HE21 . GLN A 1 17 ? -9.054  -28.037 15.859  1.00 92.45  ? 17 GLN A HE21 1 
ATOM 260 H HE22 . GLN A 1 17 ? -8.824  -29.701 16.243  1.00 92.45  ? 17 GLN A HE22 1 
ATOM 261 N N    . ALA A 1 18 ? -9.711  -24.230 14.634  1.00 4.00   ? 18 ALA A N    1 
ATOM 262 C CA   . ALA A 1 18 ? -10.650 -23.727 13.668  1.00 4.00   ? 18 ALA A CA   1 
ATOM 263 C C    . ALA A 1 18 ? -10.673 -22.221 13.689  1.00 4.00   ? 18 ALA A C    1 
ATOM 264 O O    . ALA A 1 18 ? -10.831 -21.543 12.670  1.00 4.00   ? 18 ALA A O    1 
ATOM 265 C CB   . ALA A 1 18 ? -12.042 -24.337 13.830  1.00 4.00   ? 18 ALA A CB   1 
ATOM 266 H H    . ALA A 1 18 ? -10.027 -24.588 15.482  1.00 81.70  ? 18 ALA A H    1 
ATOM 267 H HA   . ALA A 1 18 ? -10.286 -24.037 12.691  1.00 81.70  ? 18 ALA A HA   1 
ATOM 268 H HB1  . ALA A 1 18 ? -11.959 -25.412 13.918  1.00 81.70  ? 18 ALA A HB1  1 
ATOM 269 H HB2  . ALA A 1 18 ? -12.644 -24.096 12.963  1.00 81.70  ? 18 ALA A HB2  1 
ATOM 270 H HB3  . ALA A 1 18 ? -12.508 -23.939 14.714  1.00 81.70  ? 18 ALA A HB3  1 
ATOM 271 N N    . ILE A 1 19 ? -10.580 -21.711 14.868  1.00 21.21  ? 19 ILE A N    1 
ATOM 272 C CA   . ILE A 1 19 ? -10.674 -20.298 15.071  1.00 21.21  ? 19 ILE A CA   1 
ATOM 273 C C    . ILE A 1 19 ? -9.689  -19.521 14.244  1.00 21.21  ? 19 ILE A C    1 
ATOM 274 O O    . ILE A 1 19 ? -10.049 -18.568 13.521  1.00 21.21  ? 19 ILE A O    1 
ATOM 275 C CB   . ILE A 1 19 ? -10.458 -19.937 16.544  1.00 4.00   ? 19 ILE A CB   1 
ATOM 276 C CG1  . ILE A 1 19 ? -11.620 -20.444 17.375  1.00 4.00   ? 19 ILE A CG1  1 
ATOM 277 C CG2  . ILE A 1 19 ? -10.306 -18.440 16.664  1.00 4.00   ? 19 ILE A CG2  1 
ATOM 278 C CD1  . ILE A 1 19 ? -11.555 -20.058 18.860  1.00 4.00   ? 19 ILE A CD1  1 
ATOM 279 H H    . ILE A 1 19 ? -10.503 -22.302 15.642  1.00 83.04  ? 19 ILE A H    1 
ATOM 280 H HA   . ILE A 1 19 ? -11.672 -19.994 14.799  1.00 83.04  ? 19 ILE A HA   1 
ATOM 281 H HB   . ILE A 1 19 ? -9.543  -20.401 16.882  1.00 83.04  ? 19 ILE A HB   1 
ATOM 282 H HG12 . ILE A 1 19 ? -12.540 -20.045 16.971  1.00 83.04  ? 19 ILE A HG12 1 
ATOM 283 H HG13 . ILE A 1 19 ? -11.646 -21.521 17.314  1.00 83.04  ? 19 ILE A HG13 1 
ATOM 284 H HG21 . ILE A 1 19 ? -10.780 -17.963 15.819  1.00 83.04  ? 19 ILE A HG21 1 
ATOM 285 H HG22 . ILE A 1 19 ? -10.770 -18.100 17.576  1.00 83.04  ? 19 ILE A HG22 1 
ATOM 286 H HG23 . ILE A 1 19 ? -9.257  -18.186 16.676  1.00 83.04  ? 19 ILE A HG23 1 
ATOM 287 H HD11 . ILE A 1 19 ? -10.522 -20.000 19.173  1.00 83.04  ? 19 ILE A HD11 1 
ATOM 288 H HD12 . ILE A 1 19 ? -12.030 -19.099 19.008  1.00 83.04  ? 19 ILE A HD12 1 
ATOM 289 H HD13 . ILE A 1 19 ? -12.066 -20.806 19.448  1.00 83.04  ? 19 ILE A HD13 1 
ATOM 290 N N    . ALA A 1 20 ? -8.459  -19.919 14.290  1.00 5.44   ? 20 ALA A N    1 
ATOM 291 C CA   . ALA A 1 20 ? -7.510  -19.190 13.545  1.00 5.44   ? 20 ALA A CA   1 
ATOM 292 C C    . ALA A 1 20 ? -8.015  -19.124 12.134  1.00 5.44   ? 20 ALA A C    1 
ATOM 293 O O    . ALA A 1 20 ? -7.781  -18.160 11.457  1.00 5.44   ? 20 ALA A O    1 
ATOM 294 C CB   . ALA A 1 20 ? -6.145  -19.841 13.647  1.00 4.00   ? 20 ALA A CB   1 
ATOM 295 H H    . ALA A 1 20 ? -8.195  -20.688 14.834  1.00 76.34  ? 20 ALA A H    1 
ATOM 296 H HA   . ALA A 1 20 ? -7.456  -18.194 13.947  1.00 76.34  ? 20 ALA A HA   1 
ATOM 297 H HB1  . ALA A 1 20 ? -6.156  -20.571 14.442  1.00 76.34  ? 20 ALA A HB1  1 
ATOM 298 H HB2  . ALA A 1 20 ? -5.402  -19.088 13.859  1.00 76.34  ? 20 ALA A HB2  1 
ATOM 299 H HB3  . ALA A 1 20 ? -5.910  -20.328 12.713  1.00 76.34  ? 20 ALA A HB3  1 
ATOM 300 N N    . ALA A 1 21 ? -8.751  -20.147 11.740  1.00 10.58  ? 21 ALA A N    1 
ATOM 301 C CA   . ALA A 1 21 ? -9.373  -20.292 10.392  1.00 10.58  ? 21 ALA A CA   1 
ATOM 302 C C    . ALA A 1 21 ? -10.519 -19.308 10.103  1.00 10.58  ? 21 ALA A C    1 
ATOM 303 O O    . ALA A 1 21 ? -10.959 -19.125 8.947   1.00 10.58  ? 21 ALA A O    1 
ATOM 304 C CB   . ALA A 1 21 ? -9.793  -21.727 10.053  1.00 11.02  ? 21 ALA A CB   1 
ATOM 305 H H    . ALA A 1 21 ? -8.915  -20.858 12.391  1.00 91.02  ? 21 ALA A H    1 
ATOM 306 H HA   . ALA A 1 21 ? -8.584  -20.044 9.690   1.00 91.02  ? 21 ALA A HA   1 
ATOM 307 H HB1  . ALA A 1 21 ? -10.630 -21.704 9.370   1.00 91.02  ? 21 ALA A HB1  1 
ATOM 308 H HB2  . ALA A 1 21 ? -8.966  -22.244 9.590   1.00 91.02  ? 21 ALA A HB2  1 
ATOM 309 H HB3  . ALA A 1 21 ? -10.079 -22.242 10.957  1.00 91.02  ? 21 ALA A HB3  1 
ATOM 310 N N    . ALA A 1 22 ? -11.188 -18.833 11.125  1.00 6.36   ? 22 ALA A N    1 
ATOM 311 C CA   . ALA A 1 22 ? -12.389 -18.116 10.799  1.00 6.36   ? 22 ALA A CA   1 
ATOM 312 C C    . ALA A 1 22 ? -12.179 -16.990 9.764   1.00 6.36   ? 22 ALA A C    1 
ATOM 313 O O    . ALA A 1 22 ? -12.886 -16.972 8.794   1.00 6.36   ? 22 ALA A O    1 
ATOM 314 C CB   . ALA A 1 22 ? -12.937 -17.520 12.097  1.00 4.00   ? 22 ALA A CB   1 
ATOM 315 H H    . ALA A 1 22 ? -10.974 -19.094 12.049  1.00 81.31  ? 22 ALA A H    1 
ATOM 316 H HA   . ALA A 1 22 ? -13.112 -18.813 10.416  1.00 81.31  ? 22 ALA A HA   1 
ATOM 317 H HB1  . ALA A 1 22 ? -12.127 -17.377 12.798  1.00 81.31  ? 22 ALA A HB1  1 
ATOM 318 H HB2  . ALA A 1 22 ? -13.667 -18.189 12.521  1.00 81.31  ? 22 ALA A HB2  1 
ATOM 319 H HB3  . ALA A 1 22 ? -13.400 -16.566 11.887  1.00 81.31  ? 22 ALA A HB3  1 
ATOM 320 N N    . GLY A 1 23 ? -11.230 -16.111 9.932   1.00 5.20   ? 23 GLY A N    1 
ATOM 321 C CA   . GLY A 1 23 ? -11.022 -15.084 8.946   1.00 5.20   ? 23 GLY A CA   1 
ATOM 322 C C    . GLY A 1 23 ? -10.324 -15.604 7.729   1.00 5.20   ? 23 GLY A C    1 
ATOM 323 O O    . GLY A 1 23 ? -10.772 -15.409 6.637   1.00 5.20   ? 23 GLY A O    1 
ATOM 324 H H    . GLY A 1 23 ? -10.653 -16.166 10.720  1.00 85.36  ? 23 GLY A H    1 
ATOM 325 H HA2  . GLY A 1 23 ? -11.983 -14.687 8.657   1.00 85.36  ? 23 GLY A HA2  1 
ATOM 326 H HA3  . GLY A 1 23 ? -10.432 -14.295 9.379   1.00 85.36  ? 23 GLY A HA3  1 
ATOM 327 N N    . VAL A 1 24 ? -9.231  -16.299 7.925   1.00 7.21   ? 24 VAL A N    1 
ATOM 328 C CA   . VAL A 1 24 ? -8.510  -16.905 6.816   1.00 7.21   ? 24 VAL A CA   1 
ATOM 329 C C    . VAL A 1 24 ? -9.156  -18.195 6.250   1.00 7.21   ? 24 VAL A C    1 
ATOM 330 O O    . VAL A 1 24 ? -9.023  -18.495 5.040   1.00 7.21   ? 24 VAL A O    1 
ATOM 331 C CB   . VAL A 1 24 ? -7.012  -17.135 7.107   1.00 16.82  ? 24 VAL A CB   1 
ATOM 332 C CG1  . VAL A 1 24 ? -6.422  -18.132 6.141   1.00 16.82  ? 24 VAL A CG1  1 
ATOM 333 C CG2  . VAL A 1 24 ? -6.261  -15.848 6.903   1.00 16.82  ? 24 VAL A CG2  1 
ATOM 334 H H    . VAL A 1 24 ? -8.919  -16.452 8.840   1.00 96.82  ? 24 VAL A H    1 
ATOM 335 H HA   . VAL A 1 24 ? -8.554  -16.172 6.028   1.00 96.82  ? 24 VAL A HA   1 
ATOM 336 H HB   . VAL A 1 24 ? -6.872  -17.475 8.126   1.00 96.82  ? 24 VAL A HB   1 
ATOM 337 H HG11 . VAL A 1 24 ? -7.183  -18.825 5.826   1.00 96.82  ? 24 VAL A HG11 1 
ATOM 338 H HG12 . VAL A 1 24 ? -6.032  -17.606 5.283   1.00 96.82  ? 24 VAL A HG12 1 
ATOM 339 H HG13 . VAL A 1 24 ? -5.621  -18.669 6.627   1.00 96.82  ? 24 VAL A HG13 1 
ATOM 340 H HG21 . VAL A 1 24 ? -6.950  -15.019 6.950   1.00 96.82  ? 24 VAL A HG21 1 
ATOM 341 H HG22 . VAL A 1 24 ? -5.513  -15.740 7.672   1.00 96.82  ? 24 VAL A HG22 1 
ATOM 342 H HG23 . VAL A 1 24 ? -5.783  -15.866 5.936   1.00 96.82  ? 24 VAL A HG23 1 
ATOM 343 N N    . GLY A 1 25 ? -9.693  -19.022 7.187   1.00 29.41  ? 25 GLY A N    1 
ATOM 344 C CA   . GLY A 1 25 ? -10.202 -20.370 6.853   1.00 29.41  ? 25 GLY A CA   1 
ATOM 345 C C    . GLY A 1 25 ? -11.544 -20.558 6.139   1.00 29.41  ? 25 GLY A C    1 
ATOM 346 O O    . GLY A 1 25 ? -11.573 -21.266 5.126   1.00 29.41  ? 25 GLY A O    1 
ATOM 347 H H    . GLY A 1 25 ? -9.628  -18.755 8.120   1.00 85.88  ? 25 GLY A H    1 
ATOM 348 H HA2  . GLY A 1 25 ? -9.463  -20.850 6.241   1.00 85.88  ? 25 GLY A HA2  1 
ATOM 349 H HA3  . GLY A 1 25 ? -10.248 -20.924 7.789   1.00 85.88  ? 25 GLY A HA3  1 
ATOM 350 N N    . VAL A 1 26 ? -12.659 -19.977 6.569   1.00 28.42  ? 26 VAL A N    1 
ATOM 351 C CA   . VAL A 1 26 ? -13.876 -20.204 5.768   1.00 28.42  ? 26 VAL A CA   1 
ATOM 352 C C    . VAL A 1 26 ? -13.795 -19.340 4.542   1.00 28.42  ? 26 VAL A C    1 
ATOM 353 O O    . VAL A 1 26 ? -14.159 -19.733 3.412   1.00 28.42  ? 26 VAL A O    1 
ATOM 354 C CB   . VAL A 1 26 ? -15.236 -20.057 6.493   1.00 23.59  ? 26 VAL A CB   1 
ATOM 355 C CG1  . VAL A 1 26 ? -16.366 -19.894 5.474   1.00 23.59  ? 26 VAL A CG1  1 
ATOM 356 C CG2  . VAL A 1 26 ? -15.510 -21.309 7.342   1.00 23.59  ? 26 VAL A CG2  1 
ATOM 357 H H    . VAL A 1 26 ? -12.662 -19.400 7.370   1.00 100.00 ? 26 VAL A H    1 
ATOM 358 H HA   . VAL A 1 26 ? -13.810 -21.234 5.429   1.00 100.00 ? 26 VAL A HA   1 
ATOM 359 H HB   . VAL A 1 26 ? -15.209 -19.192 7.142   1.00 100.00 ? 26 VAL A HB   1 
ATOM 360 H HG11 . VAL A 1 26 ? -16.058 -20.313 4.526   1.00 100.00 ? 26 VAL A HG11 1 
ATOM 361 H HG12 . VAL A 1 26 ? -17.245 -20.414 5.826   1.00 100.00 ? 26 VAL A HG12 1 
ATOM 362 H HG13 . VAL A 1 26 ? -16.592 -18.846 5.349   1.00 100.00 ? 26 VAL A HG13 1 
ATOM 363 H HG21 . VAL A 1 26 ? -14.578 -21.815 7.551   1.00 100.00 ? 26 VAL A HG21 1 
ATOM 364 H HG22 . VAL A 1 26 ? -15.977 -21.021 8.274   1.00 100.00 ? 26 VAL A HG22 1 
ATOM 365 H HG23 . VAL A 1 26 ? -16.168 -21.975 6.800   1.00 100.00 ? 26 VAL A HG23 1 
ATOM 366 N N    . LEU A 1 27 ? -13.226 -18.179 4.800   1.00 8.50   ? 27 LEU A N    1 
ATOM 367 C CA   . LEU A 1 27 ? -12.980 -17.186 3.803   1.00 8.50   ? 27 LEU A CA   1 
ATOM 368 C C    . LEU A 1 27 ? -12.218 -17.656 2.640   1.00 8.50   ? 27 LEU A C    1 
ATOM 369 O O    . LEU A 1 27 ? -12.403 -17.120 1.659   1.00 8.50   ? 27 LEU A O    1 
ATOM 370 C CB   . LEU A 1 27 ? -12.472 -15.884 4.347   1.00 19.14  ? 27 LEU A CB   1 
ATOM 371 C CG   . LEU A 1 27 ? -13.573 -15.064 4.949   1.00 19.14  ? 27 LEU A CG   1 
ATOM 372 C CD1  . LEU A 1 27 ? -14.501 -15.941 5.747   1.00 19.14  ? 27 LEU A CD1  1 
ATOM 373 C CD2  . LEU A 1 27 ? -12.987 -13.951 5.761   1.00 19.14  ? 27 LEU A CD2  1 
ATOM 374 H H    . LEU A 1 27 ? -12.930 -17.999 5.715   1.00 99.14  ? 27 LEU A H    1 
ATOM 375 H HA   . LEU A 1 27 ? -13.964 -16.969 3.411   1.00 99.14  ? 27 LEU A HA   1 
ATOM 376 H HB2  . LEU A 1 27 ? -11.728 -16.090 5.103   1.00 99.14  ? 27 LEU A HB2  1 
ATOM 377 H HB3  . LEU A 1 27 ? -12.019 -15.320 3.555   1.00 99.14  ? 27 LEU A HB3  1 
ATOM 378 H HG   . LEU A 1 27 ? -14.152 -14.618 4.153   1.00 99.14  ? 27 LEU A HG   1 
ATOM 379 H HD11 . LEU A 1 27 ? -13.947 -16.430 6.535   1.00 99.14  ? 27 LEU A HD11 1 
ATOM 380 H HD12 . LEU A 1 27 ? -15.285 -15.337 6.180   1.00 99.14  ? 27 LEU A HD12 1 
ATOM 381 H HD13 . LEU A 1 27 ? -14.940 -16.687 5.100   1.00 99.14  ? 27 LEU A HD13 1 
ATOM 382 H HD21 . LEU A 1 27 ? -12.160 -13.509 5.222   1.00 99.14  ? 27 LEU A HD21 1 
ATOM 383 H HD22 . LEU A 1 27 ? -13.743 -13.199 5.938   1.00 99.14  ? 27 LEU A HD22 1 
ATOM 384 H HD23 . LEU A 1 27 ? -12.636 -14.338 6.707   1.00 99.14  ? 27 LEU A HD23 1 
ATOM 385 N N    . ALA A 1 28 ? -11.390 -18.622 2.683   1.00 5.97   ? 28 ALA A N    1 
ATOM 386 C CA   . ALA A 1 28 ? -10.747 -18.996 1.441   1.00 5.97   ? 28 ALA A CA   1 
ATOM 387 C C    . ALA A 1 28 ? -11.838 -19.255 0.374   1.00 5.97   ? 28 ALA A C    1 
ATOM 388 O O    . ALA A 1 28 ? -11.560 -19.112 -0.841  1.00 5.97   ? 28 ALA A O    1 
ATOM 389 C CB   . ALA A 1 28 ? -9.830  -20.182 1.578   1.00 6.07   ? 28 ALA A CB   1 
ATOM 390 H H    . ALA A 1 28 ? -11.216 -19.108 3.512   1.00 86.07  ? 28 ALA A H    1 
ATOM 391 H HA   . ALA A 1 28 ? -10.152 -18.150 1.117   1.00 86.07  ? 28 ALA A HA   1 
ATOM 392 H HB1  . ALA A 1 28 ? -10.415 -21.066 1.779   1.00 86.07  ? 28 ALA A HB1  1 
ATOM 393 H HB2  . ALA A 1 28 ? -9.143  -20.008 2.393   1.00 86.07  ? 28 ALA A HB2  1 
ATOM 394 H HB3  . ALA A 1 28 ? -9.274  -20.317 0.662   1.00 86.07  ? 28 ALA A HB3  1 
ATOM 395 N N    . LEU A 1 29 ? -13.084 -19.663 0.767   1.00 12.30  ? 29 LEU A N    1 
ATOM 396 C CA   . LEU A 1 29 ? -14.109 -19.879 -0.272  1.00 12.30  ? 29 LEU A CA   1 
ATOM 397 C C    . LEU A 1 29 ? -14.361 -18.517 -1.000  1.00 12.30  ? 29 LEU A C    1 
ATOM 398 O O    . LEU A 1 29 ? -14.184 -18.446 -2.236  1.00 12.30  ? 29 LEU A O    1 
ATOM 399 C CB   . LEU A 1 29 ? -15.427 -20.450 0.340   1.00 4.00   ? 29 LEU A CB   1 
ATOM 400 C CG   . LEU A 1 29 ? -15.326 -21.832 1.038   1.00 4.00   ? 29 LEU A CG   1 
ATOM 401 C CD1  . LEU A 1 29 ? -16.576 -22.165 1.811   1.00 4.00   ? 29 LEU A CD1  1 
ATOM 402 C CD2  . LEU A 1 29 ? -15.106 -22.937 0.038   1.00 4.00   ? 29 LEU A CD2  1 
ATOM 403 H H    . LEU A 1 29 ? -13.293 -19.799 1.716   1.00 79.16  ? 29 LEU A H    1 
ATOM 404 H HA   . LEU A 1 29 ? -13.712 -20.585 -0.989  1.00 79.16  ? 29 LEU A HA   1 
ATOM 405 H HB2  . LEU A 1 29 ? -15.794 -19.739 1.059   1.00 79.16  ? 29 LEU A HB2  1 
ATOM 406 H HB3  . LEU A 1 29 ? -16.153 -20.531 -0.456  1.00 79.16  ? 29 LEU A HB3  1 
ATOM 407 H HG   . LEU A 1 29 ? -14.494 -21.829 1.721   1.00 79.16  ? 29 LEU A HG   1 
ATOM 408 H HD11 . LEU A 1 29 ? -17.435 -21.771 1.290   1.00 79.16  ? 29 LEU A HD11 1 
ATOM 409 H HD12 . LEU A 1 29 ? -16.669 -23.238 1.897   1.00 79.16  ? 29 LEU A HD12 1 
ATOM 410 H HD13 . LEU A 1 29 ? -16.516 -21.730 2.793   1.00 79.16  ? 29 LEU A HD13 1 
ATOM 411 H HD21 . LEU A 1 29 ? -15.573 -22.671 -0.898  1.00 79.16  ? 29 LEU A HD21 1 
ATOM 412 H HD22 . LEU A 1 29 ? -14.049 -23.080 -0.114  1.00 79.16  ? 29 LEU A HD22 1 
ATOM 413 H HD23 . LEU A 1 29 ? -15.545 -23.850 0.412   1.00 79.16  ? 29 LEU A HD23 1 
ATOM 414 N N    . ALA A 1 30 ? -14.619 -17.424 -0.214  1.00 4.00   ? 30 ALA A N    1 
ATOM 415 C CA   . ALA A 1 30 ? -14.745 -16.006 -0.701  1.00 4.00   ? 30 ALA A CA   1 
ATOM 416 C C    . ALA A 1 30 ? -13.409 -15.300 -1.025  1.00 4.00   ? 30 ALA A C    1 
ATOM 417 O O    . ALA A 1 30 ? -13.368 -14.389 -1.797  1.00 4.00   ? 30 ALA A O    1 
ATOM 418 C CB   . ALA A 1 30 ? -15.556 -15.130 0.234   1.00 4.00   ? 30 ALA A CB   1 
ATOM 419 H H    . ALA A 1 30 ? -14.625 -17.563 0.754   1.00 76.20  ? 30 ALA A H    1 
ATOM 420 H HA   . ALA A 1 30 ? -15.300 -16.063 -1.624  1.00 76.20  ? 30 ALA A HA   1 
ATOM 421 H HB1  . ALA A 1 30 ? -15.032 -15.022 1.170   1.00 76.20  ? 30 ALA A HB1  1 
ATOM 422 H HB2  . ALA A 1 30 ? -16.519 -15.583 0.408   1.00 76.20  ? 30 ALA A HB2  1 
ATOM 423 H HB3  . ALA A 1 30 ? -15.692 -14.158 -0.215  1.00 76.20  ? 30 ALA A HB3  1 
ATOM 424 N N    . ILE A 1 31 ? -12.359 -15.611 -0.327  1.00 4.00   ? 31 ILE A N    1 
ATOM 425 C CA   . ILE A 1 31 ? -11.063 -14.944 -0.504  1.00 4.00   ? 31 ILE A CA   1 
ATOM 426 C C    . ILE A 1 31 ? -10.300 -15.409 -1.760  1.00 4.00   ? 31 ILE A C    1 
ATOM 427 O O    . ILE A 1 31 ? -9.758  -14.623 -2.499  1.00 4.00   ? 31 ILE A O    1 
ATOM 428 C CB   . ILE A 1 31 ? -10.129 -14.974 0.760   1.00 4.00   ? 31 ILE A CB   1 
ATOM 429 C CG1  . ILE A 1 31 ? -10.814 -14.355 1.987   1.00 4.00   ? 31 ILE A CG1  1 
ATOM 430 C CG2  . ILE A 1 31 ? -8.860  -14.199 0.491   1.00 4.00   ? 31 ILE A CG2  1 
ATOM 431 C CD1  . ILE A 1 31 ? -9.849  -13.792 2.990   1.00 4.00   ? 31 ILE A CD1  1 
ATOM 432 H H    . ILE A 1 31 ? -12.451 -16.265 0.363   1.00 80.44  ? 31 ILE A H    1 
ATOM 433 H HA   . ILE A 1 31 ? -11.307 -13.901 -0.673  1.00 80.44  ? 31 ILE A HA   1 
ATOM 434 H HB   . ILE A 1 31 ? -9.869  -15.998 0.975   1.00 80.44  ? 31 ILE A HB   1 
ATOM 435 H HG12 . ILE A 1 31 ? -11.461 -13.556 1.664   1.00 80.44  ? 31 ILE A HG12 1 
ATOM 436 H HG13 . ILE A 1 31 ? -11.398 -15.113 2.473   1.00 80.44  ? 31 ILE A HG13 1 
ATOM 437 H HG21 . ILE A 1 31 ? -9.106  -13.260 0.021   1.00 80.44  ? 31 ILE A HG21 1 
ATOM 438 H HG22 . ILE A 1 31 ? -8.344  -14.014 1.420   1.00 80.44  ? 31 ILE A HG22 1 
ATOM 439 H HG23 . ILE A 1 31 ? -8.226  -14.775 -0.165  1.00 80.44  ? 31 ILE A HG23 1 
ATOM 440 H HD11 . ILE A 1 31 ? -9.072  -14.515 3.187   1.00 80.44  ? 31 ILE A HD11 1 
ATOM 441 H HD12 . ILE A 1 31 ? -9.408  -12.889 2.598   1.00 80.44  ? 31 ILE A HD12 1 
ATOM 442 H HD13 . ILE A 1 31 ? -10.373 -13.567 3.906   1.00 80.44  ? 31 ILE A HD13 1 
ATOM 443 N N    . GLY A 1 32 ? -10.203 -16.675 -2.014  1.00 4.00   ? 32 GLY A N    1 
ATOM 444 C CA   . GLY A 1 32 ? -9.477  -17.013 -3.173  1.00 4.00   ? 32 GLY A CA   1 
ATOM 445 C C    . GLY A 1 32 ? -10.154 -16.233 -4.211  1.00 4.00   ? 32 GLY A C    1 
ATOM 446 O O    . GLY A 1 32 ? -9.554  -15.701 -5.093  1.00 4.00   ? 32 GLY A O    1 
ATOM 447 H H    . GLY A 1 32 ? -10.603 -17.353 -1.429  1.00 85.04  ? 32 GLY A H    1 
ATOM 448 H HA2  . GLY A 1 32 ? -8.442  -16.709 -3.079  1.00 85.04  ? 32 GLY A HA2  1 
ATOM 449 H HA3  . GLY A 1 32 ? -9.555  -18.064 -3.386  1.00 85.04  ? 32 GLY A HA3  1 
ATOM 450 N N    . LEU A 1 33 ? -11.435 -16.084 -3.969  1.00 12.05  ? 33 LEU A N    1 
ATOM 451 C CA   . LEU A 1 33 ? -12.336 -15.308 -4.768  1.00 12.05  ? 33 LEU A CA   1 
ATOM 452 C C    . LEU A 1 33 ? -11.884 -13.904 -4.960  1.00 12.05  ? 33 LEU A C    1 
ATOM 453 O O    . LEU A 1 33 ? -12.241 -13.296 -5.926  1.00 12.05  ? 33 LEU A O    1 
ATOM 454 C CB   . LEU A 1 33 ? -13.748 -15.399 -4.306  1.00 7.34   ? 33 LEU A CB   1 
ATOM 455 C CG   . LEU A 1 33 ? -14.392 -16.689 -4.728  1.00 7.34   ? 33 LEU A CG   1 
ATOM 456 C CD1  . LEU A 1 33 ? -14.734 -16.622 -6.215  1.00 7.34   ? 33 LEU A CD1  1 
ATOM 457 C CD2  . LEU A 1 33 ? -13.442 -17.829 -4.438  1.00 7.34   ? 33 LEU A CD2  1 
ATOM 458 H H    . LEU A 1 33 ? -11.788 -16.488 -3.156  1.00 87.34  ? 33 LEU A H    1 
ATOM 459 H HA   . LEU A 1 33 ? -12.306 -15.764 -5.751  1.00 87.34  ? 33 LEU A HA   1 
ATOM 460 H HB2  . LEU A 1 33 ? -13.768 -15.331 -3.234  1.00 87.34  ? 33 LEU A HB2  1 
ATOM 461 H HB3  . LEU A 1 33 ? -14.310 -14.580 -4.729  1.00 87.34  ? 33 LEU A HB3  1 
ATOM 462 H HG   . LEU A 1 33 ? -15.303 -16.846 -4.174  1.00 87.34  ? 33 LEU A HG   1 
ATOM 463 H HD11 . LEU A 1 33 ? -14.176 -15.823 -6.679  1.00 87.34  ? 33 LEU A HD11 1 
ATOM 464 H HD12 . LEU A 1 33 ? -14.479 -17.558 -6.687  1.00 87.34  ? 33 LEU A HD12 1 
ATOM 465 H HD13 . LEU A 1 33 ? -15.792 -16.434 -6.335  1.00 87.34  ? 33 LEU A HD13 1 
ATOM 466 H HD21 . LEU A 1 33 ? -12.834 -17.581 -3.582  1.00 87.34  ? 33 LEU A HD21 1 
ATOM 467 H HD22 . LEU A 1 33 ? -14.006 -18.726 -4.232  1.00 87.34  ? 33 LEU A HD22 1 
ATOM 468 H HD23 . LEU A 1 33 ? -12.805 -17.993 -5.295  1.00 87.34  ? 33 LEU A HD23 1 
ATOM 469 N N    . SER A 1 34 ? -11.136 -13.379 -4.062  1.00 7.96   ? 34 SER A N    1 
ATOM 470 C CA   . SER A 1 34 ? -10.609 -12.051 -4.233  1.00 7.96   ? 34 SER A CA   1 
ATOM 471 C C    . SER A 1 34 ? -9.632  -12.159 -5.401  1.00 7.96   ? 34 SER A C    1 
ATOM 472 O O    . SER A 1 34 ? -9.492  -11.239 -6.212  1.00 7.96   ? 34 SER A O    1 
ATOM 473 C CB   . SER A 1 34 ? -9.918  -11.626 -2.970  1.00 4.00   ? 34 SER A CB   1 
ATOM 474 O OG   . SER A 1 34 ? -10.815 -11.704 -1.900  1.00 4.00   ? 34 SER A OG   1 
ATOM 475 H H    . SER A 1 34 ? -10.895 -13.895 -3.289  1.00 74.66  ? 34 SER A H    1 
ATOM 476 H HA   . SER A 1 34 ? -11.415 -11.379 -4.482  1.00 74.66  ? 34 SER A HA   1 
ATOM 477 H HB2  . SER A 1 34 ? -9.081  -12.280 -2.777  1.00 74.66  ? 34 SER A HB2  1 
ATOM 478 H HB3  . SER A 1 34 ? -9.574  -10.608 -3.068  1.00 74.66  ? 34 SER A HB3  1 
ATOM 479 H HG   . SER A 1 34 ? -11.687 -11.944 -2.231  1.00 74.66  ? 34 SER A HG   1 
ATOM 480 N N    . ALA A 1 35 ? -9.017  -13.371 -5.474  1.00 6.19   ? 35 ALA A N    1 
ATOM 481 C CA   . ALA A 1 35 ? -8.107  -13.780 -6.562  1.00 6.19   ? 35 ALA A CA   1 
ATOM 482 C C    . ALA A 1 35 ? -8.955  -14.117 -7.802  1.00 6.19   ? 35 ALA A C    1 
ATOM 483 O O    . ALA A 1 35 ? -8.740  -13.608 -8.895  1.00 6.19   ? 35 ALA A O    1 
ATOM 484 C CB   . ALA A 1 35 ? -7.260  -14.975 -6.148  1.00 4.00   ? 35 ALA A CB   1 
ATOM 485 H H    . ALA A 1 35 ? -9.242  -14.038 -4.793  1.00 82.06  ? 35 ALA A H    1 
ATOM 486 H HA   . ALA A 1 35 ? -7.458  -12.948 -6.789  1.00 82.06  ? 35 ALA A HA   1 
ATOM 487 H HB1  . ALA A 1 35 ? -7.475  -15.224 -5.118  1.00 82.06  ? 35 ALA A HB1  1 
ATOM 488 H HB2  . ALA A 1 35 ? -7.494  -15.819 -6.777  1.00 82.06  ? 35 ALA A HB2  1 
ATOM 489 H HB3  . ALA A 1 35 ? -6.213  -14.730 -6.248  1.00 82.06  ? 35 ALA A HB3  1 
ATOM 490 N N    . ALA A 1 36 ? -9.976  -14.938 -7.552  1.00 4.00   ? 36 ALA A N    1 
ATOM 491 C CA   . ALA A 1 36 ? -10.964 -15.320 -8.536  1.00 4.00   ? 36 ALA A CA   1 
ATOM 492 C C    . ALA A 1 36 ? -11.655 -14.070 -8.916  1.00 4.00   ? 36 ALA A C    1 
ATOM 493 O O    . ALA A 1 36 ? -12.159 -13.907 -9.981  1.00 4.00   ? 36 ALA A O    1 
ATOM 494 C CB   . ALA A 1 36 ? -11.970 -16.333 -8.000  1.00 11.35  ? 36 ALA A CB   1 
ATOM 495 H H    . ALA A 1 36 ? -10.099 -15.250 -6.636  1.00 91.35  ? 36 ALA A H    1 
ATOM 496 H HA   . ALA A 1 36 ? -10.461 -15.733 -9.397  1.00 91.35  ? 36 ALA A HA   1 
ATOM 497 H HB1  . ALA A 1 36 ? -12.150 -17.096 -8.743  1.00 91.35  ? 36 ALA A HB1  1 
ATOM 498 H HB2  . ALA A 1 36 ? -11.576 -16.790 -7.105  1.00 91.35  ? 36 ALA A HB2  1 
ATOM 499 H HB3  . ALA A 1 36 ? -12.897 -15.830 -7.769  1.00 91.35  ? 36 ALA A HB3  1 
ATOM 500 N N    . TRP A 1 37 ? -11.681 -13.181 -8.014  1.00 4.05   ? 37 TRP A N    1 
ATOM 501 C CA   . TRP A 1 37 ? -12.298 -11.943 -8.283  1.00 4.05   ? 37 TRP A CA   1 
ATOM 502 C C    . TRP A 1 37 ? -11.445 -11.243 -9.368  1.00 4.05   ? 37 TRP A C    1 
ATOM 503 O O    . TRP A 1 37 ? -11.984 -10.604 -10.268 1.00 4.05   ? 37 TRP A O    1 
ATOM 504 C CB   . TRP A 1 37 ? -12.489 -11.091 -7.004  1.00 13.84  ? 37 TRP A CB   1 
ATOM 505 C CG   . TRP A 1 37 ? -13.640 -10.156 -7.125  1.00 13.84  ? 37 TRP A CG   1 
ATOM 506 C CD1  . TRP A 1 37 ? -14.965 -10.470 -7.032  1.00 13.84  ? 37 TRP A CD1  1 
ATOM 507 C CD2  . TRP A 1 37 ? -13.572 -8.789  -7.521  1.00 13.84  ? 37 TRP A CD2  1 
ATOM 508 N NE1  . TRP A 1 37 ? -15.721 -9.364  -7.294  1.00 13.84  ? 37 TRP A NE1  1 
ATOM 509 C CE2  . TRP A 1 37 ? -14.884 -8.319  -7.595  1.00 13.84  ? 37 TRP A CE2  1 
ATOM 510 C CE3  . TRP A 1 37 ? -12.508 -7.912  -7.816  1.00 13.84  ? 37 TRP A CE3  1 
ATOM 511 C CZ2  . TRP A 1 37 ? -15.167 -7.008  -7.960  1.00 13.84  ? 37 TRP A CZ2  1 
ATOM 512 C CZ3  . TRP A 1 37 ? -12.789 -6.614  -8.191  1.00 13.84  ? 37 TRP A CZ3  1 
ATOM 513 C CH2  . TRP A 1 37 ? -14.110 -6.173  -8.258  1.00 13.84  ? 37 TRP A CH2  1 
ATOM 514 H H    . TRP A 1 37 ? -11.250 -13.345 -7.160  1.00 93.84  ? 37 TRP A H    1 
ATOM 515 H HA   . TRP A 1 37 ? -13.271 -12.160 -8.703  1.00 93.84  ? 37 TRP A HA   1 
ATOM 516 H HB2  . TRP A 1 37 ? -12.680 -11.730 -6.163  1.00 93.84  ? 37 TRP A HB2  1 
ATOM 517 H HB3  . TRP A 1 37 ? -11.598 -10.511 -6.823  1.00 93.84  ? 37 TRP A HB3  1 
ATOM 518 H HD1  . TRP A 1 37 ? -15.343 -11.449 -6.778  1.00 93.84  ? 37 TRP A HD1  1 
ATOM 519 H HE1  . TRP A 1 37 ? -16.696 -9.327  -7.275  1.00 93.84  ? 37 TRP A HE1  1 
ATOM 520 H HE3  . TRP A 1 37 ? -11.482 -8.249  -7.772  1.00 93.84  ? 37 TRP A HE3  1 
ATOM 521 H HZ2  . TRP A 1 37 ? -16.181 -6.644  -8.026  1.00 93.84  ? 37 TRP A HZ2  1 
ATOM 522 H HZ3  . TRP A 1 37 ? -11.986 -5.932  -8.435  1.00 93.84  ? 37 TRP A HZ3  1 
ATOM 523 H HH2  . TRP A 1 37 ? -14.297 -5.152  -8.561  1.00 93.84  ? 37 TRP A HH2  1 
ATOM 524 N N    . LYS A 1 38 ? -10.105 -11.429 -9.345  1.00 9.74   ? 38 LYS A N    1 
ATOM 525 C CA   . LYS A 1 38 ? -9.262  -10.827 -10.397 1.00 9.74   ? 38 LYS A CA   1 
ATOM 526 C C    . LYS A 1 38 ? -9.699  -11.208 -11.796 1.00 9.74   ? 38 LYS A C    1 
ATOM 527 O O    . LYS A 1 38 ? -9.876  -10.386 -12.683 1.00 9.74   ? 38 LYS A O    1 
ATOM 528 C CB   . LYS A 1 38 ? -7.821  -11.383 -10.395 1.00 4.86   ? 38 LYS A CB   1 
ATOM 529 C CG   . LYS A 1 38 ? -6.857  -10.892 -9.381  1.00 4.86   ? 38 LYS A CG   1 
ATOM 530 C CD   . LYS A 1 38 ? -5.556  -10.522 -10.094 1.00 4.86   ? 38 LYS A CD   1 
ATOM 531 C CE   . LYS A 1 38 ? -5.005  -11.663 -10.917 1.00 4.86   ? 38 LYS A CE   1 
ATOM 532 N NZ   . LYS A 1 38 ? -3.778  -11.243 -11.616 1.00 4.86   ? 38 LYS A NZ   1 
ATOM 533 H H    . LYS A 1 38 ? -9.701  -11.994 -8.653  1.00 84.86  ? 38 LYS A H    1 
ATOM 534 H HA   . LYS A 1 38 ? -9.240  -9.757  -10.278 1.00 84.86  ? 38 LYS A HA   1 
ATOM 535 H HB2  . LYS A 1 38 ? -7.880  -12.450 -10.272 1.00 84.86  ? 38 LYS A HB2  1 
ATOM 536 H HB3  . LYS A 1 38 ? -7.394  -11.189 -11.369 1.00 84.86  ? 38 LYS A HB3  1 
ATOM 537 H HG2  . LYS A 1 38 ? -7.261  -10.020 -8.884  1.00 84.86  ? 38 LYS A HG2  1 
ATOM 538 H HG3  . LYS A 1 38 ? -6.658  -11.672 -8.663  1.00 84.86  ? 38 LYS A HG3  1 
ATOM 539 H HD2  . LYS A 1 38 ? -5.743  -9.685  -10.745 1.00 84.86  ? 38 LYS A HD2  1 
ATOM 540 H HD3  . LYS A 1 38 ? -4.822  -10.241 -9.351  1.00 84.86  ? 38 LYS A HD3  1 
ATOM 541 H HE2  . LYS A 1 38 ? -4.778  -12.492 -10.265 1.00 84.86  ? 38 LYS A HE2  1 
ATOM 542 H HE3  . LYS A 1 38 ? -5.743  -11.964 -11.641 1.00 84.86  ? 38 LYS A HE3  1 
ATOM 543 H HZ1  . LYS A 1 38 ? -3.431  -10.346 -11.219 1.00 84.86  ? 38 LYS A HZ1  1 
ATOM 544 H HZ2  . LYS A 1 38 ? -3.040  -11.966 -11.508 1.00 84.86  ? 38 LYS A HZ2  1 
ATOM 545 H HZ3  . LYS A 1 38 ? -3.972  -11.109 -12.625 1.00 84.86  ? 38 LYS A HZ3  1 
ATOM 546 N N    . TYR A 1 39 ? -9.854  -12.462 -11.985 1.00 4.76   ? 39 TYR A N    1 
ATOM 547 C CA   . TYR A 1 39 ? -10.206 -12.951 -13.271 1.00 4.76   ? 39 TYR A CA   1 
ATOM 548 C C    . TYR A 1 39 ? -11.519 -12.317 -13.647 1.00 4.76   ? 39 TYR A C    1 
ATOM 549 O O    . TYR A 1 39 ? -11.840 -12.142 -14.803 1.00 4.76   ? 39 TYR A O    1 
ATOM 550 C CB   . TYR A 1 39 ? -10.172 -14.498 -13.269 1.00 15.26  ? 39 TYR A CB   1 
ATOM 551 C CG   . TYR A 1 39 ? -8.819  -15.060 -12.796 1.00 15.26  ? 39 TYR A CG   1 
ATOM 552 C CD1  . TYR A 1 39 ? -7.725  -15.177 -13.670 1.00 15.26  ? 39 TYR A CD1  1 
ATOM 553 C CD2  . TYR A 1 39 ? -8.620  -15.413 -11.438 1.00 15.26  ? 39 TYR A CD2  1 
ATOM 554 C CE1  . TYR A 1 39 ? -6.482  -15.630 -13.194 1.00 15.26  ? 39 TYR A CE1  1 
ATOM 555 C CE2  . TYR A 1 39 ? -7.391  -15.872 -10.962 1.00 15.26  ? 39 TYR A CE2  1 
ATOM 556 C CZ   . TYR A 1 39 ? -6.319  -15.981 -11.819 1.00 15.26  ? 39 TYR A CZ   1 
ATOM 557 O OH   . TYR A 1 39 ? -5.081  -16.410 -11.333 1.00 15.26  ? 39 TYR A OH   1 
ATOM 558 H H    . TYR A 1 39 ? -9.693  -13.088 -11.246 1.00 95.26  ? 39 TYR A H    1 
ATOM 559 H HA   . TYR A 1 39 ? -9.454  -12.597 -13.963 1.00 95.26  ? 39 TYR A HA   1 
ATOM 560 H HB2  . TYR A 1 39 ? -10.939 -14.874 -12.608 1.00 95.26  ? 39 TYR A HB2  1 
ATOM 561 H HB3  . TYR A 1 39 ? -10.347 -14.862 -14.264 1.00 95.26  ? 39 TYR A HB3  1 
ATOM 562 H HD1  . TYR A 1 39 ? -7.846  -14.916 -14.712 1.00 95.26  ? 39 TYR A HD1  1 
ATOM 563 H HD2  . TYR A 1 39 ? -9.453  -15.331 -10.757 1.00 95.26  ? 39 TYR A HD2  1 
ATOM 564 H HE1  . TYR A 1 39 ? -5.647  -15.714 -13.877 1.00 95.26  ? 39 TYR A HE1  1 
ATOM 565 H HE2  . TYR A 1 39 ? -7.281  -16.131 -9.922  1.00 95.26  ? 39 TYR A HE2  1 
ATOM 566 H HH   . TYR A 1 39 ? -4.538  -15.648 -11.122 1.00 95.26  ? 39 TYR A HH   1 
ATOM 567 N N    . ALA A 1 40 ? -12.305 -11.983 -12.650 1.00 10.04  ? 40 ALA A N    1 
ATOM 568 C CA   . ALA A 1 40 ? -13.582 -11.405 -12.944 1.00 10.04  ? 40 ALA A CA   1 
ATOM 569 C C    . ALA A 1 40 ? -13.393 -10.204 -13.827 1.00 10.04  ? 40 ALA A C    1 
ATOM 570 O O    . ALA A 1 40 ? -14.036 -10.067 -14.822 1.00 10.04  ? 40 ALA A O    1 
ATOM 571 C CB   . ALA A 1 40 ? -14.284 -11.013 -11.664 1.00 4.00   ? 40 ALA A CB   1 
ATOM 572 H H    . ALA A 1 40 ? -12.036 -12.150 -11.723 1.00 78.11  ? 40 ALA A H    1 
ATOM 573 H HA   . ALA A 1 40 ? -14.186 -12.139 -13.457 1.00 78.11  ? 40 ALA A HA   1 
ATOM 574 H HB1  . ALA A 1 40 ? -14.403 -9.943  -11.633 1.00 78.11  ? 40 ALA A HB1  1 
ATOM 575 H HB2  . ALA A 1 40 ? -13.695 -11.334 -10.820 1.00 78.11  ? 40 ALA A HB2  1 
ATOM 576 H HB3  . ALA A 1 40 ? -15.254 -11.486 -11.624 1.00 78.11  ? 40 ALA A HB3  1 
ATOM 577 N N    . LYS A 1 41 ? -12.527 -9.347  -13.438 1.00 4.00   ? 41 LYS A N    1 
ATOM 578 C CA   . LYS A 1 41 ? -12.262 -8.160  -14.174 1.00 4.00   ? 41 LYS A CA   1 
ATOM 579 C C    . LYS A 1 41 ? -11.403 -8.287  -15.452 1.00 4.00   ? 41 LYS A C    1 
ATOM 580 O O    . LYS A 1 41 ? -11.529 -7.450  -16.297 1.00 4.00   ? 41 LYS A O    1 
ATOM 581 C CB   . LYS A 1 41 ? -11.849 -7.042  -13.226 1.00 4.00   ? 41 LYS A CB   1 
ATOM 582 C CG   . LYS A 1 41 ? -13.046 -6.649  -12.373 1.00 4.00   ? 41 LYS A CG   1 
ATOM 583 C CD   . LYS A 1 41 ? -13.010 -5.199  -11.919 1.00 4.00   ? 41 LYS A CD   1 
ATOM 584 C CE   . LYS A 1 41 ? -14.222 -4.877  -11.017 1.00 4.00   ? 41 LYS A CE   1 
ATOM 585 N NZ   . LYS A 1 41 ? -14.001 -3.716  -10.068 1.00 4.00   ? 41 LYS A NZ   1 
ATOM 586 H H    . LYS A 1 41 ? -12.037 -9.515  -12.609 1.00 82.73  ? 41 LYS A H    1 
ATOM 587 H HA   . LYS A 1 41 ? -13.239 -7.866  -14.541 1.00 82.73  ? 41 LYS A HA   1 
ATOM 588 H HB2  . LYS A 1 41 ? -11.048 -7.386  -12.592 1.00 82.73  ? 41 LYS A HB2  1 
ATOM 589 H HB3  . LYS A 1 41 ? -11.528 -6.182  -13.794 1.00 82.73  ? 41 LYS A HB3  1 
ATOM 590 H HG2  . LYS A 1 41 ? -13.945 -6.801  -12.951 1.00 82.73  ? 41 LYS A HG2  1 
ATOM 591 H HG3  . LYS A 1 41 ? -13.074 -7.286  -11.506 1.00 82.73  ? 41 LYS A HG3  1 
ATOM 592 H HD2  . LYS A 1 41 ? -12.100 -5.025  -11.367 1.00 82.73  ? 41 LYS A HD2  1 
ATOM 593 H HD3  . LYS A 1 41 ? -13.039 -4.557  -12.787 1.00 82.73  ? 41 LYS A HD3  1 
ATOM 594 H HE2  . LYS A 1 41 ? -15.064 -4.644  -11.650 1.00 82.73  ? 41 LYS A HE2  1 
ATOM 595 H HE3  . LYS A 1 41 ? -14.454 -5.757  -10.439 1.00 82.73  ? 41 LYS A HE3  1 
ATOM 596 H HZ1  . LYS A 1 41 ? -13.080 -3.809  -9.593  1.00 82.73  ? 41 LYS A HZ1  1 
ATOM 597 H HZ2  . LYS A 1 41 ? -14.017 -2.817  -10.589 1.00 82.73  ? 41 LYS A HZ2  1 
ATOM 598 H HZ3  . LYS A 1 41 ? -14.750 -3.699  -9.346  1.00 82.73  ? 41 LYS A HZ3  1 
ATOM 599 N N    . ARG A 1 42 ? -10.479 -9.269  -15.559 1.00 4.00   ? 42 ARG A N    1 
ATOM 600 C CA   . ARG A 1 42 ? -9.507  -9.423  -16.760 1.00 4.00   ? 42 ARG A CA   1 
ATOM 601 C C    . ARG A 1 42 ? -10.112 -9.920  -18.117 1.00 4.00   ? 42 ARG A C    1 
ATOM 602 O O    . ARG A 1 42 ? -9.642  -9.577  -19.179 1.00 4.00   ? 42 ARG A O    1 
ATOM 603 C CB   . ARG A 1 42 ? -8.307  -10.372 -16.422 1.00 4.45   ? 42 ARG A CB   1 
ATOM 604 C CG   . ARG A 1 42 ? -7.454  -9.929  -15.227 1.00 4.45   ? 42 ARG A CG   1 
ATOM 605 C CD   . ARG A 1 42 ? -5.984  -10.185 -15.464 1.00 4.45   ? 42 ARG A CD   1 
ATOM 606 N NE   . ARG A 1 42 ? -5.705  -11.595 -15.469 1.00 4.45   ? 42 ARG A NE   1 
ATOM 607 C CZ   . ARG A 1 42 ? -4.518  -12.068 -15.696 1.00 4.45   ? 42 ARG A CZ   1 
ATOM 608 N NH1  . ARG A 1 42 ? -3.541  -11.234 -16.020 1.00 4.45   ? 42 ARG A NH1  1 
ATOM 609 N NH2  . ARG A 1 42 ? -4.311  -13.360 -15.623 1.00 4.45   ? 42 ARG A NH2  1 
ATOM 610 H H    . ARG A 1 42 ? -10.383 -9.885  -14.800 1.00 84.45  ? 42 ARG A H    1 
ATOM 611 H HA   . ARG A 1 42 ? -9.095  -8.444  -16.938 1.00 84.45  ? 42 ARG A HA   1 
ATOM 612 H HB2  . ARG A 1 42 ? -8.692  -11.358 -16.208 1.00 84.45  ? 42 ARG A HB2  1 
ATOM 613 H HB3  . ARG A 1 42 ? -7.662  -10.434 -17.290 1.00 84.45  ? 42 ARG A HB3  1 
ATOM 614 H HG2  . ARG A 1 42 ? -7.598  -8.872  -15.061 1.00 84.45  ? 42 ARG A HG2  1 
ATOM 615 H HG3  . ARG A 1 42 ? -7.765  -10.480 -14.352 1.00 84.45  ? 42 ARG A HG3  1 
ATOM 616 H HD2  . ARG A 1 42 ? -5.704  -9.766  -16.422 1.00 84.45  ? 42 ARG A HD2  1 
ATOM 617 H HD3  . ARG A 1 42 ? -5.408  -9.712  -14.683 1.00 84.45  ? 42 ARG A HD3  1 
ATOM 618 H HE   . ARG A 1 42 ? -6.439  -12.213 -15.281 1.00 84.45  ? 42 ARG A HE   1 
ATOM 619 H HH11 . ARG A 1 42 ? -3.722  -10.251 -16.087 1.00 84.45  ? 42 ARG A HH11 1 
ATOM 620 H HH12 . ARG A 1 42 ? -2.625  -11.584 -16.203 1.00 84.45  ? 42 ARG A HH12 1 
ATOM 621 H HH21 . ARG A 1 42 ? -5.067  -13.972 -15.399 1.00 84.45  ? 42 ARG A HH21 1 
ATOM 622 H HH22 . ARG A 1 42 ? -3.396  -13.728 -15.775 1.00 84.45  ? 42 ARG A HH22 1 
ATOM 623 N N    . PHE A 1 43 ? -11.105 -10.740 -18.064 1.00 4.00   ? 43 PHE A N    1 
ATOM 624 C CA   . PHE A 1 43 ? -11.699 -11.223 -19.231 1.00 4.00   ? 43 PHE A CA   1 
ATOM 625 C C    . PHE A 1 43 ? -12.338 -10.053 -19.823 1.00 4.00   ? 43 PHE A C    1 
ATOM 626 O O    . PHE A 1 43 ? -12.463 -9.921  -21.042 1.00 4.00   ? 43 PHE A O    1 
ATOM 627 C CB   . PHE A 1 43 ? -12.621 -12.336 -18.859 1.00 10.26  ? 43 PHE A CB   1 
ATOM 628 C CG   . PHE A 1 43 ? -11.783 -13.330 -18.189 1.00 10.26  ? 43 PHE A CG   1 
ATOM 629 C CD1  . PHE A 1 43 ? -10.666 -13.815 -18.825 1.00 10.26  ? 43 PHE A CD1  1 
ATOM 630 C CD2  . PHE A 1 43 ? -11.983 -13.646 -16.870 1.00 10.26  ? 43 PHE A CD2  1 
ATOM 631 C CE1  . PHE A 1 43 ? -9.757  -14.606 -18.156 1.00 10.26  ? 43 PHE A CE1  1 
ATOM 632 C CE2  . PHE A 1 43 ? -11.093 -14.461 -16.196 1.00 10.26  ? 43 PHE A CE2  1 
ATOM 633 C CZ   . PHE A 1 43 ? -9.968  -14.934 -16.839 1.00 10.26  ? 43 PHE A CZ   1 
ATOM 634 H H    . PHE A 1 43 ? -11.447 -11.032 -17.192 1.00 90.26  ? 43 PHE A H    1 
ATOM 635 H HA   . PHE A 1 43 ? -10.924 -11.587 -19.887 1.00 90.26  ? 43 PHE A HA   1 
ATOM 636 H HB2  . PHE A 1 43 ? -13.387 -11.987 -18.178 1.00 90.26  ? 43 PHE A HB2  1 
ATOM 637 H HB3  . PHE A 1 43 ? -13.060 -12.779 -19.737 1.00 90.26  ? 43 PHE A HB3  1 
ATOM 638 H HD1  . PHE A 1 43 ? -10.504 -13.574 -19.866 1.00 90.26  ? 43 PHE A HD1  1 
ATOM 639 H HD2  . PHE A 1 43 ? -12.864 -13.278 -16.366 1.00 90.26  ? 43 PHE A HD2  1 
ATOM 640 H HE1  . PHE A 1 43 ? -8.886  -14.981 -18.672 1.00 90.26  ? 43 PHE A HE1  1 
ATOM 641 H HE2  . PHE A 1 43 ? -11.273 -14.714 -15.165 1.00 90.26  ? 43 PHE A HE2  1 
ATOM 642 H HZ   . PHE A 1 43 ? -9.258  -15.550 -16.310 1.00 90.26  ? 43 PHE A HZ   1 
ATOM 643 N N    . LEU A 1 44 ? -12.694 -9.170  -18.903 1.00 21.09  ? 44 LEU A N    1 
ATOM 644 C CA   . LEU A 1 44 ? -13.302 -7.857  -19.210 1.00 21.09  ? 44 LEU A CA   1 
ATOM 645 C C    . LEU A 1 44 ? -12.138 -6.869  -19.760 1.00 21.09  ? 44 LEU A C    1 
ATOM 646 O O    . LEU A 1 44 ? -12.338 -6.122  -20.775 1.00 21.09  ? 44 LEU A O    1 
ATOM 647 C CB   . LEU A 1 44 ? -13.966 -7.292  -17.879 1.00 4.00   ? 44 LEU A CB   1 
ATOM 648 C CG   . LEU A 1 44 ? -15.039 -8.180  -17.143 1.00 4.00   ? 44 LEU A CG   1 
ATOM 649 C CD1  . LEU A 1 44 ? -15.429 -7.544  -15.812 1.00 4.00   ? 44 LEU A CD1  1 
ATOM 650 C CD2  . LEU A 1 44 ? -16.296 -8.448  -17.948 1.00 4.00   ? 44 LEU A CD2  1 
ATOM 651 H H    . LEU A 1 44 ? -12.507 -9.382  -17.968 1.00 82.63  ? 44 LEU A H    1 
ATOM 652 H HA   . LEU A 1 44 ? -14.059 -7.991  -19.973 1.00 82.63  ? 44 LEU A HA   1 
ATOM 653 H HB2  . LEU A 1 44 ? -13.177 -7.096  -17.177 1.00 82.63  ? 44 LEU A HB2  1 
ATOM 654 H HB3  . LEU A 1 44 ? -14.435 -6.352  -18.126 1.00 82.63  ? 44 LEU A HB3  1 
ATOM 655 H HG   . LEU A 1 44 ? -14.586 -9.136  -16.917 1.00 82.63  ? 44 LEU A HG   1 
ATOM 656 H HD11 . LEU A 1 44 ? -14.782 -6.704  -15.610 1.00 82.63  ? 44 LEU A HD11 1 
ATOM 657 H HD12 . LEU A 1 44 ? -16.453 -7.206  -15.860 1.00 82.63  ? 44 LEU A HD12 1 
ATOM 658 H HD13 . LEU A 1 44 ? -15.328 -8.273  -15.022 1.00 82.63  ? 44 LEU A HD13 1 
ATOM 659 H HD21 . LEU A 1 44 ? -16.228 -7.954  -18.905 1.00 82.63  ? 44 LEU A HD21 1 
ATOM 660 H HD22 . LEU A 1 44 ? -16.407 -9.512  -18.097 1.00 82.63  ? 44 LEU A HD22 1 
ATOM 661 H HD23 . LEU A 1 44 ? -17.153 -8.070  -17.409 1.00 82.63  ? 44 LEU A HD23 1 
ATOM 662 N N    . LYS A 1 45 ? -10.948 -6.957  -18.997 1.00 19.87  ? 45 LYS A N    1 
ATOM 663 C CA   . LYS A 1 45 ? -9.603  -6.210  -19.102 1.00 19.87  ? 45 LYS A CA   1 
ATOM 664 C C    . LYS A 1 45 ? -8.662  -6.623  -20.221 1.00 19.87  ? 45 LYS A C    1 
ATOM 665 O O    . LYS A 1 45 ? -7.797  -5.840  -20.564 1.00 19.87  ? 45 LYS A O    1 
ATOM 666 C CB   . LYS A 1 45 ? -8.778  -6.228  -17.746 1.00 6.68   ? 45 LYS A CB   1 
ATOM 667 C CG   . LYS A 1 45 ? -9.270  -5.264  -16.622 1.00 6.68   ? 45 LYS A CG   1 
ATOM 668 C CD   . LYS A 1 45 ? -8.284  -5.132  -15.432 1.00 6.68   ? 45 LYS A CD   1 
ATOM 669 C CE   . LYS A 1 45 ? -8.531  -3.863  -14.590 1.00 6.68   ? 45 LYS A CE   1 
ATOM 670 N NZ   . LYS A 1 45 ? -7.811  -3.897  -13.264 1.00 6.68   ? 45 LYS A NZ   1 
ATOM 671 H H    . LYS A 1 45 ? -10.996 -7.596  -18.259 1.00 86.68  ? 45 LYS A H    1 
ATOM 672 H HA   . LYS A 1 45 ? -9.864  -5.178  -19.296 1.00 86.68  ? 45 LYS A HA   1 
ATOM 673 H HB2  . LYS A 1 45 ? -8.810  -7.231  -17.361 1.00 86.68  ? 45 LYS A HB2  1 
ATOM 674 H HB3  . LYS A 1 45 ? -7.749  -5.984  -17.980 1.00 86.68  ? 45 LYS A HB3  1 
ATOM 675 H HG2  . LYS A 1 45 ? -9.419  -4.286  -17.049 1.00 86.68  ? 45 LYS A HG2  1 
ATOM 676 H HG3  . LYS A 1 45 ? -10.218 -5.633  -16.245 1.00 86.68  ? 45 LYS A HG3  1 
ATOM 677 H HD2  . LYS A 1 45 ? -8.397  -5.994  -14.790 1.00 86.68  ? 45 LYS A HD2  1 
ATOM 678 H HD3  . LYS A 1 45 ? -7.276  -5.104  -15.818 1.00 86.68  ? 45 LYS A HD3  1 
ATOM 679 H HE2  . LYS A 1 45 ? -8.188  -3.004  -15.147 1.00 86.68  ? 45 LYS A HE2  1 
ATOM 680 H HE3  . LYS A 1 45 ? -9.591  -3.769  -14.408 1.00 86.68  ? 45 LYS A HE3  1 
ATOM 681 H HZ1  . LYS A 1 45 ? -6.812  -4.148  -13.403 1.00 86.68  ? 45 LYS A HZ1  1 
ATOM 682 H HZ2  . LYS A 1 45 ? -7.860  -2.962  -12.807 1.00 86.68  ? 45 LYS A HZ2  1 
ATOM 683 H HZ3  . LYS A 1 45 ? -8.250  -4.599  -12.634 1.00 86.68  ? 45 LYS A HZ3  1 
ATOM 684 N N    . GLY A 1 46 ? -8.730  -7.858  -20.671 1.00 4.09   ? 46 GLY A N    1 
ATOM 685 C CA   . GLY A 1 46 ? -7.839  -8.354  -21.710 1.00 4.09   ? 46 GLY A CA   1 
ATOM 686 C C    . GLY A 1 46 ? -8.004  -7.667  -23.101 1.00 4.09   ? 46 GLY A C    1 
ATOM 687 O O    . GLY A 1 46 ? -7.086  -7.779  -23.892 1.00 4.09   ? 46 GLY A O    1 
ATOM 688 O OXT  . GLY A 1 46 ? -9.027  -7.030  -23.381 1.00 4.00   ? 46 GLY A OXT  1 
ATOM 689 H H    . GLY A 1 46 ? -9.379  -8.451  -20.287 1.00 81.04  ? 46 GLY A H    1 
ATOM 690 H HA2  . GLY A 1 46 ? -6.821  -8.217  -21.374 1.00 81.04  ? 46 GLY A HA2  1 
ATOM 691 H HA3  . GLY A 1 46 ? -8.017  -9.413  -21.830 1.00 81.04  ? 46 GLY A HA3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  PHE 3  3  3  PHE PHE A . n 
A 1 4  ASN 4  4  4  ASN ASN A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  ALA 9  9  9  ALA ALA A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 GLN 17 17 17 GLN GLN A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 ALA 21 21 21 ALA ALA A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 LEU 27 27 27 LEU LEU A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 ILE 31 31 31 ILE ILE A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 TYR 39 39 39 TYR TYR A . n 
A 1 40 ALA 40 40 40 ALA ALA A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 ARG 42 42 42 ARG ARG A . n 
A 1 43 PHE 43 43 43 PHE PHE A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'representative helical assembly'            ? helical   35 
2 'helical asymmetric unit'                    ? monomeric 1  
3 'helical asymmetric unit, std helical frame' ? monomeric 1  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-35)' A 
2 1        A 
3 H        A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
H  'transform to helical frame' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 0.00000   
1  'helical symmetry operation' ? ? 0.59707926  0.80218225  0.00000000 0.00000 -0.80218225 0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -49.30000 
2  'helical symmetry operation' ? ? 0.97306633  -0.23052529 0.00000000 0.00000 0.23052529  0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -46.40000 
3  'helical symmetry operation' ? ? 0.17373412  -0.98479260 0.00000000 0.00000 0.98479260  0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -43.50000 
4  'helical symmetry operation' ? ? -0.83544305 -0.54957703 0.00000000 0.00000 0.54957703  -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -40.60000 
5  'helical symmetry operation' ? ? -0.83552937 0.54944579  0.00000000 0.00000 -0.54944579 -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -37.70000 
6  'helical symmetry operation' ? ? 0.17357942  0.98481987  0.00000000 0.00000 -0.98481987 0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -34.80000 
7  'helical symmetry operation' ? ? 0.97303011  0.23067814  0.00000000 0.00000 -0.23067814 0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -31.90000 
8  'helical symmetry operation' ? ? 0.59720526  -0.80208845 0.00000000 0.00000 0.80208845  0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -29.00000 
9  'helical symmetry operation' ? ? -0.49995465 -0.86605158 0.00000000 0.00000 0.86605158  -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -26.10000 
10 'helical symmetry operation' ? ? -0.99324376 0.11604669  0.00000000 0.00000 -0.11604669 -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -23.20000 
11 'helical symmetry operation' ? ? -0.28684225 0.95797783  0.00000000 0.00000 -0.95797783 -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -20.30000 
12 'helical symmetry operation' ? ? 0.76602201  0.64281435  0.00000000 0.00000 -0.64281435 0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -17.40000 
13 'helical symmetry operation' ? ? 0.89364569  -0.44877319 0.00000000 0.00000 0.44877319  0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -14.50000 
14 'helical symmetry operation' ? ? -0.05812160 -0.99830951 0.00000000 0.00000 0.99830951  -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -11.60000 
15 'helical symmetry operation' ? ? -0.93968665 -0.34203654 0.00000000 0.00000 0.34203654  -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -8.70000  
16 'helical symmetry operation' ? ? -0.68625010 0.72736566  0.00000000 0.00000 -0.72736566 -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -5.80000  
17 'helical symmetry operation' ? ? 0.39607442  0.91821841  0.00000000 0.00000 -0.91821841 0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -2.90000  
18 'helical symmetry operation' ? ? 1.00000000  0.00000000  0.00000000 0.00000 0.00000000  1.00000000  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 -0.00000  
19 'helical symmetry operation' ? ? 0.39607442  -0.91821841 0.00000000 0.00000 0.91821841  0.39607442  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 2.90000   
20 'helical symmetry operation' ? ? -0.68625010 -0.72736566 0.00000000 0.00000 0.72736566  -0.68625010 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 5.80000   
21 'helical symmetry operation' ? ? -0.93968665 0.34203654  0.00000000 0.00000 -0.34203654 -0.93968665 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 8.70000   
22 'helical symmetry operation' ? ? -0.05812160 0.99830951  0.00000000 0.00000 -0.99830951 -0.05812160 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 11.60000  
23 'helical symmetry operation' ? ? 0.89364569  0.44877319  0.00000000 0.00000 -0.44877319 0.89364569  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 14.50000  
24 'helical symmetry operation' ? ? 0.76602201  -0.64281435 0.00000000 0.00000 0.64281435  0.76602201  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 17.40000  
25 'helical symmetry operation' ? ? -0.28684225 -0.95797783 0.00000000 0.00000 0.95797783  -0.28684225 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 20.30000  
26 'helical symmetry operation' ? ? -0.99324376 -0.11604669 0.00000000 0.00000 0.11604669  -0.99324376 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 23.20000  
27 'helical symmetry operation' ? ? -0.49995465 0.86605158  0.00000000 0.00000 -0.86605158 -0.49995465 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 26.10000  
28 'helical symmetry operation' ? ? 0.59720526  0.80208845  0.00000000 0.00000 -0.80208845 0.59720526  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 29.00000  
29 'helical symmetry operation' ? ? 0.97303011  -0.23067814 0.00000000 0.00000 0.23067814  0.97303011  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 31.90000  
30 'helical symmetry operation' ? ? 0.17357942  -0.98481987 0.00000000 0.00000 0.98481987  0.17357942  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 34.80000  
31 'helical symmetry operation' ? ? -0.83552937 -0.54944579 0.00000000 0.00000 0.54944579  -0.83552937 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 37.70000  
32 'helical symmetry operation' ? ? -0.83544305 0.54957703  0.00000000 0.00000 -0.54957703 -0.83544305 0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 40.60000  
33 'helical symmetry operation' ? ? 0.17373412  0.98479260  0.00000000 0.00000 -0.98479260 0.17373412  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 43.50000  
34 'helical symmetry operation' ? ? 0.97306633  0.23052529  0.00000000 0.00000 -0.23052529 0.97306633  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 46.40000  
35 'helical symmetry operation' ? ? 0.59707926  -0.80218225 0.00000000 0.00000 0.80218225  0.59707926  0.00000000 0.00000 
0.00000000 0.00000000 1.00000000 49.30000  
# 
_pdbx_helical_symmetry.entry_id                  1HGZ 
_pdbx_helical_symmetry.number_of_operations      35 
_pdbx_helical_symmetry.rotation_per_n_subunits   66.667000 
_pdbx_helical_symmetry.rise_per_n_subunits       2.900000 
_pdbx_helical_symmetry.n_subunits_divisor        1 
_pdbx_helical_symmetry.dyad_axis                 no 
_pdbx_helical_symmetry.circular_symmetry         1 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-01 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
FXPLOR        refinement       .          ? 1 
CCP13         'data reduction' '(LSQINT)' ? 2 
CCP13-FDSCALE 'data scaling'   .          ? 3 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HB3 A LEU 27 ? ? HG13 A ILE 31 ? ? 1.26 
2 1 HB3 A TYR 39 ? ? HE2  A PHE 43 ? ? 1.30 
3 1 HA  A ARG 42 ? ? HB2  A LYS 45 ? ? 1.32 
4 1 HB2 A ASN 4  ? ? HD3  A PRO 5  ? ? 1.33 
5 1 O   A LEU 27 ? ? H    A ILE 31 ? ? 1.55 
6 1 O   A ILE 31 ? ? H    A SER 34 ? ? 1.56 
7 1 O   A LEU 33 ? ? H    A TRP 37 ? ? 1.58 
8 1 O   A LEU 33 ? ? N    A TRP 37 ? ? 2.16 
9 1 O   A ALA 21 ? ? N    A GLY 25 ? ? 2.17 
#