data_1HIB
# 
_entry.id   1HIB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HIB         
WWPDB D_1000173860 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HIB 
_pdbx_database_status.recvd_initial_deposition_date   1993-03-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Camacho, N.P.' 1 
'Smith, D.R.'   2 
'Goldman, A.'   3 
'Schneider, B.' 4 
'Green, D.'     5 
'Young, P.R.'   6 
'Berman, H.M.'  7 
# 
_citation.id                        primary 
_citation.title                     
;Structure of an interleukin-1 beta mutant with reduced bioactivity shows multiple subtle changes in conformation that affect protein-protein recognition.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            32 
_citation.page_first                8749 
_citation.page_last                 8757 
_citation.year                      1993 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8364024 
_citation.pdbx_database_id_DOI      10.1021/bi00085a005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Camacho, N.P.' 1 ? 
primary 'Smith, D.R.'   2 ? 
primary 'Goldman, A.'   3 ? 
primary 'Schneider, B.' 4 ? 
primary 'Green, D.'     5 ? 
primary 'Young, P.R.'   6 ? 
primary 'Berman, H.M.'  7 ? 
# 
_cell.entry_id           1HIB 
_cell.length_a           55.430 
_cell.length_b           55.430 
_cell.length_c           241.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HIB 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTERLEUKIN-1 BETA' 17351.779 1   ? ? ? ? 
2 water   nat water                18.015    113 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   CYS n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  MET n 
1 21  SER n 
1 22  GLY n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  GLN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  MET n 
1 37  GLU n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  VAL n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  ASN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 ILE n 
1 107 ASN n 
1 108 ASN n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLN n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 ASN n 
1 130 MET n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLY n 
1 140 GLY n 
1 141 GLN n 
1 142 ASP n 
1 143 ILE n 
1 144 THR n 
1 145 ASP n 
1 146 PHE n 
1 147 THR n 
1 148 MET n 
1 149 GLN n 
1 150 PHE n 
1 151 VAL n 
1 152 SER n 
1 153 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01584 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAEVPKLASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVP
CPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSM
SFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HIB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 153 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01584 
_struct_ref_seq.db_align_beg                  117 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1HIB 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      9 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01584 
_struct_ref_seq_dif.db_mon_id                    THR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          125 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            9 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HIB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.09 
_exptl_crystal.density_percent_sol   60.20 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1HIB 
_refine.ls_number_reflns_obs                     8143 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1900000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;ELECTRON DENSITY FOR RESIDUES 34 - 35, 53 - 54 AND FOR THE
SIDE CHAINS OF RESIDUES 93 - 94 WAS WEAK.  ALTHOUGH OMIT
MAPS ALLOWED POSITIONING OF THESE REGIONS, THE ASSIGNMENTS
FOR THESE RESIDUES MUST BE CONSIDERED DUBIOUS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1196 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               1309 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1HIB 
_struct.title                     
;THE STRUCTURE OF AN INTERLEUKIN-1 BETA MUTANT WITH REDUCED BIOACTIVITY SHOWS MULTIPLE SUBTLE CHANGES IN CONFORMATION THAT AFFECT PROTEIN-PROTEIN RECOGNITION
;
_struct.pdbx_descriptor           'INTERLEUKIN-1 BETA (HUMAN) MUTANT WITH THR 9 REPLACED BY GLY (T9G)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HIB 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       H1 
_struct_conf.beg_label_comp_id       GLU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        96 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        98 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         96 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         98 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.26 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BRL ? 7 ? 
L1  ? 2 ? 
L2  ? 2 ? 
L3  ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BRL 1 2 ? anti-parallel 
BRL 2 3 ? anti-parallel 
BRL 3 4 ? anti-parallel 
BRL 4 5 ? anti-parallel 
BRL 5 6 ? anti-parallel 
BRL 6 7 ? anti-parallel 
L1  1 2 ? anti-parallel 
L2  1 2 ? anti-parallel 
L3  1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BRL 1 VAL A 3   ? ASP A 12  ? VAL A 3   ASP A 12  
BRL 2 VAL A 41  ? VAL A 47  ? VAL A 41  VAL A 47  
BRL 3 ASP A 54  ? LYS A 63  ? ASP A 54  LYS A 63  
BRL 4 PHE A 99  ? ILE A 106 ? PHE A 99  ILE A 106 
BRL 5 LYS A 109 ? ALA A 115 ? LYS A 109 ALA A 115 
BRL 6 ASP A 145 ? SER A 153 ? ASP A 145 SER A 153 
BRL 7 VAL A 3   ? ASP A 12  ? VAL A 3   ASP A 12  
L1  1 LYS A 16  ? GLY A 22  ? LYS A 16  GLY A 22  
L1  2 GLU A 25  ? LEU A 31  ? GLU A 25  LEU A 31  
L2  1 ASN A 66  ? LYS A 74  ? ASN A 66  LYS A 74  
L2  2 LYS A 77  ? VAL A 85  ? LYS A 77  VAL A 85  
L3  1 TYR A 121 ? SER A 125 ? TYR A 121 SER A 125 
L3  2 MET A 130 ? GLY A 135 ? MET A 130 GLY A 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BRL 1 2 N LEU A 6   ? N LEU A 6   O MET A 44  ? O MET A 44  
BRL 2 3 N SER A 43  ? N SER A 43  O GLY A 61  ? O GLY A 61  
BRL 3 4 N VAL A 58  ? N VAL A 58  O PHE A 101 ? O PHE A 101 
BRL 4 5 N ILE A 104 ? N ILE A 104 O GLU A 111 ? O GLU A 111 
BRL 5 6 N LEU A 110 ? N LEU A 110 O PHE A 146 ? O PHE A 146 
BRL 6 7 N THR A 147 ? N THR A 147 O ARG A 11  ? O ARG A 11  
L1  1 2 O SER A 17  ? O SER A 17  N LEU A 29  ? N LEU A 29  
L2  1 2 O LYS A 74  ? O LYS A 74  N LYS A 77  ? N LYS A 77  
L3  1 2 N TYR A 121 ? N TYR A 121 O GLY A 135 ? O GLY A 135 
# 
_database_PDB_matrix.entry_id          1HIB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HIB 
_atom_sites.fract_transf_matrix[1][1]   0.018041 
_atom_sites.fract_transf_matrix[1][2]   0.010416 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020832 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004133 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO      91'                                                                                 
2 'ILE     106  - ASN     108     OMEGA  = 96.42 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 3   ? 11.377 -7.495  59.297 1.00 40.70 ? 3   VAL A N   1 
ATOM   2    C CA  . VAL A 1 3   ? 11.812 -6.259  60.023 1.00 38.72 ? 3   VAL A CA  1 
ATOM   3    C C   . VAL A 1 3   ? 13.308 -6.018  59.807 1.00 37.32 ? 3   VAL A C   1 
ATOM   4    O O   . VAL A 1 3   ? 14.139 -6.876  60.121 1.00 36.47 ? 3   VAL A O   1 
ATOM   5    C CB  . VAL A 1 3   ? 11.340 -6.337  61.477 1.00 37.69 ? 3   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 3   ? 11.889 -7.625  62.056 1.00 39.12 ? 3   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 3   ? 11.704 -5.125  62.301 1.00 36.26 ? 3   VAL A CG2 1 
ATOM   8    N N   . ARG A 1 4   ? 13.618 -4.848  59.263 1.00 36.09 ? 4   ARG A N   1 
ATOM   9    C CA  . ARG A 1 4   ? 14.977 -4.408  58.964 1.00 34.70 ? 4   ARG A CA  1 
ATOM   10   C C   . ARG A 1 4   ? 15.719 -3.961  60.240 1.00 30.34 ? 4   ARG A C   1 
ATOM   11   O O   . ARG A 1 4   ? 15.247 -3.082  60.995 1.00 29.45 ? 4   ARG A O   1 
ATOM   12   C CB  . ARG A 1 4   ? 15.018 -3.222  57.970 1.00 41.71 ? 4   ARG A CB  1 
ATOM   13   C CG  . ARG A 1 4   ? 16.411 -2.728  57.664 1.00 50.15 ? 4   ARG A CG  1 
ATOM   14   C CD  . ARG A 1 4   ? 16.613 -1.345  57.158 1.00 56.23 ? 4   ARG A CD  1 
ATOM   15   N NE  . ARG A 1 4   ? 17.982 -0.857  57.213 1.00 59.21 ? 4   ARG A NE  1 
ATOM   16   C CZ  . ARG A 1 4   ? 19.170 -1.346  56.885 1.00 59.70 ? 4   ARG A CZ  1 
ATOM   17   N NH1 . ARG A 1 4   ? 19.329 -2.556  56.359 1.00 59.59 ? 4   ARG A NH1 1 
ATOM   18   N NH2 . ARG A 1 4   ? 20.274 -0.611  57.072 1.00 59.56 ? 4   ARG A NH2 1 
ATOM   19   N N   . SER A 1 5   ? 16.893 -4.527  60.368 1.00 25.68 ? 5   SER A N   1 
ATOM   20   C CA  . SER A 1 5   ? 17.780 -4.246  61.493 1.00 22.32 ? 5   SER A CA  1 
ATOM   21   C C   . SER A 1 5   ? 19.156 -3.849  60.978 1.00 20.44 ? 5   SER A C   1 
ATOM   22   O O   . SER A 1 5   ? 19.519 -4.190  59.858 1.00 21.13 ? 5   SER A O   1 
ATOM   23   C CB  . SER A 1 5   ? 17.934 -5.494  62.379 1.00 19.72 ? 5   SER A CB  1 
ATOM   24   O OG  . SER A 1 5   ? 16.568 -5.779  62.613 1.00 22.69 ? 5   SER A OG  1 
ATOM   25   N N   . LEU A 1 6   ? 19.869 -3.230  61.879 1.00 18.30 ? 6   LEU A N   1 
ATOM   26   C CA  . LEU A 1 6   ? 21.250 -2.764  61.704 1.00 17.33 ? 6   LEU A CA  1 
ATOM   27   C C   . LEU A 1 6   ? 22.002 -2.978  63.021 1.00 16.36 ? 6   LEU A C   1 
ATOM   28   O O   . LEU A 1 6   ? 21.382 -3.125  64.103 1.00 17.42 ? 6   LEU A O   1 
ATOM   29   C CB  . LEU A 1 6   ? 21.071 -1.375  61.203 1.00 15.92 ? 6   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 6   ? 20.489 -0.139  61.709 1.00 14.73 ? 6   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 6   ? 21.175 0.143   63.040 1.00 12.68 ? 6   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 6   ? 20.563 1.064   60.806 1.00 15.12 ? 6   LEU A CD2 1 
ATOM   33   N N   . ASN A 1 7   ? 23.299 -2.970  62.969 1.00 14.72 ? 7   ASN A N   1 
ATOM   34   C CA  . ASN A 1 7   ? 24.189 -3.147  64.127 1.00 14.40 ? 7   ASN A CA  1 
ATOM   35   C C   . ASN A 1 7   ? 25.077 -1.907  64.336 1.00 13.25 ? 7   ASN A C   1 
ATOM   36   O O   . ASN A 1 7   ? 25.709 -1.497  63.327 1.00 13.62 ? 7   ASN A O   1 
ATOM   37   C CB  . ASN A 1 7   ? 25.091 -4.385  63.871 1.00 15.60 ? 7   ASN A CB  1 
ATOM   38   C CG  . ASN A 1 7   ? 24.283 -5.652  63.819 1.00 15.82 ? 7   ASN A CG  1 
ATOM   39   O OD1 . ASN A 1 7   ? 23.372 -5.909  64.598 1.00 18.68 ? 7   ASN A OD1 1 
ATOM   40   N ND2 . ASN A 1 7   ? 24.558 -6.517  62.867 1.00 17.30 ? 7   ASN A ND2 1 
ATOM   41   N N   . CYS A 1 8   ? 25.089 -1.325  65.515 1.00 10.30 ? 8   CYS A N   1 
ATOM   42   C CA  . CYS A 1 8   ? 25.980 -0.139  65.670 1.00 8.88  ? 8   CYS A CA  1 
ATOM   43   C C   . CYS A 1 8   ? 26.322 -0.103  67.160 1.00 8.19  ? 8   CYS A C   1 
ATOM   44   O O   . CYS A 1 8   ? 25.842 -0.936  67.954 1.00 8.57  ? 8   CYS A O   1 
ATOM   45   C CB  . CYS A 1 8   ? 25.252 1.135   65.260 1.00 6.84  ? 8   CYS A CB  1 
ATOM   46   S SG  . CYS A 1 8   ? 23.758 1.320   66.312 1.00 10.03 ? 8   CYS A SG  1 
ATOM   47   N N   . GLY A 1 9   ? 27.134 0.843   67.498 1.00 6.54  ? 9   GLY A N   1 
ATOM   48   C CA  . GLY A 1 9   ? 27.526 1.134   68.895 1.00 4.13  ? 9   GLY A CA  1 
ATOM   49   C C   . GLY A 1 9   ? 26.932 2.553   69.070 1.00 3.41  ? 9   GLY A C   1 
ATOM   50   O O   . GLY A 1 9   ? 26.516 3.162   68.040 1.00 4.17  ? 9   GLY A O   1 
ATOM   51   N N   . LEU A 1 10  ? 26.883 3.051   70.258 1.00 3.06  ? 10  LEU A N   1 
ATOM   52   C CA  . LEU A 1 10  ? 26.322 4.396   70.437 1.00 4.56  ? 10  LEU A CA  1 
ATOM   53   C C   . LEU A 1 10  ? 27.371 5.143   71.238 1.00 5.29  ? 10  LEU A C   1 
ATOM   54   O O   . LEU A 1 10  ? 27.949 4.455   72.050 1.00 4.36  ? 10  LEU A O   1 
ATOM   55   C CB  . LEU A 1 10  ? 24.968 4.351   71.116 1.00 5.70  ? 10  LEU A CB  1 
ATOM   56   C CG  . LEU A 1 10  ? 23.696 3.902   70.426 1.00 7.80  ? 10  LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 10  ? 22.517 4.111   71.343 1.00 6.17  ? 10  LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 10  ? 23.490 4.732   69.179 1.00 8.33  ? 10  LEU A CD2 1 
ATOM   59   N N   . ARG A 1 11  ? 27.486 6.424   70.948 1.00 6.81  ? 11  ARG A N   1 
ATOM   60   C CA  . ARG A 1 11  ? 28.449 7.241   71.730 1.00 8.01  ? 11  ARG A CA  1 
ATOM   61   C C   . ARG A 1 11  ? 27.772 8.593   71.969 1.00 8.62  ? 11  ARG A C   1 
ATOM   62   O O   . ARG A 1 11  ? 27.167 9.170   71.015 1.00 7.07  ? 11  ARG A O   1 
ATOM   63   C CB  . ARG A 1 11  ? 29.704 7.346   70.934 1.00 11.92 ? 11  ARG A CB  1 
ATOM   64   C CG  . ARG A 1 11  ? 30.829 8.303   71.376 1.00 18.07 ? 11  ARG A CG  1 
ATOM   65   C CD  . ARG A 1 11  ? 31.997 7.765   70.643 1.00 23.96 ? 11  ARG A CD  1 
ATOM   66   N NE  . ARG A 1 11  ? 33.134 8.435   70.220 1.00 29.51 ? 11  ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 11  ? 33.592 9.141   69.220 1.00 29.09 ? 11  ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 11  ? 32.860 9.461   68.168 1.00 26.64 ? 11  ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 11  ? 34.854 9.575   69.352 1.00 32.07 ? 11  ARG A NH2 1 
ATOM   70   N N   . ASP A 1 12  ? 27.874 9.056   73.245 1.00 9.05  ? 12  ASP A N   1 
ATOM   71   C CA  . ASP A 1 12  ? 27.221 10.376  73.495 1.00 11.10 ? 12  ASP A CA  1 
ATOM   72   C C   . ASP A 1 12  ? 28.009 11.475  72.801 1.00 14.31 ? 12  ASP A C   1 
ATOM   73   O O   . ASP A 1 12  ? 29.101 11.278  72.240 1.00 15.87 ? 12  ASP A O   1 
ATOM   74   C CB  . ASP A 1 12  ? 26.880 10.557  74.938 1.00 6.17  ? 12  ASP A CB  1 
ATOM   75   C CG  . ASP A 1 12  ? 28.021 10.729  75.875 1.00 6.65  ? 12  ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 12  ? 29.121 11.193  75.370 1.00 4.96  ? 12  ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 12  ? 27.969 10.508  77.073 1.00 7.04  ? 12  ASP A OD2 1 
ATOM   78   N N   . SER A 1 13  ? 27.531 12.687  72.886 1.00 17.11 ? 13  SER A N   1 
ATOM   79   C CA  . SER A 1 13  ? 28.133 13.896  72.309 1.00 19.16 ? 13  SER A CA  1 
ATOM   80   C C   . SER A 1 13  ? 29.447 14.255  72.982 1.00 19.62 ? 13  SER A C   1 
ATOM   81   O O   . SER A 1 13  ? 30.258 14.946  72.345 1.00 20.76 ? 13  SER A O   1 
ATOM   82   C CB  . SER A 1 13  ? 27.170 15.070  72.274 1.00 20.93 ? 13  SER A CB  1 
ATOM   83   O OG  . SER A 1 13  ? 26.676 15.339  73.581 1.00 24.34 ? 13  SER A OG  1 
ATOM   84   N N   . GLN A 1 14  ? 29.688 13.842  74.200 1.00 20.03 ? 14  GLN A N   1 
ATOM   85   C CA  . GLN A 1 14  ? 30.930 14.049  74.951 1.00 19.30 ? 14  GLN A CA  1 
ATOM   86   C C   . GLN A 1 14  ? 31.922 12.915  74.680 1.00 16.32 ? 14  GLN A C   1 
ATOM   87   O O   . GLN A 1 14  ? 32.871 12.785  75.465 1.00 16.20 ? 14  GLN A O   1 
ATOM   88   C CB  . GLN A 1 14  ? 30.689 13.945  76.478 1.00 25.34 ? 14  GLN A CB  1 
ATOM   89   C CG  . GLN A 1 14  ? 29.634 14.889  76.983 1.00 33.66 ? 14  GLN A CG  1 
ATOM   90   C CD  . GLN A 1 14  ? 30.243 16.135  77.587 1.00 35.59 ? 14  GLN A CD  1 
ATOM   91   O OE1 . GLN A 1 14  ? 30.380 16.170  78.811 1.00 37.58 ? 14  GLN A OE1 1 
ATOM   92   N NE2 . GLN A 1 14  ? 30.550 17.048  76.672 1.00 37.70 ? 14  GLN A NE2 1 
ATOM   93   N N   . GLN A 1 15  ? 31.728 12.069  73.713 1.00 14.35 ? 15  GLN A N   1 
ATOM   94   C CA  . GLN A 1 15  ? 32.623 10.966  73.359 1.00 14.04 ? 15  GLN A CA  1 
ATOM   95   C C   . GLN A 1 15  ? 32.654 9.782   74.285 1.00 11.86 ? 15  GLN A C   1 
ATOM   96   O O   . GLN A 1 15  ? 33.618 9.011   74.205 1.00 11.08 ? 15  GLN A O   1 
ATOM   97   C CB  . GLN A 1 15  ? 34.072 11.413  73.112 1.00 18.11 ? 15  GLN A CB  1 
ATOM   98   C CG  . GLN A 1 15  ? 34.273 12.729  72.402 1.00 25.93 ? 15  GLN A CG  1 
ATOM   99   C CD  . GLN A 1 15  ? 33.552 12.742  71.068 1.00 27.92 ? 15  GLN A CD  1 
ATOM   100  O OE1 . GLN A 1 15  ? 32.451 13.258  70.898 1.00 29.70 ? 15  GLN A OE1 1 
ATOM   101  N NE2 . GLN A 1 15  ? 34.256 12.080  70.168 1.00 32.42 ? 15  GLN A NE2 1 
ATOM   102  N N   . LYS A 1 16  ? 31.666 9.625   75.132 1.00 11.78 ? 16  LYS A N   1 
ATOM   103  C CA  . LYS A 1 16  ? 31.538 8.466   76.043 1.00 11.18 ? 16  LYS A CA  1 
ATOM   104  C C   . LYS A 1 16  ? 30.772 7.378   75.299 1.00 11.65 ? 16  LYS A C   1 
ATOM   105  O O   . LYS A 1 16  ? 29.639 7.575   74.808 1.00 12.66 ? 16  LYS A O   1 
ATOM   106  C CB  . LYS A 1 16  ? 30.970 8.756   77.415 1.00 10.63 ? 16  LYS A CB  1 
ATOM   107  C CG  . LYS A 1 16  ? 31.707 9.899   78.152 1.00 9.02  ? 16  LYS A CG  1 
ATOM   108  C CD  . LYS A 1 16  ? 31.462 9.975   79.636 1.00 6.64  ? 16  LYS A CD  1 
ATOM   109  C CE  . LYS A 1 16  ? 30.060 10.309  80.055 1.00 5.18  ? 16  LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 16  ? 29.465 11.439  79.305 1.00 4.98  ? 16  LYS A NZ  1 
ATOM   111  N N   . SER A 1 17  ? 31.413 6.222   75.168 1.00 10.83 ? 17  SER A N   1 
ATOM   112  C CA  . SER A 1 17  ? 30.836 5.040   74.489 1.00 9.45  ? 17  SER A CA  1 
ATOM   113  C C   . SER A 1 17  ? 29.987 4.214   75.448 1.00 8.96  ? 17  SER A C   1 
ATOM   114  O O   . SER A 1 17  ? 30.406 4.168   76.657 1.00 9.80  ? 17  SER A O   1 
ATOM   115  C CB  . SER A 1 17  ? 32.008 4.125   74.079 1.00 9.43  ? 17  SER A CB  1 
ATOM   116  O OG  . SER A 1 17  ? 32.489 4.572   72.806 1.00 8.02  ? 17  SER A OG  1 
ATOM   117  N N   . LEU A 1 18  ? 28.904 3.604   74.913 1.00 6.28  ? 18  LEU A N   1 
ATOM   118  C CA  . LEU A 1 18  ? 28.139 2.794   75.860 1.00 6.40  ? 18  LEU A CA  1 
ATOM   119  C C   . LEU A 1 18  ? 28.812 1.405   75.925 1.00 6.56  ? 18  LEU A C   1 
ATOM   120  O O   . LEU A 1 18  ? 29.169 0.833   74.896 1.00 6.24  ? 18  LEU A O   1 
ATOM   121  C CB  . LEU A 1 18  ? 26.648 2.765   75.681 1.00 3.85  ? 18  LEU A CB  1 
ATOM   122  C CG  . LEU A 1 18  ? 25.911 4.026   75.374 1.00 4.88  ? 18  LEU A CG  1 
ATOM   123  C CD1 . LEU A 1 18  ? 24.465 3.671   75.481 1.00 2.40  ? 18  LEU A CD1 1 
ATOM   124  C CD2 . LEU A 1 18  ? 26.330 5.223   76.196 1.00 4.86  ? 18  LEU A CD2 1 
ATOM   125  N N   . VAL A 1 19  ? 28.903 0.953   77.151 1.00 7.09  ? 19  VAL A N   1 
ATOM   126  C CA  . VAL A 1 19  ? 29.553 -0.332  77.473 1.00 9.12  ? 19  VAL A CA  1 
ATOM   127  C C   . VAL A 1 19  ? 28.678 -1.082  78.475 1.00 10.53 ? 19  VAL A C   1 
ATOM   128  O O   . VAL A 1 19  ? 27.728 -0.509  79.057 1.00 11.20 ? 19  VAL A O   1 
ATOM   129  C CB  . VAL A 1 19  ? 30.888 0.227   78.045 1.00 8.58  ? 19  VAL A CB  1 
ATOM   130  C CG1 . VAL A 1 19  ? 31.763 -0.766  78.705 1.00 11.85 ? 19  VAL A CG1 1 
ATOM   131  C CG2 . VAL A 1 19  ? 31.683 0.869   76.899 1.00 10.24 ? 19  VAL A CG2 1 
ATOM   132  N N   . MET A 1 20  ? 29.001 -2.344  78.684 1.00 11.37 ? 20  MET A N   1 
ATOM   133  C CA  . MET A 1 20  ? 28.298 -3.218  79.626 1.00 13.20 ? 20  MET A CA  1 
ATOM   134  C C   . MET A 1 20  ? 28.888 -2.958  81.027 1.00 14.81 ? 20  MET A C   1 
ATOM   135  O O   . MET A 1 20  ? 30.094 -2.661  81.182 1.00 14.79 ? 20  MET A O   1 
ATOM   136  C CB  . MET A 1 20  ? 28.291 -4.686  79.329 1.00 13.08 ? 20  MET A CB  1 
ATOM   137  C CG  . MET A 1 20  ? 27.553 -5.347  78.257 1.00 19.05 ? 20  MET A CG  1 
ATOM   138  S SD  . MET A 1 20  ? 25.781 -5.248  78.075 1.00 22.89 ? 20  MET A SD  1 
ATOM   139  C CE  . MET A 1 20  ? 25.289 -6.349  79.410 1.00 22.80 ? 20  MET A CE  1 
ATOM   140  N N   . SER A 1 21  ? 28.004 -3.048  81.983 1.00 17.65 ? 21  SER A N   1 
ATOM   141  C CA  . SER A 1 21  ? 28.309 -2.830  83.406 1.00 22.64 ? 21  SER A CA  1 
ATOM   142  C C   . SER A 1 21  ? 28.332 -4.228  84.014 1.00 23.76 ? 21  SER A C   1 
ATOM   143  O O   . SER A 1 21  ? 29.430 -4.751  84.252 1.00 27.71 ? 21  SER A O   1 
ATOM   144  C CB  . SER A 1 21  ? 27.269 -1.929  84.016 1.00 25.31 ? 21  SER A CB  1 
ATOM   145  O OG  . SER A 1 21  ? 27.639 -1.566  85.322 1.00 30.33 ? 21  SER A OG  1 
ATOM   146  N N   . GLY A 1 22  ? 27.198 -4.794  84.241 1.00 23.13 ? 22  GLY A N   1 
ATOM   147  C CA  . GLY A 1 22  ? 27.118 -6.208  84.721 1.00 22.21 ? 22  GLY A CA  1 
ATOM   148  C C   . GLY A 1 22  ? 26.225 -6.773  83.583 1.00 21.26 ? 22  GLY A C   1 
ATOM   149  O O   . GLY A 1 22  ? 26.186 -6.162  82.497 1.00 21.81 ? 22  GLY A O   1 
ATOM   150  N N   . PRO A 1 23  ? 25.543 -7.847  83.880 1.00 19.87 ? 23  PRO A N   1 
ATOM   151  C CA  . PRO A 1 23  ? 24.653 -8.472  82.911 1.00 18.96 ? 23  PRO A CA  1 
ATOM   152  C C   . PRO A 1 23  ? 23.408 -7.649  82.596 1.00 18.10 ? 23  PRO A C   1 
ATOM   153  O O   . PRO A 1 23  ? 22.893 -7.820  81.474 1.00 17.96 ? 23  PRO A O   1 
ATOM   154  C CB  . PRO A 1 23  ? 24.282 -9.853  83.485 1.00 18.50 ? 23  PRO A CB  1 
ATOM   155  C CG  . PRO A 1 23  ? 24.873 -9.920  84.869 1.00 19.18 ? 23  PRO A CG  1 
ATOM   156  C CD  . PRO A 1 23  ? 25.595 -8.599  85.176 1.00 18.50 ? 23  PRO A CD  1 
ATOM   157  N N   . TYR A 1 24  ? 22.960 -6.816  83.535 1.00 16.89 ? 24  TYR A N   1 
ATOM   158  C CA  . TYR A 1 24  ? 21.713 -6.065  83.348 1.00 15.84 ? 24  TYR A CA  1 
ATOM   159  C C   . TYR A 1 24  ? 21.731 -4.563  83.487 1.00 14.51 ? 24  TYR A C   1 
ATOM   160  O O   . TYR A 1 24  ? 20.760 -3.914  83.926 1.00 13.93 ? 24  TYR A O   1 
ATOM   161  C CB  . TYR A 1 24  ? 20.581 -6.695  84.240 1.00 15.54 ? 24  TYR A CB  1 
ATOM   162  C CG  . TYR A 1 24  ? 20.464 -8.161  83.904 1.00 16.27 ? 24  TYR A CG  1 
ATOM   163  C CD1 . TYR A 1 24  ? 20.019 -8.603  82.662 1.00 15.05 ? 24  TYR A CD1 1 
ATOM   164  C CD2 . TYR A 1 24  ? 20.917 -9.122  84.829 1.00 15.89 ? 24  TYR A CD2 1 
ATOM   165  C CE1 . TYR A 1 24  ? 19.938 -9.956  82.353 1.00 14.41 ? 24  TYR A CE1 1 
ATOM   166  C CE2 . TYR A 1 24  ? 20.834 -10.479 84.536 1.00 14.84 ? 24  TYR A CE2 1 
ATOM   167  C CZ  . TYR A 1 24  ? 20.373 -10.876 83.298 1.00 14.18 ? 24  TYR A CZ  1 
ATOM   168  O OH  . TYR A 1 24  ? 20.326 -12.191 82.986 1.00 15.38 ? 24  TYR A OH  1 
ATOM   169  N N   . GLU A 1 25  ? 22.843 -4.006  83.061 1.00 13.93 ? 25  GLU A N   1 
ATOM   170  C CA  . GLU A 1 25  ? 23.106 -2.583  83.108 1.00 12.23 ? 25  GLU A CA  1 
ATOM   171  C C   . GLU A 1 25  ? 24.197 -2.131  82.171 1.00 10.87 ? 25  GLU A C   1 
ATOM   172  O O   . GLU A 1 25  ? 25.127 -2.902  81.898 1.00 10.16 ? 25  GLU A O   1 
ATOM   173  C CB  . GLU A 1 25  ? 23.556 -2.297  84.535 1.00 15.58 ? 25  GLU A CB  1 
ATOM   174  C CG  . GLU A 1 25  ? 23.348 -0.820  84.896 1.00 22.36 ? 25  GLU A CG  1 
ATOM   175  C CD  . GLU A 1 25  ? 23.770 -0.436  86.267 1.00 24.34 ? 25  GLU A CD  1 
ATOM   176  O OE1 . GLU A 1 25  ? 24.702 -0.988  86.783 1.00 26.49 ? 25  GLU A OE1 1 
ATOM   177  O OE2 . GLU A 1 25  ? 23.048 0.538   86.774 1.00 29.52 ? 25  GLU A OE2 1 
ATOM   178  N N   . LEU A 1 26  ? 24.033 -0.918  81.706 1.00 9.95  ? 26  LEU A N   1 
ATOM   179  C CA  . LEU A 1 26  ? 24.982 -0.226  80.826 1.00 10.09 ? 26  LEU A CA  1 
ATOM   180  C C   . LEU A 1 26  ? 25.619 0.955   81.576 1.00 8.45  ? 26  LEU A C   1 
ATOM   181  O O   . LEU A 1 26  ? 25.081 1.572   82.519 1.00 7.16  ? 26  LEU A O   1 
ATOM   182  C CB  . LEU A 1 26  ? 24.211 0.351   79.651 1.00 13.60 ? 26  LEU A CB  1 
ATOM   183  C CG  . LEU A 1 26  ? 23.419 -0.514  78.704 1.00 17.46 ? 26  LEU A CG  1 
ATOM   184  C CD1 . LEU A 1 26  ? 22.540 0.327   77.814 1.00 15.62 ? 26  LEU A CD1 1 
ATOM   185  C CD2 . LEU A 1 26  ? 24.333 -1.465  77.948 1.00 20.00 ? 26  LEU A CD2 1 
ATOM   186  N N   . LYS A 1 27  ? 26.794 1.343   81.103 1.00 8.01  ? 27  LYS A N   1 
ATOM   187  C CA  . LYS A 1 27  ? 27.566 2.489   81.656 1.00 8.03  ? 27  LYS A CA  1 
ATOM   188  C C   . LYS A 1 27  ? 28.211 3.240   80.501 1.00 8.74  ? 27  LYS A C   1 
ATOM   189  O O   . LYS A 1 27  ? 28.304 2.696   79.373 1.00 8.45  ? 27  LYS A O   1 
ATOM   190  C CB  . LYS A 1 27  ? 28.532 2.090   82.739 1.00 6.94  ? 27  LYS A CB  1 
ATOM   191  C CG  . LYS A 1 27  ? 29.698 1.245   82.257 1.00 8.56  ? 27  LYS A CG  1 
ATOM   192  C CD  . LYS A 1 27  ? 30.706 1.015   83.348 1.00 13.94 ? 27  LYS A CD  1 
ATOM   193  C CE  . LYS A 1 27  ? 31.872 0.176   82.768 1.00 19.69 ? 27  LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 27  ? 32.972 0.180   83.807 1.00 25.35 ? 27  LYS A NZ  1 
ATOM   195  N N   . ALA A 1 28  ? 28.652 4.449   80.759 1.00 10.15 ? 28  ALA A N   1 
ATOM   196  C CA  . ALA A 1 28  ? 29.333 5.248   79.677 1.00 10.49 ? 28  ALA A CA  1 
ATOM   197  C C   . ALA A 1 28  ? 30.693 5.776   80.096 1.00 11.29 ? 28  ALA A C   1 
ATOM   198  O O   . ALA A 1 28  ? 30.872 6.292   81.248 1.00 10.59 ? 28  ALA A O   1 
ATOM   199  C CB  . ALA A 1 28  ? 28.431 6.387   79.259 1.00 10.39 ? 28  ALA A CB  1 
ATOM   200  N N   . LEU A 1 29  ? 31.636 5.549   79.163 1.00 11.96 ? 29  LEU A N   1 
ATOM   201  C CA  . LEU A 1 29  ? 33.012 6.049   79.415 1.00 13.28 ? 29  LEU A CA  1 
ATOM   202  C C   . LEU A 1 29  ? 33.776 6.219   78.102 1.00 14.61 ? 29  LEU A C   1 
ATOM   203  O O   . LEU A 1 29  ? 33.579 5.542   77.104 1.00 13.37 ? 29  LEU A O   1 
ATOM   204  C CB  . LEU A 1 29  ? 33.777 5.253   80.428 1.00 13.75 ? 29  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 29  ? 34.324 3.837   80.233 1.00 11.32 ? 29  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 29  ? 33.434 2.981   79.357 1.00 10.00 ? 29  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 29  ? 35.727 3.785   79.870 1.00 6.95  ? 29  LEU A CD2 1 
ATOM   208  N N   . HIS A 1 30  ? 34.669 7.208   78.112 1.00 16.81 ? 30  HIS A N   1 
ATOM   209  C CA  . HIS A 1 30  ? 35.523 7.571   76.998 1.00 19.20 ? 30  HIS A CA  1 
ATOM   210  C C   . HIS A 1 30  ? 36.600 6.482   76.781 1.00 21.60 ? 30  HIS A C   1 
ATOM   211  O O   . HIS A 1 30  ? 37.503 6.188   77.600 1.00 20.24 ? 30  HIS A O   1 
ATOM   212  C CB  . HIS A 1 30  ? 36.258 8.870   77.279 1.00 19.15 ? 30  HIS A CB  1 
ATOM   213  C CG  . HIS A 1 30  ? 37.033 9.410   76.128 1.00 21.08 ? 30  HIS A CG  1 
ATOM   214  N ND1 . HIS A 1 30  ? 36.486 9.477   74.877 1.00 23.21 ? 30  HIS A ND1 1 
ATOM   215  C CD2 . HIS A 1 30  ? 38.297 9.927   76.073 1.00 22.80 ? 30  HIS A CD2 1 
ATOM   216  C CE1 . HIS A 1 30  ? 37.371 10.023  74.085 1.00 23.21 ? 30  HIS A CE1 1 
ATOM   217  N NE2 . HIS A 1 30  ? 38.488 10.319  74.772 1.00 24.57 ? 30  HIS A NE2 1 
ATOM   218  N N   . LEU A 1 31  ? 36.402 5.961   75.571 1.00 24.61 ? 31  LEU A N   1 
ATOM   219  C CA  . LEU A 1 31  ? 37.299 4.895   75.064 1.00 28.28 ? 31  LEU A CA  1 
ATOM   220  C C   . LEU A 1 31  ? 38.326 5.529   74.145 1.00 34.33 ? 31  LEU A C   1 
ATOM   221  O O   . LEU A 1 31  ? 38.636 6.718   74.248 1.00 33.64 ? 31  LEU A O   1 
ATOM   222  C CB  . LEU A 1 31  ? 36.490 3.755   74.493 1.00 20.66 ? 31  LEU A CB  1 
ATOM   223  C CG  . LEU A 1 31  ? 35.506 2.917   75.254 1.00 15.22 ? 31  LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 31  ? 34.897 1.898   74.324 1.00 11.81 ? 31  LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 31  ? 36.154 2.161   76.381 1.00 13.74 ? 31  LEU A CD2 1 
ATOM   226  N N   . GLN A 1 32  ? 38.834 4.818   73.196 1.00 44.13 ? 32  GLN A N   1 
ATOM   227  C CA  . GLN A 1 32  ? 39.863 5.225   72.211 1.00 53.98 ? 32  GLN A CA  1 
ATOM   228  C C   . GLN A 1 32  ? 41.132 5.101   73.068 1.00 58.58 ? 32  GLN A C   1 
ATOM   229  O O   . GLN A 1 32  ? 41.558 3.978   73.331 1.00 58.44 ? 32  GLN A O   1 
ATOM   230  C CB  . GLN A 1 32  ? 39.610 6.524   71.483 1.00 58.90 ? 32  GLN A CB  1 
ATOM   231  C CG  . GLN A 1 32  ? 40.666 7.110   70.579 1.00 65.28 ? 32  GLN A CG  1 
ATOM   232  C CD  . GLN A 1 32  ? 40.892 6.514   69.219 1.00 69.02 ? 32  GLN A CD  1 
ATOM   233  O OE1 . GLN A 1 32  ? 41.549 5.490   68.979 1.00 71.40 ? 32  GLN A OE1 1 
ATOM   234  N NE2 . GLN A 1 32  ? 40.323 7.201   68.221 1.00 70.51 ? 32  GLN A NE2 1 
ATOM   235  N N   . GLY A 1 33  ? 41.637 6.198   73.544 1.00 63.87 ? 33  GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? 42.825 6.315   74.355 1.00 70.27 ? 33  GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? 42.511 6.676   75.802 1.00 74.59 ? 33  GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? 42.545 7.815   76.287 1.00 75.15 ? 33  GLY A O   1 
ATOM   239  N N   . GLN A 1 34  ? 42.216 5.604   76.499 1.00 78.34 ? 34  GLN A N   1 
ATOM   240  C CA  . GLN A 1 34  ? 41.872 5.505   77.928 1.00 81.35 ? 34  GLN A CA  1 
ATOM   241  C C   . GLN A 1 34  ? 41.640 3.993   78.132 1.00 81.89 ? 34  GLN A C   1 
ATOM   242  O O   . GLN A 1 34  ? 42.543 3.250   78.555 1.00 82.96 ? 34  GLN A O   1 
ATOM   243  C CB  . GLN A 1 34  ? 40.692 6.364   78.357 1.00 83.47 ? 34  GLN A CB  1 
ATOM   244  C CG  . GLN A 1 34  ? 40.979 7.845   78.271 1.00 85.85 ? 34  GLN A CG  1 
ATOM   245  C CD  . GLN A 1 34  ? 39.870 8.694   78.833 1.00 87.52 ? 34  GLN A CD  1 
ATOM   246  O OE1 . GLN A 1 34  ? 40.016 9.881   79.099 1.00 87.44 ? 34  GLN A OE1 1 
ATOM   247  N NE2 . GLN A 1 34  ? 38.721 8.046   78.988 1.00 89.11 ? 34  GLN A NE2 1 
ATOM   248  N N   . ASP A 1 35  ? 40.433 3.607   77.755 1.00 80.99 ? 35  ASP A N   1 
ATOM   249  C CA  . ASP A 1 35  ? 39.992 2.191   77.805 1.00 79.27 ? 35  ASP A CA  1 
ATOM   250  C C   . ASP A 1 35  ? 39.755 1.898   76.325 1.00 76.90 ? 35  ASP A C   1 
ATOM   251  O O   . ASP A 1 35  ? 39.096 2.692   75.670 1.00 76.53 ? 35  ASP A O   1 
ATOM   252  C CB  . ASP A 1 35  ? 38.786 2.017   78.706 1.00 80.83 ? 35  ASP A CB  1 
ATOM   253  C CG  . ASP A 1 35  ? 38.985 2.564   80.097 1.00 81.80 ? 35  ASP A CG  1 
ATOM   254  O OD1 . ASP A 1 35  ? 39.066 3.863   80.228 1.00 81.34 ? 35  ASP A OD1 1 
ATOM   255  O OD2 . ASP A 1 35  ? 39.045 1.806   81.042 1.00 82.96 ? 35  ASP A OD2 1 
ATOM   256  N N   . MET A 1 36  ? 40.277 0.870   75.753 1.00 74.10 ? 36  MET A N   1 
ATOM   257  C CA  . MET A 1 36  ? 40.200 0.463   74.350 1.00 70.99 ? 36  MET A CA  1 
ATOM   258  C C   . MET A 1 36  ? 38.809 0.174   73.807 1.00 67.39 ? 36  MET A C   1 
ATOM   259  O O   . MET A 1 36  ? 37.815 -0.199  74.457 1.00 66.39 ? 36  MET A O   1 
ATOM   260  C CB  . MET A 1 36  ? 41.221 -0.672  74.181 1.00 74.81 ? 36  MET A CB  1 
ATOM   261  C CG  . MET A 1 36  ? 42.665 -0.287  74.347 1.00 79.22 ? 36  MET A CG  1 
ATOM   262  S SD  . MET A 1 36  ? 43.197 0.516   75.884 1.00 82.86 ? 36  MET A SD  1 
ATOM   263  C CE  . MET A 1 36  ? 44.802 -0.302  76.103 1.00 83.49 ? 36  MET A CE  1 
ATOM   264  N N   . GLU A 1 37  ? 38.616 0.346   72.524 1.00 63.94 ? 37  GLU A N   1 
ATOM   265  C CA  . GLU A 1 37  ? 37.517 0.245   71.614 1.00 61.14 ? 37  GLU A CA  1 
ATOM   266  C C   . GLU A 1 37  ? 36.225 -0.516  71.802 1.00 56.75 ? 37  GLU A C   1 
ATOM   267  O O   . GLU A 1 37  ? 35.246 -0.180  71.054 1.00 56.03 ? 37  GLU A O   1 
ATOM   268  C CB  . GLU A 1 37  ? 38.105 -0.035  70.224 1.00 67.54 ? 37  GLU A CB  1 
ATOM   269  C CG  . GLU A 1 37  ? 37.423 -0.267  68.901 1.00 74.77 ? 37  GLU A CG  1 
ATOM   270  C CD  . GLU A 1 37  ? 36.470 0.717   68.295 1.00 78.33 ? 37  GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 37  ? 35.948 1.637   68.907 1.00 80.41 ? 37  GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 37  ? 36.231 0.502   67.017 1.00 80.36 ? 37  GLU A OE2 1 
ATOM   273  N N   . GLN A 1 38  ? 36.238 -1.686  72.556 1.00 50.67 ? 38  GLN A N   1 
ATOM   274  C CA  . GLN A 1 38  ? 34.867 -2.237  72.887 1.00 42.14 ? 38  GLN A CA  1 
ATOM   275  C C   . GLN A 1 38  ? 33.598 -1.865  73.626 1.00 35.02 ? 38  GLN A C   1 
ATOM   276  O O   . GLN A 1 38  ? 33.152 -2.125  74.736 1.00 31.99 ? 38  GLN A O   1 
ATOM   277  C CB  . GLN A 1 38  ? 35.041 -3.727  72.645 1.00 44.05 ? 38  GLN A CB  1 
ATOM   278  C CG  . GLN A 1 38  ? 34.741 -4.010  71.178 1.00 49.37 ? 38  GLN A CG  1 
ATOM   279  C CD  . GLN A 1 38  ? 35.737 -3.469  70.162 1.00 53.93 ? 38  GLN A CD  1 
ATOM   280  O OE1 . GLN A 1 38  ? 35.454 -3.176  68.988 1.00 56.29 ? 38  GLN A OE1 1 
ATOM   281  N NE2 . GLN A 1 38  ? 36.956 -3.255  70.691 1.00 56.36 ? 38  GLN A NE2 1 
ATOM   282  N N   . GLN A 1 39  ? 32.793 -1.218  72.770 1.00 27.86 ? 39  GLN A N   1 
ATOM   283  C CA  . GLN A 1 39  ? 31.462 -0.704  72.944 1.00 22.83 ? 39  GLN A CA  1 
ATOM   284  C C   . GLN A 1 39  ? 30.456 -1.869  72.786 1.00 19.84 ? 39  GLN A C   1 
ATOM   285  O O   . GLN A 1 39  ? 30.809 -2.813  72.063 1.00 18.71 ? 39  GLN A O   1 
ATOM   286  C CB  . GLN A 1 39  ? 31.276 0.316   71.805 1.00 20.72 ? 39  GLN A CB  1 
ATOM   287  C CG  . GLN A 1 39  ? 31.391 -0.252  70.417 1.00 20.50 ? 39  GLN A CG  1 
ATOM   288  C CD  . GLN A 1 39  ? 31.565 0.684   69.237 1.00 18.72 ? 39  GLN A CD  1 
ATOM   289  O OE1 . GLN A 1 39  ? 31.114 1.805   69.201 1.00 19.21 ? 39  GLN A OE1 1 
ATOM   290  N NE2 . GLN A 1 39  ? 32.236 0.189   68.174 1.00 18.51 ? 39  GLN A NE2 1 
ATOM   291  N N   . VAL A 1 40  ? 29.315 -1.804  73.451 1.00 15.97 ? 40  VAL A N   1 
ATOM   292  C CA  . VAL A 1 40  ? 28.267 -2.805  73.282 1.00 13.97 ? 40  VAL A CA  1 
ATOM   293  C C   . VAL A 1 40  ? 27.785 -2.670  71.813 1.00 12.08 ? 40  VAL A C   1 
ATOM   294  O O   . VAL A 1 40  ? 27.750 -1.531  71.281 1.00 11.35 ? 40  VAL A O   1 
ATOM   295  C CB  . VAL A 1 40  ? 27.109 -2.529  74.283 1.00 14.69 ? 40  VAL A CB  1 
ATOM   296  C CG1 . VAL A 1 40  ? 25.794 -3.204  73.896 1.00 15.71 ? 40  VAL A CG1 1 
ATOM   297  C CG2 . VAL A 1 40  ? 27.418 -3.175  75.636 1.00 14.95 ? 40  VAL A CG2 1 
ATOM   298  N N   . VAL A 1 41  ? 27.434 -3.780  71.183 1.00 9.66  ? 41  VAL A N   1 
ATOM   299  C CA  . VAL A 1 41  ? 26.914 -3.726  69.795 1.00 7.58  ? 41  VAL A CA  1 
ATOM   300  C C   . VAL A 1 41  ? 25.371 -3.844  69.930 1.00 7.85  ? 41  VAL A C   1 
ATOM   301  O O   . VAL A 1 41  ? 24.859 -4.885  70.442 1.00 7.40  ? 41  VAL A O   1 
ATOM   302  C CB  . VAL A 1 41  ? 27.501 -4.905  69.001 1.00 7.22  ? 41  VAL A CB  1 
ATOM   303  C CG1 . VAL A 1 41  ? 26.691 -5.150  67.698 1.00 9.02  ? 41  VAL A CG1 1 
ATOM   304  C CG2 . VAL A 1 41  ? 28.972 -4.845  68.750 1.00 3.77  ? 41  VAL A CG2 1 
ATOM   305  N N   . PHE A 1 42  ? 24.646 -2.822  69.520 1.00 7.40  ? 42  PHE A N   1 
ATOM   306  C CA  . PHE A 1 42  ? 23.198 -2.818  69.561 1.00 7.41  ? 42  PHE A CA  1 
ATOM   307  C C   . PHE A 1 42  ? 22.691 -3.278  68.183 1.00 10.19 ? 42  PHE A C   1 
ATOM   308  O O   . PHE A 1 42  ? 23.340 -3.123  67.136 1.00 12.84 ? 42  PHE A O   1 
ATOM   309  C CB  . PHE A 1 42  ? 22.553 -1.471  69.740 1.00 4.51  ? 42  PHE A CB  1 
ATOM   310  C CG  . PHE A 1 42  ? 22.888 -0.847  71.049 1.00 5.24  ? 42  PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 42  ? 22.107 -1.114  72.167 1.00 6.07  ? 42  PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 42  ? 23.993 -0.012  71.155 1.00 5.70  ? 42  PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 42  ? 22.406 -0.528  73.413 1.00 6.38  ? 42  PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 42  ? 24.346 0.560   72.385 1.00 6.08  ? 42  PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 42  ? 23.525 0.315   73.501 1.00 7.00  ? 42  PHE A CZ  1 
ATOM   316  N N   . SER A 1 43  ? 21.517 -3.818  68.187 1.00 11.60 ? 43  SER A N   1 
ATOM   317  C CA  . SER A 1 43  ? 20.806 -4.274  66.998 1.00 12.78 ? 43  SER A CA  1 
ATOM   318  C C   . SER A 1 43  ? 19.607 -3.293  67.081 1.00 11.92 ? 43  SER A C   1 
ATOM   319  O O   . SER A 1 43  ? 18.852 -3.406  68.050 1.00 10.60 ? 43  SER A O   1 
ATOM   320  C CB  . SER A 1 43  ? 20.506 -5.765  67.081 1.00 16.51 ? 43  SER A CB  1 
ATOM   321  O OG  . SER A 1 43  ? 19.825 -6.233  65.913 1.00 23.58 ? 43  SER A OG  1 
ATOM   322  N N   . MET A 1 44  ? 19.548 -2.381  66.149 1.00 10.65 ? 44  MET A N   1 
ATOM   323  C CA  . MET A 1 44  ? 18.516 -1.354  66.053 1.00 10.39 ? 44  MET A CA  1 
ATOM   324  C C   . MET A 1 44  ? 17.574 -1.799  64.918 1.00 10.08 ? 44  MET A C   1 
ATOM   325  O O   . MET A 1 44  ? 17.986 -1.948  63.762 1.00 7.46  ? 44  MET A O   1 
ATOM   326  C CB  . MET A 1 44  ? 19.153 0.022   65.640 1.00 10.64 ? 44  MET A CB  1 
ATOM   327  C CG  . MET A 1 44  ? 18.128 1.123   65.362 1.00 8.72  ? 44  MET A CG  1 
ATOM   328  S SD  . MET A 1 44  ? 18.931 2.616   64.791 1.00 8.08  ? 44  MET A SD  1 
ATOM   329  C CE  . MET A 1 44  ? 19.518 3.285   66.340 1.00 11.07 ? 44  MET A CE  1 
ATOM   330  N N   . SER A 1 45  ? 16.330 -1.979  65.328 1.00 11.39 ? 45  SER A N   1 
ATOM   331  C CA  . SER A 1 45  ? 15.271 -2.457  64.409 1.00 12.66 ? 45  SER A CA  1 
ATOM   332  C C   . SER A 1 45  ? 14.333 -1.319  64.101 1.00 14.29 ? 45  SER A C   1 
ATOM   333  O O   . SER A 1 45  ? 14.128 -0.504  64.985 1.00 15.92 ? 45  SER A O   1 
ATOM   334  C CB  . SER A 1 45  ? 14.545 -3.627  65.046 1.00 12.90 ? 45  SER A CB  1 
ATOM   335  O OG  . SER A 1 45  ? 15.444 -4.715  65.169 1.00 12.18 ? 45  SER A OG  1 
ATOM   336  N N   . PHE A 1 46  ? 13.784 -1.291  62.923 1.00 15.82 ? 46  PHE A N   1 
ATOM   337  C CA  . PHE A 1 46  ? 12.872 -0.239  62.456 1.00 18.15 ? 46  PHE A CA  1 
ATOM   338  C C   . PHE A 1 46  ? 11.445 -0.681  62.673 1.00 20.37 ? 46  PHE A C   1 
ATOM   339  O O   . PHE A 1 46  ? 10.873 -1.332  61.788 1.00 19.66 ? 46  PHE A O   1 
ATOM   340  C CB  . PHE A 1 46  ? 13.320 0.042   61.003 1.00 18.77 ? 46  PHE A CB  1 
ATOM   341  C CG  . PHE A 1 46  ? 14.638 0.785   61.087 1.00 24.00 ? 46  PHE A CG  1 
ATOM   342  C CD1 . PHE A 1 46  ? 14.657 2.162   61.328 1.00 25.17 ? 46  PHE A CD1 1 
ATOM   343  C CD2 . PHE A 1 46  ? 15.842 0.096   60.968 1.00 25.61 ? 46  PHE A CD2 1 
ATOM   344  C CE1 . PHE A 1 46  ? 15.890 2.839   61.416 1.00 24.58 ? 46  PHE A CE1 1 
ATOM   345  C CE2 . PHE A 1 46  ? 17.041 0.775   61.059 1.00 26.56 ? 46  PHE A CE2 1 
ATOM   346  C CZ  . PHE A 1 46  ? 17.075 2.152   61.271 1.00 25.09 ? 46  PHE A CZ  1 
ATOM   347  N N   . VAL A 1 47  ? 10.906 -0.347  63.820 1.00 23.51 ? 47  VAL A N   1 
ATOM   348  C CA  . VAL A 1 47  ? 9.534  -0.782  64.179 1.00 27.80 ? 47  VAL A CA  1 
ATOM   349  C C   . VAL A 1 47  ? 8.434  0.170   63.759 1.00 31.65 ? 47  VAL A C   1 
ATOM   350  O O   . VAL A 1 47  ? 8.689  1.147   63.023 1.00 31.83 ? 47  VAL A O   1 
ATOM   351  C CB  . VAL A 1 47  ? 9.614  -1.271  65.639 1.00 27.24 ? 47  VAL A CB  1 
ATOM   352  C CG1 . VAL A 1 47  ? 10.732 -2.300  65.827 1.00 26.94 ? 47  VAL A CG1 1 
ATOM   353  C CG2 . VAL A 1 47  ? 9.743  -0.173  66.652 1.00 24.67 ? 47  VAL A CG2 1 
ATOM   354  N N   . GLN A 1 48  ? 7.215  -0.093  64.194 1.00 36.79 ? 48  GLN A N   1 
ATOM   355  C CA  . GLN A 1 48  ? 6.044  0.715   63.863 1.00 42.67 ? 48  GLN A CA  1 
ATOM   356  C C   . GLN A 1 48  ? 5.685  1.704   64.963 1.00 44.42 ? 48  GLN A C   1 
ATOM   357  O O   . GLN A 1 48  ? 5.800  1.543   66.178 1.00 43.49 ? 48  GLN A O   1 
ATOM   358  C CB  . GLN A 1 48  ? 4.862  -0.056  63.326 1.00 49.20 ? 48  GLN A CB  1 
ATOM   359  C CG  . GLN A 1 48  ? 3.703  0.742   62.763 1.00 58.86 ? 48  GLN A CG  1 
ATOM   360  C CD  . GLN A 1 48  ? 3.827  1.654   61.564 1.00 63.97 ? 48  GLN A CD  1 
ATOM   361  O OE1 . GLN A 1 48  ? 3.330  2.802   61.532 1.00 65.99 ? 48  GLN A OE1 1 
ATOM   362  N NE2 . GLN A 1 48  ? 4.488  1.152   60.495 1.00 65.93 ? 48  GLN A NE2 1 
ATOM   363  N N   . GLY A 1 49  ? 5.214  2.829   64.461 1.00 47.36 ? 49  GLY A N   1 
ATOM   364  C CA  . GLY A 1 49  ? 4.769  4.014   65.174 1.00 52.00 ? 49  GLY A CA  1 
ATOM   365  C C   . GLY A 1 49  ? 4.816  5.201   64.177 1.00 55.74 ? 49  GLY A C   1 
ATOM   366  O O   . GLY A 1 49  ? 5.037  5.125   62.958 1.00 54.52 ? 49  GLY A O   1 
ATOM   367  N N   . GLU A 1 50  ? 4.585  6.337   64.821 1.00 60.31 ? 50  GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? 4.583  7.620   64.137 1.00 65.09 ? 50  GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? 5.990  7.896   63.607 1.00 66.76 ? 50  GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? 6.921  8.126   64.396 1.00 67.51 ? 50  GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? 4.147  8.775   65.029 1.00 69.02 ? 50  GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? 3.917  10.117  64.333 1.00 73.53 ? 50  GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? 2.677  10.277  63.511 1.00 75.03 ? 50  GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? 2.306  9.216   62.829 1.00 75.96 ? 50  GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? 2.057  11.339  63.488 1.00 76.72 ? 50  GLU A OE2 1 
ATOM   376  N N   . GLU A 1 51  ? 6.065  7.851   62.293 1.00 68.12 ? 51  GLU A N   1 
ATOM   377  C CA  . GLU A 1 51  ? 7.305  8.130   61.559 1.00 69.72 ? 51  GLU A CA  1 
ATOM   378  C C   . GLU A 1 51  ? 7.215  9.592   61.116 1.00 69.71 ? 51  GLU A C   1 
ATOM   379  O O   . GLU A 1 51  ? 7.065  9.967   59.944 1.00 69.35 ? 51  GLU A O   1 
ATOM   380  C CB  . GLU A 1 51  ? 7.569  7.229   60.360 1.00 72.71 ? 51  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 51  ? 8.098  5.838   60.648 1.00 77.59 ? 51  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 51  ? 7.783  4.682   59.756 1.00 79.75 ? 51  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 51  ? 8.017  4.960   58.497 1.00 81.00 ? 51  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 51  ? 7.369  3.611   60.181 1.00 81.10 ? 51  GLU A OE2 1 
ATOM   385  N N   . SER A 1 52  ? 7.311  10.443  62.130 1.00 70.21 ? 52  SER A N   1 
ATOM   386  C CA  . SER A 1 52  ? 7.270  11.901  61.976 1.00 70.73 ? 52  SER A CA  1 
ATOM   387  C C   . SER A 1 52  ? 8.429  12.322  61.065 1.00 71.80 ? 52  SER A C   1 
ATOM   388  O O   . SER A 1 52  ? 9.251  11.578  60.488 1.00 72.01 ? 52  SER A O   1 
ATOM   389  C CB  . SER A 1 52  ? 7.297  12.608  63.319 1.00 69.71 ? 52  SER A CB  1 
ATOM   390  O OG  . SER A 1 52  ? 6.213  12.253  64.145 1.00 68.18 ? 52  SER A OG  1 
ATOM   391  N N   . ASN A 1 53  ? 8.524  13.626  60.937 1.00 72.85 ? 53  ASN A N   1 
ATOM   392  C CA  . ASN A 1 53  ? 9.502  14.374  60.143 1.00 73.17 ? 53  ASN A CA  1 
ATOM   393  C C   . ASN A 1 53  ? 10.926 13.779  60.164 1.00 69.66 ? 53  ASN A C   1 
ATOM   394  O O   . ASN A 1 53  ? 11.531 13.278  59.187 1.00 70.78 ? 53  ASN A O   1 
ATOM   395  C CB  . ASN A 1 53  ? 9.486  15.844  60.573 1.00 80.75 ? 53  ASN A CB  1 
ATOM   396  C CG  . ASN A 1 53  ? 8.236  16.656  60.803 1.00 85.38 ? 53  ASN A CG  1 
ATOM   397  O OD1 . ASN A 1 53  ? 8.189  17.856  61.153 1.00 87.42 ? 53  ASN A OD1 1 
ATOM   398  N ND2 . ASN A 1 53  ? 7.075  15.978  60.598 1.00 88.43 ? 53  ASN A ND2 1 
ATOM   399  N N   . ASP A 1 54  ? 11.497 13.876  61.353 1.00 63.58 ? 54  ASP A N   1 
ATOM   400  C CA  . ASP A 1 54  ? 12.849 13.458  61.733 1.00 55.74 ? 54  ASP A CA  1 
ATOM   401  C C   . ASP A 1 54  ? 12.852 12.360  62.809 1.00 49.03 ? 54  ASP A C   1 
ATOM   402  O O   . ASP A 1 54  ? 13.870 12.128  63.461 1.00 46.78 ? 54  ASP A O   1 
ATOM   403  C CB  . ASP A 1 54  ? 13.551 14.713  62.285 1.00 57.52 ? 54  ASP A CB  1 
ATOM   404  C CG  . ASP A 1 54  ? 12.803 15.451  63.361 1.00 58.41 ? 54  ASP A CG  1 
ATOM   405  O OD1 . ASP A 1 54  ? 11.876 14.856  64.063 1.00 58.90 ? 54  ASP A OD1 1 
ATOM   406  O OD2 . ASP A 1 54  ? 13.028 16.625  63.629 1.00 59.48 ? 54  ASP A OD2 1 
ATOM   407  N N   . LYS A 1 55  ? 11.697 11.775  62.999 1.00 42.83 ? 55  LYS A N   1 
ATOM   408  C CA  . LYS A 1 55  ? 11.394 10.731  63.938 1.00 37.69 ? 55  LYS A CA  1 
ATOM   409  C C   . LYS A 1 55  ? 11.120 9.362   63.305 1.00 34.12 ? 55  LYS A C   1 
ATOM   410  O O   . LYS A 1 55  ? 10.277 9.212   62.407 1.00 34.04 ? 55  LYS A O   1 
ATOM   411  C CB  . LYS A 1 55  ? 10.098 11.043  64.692 1.00 37.05 ? 55  LYS A CB  1 
ATOM   412  C CG  . LYS A 1 55  ? 10.427 11.856  65.915 1.00 40.97 ? 55  LYS A CG  1 
ATOM   413  C CD  . LYS A 1 55  ? 9.245  12.487  66.603 1.00 43.95 ? 55  LYS A CD  1 
ATOM   414  C CE  . LYS A 1 55  ? 8.554  11.490  67.508 1.00 44.45 ? 55  LYS A CE  1 
ATOM   415  N NZ  . LYS A 1 55  ? 8.055  12.292  68.669 1.00 47.17 ? 55  LYS A NZ  1 
ATOM   416  N N   . ILE A 1 56  ? 11.837 8.388   63.806 1.00 29.93 ? 56  ILE A N   1 
ATOM   417  C CA  . ILE A 1 56  ? 11.702 7.008   63.366 1.00 25.96 ? 56  ILE A CA  1 
ATOM   418  C C   . ILE A 1 56  ? 11.629 6.148   64.621 1.00 22.48 ? 56  ILE A C   1 
ATOM   419  O O   . ILE A 1 56  ? 12.587 6.217   65.374 1.00 21.15 ? 56  ILE A O   1 
ATOM   420  C CB  . ILE A 1 56  ? 12.934 6.449   62.665 1.00 27.18 ? 56  ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 56  ? 13.616 7.402   61.749 1.00 30.23 ? 56  ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 56  ? 12.644 5.094   62.043 1.00 28.49 ? 56  ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 56  ? 12.954 8.178   60.630 1.00 31.38 ? 56  ILE A CD1 1 
ATOM   424  N N   . PRO A 1 57  ? 10.578 5.391   64.780 1.00 20.95 ? 57  PRO A N   1 
ATOM   425  C CA  . PRO A 1 57  ? 10.434 4.440   65.904 1.00 18.81 ? 57  PRO A CA  1 
ATOM   426  C C   . PRO A 1 57  ? 11.430 3.271   65.634 1.00 15.93 ? 57  PRO A C   1 
ATOM   427  O O   . PRO A 1 57  ? 11.629 2.663   64.536 1.00 14.97 ? 57  PRO A O   1 
ATOM   428  C CB  . PRO A 1 57  ? 8.956  4.045   65.890 1.00 20.11 ? 57  PRO A CB  1 
ATOM   429  C CG  . PRO A 1 57  ? 8.268  4.893   64.830 1.00 21.65 ? 57  PRO A CG  1 
ATOM   430  C CD  . PRO A 1 57  ? 9.391  5.296   63.844 1.00 21.75 ? 57  PRO A CD  1 
ATOM   431  N N   . VAL A 1 58  ? 12.187 2.967   66.672 1.00 12.47 ? 58  VAL A N   1 
ATOM   432  C CA  . VAL A 1 58  ? 13.192 1.906   66.678 1.00 8.79  ? 58  VAL A CA  1 
ATOM   433  C C   . VAL A 1 58  ? 13.060 1.163   68.003 1.00 7.41  ? 58  VAL A C   1 
ATOM   434  O O   . VAL A 1 58  ? 12.477 1.683   68.953 1.00 6.90  ? 58  VAL A O   1 
ATOM   435  C CB  . VAL A 1 58  ? 14.657 2.425   66.503 1.00 5.80  ? 58  VAL A CB  1 
ATOM   436  C CG1 . VAL A 1 58  ? 14.826 3.307   65.225 1.00 3.25  ? 58  VAL A CG1 1 
ATOM   437  C CG2 . VAL A 1 58  ? 15.135 3.230   67.701 1.00 2.79  ? 58  VAL A CG2 1 
ATOM   438  N N   . ALA A 1 59  ? 13.726 0.028   67.972 1.00 6.94  ? 59  ALA A N   1 
ATOM   439  C CA  . ALA A 1 59  ? 13.884 -0.837  69.144 1.00 6.69  ? 59  ALA A CA  1 
ATOM   440  C C   . ALA A 1 59  ? 15.410 -1.047  69.283 1.00 5.90  ? 59  ALA A C   1 
ATOM   441  O O   . ALA A 1 59  ? 16.031 -1.255  68.220 1.00 4.79  ? 59  ALA A O   1 
ATOM   442  C CB  . ALA A 1 59  ? 13.163 -2.154  68.915 1.00 10.13 ? 59  ALA A CB  1 
ATOM   443  N N   . LEU A 1 60  ? 15.933 -1.042  70.481 1.00 4.84  ? 60  LEU A N   1 
ATOM   444  C CA  . LEU A 1 60  ? 17.348 -1.235  70.747 1.00 5.01  ? 60  LEU A CA  1 
ATOM   445  C C   . LEU A 1 60  ? 17.565 -2.530  71.483 1.00 5.75  ? 60  LEU A C   1 
ATOM   446  O O   . LEU A 1 60  ? 17.129 -2.699  72.632 1.00 5.44  ? 60  LEU A O   1 
ATOM   447  C CB  . LEU A 1 60  ? 17.925 -0.014  71.485 1.00 4.93  ? 60  LEU A CB  1 
ATOM   448  C CG  . LEU A 1 60  ? 17.882 1.287   70.665 1.00 4.45  ? 60  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 60  ? 17.771 2.485   71.568 1.00 5.68  ? 60  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 60  ? 19.121 1.498   69.791 1.00 4.65  ? 60  LEU A CD2 1 
ATOM   451  N N   . GLY A 1 61  ? 18.232 -3.444  70.771 1.00 7.16  ? 61  GLY A N   1 
ATOM   452  C CA  . GLY A 1 61  ? 18.563 -4.780  71.314 1.00 8.81  ? 61  GLY A CA  1 
ATOM   453  C C   . GLY A 1 61  ? 20.056 -4.999  71.465 1.00 9.05  ? 61  GLY A C   1 
ATOM   454  O O   . GLY A 1 61  ? 20.812 -4.380  70.733 1.00 9.19  ? 61  GLY A O   1 
ATOM   455  N N   . LEU A 1 62  ? 20.463 -5.796  72.419 1.00 10.83 ? 62  LEU A N   1 
ATOM   456  C CA  . LEU A 1 62  ? 21.864 -6.132  72.691 1.00 12.91 ? 62  LEU A CA  1 
ATOM   457  C C   . LEU A 1 62  ? 22.111 -7.323  71.778 1.00 15.03 ? 62  LEU A C   1 
ATOM   458  O O   . LEU A 1 62  ? 21.565 -8.410  72.041 1.00 13.18 ? 62  LEU A O   1 
ATOM   459  C CB  . LEU A 1 62  ? 22.192 -6.473  74.137 1.00 13.36 ? 62  LEU A CB  1 
ATOM   460  C CG  . LEU A 1 62  ? 22.439 -5.266  75.077 1.00 15.36 ? 62  LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 62  ? 21.251 -4.352  75.187 1.00 15.18 ? 62  LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 62  ? 22.671 -5.791  76.473 1.00 14.88 ? 62  LEU A CD2 1 
ATOM   463  N N   . LYS A 1 63  ? 22.928 -7.016  70.762 1.00 18.71 ? 63  LYS A N   1 
ATOM   464  C CA  . LYS A 1 63  ? 23.296 -8.051  69.787 1.00 22.80 ? 63  LYS A CA  1 
ATOM   465  C C   . LYS A 1 63  ? 23.750 -9.333  70.516 1.00 25.23 ? 63  LYS A C   1 
ATOM   466  O O   . LYS A 1 63  ? 24.691 -9.322  71.310 1.00 23.83 ? 63  LYS A O   1 
ATOM   467  C CB  . LYS A 1 63  ? 24.391 -7.693  68.808 1.00 24.33 ? 63  LYS A CB  1 
ATOM   468  C CG  . LYS A 1 63  ? 24.320 -8.662  67.583 1.00 26.97 ? 63  LYS A CG  1 
ATOM   469  C CD  . LYS A 1 63  ? 25.593 -8.413  66.808 1.00 32.64 ? 63  LYS A CD  1 
ATOM   470  C CE  . LYS A 1 63  ? 25.828 -9.257  65.588 1.00 35.58 ? 63  LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 63  ? 27.017 -8.672  64.897 1.00 39.59 ? 63  LYS A NZ  1 
ATOM   472  N N   . GLU A 1 64  ? 23.023 -10.407 70.185 1.00 28.24 ? 64  GLU A N   1 
ATOM   473  C CA  . GLU A 1 64  ? 23.253 -11.750 70.695 1.00 30.96 ? 64  GLU A CA  1 
ATOM   474  C C   . GLU A 1 64  ? 23.052 -12.041 72.165 1.00 29.18 ? 64  GLU A C   1 
ATOM   475  O O   . GLU A 1 64  ? 23.564 -13.056 72.702 1.00 31.39 ? 64  GLU A O   1 
ATOM   476  C CB  . GLU A 1 64  ? 24.580 -12.321 70.162 1.00 39.05 ? 64  GLU A CB  1 
ATOM   477  C CG  . GLU A 1 64  ? 24.779 -12.449 68.649 1.00 48.70 ? 64  GLU A CG  1 
ATOM   478  C CD  . GLU A 1 64  ? 26.174 -12.662 68.101 1.00 54.04 ? 64  GLU A CD  1 
ATOM   479  O OE1 . GLU A 1 64  ? 27.221 -12.510 68.743 1.00 56.72 ? 64  GLU A OE1 1 
ATOM   480  O OE2 . GLU A 1 64  ? 26.151 -13.040 66.826 1.00 56.96 ? 64  GLU A OE2 1 
ATOM   481  N N   . LYS A 1 65  ? 22.306 -11.199 72.890 1.00 25.48 ? 65  LYS A N   1 
ATOM   482  C CA  . LYS A 1 65  ? 22.032 -11.430 74.309 1.00 20.27 ? 65  LYS A CA  1 
ATOM   483  C C   . LYS A 1 65  ? 20.558 -11.795 74.493 1.00 15.85 ? 65  LYS A C   1 
ATOM   484  O O   . LYS A 1 65  ? 20.244 -12.437 75.487 1.00 14.97 ? 65  LYS A O   1 
ATOM   485  C CB  . LYS A 1 65  ? 22.330 -10.302 75.239 1.00 22.21 ? 65  LYS A CB  1 
ATOM   486  C CG  . LYS A 1 65  ? 23.747 -9.887  75.427 1.00 26.07 ? 65  LYS A CG  1 
ATOM   487  C CD  . LYS A 1 65  ? 24.574 -10.872 76.215 1.00 28.64 ? 65  LYS A CD  1 
ATOM   488  C CE  . LYS A 1 65  ? 25.872 -10.174 76.627 1.00 32.11 ? 65  LYS A CE  1 
ATOM   489  N NZ  . LYS A 1 65  ? 26.744 -11.165 77.321 1.00 36.15 ? 65  LYS A NZ  1 
ATOM   490  N N   . ASN A 1 66  ? 19.742 -11.437 73.555 1.00 13.39 ? 66  ASN A N   1 
ATOM   491  C CA  . ASN A 1 66  ? 18.277 -11.647 73.590 1.00 11.03 ? 66  ASN A CA  1 
ATOM   492  C C   . ASN A 1 66  ? 17.771 -10.678 74.670 1.00 10.76 ? 66  ASN A C   1 
ATOM   493  O O   . ASN A 1 66  ? 16.868 -11.065 75.394 1.00 11.42 ? 66  ASN A O   1 
ATOM   494  C CB  . ASN A 1 66  ? 17.822 -13.057 73.757 1.00 7.86  ? 66  ASN A CB  1 
ATOM   495  C CG  . ASN A 1 66  ? 18.347 -14.028 72.736 1.00 9.18  ? 66  ASN A CG  1 
ATOM   496  O OD1 . ASN A 1 66  ? 18.244 -13.834 71.529 1.00 8.86  ? 66  ASN A OD1 1 
ATOM   497  N ND2 . ASN A 1 66  ? 18.907 -15.158 73.181 1.00 10.59 ? 66  ASN A ND2 1 
ATOM   498  N N   . LEU A 1 67  ? 18.426 -9.536  74.778 1.00 10.70 ? 67  LEU A N   1 
ATOM   499  C CA  . LEU A 1 67  ? 18.078 -8.499  75.772 1.00 10.68 ? 67  LEU A CA  1 
ATOM   500  C C   . LEU A 1 67  ? 17.656 -7.234  75.047 1.00 10.69 ? 67  LEU A C   1 
ATOM   501  O O   . LEU A 1 67  ? 18.297 -6.890  74.022 1.00 10.84 ? 67  LEU A O   1 
ATOM   502  C CB  . LEU A 1 67  ? 19.318 -8.298  76.652 1.00 9.88  ? 67  LEU A CB  1 
ATOM   503  C CG  . LEU A 1 67  ? 19.500 -8.995  77.979 1.00 9.97  ? 67  LEU A CG  1 
ATOM   504  C CD1 . LEU A 1 67  ? 20.772 -8.491  78.639 1.00 7.86  ? 67  LEU A CD1 1 
ATOM   505  C CD2 . LEU A 1 67  ? 18.347 -8.862  78.958 1.00 8.40  ? 67  LEU A CD2 1 
ATOM   506  N N   . TYR A 1 68  ? 16.609 -6.546  75.476 1.00 10.64 ? 68  TYR A N   1 
ATOM   507  C CA  . TYR A 1 68  ? 16.148 -5.305  74.811 1.00 9.19  ? 68  TYR A CA  1 
ATOM   508  C C   . TYR A 1 68  ? 16.081 -4.191  75.835 1.00 8.98  ? 68  TYR A C   1 
ATOM   509  O O   . TYR A 1 68  ? 15.751 -4.643  76.966 1.00 10.52 ? 68  TYR A O   1 
ATOM   510  C CB  . TYR A 1 68  ? 14.719 -5.431  74.157 1.00 6.72  ? 68  TYR A CB  1 
ATOM   511  C CG  . TYR A 1 68  ? 14.901 -5.864  72.720 1.00 6.61  ? 68  TYR A CG  1 
ATOM   512  C CD1 . TYR A 1 68  ? 15.361 -7.174  72.473 1.00 9.07  ? 68  TYR A CD1 1 
ATOM   513  C CD2 . TYR A 1 68  ? 14.778 -5.044  71.613 1.00 6.24  ? 68  TYR A CD2 1 
ATOM   514  C CE1 . TYR A 1 68  ? 15.632 -7.639  71.192 1.00 7.74  ? 68  TYR A CE1 1 
ATOM   515  C CE2 . TYR A 1 68  ? 15.044 -5.479  70.319 1.00 6.44  ? 68  TYR A CE2 1 
ATOM   516  C CZ  . TYR A 1 68  ? 15.460 -6.782  70.119 1.00 8.24  ? 68  TYR A CZ  1 
ATOM   517  O OH  . TYR A 1 68  ? 15.736 -7.265  68.857 1.00 10.45 ? 68  TYR A OH  1 
ATOM   518  N N   . LEU A 1 69  ? 16.311 -2.942  75.425 1.00 7.48  ? 69  LEU A N   1 
ATOM   519  C CA  . LEU A 1 69  ? 16.151 -1.856  76.401 1.00 6.77  ? 69  LEU A CA  1 
ATOM   520  C C   . LEU A 1 69  ? 14.637 -1.629  76.540 1.00 7.74  ? 69  LEU A C   1 
ATOM   521  O O   . LEU A 1 69  ? 13.845 -1.614  75.504 1.00 8.46  ? 69  LEU A O   1 
ATOM   522  C CB  . LEU A 1 69  ? 16.789 -0.558  75.943 1.00 7.43  ? 69  LEU A CB  1 
ATOM   523  C CG  . LEU A 1 69  ? 18.199 -0.406  75.368 1.00 10.18 ? 69  LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 69  ? 18.607 1.039   75.347 1.00 9.68  ? 69  LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 69  ? 19.307 -1.216  75.995 1.00 7.11  ? 69  LEU A CD2 1 
ATOM   526  N N   . SER A 1 70  ? 14.220 -1.407  77.770 1.00 7.04  ? 70  SER A N   1 
ATOM   527  C CA  . SER A 1 70  ? 12.781 -1.126  78.015 1.00 8.13  ? 70  SER A CA  1 
ATOM   528  C C   . SER A 1 70  ? 12.620 -0.059  79.113 1.00 7.78  ? 70  SER A C   1 
ATOM   529  O O   . SER A 1 70  ? 13.467 0.102   80.017 1.00 8.09  ? 70  SER A O   1 
ATOM   530  C CB  . SER A 1 70  ? 11.918 -2.361  78.253 1.00 7.19  ? 70  SER A CB  1 
ATOM   531  O OG  . SER A 1 70  ? 12.036 -2.840  79.578 1.00 12.58 ? 70  SER A OG  1 
ATOM   532  N N   . CYS A 1 71  ? 11.504 0.610   78.950 1.00 7.74  ? 71  CYS A N   1 
ATOM   533  C CA  . CYS A 1 71  ? 11.078 1.681   79.857 1.00 9.22  ? 71  CYS A CA  1 
ATOM   534  C C   . CYS A 1 71  ? 9.867  1.144   80.642 1.00 10.03 ? 71  CYS A C   1 
ATOM   535  O O   . CYS A 1 71  ? 8.862  0.721   80.061 1.00 9.08  ? 71  CYS A O   1 
ATOM   536  C CB  . CYS A 1 71  ? 10.739 2.983   79.108 1.00 8.73  ? 71  CYS A CB  1 
ATOM   537  S SG  . CYS A 1 71  ? 12.046 3.313   77.879 1.00 11.92 ? 71  CYS A SG  1 
ATOM   538  N N   . VAL A 1 72  ? 10.039 1.204   81.946 1.00 11.31 ? 72  VAL A N   1 
ATOM   539  C CA  . VAL A 1 72  ? 9.069  0.780   82.929 1.00 13.11 ? 72  VAL A CA  1 
ATOM   540  C C   . VAL A 1 72  ? 9.116  1.783   84.091 1.00 14.35 ? 72  VAL A C   1 
ATOM   541  O O   . VAL A 1 72  ? 10.140 2.423   84.305 1.00 13.72 ? 72  VAL A O   1 
ATOM   542  C CB  . VAL A 1 72  ? 9.344  -0.648  83.472 1.00 14.27 ? 72  VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 72  ? 9.600  -1.715  82.424 1.00 13.73 ? 72  VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 72  ? 10.467 -0.731  84.497 1.00 13.13 ? 72  VAL A CG2 1 
ATOM   545  N N   . LEU A 1 73  ? 8.044  1.797   84.825 1.00 17.28 ? 73  LEU A N   1 
ATOM   546  C CA  . LEU A 1 73  ? 7.935  2.632   86.043 1.00 20.94 ? 73  LEU A CA  1 
ATOM   547  C C   . LEU A 1 73  ? 8.381  1.778   87.233 1.00 24.10 ? 73  LEU A C   1 
ATOM   548  O O   . LEU A 1 73  ? 7.941  0.639   87.468 1.00 23.70 ? 73  LEU A O   1 
ATOM   549  C CB  . LEU A 1 73  ? 6.498  3.009   86.163 1.00 20.82 ? 73  LEU A CB  1 
ATOM   550  C CG  . LEU A 1 73  ? 6.041  4.303   86.800 1.00 23.24 ? 73  LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 73  ? 6.770  5.458   86.205 1.00 21.00 ? 73  LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 73  ? 4.534  4.348   86.579 1.00 22.60 ? 73  LEU A CD2 1 
ATOM   553  N N   . LYS A 1 74  ? 9.314  2.283   87.985 1.00 28.53 ? 74  LYS A N   1 
ATOM   554  C CA  . LYS A 1 74  ? 9.911  1.705   89.171 1.00 34.27 ? 74  LYS A CA  1 
ATOM   555  C C   . LYS A 1 74  ? 10.189 2.913   90.099 1.00 38.15 ? 74  LYS A C   1 
ATOM   556  O O   . LYS A 1 74  ? 10.811 3.948   89.752 1.00 37.53 ? 74  LYS A O   1 
ATOM   557  C CB  . LYS A 1 74  ? 11.189 0.911   89.116 1.00 37.29 ? 74  LYS A CB  1 
ATOM   558  C CG  . LYS A 1 74  ? 11.215 -0.309  88.208 1.00 41.74 ? 74  LYS A CG  1 
ATOM   559  C CD  . LYS A 1 74  ? 12.127 -1.435  88.693 1.00 44.72 ? 74  LYS A CD  1 
ATOM   560  C CE  . LYS A 1 74  ? 11.608 -2.746  88.128 1.00 47.81 ? 74  LYS A CE  1 
ATOM   561  N NZ  . LYS A 1 74  ? 12.564 -3.846  88.401 1.00 51.62 ? 74  LYS A NZ  1 
ATOM   562  N N   . ASP A 1 75  ? 9.611  2.684   91.284 1.00 42.48 ? 75  ASP A N   1 
ATOM   563  C CA  . ASP A 1 75  ? 9.725  3.696   92.363 1.00 45.91 ? 75  ASP A CA  1 
ATOM   564  C C   . ASP A 1 75  ? 9.173  5.006   91.801 1.00 44.22 ? 75  ASP A C   1 
ATOM   565  O O   . ASP A 1 75  ? 9.692  6.107   92.020 1.00 44.35 ? 75  ASP A O   1 
ATOM   566  C CB  . ASP A 1 75  ? 11.156 3.787   92.864 1.00 55.80 ? 75  ASP A CB  1 
ATOM   567  C CG  . ASP A 1 75  ? 11.612 2.689   93.786 1.00 63.03 ? 75  ASP A CG  1 
ATOM   568  O OD1 . ASP A 1 75  ? 11.408 1.482   93.681 1.00 66.57 ? 75  ASP A OD1 1 
ATOM   569  O OD2 . ASP A 1 75  ? 12.313 3.195   94.798 1.00 67.72 ? 75  ASP A OD2 1 
ATOM   570  N N   . ASP A 1 76  ? 8.110  4.812   91.025 1.00 41.94 ? 76  ASP A N   1 
ATOM   571  C CA  . ASP A 1 76  ? 7.380  5.939   90.416 1.00 39.70 ? 76  ASP A CA  1 
ATOM   572  C C   . ASP A 1 76  ? 8.142  6.890   89.510 1.00 36.06 ? 76  ASP A C   1 
ATOM   573  O O   . ASP A 1 76  ? 7.802  8.088   89.356 1.00 36.41 ? 76  ASP A O   1 
ATOM   574  C CB  . ASP A 1 76  ? 6.725  6.706   91.579 1.00 43.95 ? 76  ASP A CB  1 
ATOM   575  C CG  . ASP A 1 76  ? 6.134  5.843   92.674 1.00 46.80 ? 76  ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 76  ? 5.243  5.057   92.462 1.00 48.52 ? 76  ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 76  ? 6.702  6.003   93.858 1.00 47.84 ? 76  ASP A OD2 1 
ATOM   578  N N   . LYS A 1 77  ? 9.175  6.416   88.866 1.00 31.76 ? 77  LYS A N   1 
ATOM   579  C CA  . LYS A 1 77  ? 9.993  7.190   87.926 1.00 27.73 ? 77  LYS A CA  1 
ATOM   580  C C   . LYS A 1 77  ? 10.183 6.276   86.725 1.00 22.96 ? 77  LYS A C   1 
ATOM   581  O O   . LYS A 1 77  ? 10.389 5.074   86.955 1.00 21.91 ? 77  LYS A O   1 
ATOM   582  C CB  . LYS A 1 77  ? 11.319 7.453   88.630 1.00 33.50 ? 77  LYS A CB  1 
ATOM   583  C CG  . LYS A 1 77  ? 12.424 8.179   87.844 1.00 37.13 ? 77  LYS A CG  1 
ATOM   584  C CD  . LYS A 1 77  ? 12.667 9.626   88.210 1.00 40.11 ? 77  LYS A CD  1 
ATOM   585  C CE  . LYS A 1 77  ? 11.402 10.475  88.337 1.00 43.01 ? 77  LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 77  ? 11.631 11.755  89.039 1.00 43.08 ? 77  LYS A NZ  1 
ATOM   587  N N   . PRO A 1 78  ? 10.110 6.816   85.533 1.00 19.10 ? 78  PRO A N   1 
ATOM   588  C CA  . PRO A 1 78  ? 10.346 6.104   84.254 1.00 17.48 ? 78  PRO A CA  1 
ATOM   589  C C   . PRO A 1 78  ? 11.816 5.633   84.306 1.00 16.82 ? 78  PRO A C   1 
ATOM   590  O O   . PRO A 1 78  ? 12.762 6.421   84.556 1.00 15.13 ? 78  PRO A O   1 
ATOM   591  C CB  . PRO A 1 78  ? 10.118 7.206   83.207 1.00 16.90 ? 78  PRO A CB  1 
ATOM   592  C CG  . PRO A 1 78  ? 9.187  8.199   83.879 1.00 15.93 ? 78  PRO A CG  1 
ATOM   593  C CD  . PRO A 1 78  ? 9.876  8.267   85.257 1.00 16.69 ? 78  PRO A CD  1 
ATOM   594  N N   . THR A 1 79  ? 11.991 4.332   84.180 1.00 16.50 ? 79  THR A N   1 
ATOM   595  C CA  . THR A 1 79  ? 13.291 3.649   84.299 1.00 15.86 ? 79  THR A CA  1 
ATOM   596  C C   . THR A 1 79  ? 13.726 2.682   83.188 1.00 13.82 ? 79  THR A C   1 
ATOM   597  O O   . THR A 1 79  ? 12.913 1.846   82.716 1.00 13.48 ? 79  THR A O   1 
ATOM   598  C CB  . THR A 1 79  ? 13.106 2.785   85.588 1.00 17.74 ? 79  THR A CB  1 
ATOM   599  O OG1 . THR A 1 79  ? 12.924 3.732   86.617 1.00 22.57 ? 79  THR A OG1 1 
ATOM   600  C CG2 . THR A 1 79  ? 14.218 1.815   85.911 1.00 19.67 ? 79  THR A CG2 1 
ATOM   601  N N   . LEU A 1 80  ? 15.012 2.798   82.877 1.00 10.95 ? 80  LEU A N   1 
ATOM   602  C CA  . LEU A 1 80  ? 15.584 1.921   81.847 1.00 9.89  ? 80  LEU A CA  1 
ATOM   603  C C   . LEU A 1 80  ? 15.964 0.575   82.476 1.00 8.54  ? 80  LEU A C   1 
ATOM   604  O O   . LEU A 1 80  ? 16.696 0.638   83.464 1.00 8.44  ? 80  LEU A O   1 
ATOM   605  C CB  . LEU A 1 80  ? 16.853 2.544   81.306 1.00 10.41 ? 80  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 80  ? 17.616 2.038   80.112 1.00 11.83 ? 80  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 80  ? 16.709 2.083   78.891 1.00 11.80 ? 80  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 80  ? 18.804 2.936   79.805 1.00 10.56 ? 80  LEU A CD2 1 
ATOM   609  N N   . GLN A 1 81  ? 15.523 -0.529  81.944 1.00 8.39  ? 81  GLN A N   1 
ATOM   610  C CA  . GLN A 1 81  ? 15.874 -1.860  82.385 1.00 9.39  ? 81  GLN A CA  1 
ATOM   611  C C   . GLN A 1 81  ? 16.173 -2.634  81.103 1.00 9.08  ? 81  GLN A C   1 
ATOM   612  O O   . GLN A 1 81  ? 15.799 -2.132  80.068 1.00 8.57  ? 81  GLN A O   1 
ATOM   613  C CB  . GLN A 1 81  ? 14.894 -2.601  83.249 1.00 11.79 ? 81  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 81  ? 13.674 -3.111  82.550 1.00 19.49 ? 81  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 81  ? 12.676 -3.837  83.442 1.00 24.39 ? 81  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 81  ? 11.909 -4.613  82.826 1.00 30.15 ? 81  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 81  ? 12.633 -3.636  84.758 1.00 22.14 ? 81  GLN A NE2 1 
ATOM   618  N N   . LEU A 1 82  ? 16.826 -3.756  81.188 1.00 9.87  ? 82  LEU A N   1 
ATOM   619  C CA  . LEU A 1 82  ? 17.185 -4.587  80.010 1.00 9.98  ? 82  LEU A CA  1 
ATOM   620  C C   . LEU A 1 82  ? 16.359 -5.839  80.256 1.00 10.29 ? 82  LEU A C   1 
ATOM   621  O O   . LEU A 1 82  ? 16.617 -6.547  81.270 1.00 10.49 ? 82  LEU A O   1 
ATOM   622  C CB  . LEU A 1 82  ? 18.682 -4.887  80.048 1.00 9.75  ? 82  LEU A CB  1 
ATOM   623  C CG  . LEU A 1 82  ? 19.702 -4.013  79.396 1.00 10.51 ? 82  LEU A CG  1 
ATOM   624  C CD1 . LEU A 1 82  ? 19.641 -2.617  79.956 1.00 16.10 ? 82  LEU A CD1 1 
ATOM   625  C CD2 . LEU A 1 82  ? 21.134 -4.491  79.715 1.00 14.51 ? 82  LEU A CD2 1 
ATOM   626  N N   . GLU A 1 83  ? 15.395 -6.051  79.389 1.00 10.44 ? 83  GLU A N   1 
ATOM   627  C CA  . GLU A 1 83  ? 14.520 -7.202  79.615 1.00 9.57  ? 83  GLU A CA  1 
ATOM   628  C C   . GLU A 1 83  ? 14.829 -8.342  78.695 1.00 9.80  ? 83  GLU A C   1 
ATOM   629  O O   . GLU A 1 83  ? 15.272 -8.143  77.526 1.00 11.65 ? 83  GLU A O   1 
ATOM   630  C CB  . GLU A 1 83  ? 13.144 -6.662  79.258 1.00 12.77 ? 83  GLU A CB  1 
ATOM   631  C CG  . GLU A 1 83  ? 11.917 -7.393  79.853 1.00 15.63 ? 83  GLU A CG  1 
ATOM   632  C CD  . GLU A 1 83  ? 10.635 -6.692  79.498 1.00 16.72 ? 83  GLU A CD  1 
ATOM   633  O OE1 . GLU A 1 83  ? 10.627 -5.427  79.872 1.00 17.28 ? 83  GLU A OE1 1 
ATOM   634  O OE2 . GLU A 1 83  ? 9.750  -7.272  78.922 1.00 19.75 ? 83  GLU A OE2 1 
ATOM   635  N N   . SER A 1 84  ? 14.497 -9.530  79.166 1.00 8.58  ? 84  SER A N   1 
ATOM   636  C CA  . SER A 1 84  ? 14.674 -10.767 78.407 1.00 7.76  ? 84  SER A CA  1 
ATOM   637  C C   . SER A 1 84  ? 13.544 -10.896 77.418 1.00 9.30  ? 84  SER A C   1 
ATOM   638  O O   . SER A 1 84  ? 12.405 -10.516 77.730 1.00 10.69 ? 84  SER A O   1 
ATOM   639  C CB  . SER A 1 84  ? 14.589 -11.907 79.389 1.00 6.66  ? 84  SER A CB  1 
ATOM   640  O OG  . SER A 1 84  ? 15.717 -11.840 80.234 1.00 10.59 ? 84  SER A OG  1 
ATOM   641  N N   . VAL A 1 85  ? 13.854 -11.477 76.269 1.00 11.26 ? 85  VAL A N   1 
ATOM   642  C CA  . VAL A 1 85  ? 12.866 -11.725 75.217 1.00 12.87 ? 85  VAL A CA  1 
ATOM   643  C C   . VAL A 1 85  ? 13.229 -13.107 74.634 1.00 16.25 ? 85  VAL A C   1 
ATOM   644  O O   . VAL A 1 85  ? 14.366 -13.583 74.801 1.00 15.94 ? 85  VAL A O   1 
ATOM   645  C CB  . VAL A 1 85  ? 12.933 -10.624 74.151 1.00 10.17 ? 85  VAL A CB  1 
ATOM   646  C CG1 . VAL A 1 85  ? 12.583 -9.270  74.728 1.00 12.01 ? 85  VAL A CG1 1 
ATOM   647  C CG2 . VAL A 1 85  ? 14.275 -10.642 73.410 1.00 7.50  ? 85  VAL A CG2 1 
ATOM   648  N N   . ASP A 1 86  ? 12.259 -13.666 73.950 1.00 19.83 ? 86  ASP A N   1 
ATOM   649  C CA  . ASP A 1 86  ? 12.420 -14.969 73.291 1.00 23.13 ? 86  ASP A CA  1 
ATOM   650  C C   . ASP A 1 86  ? 12.941 -14.708 71.885 1.00 23.48 ? 86  ASP A C   1 
ATOM   651  O O   . ASP A 1 86  ? 12.260 -13.999 71.137 1.00 21.51 ? 86  ASP A O   1 
ATOM   652  C CB  . ASP A 1 86  ? 11.091 -15.713 73.335 1.00 29.80 ? 86  ASP A CB  1 
ATOM   653  C CG  . ASP A 1 86  ? 11.071 -16.981 72.524 1.00 35.35 ? 86  ASP A CG  1 
ATOM   654  O OD1 . ASP A 1 86  ? 12.193 -17.611 72.290 1.00 37.17 ? 86  ASP A OD1 1 
ATOM   655  O OD2 . ASP A 1 86  ? 9.982  -17.332 72.091 1.00 39.88 ? 86  ASP A OD2 1 
ATOM   656  N N   . PRO A 1 87  ? 14.075 -15.306 71.560 1.00 24.59 ? 87  PRO A N   1 
ATOM   657  C CA  . PRO A 1 87  ? 14.730 -15.167 70.273 1.00 26.22 ? 87  PRO A CA  1 
ATOM   658  C C   . PRO A 1 87  ? 13.830 -15.577 69.105 1.00 29.31 ? 87  PRO A C   1 
ATOM   659  O O   . PRO A 1 87  ? 14.007 -15.060 67.970 1.00 29.20 ? 87  PRO A O   1 
ATOM   660  C CB  . PRO A 1 87  ? 15.983 -16.029 70.359 1.00 25.11 ? 87  PRO A CB  1 
ATOM   661  C CG  . PRO A 1 87  ? 15.857 -16.925 71.585 1.00 25.14 ? 87  PRO A CG  1 
ATOM   662  C CD  . PRO A 1 87  ? 14.882 -16.174 72.485 1.00 25.22 ? 87  PRO A CD  1 
ATOM   663  N N   . LYS A 1 88  ? 12.890 -16.467 69.399 1.00 32.91 ? 88  LYS A N   1 
ATOM   664  C CA  . LYS A 1 88  ? 11.980 -16.944 68.354 1.00 37.07 ? 88  LYS A CA  1 
ATOM   665  C C   . LYS A 1 88  ? 11.064 -15.800 67.930 1.00 37.32 ? 88  LYS A C   1 
ATOM   666  O O   . LYS A 1 88  ? 10.837 -15.623 66.729 1.00 38.47 ? 88  LYS A O   1 
ATOM   667  C CB  . LYS A 1 88  ? 11.088 -18.120 68.738 1.00 43.29 ? 88  LYS A CB  1 
ATOM   668  C CG  . LYS A 1 88  ? 11.767 -19.323 69.380 1.00 50.49 ? 88  LYS A CG  1 
ATOM   669  C CD  . LYS A 1 88  ? 10.785 -20.158 70.197 1.00 57.13 ? 88  LYS A CD  1 
ATOM   670  C CE  . LYS A 1 88  ? 11.246 -21.565 70.534 1.00 60.63 ? 88  LYS A CE  1 
ATOM   671  N NZ  . LYS A 1 88  ? 10.140 -22.464 70.991 1.00 62.35 ? 88  LYS A NZ  1 
ATOM   672  N N   . ASN A 1 89  ? 10.571 -15.074 68.905 1.00 37.57 ? 89  ASN A N   1 
ATOM   673  C CA  . ASN A 1 89  ? 9.623  -13.978 68.694 1.00 37.71 ? 89  ASN A CA  1 
ATOM   674  C C   . ASN A 1 89  ? 10.188 -12.606 68.378 1.00 37.02 ? 89  ASN A C   1 
ATOM   675  O O   . ASN A 1 89  ? 9.410  -11.814 67.790 1.00 36.49 ? 89  ASN A O   1 
ATOM   676  C CB  . ASN A 1 89  ? 8.642  -13.912 69.875 1.00 40.77 ? 89  ASN A CB  1 
ATOM   677  C CG  . ASN A 1 89  ? 7.696  -15.099 69.948 1.00 42.74 ? 89  ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 89  ? 8.111  -16.203 70.296 1.00 43.15 ? 89  ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 89  ? 6.404  -14.945 69.666 1.00 45.11 ? 89  ASN A ND2 1 
ATOM   680  N N   . TYR A 1 90  ? 11.438 -12.384 68.740 1.00 35.60 ? 90  TYR A N   1 
ATOM   681  C CA  . TYR A 1 90  ? 12.084 -11.081 68.502 1.00 34.10 ? 90  TYR A CA  1 
ATOM   682  C C   . TYR A 1 90  ? 13.302 -11.079 67.588 1.00 33.34 ? 90  TYR A C   1 
ATOM   683  O O   . TYR A 1 90  ? 13.988 -12.093 67.472 1.00 33.65 ? 90  TYR A O   1 
ATOM   684  C CB  . TYR A 1 90  ? 12.484 -10.500 69.881 1.00 31.88 ? 90  TYR A CB  1 
ATOM   685  C CG  . TYR A 1 90  ? 11.296 -10.019 70.662 1.00 29.93 ? 90  TYR A CG  1 
ATOM   686  C CD1 . TYR A 1 90  ? 10.524 -10.940 71.367 1.00 30.02 ? 90  TYR A CD1 1 
ATOM   687  C CD2 . TYR A 1 90  ? 10.925 -8.675  70.692 1.00 29.30 ? 90  TYR A CD2 1 
ATOM   688  C CE1 . TYR A 1 90  ? 9.407  -10.536 72.123 1.00 28.64 ? 90  TYR A CE1 1 
ATOM   689  C CE2 . TYR A 1 90  ? 9.817  -8.265  71.420 1.00 28.48 ? 90  TYR A CE2 1 
ATOM   690  C CZ  . TYR A 1 90  ? 9.083  -9.192  72.140 1.00 28.09 ? 90  TYR A CZ  1 
ATOM   691  O OH  . TYR A 1 90  ? 7.989  -8.847  72.868 1.00 29.51 ? 90  TYR A OH  1 
ATOM   692  N N   . PRO A 1 91  ? 13.608 -9.962  66.978 1.00 33.50 ? 91  PRO A N   1 
ATOM   693  C CA  . PRO A 1 91  ? 12.940 -8.669  67.071 1.00 34.92 ? 91  PRO A CA  1 
ATOM   694  C C   . PRO A 1 91  ? 11.536 -8.779  66.515 1.00 38.20 ? 91  PRO A C   1 
ATOM   695  O O   . PRO A 1 91  ? 10.487 -8.435  67.075 1.00 37.58 ? 91  PRO A O   1 
ATOM   696  C CB  . PRO A 1 91  ? 13.773 -7.693  66.206 1.00 33.16 ? 91  PRO A CB  1 
ATOM   697  C CG  . PRO A 1 91  ? 14.615 -8.557  65.274 1.00 31.82 ? 91  PRO A CG  1 
ATOM   698  C CD  . PRO A 1 91  ? 14.808 -9.845  66.077 1.00 32.95 ? 91  PRO A CD  1 
ATOM   699  N N   . LYS A 1 92  ? 11.578 -9.321  65.311 1.00 43.13 ? 92  LYS A N   1 
ATOM   700  C CA  . LYS A 1 92  ? 10.430 -9.524  64.436 1.00 48.82 ? 92  LYS A CA  1 
ATOM   701  C C   . LYS A 1 92  ? 9.508  -8.318  64.730 1.00 50.19 ? 92  LYS A C   1 
ATOM   702  O O   . LYS A 1 92  ? 9.833  -7.110  64.973 1.00 49.80 ? 92  LYS A O   1 
ATOM   703  C CB  . LYS A 1 92  ? 9.893  -10.943 64.488 1.00 54.74 ? 92  LYS A CB  1 
ATOM   704  C CG  . LYS A 1 92  ? 9.174  -11.349 63.188 1.00 60.00 ? 92  LYS A CG  1 
ATOM   705  C CD  . LYS A 1 92  ? 7.728  -10.890 63.122 1.00 63.90 ? 92  LYS A CD  1 
ATOM   706  C CE  . LYS A 1 92  ? 7.304  -10.255 61.821 1.00 65.11 ? 92  LYS A CE  1 
ATOM   707  N NZ  . LYS A 1 92  ? 8.072  -9.016  61.550 1.00 65.76 ? 92  LYS A NZ  1 
ATOM   708  N N   . LYS A 1 93  ? 8.253  -8.671  64.731 1.00 50.93 ? 93  LYS A N   1 
ATOM   709  C CA  . LYS A 1 93  ? 7.145  -7.786  65.043 1.00 50.28 ? 93  LYS A CA  1 
ATOM   710  C C   . LYS A 1 93  ? 7.359  -6.364  64.508 1.00 50.06 ? 93  LYS A C   1 
ATOM   711  O O   . LYS A 1 93  ? 8.013  -5.738  63.667 1.00 49.93 ? 93  LYS A O   1 
ATOM   712  C CB  . LYS A 1 93  ? 7.201  -7.836  66.610 1.00 47.38 ? 93  LYS A CB  1 
ATOM   713  C CG  . LYS A 1 93  ? 7.236  -9.235  67.213 1.00 39.73 ? 93  LYS A CG  1 
ATOM   714  C CD  . LYS A 1 93  ? 7.099  -9.237  68.707 1.00 33.83 ? 93  LYS A CD  1 
ATOM   715  C CE  . LYS A 1 93  ? 5.788  -8.770  69.248 1.00 30.58 ? 93  LYS A CE  1 
ATOM   716  N NZ  . LYS A 1 93  ? 5.601  -9.415  70.569 1.00 26.61 ? 93  LYS A NZ  1 
ATOM   717  N N   . LYS A 1 94  ? 6.577  -5.535  65.120 1.00 48.61 ? 94  LYS A N   1 
ATOM   718  C CA  . LYS A 1 94  ? 6.044  -4.279  65.458 1.00 45.32 ? 94  LYS A CA  1 
ATOM   719  C C   . LYS A 1 94  ? 5.745  -4.694  66.939 1.00 40.65 ? 94  LYS A C   1 
ATOM   720  O O   . LYS A 1 94  ? 4.903  -5.537  67.216 1.00 39.96 ? 94  LYS A O   1 
ATOM   721  C CB  . LYS A 1 94  ? 4.897  -3.796  64.677 1.00 52.93 ? 94  LYS A CB  1 
ATOM   722  C CG  . LYS A 1 94  ? 3.545  -4.464  64.559 1.00 60.05 ? 94  LYS A CG  1 
ATOM   723  C CD  . LYS A 1 94  ? 2.842  -4.250  63.230 1.00 67.88 ? 94  LYS A CD  1 
ATOM   724  C CE  . LYS A 1 94  ? 2.732  -2.846  62.665 1.00 72.75 ? 94  LYS A CE  1 
ATOM   725  N NZ  . LYS A 1 94  ? 2.163  -1.862  63.628 1.00 74.59 ? 94  LYS A NZ  1 
ATOM   726  N N   . MET A 1 95  ? 6.548  -4.174  67.844 1.00 35.40 ? 95  MET A N   1 
ATOM   727  C CA  . MET A 1 95  ? 6.578  -4.399  69.251 1.00 29.82 ? 95  MET A CA  1 
ATOM   728  C C   . MET A 1 95  ? 5.982  -3.461  70.282 1.00 27.24 ? 95  MET A C   1 
ATOM   729  O O   . MET A 1 95  ? 5.490  -2.352  70.070 1.00 27.38 ? 95  MET A O   1 
ATOM   730  C CB  . MET A 1 95  ? 7.965  -4.771  69.729 1.00 29.28 ? 95  MET A CB  1 
ATOM   731  C CG  . MET A 1 95  ? 9.242  -4.027  69.547 1.00 22.50 ? 95  MET A CG  1 
ATOM   732  S SD  . MET A 1 95  ? 10.386 -5.470  69.531 1.00 17.91 ? 95  MET A SD  1 
ATOM   733  C CE  . MET A 1 95  ? 10.486 -5.409  67.736 1.00 16.96 ? 95  MET A CE  1 
ATOM   734  N N   . GLU A 1 96  ? 5.955  -3.990  71.495 1.00 24.36 ? 96  GLU A N   1 
ATOM   735  C CA  . GLU A 1 96  ? 5.386  -3.368  72.657 1.00 23.63 ? 96  GLU A CA  1 
ATOM   736  C C   . GLU A 1 96  ? 6.139  -2.069  72.955 1.00 23.35 ? 96  GLU A C   1 
ATOM   737  O O   . GLU A 1 96  ? 7.348  -1.878  72.868 1.00 22.19 ? 96  GLU A O   1 
ATOM   738  C CB  . GLU A 1 96  ? 5.269  -4.239  73.892 1.00 24.35 ? 96  GLU A CB  1 
ATOM   739  C CG  . GLU A 1 96  ? 4.707  -5.648  73.732 1.00 23.78 ? 96  GLU A CG  1 
ATOM   740  C CD  . GLU A 1 96  ? 5.535  -6.617  72.940 1.00 23.17 ? 96  GLU A CD  1 
ATOM   741  O OE1 . GLU A 1 96  ? 6.723  -6.398  72.740 1.00 23.46 ? 96  GLU A OE1 1 
ATOM   742  O OE2 . GLU A 1 96  ? 4.863  -7.617  72.465 1.00 22.00 ? 96  GLU A OE2 1 
ATOM   743  N N   . LYS A 1 97  ? 5.289  -1.152  73.368 1.00 22.93 ? 97  LYS A N   1 
ATOM   744  C CA  . LYS A 1 97  ? 5.588  0.213   73.728 1.00 22.05 ? 97  LYS A CA  1 
ATOM   745  C C   . LYS A 1 97  ? 6.783  0.422   74.624 1.00 18.59 ? 97  LYS A C   1 
ATOM   746  O O   . LYS A 1 97  ? 7.574  1.339   74.351 1.00 19.61 ? 97  LYS A O   1 
ATOM   747  C CB  . LYS A 1 97  ? 4.332  0.796   74.410 1.00 26.47 ? 97  LYS A CB  1 
ATOM   748  C CG  . LYS A 1 97  ? 3.410  1.387   73.336 1.00 33.22 ? 97  LYS A CG  1 
ATOM   749  C CD  . LYS A 1 97  ? 2.602  2.567   73.899 1.00 34.94 ? 97  LYS A CD  1 
ATOM   750  C CE  . LYS A 1 97  ? 2.868  3.792   73.028 1.00 39.39 ? 97  LYS A CE  1 
ATOM   751  N NZ  . LYS A 1 97  ? 2.799  3.436   71.589 1.00 41.27 ? 97  LYS A NZ  1 
ATOM   752  N N   . ARG A 1 98  ? 6.899  -0.364  75.663 1.00 14.32 ? 98  ARG A N   1 
ATOM   753  C CA  . ARG A 1 98  ? 8.014  -0.216  76.598 1.00 11.07 ? 98  ARG A CA  1 
ATOM   754  C C   . ARG A 1 98  ? 9.372  -0.333  75.886 1.00 8.85  ? 98  ARG A C   1 
ATOM   755  O O   . ARG A 1 98  ? 10.378 0.229   76.472 1.00 9.04  ? 98  ARG A O   1 
ATOM   756  C CB  . ARG A 1 98  ? 7.923  -1.170  77.777 1.00 9.59  ? 98  ARG A CB  1 
ATOM   757  C CG  . ARG A 1 98  ? 7.692  -2.623  77.377 1.00 7.96  ? 98  ARG A CG  1 
ATOM   758  C CD  . ARG A 1 98  ? 7.483  -3.397  78.640 1.00 9.54  ? 98  ARG A CD  1 
ATOM   759  N NE  . ARG A 1 98  ? 7.692  -4.827  78.439 1.00 13.39 ? 98  ARG A NE  1 
ATOM   760  C CZ  . ARG A 1 98  ? 6.765  -5.624  77.841 1.00 15.53 ? 98  ARG A CZ  1 
ATOM   761  N NH1 . ARG A 1 98  ? 5.584  -5.153  77.406 1.00 15.72 ? 98  ARG A NH1 1 
ATOM   762  N NH2 . ARG A 1 98  ? 7.061  -6.924  77.669 1.00 14.63 ? 98  ARG A NH2 1 
ATOM   763  N N   . PHE A 1 99  ? 9.371  -0.998  74.746 1.00 5.70  ? 99  PHE A N   1 
ATOM   764  C CA  . PHE A 1 99  ? 10.611 -1.165  73.995 1.00 5.46  ? 99  PHE A CA  1 
ATOM   765  C C   . PHE A 1 99  ? 10.808 -0.133  72.902 1.00 6.36  ? 99  PHE A C   1 
ATOM   766  O O   . PHE A 1 99  ? 11.949 -0.121  72.355 1.00 8.94  ? 99  PHE A O   1 
ATOM   767  C CB  . PHE A 1 99  ? 10.769 -2.560  73.386 1.00 3.60  ? 99  PHE A CB  1 
ATOM   768  C CG  . PHE A 1 99  ? 10.539 -3.839  74.133 1.00 5.23  ? 99  PHE A CG  1 
ATOM   769  C CD1 . PHE A 1 99  ? 11.468 -4.345  75.048 1.00 5.47  ? 99  PHE A CD1 1 
ATOM   770  C CD2 . PHE A 1 99  ? 9.364  -4.580  73.904 1.00 4.97  ? 99  PHE A CD2 1 
ATOM   771  C CE1 . PHE A 1 99  ? 11.243 -5.528  75.739 1.00 6.11  ? 99  PHE A CE1 1 
ATOM   772  C CE2 . PHE A 1 99  ? 9.121  -5.780  74.577 1.00 3.16  ? 99  PHE A CE2 1 
ATOM   773  C CZ  . PHE A 1 99  ? 10.028 -6.250  75.491 1.00 4.43  ? 99  PHE A CZ  1 
ATOM   774  N N   . VAL A 1 100 ? 9.845  0.697   72.516 1.00 6.08  ? 100 VAL A N   1 
ATOM   775  C CA  . VAL A 1 100 ? 9.998  1.647   71.429 1.00 5.91  ? 100 VAL A CA  1 
ATOM   776  C C   . VAL A 1 100 ? 10.588 2.986   71.798 1.00 6.06  ? 100 VAL A C   1 
ATOM   777  O O   . VAL A 1 100 ? 10.076 3.585   72.745 1.00 5.95  ? 100 VAL A O   1 
ATOM   778  C CB  . VAL A 1 100 ? 8.632  1.855   70.685 1.00 7.81  ? 100 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 100 ? 8.703  2.885   69.556 1.00 4.70  ? 100 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 100 ? 8.013  0.501   70.249 1.00 6.69  ? 100 VAL A CG2 1 
ATOM   781  N N   . PHE A 1 101 ? 11.553 3.418   71.003 1.00 5.91  ? 101 PHE A N   1 
ATOM   782  C CA  . PHE A 1 101 ? 12.181 4.722   71.230 1.00 6.98  ? 101 PHE A CA  1 
ATOM   783  C C   . PHE A 1 101 ? 11.993 5.525   69.947 1.00 8.56  ? 101 PHE A C   1 
ATOM   784  O O   . PHE A 1 101 ? 12.099 4.913   68.856 1.00 10.59 ? 101 PHE A O   1 
ATOM   785  C CB  . PHE A 1 101 ? 13.661 4.716   71.602 1.00 6.96  ? 101 PHE A CB  1 
ATOM   786  C CG  . PHE A 1 101 ? 13.991 4.073   72.923 1.00 6.56  ? 101 PHE A CG  1 
ATOM   787  C CD1 . PHE A 1 101 ? 14.126 2.687   72.994 1.00 7.46  ? 101 PHE A CD1 1 
ATOM   788  C CD2 . PHE A 1 101 ? 14.130 4.817   74.089 1.00 4.33  ? 101 PHE A CD2 1 
ATOM   789  C CE1 . PHE A 1 101 ? 14.389 2.017   74.171 1.00 6.11  ? 101 PHE A CE1 1 
ATOM   790  C CE2 . PHE A 1 101 ? 14.430 4.180   75.292 1.00 3.04  ? 101 PHE A CE2 1 
ATOM   791  C CZ  . PHE A 1 101 ? 14.528 2.796   75.327 1.00 5.28  ? 101 PHE A CZ  1 
ATOM   792  N N   . ASN A 1 102 ? 11.747 6.790   70.070 1.00 9.27  ? 102 ASN A N   1 
ATOM   793  C CA  . ASN A 1 102 ? 11.608 7.587   68.825 1.00 11.90 ? 102 ASN A CA  1 
ATOM   794  C C   . ASN A 1 102 ? 13.069 8.064   68.620 1.00 12.39 ? 102 ASN A C   1 
ATOM   795  O O   . ASN A 1 102 ? 13.591 8.691   69.572 1.00 13.10 ? 102 ASN A O   1 
ATOM   796  C CB  . ASN A 1 102 ? 10.579 8.701   68.985 1.00 14.23 ? 102 ASN A CB  1 
ATOM   797  C CG  . ASN A 1 102 ? 9.168  8.148   69.070 1.00 16.88 ? 102 ASN A CG  1 
ATOM   798  O OD1 . ASN A 1 102 ? 8.693  7.480   68.141 1.00 19.82 ? 102 ASN A OD1 1 
ATOM   799  N ND2 . ASN A 1 102 ? 8.550  8.444   70.201 1.00 19.79 ? 102 ASN A ND2 1 
ATOM   800  N N   . LYS A 1 103 ? 13.620 7.741   67.488 1.00 11.75 ? 103 LYS A N   1 
ATOM   801  C CA  . LYS A 1 103 ? 14.984 8.172   67.163 1.00 13.31 ? 103 LYS A CA  1 
ATOM   802  C C   . LYS A 1 103 ? 14.805 9.536   66.463 1.00 15.18 ? 103 LYS A C   1 
ATOM   803  O O   . LYS A 1 103 ? 14.272 9.574   65.323 1.00 15.04 ? 103 LYS A O   1 
ATOM   804  C CB  . LYS A 1 103 ? 15.708 7.155   66.329 1.00 11.55 ? 103 LYS A CB  1 
ATOM   805  C CG  . LYS A 1 103 ? 17.107 7.593   65.811 1.00 10.51 ? 103 LYS A CG  1 
ATOM   806  C CD  . LYS A 1 103 ? 17.683 6.530   64.917 1.00 8.81  ? 103 LYS A CD  1 
ATOM   807  C CE  . LYS A 1 103 ? 17.033 6.284   63.580 1.00 7.21  ? 103 LYS A CE  1 
ATOM   808  N NZ  . LYS A 1 103 ? 17.721 7.257   62.625 1.00 8.35  ? 103 LYS A NZ  1 
ATOM   809  N N   . ILE A 1 104 ? 15.237 10.584  67.163 1.00 16.54 ? 104 ILE A N   1 
ATOM   810  C CA  . ILE A 1 104 ? 15.070 11.962  66.642 1.00 19.28 ? 104 ILE A CA  1 
ATOM   811  C C   . ILE A 1 104 ? 16.371 12.442  66.054 1.00 23.42 ? 104 ILE A C   1 
ATOM   812  O O   . ILE A 1 104 ? 17.345 12.446  66.828 1.00 24.14 ? 104 ILE A O   1 
ATOM   813  C CB  . ILE A 1 104 ? 14.575 12.866  67.760 1.00 17.30 ? 104 ILE A CB  1 
ATOM   814  C CG1 . ILE A 1 104 ? 13.200 12.379  68.233 1.00 17.89 ? 104 ILE A CG1 1 
ATOM   815  C CG2 . ILE A 1 104 ? 14.417 14.359  67.434 1.00 14.80 ? 104 ILE A CG2 1 
ATOM   816  C CD1 . ILE A 1 104 ? 12.910 12.680  69.727 1.00 17.57 ? 104 ILE A CD1 1 
ATOM   817  N N   . GLU A 1 105 ? 16.409 12.794  64.791 1.00 29.33 ? 105 GLU A N   1 
ATOM   818  C CA  . GLU A 1 105 ? 17.649 13.264  64.142 1.00 36.68 ? 105 GLU A CA  1 
ATOM   819  C C   . GLU A 1 105 ? 17.696 14.801  64.209 1.00 40.70 ? 105 GLU A C   1 
ATOM   820  O O   . GLU A 1 105 ? 16.688 15.507  64.091 1.00 40.96 ? 105 GLU A O   1 
ATOM   821  C CB  . GLU A 1 105 ? 17.957 13.045  62.695 1.00 39.47 ? 105 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 105 ? 18.210 11.669  62.103 1.00 46.08 ? 105 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 105 ? 18.430 11.833  60.602 1.00 49.36 ? 105 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 105 ? 19.564 12.482  60.413 1.00 51.24 ? 105 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 105 ? 17.650 11.439  59.757 1.00 50.04 ? 105 GLU A OE2 1 
ATOM   826  N N   . ILE A 1 106 ? 18.923 15.222  64.367 1.00 45.95 ? 106 ILE A N   1 
ATOM   827  C CA  . ILE A 1 106 ? 19.185 16.686  64.496 1.00 50.66 ? 106 ILE A CA  1 
ATOM   828  C C   . ILE A 1 106 ? 20.022 17.284  63.426 1.00 52.91 ? 106 ILE A C   1 
ATOM   829  O O   . ILE A 1 106 ? 20.720 16.665  62.597 1.00 55.41 ? 106 ILE A O   1 
ATOM   830  C CB  . ILE A 1 106 ? 19.536 16.835  65.973 1.00 52.75 ? 106 ILE A CB  1 
ATOM   831  C CG1 . ILE A 1 106 ? 18.204 17.217  66.612 1.00 52.46 ? 106 ILE A CG1 1 
ATOM   832  C CG2 . ILE A 1 106 ? 20.749 17.657  66.283 1.00 55.29 ? 106 ILE A CG2 1 
ATOM   833  C CD1 . ILE A 1 106 ? 18.075 17.176  68.117 1.00 51.07 ? 106 ILE A CD1 1 
ATOM   834  N N   . ASN A 1 108 ? 22.818 16.994  63.904 1.00 49.23 ? 108 ASN A N   1 
ATOM   835  C CA  . ASN A 1 108 ? 23.640 15.899  63.313 1.00 47.31 ? 108 ASN A CA  1 
ATOM   836  C C   . ASN A 1 108 ? 23.823 14.699  64.260 1.00 42.42 ? 108 ASN A C   1 
ATOM   837  O O   . ASN A 1 108 ? 24.547 13.717  64.009 1.00 40.65 ? 108 ASN A O   1 
ATOM   838  C CB  . ASN A 1 108 ? 24.948 16.655  63.055 1.00 55.93 ? 108 ASN A CB  1 
ATOM   839  C CG  . ASN A 1 108 ? 25.983 16.029  62.160 1.00 62.02 ? 108 ASN A CG  1 
ATOM   840  O OD1 . ASN A 1 108 ? 26.949 16.770  61.832 1.00 65.41 ? 108 ASN A OD1 1 
ATOM   841  N ND2 . ASN A 1 108 ? 25.846 14.764  61.763 1.00 64.93 ? 108 ASN A ND2 1 
ATOM   842  N N   . LYS A 1 109 ? 23.153 14.819  65.392 1.00 36.96 ? 109 LYS A N   1 
ATOM   843  C CA  . LYS A 1 109 ? 23.136 13.891  66.509 1.00 32.14 ? 109 LYS A CA  1 
ATOM   844  C C   . LYS A 1 109 ? 21.772 13.248  66.686 1.00 28.02 ? 109 LYS A C   1 
ATOM   845  O O   . LYS A 1 109 ? 20.801 13.655  65.998 1.00 28.70 ? 109 LYS A O   1 
ATOM   846  C CB  . LYS A 1 109 ? 23.516 14.691  67.755 1.00 33.26 ? 109 LYS A CB  1 
ATOM   847  C CG  . LYS A 1 109 ? 24.952 15.245  67.598 1.00 36.45 ? 109 LYS A CG  1 
ATOM   848  C CD  . LYS A 1 109 ? 25.167 16.306  68.672 1.00 41.91 ? 109 LYS A CD  1 
ATOM   849  C CE  . LYS A 1 109 ? 26.290 17.275  68.350 1.00 44.80 ? 109 LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 109 ? 26.383 18.315  69.438 1.00 46.50 ? 109 LYS A NZ  1 
ATOM   851  N N   . LEU A 1 110 ? 21.690 12.250  67.545 1.00 22.49 ? 110 LEU A N   1 
ATOM   852  C CA  . LEU A 1 110 ? 20.415 11.570  67.783 1.00 16.51 ? 110 LEU A CA  1 
ATOM   853  C C   . LEU A 1 110 ? 20.091 11.582  69.275 1.00 14.18 ? 110 LEU A C   1 
ATOM   854  O O   . LEU A 1 110 ? 20.967 11.516  70.167 1.00 14.04 ? 110 LEU A O   1 
ATOM   855  C CB  . LEU A 1 110 ? 20.544 10.127  67.377 1.00 14.44 ? 110 LEU A CB  1 
ATOM   856  C CG  . LEU A 1 110 ? 21.112 9.746   66.034 1.00 12.57 ? 110 LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 110 ? 21.287 8.264   66.038 1.00 11.90 ? 110 LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 110 ? 20.102 10.109  64.958 1.00 15.64 ? 110 LEU A CD2 1 
ATOM   859  N N   . GLU A 1 111 ? 18.806 11.595  69.491 1.00 11.57 ? 111 GLU A N   1 
ATOM   860  C CA  . GLU A 1 111 ? 18.190 11.527  70.810 1.00 10.36 ? 111 GLU A CA  1 
ATOM   861  C C   . GLU A 1 111 ? 17.274 10.297  70.715 1.00 7.28  ? 111 GLU A C   1 
ATOM   862  O O   . GLU A 1 111 ? 16.798 9.979   69.608 1.00 5.94  ? 111 GLU A O   1 
ATOM   863  C CB  . GLU A 1 111 ? 17.225 12.678  71.061 1.00 17.96 ? 111 GLU A CB  1 
ATOM   864  C CG  . GLU A 1 111 ? 17.912 14.038  71.089 1.00 28.47 ? 111 GLU A CG  1 
ATOM   865  C CD  . GLU A 1 111 ? 17.045 15.098  71.724 1.00 33.49 ? 111 GLU A CD  1 
ATOM   866  O OE1 . GLU A 1 111 ? 16.011 15.486  71.200 1.00 37.13 ? 111 GLU A OE1 1 
ATOM   867  O OE2 . GLU A 1 111 ? 17.574 15.468  72.871 1.00 37.61 ? 111 GLU A OE2 1 
ATOM   868  N N   . PHE A 1 112 ? 17.026 9.685   71.839 1.00 4.76  ? 112 PHE A N   1 
ATOM   869  C CA  . PHE A 1 112 ? 16.172 8.510   71.854 1.00 3.99  ? 112 PHE A CA  1 
ATOM   870  C C   . PHE A 1 112 ? 15.156 8.788   72.960 1.00 4.24  ? 112 PHE A C   1 
ATOM   871  O O   . PHE A 1 112 ? 15.514 8.749   74.170 1.00 3.34  ? 112 PHE A O   1 
ATOM   872  C CB  . PHE A 1 112 ? 16.917 7.197   72.055 1.00 4.54  ? 112 PHE A CB  1 
ATOM   873  C CG  . PHE A 1 112 ? 17.815 6.817   70.945 1.00 3.50  ? 112 PHE A CG  1 
ATOM   874  C CD1 . PHE A 1 112 ? 17.299 6.070   69.884 1.00 4.33  ? 112 PHE A CD1 1 
ATOM   875  C CD2 . PHE A 1 112 ? 19.154 7.265   70.952 1.00 4.69  ? 112 PHE A CD2 1 
ATOM   876  C CE1 . PHE A 1 112 ? 18.132 5.722   68.794 1.00 4.45  ? 112 PHE A CE1 1 
ATOM   877  C CE2 . PHE A 1 112 ? 19.996 6.931   69.894 1.00 4.82  ? 112 PHE A CE2 1 
ATOM   878  C CZ  . PHE A 1 112 ? 19.491 6.150   68.819 1.00 7.00  ? 112 PHE A CZ  1 
ATOM   879  N N   . GLU A 1 113 ? 13.955 9.051   72.449 1.00 4.45  ? 113 GLU A N   1 
ATOM   880  C CA  . GLU A 1 113 ? 12.876 9.308   73.434 1.00 5.46  ? 113 GLU A CA  1 
ATOM   881  C C   . GLU A 1 113 ? 12.017 8.090   73.664 1.00 4.95  ? 113 GLU A C   1 
ATOM   882  O O   . GLU A 1 113 ? 11.685 7.359   72.715 1.00 4.40  ? 113 GLU A O   1 
ATOM   883  C CB  . GLU A 1 113 ? 11.932 10.382  72.902 1.00 9.12  ? 113 GLU A CB  1 
ATOM   884  C CG  . GLU A 1 113 ? 11.155 11.135  74.019 1.00 12.89 ? 113 GLU A CG  1 
ATOM   885  C CD  . GLU A 1 113 ? 10.099 11.986  73.357 1.00 16.35 ? 113 GLU A CD  1 
ATOM   886  O OE1 . GLU A 1 113 ? 9.895  11.948  72.149 1.00 16.31 ? 113 GLU A OE1 1 
ATOM   887  O OE2 . GLU A 1 113 ? 9.495  12.757  74.219 1.00 18.81 ? 113 GLU A OE2 1 
ATOM   888  N N   . SER A 1 114 ? 11.668 7.905   74.929 1.00 5.61  ? 114 SER A N   1 
ATOM   889  C CA  . SER A 1 114 ? 10.808 6.746   75.279 1.00 6.23  ? 114 SER A CA  1 
ATOM   890  C C   . SER A 1 114 ? 9.450  6.966   74.623 1.00 6.85  ? 114 SER A C   1 
ATOM   891  O O   . SER A 1 114 ? 8.968  8.070   74.937 1.00 9.23  ? 114 SER A O   1 
ATOM   892  C CB  . SER A 1 114 ? 10.668 6.768   76.788 1.00 7.45  ? 114 SER A CB  1 
ATOM   893  O OG  . SER A 1 114 ? 9.808  5.729   77.192 1.00 9.08  ? 114 SER A OG  1 
ATOM   894  N N   . ALA A 1 115 ? 8.871  6.110   73.819 1.00 5.78  ? 115 ALA A N   1 
ATOM   895  C CA  . ALA A 1 115 ? 7.582  6.272   73.211 1.00 5.05  ? 115 ALA A CA  1 
ATOM   896  C C   . ALA A 1 115 ? 6.522  6.065   74.323 1.00 6.44  ? 115 ALA A C   1 
ATOM   897  O O   . ALA A 1 115 ? 5.414  6.637   74.369 1.00 5.10  ? 115 ALA A O   1 
ATOM   898  C CB  . ALA A 1 115 ? 7.260  5.209   72.166 1.00 3.50  ? 115 ALA A CB  1 
ATOM   899  N N   . GLN A 1 116 ? 6.928  5.161   75.211 1.00 8.19  ? 116 GLN A N   1 
ATOM   900  C CA  . GLN A 1 116 ? 6.100  4.827   76.386 1.00 11.30 ? 116 GLN A CA  1 
ATOM   901  C C   . GLN A 1 116 ? 6.029  6.001   77.360 1.00 11.86 ? 116 GLN A C   1 
ATOM   902  O O   . GLN A 1 116 ? 4.996  6.169   78.044 1.00 13.49 ? 116 GLN A O   1 
ATOM   903  C CB  . GLN A 1 116 ? 6.503  3.509   77.075 1.00 14.27 ? 116 GLN A CB  1 
ATOM   904  C CG  . GLN A 1 116 ? 5.690  3.134   78.309 1.00 17.27 ? 116 GLN A CG  1 
ATOM   905  C CD  . GLN A 1 116 ? 4.257  2.817   78.001 1.00 22.54 ? 116 GLN A CD  1 
ATOM   906  O OE1 . GLN A 1 116 ? 4.006  1.769   77.378 1.00 25.53 ? 116 GLN A OE1 1 
ATOM   907  N NE2 . GLN A 1 116 ? 3.373  3.751   78.415 1.00 23.04 ? 116 GLN A NE2 1 
ATOM   908  N N   . PHE A 1 117 ? 7.025  6.824   77.464 1.00 12.05 ? 117 PHE A N   1 
ATOM   909  C CA  . PHE A 1 117 ? 7.052  7.970   78.386 1.00 13.09 ? 117 PHE A CA  1 
ATOM   910  C C   . PHE A 1 117 ? 7.587  9.199   77.647 1.00 12.83 ? 117 PHE A C   1 
ATOM   911  O O   . PHE A 1 117 ? 8.780  9.547   77.728 1.00 14.74 ? 117 PHE A O   1 
ATOM   912  C CB  . PHE A 1 117 ? 7.912  7.675   79.638 1.00 13.11 ? 117 PHE A CB  1 
ATOM   913  C CG  . PHE A 1 117 ? 7.459  6.517   80.465 1.00 13.53 ? 117 PHE A CG  1 
ATOM   914  C CD1 . PHE A 1 117 ? 6.417  6.675   81.390 1.00 13.11 ? 117 PHE A CD1 1 
ATOM   915  C CD2 . PHE A 1 117 ? 8.029  5.248   80.319 1.00 13.05 ? 117 PHE A CD2 1 
ATOM   916  C CE1 . PHE A 1 117 ? 5.962  5.631   82.179 1.00 11.15 ? 117 PHE A CE1 1 
ATOM   917  C CE2 . PHE A 1 117 ? 7.594  4.165   81.071 1.00 10.11 ? 117 PHE A CE2 1 
ATOM   918  C CZ  . PHE A 1 117 ? 6.562  4.354   81.984 1.00 11.47 ? 117 PHE A CZ  1 
ATOM   919  N N   . PRO A 1 118 ? 6.699  9.874   76.967 1.00 11.46 ? 118 PRO A N   1 
ATOM   920  C CA  . PRO A 1 118 ? 7.060  11.085  76.189 1.00 10.94 ? 118 PRO A CA  1 
ATOM   921  C C   . PRO A 1 118 ? 7.833  11.974  77.137 1.00 11.70 ? 118 PRO A C   1 
ATOM   922  O O   . PRO A 1 118 ? 7.515  12.108  78.326 1.00 10.68 ? 118 PRO A O   1 
ATOM   923  C CB  . PRO A 1 118 ? 5.735  11.481  75.573 1.00 9.30  ? 118 PRO A CB  1 
ATOM   924  C CG  . PRO A 1 118 ? 5.105  10.127  75.306 1.00 8.51  ? 118 PRO A CG  1 
ATOM   925  C CD  . PRO A 1 118 ? 5.255  9.521   76.735 1.00 9.70  ? 118 PRO A CD  1 
ATOM   926  N N   . ASN A 1 119 ? 8.903  12.538  76.605 1.00 13.10 ? 119 ASN A N   1 
ATOM   927  C CA  . ASN A 1 119 ? 9.839  13.439  77.260 1.00 14.87 ? 119 ASN A CA  1 
ATOM   928  C C   . ASN A 1 119 ? 10.852 12.769  78.179 1.00 14.62 ? 119 ASN A C   1 
ATOM   929  O O   . ASN A 1 119 ? 11.555 13.533  78.903 1.00 14.97 ? 119 ASN A O   1 
ATOM   930  C CB  . ASN A 1 119 ? 9.151  14.610  77.988 1.00 19.92 ? 119 ASN A CB  1 
ATOM   931  C CG  . ASN A 1 119 ? 8.661  15.763  77.174 1.00 23.12 ? 119 ASN A CG  1 
ATOM   932  O OD1 . ASN A 1 119 ? 7.791  16.504  77.672 1.00 28.09 ? 119 ASN A OD1 1 
ATOM   933  N ND2 . ASN A 1 119 ? 9.037  16.037  75.932 1.00 27.27 ? 119 ASN A ND2 1 
ATOM   934  N N   . TRP A 1 120 ? 10.951 11.460  78.162 1.00 13.69 ? 120 TRP A N   1 
ATOM   935  C CA  . TRP A 1 120 ? 12.079 10.749  78.835 1.00 12.96 ? 120 TRP A CA  1 
ATOM   936  C C   . TRP A 1 120 ? 13.097 10.254  77.785 1.00 11.85 ? 120 TRP A C   1 
ATOM   937  O O   . TRP A 1 120 ? 12.683 9.698   76.735 1.00 11.49 ? 120 TRP A O   1 
ATOM   938  C CB  . TRP A 1 120 ? 11.585 9.756   79.887 1.00 11.81 ? 120 TRP A CB  1 
ATOM   939  C CG  . TRP A 1 120 ? 10.908 10.436  81.030 1.00 10.78 ? 120 TRP A CG  1 
ATOM   940  C CD1 . TRP A 1 120 ? 9.643  10.952  81.038 1.00 8.81  ? 120 TRP A CD1 1 
ATOM   941  C CD2 . TRP A 1 120 ? 11.411 10.602  82.359 1.00 9.77  ? 120 TRP A CD2 1 
ATOM   942  N NE1 . TRP A 1 120 ? 9.336  11.455  82.267 1.00 6.86  ? 120 TRP A NE1 1 
ATOM   943  C CE2 . TRP A 1 120 ? 10.406 11.276  83.094 1.00 8.73  ? 120 TRP A CE2 1 
ATOM   944  C CE3 . TRP A 1 120 ? 12.595 10.229  82.997 1.00 9.85  ? 120 TRP A CE3 1 
ATOM   945  C CZ2 . TRP A 1 120 ? 10.570 11.613  84.448 1.00 7.31  ? 120 TRP A CZ2 1 
ATOM   946  C CZ3 . TRP A 1 120 ? 12.753 10.594  84.332 1.00 6.51  ? 120 TRP A CZ3 1 
ATOM   947  C CH2 . TRP A 1 120 ? 11.776 11.255  85.025 1.00 4.14  ? 120 TRP A CH2 1 
ATOM   948  N N   . TYR A 1 121 ? 14.348 10.522  78.143 1.00 10.87 ? 121 TYR A N   1 
ATOM   949  C CA  . TYR A 1 121 ? 15.427 10.168  77.180 1.00 11.39 ? 121 TYR A CA  1 
ATOM   950  C C   . TYR A 1 121 ? 16.540 9.288   77.752 1.00 11.19 ? 121 TYR A C   1 
ATOM   951  O O   . TYR A 1 121 ? 16.845 9.356   78.969 1.00 11.53 ? 121 TYR A O   1 
ATOM   952  C CB  . TYR A 1 121 ? 16.082 11.485  76.720 1.00 10.65 ? 121 TYR A CB  1 
ATOM   953  C CG  . TYR A 1 121 ? 15.105 12.473  76.148 1.00 13.49 ? 121 TYR A CG  1 
ATOM   954  C CD1 . TYR A 1 121 ? 14.377 13.365  76.938 1.00 12.66 ? 121 TYR A CD1 1 
ATOM   955  C CD2 . TYR A 1 121 ? 14.917 12.515  74.761 1.00 15.57 ? 121 TYR A CD2 1 
ATOM   956  C CE1 . TYR A 1 121 ? 13.453 14.235  76.388 1.00 15.24 ? 121 TYR A CE1 1 
ATOM   957  C CE2 . TYR A 1 121 ? 13.987 13.399  74.186 1.00 17.86 ? 121 TYR A CE2 1 
ATOM   958  C CZ  . TYR A 1 121 ? 13.280 14.258  75.015 1.00 16.92 ? 121 TYR A CZ  1 
ATOM   959  O OH  . TYR A 1 121 ? 12.420 15.107  74.403 1.00 21.30 ? 121 TYR A OH  1 
ATOM   960  N N   . ILE A 1 122 ? 17.136 8.537   76.849 1.00 10.18 ? 122 ILE A N   1 
ATOM   961  C CA  . ILE A 1 122 ? 18.308 7.682   77.184 1.00 9.20  ? 122 ILE A CA  1 
ATOM   962  C C   . ILE A 1 122 ? 19.351 8.788   77.477 1.00 10.30 ? 122 ILE A C   1 
ATOM   963  O O   . ILE A 1 122 ? 19.470 9.692   76.652 1.00 9.35  ? 122 ILE A O   1 
ATOM   964  C CB  . ILE A 1 122 ? 18.735 6.834   75.993 1.00 7.77  ? 122 ILE A CB  1 
ATOM   965  C CG1 . ILE A 1 122 ? 17.640 5.773   75.752 1.00 3.40  ? 122 ILE A CG1 1 
ATOM   966  C CG2 . ILE A 1 122 ? 20.142 6.261   76.210 1.00 3.44  ? 122 ILE A CG2 1 
ATOM   967  C CD1 . ILE A 1 122 ? 17.966 4.682   74.724 1.00 3.13  ? 122 ILE A CD1 1 
ATOM   968  N N   . SER A 1 123 ? 19.948 8.743   78.657 1.00 11.19 ? 123 SER A N   1 
ATOM   969  C CA  . SER A 1 123 ? 20.900 9.775   79.101 1.00 10.93 ? 123 SER A CA  1 
ATOM   970  C C   . SER A 1 123 ? 22.121 9.171   79.821 1.00 10.34 ? 123 SER A C   1 
ATOM   971  O O   . SER A 1 123 ? 22.023 8.036   80.371 1.00 10.38 ? 123 SER A O   1 
ATOM   972  C CB  . SER A 1 123 ? 20.139 10.697  80.113 1.00 10.58 ? 123 SER A CB  1 
ATOM   973  O OG  . SER A 1 123 ? 18.997 11.278  79.460 1.00 11.64 ? 123 SER A OG  1 
ATOM   974  N N   . THR A 1 124 ? 23.204 9.937   79.853 1.00 8.00  ? 124 THR A N   1 
ATOM   975  C CA  . THR A 1 124 ? 24.450 9.604   80.510 1.00 6.79  ? 124 THR A CA  1 
ATOM   976  C C   . THR A 1 124 ? 24.781 10.819  81.392 1.00 7.92  ? 124 THR A C   1 
ATOM   977  O O   . THR A 1 124 ? 24.255 11.938  81.283 1.00 6.35  ? 124 THR A O   1 
ATOM   978  C CB  . THR A 1 124 ? 25.602 9.272   79.518 1.00 4.85  ? 124 THR A CB  1 
ATOM   979  O OG1 . THR A 1 124 ? 25.693 10.392  78.662 1.00 5.68  ? 124 THR A OG1 1 
ATOM   980  C CG2 . THR A 1 124 ? 25.349 8.121   78.518 1.00 3.04  ? 124 THR A CG2 1 
ATOM   981  N N   . SER A 1 125 ? 25.710 10.556  82.315 1.00 9.03  ? 125 SER A N   1 
ATOM   982  C CA  . SER A 1 125 ? 26.200 11.613  83.211 1.00 10.27 ? 125 SER A CA  1 
ATOM   983  C C   . SER A 1 125 ? 27.426 12.217  82.504 1.00 11.06 ? 125 SER A C   1 
ATOM   984  O O   . SER A 1 125 ? 27.830 11.705  81.493 1.00 10.37 ? 125 SER A O   1 
ATOM   985  C CB  . SER A 1 125 ? 26.710 11.098  84.543 1.00 9.41  ? 125 SER A CB  1 
ATOM   986  O OG  . SER A 1 125 ? 25.495 10.541  85.031 1.00 18.29 ? 125 SER A OG  1 
ATOM   987  N N   . GLN A 1 126 ? 27.912 13.270  83.104 1.00 13.58 ? 126 GLN A N   1 
ATOM   988  C CA  . GLN A 1 126 ? 29.103 14.008  82.735 1.00 15.45 ? 126 GLN A CA  1 
ATOM   989  C C   . GLN A 1 126 ? 30.286 13.142  83.195 1.00 13.63 ? 126 GLN A C   1 
ATOM   990  O O   . GLN A 1 126 ? 31.259 13.060  82.483 1.00 13.71 ? 126 GLN A O   1 
ATOM   991  C CB  . GLN A 1 126 ? 29.269 15.284  83.591 1.00 23.87 ? 126 GLN A CB  1 
ATOM   992  C CG  . GLN A 1 126 ? 28.323 16.429  83.352 1.00 30.73 ? 126 GLN A CG  1 
ATOM   993  C CD  . GLN A 1 126 ? 28.670 17.217  82.102 1.00 36.02 ? 126 GLN A CD  1 
ATOM   994  O OE1 . GLN A 1 126 ? 29.705 17.927  82.166 1.00 40.26 ? 126 GLN A OE1 1 
ATOM   995  N NE2 . GLN A 1 126 ? 27.870 17.135  81.043 1.00 34.42 ? 126 GLN A NE2 1 
ATOM   996  N N   . ALA A 1 127 ? 30.173 12.555  84.352 1.00 11.64 ? 127 ALA A N   1 
ATOM   997  C CA  . ALA A 1 127 ? 31.197 11.712  84.970 1.00 10.24 ? 127 ALA A CA  1 
ATOM   998  C C   . ALA A 1 127 ? 31.336 10.375  84.241 1.00 9.59  ? 127 ALA A C   1 
ATOM   999  O O   . ALA A 1 127 ? 30.373 9.830   83.657 1.00 10.65 ? 127 ALA A O   1 
ATOM   1000 C CB  . ALA A 1 127 ? 30.904 11.512  86.446 1.00 6.41  ? 127 ALA A CB  1 
ATOM   1001 N N   . GLU A 1 128 ? 32.569 9.856   84.289 1.00 7.80  ? 128 GLU A N   1 
ATOM   1002 C CA  . GLU A 1 128 ? 32.860 8.602   83.608 1.00 7.25  ? 128 GLU A CA  1 
ATOM   1003 C C   . GLU A 1 128 ? 32.368 7.405   84.410 1.00 9.36  ? 128 GLU A C   1 
ATOM   1004 O O   . GLU A 1 128 ? 32.224 7.492   85.644 1.00 10.39 ? 128 GLU A O   1 
ATOM   1005 C CB  . GLU A 1 128 ? 34.402 8.485   83.550 1.00 3.79  ? 128 GLU A CB  1 
ATOM   1006 C CG  . GLU A 1 128 ? 35.022 9.704   82.848 1.00 3.89  ? 128 GLU A CG  1 
ATOM   1007 C CD  . GLU A 1 128 ? 34.882 9.631   81.359 1.00 3.67  ? 128 GLU A CD  1 
ATOM   1008 O OE1 . GLU A 1 128 ? 35.071 8.647   80.662 1.00 7.28  ? 128 GLU A OE1 1 
ATOM   1009 O OE2 . GLU A 1 128 ? 34.488 10.727  80.799 1.00 7.17  ? 128 GLU A OE2 1 
ATOM   1010 N N   . ASN A 1 129 ? 32.221 6.255   83.709 1.00 10.53 ? 129 ASN A N   1 
ATOM   1011 C CA  . ASN A 1 129 ? 31.842 5.027   84.372 1.00 9.92  ? 129 ASN A CA  1 
ATOM   1012 C C   . ASN A 1 129 ? 30.539 5.105   85.146 1.00 8.57  ? 129 ASN A C   1 
ATOM   1013 O O   . ASN A 1 129 ? 30.478 4.367   86.128 1.00 7.59  ? 129 ASN A O   1 
ATOM   1014 C CB  . ASN A 1 129 ? 33.016 4.518   85.267 1.00 12.12 ? 129 ASN A CB  1 
ATOM   1015 C CG  . ASN A 1 129 ? 34.046 3.885   84.360 1.00 16.29 ? 129 ASN A CG  1 
ATOM   1016 O OD1 . ASN A 1 129 ? 33.718 3.203   83.375 1.00 19.42 ? 129 ASN A OD1 1 
ATOM   1017 N ND2 . ASN A 1 129 ? 35.297 4.209   84.702 1.00 18.56 ? 129 ASN A ND2 1 
ATOM   1018 N N   . MET A 1 130 ? 29.601 5.874   84.708 1.00 8.64  ? 130 MET A N   1 
ATOM   1019 C CA  . MET A 1 130 ? 28.280 5.898   85.414 1.00 10.11 ? 130 MET A CA  1 
ATOM   1020 C C   . MET A 1 130 ? 27.273 5.146   84.532 1.00 9.25  ? 130 MET A C   1 
ATOM   1021 O O   . MET A 1 130 ? 27.380 5.044   83.272 1.00 8.61  ? 130 MET A O   1 
ATOM   1022 C CB  . MET A 1 130 ? 28.027 7.379   85.677 1.00 14.53 ? 130 MET A CB  1 
ATOM   1023 C CG  . MET A 1 130 ? 28.956 8.101   86.635 1.00 18.06 ? 130 MET A CG  1 
ATOM   1024 S SD  . MET A 1 130 ? 28.899 7.340   88.320 1.00 24.05 ? 130 MET A SD  1 
ATOM   1025 C CE  . MET A 1 130 ? 27.574 8.419   88.916 1.00 22.22 ? 130 MET A CE  1 
ATOM   1026 N N   . PRO A 1 131 ? 26.256 4.566   85.155 1.00 8.42  ? 131 PRO A N   1 
ATOM   1027 C CA  . PRO A 1 131 ? 25.139 3.868   84.466 1.00 7.52  ? 131 PRO A CA  1 
ATOM   1028 C C   . PRO A 1 131 ? 24.382 4.791   83.508 1.00 6.19  ? 131 PRO A C   1 
ATOM   1029 O O   . PRO A 1 131 ? 24.293 6.009   83.727 1.00 6.76  ? 131 PRO A O   1 
ATOM   1030 C CB  . PRO A 1 131 ? 24.165 3.469   85.566 1.00 7.59  ? 131 PRO A CB  1 
ATOM   1031 C CG  . PRO A 1 131 ? 24.746 3.902   86.883 1.00 8.38  ? 131 PRO A CG  1 
ATOM   1032 C CD  . PRO A 1 131 ? 26.029 4.638   86.627 1.00 7.70  ? 131 PRO A CD  1 
ATOM   1033 N N   . VAL A 1 132 ? 23.880 4.318   82.431 1.00 5.81  ? 132 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 132 ? 23.080 4.965   81.396 1.00 5.11  ? 132 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 132 ? 21.663 4.869   82.035 1.00 7.89  ? 132 VAL A C   1 
ATOM   1036 O O   . VAL A 1 132 ? 21.399 3.896   82.784 1.00 9.01  ? 132 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 132 ? 23.172 4.217   80.079 1.00 4.67  ? 132 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 132 ? 22.182 4.586   79.011 1.00 2.19  ? 132 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 132 ? 24.620 4.093   79.612 1.00 2.57  ? 132 VAL A CG2 1 
ATOM   1040 N N   . PHE A 1 133 ? 20.818 5.861   81.767 1.00 7.28  ? 133 PHE A N   1 
ATOM   1041 C CA  . PHE A 1 133 ? 19.521 5.893   82.417 1.00 6.89  ? 133 PHE A CA  1 
ATOM   1042 C C   . PHE A 1 133 ? 18.547 6.698   81.579 1.00 7.60  ? 133 PHE A C   1 
ATOM   1043 O O   . PHE A 1 133 ? 18.881 7.327   80.562 1.00 6.80  ? 133 PHE A O   1 
ATOM   1044 C CB  . PHE A 1 133 ? 19.797 6.587   83.783 1.00 7.42  ? 133 PHE A CB  1 
ATOM   1045 C CG  . PHE A 1 133 ? 20.277 8.034   83.787 1.00 7.41  ? 133 PHE A CG  1 
ATOM   1046 C CD1 . PHE A 1 133 ? 21.617 8.338   83.574 1.00 3.69  ? 133 PHE A CD1 1 
ATOM   1047 C CD2 . PHE A 1 133 ? 19.347 9.080   83.993 1.00 6.69  ? 133 PHE A CD2 1 
ATOM   1048 C CE1 . PHE A 1 133 ? 22.056 9.681   83.585 1.00 5.23  ? 133 PHE A CE1 1 
ATOM   1049 C CE2 . PHE A 1 133 ? 19.798 10.401  83.993 1.00 8.11  ? 133 PHE A CE2 1 
ATOM   1050 C CZ  . PHE A 1 133 ? 21.165 10.727  83.804 1.00 4.42  ? 133 PHE A CZ  1 
ATOM   1051 N N   . LEU A 1 134 ? 17.334 6.660   82.096 1.00 9.31  ? 134 LEU A N   1 
ATOM   1052 C CA  . LEU A 1 134 ? 16.220 7.478   81.469 1.00 9.46  ? 134 LEU A CA  1 
ATOM   1053 C C   . LEU A 1 134 ? 16.181 8.797   82.262 1.00 9.21  ? 134 LEU A C   1 
ATOM   1054 O O   . LEU A 1 134 ? 15.953 8.723   83.497 1.00 8.00  ? 134 LEU A O   1 
ATOM   1055 C CB  . LEU A 1 134 ? 14.833 6.869   81.613 1.00 6.51  ? 134 LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 134 ? 14.316 5.968   80.577 1.00 8.65  ? 134 LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 134 ? 12.828 5.848   80.825 1.00 10.85 ? 134 LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 134 ? 14.690 6.327   79.152 1.00 7.36  ? 134 LEU A CD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 16.359 9.865   81.527 1.00 11.56 ? 135 GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 16.336 11.188  82.217 1.00 16.63 ? 135 GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 15.351 12.096  81.503 1.00 22.45 ? 135 GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 15.175 12.018  80.271 1.00 19.58 ? 135 GLY A O   1 
ATOM   1063 N N   . GLY A 1 136 ? 14.769 12.947  82.344 1.00 29.85 ? 136 GLY A N   1 
ATOM   1064 C CA  . GLY A 1 136 ? 13.776 13.920  81.854 1.00 39.94 ? 136 GLY A CA  1 
ATOM   1065 C C   . GLY A 1 136 ? 14.092 15.396  81.993 1.00 45.97 ? 136 GLY A C   1 
ATOM   1066 O O   . GLY A 1 136 ? 13.292 16.110  82.655 1.00 47.28 ? 136 GLY A O   1 
ATOM   1067 N N   . THR A 1 137 ? 15.205 15.831  81.414 1.00 51.26 ? 137 THR A N   1 
ATOM   1068 C CA  . THR A 1 137 ? 15.580 17.261  81.502 1.00 56.11 ? 137 THR A CA  1 
ATOM   1069 C C   . THR A 1 137 ? 16.041 17.795  80.152 1.00 58.58 ? 137 THR A C   1 
ATOM   1070 O O   . THR A 1 137 ? 15.481 18.863  79.772 1.00 60.71 ? 137 THR A O   1 
ATOM   1071 C CB  . THR A 1 137 ? 16.308 17.737  82.757 1.00 56.33 ? 137 THR A CB  1 
ATOM   1072 O OG1 . THR A 1 137 ? 15.549 17.429  83.914 1.00 54.99 ? 137 THR A OG1 1 
ATOM   1073 C CG2 . THR A 1 137 ? 16.411 19.279  82.698 1.00 56.59 ? 137 THR A CG2 1 
ATOM   1074 N N   . LYS A 1 138 ? 16.937 17.128  79.442 1.00 59.37 ? 138 LYS A N   1 
ATOM   1075 C CA  . LYS A 1 138 ? 17.382 17.565  78.096 1.00 59.43 ? 138 LYS A CA  1 
ATOM   1076 C C   . LYS A 1 138 ? 18.064 18.921  78.043 1.00 59.56 ? 138 LYS A C   1 
ATOM   1077 O O   . LYS A 1 138 ? 18.271 19.618  77.041 1.00 60.14 ? 138 LYS A O   1 
ATOM   1078 C CB  . LYS A 1 138 ? 16.220 17.527  77.100 1.00 58.85 ? 138 LYS A CB  1 
ATOM   1079 C CG  . LYS A 1 138 ? 16.621 17.460  75.640 1.00 59.95 ? 138 LYS A CG  1 
ATOM   1080 C CD  . LYS A 1 138 ? 15.465 17.183  74.714 1.00 62.61 ? 138 LYS A CD  1 
ATOM   1081 C CE  . LYS A 1 138 ? 14.487 18.295  74.464 1.00 64.38 ? 138 LYS A CE  1 
ATOM   1082 N NZ  . LYS A 1 138 ? 13.562 18.025  73.314 1.00 65.27 ? 138 LYS A NZ  1 
ATOM   1083 N N   . GLY A 1 139 ? 18.466 19.347  79.210 1.00 59.25 ? 139 GLY A N   1 
ATOM   1084 C CA  . GLY A 1 139 ? 19.156 20.578  79.585 1.00 58.63 ? 139 GLY A CA  1 
ATOM   1085 C C   . GLY A 1 139 ? 19.572 20.273  81.040 1.00 57.60 ? 139 GLY A C   1 
ATOM   1086 O O   . GLY A 1 139 ? 18.796 19.639  81.782 1.00 58.70 ? 139 GLY A O   1 
ATOM   1087 N N   . GLY A 1 140 ? 20.759 20.703  81.372 1.00 55.32 ? 140 GLY A N   1 
ATOM   1088 C CA  . GLY A 1 140 ? 21.313 20.448  82.735 1.00 51.35 ? 140 GLY A CA  1 
ATOM   1089 C C   . GLY A 1 140 ? 22.662 19.826  82.381 1.00 48.00 ? 140 GLY A C   1 
ATOM   1090 O O   . GLY A 1 140 ? 23.176 20.118  81.303 1.00 49.07 ? 140 GLY A O   1 
ATOM   1091 N N   . GLN A 1 141 ? 23.185 18.996  83.214 1.00 44.83 ? 141 GLN A N   1 
ATOM   1092 C CA  . GLN A 1 141 ? 24.476 18.344  83.037 1.00 41.24 ? 141 GLN A CA  1 
ATOM   1093 C C   . GLN A 1 141 ? 24.424 16.928  82.503 1.00 37.74 ? 141 GLN A C   1 
ATOM   1094 O O   . GLN A 1 141 ? 25.524 16.388  82.372 1.00 37.48 ? 141 GLN A O   1 
ATOM   1095 C CB  . GLN A 1 141 ? 25.292 18.460  84.320 1.00 43.18 ? 141 GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 141 ? 24.728 17.635  85.468 1.00 46.06 ? 141 GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 141 ? 23.533 18.306  86.112 1.00 47.75 ? 141 GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 141 ? 22.417 17.829  85.899 1.00 50.08 ? 141 GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 141 ? 23.787 19.416  86.801 1.00 49.26 ? 141 GLN A NE2 1 
ATOM   1100 N N   . ASP A 1 142 ? 23.285 16.363  82.192 1.00 34.05 ? 142 ASP A N   1 
ATOM   1101 C CA  . ASP A 1 142 ? 23.220 14.976  81.675 1.00 30.38 ? 142 ASP A CA  1 
ATOM   1102 C C   . ASP A 1 142 ? 23.030 15.046  80.166 1.00 25.99 ? 142 ASP A C   1 
ATOM   1103 O O   . ASP A 1 142 ? 22.262 15.905  79.703 1.00 25.13 ? 142 ASP A O   1 
ATOM   1104 C CB  . ASP A 1 142 ? 22.194 14.137  82.396 1.00 34.66 ? 142 ASP A CB  1 
ATOM   1105 C CG  . ASP A 1 142 ? 22.335 14.191  83.896 1.00 37.75 ? 142 ASP A CG  1 
ATOM   1106 O OD1 . ASP A 1 142 ? 23.317 13.997  84.584 1.00 40.26 ? 142 ASP A OD1 1 
ATOM   1107 O OD2 . ASP A 1 142 ? 21.200 14.483  84.440 1.00 41.03 ? 142 ASP A OD2 1 
ATOM   1108 N N   . ILE A 1 143 ? 23.720 14.168  79.478 1.00 20.94 ? 143 ILE A N   1 
ATOM   1109 C CA  . ILE A 1 143 ? 23.758 14.090  78.018 1.00 15.15 ? 143 ILE A CA  1 
ATOM   1110 C C   . ILE A 1 143 ? 22.639 13.250  77.450 1.00 13.13 ? 143 ILE A C   1 
ATOM   1111 O O   . ILE A 1 143 ? 22.307 12.159  77.918 1.00 11.79 ? 143 ILE A O   1 
ATOM   1112 C CB  . ILE A 1 143 ? 25.146 13.676  77.519 1.00 13.33 ? 143 ILE A CB  1 
ATOM   1113 C CG1 . ILE A 1 143 ? 26.252 14.434  78.206 1.00 13.18 ? 143 ILE A CG1 1 
ATOM   1114 C CG2 . ILE A 1 143 ? 25.314 13.960  76.025 1.00 9.68  ? 143 ILE A CG2 1 
ATOM   1115 C CD1 . ILE A 1 143 ? 26.813 13.987  79.537 1.00 15.55 ? 143 ILE A CD1 1 
ATOM   1116 N N   . THR A 1 144 ? 22.005 13.747  76.405 1.00 12.67 ? 144 THR A N   1 
ATOM   1117 C CA  . THR A 1 144 ? 20.880 13.173  75.700 1.00 13.18 ? 144 THR A CA  1 
ATOM   1118 C C   . THR A 1 144 ? 21.119 12.954  74.206 1.00 12.61 ? 144 THR A C   1 
ATOM   1119 O O   . THR A 1 144 ? 20.232 12.355  73.611 1.00 12.64 ? 144 THR A O   1 
ATOM   1120 C CB  . THR A 1 144 ? 19.550 13.931  75.970 1.00 14.48 ? 144 THR A CB  1 
ATOM   1121 O OG1 . THR A 1 144 ? 19.772 15.246  75.472 1.00 17.05 ? 144 THR A OG1 1 
ATOM   1122 C CG2 . THR A 1 144 ? 19.047 13.978  77.396 1.00 11.79 ? 144 THR A CG2 1 
ATOM   1123 N N   . ASP A 1 145 ? 22.217 13.329  73.649 1.00 12.74 ? 145 ASP A N   1 
ATOM   1124 C CA  . ASP A 1 145 ? 22.656 13.299  72.271 1.00 13.43 ? 145 ASP A CA  1 
ATOM   1125 C C   . ASP A 1 145 ? 23.751 12.248  72.005 1.00 12.57 ? 145 ASP A C   1 
ATOM   1126 O O   . ASP A 1 145 ? 24.694 12.131  72.828 1.00 11.85 ? 145 ASP A O   1 
ATOM   1127 C CB  . ASP A 1 145 ? 23.381 14.668  72.028 1.00 19.79 ? 145 ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 145 ? 22.362 15.642  71.564 1.00 26.37 ? 145 ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 145 ? 21.674 15.270  70.512 1.00 31.27 ? 145 ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 145 ? 22.222 16.692  72.174 1.00 31.54 ? 145 ASP A OD2 1 
ATOM   1131 N N   . PHE A 1 146 ? 23.622 11.564  70.890 1.00 10.44 ? 146 PHE A N   1 
ATOM   1132 C CA  . PHE A 1 146 ? 24.514 10.476  70.531 1.00 8.73  ? 146 PHE A CA  1 
ATOM   1133 C C   . PHE A 1 146 ? 24.728 10.368  69.005 1.00 8.80  ? 146 PHE A C   1 
ATOM   1134 O O   . PHE A 1 146 ? 24.049 11.004  68.163 1.00 8.48  ? 146 PHE A O   1 
ATOM   1135 C CB  . PHE A 1 146 ? 23.854 9.087   70.918 1.00 5.58  ? 146 PHE A CB  1 
ATOM   1136 C CG  . PHE A 1 146 ? 23.474 8.930   72.350 1.00 3.77  ? 146 PHE A CG  1 
ATOM   1137 C CD1 . PHE A 1 146 ? 22.264 9.438   72.823 1.00 5.85  ? 146 PHE A CD1 1 
ATOM   1138 C CD2 . PHE A 1 146 ? 24.349 8.320   73.254 1.00 3.28  ? 146 PHE A CD2 1 
ATOM   1139 C CE1 . PHE A 1 146 ? 21.924 9.315   74.181 1.00 6.54  ? 146 PHE A CE1 1 
ATOM   1140 C CE2 . PHE A 1 146 ? 24.077 8.202   74.607 1.00 3.96  ? 146 PHE A CE2 1 
ATOM   1141 C CZ  . PHE A 1 146 ? 22.832 8.683   75.060 1.00 6.31  ? 146 PHE A CZ  1 
ATOM   1142 N N   . THR A 1 147 ? 25.701 9.499   68.726 1.00 7.14  ? 147 THR A N   1 
ATOM   1143 C CA  . THR A 1 147 ? 26.080 9.164   67.389 1.00 6.11  ? 147 THR A CA  1 
ATOM   1144 C C   . THR A 1 147 ? 26.139 7.619   67.406 1.00 6.19  ? 147 THR A C   1 
ATOM   1145 O O   . THR A 1 147 ? 26.437 6.924   68.383 1.00 5.31  ? 147 THR A O   1 
ATOM   1146 C CB  . THR A 1 147 ? 27.335 9.825   66.871 1.00 6.41  ? 147 THR A CB  1 
ATOM   1147 O OG1 . THR A 1 147 ? 28.343 9.415   67.749 1.00 8.02  ? 147 THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 147 ? 27.437 11.341  66.898 1.00 7.21  ? 147 THR A CG2 1 
ATOM   1149 N N   . MET A 1 148 ? 25.840 7.135   66.220 1.00 7.34  ? 148 MET A N   1 
ATOM   1150 C CA  . MET A 1 148 ? 25.830 5.746   65.804 1.00 9.09  ? 148 MET A CA  1 
ATOM   1151 C C   . MET A 1 148 ? 27.277 5.488   65.388 1.00 9.50  ? 148 MET A C   1 
ATOM   1152 O O   . MET A 1 148 ? 27.890 6.285   64.631 1.00 9.98  ? 148 MET A O   1 
ATOM   1153 C CB  . MET A 1 148 ? 24.809 5.475   64.693 1.00 10.46 ? 148 MET A CB  1 
ATOM   1154 C CG  . MET A 1 148 ? 23.413 5.374   65.368 1.00 12.56 ? 148 MET A CG  1 
ATOM   1155 S SD  . MET A 1 148 ? 22.166 5.323   64.066 1.00 13.12 ? 148 MET A SD  1 
ATOM   1156 C CE  . MET A 1 148 ? 22.557 3.795   63.237 1.00 9.65  ? 148 MET A CE  1 
ATOM   1157 N N   . GLN A 1 149 ? 27.789 4.399   65.941 1.00 9.76  ? 149 GLN A N   1 
ATOM   1158 C CA  . GLN A 1 149 ? 29.166 4.000   65.629 1.00 10.69 ? 149 GLN A CA  1 
ATOM   1159 C C   . GLN A 1 149 ? 29.181 2.661   64.879 1.00 11.84 ? 149 GLN A C   1 
ATOM   1160 O O   . GLN A 1 149 ? 28.354 1.769   65.162 1.00 12.35 ? 149 GLN A O   1 
ATOM   1161 C CB  . GLN A 1 149 ? 30.051 3.927   66.865 1.00 10.03 ? 149 GLN A CB  1 
ATOM   1162 C CG  . GLN A 1 149 ? 30.260 5.235   67.588 1.00 11.06 ? 149 GLN A CG  1 
ATOM   1163 C CD  . GLN A 1 149 ? 31.035 6.230   66.742 1.00 15.92 ? 149 GLN A CD  1 
ATOM   1164 O OE1 . GLN A 1 149 ? 30.593 7.352   66.537 1.00 16.56 ? 149 GLN A OE1 1 
ATOM   1165 N NE2 . GLN A 1 149 ? 32.181 5.788   66.226 1.00 18.14 ? 149 GLN A NE2 1 
ATOM   1166 N N   . PHE A 1 150 ? 30.127 2.580   63.952 1.00 13.13 ? 150 PHE A N   1 
ATOM   1167 C CA  . PHE A 1 150 ? 30.416 1.407   63.153 1.00 14.99 ? 150 PHE A CA  1 
ATOM   1168 C C   . PHE A 1 150 ? 31.274 0.509   64.066 1.00 18.29 ? 150 PHE A C   1 
ATOM   1169 O O   . PHE A 1 150 ? 32.171 0.956   64.804 1.00 17.28 ? 150 PHE A O   1 
ATOM   1170 C CB  . PHE A 1 150 ? 31.202 1.612   61.869 1.00 12.36 ? 150 PHE A CB  1 
ATOM   1171 C CG  . PHE A 1 150 ? 30.395 2.319   60.800 1.00 8.44  ? 150 PHE A CG  1 
ATOM   1172 C CD1 . PHE A 1 150 ? 30.389 3.700   60.742 1.00 5.72  ? 150 PHE A CD1 1 
ATOM   1173 C CD2 . PHE A 1 150 ? 29.661 1.554   59.902 1.00 6.23  ? 150 PHE A CD2 1 
ATOM   1174 C CE1 . PHE A 1 150 ? 29.619 4.359   59.805 1.00 5.80  ? 150 PHE A CE1 1 
ATOM   1175 C CE2 . PHE A 1 150 ? 28.931 2.212   58.908 1.00 7.01  ? 150 PHE A CE2 1 
ATOM   1176 C CZ  . PHE A 1 150 ? 28.901 3.622   58.858 1.00 5.16  ? 150 PHE A CZ  1 
ATOM   1177 N N   . VAL A 1 151 ? 30.961 -0.740  63.909 1.00 24.22 ? 151 VAL A N   1 
ATOM   1178 C CA  . VAL A 1 151 ? 31.669 -1.792  64.714 1.00 31.90 ? 151 VAL A CA  1 
ATOM   1179 C C   . VAL A 1 151 ? 32.454 -2.702  63.798 1.00 36.29 ? 151 VAL A C   1 
ATOM   1180 O O   . VAL A 1 151 ? 33.621 -3.056  63.803 1.00 35.42 ? 151 VAL A O   1 
ATOM   1181 C CB  . VAL A 1 151 ? 30.497 -2.280  65.579 1.00 34.25 ? 151 VAL A CB  1 
ATOM   1182 C CG1 . VAL A 1 151 ? 29.490 -3.239  64.963 1.00 33.08 ? 151 VAL A CG1 1 
ATOM   1183 C CG2 . VAL A 1 151 ? 31.017 -2.688  66.951 1.00 38.07 ? 151 VAL A CG2 1 
ATOM   1184 N N   . SER A 1 152 ? 31.787 -3.172  62.806 1.00 42.88 ? 152 SER A N   1 
ATOM   1185 C CA  . SER A 1 152 ? 31.777 -3.995  61.646 1.00 48.89 ? 152 SER A CA  1 
ATOM   1186 C C   . SER A 1 152 ? 32.273 -5.410  61.774 1.00 54.20 ? 152 SER A C   1 
ATOM   1187 O O   . SER A 1 152 ? 32.074 -6.015  62.857 1.00 55.10 ? 152 SER A O   1 
ATOM   1188 C CB  . SER A 1 152 ? 32.100 -3.135  60.430 1.00 46.39 ? 152 SER A CB  1 
ATOM   1189 O OG  . SER A 1 152 ? 31.056 -2.148  60.364 1.00 42.30 ? 152 SER A OG  1 
ATOM   1190 N N   . SER A 1 153 ? 32.809 -5.977  60.722 1.00 59.72 ? 153 SER A N   1 
ATOM   1191 C CA  . SER A 1 153 ? 33.333 -7.325  60.593 1.00 65.72 ? 153 SER A CA  1 
ATOM   1192 C C   . SER A 1 153 ? 32.300 -8.286  59.963 1.00 69.14 ? 153 SER A C   1 
ATOM   1193 O O   . SER A 1 153 ? 32.463 -9.535  60.218 1.00 71.28 ? 153 SER A O   1 
ATOM   1194 C CB  . SER A 1 153 ? 33.981 -7.936  61.820 1.00 67.66 ? 153 SER A CB  1 
ATOM   1195 O OG  . SER A 1 153 ? 34.763 -9.095  61.576 1.00 69.15 ? 153 SER A OG  1 
ATOM   1196 O OXT . SER A 1 153 ? 31.182 -7.826  59.613 1.00 72.68 ? 153 SER A OXT 1 
HETATM 1197 O O   . HOH B 2 .   ? 9.442  3.352   75.308 1.00 21.65 ? 154 HOH A O   1 
HETATM 1198 O O   . HOH B 2 .   ? 10.329 -10.704 79.891 1.00 46.99 ? 155 HOH A O   1 
HETATM 1199 O O   . HOH B 2 .   ? 14.178 -1.610  72.564 1.00 5.40  ? 156 HOH A O   1 
HETATM 1200 O O   . HOH B 2 .   ? 11.756 -2.830  60.302 1.00 49.30 ? 157 HOH A O   1 
HETATM 1201 O O   . HOH B 2 .   ? 19.190 -9.608  68.259 1.00 46.69 ? 158 HOH A O   1 
HETATM 1202 O O   . HOH B 2 .   ? 26.384 7.722   82.469 1.00 6.39  ? 159 HOH A O   1 
HETATM 1203 O O   . HOH B 2 .   ? 29.710 10.841  69.817 1.00 22.37 ? 160 HOH A O   1 
HETATM 1204 O O   . HOH B 2 .   ? 23.036 -5.634  85.453 1.00 60.53 ? 161 HOH A O   1 
HETATM 1205 O O   . HOH B 2 .   ? 9.584  -10.011 77.256 1.00 25.75 ? 162 HOH A O   1 
HETATM 1206 O O   . HOH B 2 .   ? 19.373 -9.577  71.601 1.00 23.67 ? 163 HOH A O   1 
HETATM 1207 O O   . HOH B 2 .   ? 10.663 2.573   61.867 1.00 17.05 ? 164 HOH A O   1 
HETATM 1208 O O   . HOH B 2 .   ? 4.422  7.421   72.252 1.00 23.96 ? 165 HOH A O   1 
HETATM 1209 O O   . HOH B 2 .   ? 32.126 4.847   63.273 1.00 24.84 ? 166 HOH A O   1 
HETATM 1210 O O   . HOH B 2 .   ? 19.572 -0.319  83.923 1.00 30.47 ? 167 HOH A O   1 
HETATM 1211 O O   . HOH B 2 .   ? 7.751  -5.393  82.042 1.00 48.80 ? 168 HOH A O   1 
HETATM 1212 O O   . HOH B 2 .   ? 25.983 -7.742  75.868 1.00 56.63 ? 169 HOH A O   1 
HETATM 1213 O O   . HOH B 2 .   ? 29.029 7.620   82.523 1.00 3.09  ? 170 HOH A O   1 
HETATM 1214 O O   . HOH B 2 .   ? 9.552  -12.951 75.342 1.00 23.02 ? 171 HOH A O   1 
HETATM 1215 O O   . HOH B 2 .   ? 3.527  -8.532  76.758 1.00 29.47 ? 172 HOH A O   1 
HETATM 1216 O O   . HOH B 2 .   ? 18.010 -3.629  83.658 1.00 17.08 ? 173 HOH A O   1 
HETATM 1217 O O   . HOH B 2 .   ? 21.737 0.601   82.427 1.00 18.07 ? 174 HOH A O   1 
HETATM 1218 O O   . HOH B 2 .   ? 6.560  -0.049  80.884 1.00 28.83 ? 175 HOH A O   1 
HETATM 1219 O O   . HOH B 2 .   ? 30.588 13.791  68.806 1.00 36.38 ? 176 HOH A O   1 
HETATM 1220 O O   . HOH B 2 .   ? 24.489 9.204   64.144 1.00 41.69 ? 177 HOH A O   1 
HETATM 1221 O O   . HOH B 2 .   ? 16.666 -5.402  67.111 1.00 10.00 ? 178 HOH A O   1 
HETATM 1222 O O   . HOH B 2 .   ? 4.135  1.042   69.262 1.00 42.47 ? 179 HOH A O   1 
HETATM 1223 O O   . HOH B 2 .   ? 1.949  -1.966  73.459 1.00 16.90 ? 180 HOH A O   1 
HETATM 1224 O O   . HOH B 2 .   ? 11.339 -13.896 77.575 1.00 43.64 ? 181 HOH A O   1 
HETATM 1225 O O   . HOH B 2 .   ? 26.638 18.797  74.004 1.00 63.65 ? 182 HOH A O   1 
HETATM 1226 O O   . HOH B 2 .   ? 17.473 -6.685  57.227 1.00 29.79 ? 183 HOH A O   1 
HETATM 1227 O O   . HOH B 2 .   ? 29.666 -6.422  75.612 1.00 20.32 ? 184 HOH A O   1 
HETATM 1228 O O   . HOH B 2 .   ? 31.268 -6.931  83.713 1.00 61.88 ? 185 HOH A O   1 
HETATM 1229 O O   . HOH B 2 .   ? 22.249 -12.212 79.386 1.00 17.22 ? 186 HOH A O   1 
HETATM 1230 O O   . HOH B 2 .   ? 25.832 -6.875  72.328 1.00 37.95 ? 187 HOH A O   1 
HETATM 1231 O O   . HOH B 2 .   ? 15.159 11.097  60.686 1.00 22.55 ? 188 HOH A O   1 
HETATM 1232 O O   . HOH B 2 .   ? 28.510 -6.383  72.189 1.00 17.61 ? 189 HOH A O   1 
HETATM 1233 O O   . HOH B 2 .   ? 28.620 -1.476  62.309 1.00 49.46 ? 190 HOH A O   1 
HETATM 1234 O O   . HOH B 2 .   ? 34.542 6.494   73.470 1.00 7.94  ? 191 HOH A O   1 
HETATM 1235 O O   . HOH B 2 .   ? 13.653 16.936  69.369 1.00 60.59 ? 192 HOH A O   1 
HETATM 1236 O O   . HOH B 2 .   ? 18.301 10.241  74.383 1.00 21.94 ? 193 HOH A O   1 
HETATM 1237 O O   . HOH B 2 .   ? 16.786 4.425   84.590 1.00 4.83  ? 194 HOH A O   1 
HETATM 1238 O O   . HOH B 2 .   ? 26.025 14.592  85.055 1.00 22.99 ? 195 HOH A O   1 
HETATM 1239 O O   . HOH B 2 .   ? 30.805 13.835  80.212 1.00 30.27 ? 196 HOH A O   1 
HETATM 1240 O O   . HOH B 2 .   ? 28.158 0.903   72.152 1.00 9.22  ? 197 HOH A O   1 
HETATM 1241 O O   . HOH B 2 .   ? 11.701 -6.260  89.997 1.00 63.53 ? 198 HOH A O   1 
HETATM 1242 O O   . HOH B 2 .   ? 33.646 4.289   69.125 1.00 34.44 ? 199 HOH A O   1 
HETATM 1243 O O   . HOH B 2 .   ? 24.207 8.016   86.136 1.00 9.92  ? 200 HOH A O   1 
HETATM 1244 O O   . HOH B 2 .   ? 29.615 -7.152  65.842 1.00 38.25 ? 201 HOH A O   1 
HETATM 1245 O O   . HOH B 2 .   ? 26.891 -5.343  59.493 1.00 39.97 ? 202 HOH A O   1 
HETATM 1246 O O   . HOH B 2 .   ? 31.060 3.900   70.784 1.00 26.56 ? 203 HOH A O   1 
HETATM 1247 O O   . HOH B 2 .   ? 32.568 -4.539  68.872 1.00 40.14 ? 204 HOH A O   1 
HETATM 1248 O O   . HOH B 2 .   ? 22.780 -16.123 71.774 1.00 34.63 ? 205 HOH A O   1 
HETATM 1249 O O   . HOH B 2 .   ? 6.390  -1.056  67.185 1.00 28.54 ? 206 HOH A O   1 
HETATM 1250 O O   . HOH B 2 .   ? 24.055 -9.992  79.863 1.00 16.24 ? 207 HOH A O   1 
HETATM 1251 O O   . HOH B 2 .   ? 19.972 -4.671  56.382 1.00 24.32 ? 208 HOH A O   1 
HETATM 1252 O O   . HOH B 2 .   ? 37.436 10.078  71.308 1.00 44.50 ? 209 HOH A O   1 
HETATM 1253 O O   . HOH B 2 .   ? 32.515 13.109  79.061 1.00 52.20 ? 210 HOH A O   1 
HETATM 1254 O O   . HOH B 2 .   ? 37.212 8.846   67.408 1.00 44.50 ? 211 HOH A O   1 
HETATM 1255 O O   . HOH B 2 .   ? 6.318  6.929   66.799 1.00 37.60 ? 212 HOH A O   1 
HETATM 1256 O O   . HOH B 2 .   ? 15.975 9.473   62.793 1.00 28.82 ? 213 HOH A O   1 
HETATM 1257 O O   . HOH B 2 .   ? 17.037 6.625   59.607 1.00 22.50 ? 214 HOH A O   1 
HETATM 1258 O O   . HOH B 2 .   ? 15.083 7.149   85.483 1.00 27.16 ? 215 HOH A O   1 
HETATM 1259 O O   . HOH B 2 .   ? 35.009 -1.067  79.641 1.00 42.84 ? 216 HOH A O   1 
HETATM 1260 O O   . HOH B 2 .   ? 7.691  14.541  75.006 1.00 50.59 ? 217 HOH A O   1 
HETATM 1261 O O   . HOH B 2 .   ? 4.621  -2.271  76.403 1.00 13.26 ? 218 HOH A O   1 
HETATM 1262 O O   . HOH B 2 .   ? 19.560 7.865   61.523 1.00 37.97 ? 219 HOH A O   1 
HETATM 1263 O O   . HOH B 2 .   ? 35.750 7.743   71.391 1.00 35.65 ? 220 HOH A O   1 
HETATM 1264 O O   . HOH B 2 .   ? 19.296 20.952  84.798 1.00 51.34 ? 221 HOH A O   1 
HETATM 1265 O O   . HOH B 2 .   ? 33.681 3.418   65.803 1.00 43.82 ? 222 HOH A O   1 
HETATM 1266 O O   . HOH B 2 .   ? 4.049  -1.969  79.659 1.00 48.04 ? 223 HOH A O   1 
HETATM 1267 O O   . HOH B 2 .   ? 6.403  2.889   90.369 1.00 41.55 ? 224 HOH A O   1 
HETATM 1268 O O   . HOH B 2 .   ? 16.790 -1.371  85.925 1.00 54.50 ? 225 HOH A O   1 
HETATM 1269 O O   . HOH B 2 .   ? 19.825 17.235  80.839 1.00 30.83 ? 226 HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? 18.290 13.876  83.433 1.00 26.64 ? 227 HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? 14.438 10.292  58.274 1.00 54.46 ? 228 HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? 5.460  3.515   68.488 1.00 49.80 ? 229 HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? 36.754 -0.754  78.197 1.00 37.50 ? 230 HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? 14.265 -2.368  86.164 1.00 47.55 ? 231 HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? 19.838 2.596   84.961 1.00 46.78 ? 232 HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? 5.506  -12.664 67.767 1.00 59.21 ? 233 HOH A O   1 
HETATM 1277 O O   . HOH B 2 .   ? 35.923 -2.355  75.213 1.00 47.97 ? 234 HOH A O   1 
HETATM 1278 O O   . HOH B 2 .   ? 21.182 -6.652  63.118 1.00 53.63 ? 235 HOH A O   1 
HETATM 1279 O O   . HOH B 2 .   ? 15.648 13.061  84.657 1.00 43.80 ? 236 HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? 15.906 10.278  86.081 1.00 51.85 ? 237 HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? 6.854  13.236  58.631 1.00 64.54 ? 238 HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? 12.556 -9.936  81.436 1.00 66.17 ? 239 HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? 10.140 -2.700  90.085 1.00 50.80 ? 240 HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? 2.329  -4.647  66.392 1.00 46.98 ? 241 HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? 8.059  4.348   95.837 1.00 53.97 ? 242 HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? 20.866 17.222  83.269 1.00 30.24 ? 243 HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? 27.592 -8.136  70.423 1.00 29.26 ? 244 HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? 15.192 12.722  87.787 1.00 58.01 ? 245 HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? 27.849 13.317  87.163 1.00 59.05 ? 246 HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? 20.852 -4.047  86.977 1.00 29.19 ? 247 HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? 5.551  9.866   67.888 1.00 56.33 ? 248 HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? 18.414 -6.137  87.550 1.00 28.12 ? 249 HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? 23.468 16.392  74.596 1.00 56.07 ? 250 HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? 31.827 16.806  74.468 1.00 41.63 ? 251 HOH A O   1 
HETATM 1295 O O   . HOH B 2 .   ? 20.160 14.626  81.756 1.00 39.74 ? 252 HOH A O   1 
HETATM 1296 O O   . HOH B 2 .   ? 37.865 12.334  72.353 1.00 53.99 ? 253 HOH A O   1 
HETATM 1297 O O   . HOH B 2 .   ? 41.959 0.309   71.478 1.00 49.45 ? 254 HOH A O   1 
HETATM 1298 O O   . HOH B 2 .   ? 7.917  -0.007  59.896 1.00 67.93 ? 255 HOH A O   1 
HETATM 1299 O O   . HOH B 2 .   ? 4.697  0.666   83.484 1.00 47.57 ? 256 HOH A O   1 
HETATM 1300 O O   . HOH B 2 .   ? 18.164 13.688  80.965 1.00 48.72 ? 257 HOH A O   1 
HETATM 1301 O O   . HOH B 2 .   ? 36.432 2.503   70.453 1.00 17.83 ? 258 HOH A O   1 
HETATM 1302 O O   . HOH B 2 .   ? 4.985  -8.491  63.899 1.00 62.02 ? 259 HOH A O   1 
HETATM 1303 O O   . HOH B 2 .   ? 19.810 -16.662 71.084 1.00 53.89 ? 260 HOH A O   1 
HETATM 1304 O O   . HOH B 2 .   ? 33.957 -12.036 60.148 1.00 60.01 ? 261 HOH A O   1 
HETATM 1305 O O   . HOH B 2 .   ? 6.128  10.599  80.615 0.5  61.93 ? 262 HOH A O   1 
HETATM 1306 O O   . HOH B 2 .   ? 2.979  -6.727  69.294 1.00 42.12 ? 263 HOH A O   1 
HETATM 1307 O O   . HOH B 2 .   ? 19.439 -16.357 68.269 1.00 58.46 ? 264 HOH A O   1 
HETATM 1308 O O   . HOH B 2 .   ? 20.893 19.899  74.547 1.00 50.89 ? 265 HOH A O   1 
HETATM 1309 O O   . HOH B 2 .   ? 19.637 18.393  85.194 1.00 48.73 ? 266 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ASN 107 107 ?   ?   ?   A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 SER 153 153 153 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   154 154 HOH HOH A . 
B 2 HOH 2   155 155 HOH HOH A . 
B 2 HOH 3   156 156 HOH HOH A . 
B 2 HOH 4   157 157 HOH HOH A . 
B 2 HOH 5   158 158 HOH HOH A . 
B 2 HOH 6   159 159 HOH HOH A . 
B 2 HOH 7   160 160 HOH HOH A . 
B 2 HOH 8   161 161 HOH HOH A . 
B 2 HOH 9   162 162 HOH HOH A . 
B 2 HOH 10  163 163 HOH HOH A . 
B 2 HOH 11  164 164 HOH HOH A . 
B 2 HOH 12  165 165 HOH HOH A . 
B 2 HOH 13  166 166 HOH HOH A . 
B 2 HOH 14  167 167 HOH HOH A . 
B 2 HOH 15  168 168 HOH HOH A . 
B 2 HOH 16  169 169 HOH HOH A . 
B 2 HOH 17  170 170 HOH HOH A . 
B 2 HOH 18  171 171 HOH HOH A . 
B 2 HOH 19  172 172 HOH HOH A . 
B 2 HOH 20  173 173 HOH HOH A . 
B 2 HOH 21  174 174 HOH HOH A . 
B 2 HOH 22  175 175 HOH HOH A . 
B 2 HOH 23  176 176 HOH HOH A . 
B 2 HOH 24  177 177 HOH HOH A . 
B 2 HOH 25  178 178 HOH HOH A . 
B 2 HOH 26  179 179 HOH HOH A . 
B 2 HOH 27  180 180 HOH HOH A . 
B 2 HOH 28  181 181 HOH HOH A . 
B 2 HOH 29  182 182 HOH HOH A . 
B 2 HOH 30  183 183 HOH HOH A . 
B 2 HOH 31  184 184 HOH HOH A . 
B 2 HOH 32  185 185 HOH HOH A . 
B 2 HOH 33  186 186 HOH HOH A . 
B 2 HOH 34  187 187 HOH HOH A . 
B 2 HOH 35  188 188 HOH HOH A . 
B 2 HOH 36  189 189 HOH HOH A . 
B 2 HOH 37  190 190 HOH HOH A . 
B 2 HOH 38  191 191 HOH HOH A . 
B 2 HOH 39  192 192 HOH HOH A . 
B 2 HOH 40  193 193 HOH HOH A . 
B 2 HOH 41  194 194 HOH HOH A . 
B 2 HOH 42  195 195 HOH HOH A . 
B 2 HOH 43  196 196 HOH HOH A . 
B 2 HOH 44  197 197 HOH HOH A . 
B 2 HOH 45  198 198 HOH HOH A . 
B 2 HOH 46  199 199 HOH HOH A . 
B 2 HOH 47  200 200 HOH HOH A . 
B 2 HOH 48  201 201 HOH HOH A . 
B 2 HOH 49  202 202 HOH HOH A . 
B 2 HOH 50  203 203 HOH HOH A . 
B 2 HOH 51  204 204 HOH HOH A . 
B 2 HOH 52  205 205 HOH HOH A . 
B 2 HOH 53  206 206 HOH HOH A . 
B 2 HOH 54  207 207 HOH HOH A . 
B 2 HOH 55  208 208 HOH HOH A . 
B 2 HOH 56  209 209 HOH HOH A . 
B 2 HOH 57  210 210 HOH HOH A . 
B 2 HOH 58  211 211 HOH HOH A . 
B 2 HOH 59  212 212 HOH HOH A . 
B 2 HOH 60  213 213 HOH HOH A . 
B 2 HOH 61  214 214 HOH HOH A . 
B 2 HOH 62  215 215 HOH HOH A . 
B 2 HOH 63  216 216 HOH HOH A . 
B 2 HOH 64  217 217 HOH HOH A . 
B 2 HOH 65  218 218 HOH HOH A . 
B 2 HOH 66  219 219 HOH HOH A . 
B 2 HOH 67  220 220 HOH HOH A . 
B 2 HOH 68  221 221 HOH HOH A . 
B 2 HOH 69  222 222 HOH HOH A . 
B 2 HOH 70  223 223 HOH HOH A . 
B 2 HOH 71  224 224 HOH HOH A . 
B 2 HOH 72  225 225 HOH HOH A . 
B 2 HOH 73  226 226 HOH HOH A . 
B 2 HOH 74  227 227 HOH HOH A . 
B 2 HOH 75  228 228 HOH HOH A . 
B 2 HOH 76  229 229 HOH HOH A . 
B 2 HOH 77  230 230 HOH HOH A . 
B 2 HOH 78  231 231 HOH HOH A . 
B 2 HOH 79  232 232 HOH HOH A . 
B 2 HOH 80  233 233 HOH HOH A . 
B 2 HOH 81  234 234 HOH HOH A . 
B 2 HOH 82  235 235 HOH HOH A . 
B 2 HOH 83  236 236 HOH HOH A . 
B 2 HOH 84  237 237 HOH HOH A . 
B 2 HOH 85  238 238 HOH HOH A . 
B 2 HOH 86  239 239 HOH HOH A . 
B 2 HOH 87  240 240 HOH HOH A . 
B 2 HOH 88  241 241 HOH HOH A . 
B 2 HOH 89  242 242 HOH HOH A . 
B 2 HOH 90  243 243 HOH HOH A . 
B 2 HOH 91  244 244 HOH HOH A . 
B 2 HOH 92  245 245 HOH HOH A . 
B 2 HOH 93  246 246 HOH HOH A . 
B 2 HOH 94  247 247 HOH HOH A . 
B 2 HOH 95  248 248 HOH HOH A . 
B 2 HOH 96  249 249 HOH HOH A . 
B 2 HOH 97  250 250 HOH HOH A . 
B 2 HOH 98  251 251 HOH HOH A . 
B 2 HOH 99  252 252 HOH HOH A . 
B 2 HOH 100 253 253 HOH HOH A . 
B 2 HOH 101 254 254 HOH HOH A . 
B 2 HOH 102 255 255 HOH HOH A . 
B 2 HOH 103 256 256 HOH HOH A . 
B 2 HOH 104 257 257 HOH HOH A . 
B 2 HOH 105 258 258 HOH HOH A . 
B 2 HOH 106 259 259 HOH HOH A . 
B 2 HOH 107 260 260 HOH HOH A . 
B 2 HOH 108 261 261 HOH HOH A . 
B 2 HOH 109 262 262 HOH HOH A . 
B 2 HOH 110 263 263 HOH HOH A . 
B 2 HOH 111 264 264 HOH HOH A . 
B 2 HOH 112 265 265 HOH HOH A . 
B 2 HOH 113 266 266 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     262 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2017-11-29 
6 'Structure model' 1 5 2019-07-17 
7 'Structure model' 1 6 2019-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 5 'Structure model' 'Derived calculations'      
5 5 'Structure model' Other                       
6 6 'Structure model' 'Data collection'           
7 6 'Structure model' 'Refinement description'    
8 7 'Structure model' 'Data collection'           
9 7 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_database_status 
2 5 'Structure model' struct_conf          
3 5 'Structure model' struct_conf_type     
4 6 'Structure model' software             
5 7 'Structure model' software             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_pdbx_database_status.process_site' 
2 6 'Structure model' '_software.classification'           
3 7 'Structure model' '_software.classification'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
PROLSQ refinement       . ? 2 
X-PLOR refinement       . ? 3 
X-PLOR phasing          . ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THE SHEET PRESENTED AS *BRL* ON SHEET RECORDS BELOW IS
ACTUALLY A SIX-STRANDED BETA-BARREL.  THIS IS REPRESENTED
BY A SEVEN-STRANDED SHEET IN WHICH THE FIRST AND LAST
STRANDS ARE IDENTICAL.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 37  ? ? O A HOH 258 ? ? 1.84 
2 1 O   A HOH 196 ? ? O A HOH 210 ? ? 2.19 
3 1 CB  A ASP 142 ? ? O A HOH 252 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CB  A GLN 34 ? ? 1_555 O   A HOH 239 ? ? 7_655  1.58 
2 1 ND2 A ASN 7  ? ? 1_555 OXT A SER 153 ? ? 11_655 2.02 
3 1 OE1 A GLN 34 ? ? 1_555 O   A LEU 82  ? ? 7_655  2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 64  ? ? OE2 A GLU 64  ? ? 1.330 1.252 0.078 0.011 N 
2 1 CD A GLU 83  ? ? OE1 A GLU 83  ? ? 1.319 1.252 0.067 0.011 N 
3 1 CD A GLU 105 ? ? OE1 A GLU 105 ? ? 1.320 1.252 0.068 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD A ARG 4   ? ? NE A ARG 4   ? ? CZ  A ARG 4   ? ? 135.26 123.60 11.66  1.40 N 
2  1 CA A LEU 6   ? ? CB A LEU 6   ? ? CG  A LEU 6   ? ? 136.33 115.30 21.03  2.30 N 
3  1 CG A ARG 11  ? ? CD A ARG 11  ? ? NE  A ARG 11  ? ? 128.52 111.80 16.72  2.10 N 
4  1 CD A ARG 11  ? ? NE A ARG 11  ? ? CZ  A ARG 11  ? ? 141.46 123.60 17.86  1.40 N 
5  1 NE A ARG 11  ? ? CZ A ARG 11  ? ? NH2 A ARG 11  ? ? 115.42 120.30 -4.88  0.50 N 
6  1 CB A ASP 12  ? ? CG A ASP 12  ? ? OD2 A ASP 12  ? ? 124.45 118.30 6.15   0.90 N 
7  1 CA A MET 20  ? ? CB A MET 20  ? ? CG  A MET 20  ? ? 126.29 113.30 12.99  1.70 N 
8  1 N  A GLY 22  ? ? CA A GLY 22  ? ? C   A GLY 22  ? ? 98.02  113.10 -15.08 2.50 N 
9  1 CA A GLU 37  ? ? CB A GLU 37  ? ? CG  A GLU 37  ? ? 130.54 113.40 17.14  2.20 N 
10 1 N  A GLU 37  ? ? CA A GLU 37  ? ? C   A GLU 37  ? ? 127.83 111.00 16.83  2.70 N 
11 1 N  A GLN 38  ? ? CA A GLN 38  ? ? C   A GLN 38  ? ? 140.87 111.00 29.87  2.70 N 
12 1 CA A GLN 38  ? ? C  A GLN 38  ? ? O   A GLN 38  ? ? 134.06 120.10 13.96  2.10 N 
13 1 CB A TYR 68  ? ? CG A TYR 68  ? ? CD2 A TYR 68  ? ? 125.47 121.00 4.47   0.60 N 
14 1 N  A LYS 74  ? ? CA A LYS 74  ? ? CB  A LYS 74  ? ? 122.04 110.60 11.44  1.80 N 
15 1 CB A ASP 75  ? ? CG A ASP 75  ? ? OD1 A ASP 75  ? ? 127.90 118.30 9.60   0.90 N 
16 1 CB A ASP 75  ? ? CG A ASP 75  ? ? OD2 A ASP 75  ? ? 110.37 118.30 -7.93  0.90 N 
17 1 N  A LYS 93  ? ? CA A LYS 93  ? ? CB  A LYS 93  ? ? 99.67  110.60 -10.93 1.80 N 
18 1 CA A LYS 93  ? ? C  A LYS 93  ? ? O   A LYS 93  ? ? 141.32 120.10 21.22  2.10 N 
19 1 O  A LYS 93  ? ? C  A LYS 93  ? ? N   A LYS 94  ? ? 108.50 122.70 -14.20 1.60 Y 
20 1 C  A LYS 93  ? ? N  A LYS 94  ? ? CA  A LYS 94  ? ? 156.29 121.70 34.59  2.50 Y 
21 1 N  A LYS 94  ? ? CA A LYS 94  ? ? C   A LYS 94  ? ? 93.61  111.00 -17.39 2.70 N 
22 1 CA A MET 95  ? ? CB A MET 95  ? ? CG  A MET 95  ? ? 128.65 113.30 15.35  1.70 N 
23 1 N  A GLU 105 ? ? CA A GLU 105 ? ? CB  A GLU 105 ? ? 123.48 110.60 12.88  1.80 N 
24 1 CB A ASP 142 ? ? CG A ASP 142 ? ? OD1 A ASP 142 ? ? 129.31 118.30 11.01  0.90 N 
25 1 CB A ASP 142 ? ? CG A ASP 142 ? ? OD2 A ASP 142 ? ? 110.17 118.30 -8.13  0.90 N 
26 1 CB A VAL 151 ? ? CA A VAL 151 ? ? C   A VAL 151 ? ? 123.12 111.40 11.72  1.90 N 
27 1 C  A VAL 151 ? ? N  A SER 152 ? ? CA  A SER 152 ? ? 147.70 121.70 26.00  2.50 Y 
28 1 CB A SER 152 ? ? CA A SER 152 ? ? C   A SER 152 ? ? 121.91 110.10 11.81  1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 21  ? ? -104.72 -76.98  
2  1 LEU A 31  ? ? -98.93  -151.96 
3  1 GLN A 32  ? ? 78.81   -101.60 
4  1 GLN A 34  ? ? -179.88 -81.54  
5  1 GLU A 37  ? ? -20.25  -31.72  
6  1 GLN A 38  ? ? -61.65  88.85   
7  1 SER A 52  ? ? -59.76  -175.95 
8  1 ASN A 66  ? ? 70.10   33.75   
9  1 LYS A 92  ? ? 33.96   -141.41 
10 1 LYS A 93  ? ? 37.27   -161.35 
11 1 THR A 137 ? ? -135.31 -48.87  
12 1 SER A 152 ? ? 51.68   -151.00 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    GLN 
_pdbx_validate_chiral.auth_seq_id     38 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1   ? A ALA 1   
2 1 Y 1 A PRO 2   ? A PRO 2   
3 1 Y 1 A ASN 107 ? A ASN 107 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#