data_1HK8
# 
_entry.id   1HK8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HK8         
PDBE  EBI-12304    
WWPDB D_1290012304 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2003-03-27 
_pdbx_database_PDB_obs_spr.pdb_id           1HK8 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1H77 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1H78 unspecified 
'STRUCTURAL BASIS FOR ALLOSTERIC SUBSTRATE SPECIFICITY REGULATION IN CLASS III RIBONUCLEOTIDE REDUCTASES: NRDD IN COMPLEX WITH DCTP.' 
PDB 1H79 unspecified 
'STRUCTURAL BASIS FOR ALLOSTERIC SUBSTRATE SPECIFICITY REGULATION IN CLASS III RIBONUCLEOTIDE REDUCTASES: NRDD IN COMPLEX WITH DTTP' 
PDB 1H7A unspecified 
'STRUCTURAL BASIS FOR ALLOSTERIC SUBSTRATE SPECIFICITY REGULATION IN CLASS III RIBONUCLEOTIDE REDUCTASES: NRDD IN COMPLEX WITH DATP.' 
PDB 1H7B unspecified 
'STRUCTURAL BASIS FOR ALLOSTERIC SUBSTRATE SPECIFICITY REGULATION IN CLASS III RIBONUCLEOTIDE REDUCTASES: NATIVE NRDD' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HK8 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Larsson, K.-M.'  1 
'Andersson, J.'   2 
'Sjoeberg, B.-M.' 3 
'Nordlund, P.'    4 
'Logan, D.T.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A Metal-Binding Site in the Catalytic Subunit of Anaerobic Ribonucleotide Reductase.'                     
Proc.Natl.Acad.Sci.USA 100 3826 ?   2003 PNASA6 US 0027-8424 0040 ? 12655046 10.1073/PNAS.0736456100 
1       'Structural basis for allosteric substrate specificity regulation in anaerobic ribonucleotide reductases.' Structure 9   
739  750 2001 STRUE6 UK 0969-2126 2005 ? 11587648 ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Logan, D.T.'    1  
primary 'Mulliez, E.'    2  
primary 'Larsson, K.-M.' 3  
primary 'Bodevin, S.'    4  
primary 'Atta, M.'       5  
primary 'Garnaud, P.E.'  6  
primary 'Sjoberg, B.-M.' 7  
primary 'Fontecave, M.'  8  
1       'Larsson, K.M.'  9  
1       'Andersson, J.'  10 
1       'Sjoberg, B.M.'  11 
1       'Nordlund, P.'   12 
1       'Logan, D.T.'    13 
# 
_cell.entry_id           1HK8 
_cell.length_a           98.163 
_cell.length_b           98.163 
_cell.length_c           246.131 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HK8 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ANAEROBIC RIBONUCLEOTIDE-TRIPHOSPHATE REDUCTASE' 68055.594 1   1.17.4.2 YES 
'ACTIVE SITE SUBUNIT, RESIDUES 1-605' 'SEQUENCE DETERMINATION\: P.YOUNG, M.OHMAN, M.Q.XU.' 
2 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"               507.181   2   ?        ?   ? ? 
3 non-polymer syn 'ZINC ION'                                        65.409    1   ?        ?   ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                              54.938    1   ?        ?   ? ? 
5 water       nat water                                             18.015    228 ?        ?   ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTIEKEIEGLIHKTNKDLLNENANKDSRVFPTQRDLMAGIVSKHIAKNMVPSFIMKAHESGIIHVHDIDYSPALPFTNCC
LVDLKGMLENGFKLGNAQIETPKSIGVATAIMAQITAQVASHQYGGTTFANVDKVLSPYVKRTYAKHIEDAEKWQIADAL
NYAQSKTEKDVYDAFQAYEYEVNTLFSSNGQTPFVTITFGTGTDWTERMIQKAILKNRIKGLGRDGITPIFPKLVMFVEE
GVNLYKDDPNYDIKQLALECASKRMYPDIISAKNNKAITGSSVPVSPMGCRSFLSVWKDSTGNEILDGRNNLGVVTLNLP
RIALDSYIGTQFNEQKFVELFNERMDLCFEALMCRISSLKGVKATVAPILYQEGAFGVRLKPDDDIIELFKNGRSSVSLG
YIGIHELNILVGRDIGREILTKMNAHLKQWTERTGFAFSLYSTPAENLCYRFCKLDTEKYGSVKDVTDKGWYTNSFHVSV
EENITPFEKISREAPYHFIATGGHISYVELPDMKNNLKGLEAVWDYAAQHLDYFGVNMPVDKCFTCGSTHEMTPTENGFV
CSICGETDPKKMNTIRRTCAYLGNPNERGFNLGKNKEIMHRVKHQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTIEKEIEGLIHKTNKDLLNENANKDSRVFPTQRDLMAGIVSKHIAKNMVPSFIMKAHESGIIHVHDIDYSPALPFTNCC
LVDLKGMLENGFKLGNAQIETPKSIGVATAIMAQITAQVASHQYGGTTFANVDKVLSPYVKRTYAKHIEDAEKWQIADAL
NYAQSKTEKDVYDAFQAYEYEVNTLFSSNGQTPFVTITFGTGTDWTERMIQKAILKNRIKGLGRDGITPIFPKLVMFVEE
GVNLYKDDPNYDIKQLALECASKRMYPDIISAKNNKAITGSSVPVSPMGCRSFLSVWKDSTGNEILDGRNNLGVVTLNLP
RIALDSYIGTQFNEQKFVELFNERMDLCFEALMCRISSLKGVKATVAPILYQEGAFGVRLKPDDDIIELFKNGRSSVSLG
YIGIHELNILVGRDIGREILTKMNAHLKQWTERTGFAFSLYSTPAENLCYRFCKLDTEKYGSVKDVTDKGWYTNSFHVSV
EENITPFEKISREAPYHFIATGGHISYVELPDMKNNLKGLEAVWDYAAQHLDYFGVNMPVDKCFTCGSTHEMTPTENGFV
CSICGETDPKKMNTIRRTCAYLGNPNERGFNLGKNKEIMHRVKHQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ILE n 
1 4   GLU n 
1 5   LYS n 
1 6   GLU n 
1 7   ILE n 
1 8   GLU n 
1 9   GLY n 
1 10  LEU n 
1 11  ILE n 
1 12  HIS n 
1 13  LYS n 
1 14  THR n 
1 15  ASN n 
1 16  LYS n 
1 17  ASP n 
1 18  LEU n 
1 19  LEU n 
1 20  ASN n 
1 21  GLU n 
1 22  ASN n 
1 23  ALA n 
1 24  ASN n 
1 25  LYS n 
1 26  ASP n 
1 27  SER n 
1 28  ARG n 
1 29  VAL n 
1 30  PHE n 
1 31  PRO n 
1 32  THR n 
1 33  GLN n 
1 34  ARG n 
1 35  ASP n 
1 36  LEU n 
1 37  MET n 
1 38  ALA n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  SER n 
1 43  LYS n 
1 44  HIS n 
1 45  ILE n 
1 46  ALA n 
1 47  LYS n 
1 48  ASN n 
1 49  MET n 
1 50  VAL n 
1 51  PRO n 
1 52  SER n 
1 53  PHE n 
1 54  ILE n 
1 55  MET n 
1 56  LYS n 
1 57  ALA n 
1 58  HIS n 
1 59  GLU n 
1 60  SER n 
1 61  GLY n 
1 62  ILE n 
1 63  ILE n 
1 64  HIS n 
1 65  VAL n 
1 66  HIS n 
1 67  ASP n 
1 68  ILE n 
1 69  ASP n 
1 70  TYR n 
1 71  SER n 
1 72  PRO n 
1 73  ALA n 
1 74  LEU n 
1 75  PRO n 
1 76  PHE n 
1 77  THR n 
1 78  ASN n 
1 79  CYS n 
1 80  CYS n 
1 81  LEU n 
1 82  VAL n 
1 83  ASP n 
1 84  LEU n 
1 85  LYS n 
1 86  GLY n 
1 87  MET n 
1 88  LEU n 
1 89  GLU n 
1 90  ASN n 
1 91  GLY n 
1 92  PHE n 
1 93  LYS n 
1 94  LEU n 
1 95  GLY n 
1 96  ASN n 
1 97  ALA n 
1 98  GLN n 
1 99  ILE n 
1 100 GLU n 
1 101 THR n 
1 102 PRO n 
1 103 LYS n 
1 104 SER n 
1 105 ILE n 
1 106 GLY n 
1 107 VAL n 
1 108 ALA n 
1 109 THR n 
1 110 ALA n 
1 111 ILE n 
1 112 MET n 
1 113 ALA n 
1 114 GLN n 
1 115 ILE n 
1 116 THR n 
1 117 ALA n 
1 118 GLN n 
1 119 VAL n 
1 120 ALA n 
1 121 SER n 
1 122 HIS n 
1 123 GLN n 
1 124 TYR n 
1 125 GLY n 
1 126 GLY n 
1 127 THR n 
1 128 THR n 
1 129 PHE n 
1 130 ALA n 
1 131 ASN n 
1 132 VAL n 
1 133 ASP n 
1 134 LYS n 
1 135 VAL n 
1 136 LEU n 
1 137 SER n 
1 138 PRO n 
1 139 TYR n 
1 140 VAL n 
1 141 LYS n 
1 142 ARG n 
1 143 THR n 
1 144 TYR n 
1 145 ALA n 
1 146 LYS n 
1 147 HIS n 
1 148 ILE n 
1 149 GLU n 
1 150 ASP n 
1 151 ALA n 
1 152 GLU n 
1 153 LYS n 
1 154 TRP n 
1 155 GLN n 
1 156 ILE n 
1 157 ALA n 
1 158 ASP n 
1 159 ALA n 
1 160 LEU n 
1 161 ASN n 
1 162 TYR n 
1 163 ALA n 
1 164 GLN n 
1 165 SER n 
1 166 LYS n 
1 167 THR n 
1 168 GLU n 
1 169 LYS n 
1 170 ASP n 
1 171 VAL n 
1 172 TYR n 
1 173 ASP n 
1 174 ALA n 
1 175 PHE n 
1 176 GLN n 
1 177 ALA n 
1 178 TYR n 
1 179 GLU n 
1 180 TYR n 
1 181 GLU n 
1 182 VAL n 
1 183 ASN n 
1 184 THR n 
1 185 LEU n 
1 186 PHE n 
1 187 SER n 
1 188 SER n 
1 189 ASN n 
1 190 GLY n 
1 191 GLN n 
1 192 THR n 
1 193 PRO n 
1 194 PHE n 
1 195 VAL n 
1 196 THR n 
1 197 ILE n 
1 198 THR n 
1 199 PHE n 
1 200 GLY n 
1 201 THR n 
1 202 GLY n 
1 203 THR n 
1 204 ASP n 
1 205 TRP n 
1 206 THR n 
1 207 GLU n 
1 208 ARG n 
1 209 MET n 
1 210 ILE n 
1 211 GLN n 
1 212 LYS n 
1 213 ALA n 
1 214 ILE n 
1 215 LEU n 
1 216 LYS n 
1 217 ASN n 
1 218 ARG n 
1 219 ILE n 
1 220 LYS n 
1 221 GLY n 
1 222 LEU n 
1 223 GLY n 
1 224 ARG n 
1 225 ASP n 
1 226 GLY n 
1 227 ILE n 
1 228 THR n 
1 229 PRO n 
1 230 ILE n 
1 231 PHE n 
1 232 PRO n 
1 233 LYS n 
1 234 LEU n 
1 235 VAL n 
1 236 MET n 
1 237 PHE n 
1 238 VAL n 
1 239 GLU n 
1 240 GLU n 
1 241 GLY n 
1 242 VAL n 
1 243 ASN n 
1 244 LEU n 
1 245 TYR n 
1 246 LYS n 
1 247 ASP n 
1 248 ASP n 
1 249 PRO n 
1 250 ASN n 
1 251 TYR n 
1 252 ASP n 
1 253 ILE n 
1 254 LYS n 
1 255 GLN n 
1 256 LEU n 
1 257 ALA n 
1 258 LEU n 
1 259 GLU n 
1 260 CYS n 
1 261 ALA n 
1 262 SER n 
1 263 LYS n 
1 264 ARG n 
1 265 MET n 
1 266 TYR n 
1 267 PRO n 
1 268 ASP n 
1 269 ILE n 
1 270 ILE n 
1 271 SER n 
1 272 ALA n 
1 273 LYS n 
1 274 ASN n 
1 275 ASN n 
1 276 LYS n 
1 277 ALA n 
1 278 ILE n 
1 279 THR n 
1 280 GLY n 
1 281 SER n 
1 282 SER n 
1 283 VAL n 
1 284 PRO n 
1 285 VAL n 
1 286 SER n 
1 287 PRO n 
1 288 MET n 
1 289 GLY n 
1 290 CYS n 
1 291 ARG n 
1 292 SER n 
1 293 PHE n 
1 294 LEU n 
1 295 SER n 
1 296 VAL n 
1 297 TRP n 
1 298 LYS n 
1 299 ASP n 
1 300 SER n 
1 301 THR n 
1 302 GLY n 
1 303 ASN n 
1 304 GLU n 
1 305 ILE n 
1 306 LEU n 
1 307 ASP n 
1 308 GLY n 
1 309 ARG n 
1 310 ASN n 
1 311 ASN n 
1 312 LEU n 
1 313 GLY n 
1 314 VAL n 
1 315 VAL n 
1 316 THR n 
1 317 LEU n 
1 318 ASN n 
1 319 LEU n 
1 320 PRO n 
1 321 ARG n 
1 322 ILE n 
1 323 ALA n 
1 324 LEU n 
1 325 ASP n 
1 326 SER n 
1 327 TYR n 
1 328 ILE n 
1 329 GLY n 
1 330 THR n 
1 331 GLN n 
1 332 PHE n 
1 333 ASN n 
1 334 GLU n 
1 335 GLN n 
1 336 LYS n 
1 337 PHE n 
1 338 VAL n 
1 339 GLU n 
1 340 LEU n 
1 341 PHE n 
1 342 ASN n 
1 343 GLU n 
1 344 ARG n 
1 345 MET n 
1 346 ASP n 
1 347 LEU n 
1 348 CYS n 
1 349 PHE n 
1 350 GLU n 
1 351 ALA n 
1 352 LEU n 
1 353 MET n 
1 354 CYS n 
1 355 ARG n 
1 356 ILE n 
1 357 SER n 
1 358 SER n 
1 359 LEU n 
1 360 LYS n 
1 361 GLY n 
1 362 VAL n 
1 363 LYS n 
1 364 ALA n 
1 365 THR n 
1 366 VAL n 
1 367 ALA n 
1 368 PRO n 
1 369 ILE n 
1 370 LEU n 
1 371 TYR n 
1 372 GLN n 
1 373 GLU n 
1 374 GLY n 
1 375 ALA n 
1 376 PHE n 
1 377 GLY n 
1 378 VAL n 
1 379 ARG n 
1 380 LEU n 
1 381 LYS n 
1 382 PRO n 
1 383 ASP n 
1 384 ASP n 
1 385 ASP n 
1 386 ILE n 
1 387 ILE n 
1 388 GLU n 
1 389 LEU n 
1 390 PHE n 
1 391 LYS n 
1 392 ASN n 
1 393 GLY n 
1 394 ARG n 
1 395 SER n 
1 396 SER n 
1 397 VAL n 
1 398 SER n 
1 399 LEU n 
1 400 GLY n 
1 401 TYR n 
1 402 ILE n 
1 403 GLY n 
1 404 ILE n 
1 405 HIS n 
1 406 GLU n 
1 407 LEU n 
1 408 ASN n 
1 409 ILE n 
1 410 LEU n 
1 411 VAL n 
1 412 GLY n 
1 413 ARG n 
1 414 ASP n 
1 415 ILE n 
1 416 GLY n 
1 417 ARG n 
1 418 GLU n 
1 419 ILE n 
1 420 LEU n 
1 421 THR n 
1 422 LYS n 
1 423 MET n 
1 424 ASN n 
1 425 ALA n 
1 426 HIS n 
1 427 LEU n 
1 428 LYS n 
1 429 GLN n 
1 430 TRP n 
1 431 THR n 
1 432 GLU n 
1 433 ARG n 
1 434 THR n 
1 435 GLY n 
1 436 PHE n 
1 437 ALA n 
1 438 PHE n 
1 439 SER n 
1 440 LEU n 
1 441 TYR n 
1 442 SER n 
1 443 THR n 
1 444 PRO n 
1 445 ALA n 
1 446 GLU n 
1 447 ASN n 
1 448 LEU n 
1 449 CYS n 
1 450 TYR n 
1 451 ARG n 
1 452 PHE n 
1 453 CYS n 
1 454 LYS n 
1 455 LEU n 
1 456 ASP n 
1 457 THR n 
1 458 GLU n 
1 459 LYS n 
1 460 TYR n 
1 461 GLY n 
1 462 SER n 
1 463 VAL n 
1 464 LYS n 
1 465 ASP n 
1 466 VAL n 
1 467 THR n 
1 468 ASP n 
1 469 LYS n 
1 470 GLY n 
1 471 TRP n 
1 472 TYR n 
1 473 THR n 
1 474 ASN n 
1 475 SER n 
1 476 PHE n 
1 477 HIS n 
1 478 VAL n 
1 479 SER n 
1 480 VAL n 
1 481 GLU n 
1 482 GLU n 
1 483 ASN n 
1 484 ILE n 
1 485 THR n 
1 486 PRO n 
1 487 PHE n 
1 488 GLU n 
1 489 LYS n 
1 490 ILE n 
1 491 SER n 
1 492 ARG n 
1 493 GLU n 
1 494 ALA n 
1 495 PRO n 
1 496 TYR n 
1 497 HIS n 
1 498 PHE n 
1 499 ILE n 
1 500 ALA n 
1 501 THR n 
1 502 GLY n 
1 503 GLY n 
1 504 HIS n 
1 505 ILE n 
1 506 SER n 
1 507 TYR n 
1 508 VAL n 
1 509 GLU n 
1 510 LEU n 
1 511 PRO n 
1 512 ASP n 
1 513 MET n 
1 514 LYS n 
1 515 ASN n 
1 516 ASN n 
1 517 LEU n 
1 518 LYS n 
1 519 GLY n 
1 520 LEU n 
1 521 GLU n 
1 522 ALA n 
1 523 VAL n 
1 524 TRP n 
1 525 ASP n 
1 526 TYR n 
1 527 ALA n 
1 528 ALA n 
1 529 GLN n 
1 530 HIS n 
1 531 LEU n 
1 532 ASP n 
1 533 TYR n 
1 534 PHE n 
1 535 GLY n 
1 536 VAL n 
1 537 ASN n 
1 538 MET n 
1 539 PRO n 
1 540 VAL n 
1 541 ASP n 
1 542 LYS n 
1 543 CYS n 
1 544 PHE n 
1 545 THR n 
1 546 CYS n 
1 547 GLY n 
1 548 SER n 
1 549 THR n 
1 550 HIS n 
1 551 GLU n 
1 552 MET n 
1 553 THR n 
1 554 PRO n 
1 555 THR n 
1 556 GLU n 
1 557 ASN n 
1 558 GLY n 
1 559 PHE n 
1 560 VAL n 
1 561 CYS n 
1 562 SER n 
1 563 ILE n 
1 564 CYS n 
1 565 GLY n 
1 566 GLU n 
1 567 THR n 
1 568 ASP n 
1 569 PRO n 
1 570 LYS n 
1 571 LYS n 
1 572 MET n 
1 573 ASN n 
1 574 THR n 
1 575 ILE n 
1 576 ARG n 
1 577 ARG n 
1 578 THR n 
1 579 CYS n 
1 580 ALA n 
1 581 TYR n 
1 582 LEU n 
1 583 GLY n 
1 584 ASN n 
1 585 PRO n 
1 586 ASN n 
1 587 GLU n 
1 588 ARG n 
1 589 GLY n 
1 590 PHE n 
1 591 ASN n 
1 592 LEU n 
1 593 GLY n 
1 594 LYS n 
1 595 ASN n 
1 596 LYS n 
1 597 GLU n 
1 598 ILE n 
1 599 MET n 
1 600 HIS n 
1 601 ARG n 
1 602 VAL n 
1 603 LYS n 
1 604 HIS n 
1 605 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'BACTERIOPHAGE T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PET29T4NRDD(G580A)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NRDD_BPT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07071 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HK8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 605 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07071 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  605 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       605 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1HK8 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      580 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P07071 
_struct_ref_seq_dif.db_mon_id                    GLY 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          580 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            580 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'      121.158 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                               ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                ? 'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                          ? 'Zn 2'              65.409  
# 
_exptl.entry_id          1HK8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.5 
_exptl_crystal.density_percent_sol   72.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% PEG 400, 02M MGCL2, 0.1M HEPES PH 7.5, 7MM DTT' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-05-15 
_diffrn_detector.details                'BENT MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.043 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.043 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1HK8 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.800 
_reflns.d_resolution_high            2.430 
_reflns.number_obs                   44361 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.09600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.43 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           0.27400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.800 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1HK8 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39943 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.08 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.200 
_refine.ls_number_reflns_R_free                  1742 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.934 
_refine.correlation_coeff_Fo_to_Fc_free          0.901 
_refine.B_iso_mean                               41.49 
_refine.aniso_B[1][1]                            -0.04000 
_refine.aniso_B[2][2]                            -0.04000 
_refine.aniso_B[3][3]                            0.09000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1B8B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.244 
_refine.pdbx_overall_ESU_R_Free                  0.213 
_refine.overall_SU_ML                            0.148 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.546 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4411 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             228 
_refine_hist.number_atoms_total               4703 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        20.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011 0.021 ? 4575 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 4047 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.397 1.964 ? 6209 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.818 3.000 ? 9458 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.203 5.000 ? 560  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.077 0.200 ? 682  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005 0.020 ? 5050 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.003 0.020 ? 915  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.186 0.200 ? 975  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.219 0.200 ? 4777 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.085 0.200 ? 2652 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.196 0.200 ? 245  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.015 0.200 ? 2    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.258 0.200 ? 22   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.268 0.200 ? 84   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.216 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.983 2.000 ? 2788 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.173 3.000 ? 4514 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.048 2.000 ? 1787 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.136 3.000 ? 1695 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.45 
_refine_ls_shell.d_res_low                        2.52 
_refine_ls_shell.number_reflns_R_work             2298 
_refine_ls_shell.R_factor_R_work                  0.2750 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3100 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1HK8 
_struct.title                     
'STRUCTURAL BASIS FOR ALLOSTERIC SUBSTRATE SPECIFICITY REGULATION IN CLASS III RIBONUCLEOTIDE REDUCTASES: NRDD IN COMPLEX WITH DGTP' 
_struct.pdbx_descriptor           'ANAEROBIC RIBONUCLEOTIDE-TRIPHOSPHATE REDUCTASE (E.C.1.17.4.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HK8 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, REDUCTASE, ALLOSTERIC REGULATION, SUBSTRATE SPECIFICITY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 29  ? VAL A 50  ? VAL A 29  VAL A 50  1 ? 22 
HELX_P HELX_P2  2  PRO A 51  ? SER A 60  ? PRO A 51  SER A 60  1 ? 10 
HELX_P HELX_P3  3  ASP A 83  ? ASN A 90  ? ASP A 83  ASN A 90  1 ? 8  
HELX_P HELX_P4  4  SER A 104 ? SER A 121 ? SER A 104 SER A 121 1 ? 18 
HELX_P HELX_P5  5  ASN A 131 ? TRP A 154 ? ASN A 131 TRP A 154 1 ? 24 
HELX_P HELX_P6  6  ASP A 158 ? LEU A 185 ? ASP A 158 LEU A 185 1 ? 28 
HELX_P HELX_P7  7  ASP A 204 ? GLY A 221 ? ASP A 204 GLY A 221 1 ? 18 
HELX_P HELX_P8  8  ASN A 250 ? MET A 265 ? ASN A 250 MET A 265 1 ? 16 
HELX_P HELX_P9  9  ALA A 272 ? GLY A 280 ? ALA A 272 GLY A 280 1 ? 9  
HELX_P HELX_P10 10 LEU A 319 ? ASP A 325 ? LEU A 319 ASP A 325 1 ? 7  
HELX_P HELX_P11 11 ASN A 333 ? LEU A 359 ? ASN A 333 LEU A 359 1 ? 27 
HELX_P HELX_P12 12 ALA A 364 ? VAL A 366 ? ALA A 364 VAL A 366 5 ? 3  
HELX_P HELX_P13 13 ALA A 367 ? GLN A 372 ? ALA A 367 GLN A 372 1 ? 6  
HELX_P HELX_P14 14 ILE A 386 ? LYS A 391 ? ILE A 386 LYS A 391 1 ? 6  
HELX_P HELX_P15 15 GLY A 403 ? GLY A 412 ? GLY A 403 GLY A 412 1 ? 10 
HELX_P HELX_P16 16 ILE A 415 ? GLY A 435 ? ILE A 415 GLY A 435 1 ? 21 
HELX_P HELX_P17 17 ASN A 447 ? GLY A 461 ? ASN A 447 GLY A 461 1 ? 15 
HELX_P HELX_P18 18 THR A 485 ? PHE A 498 ? THR A 485 PHE A 498 1 ? 14 
HELX_P HELX_P19 19 ASN A 516 ? LEU A 531 ? ASN A 516 LEU A 531 1 ? 16 
HELX_P HELX_P20 20 ASP A 568 ? LYS A 570 ? ASP A 568 LYS A 570 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B DGT . O1G ? ? ? 1_555 E MN  .   MN  ? ? A DGT 1587 A MN  1590 1_555 ? ? ? ? ? ? ? 1.732 ? 
metalc2 metalc ? ? B DGT . O1A ? ? ? 1_555 E MN  .   MN  ? ? A DGT 1587 A MN  1590 1_555 ? ? ? ? ? ? ? 1.721 ? 
metalc3 metalc ? ? D ZN  . ZN  ? ? ? 1_555 A CYS 564 SG  ? ? A ZN  1589 A CYS 564  1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc4 metalc ? ? D ZN  . ZN  ? ? ? 1_555 A CYS 561 SG  ? ? A ZN  1589 A CYS 561  1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc5 metalc ? ? D ZN  . ZN  ? ? ? 1_555 A CYS 546 SG  ? ? A ZN  1589 A CYS 546  1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc6 metalc ? ? D ZN  . ZN  ? ? ? 1_555 A CYS 543 SG  ? ? A ZN  1589 A CYS 543  1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc7 metalc ? ? E MN  . MN  ? ? ? 1_555 B DGT .   O2B ? ? A MN  1590 A DGT 1587 1_555 ? ? ? ? ? ? ? 2.256 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 71  A . ? SER 71  A PRO 72  A ? PRO 72  A 1 8.15  
2 PHE 231 A . ? PHE 231 A PRO 232 A ? PRO 232 A 1 -4.50 
3 TYR 266 A . ? TYR 266 A PRO 267 A ? PRO 267 A 1 6.67  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 7 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AB 4 5 ? parallel      
AB 5 6 ? anti-parallel 
AB 6 7 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 63  ? VAL A 65  ? ILE A 63  VAL A 65  
AA 2 ASN A 311 ? ASN A 318 ? ASN A 311 ASN A 318 
AA 3 SER A 396 ? ILE A 402 ? SER A 396 ILE A 402 
AA 4 ALA A 437 ? SER A 442 ? ALA A 437 SER A 442 
AB 1 CYS A 80  ? LEU A 81  ? CYS A 80  LEU A 81  
AB 2 THR A 127 ? PHE A 129 ? THR A 127 PHE A 129 
AB 3 VAL A 195 ? PHE A 199 ? VAL A 195 PHE A 199 
AB 4 LYS A 233 ? VAL A 238 ? LYS A 233 VAL A 238 
AB 5 ASP A 268 ? SER A 271 ? ASP A 268 SER A 271 
AB 6 TYR A 533 ? ASN A 537 ? TYR A 533 ASN A 537 
AB 7 SER A 506 ? GLU A 509 ? SER A 506 GLU A 509 
AC 1 PHE A 92  ? LEU A 94  ? PHE A 92  LEU A 94  
AC 2 ALA A 97  ? ILE A 99  ? ALA A 97  ILE A 99  
AD 1 TYR A 327 ? ILE A 328 ? TYR A 327 ILE A 328 
AD 2 GLN A 331 ? PHE A 332 ? GLN A 331 PHE A 332 
AE 1 VAL A 540 ? CYS A 543 ? VAL A 540 CYS A 543 
AE 2 MET A 572 ? ILE A 575 ? MET A 572 ILE A 575 
AF 1 THR A 553 ? PRO A 554 ? THR A 553 PRO A 554 
AF 2 PHE A 559 ? VAL A 560 ? PHE A 559 VAL A 560 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N HIS A 64  ? N HIS A 64  O THR A 316 ? O THR A 316 
AA 2 3 N LEU A 312 ? N LEU A 312 O SER A 396 ? O SER A 396 
AA 3 4 N VAL A 397 ? N VAL A 397 O ALA A 437 ? O ALA A 437 
AB 1 2 O CYS A 80  ? O CYS A 80  N THR A 128 ? N THR A 128 
AB 2 3 N PHE A 129 ? N PHE A 129 O THR A 196 ? O THR A 196 
AB 3 4 N ILE A 197 ? N ILE A 197 O LYS A 233 ? O LYS A 233 
AB 4 5 N MET A 236 ? N MET A 236 O ASP A 268 ? O ASP A 268 
AB 5 6 N ILE A 269 ? N ILE A 269 O PHE A 534 ? O PHE A 534 
AB 6 7 N GLY A 535 ? N GLY A 535 O SER A 506 ? O SER A 506 
AC 1 2 N LEU A 94  ? N LEU A 94  O ALA A 97  ? O ALA A 97  
AD 1 2 N ILE A 328 ? N ILE A 328 O GLN A 331 ? O GLN A 331 
AE 1 2 N LYS A 542 ? N LYS A 542 O ASN A 573 ? O ASN A 573 
AF 1 2 N THR A 553 ? N THR A 553 O VAL A 560 ? O VAL A 560 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A1589'  
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MN A1590'  
AC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DGT A1587' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE DGT A1588' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 543 ? CYS A 543  . ? 1_555 ? 
2  AC1 4  CYS A 546 ? CYS A 546  . ? 1_555 ? 
3  AC1 4  CYS A 561 ? CYS A 561  . ? 1_555 ? 
4  AC1 4  CYS A 564 ? CYS A 564  . ? 1_555 ? 
5  AC2 1  DGT B .   ? DGT A 1587 . ? 1_555 ? 
6  AC3 18 GLU A 100 ? GLU A 100  . ? 1_555 ? 
7  AC3 18 PRO A 102 ? PRO A 102  . ? 1_555 ? 
8  AC3 18 LYS A 103 ? LYS A 103  . ? 1_555 ? 
9  AC3 18 VAL A 107 ? VAL A 107  . ? 1_555 ? 
10 AC3 18 ILE A 111 ? ILE A 111  . ? 1_555 ? 
11 AC3 18 LYS A 146 ? LYS A 146  . ? 1_555 ? 
12 AC3 18 LYS A 169 ? LYS A 169  . ? 1_555 ? 
13 AC3 18 ASP A 173 ? ASP A 173  . ? 1_555 ? 
14 AC3 18 GLN A 176 ? GLN A 176  . ? 1_555 ? 
15 AC3 18 ALA A 177 ? ALA A 177  . ? 1_555 ? 
16 AC3 18 TYR A 180 ? TYR A 180  . ? 1_555 ? 
17 AC3 18 GLU A 181 ? GLU A 181  . ? 1_555 ? 
18 AC3 18 MN  E .   ? MN  A 1590 . ? 1_555 ? 
19 AC3 18 HOH F .   ? HOH A 2077 . ? 1_555 ? 
20 AC3 18 HOH F .   ? HOH A 2220 . ? 1_555 ? 
21 AC3 18 HOH F .   ? HOH A 2221 . ? 1_555 ? 
22 AC3 18 HOH F .   ? HOH A 2222 . ? 1_555 ? 
23 AC3 18 HOH F .   ? HOH A 2223 . ? 1_555 ? 
24 AC4 11 HIS A 64  ? HIS A 64   . ? 1_555 ? 
25 AC4 11 HIS A 66  ? HIS A 66   . ? 1_555 ? 
26 AC4 11 ASP A 67  ? ASP A 67   . ? 1_555 ? 
27 AC4 11 GLU A 446 ? GLU A 446  . ? 1_555 ? 
28 AC4 11 ASN A 447 ? ASN A 447  . ? 1_555 ? 
29 AC4 11 LEU A 448 ? LEU A 448  . ? 1_555 ? 
30 AC4 11 HOH F .   ? HOH A 2014 . ? 1_555 ? 
31 AC4 11 HOH F .   ? HOH A 2224 . ? 1_555 ? 
32 AC4 11 HOH F .   ? HOH A 2226 . ? 1_555 ? 
33 AC4 11 HOH F .   ? HOH A 2227 . ? 1_555 ? 
34 AC4 11 HOH F .   ? HOH A 2228 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HK8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HK8 
_atom_sites.fract_transf_matrix[1][1]   0.010187 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010187 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004063 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 26  ? 38.966 76.519  61.595  1.00 88.39  ? 26   ASP A N     1 
ATOM   2    C  CA    . ASP A 1 26  ? 39.533 77.872  61.318  1.00 88.37  ? 26   ASP A CA    1 
ATOM   3    C  C     . ASP A 1 26  ? 38.443 78.950  61.455  1.00 86.59  ? 26   ASP A C     1 
ATOM   4    O  O     . ASP A 1 26  ? 38.311 79.555  62.526  1.00 88.48  ? 26   ASP A O     1 
ATOM   5    C  CB    . ASP A 1 26  ? 40.213 77.899  59.933  1.00 88.65  ? 26   ASP A CB    1 
ATOM   6    C  CG    . ASP A 1 26  ? 40.737 79.284  59.548  1.00 88.85  ? 26   ASP A CG    1 
ATOM   7    O  OD1   . ASP A 1 26  ? 40.309 79.819  58.498  1.00 87.83  ? 26   ASP A OD1   1 
ATOM   8    O  OD2   . ASP A 1 26  ? 41.584 79.903  60.230  1.00 90.01  ? 26   ASP A OD2   1 
ATOM   9    N  N     . SER A 1 27  ? 37.662 79.171  60.392  1.00 82.90  ? 27   SER A N     1 
ATOM   10   C  CA    . SER A 1 27  ? 36.670 80.260  60.348  1.00 80.31  ? 27   SER A CA    1 
ATOM   11   C  C     . SER A 1 27  ? 35.862 80.275  59.035  1.00 75.42  ? 27   SER A C     1 
ATOM   12   O  O     . SER A 1 27  ? 34.629 80.169  59.059  1.00 73.98  ? 27   SER A O     1 
ATOM   13   C  CB    . SER A 1 27  ? 37.349 81.632  60.543  1.00 81.46  ? 27   SER A CB    1 
ATOM   14   O  OG    . SER A 1 27  ? 37.139 82.133  61.852  1.00 82.25  ? 27   SER A OG    1 
ATOM   15   N  N     . ARG A 1 28  ? 36.560 80.435  57.904  1.00 68.91  ? 28   ARG A N     1 
ATOM   16   C  CA    . ARG A 1 28  ? 35.920 80.387  56.582  1.00 63.96  ? 28   ARG A CA    1 
ATOM   17   C  C     . ARG A 1 28  ? 35.962 78.962  55.987  1.00 54.27  ? 28   ARG A C     1 
ATOM   18   O  O     . ARG A 1 28  ? 35.485 78.731  54.895  1.00 52.67  ? 28   ARG A O     1 
ATOM   19   C  CB    . ARG A 1 28  ? 36.553 81.421  55.633  1.00 66.29  ? 28   ARG A CB    1 
ATOM   20   C  CG    . ARG A 1 28  ? 35.593 82.043  54.580  1.00 67.58  ? 28   ARG A CG    1 
ATOM   21   C  CD    . ARG A 1 28  ? 35.810 81.546  53.142  1.00 67.72  ? 28   ARG A CD    1 
ATOM   22   N  NE    . ARG A 1 28  ? 36.399 82.533  52.214  1.00 67.66  ? 28   ARG A NE    1 
ATOM   23   C  CZ    . ARG A 1 28  ? 35.888 82.883  51.015  1.00 67.30  ? 28   ARG A CZ    1 
ATOM   24   N  NH1   . ARG A 1 28  ? 34.746 82.369  50.557  1.00 69.17  ? 28   ARG A NH1   1 
ATOM   25   N  NH2   . ARG A 1 28  ? 36.513 83.779  50.267  1.00 66.40  ? 28   ARG A NH2   1 
ATOM   26   N  N     . VAL A 1 29  ? 36.488 78.012  56.750  1.00 47.18  ? 29   VAL A N     1 
ATOM   27   C  CA    . VAL A 1 29  ? 36.546 76.594  56.370  1.00 41.97  ? 29   VAL A CA    1 
ATOM   28   C  C     . VAL A 1 29  ? 35.138 75.962  56.468  1.00 39.06  ? 29   VAL A C     1 
ATOM   29   O  O     . VAL A 1 29  ? 34.415 76.242  57.400  1.00 38.69  ? 29   VAL A O     1 
ATOM   30   C  CB    . VAL A 1 29  ? 37.630 75.899  57.256  1.00 40.80  ? 29   VAL A CB    1 
ATOM   31   C  CG1   . VAL A 1 29  ? 37.171 74.622  57.862  1.00 42.85  ? 29   VAL A CG1   1 
ATOM   32   C  CG2   . VAL A 1 29  ? 38.890 75.674  56.480  1.00 42.18  ? 29   VAL A CG2   1 
ATOM   33   N  N     . PHE A 1 30  ? 34.742 75.129  55.509  1.00 36.59  ? 30   PHE A N     1 
ATOM   34   C  CA    . PHE A 1 30  ? 33.334 74.717  55.381  1.00 35.75  ? 30   PHE A CA    1 
ATOM   35   C  C     . PHE A 1 30  ? 32.659 74.143  56.648  1.00 37.82  ? 30   PHE A C     1 
ATOM   36   O  O     . PHE A 1 30  ? 31.585 74.596  57.020  1.00 36.91  ? 30   PHE A O     1 
ATOM   37   C  CB    . PHE A 1 30  ? 33.160 73.692  54.267  1.00 34.29  ? 30   PHE A CB    1 
ATOM   38   C  CG    . PHE A 1 30  ? 33.170 74.267  52.876  1.00 34.73  ? 30   PHE A CG    1 
ATOM   39   C  CD1   . PHE A 1 30  ? 32.276 75.263  52.504  1.00 33.48  ? 30   PHE A CD1   1 
ATOM   40   C  CD2   . PHE A 1 30  ? 34.050 73.762  51.910  1.00 33.09  ? 30   PHE A CD2   1 
ATOM   41   C  CE1   . PHE A 1 30  ? 32.289 75.767  51.219  1.00 32.49  ? 30   PHE A CE1   1 
ATOM   42   C  CE2   . PHE A 1 30  ? 34.045 74.262  50.623  1.00 31.93  ? 30   PHE A CE2   1 
ATOM   43   C  CZ    . PHE A 1 30  ? 33.165 75.264  50.279  1.00 29.83  ? 30   PHE A CZ    1 
ATOM   44   N  N     . PRO A 1 31  ? 33.254 73.140  57.294  1.00 38.40  ? 31   PRO A N     1 
ATOM   45   C  CA    . PRO A 1 31  ? 32.592 72.492  58.440  1.00 37.34  ? 31   PRO A CA    1 
ATOM   46   C  C     . PRO A 1 31  ? 32.425 73.455  59.620  1.00 37.60  ? 31   PRO A C     1 
ATOM   47   O  O     . PRO A 1 31  ? 31.504 73.370  60.421  1.00 39.54  ? 31   PRO A O     1 
ATOM   48   C  CB    . PRO A 1 31  ? 33.531 71.337  58.808  1.00 35.34  ? 31   PRO A CB    1 
ATOM   49   C  CG    . PRO A 1 31  ? 34.518 71.216  57.652  1.00 37.22  ? 31   PRO A CG    1 
ATOM   50   C  CD    . PRO A 1 31  ? 34.586 72.559  57.014  1.00 36.38  ? 31   PRO A CD    1 
ATOM   51   N  N     . THR A 1 32  ? 33.347 74.385  59.720  1.00 37.19  ? 32   THR A N     1 
ATOM   52   C  CA    . THR A 1 32  ? 33.240 75.448  60.702  1.00 37.31  ? 32   THR A CA    1 
ATOM   53   C  C     . THR A 1 32  ? 32.092 76.392  60.403  1.00 32.77  ? 32   THR A C     1 
ATOM   54   O  O     . THR A 1 32  ? 31.446 76.841  61.321  1.00 35.79  ? 32   THR A O     1 
ATOM   55   C  CB    . THR A 1 32  ? 34.578 76.209  60.772  1.00 36.66  ? 32   THR A CB    1 
ATOM   56   O  OG1   . THR A 1 32  ? 35.580 75.302  61.242  1.00 40.17  ? 32   THR A OG1   1 
ATOM   57   C  CG2   . THR A 1 32  ? 34.547 77.276  61.835  1.00 38.45  ? 32   THR A CG2   1 
ATOM   58   N  N     . GLN A 1 33  ? 31.857 76.701  59.129  1.00 31.25  ? 33   GLN A N     1 
ATOM   59   C  CA    . GLN A 1 33  ? 30.789 77.603  58.739  1.00 33.40  ? 33   GLN A CA    1 
ATOM   60   C  C     . GLN A 1 33  ? 29.434 76.957  59.017  1.00 33.21  ? 33   GLN A C     1 
ATOM   61   O  O     . GLN A 1 33  ? 28.522 77.618  59.490  1.00 31.61  ? 33   GLN A O     1 
ATOM   62   C  CB    . GLN A 1 33  ? 30.892 77.961  57.264  1.00 35.82  ? 33   GLN A CB    1 
ATOM   63   C  CG    . GLN A 1 33  ? 32.047 78.861  56.943  1.00 41.21  ? 33   GLN A CG    1 
ATOM   64   C  CD    . GLN A 1 33  ? 31.622 80.297  56.804  1.00 46.40  ? 33   GLN A CD    1 
ATOM   65   O  OE1   . GLN A 1 33  ? 31.444 80.997  57.803  1.00 49.28  ? 33   GLN A OE1   1 
ATOM   66   N  NE2   . GLN A 1 33  ? 31.446 80.745  55.566  1.00 51.00  ? 33   GLN A NE2   1 
ATOM   67   N  N     . ARG A 1 34  ? 29.331 75.665  58.715  1.00 31.39  ? 34   ARG A N     1 
ATOM   68   C  CA    . ARG A 1 34  ? 28.146 74.870  59.007  1.00 31.87  ? 34   ARG A CA    1 
ATOM   69   C  C     . ARG A 1 34  ? 27.879 74.834  60.489  1.00 31.05  ? 34   ARG A C     1 
ATOM   70   O  O     . ARG A 1 34  ? 26.735 74.933  60.918  1.00 29.96  ? 34   ARG A O     1 
ATOM   71   C  CB    . ARG A 1 34  ? 28.307 73.433  58.522  1.00 31.81  ? 34   ARG A CB    1 
ATOM   72   C  CG    . ARG A 1 34  ? 28.598 73.308  57.035  1.00 34.04  ? 34   ARG A CG    1 
ATOM   73   C  CD    . ARG A 1 34  ? 27.396 73.300  56.154  1.00 32.18  ? 34   ARG A CD    1 
ATOM   74   N  NE    . ARG A 1 34  ? 26.486 72.195  56.444  1.00 32.18  ? 34   ARG A NE    1 
ATOM   75   C  CZ    . ARG A 1 34  ? 25.254 72.110  55.932  1.00 32.50  ? 34   ARG A CZ    1 
ATOM   76   N  NH1   . ARG A 1 34  ? 24.816 73.018  55.075  1.00 32.27  ? 34   ARG A NH1   1 
ATOM   77   N  NH2   . ARG A 1 34  ? 24.460 71.110  56.260  1.00 32.96  ? 34   ARG A NH2   1 
ATOM   78   N  N     . ASP A 1 35  ? 28.943 74.673  61.268  1.00 32.31  ? 35   ASP A N     1 
ATOM   79   C  CA    . ASP A 1 35  ? 28.826 74.624  62.708  1.00 31.89  ? 35   ASP A CA    1 
ATOM   80   C  C     . ASP A 1 35  ? 28.374 75.974  63.250  1.00 31.45  ? 35   ASP A C     1 
ATOM   81   O  O     . ASP A 1 35  ? 27.543 76.020  64.152  1.00 31.21  ? 35   ASP A O     1 
ATOM   82   C  CB    . ASP A 1 35  ? 30.145 74.226  63.346  1.00 35.27  ? 35   ASP A CB    1 
ATOM   83   C  CG    . ASP A 1 35  ? 30.062 74.193  64.859  1.00 37.38  ? 35   ASP A CG    1 
ATOM   84   O  OD1   . ASP A 1 35  ? 29.559 73.188  65.405  1.00 37.02  ? 35   ASP A OD1   1 
ATOM   85   O  OD2   . ASP A 1 35  ? 30.439 75.143  65.575  1.00 40.08  ? 35   ASP A OD2   1 
ATOM   86   N  N     . LEU A 1 36  ? 28.901 77.067  62.699  1.00 29.73  ? 36   LEU A N     1 
ATOM   87   C  CA    . LEU A 1 36  ? 28.456 78.386  63.108  1.00 32.36  ? 36   LEU A CA    1 
ATOM   88   C  C     . LEU A 1 36  ? 26.982 78.569  62.809  1.00 31.25  ? 36   LEU A C     1 
ATOM   89   O  O     . LEU A 1 36  ? 26.293 79.211  63.570  1.00 31.57  ? 36   LEU A O     1 
ATOM   90   C  CB    . LEU A 1 36  ? 29.283 79.499  62.468  1.00 37.73  ? 36   LEU A CB    1 
ATOM   91   C  CG    . LEU A 1 36  ? 30.644 79.761  63.132  1.00 43.50  ? 36   LEU A CG    1 
ATOM   92   C  CD1   . LEU A 1 36  ? 31.307 81.014  62.551  1.00 45.76  ? 36   LEU A CD1   1 
ATOM   93   C  CD2   . LEU A 1 36  ? 30.535 79.894  64.666  1.00 44.63  ? 36   LEU A CD2   1 
ATOM   94   N  N     . MET A 1 37  ? 26.479 77.960  61.742  1.00 29.91  ? 37   MET A N     1 
ATOM   95   C  CA    . MET A 1 37  ? 25.061 78.075  61.448  1.00 32.38  ? 37   MET A CA    1 
ATOM   96   C  C     . MET A 1 37  ? 24.219 77.403  62.524  1.00 31.99  ? 37   MET A C     1 
ATOM   97   O  O     . MET A 1 37  ? 23.227 77.972  62.956  1.00 32.72  ? 37   MET A O     1 
ATOM   98   C  CB    . MET A 1 37  ? 24.723 77.513  60.079  1.00 31.81  ? 37   MET A CB    1 
ATOM   99   C  CG    . MET A 1 37  ? 25.364 78.274  58.934  1.00 35.27  ? 37   MET A CG    1 
ATOM   100  S  SD    . MET A 1 37  ? 25.030 77.472  57.376  1.00 35.39  ? 37   MET A SD    1 
ATOM   101  C  CE    . MET A 1 37  ? 25.391 78.754  56.237  1.00 36.22  ? 37   MET A CE    1 
ATOM   102  N  N     . ALA A 1 38  ? 24.622 76.200  62.945  1.00 31.40  ? 38   ALA A N     1 
ATOM   103  C  CA    . ALA A 1 38  ? 23.944 75.479  64.013  1.00 29.09  ? 38   ALA A CA    1 
ATOM   104  C  C     . ALA A 1 38  ? 24.102 76.192  65.349  1.00 26.90  ? 38   ALA A C     1 
ATOM   105  O  O     . ALA A 1 38  ? 23.192 76.222  66.141  1.00 26.21  ? 38   ALA A O     1 
ATOM   106  C  CB    . ALA A 1 38  ? 24.463 74.053  64.113  1.00 29.22  ? 38   ALA A CB    1 
ATOM   107  N  N     . GLY A 1 39  ? 25.267 76.761  65.588  1.00 31.15  ? 39   GLY A N     1 
ATOM   108  C  CA    . GLY A 1 39  ? 25.521 77.549  66.783  1.00 33.96  ? 39   GLY A CA    1 
ATOM   109  C  C     . GLY A 1 39  ? 24.612 78.756  66.923  1.00 34.06  ? 39   GLY A C     1 
ATOM   110  O  O     . GLY A 1 39  ? 24.195 79.072  68.030  1.00 33.25  ? 39   GLY A O     1 
ATOM   111  N  N     . ILE A 1 40  ? 24.310 79.415  65.805  1.00 34.44  ? 40   ILE A N     1 
ATOM   112  C  CA    . ILE A 1 40  ? 23.399 80.565  65.775  1.00 36.83  ? 40   ILE A CA    1 
ATOM   113  C  C     . ILE A 1 40  ? 21.946 80.144  66.015  1.00 32.30  ? 40   ILE A C     1 
ATOM   114  O  O     . ILE A 1 40  ? 21.223 80.762  66.785  1.00 33.04  ? 40   ILE A O     1 
ATOM   115  C  CB    . ILE A 1 40  ? 23.518 81.308  64.407  1.00 39.88  ? 40   ILE A CB    1 
ATOM   116  C  CG1   . ILE A 1 40  ? 24.839 82.082  64.322  1.00 44.01  ? 40   ILE A CG1   1 
ATOM   117  C  CG2   . ILE A 1 40  ? 22.325 82.215  64.159  1.00 39.80  ? 40   ILE A CG2   1 
ATOM   118  C  CD1   . ILE A 1 40  ? 25.326 82.697  65.677  1.00 48.50  ? 40   ILE A CD1   1 
ATOM   119  N  N     . VAL A 1 41  ? 21.523 79.094  65.344  1.00 28.58  ? 41   VAL A N     1 
ATOM   120  C  CA    . VAL A 1 41  ? 20.195 78.550  65.569  1.00 29.05  ? 41   VAL A CA    1 
ATOM   121  C  C     . VAL A 1 41  ? 20.049 78.108  67.020  1.00 27.12  ? 41   VAL A C     1 
ATOM   122  O  O     . VAL A 1 41  ? 18.973 78.247  67.615  1.00 20.85  ? 41   VAL A O     1 
ATOM   123  C  CB    . VAL A 1 41  ? 19.916 77.374  64.630  1.00 28.95  ? 41   VAL A CB    1 
ATOM   124  C  CG1   . VAL A 1 41  ? 18.578 76.710  64.972  1.00 30.28  ? 41   VAL A CG1   1 
ATOM   125  C  CG2   . VAL A 1 41  ? 19.876 77.878  63.204  1.00 29.13  ? 41   VAL A CG2   1 
ATOM   126  N  N     . SER A 1 42  ? 21.147 77.634  67.605  1.00 24.48  ? 42   SER A N     1 
ATOM   127  C  CA    . SER A 1 42  ? 21.091 77.100  68.944  1.00 26.98  ? 42   SER A CA    1 
ATOM   128  C  C     . SER A 1 42  ? 21.009 78.211  69.973  1.00 28.71  ? 42   SER A C     1 
ATOM   129  O  O     . SER A 1 42  ? 20.304 78.057  70.962  1.00 31.24  ? 42   SER A O     1 
ATOM   130  C  CB    . SER A 1 42  ? 22.269 76.155  69.219  1.00 26.35  ? 42   SER A CB    1 
ATOM   131  O  OG    . SER A 1 42  ? 22.118 74.964  68.489  1.00 22.78  ? 42   SER A OG    1 
ATOM   132  N  N     . LYS A 1 43  ? 21.704 79.326  69.744  1.00 33.42  ? 43   LYS A N     1 
ATOM   133  C  CA    . LYS A 1 43  ? 21.588 80.514  70.614  1.00 36.47  ? 43   LYS A CA    1 
ATOM   134  C  C     . LYS A 1 43  ? 20.169 81.080  70.601  1.00 39.17  ? 43   LYS A C     1 
ATOM   135  O  O     . LYS A 1 43  ? 19.680 81.547  71.622  1.00 43.39  ? 43   LYS A O     1 
ATOM   136  C  CB    . LYS A 1 43  ? 22.553 81.619  70.201  1.00 39.35  ? 43   LYS A CB    1 
ATOM   137  C  CG    . LYS A 1 43  ? 23.966 81.473  70.740  1.00 45.01  ? 43   LYS A CG    1 
ATOM   138  C  CD    . LYS A 1 43  ? 24.916 82.518  70.100  1.00 50.16  ? 43   LYS A CD    1 
ATOM   139  C  CE    . LYS A 1 43  ? 26.259 81.902  69.712  1.00 52.62  ? 43   LYS A CE    1 
ATOM   140  N  NZ    . LYS A 1 43  ? 27.281 82.925  69.330  1.00 54.78  ? 43   LYS A NZ    1 
ATOM   141  N  N     . HIS A 1 44  ? 19.523 81.033  69.445  1.00 39.61  ? 44   HIS A N     1 
ATOM   142  C  CA    . HIS A 1 44  ? 18.173 81.542  69.273  1.00 42.06  ? 44   HIS A CA    1 
ATOM   143  C  C     . HIS A 1 44  ? 17.184 80.671  70.055  1.00 39.06  ? 44   HIS A C     1 
ATOM   144  O  O     . HIS A 1 44  ? 16.279 81.158  70.700  1.00 40.47  ? 44   HIS A O     1 
ATOM   145  C  CB    . HIS A 1 44  ? 17.839 81.568  67.765  1.00 44.99  ? 44   HIS A CB    1 
ATOM   146  C  CG    . HIS A 1 44  ? 16.494 82.151  67.438  1.00 50.72  ? 44   HIS A CG    1 
ATOM   147  N  ND1   . HIS A 1 44  ? 15.315 81.459  67.621  1.00 53.69  ? 44   HIS A ND1   1 
ATOM   148  C  CD2   . HIS A 1 44  ? 16.144 83.354  66.918  1.00 53.84  ? 44   HIS A CD2   1 
ATOM   149  C  CE1   . HIS A 1 44  ? 14.296 82.215  67.248  1.00 54.68  ? 44   HIS A CE1   1 
ATOM   150  N  NE2   . HIS A 1 44  ? 14.771 83.369  66.816  1.00 54.23  ? 44   HIS A NE2   1 
ATOM   151  N  N     . ILE A 1 45  ? 17.368 79.364  69.983  1.00 39.81  ? 45   ILE A N     1 
ATOM   152  C  CA    . ILE A 1 45  ? 16.505 78.427  70.674  1.00 35.13  ? 45   ILE A CA    1 
ATOM   153  C  C     . ILE A 1 45  ? 16.669 78.551  72.191  1.00 34.90  ? 45   ILE A C     1 
ATOM   154  O  O     . ILE A 1 45  ? 15.706 78.415  72.934  1.00 36.81  ? 45   ILE A O     1 
ATOM   155  C  CB    . ILE A 1 45  ? 16.825 77.022  70.194  1.00 33.74  ? 45   ILE A CB    1 
ATOM   156  C  CG1   . ILE A 1 45  ? 16.239 76.822  68.796  1.00 34.74  ? 45   ILE A CG1   1 
ATOM   157  C  CG2   . ILE A 1 45  ? 16.266 75.969  71.152  1.00 34.80  ? 45   ILE A CG2   1 
ATOM   158  C  CD1   . ILE A 1 45  ? 16.517 75.392  68.201  1.00 33.00  ? 45   ILE A CD1   1 
ATOM   159  N  N     . ALA A 1 46  ? 17.893 78.812  72.634  1.00 34.80  ? 46   ALA A N     1 
ATOM   160  C  CA    . ALA A 1 46  ? 18.202 79.019  74.035  1.00 36.54  ? 46   ALA A CA    1 
ATOM   161  C  C     . ALA A 1 46  ? 17.516 80.252  74.585  1.00 40.16  ? 46   ALA A C     1 
ATOM   162  O  O     . ALA A 1 46  ? 17.183 80.287  75.763  1.00 42.09  ? 46   ALA A O     1 
ATOM   163  C  CB    . ALA A 1 46  ? 19.708 79.148  74.231  1.00 36.96  ? 46   ALA A CB    1 
ATOM   164  N  N     . LYS A 1 47  ? 17.338 81.262  73.740  1.00 42.86  ? 47   LYS A N     1 
ATOM   165  C  CA    . LYS A 1 47  ? 16.642 82.487  74.109  1.00 47.47  ? 47   LYS A CA    1 
ATOM   166  C  C     . LYS A 1 47  ? 15.159 82.214  74.410  1.00 47.29  ? 47   LYS A C     1 
ATOM   167  O  O     . LYS A 1 47  ? 14.547 82.940  75.183  1.00 44.93  ? 47   LYS A O     1 
ATOM   168  C  CB    . LYS A 1 47  ? 16.773 83.525  72.983  1.00 52.43  ? 47   LYS A CB    1 
ATOM   169  C  CG    . LYS A 1 47  ? 17.192 84.908  73.442  1.00 56.31  ? 47   LYS A CG    1 
ATOM   170  C  CD    . LYS A 1 47  ? 18.697 84.976  73.693  1.00 59.01  ? 47   LYS A CD    1 
ATOM   171  C  CE    . LYS A 1 47  ? 19.488 85.379  72.451  1.00 59.88  ? 47   LYS A CE    1 
ATOM   172  N  NZ    . LYS A 1 47  ? 20.782 86.003  72.830  1.00 60.52  ? 47   LYS A NZ    1 
ATOM   173  N  N     . ASN A 1 48  ? 14.592 81.182  73.781  1.00 47.74  ? 48   ASN A N     1 
ATOM   174  C  CA    . ASN A 1 48  ? 13.215 80.739  74.048  1.00 50.40  ? 48   ASN A CA    1 
ATOM   175  C  C     . ASN A 1 48  ? 13.069 79.701  75.170  1.00 49.85  ? 48   ASN A C     1 
ATOM   176  O  O     . ASN A 1 48  ? 11.954 79.445  75.617  1.00 51.13  ? 48   ASN A O     1 
ATOM   177  C  CB    . ASN A 1 48  ? 12.564 80.158  72.772  1.00 52.07  ? 48   ASN A CB    1 
ATOM   178  C  CG    . ASN A 1 48  ? 12.583 81.137  71.588  1.00 55.80  ? 48   ASN A CG    1 
ATOM   179  O  OD1   . ASN A 1 48  ? 12.840 80.746  70.439  1.00 59.33  ? 48   ASN A OD1   1 
ATOM   180  N  ND2   . ASN A 1 48  ? 12.307 82.405  71.863  1.00 54.45  ? 48   ASN A ND2   1 
ATOM   181  N  N     . MET A 1 49  ? 14.172 79.087  75.598  1.00 47.52  ? 49   MET A N     1 
ATOM   182  C  CA    . MET A 1 49  ? 14.137 78.009  76.596  1.00 46.33  ? 49   MET A CA    1 
ATOM   183  C  C     . MET A 1 49  ? 14.565 78.467  77.985  1.00 44.41  ? 49   MET A C     1 
ATOM   184  O  O     . MET A 1 49  ? 14.109 77.928  78.981  1.00 47.72  ? 49   MET A O     1 
ATOM   185  C  CB    . MET A 1 49  ? 15.074 76.868  76.184  1.00 45.56  ? 49   MET A CB    1 
ATOM   186  C  CG    . MET A 1 49  ? 14.536 75.992  75.090  1.00 47.55  ? 49   MET A CG    1 
ATOM   187  S  SD    . MET A 1 49  ? 15.779 74.806  74.562  1.00 47.75  ? 49   MET A SD    1 
ATOM   188  C  CE    . MET A 1 49  ? 15.304 73.348  75.596  1.00 48.52  ? 49   MET A CE    1 
ATOM   189  N  N     . VAL A 1 50  ? 15.480 79.422  78.034  1.00 42.53  ? 50   VAL A N     1 
ATOM   190  C  CA    . VAL A 1 50  ? 16.132 79.836  79.263  1.00 42.92  ? 50   VAL A CA    1 
ATOM   191  C  C     . VAL A 1 50  ? 15.380 81.045  79.809  1.00 42.46  ? 50   VAL A C     1 
ATOM   192  O  O     . VAL A 1 50  ? 15.134 81.999  79.068  1.00 38.94  ? 50   VAL A O     1 
ATOM   193  C  CB    . VAL A 1 50  ? 17.598 80.225  79.001  1.00 43.30  ? 50   VAL A CB    1 
ATOM   194  C  CG1   . VAL A 1 50  ? 18.288 80.748  80.277  1.00 42.00  ? 50   VAL A CG1   1 
ATOM   195  C  CG2   . VAL A 1 50  ? 18.363 79.031  78.416  1.00 44.47  ? 50   VAL A CG2   1 
ATOM   196  N  N     . PRO A 1 51  ? 14.966 80.989  81.073  1.00 40.35  ? 51   PRO A N     1 
ATOM   197  C  CA    . PRO A 1 51  ? 14.305 82.137  81.703  1.00 42.73  ? 51   PRO A CA    1 
ATOM   198  C  C     . PRO A 1 51  ? 15.081 83.438  81.515  1.00 39.63  ? 51   PRO A C     1 
ATOM   199  O  O     . PRO A 1 51  ? 16.297 83.467  81.655  1.00 35.70  ? 51   PRO A O     1 
ATOM   200  C  CB    . PRO A 1 51  ? 14.229 81.733  83.183  1.00 42.36  ? 51   PRO A CB    1 
ATOM   201  C  CG    . PRO A 1 51  ? 14.168 80.247  83.155  1.00 40.60  ? 51   PRO A CG    1 
ATOM   202  C  CD    . PRO A 1 51  ? 15.038 79.844  81.992  1.00 40.12  ? 51   PRO A CD    1 
ATOM   203  N  N     . SER A 1 52  ? 14.345 84.489  81.178  1.00 41.23  ? 52   SER A N     1 
ATOM   204  C  CA    . SER A 1 52  ? 14.876 85.841  80.993  1.00 41.88  ? 52   SER A CA    1 
ATOM   205  C  C     . SER A 1 52  ? 15.930 86.307  82.009  1.00 39.82  ? 52   SER A C     1 
ATOM   206  O  O     . SER A 1 52  ? 16.933 86.851  81.609  1.00 43.23  ? 52   SER A O     1 
ATOM   207  C  CB    . SER A 1 52  ? 13.717 86.838  80.998  1.00 44.51  ? 52   SER A CB    1 
ATOM   208  O  OG    . SER A 1 52  ? 13.964 87.892  80.103  1.00 48.20  ? 52   SER A OG    1 
ATOM   209  N  N     . PHE A 1 53  ? 15.708 86.116  83.307  1.00 38.20  ? 53   PHE A N     1 
ATOM   210  C  CA    . PHE A 1 53  ? 16.633 86.639  84.327  1.00 37.41  ? 53   PHE A CA    1 
ATOM   211  C  C     . PHE A 1 53  ? 18.011 85.971  84.263  1.00 39.45  ? 53   PHE A C     1 
ATOM   212  O  O     . PHE A 1 53  ? 19.028 86.568  84.653  1.00 41.47  ? 53   PHE A O     1 
ATOM   213  C  CB    . PHE A 1 53  ? 16.036 86.568  85.769  1.00 35.85  ? 53   PHE A CB    1 
ATOM   214  C  CG    . PHE A 1 53  ? 15.944 85.158  86.363  1.00 36.91  ? 53   PHE A CG    1 
ATOM   215  C  CD1   . PHE A 1 53  ? 14.903 84.302  86.024  1.00 36.48  ? 53   PHE A CD1   1 
ATOM   216  C  CD2   . PHE A 1 53  ? 16.888 84.702  87.272  1.00 37.78  ? 53   PHE A CD2   1 
ATOM   217  C  CE1   . PHE A 1 53  ? 14.813 83.028  86.564  1.00 34.79  ? 53   PHE A CE1   1 
ATOM   218  C  CE2   . PHE A 1 53  ? 16.799 83.406  87.811  1.00 36.02  ? 53   PHE A CE2   1 
ATOM   219  C  CZ    . PHE A 1 53  ? 15.759 82.585  87.457  1.00 34.28  ? 53   PHE A CZ    1 
ATOM   220  N  N     . ILE A 1 54  ? 18.034 84.727  83.791  1.00 38.24  ? 54   ILE A N     1 
ATOM   221  C  CA    . ILE A 1 54  ? 19.276 83.984  83.636  1.00 36.33  ? 54   ILE A CA    1 
ATOM   222  C  C     . ILE A 1 54  ? 20.016 84.475  82.413  1.00 31.41  ? 54   ILE A C     1 
ATOM   223  O  O     . ILE A 1 54  ? 21.200 84.749  82.481  1.00 28.66  ? 54   ILE A O     1 
ATOM   224  C  CB    . ILE A 1 54  ? 18.986 82.464  83.562  1.00 37.63  ? 54   ILE A CB    1 
ATOM   225  C  CG1   . ILE A 1 54  ? 18.598 81.969  84.957  1.00 37.14  ? 54   ILE A CG1   1 
ATOM   226  C  CG2   . ILE A 1 54  ? 20.205 81.695  83.012  1.00 38.01  ? 54   ILE A CG2   1 
ATOM   227  C  CD1   . ILE A 1 54  ? 17.961 80.603  84.978  1.00 39.26  ? 54   ILE A CD1   1 
ATOM   228  N  N     . MET A 1 55  ? 19.305 84.583  81.300  1.00 33.25  ? 55   MET A N     1 
ATOM   229  C  CA    . MET A 1 55  ? 19.852 85.185  80.091  1.00 37.15  ? 55   MET A CA    1 
ATOM   230  C  C     . MET A 1 55  ? 20.374 86.592  80.340  1.00 37.63  ? 55   MET A C     1 
ATOM   231  O  O     . MET A 1 55  ? 21.494 86.899  79.963  1.00 37.29  ? 55   MET A O     1 
ATOM   232  C  CB    . MET A 1 55  ? 18.808 85.229  78.976  1.00 41.32  ? 55   MET A CB    1 
ATOM   233  C  CG    . MET A 1 55  ? 18.837 84.030  78.037  1.00 46.86  ? 55   MET A CG    1 
ATOM   234  S  SD    . MET A 1 55  ? 20.525 83.577  77.433  1.00 52.28  ? 55   MET A SD    1 
ATOM   235  C  CE    . MET A 1 55  ? 20.606 81.904  78.052  1.00 49.41  ? 55   MET A CE    1 
ATOM   236  N  N     . LYS A 1 56  ? 19.580 87.444  80.980  1.00 37.94  ? 56   LYS A N     1 
ATOM   237  C  CA    . LYS A 1 56  ? 20.004 88.831  81.238  1.00 42.57  ? 56   LYS A CA    1 
ATOM   238  C  C     . LYS A 1 56  ? 21.300 88.884  82.048  1.00 39.66  ? 56   LYS A C     1 
ATOM   239  O  O     . LYS A 1 56  ? 22.195 89.682  81.751  1.00 39.67  ? 56   LYS A O     1 
ATOM   240  C  CB    . LYS A 1 56  ? 18.914 89.638  81.961  1.00 46.21  ? 56   LYS A CB    1 
ATOM   241  C  CG    . LYS A 1 56  ? 18.394 90.837  81.173  1.00 51.17  ? 56   LYS A CG    1 
ATOM   242  C  CD    . LYS A 1 56  ? 17.272 90.470  80.203  1.00 54.46  ? 56   LYS A CD    1 
ATOM   243  C  CE    . LYS A 1 56  ? 17.025 91.596  79.157  1.00 57.70  ? 56   LYS A CE    1 
ATOM   244  N  NZ    . LYS A 1 56  ? 17.979 91.575  77.981  1.00 56.62  ? 56   LYS A NZ    1 
ATOM   245  N  N     . ALA A 1 57  ? 21.393 88.016  83.054  1.00 35.26  ? 57   ALA A N     1 
ATOM   246  C  CA    . ALA A 1 57  ? 22.569 87.934  83.901  1.00 33.69  ? 57   ALA A CA    1 
ATOM   247  C  C     . ALA A 1 57  ? 23.807 87.502  83.111  1.00 34.02  ? 57   ALA A C     1 
ATOM   248  O  O     . ALA A 1 57  ? 24.905 87.929  83.426  1.00 31.38  ? 57   ALA A O     1 
ATOM   249  C  CB    . ALA A 1 57  ? 22.309 86.993  85.069  1.00 33.22  ? 57   ALA A CB    1 
ATOM   250  N  N     . HIS A 1 58  ? 23.607 86.668  82.085  1.00 35.00  ? 58   HIS A N     1 
ATOM   251  C  CA    . HIS A 1 58  ? 24.674 86.222  81.181  1.00 35.03  ? 58   HIS A CA    1 
ATOM   252  C  C     . HIS A 1 58  ? 25.111 87.328  80.213  1.00 35.58  ? 58   HIS A C     1 
ATOM   253  O  O     . HIS A 1 58  ? 26.297 87.554  80.042  1.00 40.73  ? 58   HIS A O     1 
ATOM   254  C  CB    . HIS A 1 58  ? 24.221 84.952  80.430  1.00 35.29  ? 58   HIS A CB    1 
ATOM   255  C  CG    . HIS A 1 58  ? 25.132 84.525  79.320  1.00 34.88  ? 58   HIS A CG    1 
ATOM   256  N  ND1   . HIS A 1 58  ? 26.206 83.690  79.522  1.00 35.54  ? 58   HIS A ND1   1 
ATOM   257  C  CD2   . HIS A 1 58  ? 25.109 84.796  77.989  1.00 34.40  ? 58   HIS A CD2   1 
ATOM   258  C  CE1   . HIS A 1 58  ? 26.824 83.484  78.370  1.00 37.56  ? 58   HIS A CE1   1 
ATOM   259  N  NE2   . HIS A 1 58  ? 26.181 84.149  77.426  1.00 36.66  ? 58   HIS A NE2   1 
ATOM   260  N  N     . GLU A 1 59  ? 24.177 88.022  79.586  1.00 39.66  ? 59   GLU A N     1 
ATOM   261  C  CA    . GLU A 1 59  ? 24.525 89.168  78.715  1.00 43.66  ? 59   GLU A CA    1 
ATOM   262  C  C     . GLU A 1 59  ? 25.346 90.229  79.456  1.00 40.85  ? 59   GLU A C     1 
ATOM   263  O  O     . GLU A 1 59  ? 26.221 90.860  78.869  1.00 40.15  ? 59   GLU A O     1 
ATOM   264  C  CB    . GLU A 1 59  ? 23.306 89.895  78.092  1.00 46.81  ? 59   GLU A CB    1 
ATOM   265  C  CG    . GLU A 1 59  ? 22.009 89.123  77.831  1.00 53.18  ? 59   GLU A CG    1 
ATOM   266  C  CD    . GLU A 1 59  ? 22.044 88.223  76.605  1.00 57.65  ? 59   GLU A CD    1 
ATOM   267  O  OE1   . GLU A 1 59  ? 23.138 87.706  76.279  1.00 60.41  ? 59   GLU A OE1   1 
ATOM   268  O  OE2   . GLU A 1 59  ? 20.967 88.026  75.970  1.00 60.82  ? 59   GLU A OE2   1 
ATOM   269  N  N     . SER A 1 60  ? 25.054 90.427  80.737  1.00 38.96  ? 60   SER A N     1 
ATOM   270  C  CA    . SER A 1 60  ? 25.661 91.519  81.486  1.00 39.32  ? 60   SER A CA    1 
ATOM   271  C  C     . SER A 1 60  ? 26.973 91.110  82.150  1.00 37.68  ? 60   SER A C     1 
ATOM   272  O  O     . SER A 1 60  ? 27.718 91.966  82.630  1.00 37.52  ? 60   SER A O     1 
ATOM   273  C  CB    . SER A 1 60  ? 24.676 92.075  82.519  1.00 40.23  ? 60   SER A CB    1 
ATOM   274  O  OG    . SER A 1 60  ? 24.528 91.188  83.599  1.00 42.31  ? 60   SER A OG    1 
ATOM   275  N  N     . GLY A 1 61  ? 27.247 89.804  82.198  1.00 33.23  ? 61   GLY A N     1 
ATOM   276  C  CA    . GLY A 1 61  ? 28.511 89.319  82.701  1.00 27.94  ? 61   GLY A CA    1 
ATOM   277  C  C     . GLY A 1 61  ? 28.533 89.112  84.181  1.00 25.91  ? 61   GLY A C     1 
ATOM   278  O  O     . GLY A 1 61  ? 29.630 89.014  84.772  1.00 23.26  ? 61   GLY A O     1 
ATOM   279  N  N     . ILE A 1 62  ? 27.340 89.057  84.780  1.00 27.48  ? 62   ILE A N     1 
ATOM   280  C  CA    . ILE A 1 62  ? 27.175 88.652  86.186  1.00 32.74  ? 62   ILE A CA    1 
ATOM   281  C  C     . ILE A 1 62  ? 27.617 87.185  86.354  1.00 32.68  ? 62   ILE A C     1 
ATOM   282  O  O     . ILE A 1 62  ? 28.343 86.834  87.291  1.00 34.68  ? 62   ILE A O     1 
ATOM   283  C  CB    . ILE A 1 62  ? 25.684 88.783  86.613  1.00 35.62  ? 62   ILE A CB    1 
ATOM   284  C  CG1   . ILE A 1 62  ? 25.198 90.240  86.546  1.00 37.77  ? 62   ILE A CG1   1 
ATOM   285  C  CG2   . ILE A 1 62  ? 25.455 88.206  87.997  1.00 37.14  ? 62   ILE A CG2   1 
ATOM   286  C  CD1   . ILE A 1 62  ? 25.979 91.188  87.350  1.00 38.70  ? 62   ILE A CD1   1 
ATOM   287  N  N     . ILE A 1 63  ? 27.115 86.342  85.458  1.00 33.74  ? 63   ILE A N     1 
ATOM   288  C  CA    . ILE A 1 63  ? 27.544 84.942  85.313  1.00 36.74  ? 63   ILE A CA    1 
ATOM   289  C  C     . ILE A 1 63  ? 27.895 84.690  83.847  1.00 35.63  ? 63   ILE A C     1 
ATOM   290  O  O     . ILE A 1 63  ? 27.809 85.593  83.003  1.00 31.95  ? 63   ILE A O     1 
ATOM   291  C  CB    . ILE A 1 63  ? 26.432 83.960  85.730  1.00 34.87  ? 63   ILE A CB    1 
ATOM   292  C  CG1   . ILE A 1 63  ? 25.295 83.976  84.692  1.00 33.56  ? 63   ILE A CG1   1 
ATOM   293  C  CG2   . ILE A 1 63  ? 25.898 84.304  87.124  1.00 37.61  ? 63   ILE A CG2   1 
ATOM   294  C  CD1   . ILE A 1 63  ? 24.001 83.296  85.138  1.00 31.89  ? 63   ILE A CD1   1 
ATOM   295  N  N     . HIS A 1 64  ? 28.279 83.452  83.572  1.00 30.74  ? 64   HIS A N     1 
ATOM   296  C  CA    . HIS A 1 64  ? 28.528 82.978  82.228  1.00 30.41  ? 64   HIS A CA    1 
ATOM   297  C  C     . HIS A 1 64  ? 28.035 81.545  82.108  1.00 30.04  ? 64   HIS A C     1 
ATOM   298  O  O     . HIS A 1 64  ? 28.552 80.636  82.760  1.00 28.54  ? 64   HIS A O     1 
ATOM   299  C  CB    . HIS A 1 64  ? 30.016 83.021  81.893  1.00 31.14  ? 64   HIS A CB    1 
ATOM   300  C  CG    . HIS A 1 64  ? 30.316 82.720  80.457  1.00 30.65  ? 64   HIS A CG    1 
ATOM   301  N  ND1   . HIS A 1 64  ? 30.236 83.676  79.469  1.00 28.44  ? 64   HIS A ND1   1 
ATOM   302  C  CD2   . HIS A 1 64  ? 30.665 81.565  79.840  1.00 31.87  ? 64   HIS A CD2   1 
ATOM   303  C  CE1   . HIS A 1 64  ? 30.554 83.131  78.308  1.00 28.36  ? 64   HIS A CE1   1 
ATOM   304  N  NE2   . HIS A 1 64  ? 30.809 81.848  78.504  1.00 30.62  ? 64   HIS A NE2   1 
ATOM   305  N  N     . VAL A 1 65  ? 27.010 81.371  81.290  1.00 29.52  ? 65   VAL A N     1 
ATOM   306  C  CA    . VAL A 1 65  ? 26.507 80.061  80.929  1.00 29.36  ? 65   VAL A CA    1 
ATOM   307  C  C     . VAL A 1 65  ? 27.345 79.576  79.760  1.00 29.53  ? 65   VAL A C     1 
ATOM   308  O  O     . VAL A 1 65  ? 27.291 80.157  78.655  1.00 29.14  ? 65   VAL A O     1 
ATOM   309  C  CB    . VAL A 1 65  ? 25.033 80.138  80.557  1.00 29.31  ? 65   VAL A CB    1 
ATOM   310  C  CG1   . VAL A 1 65  ? 24.498 78.755  80.252  1.00 29.45  ? 65   VAL A CG1   1 
ATOM   311  C  CG2   . VAL A 1 65  ? 24.252 80.807  81.715  1.00 30.13  ? 65   VAL A CG2   1 
ATOM   312  N  N     . HIS A 1 66  ? 28.149 78.540  80.011  1.00 29.60  ? 66   HIS A N     1 
ATOM   313  C  CA    . HIS A 1 66  ? 29.090 78.047  79.007  1.00 29.39  ? 66   HIS A CA    1 
ATOM   314  C  C     . HIS A 1 66  ? 28.333 77.269  77.940  1.00 29.29  ? 66   HIS A C     1 
ATOM   315  O  O     . HIS A 1 66  ? 27.253 76.756  78.217  1.00 31.81  ? 66   HIS A O     1 
ATOM   316  C  CB    . HIS A 1 66  ? 30.170 77.187  79.639  1.00 29.78  ? 66   HIS A CB    1 
ATOM   317  C  CG    . HIS A 1 66  ? 31.122 77.939  80.519  1.00 28.65  ? 66   HIS A CG    1 
ATOM   318  N  ND1   . HIS A 1 66  ? 32.329 78.417  80.065  1.00 27.31  ? 66   HIS A ND1   1 
ATOM   319  C  CD2   . HIS A 1 66  ? 31.062 78.261  81.837  1.00 30.71  ? 66   HIS A CD2   1 
ATOM   320  C  CE1   . HIS A 1 66  ? 32.971 79.008  81.061  1.00 27.80  ? 66   HIS A CE1   1 
ATOM   321  N  NE2   . HIS A 1 66  ? 32.219 78.938  82.146  1.00 26.03  ? 66   HIS A NE2   1 
ATOM   322  N  N     . ASP A 1 67  ? 28.856 77.263  76.708  1.00 27.22  ? 67   ASP A N     1 
ATOM   323  C  CA    . ASP A 1 67  ? 28.390 76.363  75.632  1.00 28.72  ? 67   ASP A CA    1 
ATOM   324  C  C     . ASP A 1 67  ? 26.917 76.542  75.236  1.00 29.54  ? 67   ASP A C     1 
ATOM   325  O  O     . ASP A 1 67  ? 26.220 75.581  74.908  1.00 26.18  ? 67   ASP A O     1 
ATOM   326  C  CB    . ASP A 1 67  ? 28.675 74.897  76.013  1.00 30.47  ? 67   ASP A CB    1 
ATOM   327  C  CG    . ASP A 1 67  ? 30.074 74.721  76.578  1.00 30.73  ? 67   ASP A CG    1 
ATOM   328  O  OD1   . ASP A 1 67  ? 30.207 74.592  77.821  1.00 31.54  ? 67   ASP A OD1   1 
ATOM   329  O  OD2   . ASP A 1 67  ? 31.102 74.756  75.870  1.00 32.81  ? 67   ASP A OD2   1 
ATOM   330  N  N     . ILE A 1 68  ? 26.481 77.790  75.222  1.00 29.89  ? 68   ILE A N     1 
ATOM   331  C  CA    . ILE A 1 68  ? 25.114 78.144  74.893  1.00 32.27  ? 68   ILE A CA    1 
ATOM   332  C  C     . ILE A 1 68  ? 24.825 77.927  73.404  1.00 31.02  ? 68   ILE A C     1 
ATOM   333  O  O     . ILE A 1 68  ? 23.668 77.759  72.997  1.00 33.15  ? 68   ILE A O     1 
ATOM   334  C  CB    . ILE A 1 68  ? 24.847 79.626  75.345  1.00 36.08  ? 68   ILE A CB    1 
ATOM   335  C  CG1   . ILE A 1 68  ? 23.354 79.900  75.441  1.00 39.65  ? 68   ILE A CG1   1 
ATOM   336  C  CG2   . ILE A 1 68  ? 25.537 80.649  74.419  1.00 34.05  ? 68   ILE A CG2   1 
ATOM   337  C  CD1   . ILE A 1 68  ? 22.719 79.247  76.638  1.00 42.16  ? 68   ILE A CD1   1 
ATOM   338  N  N     . ASP A 1 69  ? 25.873 77.944  72.592  1.00 28.50  ? 69   ASP A N     1 
ATOM   339  C  CA    . ASP A 1 69  ? 25.767 77.552  71.177  1.00 30.00  ? 69   ASP A CA    1 
ATOM   340  C  C     . ASP A 1 69  ? 25.534 76.031  70.930  1.00 31.19  ? 69   ASP A C     1 
ATOM   341  O  O     . ASP A 1 69  ? 25.345 75.627  69.773  1.00 26.88  ? 69   ASP A O     1 
ATOM   342  C  CB    . ASP A 1 69  ? 26.962 78.075  70.354  1.00 32.15  ? 69   ASP A CB    1 
ATOM   343  C  CG    . ASP A 1 69  ? 28.349 77.598  70.877  1.00 38.25  ? 69   ASP A CG    1 
ATOM   344  O  OD1   . ASP A 1 69  ? 28.569 77.462  72.114  1.00 39.75  ? 69   ASP A OD1   1 
ATOM   345  O  OD2   . ASP A 1 69  ? 29.309 77.361  70.097  1.00 40.12  ? 69   ASP A OD2   1 
ATOM   346  N  N     . TYR A 1 70  ? 25.514 75.223  72.006  1.00 29.33  ? 70   TYR A N     1 
ATOM   347  C  CA    . TYR A 1 70  ? 25.179 73.792  71.953  1.00 30.55  ? 70   TYR A CA    1 
ATOM   348  C  C     . TYR A 1 70  ? 23.954 73.448  72.809  1.00 31.84  ? 70   TYR A C     1 
ATOM   349  O  O     . TYR A 1 70  ? 23.005 72.856  72.311  1.00 30.53  ? 70   TYR A O     1 
ATOM   350  C  CB    . TYR A 1 70  ? 26.365 72.964  72.420  1.00 31.51  ? 70   TYR A CB    1 
ATOM   351  C  CG    . TYR A 1 70  ? 27.473 72.889  71.406  1.00 35.43  ? 70   TYR A CG    1 
ATOM   352  C  CD1   . TYR A 1 70  ? 28.460 73.868  71.342  1.00 40.15  ? 70   TYR A CD1   1 
ATOM   353  C  CD2   . TYR A 1 70  ? 27.542 71.822  70.507  1.00 39.50  ? 70   TYR A CD2   1 
ATOM   354  C  CE1   . TYR A 1 70  ? 29.492 73.795  70.384  1.00 41.93  ? 70   TYR A CE1   1 
ATOM   355  C  CE2   . TYR A 1 70  ? 28.552 71.739  69.554  1.00 41.14  ? 70   TYR A CE2   1 
ATOM   356  C  CZ    . TYR A 1 70  ? 29.515 72.726  69.495  1.00 43.02  ? 70   TYR A CZ    1 
ATOM   357  O  OH    . TYR A 1 70  ? 30.504 72.620  68.554  1.00 49.51  ? 70   TYR A OH    1 
ATOM   358  N  N     . SER A 1 71  ? 23.971 73.850  74.084  1.00 33.13  ? 71   SER A N     1 
ATOM   359  C  CA    . SER A 1 71  ? 22.947 73.502  75.079  1.00 31.74  ? 71   SER A CA    1 
ATOM   360  C  C     . SER A 1 71  ? 22.311 74.751  75.681  1.00 34.30  ? 71   SER A C     1 
ATOM   361  O  O     . SER A 1 71  ? 23.019 75.726  75.927  1.00 31.79  ? 71   SER A O     1 
ATOM   362  C  CB    . SER A 1 71  ? 23.614 72.736  76.216  1.00 32.66  ? 71   SER A CB    1 
ATOM   363  O  OG    . SER A 1 71  ? 22.759 72.589  77.335  1.00 27.34  ? 71   SER A OG    1 
ATOM   364  N  N     . PRO A 1 72  ? 21.009 74.734  75.999  1.00 35.04  ? 72   PRO A N     1 
ATOM   365  C  CA    . PRO A 1 72  ? 20.122 73.556  75.985  1.00 32.86  ? 72   PRO A CA    1 
ATOM   366  C  C     . PRO A 1 72  ? 19.316 73.283  74.702  1.00 34.28  ? 72   PRO A C     1 
ATOM   367  O  O     . PRO A 1 72  ? 18.327 72.561  74.763  1.00 34.70  ? 72   PRO A O     1 
ATOM   368  C  CB    . PRO A 1 72  ? 19.129 73.907  77.091  1.00 33.79  ? 72   PRO A CB    1 
ATOM   369  C  CG    . PRO A 1 72  ? 18.999 75.415  76.994  1.00 34.65  ? 72   PRO A CG    1 
ATOM   370  C  CD    . PRO A 1 72  ? 20.298 75.937  76.457  1.00 33.95  ? 72   PRO A CD    1 
ATOM   371  N  N     . ALA A 1 73  ? 19.715 73.825  73.561  1.00 34.71  ? 73   ALA A N     1 
ATOM   372  C  CA    . ALA A 1 73  ? 18.928 73.650  72.341  1.00 32.44  ? 73   ALA A CA    1 
ATOM   373  C  C     . ALA A 1 73  ? 18.938 72.172  71.957  1.00 32.16  ? 73   ALA A C     1 
ATOM   374  O  O     . ALA A 1 73  ? 17.957 71.638  71.444  1.00 31.53  ? 73   ALA A O     1 
ATOM   375  C  CB    . ALA A 1 73  ? 19.493 74.502  71.231  1.00 30.98  ? 73   ALA A CB    1 
ATOM   376  N  N     . LEU A 1 74  ? 20.072 71.530  72.200  1.00 30.99  ? 74   LEU A N     1 
ATOM   377  C  CA    . LEU A 1 74  ? 20.165 70.094  72.164  1.00 32.34  ? 74   LEU A CA    1 
ATOM   378  C  C     . LEU A 1 74  ? 20.717 69.603  73.498  1.00 31.78  ? 74   LEU A C     1 
ATOM   379  O  O     . LEU A 1 74  ? 21.503 70.292  74.157  1.00 28.63  ? 74   LEU A O     1 
ATOM   380  C  CB    . LEU A 1 74  ? 21.053 69.632  71.003  1.00 33.96  ? 74   LEU A CB    1 
ATOM   381  C  CG    . LEU A 1 74  ? 20.563 69.873  69.568  1.00 33.09  ? 74   LEU A CG    1 
ATOM   382  C  CD1   . LEU A 1 74  ? 21.644 69.461  68.567  1.00 32.95  ? 74   LEU A CD1   1 
ATOM   383  C  CD2   . LEU A 1 74  ? 19.258 69.176  69.257  1.00 30.94  ? 74   LEU A CD2   1 
ATOM   384  N  N     . PRO A 1 75  ? 20.294 68.411  73.915  1.00 33.17  ? 75   PRO A N     1 
ATOM   385  C  CA    . PRO A 1 75  ? 20.682 67.855  75.224  1.00 29.99  ? 75   PRO A CA    1 
ATOM   386  C  C     . PRO A 1 75  ? 22.100 67.265  75.342  1.00 30.95  ? 75   PRO A C     1 
ATOM   387  O  O     . PRO A 1 75  ? 22.295 66.184  75.899  1.00 36.39  ? 75   PRO A O     1 
ATOM   388  C  CB    . PRO A 1 75  ? 19.610 66.813  75.457  1.00 28.99  ? 75   PRO A CB    1 
ATOM   389  C  CG    . PRO A 1 75  ? 19.305 66.320  74.069  1.00 32.50  ? 75   PRO A CG    1 
ATOM   390  C  CD    . PRO A 1 75  ? 19.346 67.538  73.199  1.00 32.47  ? 75   PRO A CD    1 
ATOM   391  N  N     . PHE A 1 76  ? 23.090 68.001  74.859  1.00 31.84  ? 76   PHE A N     1 
ATOM   392  C  CA    . PHE A 1 76  ? 24.495 67.658  75.034  1.00 31.22  ? 76   PHE A CA    1 
ATOM   393  C  C     . PHE A 1 76  ? 24.919 67.728  76.486  1.00 31.83  ? 76   PHE A C     1 
ATOM   394  O  O     . PHE A 1 76  ? 24.409 68.540  77.253  1.00 35.43  ? 76   PHE A O     1 
ATOM   395  C  CB    . PHE A 1 76  ? 25.392 68.684  74.341  1.00 31.77  ? 76   PHE A CB    1 
ATOM   396  C  CG    . PHE A 1 76  ? 25.411 68.596  72.867  1.00 32.23  ? 76   PHE A CG    1 
ATOM   397  C  CD1   . PHE A 1 76  ? 26.240 67.673  72.228  1.00 31.21  ? 76   PHE A CD1   1 
ATOM   398  C  CD2   . PHE A 1 76  ? 24.652 69.472  72.104  1.00 32.36  ? 76   PHE A CD2   1 
ATOM   399  C  CE1   . PHE A 1 76  ? 26.298 67.599  70.859  1.00 30.37  ? 76   PHE A CE1   1 
ATOM   400  C  CE2   . PHE A 1 76  ? 24.692 69.398  70.721  1.00 36.04  ? 76   PHE A CE2   1 
ATOM   401  C  CZ    . PHE A 1 76  ? 25.520 68.447  70.094  1.00 34.46  ? 76   PHE A CZ    1 
ATOM   402  N  N     . THR A 1 77  ? 25.947 66.953  76.797  1.00 30.39  ? 77   THR A N     1 
ATOM   403  C  CA    . THR A 1 77  ? 26.687 67.012  78.043  1.00 26.85  ? 77   THR A CA    1 
ATOM   404  C  C     . THR A 1 77  ? 28.054 67.560  77.674  1.00 28.37  ? 77   THR A C     1 
ATOM   405  O  O     . THR A 1 77  ? 28.329 67.814  76.515  1.00 33.79  ? 77   THR A O     1 
ATOM   406  C  CB    . THR A 1 77  ? 26.814 65.577  78.680  1.00 27.30  ? 77   THR A CB    1 
ATOM   407  O  OG1   . THR A 1 77  ? 27.431 64.646  77.753  1.00 22.57  ? 77   THR A OG1   1 
ATOM   408  C  CG2   . THR A 1 77  ? 25.433 64.997  78.945  1.00 26.82  ? 77   THR A CG2   1 
ATOM   409  N  N     . ASN A 1 78  ? 28.930 67.684  78.657  1.00 27.23  ? 78   ASN A N     1 
ATOM   410  C  CA    . ASN A 1 78  ? 30.161 68.430  78.515  1.00 25.88  ? 78   ASN A CA    1 
ATOM   411  C  C     . ASN A 1 78  ? 31.329 67.486  78.299  1.00 26.30  ? 78   ASN A C     1 
ATOM   412  O  O     . ASN A 1 78  ? 31.576 67.092  77.171  1.00 29.70  ? 78   ASN A O     1 
ATOM   413  C  CB    . ASN A 1 78  ? 30.325 69.377  79.729  1.00 25.15  ? 78   ASN A CB    1 
ATOM   414  C  CG    . ASN A 1 78  ? 31.665 70.048  79.789  1.00 25.94  ? 78   ASN A CG    1 
ATOM   415  O  OD1   . ASN A 1 78  ? 32.376 70.159  78.789  1.00 26.25  ? 78   ASN A OD1   1 
ATOM   416  N  ND2   . ASN A 1 78  ? 32.033 70.500  80.986  1.00 30.94  ? 78   ASN A ND2   1 
ATOM   417  N  N     . CYS A 1 79  ? 32.061 67.123  79.347  1.00 27.66  ? 79   CYS A N     1 
ATOM   418  C  CA    . CYS A 1 79  ? 33.259 66.311  79.179  1.00 29.74  ? 79   CYS A CA    1 
ATOM   419  C  C     . CYS A 1 79  ? 33.035 64.903  79.765  1.00 30.35  ? 79   CYS A C     1 
ATOM   420  O  O     . CYS A 1 79  ? 31.967 64.631  80.295  1.00 23.34  ? 79   CYS A O     1 
ATOM   421  C  CB    . CYS A 1 79  ? 34.439 67.006  79.822  1.00 31.68  ? 79   CYS A CB    1 
ATOM   422  S  SG    . CYS A 1 79  ? 34.138 67.471  81.539  1.00 34.29  ? 79   CYS A SG    1 
ATOM   423  N  N     . CYS A 1 80  ? 34.014 64.004  79.635  1.00 33.14  ? 80   CYS A N     1 
ATOM   424  C  CA    . CYS A 1 80  ? 33.888 62.641  80.214  1.00 33.83  ? 80   CYS A CA    1 
ATOM   425  C  C     . CYS A 1 80  ? 35.185 61.861  80.336  1.00 32.78  ? 80   CYS A C     1 
ATOM   426  O  O     . CYS A 1 80  ? 36.193 62.196  79.736  1.00 33.74  ? 80   CYS A O     1 
ATOM   427  C  CB    . CYS A 1 80  ? 32.896 61.780  79.433  1.00 32.67  ? 80   CYS A CB    1 
ATOM   428  S  SG    . CYS A 1 80  ? 33.466 61.243  77.811  1.00 34.77  ? 80   CYS A SG    1 
ATOM   429  N  N     . LEU A 1 81  ? 35.153 60.831  81.169  1.00 35.17  ? 81   LEU A N     1 
ATOM   430  C  CA    . LEU A 1 81  ? 36.180 59.802  81.143  1.00 35.76  ? 81   LEU A CA    1 
ATOM   431  C  C     . LEU A 1 81  ? 35.606 58.693  80.298  1.00 31.77  ? 81   LEU A C     1 
ATOM   432  O  O     . LEU A 1 81  ? 34.611 58.089  80.672  1.00 34.55  ? 81   LEU A O     1 
ATOM   433  C  CB    . LEU A 1 81  ? 36.485 59.283  82.547  1.00 35.47  ? 81   LEU A CB    1 
ATOM   434  C  CG    . LEU A 1 81  ? 37.234 60.208  83.498  1.00 33.83  ? 81   LEU A CG    1 
ATOM   435  C  CD1   . LEU A 1 81  ? 37.534 59.460  84.805  1.00 35.99  ? 81   LEU A CD1   1 
ATOM   436  C  CD2   . LEU A 1 81  ? 38.494 60.700  82.866  1.00 34.04  ? 81   LEU A CD2   1 
ATOM   437  N  N     . VAL A 1 82  ? 36.190 58.439  79.139  1.00 30.40  ? 82   VAL A N     1 
ATOM   438  C  CA    . VAL A 1 82  ? 35.680 57.346  78.296  1.00 32.99  ? 82   VAL A CA    1 
ATOM   439  C  C     . VAL A 1 82  ? 36.013 55.990  78.907  1.00 34.84  ? 82   VAL A C     1 
ATOM   440  O  O     . VAL A 1 82  ? 37.166 55.731  79.272  1.00 33.95  ? 82   VAL A O     1 
ATOM   441  C  CB    . VAL A 1 82  ? 36.239 57.385  76.859  1.00 31.80  ? 82   VAL A CB    1 
ATOM   442  C  CG1   . VAL A 1 82  ? 35.796 56.156  76.076  1.00 31.73  ? 82   VAL A CG1   1 
ATOM   443  C  CG2   . VAL A 1 82  ? 35.779 58.656  76.161  1.00 31.27  ? 82   VAL A CG2   1 
ATOM   444  N  N     . ASP A 1 83  ? 35.001 55.133  79.001  1.00 34.20  ? 83   ASP A N     1 
ATOM   445  C  CA    . ASP A 1 83  ? 35.196 53.753  79.414  1.00 36.23  ? 83   ASP A CA    1 
ATOM   446  C  C     . ASP A 1 83  ? 35.719 52.871  78.281  1.00 34.83  ? 83   ASP A C     1 
ATOM   447  O  O     . ASP A 1 83  ? 35.045 51.935  77.846  1.00 34.42  ? 83   ASP A O     1 
ATOM   448  C  CB    . ASP A 1 83  ? 33.897 53.165  79.968  1.00 37.33  ? 83   ASP A CB    1 
ATOM   449  C  CG    . ASP A 1 83  ? 34.110 51.813  80.642  1.00 40.58  ? 83   ASP A CG    1 
ATOM   450  O  OD1   . ASP A 1 83  ? 35.284 51.446  80.935  1.00 40.16  ? 83   ASP A OD1   1 
ATOM   451  O  OD2   . ASP A 1 83  ? 33.156 51.060  80.917  1.00 43.59  ? 83   ASP A OD2   1 
ATOM   452  N  N     . LEU A 1 84  ? 36.940 53.146  77.843  1.00 31.61  ? 84   LEU A N     1 
ATOM   453  C  CA    . LEU A 1 84  ? 37.556 52.390  76.770  1.00 33.03  ? 84   LEU A CA    1 
ATOM   454  C  C     . LEU A 1 84  ? 37.764 50.901  77.113  1.00 34.58  ? 84   LEU A C     1 
ATOM   455  O  O     . LEU A 1 84  ? 37.731 50.054  76.230  1.00 35.65  ? 84   LEU A O     1 
ATOM   456  C  CB    . LEU A 1 84  ? 38.900 53.017  76.427  1.00 32.68  ? 84   LEU A CB    1 
ATOM   457  C  CG    . LEU A 1 84  ? 39.680 52.430  75.262  1.00 32.20  ? 84   LEU A CG    1 
ATOM   458  C  CD1   . LEU A 1 84  ? 38.940 52.660  73.976  1.00 33.04  ? 84   LEU A CD1   1 
ATOM   459  C  CD2   . LEU A 1 84  ? 41.060 53.060  75.225  1.00 33.60  ? 84   LEU A CD2   1 
ATOM   460  N  N     . LYS A 1 85  ? 38.005 50.598  78.383  1.00 35.69  ? 85   LYS A N     1 
ATOM   461  C  CA    . LYS A 1 85  ? 38.324 49.243  78.816  1.00 37.28  ? 85   LYS A CA    1 
ATOM   462  C  C     . LYS A 1 85  ? 37.113 48.357  78.568  1.00 38.08  ? 85   LYS A C     1 
ATOM   463  O  O     . LYS A 1 85  ? 37.204 47.357  77.870  1.00 33.48  ? 85   LYS A O     1 
ATOM   464  C  CB    . LYS A 1 85  ? 38.707 49.259  80.292  1.00 39.26  ? 85   LYS A CB    1 
ATOM   465  C  CG    . LYS A 1 85  ? 39.000 47.915  80.940  1.00 40.63  ? 85   LYS A CG    1 
ATOM   466  C  CD    . LYS A 1 85  ? 39.726 48.123  82.295  1.00 42.95  ? 85   LYS A CD    1 
ATOM   467  C  CE    . LYS A 1 85  ? 40.248 46.817  82.883  1.00 43.56  ? 85   LYS A CE    1 
ATOM   468  N  NZ    . LYS A 1 85  ? 39.131 45.853  83.103  1.00 42.25  ? 85   LYS A NZ    1 
ATOM   469  N  N     . GLY A 1 86  ? 35.971 48.768  79.114  1.00 39.17  ? 86   GLY A N     1 
ATOM   470  C  CA    . GLY A 1 86  ? 34.713 48.083  78.896  1.00 39.04  ? 86   GLY A CA    1 
ATOM   471  C  C     . GLY A 1 86  ? 34.340 47.963  77.431  1.00 40.28  ? 86   GLY A C     1 
ATOM   472  O  O     . GLY A 1 86  ? 33.784 46.938  77.026  1.00 43.35  ? 86   GLY A O     1 
ATOM   473  N  N     . MET A 1 87  ? 34.642 48.988  76.632  1.00 37.11  ? 87   MET A N     1 
ATOM   474  C  CA    . MET A 1 87  ? 34.279 48.954  75.224  1.00 37.07  ? 87   MET A CA    1 
ATOM   475  C  C     . MET A 1 87  ? 35.090 47.888  74.501  1.00 36.75  ? 87   MET A C     1 
ATOM   476  O  O     . MET A 1 87  ? 34.534 47.044  73.818  1.00 36.39  ? 87   MET A O     1 
ATOM   477  C  CB    . MET A 1 87  ? 34.475 50.317  74.561  1.00 35.94  ? 87   MET A CB    1 
ATOM   478  C  CG    . MET A 1 87  ? 33.435 51.331  74.997  1.00 38.46  ? 87   MET A CG    1 
ATOM   479  S  SD    . MET A 1 87  ? 33.815 52.997  74.539  1.00 37.91  ? 87   MET A SD    1 
ATOM   480  C  CE    . MET A 1 87  ? 33.244 52.965  72.822  1.00 41.08  ? 87   MET A CE    1 
ATOM   481  N  N     . LEU A 1 88  ? 36.405 47.947  74.673  1.00 35.80  ? 88   LEU A N     1 
ATOM   482  C  CA    . LEU A 1 88  ? 37.327 47.072  73.989  1.00 35.56  ? 88   LEU A CA    1 
ATOM   483  C  C     . LEU A 1 88  ? 37.184 45.607  74.434  1.00 39.48  ? 88   LEU A C     1 
ATOM   484  O  O     . LEU A 1 88  ? 37.227 44.704  73.601  1.00 36.02  ? 88   LEU A O     1 
ATOM   485  C  CB    . LEU A 1 88  ? 38.757 47.554  74.209  1.00 33.46  ? 88   LEU A CB    1 
ATOM   486  C  CG    . LEU A 1 88  ? 39.172 48.853  73.527  1.00 33.65  ? 88   LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1 88  ? 40.696 49.014  73.611  1.00 35.30  ? 88   LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1 88  ? 38.702 48.950  72.074  1.00 31.51  ? 88   LEU A CD2   1 
ATOM   489  N  N     . GLU A 1 89  ? 36.986 45.392  75.735  1.00 43.23  ? 89   GLU A N     1 
ATOM   490  C  CA    . GLU A 1 89  ? 36.942 44.049  76.319  1.00 45.70  ? 89   GLU A CA    1 
ATOM   491  C  C     . GLU A 1 89  ? 35.775 43.274  75.748  1.00 47.60  ? 89   GLU A C     1 
ATOM   492  O  O     . GLU A 1 89  ? 35.925 42.135  75.329  1.00 48.70  ? 89   GLU A O     1 
ATOM   493  C  CB    . GLU A 1 89  ? 36.800 44.105  77.843  1.00 46.48  ? 89   GLU A CB    1 
ATOM   494  C  CG    . GLU A 1 89  ? 38.119 44.055  78.598  1.00 49.88  ? 89   GLU A CG    1 
ATOM   495  C  CD    . GLU A 1 89  ? 37.953 44.251  80.103  1.00 52.52  ? 89   GLU A CD    1 
ATOM   496  O  OE1   . GLU A 1 89  ? 36.792 44.351  80.577  1.00 53.45  ? 89   GLU A OE1   1 
ATOM   497  O  OE2   . GLU A 1 89  ? 38.989 44.313  80.812  1.00 53.14  ? 89   GLU A OE2   1 
ATOM   498  N  N     . ASN A 1 90  ? 34.613 43.915  75.750  1.00 48.81  ? 90   ASN A N     1 
ATOM   499  C  CA    . ASN A 1 90  ? 33.386 43.339  75.217  1.00 49.86  ? 90   ASN A CA    1 
ATOM   500  C  C     . ASN A 1 90  ? 33.246 43.728  73.744  1.00 49.94  ? 90   ASN A C     1 
ATOM   501  O  O     . ASN A 1 90  ? 34.160 44.299  73.142  1.00 51.64  ? 90   ASN A O     1 
ATOM   502  C  CB    . ASN A 1 90  ? 32.201 43.867  76.028  1.00 50.46  ? 90   ASN A CB    1 
ATOM   503  C  CG    . ASN A 1 90  ? 32.428 43.753  77.533  1.00 51.96  ? 90   ASN A CG    1 
ATOM   504  O  OD1   . ASN A 1 90  ? 32.250 42.684  78.113  1.00 52.90  ? 90   ASN A OD1   1 
ATOM   505  N  ND2   . ASN A 1 90  ? 32.830 44.853  78.167  1.00 50.50  ? 90   ASN A ND2   1 
ATOM   506  N  N     . GLY A 1 91  ? 32.109 43.449  73.139  1.00 48.91  ? 91   GLY A N     1 
ATOM   507  C  CA    . GLY A 1 91  ? 31.851 44.062  71.843  1.00 49.46  ? 91   GLY A CA    1 
ATOM   508  C  C     . GLY A 1 91  ? 31.484 45.535  71.998  1.00 45.06  ? 91   GLY A C     1 
ATOM   509  O  O     . GLY A 1 91  ? 31.252 45.978  73.108  1.00 41.19  ? 91   GLY A O     1 
ATOM   510  N  N     . PHE A 1 92  ? 31.449 46.282  70.896  1.00 43.16  ? 92   PHE A N     1 
ATOM   511  C  CA    . PHE A 1 92  ? 30.618 47.491  70.807  1.00 42.73  ? 92   PHE A CA    1 
ATOM   512  C  C     . PHE A 1 92  ? 30.409 47.948  69.364  1.00 41.06  ? 92   PHE A C     1 
ATOM   513  O  O     . PHE A 1 92  ? 31.309 47.847  68.537  1.00 41.47  ? 92   PHE A O     1 
ATOM   514  C  CB    . PHE A 1 92  ? 31.190 48.647  71.640  1.00 42.87  ? 92   PHE A CB    1 
ATOM   515  C  CG    . PHE A 1 92  ? 32.385 49.301  71.029  1.00 41.39  ? 92   PHE A CG    1 
ATOM   516  C  CD1   . PHE A 1 92  ? 33.623 48.684  71.073  1.00 40.37  ? 92   PHE A CD1   1 
ATOM   517  C  CD2   . PHE A 1 92  ? 32.276 50.536  70.406  1.00 41.02  ? 92   PHE A CD2   1 
ATOM   518  C  CE1   . PHE A 1 92  ? 34.745 49.293  70.526  1.00 39.01  ? 92   PHE A CE1   1 
ATOM   519  C  CE2   . PHE A 1 92  ? 33.398 51.148  69.853  1.00 41.10  ? 92   PHE A CE2   1 
ATOM   520  C  CZ    . PHE A 1 92  ? 34.632 50.521  69.906  1.00 38.66  ? 92   PHE A CZ    1 
ATOM   521  N  N     . LYS A 1 93  ? 29.210 48.435  69.066  1.00 41.01  ? 93   LYS A N     1 
ATOM   522  C  CA    . LYS A 1 93  ? 28.915 49.025  67.764  1.00 41.93  ? 93   LYS A CA    1 
ATOM   523  C  C     . LYS A 1 93  ? 29.461 50.450  67.674  1.00 40.81  ? 93   LYS A C     1 
ATOM   524  O  O     . LYS A 1 93  ? 29.309 51.244  68.594  1.00 41.66  ? 93   LYS A O     1 
ATOM   525  C  CB    . LYS A 1 93  ? 27.407 49.038  67.484  1.00 44.18  ? 93   LYS A CB    1 
ATOM   526  C  CG    . LYS A 1 93  ? 27.080 49.288  66.003  1.00 46.49  ? 93   LYS A CG    1 
ATOM   527  C  CD    . LYS A 1 93  ? 25.603 49.197  65.710  1.00 49.57  ? 93   LYS A CD    1 
ATOM   528  C  CE    . LYS A 1 93  ? 25.270 49.755  64.331  1.00 51.38  ? 93   LYS A CE    1 
ATOM   529  N  NZ    . LYS A 1 93  ? 24.460 48.779  63.533  1.00 54.32  ? 93   LYS A NZ    1 
ATOM   530  N  N     . LEU A 1 94  ? 30.083 50.759  66.547  1.00 41.27  ? 94   LEU A N     1 
ATOM   531  C  CA    . LEU A 1 94  ? 30.732 52.046  66.306  1.00 42.12  ? 94   LEU A CA    1 
ATOM   532  C  C     . LEU A 1 94  ? 30.451 52.363  64.860  1.00 44.37  ? 94   LEU A C     1 
ATOM   533  O  O     . LEU A 1 94  ? 30.901 51.634  63.979  1.00 44.74  ? 94   LEU A O     1 
ATOM   534  C  CB    . LEU A 1 94  ? 32.246 51.929  66.523  1.00 41.86  ? 94   LEU A CB    1 
ATOM   535  C  CG    . LEU A 1 94  ? 33.129 53.147  66.240  1.00 41.32  ? 94   LEU A CG    1 
ATOM   536  C  CD1   . LEU A 1 94  ? 32.837 54.262  67.206  1.00 41.55  ? 94   LEU A CD1   1 
ATOM   537  C  CD2   . LEU A 1 94  ? 34.588 52.769  66.330  1.00 42.21  ? 94   LEU A CD2   1 
ATOM   538  N  N     . GLY A 1 95  ? 29.712 53.438  64.603  1.00 45.73  ? 95   GLY A N     1 
ATOM   539  C  CA    . GLY A 1 95  ? 29.201 53.686  63.273  1.00 44.62  ? 95   GLY A CA    1 
ATOM   540  C  C     . GLY A 1 95  ? 28.323 52.515  62.895  1.00 44.10  ? 95   GLY A C     1 
ATOM   541  O  O     . GLY A 1 95  ? 27.449 52.155  63.665  1.00 46.23  ? 95   GLY A O     1 
ATOM   542  N  N     . ASN A 1 96  ? 28.580 51.910  61.735  1.00 45.81  ? 96   ASN A N     1 
ATOM   543  C  CA    . ASN A 1 96  ? 27.820 50.755  61.225  1.00 48.39  ? 96   ASN A CA    1 
ATOM   544  C  C     . ASN A 1 96  ? 28.434 49.397  61.567  1.00 46.58  ? 96   ASN A C     1 
ATOM   545  O  O     . ASN A 1 96  ? 27.912 48.351  61.164  1.00 48.69  ? 96   ASN A O     1 
ATOM   546  C  CB    . ASN A 1 96  ? 27.703 50.836  59.695  1.00 50.44  ? 96   ASN A CB    1 
ATOM   547  C  CG    . ASN A 1 96  ? 27.287 52.219  59.208  1.00 53.57  ? 96   ASN A CG    1 
ATOM   548  O  OD1   . ASN A 1 96  ? 26.254 52.743  59.623  1.00 56.86  ? 96   ASN A OD1   1 
ATOM   549  N  ND2   . ASN A 1 96  ? 28.091 52.812  58.319  1.00 53.37  ? 96   ASN A ND2   1 
ATOM   550  N  N     . ALA A 1 97  ? 29.537 49.428  62.308  1.00 44.75  ? 97   ALA A N     1 
ATOM   551  C  CA    . ALA A 1 97  ? 30.415 48.281  62.495  1.00 43.99  ? 97   ALA A CA    1 
ATOM   552  C  C     . ALA A 1 97  ? 30.384 47.741  63.922  1.00 41.34  ? 97   ALA A C     1 
ATOM   553  O  O     . ALA A 1 97  ? 30.622 48.481  64.869  1.00 40.69  ? 97   ALA A O     1 
ATOM   554  C  CB    . ALA A 1 97  ? 31.836 48.675  62.137  1.00 44.83  ? 97   ALA A CB    1 
ATOM   555  N  N     . GLN A 1 98  ? 30.123 46.443  64.051  1.00 39.85  ? 98   GLN A N     1 
ATOM   556  C  CA    . GLN A 1 98  ? 30.131 45.752  65.334  1.00 39.97  ? 98   GLN A CA    1 
ATOM   557  C  C     . GLN A 1 98  ? 31.558 45.302  65.647  1.00 40.98  ? 98   GLN A C     1 
ATOM   558  O  O     . GLN A 1 98  ? 31.942 44.182  65.348  1.00 41.82  ? 98   GLN A O     1 
ATOM   559  C  CB    . GLN A 1 98  ? 29.190 44.555  65.270  1.00 40.21  ? 98   GLN A CB    1 
ATOM   560  C  CG    . GLN A 1 98  ? 28.898 43.918  66.599  1.00 42.53  ? 98   GLN A CG    1 
ATOM   561  C  CD    . GLN A 1 98  ? 28.145 44.839  67.546  1.00 43.39  ? 98   GLN A CD    1 
ATOM   562  O  OE1   . GLN A 1 98  ? 27.210 45.525  67.140  1.00 43.84  ? 98   GLN A OE1   1 
ATOM   563  N  NE2   . GLN A 1 98  ? 28.548 44.842  68.814  1.00 44.45  ? 98   GLN A NE2   1 
ATOM   564  N  N     . ILE A 1 99  ? 32.333 46.199  66.241  1.00 40.32  ? 99   ILE A N     1 
ATOM   565  C  CA    . ILE A 1 99  ? 33.749 45.977  66.526  1.00 42.18  ? 99   ILE A CA    1 
ATOM   566  C  C     . ILE A 1 99  ? 33.964 44.868  67.579  1.00 41.67  ? 99   ILE A C     1 
ATOM   567  O  O     . ILE A 1 99  ? 33.186 44.721  68.517  1.00 44.13  ? 99   ILE A O     1 
ATOM   568  C  CB    . ILE A 1 99  ? 34.382 47.305  67.038  1.00 43.64  ? 99   ILE A CB    1 
ATOM   569  C  CG1   . ILE A 1 99  ? 34.165 48.461  66.045  1.00 44.53  ? 99   ILE A CG1   1 
ATOM   570  C  CG2   . ILE A 1 99  ? 35.847 47.127  67.348  1.00 43.25  ? 99   ILE A CG2   1 
ATOM   571  C  CD1   . ILE A 1 99  ? 34.873 48.311  64.711  1.00 45.50  ? 99   ILE A CD1   1 
ATOM   572  N  N     . GLU A 1 100 ? 35.028 44.098  67.414  1.00 42.79  ? 100  GLU A N     1 
ATOM   573  C  CA    . GLU A 1 100 ? 35.404 43.023  68.355  1.00 42.44  ? 100  GLU A CA    1 
ATOM   574  C  C     . GLU A 1 100 ? 36.674 43.399  69.108  1.00 39.26  ? 100  GLU A C     1 
ATOM   575  O  O     . GLU A 1 100 ? 37.388 44.309  68.698  1.00 36.32  ? 100  GLU A O     1 
ATOM   576  C  CB    . GLU A 1 100 ? 35.645 41.721  67.594  1.00 40.59  ? 100  GLU A CB    1 
ATOM   577  C  CG    . GLU A 1 100 ? 34.393 41.156  66.958  1.00 44.32  ? 100  GLU A CG    1 
ATOM   578  C  CD    . GLU A 1 100 ? 34.618 39.790  66.309  1.00 47.51  ? 100  GLU A CD    1 
ATOM   579  O  OE1   . GLU A 1 100 ? 35.582 39.644  65.524  1.00 47.46  ? 100  GLU A OE1   1 
ATOM   580  O  OE2   . GLU A 1 100 ? 33.826 38.858  66.579  1.00 49.75  ? 100  GLU A OE2   1 
ATOM   581  N  N     . THR A 1 101 ? 36.970 42.686  70.194  1.00 39.35  ? 101  THR A N     1 
ATOM   582  C  CA    . THR A 1 101 ? 38.206 42.933  70.961  1.00 37.34  ? 101  THR A CA    1 
ATOM   583  C  C     . THR A 1 101 ? 39.417 42.913  70.033  1.00 36.18  ? 101  THR A C     1 
ATOM   584  O  O     . THR A 1 101 ? 39.599 41.948  69.295  1.00 38.96  ? 101  THR A O     1 
ATOM   585  C  CB    . THR A 1 101 ? 38.371 41.879  72.087  1.00 35.82  ? 101  THR A CB    1 
ATOM   586  O  OG1   . THR A 1 101 ? 37.277 41.979  73.011  1.00 36.68  ? 101  THR A OG1   1 
ATOM   587  C  CG2   . THR A 1 101 ? 39.576 42.183  72.962  1.00 35.43  ? 101  THR A CG2   1 
ATOM   588  N  N     . PRO A 1 102 ? 40.219 43.973  70.017  1.00 38.21  ? 102  PRO A N     1 
ATOM   589  C  CA    . PRO A 1 102 ? 41.414 43.989  69.168  1.00 39.96  ? 102  PRO A CA    1 
ATOM   590  C  C     . PRO A 1 102 ? 42.413 42.907  69.552  1.00 41.74  ? 102  PRO A C     1 
ATOM   591  O  O     . PRO A 1 102 ? 42.519 42.556  70.724  1.00 42.84  ? 102  PRO A O     1 
ATOM   592  C  CB    . PRO A 1 102 ? 42.000 45.394  69.381  1.00 38.72  ? 102  PRO A CB    1 
ATOM   593  C  CG    . PRO A 1 102 ? 41.383 45.915  70.572  1.00 39.27  ? 102  PRO A CG    1 
ATOM   594  C  CD    . PRO A 1 102 ? 40.056 45.242  70.746  1.00 39.51  ? 102  PRO A CD    1 
ATOM   595  N  N     . LYS A 1 103 ? 43.123 42.394  68.554  1.00 45.67  ? 103  LYS A N     1 
ATOM   596  C  CA    . LYS A 1 103 ? 44.091 41.312  68.721  1.00 47.66  ? 103  LYS A CA    1 
ATOM   597  C  C     . LYS A 1 103 ? 45.489 41.824  68.413  1.00 48.62  ? 103  LYS A C     1 
ATOM   598  O  O     . LYS A 1 103 ? 46.410 41.052  68.152  1.00 51.20  ? 103  LYS A O     1 
ATOM   599  C  CB    . LYS A 1 103 ? 43.712 40.123  67.823  1.00 48.53  ? 103  LYS A CB    1 
ATOM   600  C  CG    . LYS A 1 103 ? 42.541 39.311  68.387  1.00 51.11  ? 103  LYS A CG    1 
ATOM   601  C  CD    . LYS A 1 103 ? 41.573 38.784  67.334  1.00 53.57  ? 103  LYS A CD    1 
ATOM   602  C  CE    . LYS A 1 103 ? 40.331 38.113  67.997  1.00 55.13  ? 103  LYS A CE    1 
ATOM   603  N  NZ    . LYS A 1 103 ? 39.160 39.060  68.254  1.00 54.13  ? 103  LYS A NZ    1 
ATOM   604  N  N     . SER A 1 104 ? 45.636 43.141  68.441  1.00 47.20  ? 104  SER A N     1 
ATOM   605  C  CA    . SER A 1 104 ? 46.939 43.777  68.312  1.00 46.92  ? 104  SER A CA    1 
ATOM   606  C  C     . SER A 1 104 ? 46.866 45.206  68.839  1.00 44.82  ? 104  SER A C     1 
ATOM   607  O  O     . SER A 1 104 ? 45.796 45.817  68.863  1.00 43.36  ? 104  SER A O     1 
ATOM   608  C  CB    . SER A 1 104 ? 47.430 43.751  66.859  1.00 47.97  ? 104  SER A CB    1 
ATOM   609  O  OG    . SER A 1 104 ? 46.726 44.656  66.037  1.00 49.09  ? 104  SER A OG    1 
ATOM   610  N  N     . ILE A 1 105 ? 48.004 45.720  69.286  1.00 42.43  ? 105  ILE A N     1 
ATOM   611  C  CA    . ILE A 1 105 ? 48.063 47.052  69.860  1.00 40.59  ? 105  ILE A CA    1 
ATOM   612  C  C     . ILE A 1 105 ? 47.666 48.133  68.842  1.00 40.36  ? 105  ILE A C     1 
ATOM   613  O  O     . ILE A 1 105 ? 47.036 49.113  69.210  1.00 43.56  ? 105  ILE A O     1 
ATOM   614  C  CB    . ILE A 1 105 ? 49.471 47.333  70.458  1.00 39.23  ? 105  ILE A CB    1 
ATOM   615  C  CG1   . ILE A 1 105 ? 49.550 48.733  71.086  1.00 37.58  ? 105  ILE A CG1   1 
ATOM   616  C  CG2   . ILE A 1 105 ? 50.575 47.222  69.408  1.00 39.57  ? 105  ILE A CG2   1 
ATOM   617  C  CD1   . ILE A 1 105 ? 48.656 48.922  72.251  1.00 37.28  ? 105  ILE A CD1   1 
ATOM   618  N  N     . GLY A 1 106 ? 48.026 47.943  67.578  1.00 40.55  ? 106  GLY A N     1 
ATOM   619  C  CA    . GLY A 1 106 ? 47.912 48.978  66.562  1.00 40.50  ? 106  GLY A CA    1 
ATOM   620  C  C     . GLY A 1 106 ? 46.466 49.172  66.153  1.00 41.46  ? 106  GLY A C     1 
ATOM   621  O  O     . GLY A 1 106 ? 46.018 50.282  65.856  1.00 41.98  ? 106  GLY A O     1 
ATOM   622  N  N     . VAL A 1 107 ? 45.738 48.069  66.148  1.00 38.26  ? 107  VAL A N     1 
ATOM   623  C  CA    . VAL A 1 107 ? 44.308 48.095  65.923  1.00 38.59  ? 107  VAL A CA    1 
ATOM   624  C  C     . VAL A 1 107 ? 43.580 48.733  67.111  1.00 38.47  ? 107  VAL A C     1 
ATOM   625  O  O     . VAL A 1 107 ? 42.541 49.370  66.933  1.00 37.32  ? 107  VAL A O     1 
ATOM   626  C  CB    . VAL A 1 107 ? 43.799 46.665  65.654  1.00 35.27  ? 107  VAL A CB    1 
ATOM   627  C  CG1   . VAL A 1 107 ? 42.270 46.596  65.658  1.00 36.25  ? 107  VAL A CG1   1 
ATOM   628  C  CG2   . VAL A 1 107 ? 44.352 46.189  64.320  1.00 32.95  ? 107  VAL A CG2   1 
ATOM   629  N  N     . ALA A 1 108 ? 44.134 48.557  68.308  1.00 35.89  ? 108  ALA A N     1 
ATOM   630  C  CA    . ALA A 1 108 ? 43.518 49.054  69.534  1.00 34.42  ? 108  ALA A CA    1 
ATOM   631  C  C     . ALA A 1 108 ? 43.514 50.602  69.584  1.00 34.91  ? 108  ALA A C     1 
ATOM   632  O  O     . ALA A 1 108 ? 42.529 51.222  70.009  1.00 35.84  ? 108  ALA A O     1 
ATOM   633  C  CB    . ALA A 1 108 ? 44.241 48.493  70.746  1.00 32.22  ? 108  ALA A CB    1 
ATOM   634  N  N     . THR A 1 109 ? 44.617 51.202  69.157  1.00 30.24  ? 109  THR A N     1 
ATOM   635  C  CA    . THR A 1 109 ? 44.742 52.636  69.156  1.00 32.20  ? 109  THR A CA    1 
ATOM   636  C  C     . THR A 1 109 ? 44.079 53.208  67.921  1.00 33.14  ? 109  THR A C     1 
ATOM   637  O  O     . THR A 1 109 ? 43.840 54.396  67.869  1.00 36.45  ? 109  THR A O     1 
ATOM   638  C  CB    . THR A 1 109 ? 46.220 53.078  69.179  1.00 31.62  ? 109  THR A CB    1 
ATOM   639  O  OG1   . THR A 1 109 ? 46.891 52.611  67.997  1.00 31.98  ? 109  THR A OG1   1 
ATOM   640  C  CG2   . THR A 1 109 ? 46.955 52.439  70.338  1.00 30.85  ? 109  THR A CG2   1 
ATOM   641  N  N     . ALA A 1 110 ? 43.840 52.377  66.913  1.00 32.05  ? 110  ALA A N     1 
ATOM   642  C  CA    . ALA A 1 110 ? 43.135 52.815  65.721  1.00 32.18  ? 110  ALA A CA    1 
ATOM   643  C  C     . ALA A 1 110 ? 41.658 52.946  66.076  1.00 31.14  ? 110  ALA A C     1 
ATOM   644  O  O     . ALA A 1 110 ? 41.023 53.902  65.710  1.00 32.66  ? 110  ALA A O     1 
ATOM   645  C  CB    . ALA A 1 110 ? 43.334 51.829  64.580  1.00 30.26  ? 110  ALA A CB    1 
ATOM   646  N  N     . ILE A 1 111 ? 41.150 51.986  66.829  1.00 32.75  ? 111  ILE A N     1 
ATOM   647  C  CA    . ILE A 1 111 ? 39.816 52.048  67.398  1.00 32.75  ? 111  ILE A CA    1 
ATOM   648  C  C     . ILE A 1 111 ? 39.713 53.155  68.448  1.00 35.55  ? 111  ILE A C     1 
ATOM   649  O  O     . ILE A 1 111 ? 38.676 53.787  68.566  1.00 35.98  ? 111  ILE A O     1 
ATOM   650  C  CB    . ILE A 1 111 ? 39.458 50.699  68.023  1.00 30.90  ? 111  ILE A CB    1 
ATOM   651  C  CG1   . ILE A 1 111 ? 39.351 49.632  66.934  1.00 32.64  ? 111  ILE A CG1   1 
ATOM   652  C  CG2   . ILE A 1 111 ? 38.129 50.766  68.773  1.00 30.88  ? 111  ILE A CG2   1 
ATOM   653  C  CD1   . ILE A 1 111 ? 39.278 48.199  67.496  1.00 33.72  ? 111  ILE A CD1   1 
ATOM   654  N  N     . MET A 1 112 ? 40.774 53.386  69.216  1.00 34.66  ? 112  MET A N     1 
ATOM   655  C  CA    . MET A 1 112 ? 40.734 54.408  70.246  1.00 36.09  ? 112  MET A CA    1 
ATOM   656  C  C     . MET A 1 112 ? 40.585 55.783  69.568  1.00 37.20  ? 112  MET A C     1 
ATOM   657  O  O     . MET A 1 112 ? 39.924 56.674  70.085  1.00 36.93  ? 112  MET A O     1 
ATOM   658  C  CB    . MET A 1 112 ? 42.001 54.345  71.113  1.00 37.87  ? 112  MET A CB    1 
ATOM   659  C  CG    . MET A 1 112 ? 42.094 55.411  72.211  1.00 39.20  ? 112  MET A CG    1 
ATOM   660  S  SD    . MET A 1 112 ? 43.452 55.132  73.391  1.00 38.50  ? 112  MET A SD    1 
ATOM   661  C  CE    . MET A 1 112 ? 44.790 55.976  72.642  1.00 40.90  ? 112  MET A CE    1 
ATOM   662  N  N     . ALA A 1 113 ? 41.187 55.918  68.391  1.00 38.78  ? 113  ALA A N     1 
ATOM   663  C  CA    . ALA A 1 113 ? 41.170 57.151  67.622  1.00 39.30  ? 113  ALA A CA    1 
ATOM   664  C  C     . ALA A 1 113 ? 39.789 57.431  67.050  1.00 40.52  ? 113  ALA A C     1 
ATOM   665  O  O     . ALA A 1 113 ? 39.374 58.586  66.969  1.00 42.76  ? 113  ALA A O     1 
ATOM   666  C  CB    . ALA A 1 113 ? 42.193 57.080  66.498  1.00 38.04  ? 113  ALA A CB    1 
ATOM   667  N  N     . GLN A 1 114 ? 39.082 56.381  66.655  1.00 38.89  ? 114  GLN A N     1 
ATOM   668  C  CA    . GLN A 1 114 ? 37.756 56.541  66.070  1.00 41.34  ? 114  GLN A CA    1 
ATOM   669  C  C     . GLN A 1 114 ? 36.729 56.853  67.149  1.00 36.09  ? 114  GLN A C     1 
ATOM   670  O  O     . GLN A 1 114 ? 35.803 57.593  66.909  1.00 36.97  ? 114  GLN A O     1 
ATOM   671  C  CB    . GLN A 1 114 ? 37.338 55.294  65.290  1.00 42.31  ? 114  GLN A CB    1 
ATOM   672  C  CG    . GLN A 1 114 ? 38.277 54.943  64.168  1.00 45.48  ? 114  GLN A CG    1 
ATOM   673  C  CD    . GLN A 1 114 ? 37.977 55.694  62.888  1.00 47.93  ? 114  GLN A CD    1 
ATOM   674  O  OE1   . GLN A 1 114 ? 38.100 56.910  62.826  1.00 50.18  ? 114  GLN A OE1   1 
ATOM   675  N  NE2   . GLN A 1 114 ? 37.600 54.963  61.856  1.00 51.72  ? 114  GLN A NE2   1 
ATOM   676  N  N     . ILE A 1 115 ? 36.919 56.284  68.330  1.00 32.25  ? 115  ILE A N     1 
ATOM   677  C  CA    . ILE A 1 115 ? 36.067 56.560  69.472  1.00 31.27  ? 115  ILE A CA    1 
ATOM   678  C  C     . ILE A 1 115 ? 36.281 58.007  69.913  1.00 29.97  ? 115  ILE A C     1 
ATOM   679  O  O     . ILE A 1 115 ? 35.363 58.673  70.323  1.00 31.19  ? 115  ILE A O     1 
ATOM   680  C  CB    . ILE A 1 115 ? 36.374 55.604  70.633  1.00 28.65  ? 115  ILE A CB    1 
ATOM   681  C  CG1   . ILE A 1 115 ? 36.029 54.156  70.259  1.00 29.94  ? 115  ILE A CG1   1 
ATOM   682  C  CG2   . ILE A 1 115 ? 35.570 55.983  71.839  1.00 28.10  ? 115  ILE A CG2   1 
ATOM   683  C  CD1   . ILE A 1 115 ? 36.757 53.130  71.150  1.00 30.36  ? 115  ILE A CD1   1 
ATOM   684  N  N     . THR A 1 116 ? 37.502 58.486  69.793  1.00 27.40  ? 116  THR A N     1 
ATOM   685  C  CA    . THR A 1 116 ? 37.806 59.851  70.099  1.00 30.59  ? 116  THR A CA    1 
ATOM   686  C  C     . THR A 1 116 ? 36.975 60.799  69.238  1.00 32.87  ? 116  THR A C     1 
ATOM   687  O  O     . THR A 1 116 ? 36.367 61.740  69.751  1.00 33.61  ? 116  THR A O     1 
ATOM   688  C  CB    . THR A 1 116 ? 39.291 60.102  69.867  1.00 30.70  ? 116  THR A CB    1 
ATOM   689  O  OG1   . THR A 1 116 ? 40.057 59.224  70.699  1.00 28.30  ? 116  THR A OG1   1 
ATOM   690  C  CG2   . THR A 1 116 ? 39.680 61.489  70.322  1.00 28.94  ? 116  THR A CG2   1 
ATOM   691  N  N     . ALA A 1 117 ? 36.951 60.545  67.937  1.00 31.93  ? 117  ALA A N     1 
ATOM   692  C  CA    . ALA A 1 117 ? 36.244 61.420  67.008  1.00 33.36  ? 117  ALA A CA    1 
ATOM   693  C  C     . ALA A 1 117 ? 34.743 61.351  67.253  1.00 34.10  ? 117  ALA A C     1 
ATOM   694  O  O     . ALA A 1 117 ? 34.044 62.354  67.152  1.00 36.71  ? 117  ALA A O     1 
ATOM   695  C  CB    . ALA A 1 117 ? 36.561 61.044  65.558  1.00 32.39  ? 117  ALA A CB    1 
ATOM   696  N  N     . GLN A 1 118 ? 34.259 60.169  67.606  1.00 32.52  ? 118  GLN A N     1 
ATOM   697  C  CA    . GLN A 1 118 ? 32.840 59.958  67.778  1.00 35.19  ? 118  GLN A CA    1 
ATOM   698  C  C     . GLN A 1 118 ? 32.316 60.579  69.081  1.00 32.89  ? 118  GLN A C     1 
ATOM   699  O  O     . GLN A 1 118 ? 31.233 61.158  69.109  1.00 32.31  ? 118  GLN A O     1 
ATOM   700  C  CB    . GLN A 1 118 ? 32.540 58.468  67.702  1.00 39.21  ? 118  GLN A CB    1 
ATOM   701  C  CG    . GLN A 1 118 ? 32.543 57.944  66.289  1.00 43.07  ? 118  GLN A CG    1 
ATOM   702  C  CD    . GLN A 1 118 ? 31.321 58.411  65.494  1.00 47.61  ? 118  GLN A CD    1 
ATOM   703  O  OE1   . GLN A 1 118 ? 30.197 58.473  66.023  1.00 48.90  ? 118  GLN A OE1   1 
ATOM   704  N  NE2   . GLN A 1 118 ? 31.537 58.730  64.227  1.00 48.33  ? 118  GLN A NE2   1 
ATOM   705  N  N     . VAL A 1 119 ? 33.094 60.463  70.146  1.00 30.53  ? 119  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 119 ? 32.711 61.014  71.437  1.00 32.62  ? 119  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 119 ? 32.755 62.556  71.363  1.00 31.27  ? 119  VAL A C     1 
ATOM   708  O  O     . VAL A 1 119 ? 31.798 63.220  71.756  1.00 30.61  ? 119  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 119 ? 33.590 60.431  72.594  1.00 32.84  ? 119  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 119 ? 33.395 61.198  73.869  1.00 33.12  ? 119  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 119 ? 33.258 58.938  72.825  1.00 32.52  ? 119  VAL A CG2   1 
ATOM   712  N  N     . ALA A 1 120 ? 33.830 63.111  70.814  1.00 27.97  ? 120  ALA A N     1 
ATOM   713  C  CA    . ALA A 1 120 ? 33.906 64.555  70.568  1.00 27.50  ? 120  ALA A CA    1 
ATOM   714  C  C     . ALA A 1 120 ? 32.695 65.119  69.805  1.00 28.24  ? 120  ALA A C     1 
ATOM   715  O  O     . ALA A 1 120 ? 32.293 66.252  70.043  1.00 30.43  ? 120  ALA A O     1 
ATOM   716  C  CB    . ALA A 1 120 ? 35.171 64.898  69.838  1.00 26.39  ? 120  ALA A CB    1 
ATOM   717  N  N     . SER A 1 121 ? 32.113 64.336  68.908  1.00 25.68  ? 121  SER A N     1 
ATOM   718  C  CA    . SER A 1 121 ? 30.967 64.793  68.114  1.00 26.72  ? 121  SER A CA    1 
ATOM   719  C  C     . SER A 1 121 ? 29.621 64.704  68.815  1.00 26.93  ? 121  SER A C     1 
ATOM   720  O  O     . SER A 1 121 ? 28.613 65.115  68.251  1.00 32.70  ? 121  SER A O     1 
ATOM   721  C  CB    . SER A 1 121 ? 30.871 63.985  66.804  1.00 26.94  ? 121  SER A CB    1 
ATOM   722  O  OG    . SER A 1 121 ? 32.078 64.072  66.058  1.00 28.97  ? 121  SER A OG    1 
ATOM   723  N  N     . HIS A 1 122 ? 29.575 64.110  70.005  1.00 29.45  ? 122  HIS A N     1 
ATOM   724  C  CA    . HIS A 1 122 ? 28.313 63.916  70.728  1.00 27.07  ? 122  HIS A CA    1 
ATOM   725  C  C     . HIS A 1 122 ? 28.313 64.544  72.108  1.00 27.16  ? 122  HIS A C     1 
ATOM   726  O  O     . HIS A 1 122 ? 27.379 64.346  72.905  1.00 27.96  ? 122  HIS A O     1 
ATOM   727  C  CB    . HIS A 1 122 ? 28.049 62.438  70.875  1.00 28.00  ? 122  HIS A CB    1 
ATOM   728  C  CG    . HIS A 1 122 ? 27.755 61.739  69.590  1.00 24.08  ? 122  HIS A CG    1 
ATOM   729  N  ND1   . HIS A 1 122 ? 28.732 61.105  68.858  1.00 21.67  ? 122  HIS A ND1   1 
ATOM   730  C  CD2   . HIS A 1 122 ? 26.591 61.546  68.922  1.00 21.34  ? 122  HIS A CD2   1 
ATOM   731  C  CE1   . HIS A 1 122 ? 28.184 60.560  67.784  1.00 23.05  ? 122  HIS A CE1   1 
ATOM   732  N  NE2   . HIS A 1 122 ? 26.887 60.802  67.803  1.00 20.24  ? 122  HIS A NE2   1 
ATOM   733  N  N     . GLN A 1 123 ? 29.369 65.292  72.393  1.00 27.42  ? 123  GLN A N     1 
ATOM   734  C  CA    . GLN A 1 123 ? 29.414 66.161  73.552  1.00 28.86  ? 123  GLN A CA    1 
ATOM   735  C  C     . GLN A 1 123 ? 30.114 67.445  73.126  1.00 29.31  ? 123  GLN A C     1 
ATOM   736  O  O     . GLN A 1 123 ? 30.797 67.441  72.124  1.00 31.56  ? 123  GLN A O     1 
ATOM   737  C  CB    . GLN A 1 123 ? 30.138 65.450  74.685  1.00 29.07  ? 123  GLN A CB    1 
ATOM   738  C  CG    . GLN A 1 123 ? 31.627 65.293  74.481  1.00 31.23  ? 123  GLN A CG    1 
ATOM   739  C  CD    . GLN A 1 123 ? 32.284 64.457  75.561  1.00 30.63  ? 123  GLN A CD    1 
ATOM   740  O  OE1   . GLN A 1 123 ? 31.607 63.814  76.361  1.00 30.92  ? 123  GLN A OE1   1 
ATOM   741  N  NE2   . GLN A 1 123 ? 33.603 64.501  75.609  1.00 31.61  ? 123  GLN A NE2   1 
ATOM   742  N  N     . TYR A 1 124 ? 29.953 68.541  73.865  1.00 29.28  ? 124  TYR A N     1 
ATOM   743  C  CA    . TYR A 1 124 ? 30.635 69.800  73.498  1.00 26.80  ? 124  TYR A CA    1 
ATOM   744  C  C     . TYR A 1 124 ? 31.971 70.042  74.222  1.00 27.76  ? 124  TYR A C     1 
ATOM   745  O  O     . TYR A 1 124 ? 32.591 71.074  74.050  1.00 31.50  ? 124  TYR A O     1 
ATOM   746  C  CB    . TYR A 1 124 ? 29.705 70.996  73.690  1.00 23.08  ? 124  TYR A CB    1 
ATOM   747  C  CG    . TYR A 1 124 ? 29.121 71.140  75.077  1.00 22.44  ? 124  TYR A CG    1 
ATOM   748  C  CD1   . TYR A 1 124 ? 29.912 71.490  76.164  1.00 24.07  ? 124  TYR A CD1   1 
ATOM   749  C  CD2   . TYR A 1 124 ? 27.773 70.937  75.296  1.00 22.18  ? 124  TYR A CD2   1 
ATOM   750  C  CE1   . TYR A 1 124 ? 29.371 71.625  77.435  1.00 22.66  ? 124  TYR A CE1   1 
ATOM   751  C  CE2   . TYR A 1 124 ? 27.223 71.063  76.557  1.00 22.63  ? 124  TYR A CE2   1 
ATOM   752  C  CZ    . TYR A 1 124 ? 28.022 71.406  77.619  1.00 21.76  ? 124  TYR A CZ    1 
ATOM   753  O  OH    . TYR A 1 124 ? 27.460 71.559  78.863  1.00 21.74  ? 124  TYR A OH    1 
ATOM   754  N  N     . GLY A 1 125 ? 32.415 69.082  75.020  1.00 32.48  ? 125  GLY A N     1 
ATOM   755  C  CA    . GLY A 1 125 ? 33.588 69.241  75.863  1.00 31.87  ? 125  GLY A CA    1 
ATOM   756  C  C     . GLY A 1 125 ? 34.689 68.249  75.543  1.00 32.27  ? 125  GLY A C     1 
ATOM   757  O  O     . GLY A 1 125 ? 34.682 67.597  74.500  1.00 33.21  ? 125  GLY A O     1 
ATOM   758  N  N     . GLY A 1 126 ? 35.642 68.134  76.460  1.00 33.84  ? 126  GLY A N     1 
ATOM   759  C  CA    . GLY A 1 126 ? 36.815 67.320  76.254  1.00 34.16  ? 126  GLY A CA    1 
ATOM   760  C  C     . GLY A 1 126 ? 36.540 65.853  76.535  1.00 35.47  ? 126  GLY A C     1 
ATOM   761  O  O     . GLY A 1 126 ? 35.680 65.499  77.335  1.00 32.53  ? 126  GLY A O     1 
ATOM   762  N  N     . THR A 1 127 ? 37.292 65.016  75.835  1.00 36.61  ? 127  THR A N     1 
ATOM   763  C  CA    . THR A 1 127 ? 37.282 63.580  75.968  1.00 37.04  ? 127  THR A CA    1 
ATOM   764  C  C     . THR A 1 127 ? 38.591 63.170  76.634  1.00 37.19  ? 127  THR A C     1 
ATOM   765  O  O     . THR A 1 127 ? 39.658 63.563  76.176  1.00 38.61  ? 127  THR A O     1 
ATOM   766  C  CB    . THR A 1 127 ? 37.239 62.969  74.567  1.00 38.72  ? 127  THR A CB    1 
ATOM   767  O  OG1   . THR A 1 127 ? 36.176 63.569  73.815  1.00 37.48  ? 127  THR A OG1   1 
ATOM   768  C  CG2   . THR A 1 127 ? 36.882 61.473  74.619  1.00 39.42  ? 127  THR A CG2   1 
ATOM   769  N  N     . THR A 1 128 ? 38.516 62.375  77.695  1.00 33.59  ? 128  THR A N     1 
ATOM   770  C  CA    . THR A 1 128 ? 39.717 61.848  78.353  1.00 32.81  ? 128  THR A CA    1 
ATOM   771  C  C     . THR A 1 128 ? 39.770 60.307  78.314  1.00 31.19  ? 128  THR A C     1 
ATOM   772  O  O     . THR A 1 128 ? 38.780 59.651  78.614  1.00 32.47  ? 128  THR A O     1 
ATOM   773  C  CB    . THR A 1 128 ? 39.754 62.330  79.811  1.00 31.72  ? 128  THR A CB    1 
ATOM   774  O  OG1   . THR A 1 128 ? 40.188 63.702  79.870  1.00 31.04  ? 128  THR A OG1   1 
ATOM   775  C  CG2   . THR A 1 128 ? 40.787 61.553  80.610  1.00 31.89  ? 128  THR A CG2   1 
ATOM   776  N  N     . PHE A 1 129 ? 40.915 59.740  77.933  1.00 31.54  ? 129  PHE A N     1 
ATOM   777  C  CA    . PHE A 1 129 ? 41.188 58.307  78.122  1.00 30.72  ? 129  PHE A CA    1 
ATOM   778  C  C     . PHE A 1 129 ? 42.156 58.176  79.278  1.00 30.35  ? 129  PHE A C     1 
ATOM   779  O  O     . PHE A 1 129 ? 43.334 58.494  79.142  1.00 27.61  ? 129  PHE A O     1 
ATOM   780  C  CB    . PHE A 1 129 ? 41.773 57.666  76.846  1.00 32.10  ? 129  PHE A CB    1 
ATOM   781  C  CG    . PHE A 1 129 ? 40.826 57.694  75.677  1.00 33.22  ? 129  PHE A CG    1 
ATOM   782  C  CD1   . PHE A 1 129 ? 40.837 58.759  74.785  1.00 32.77  ? 129  PHE A CD1   1 
ATOM   783  C  CD2   . PHE A 1 129 ? 39.891 56.685  75.502  1.00 33.67  ? 129  PHE A CD2   1 
ATOM   784  C  CE1   . PHE A 1 129 ? 39.948 58.815  73.736  1.00 33.37  ? 129  PHE A CE1   1 
ATOM   785  C  CE2   . PHE A 1 129 ? 39.000 56.734  74.451  1.00 36.07  ? 129  PHE A CE2   1 
ATOM   786  C  CZ    . PHE A 1 129 ? 39.032 57.808  73.560  1.00 34.34  ? 129  PHE A CZ    1 
ATOM   787  N  N     . ALA A 1 130 ? 41.642 57.731  80.419  1.00 31.58  ? 130  ALA A N     1 
ATOM   788  C  CA    . ALA A 1 130 ? 42.439 57.549  81.625  1.00 33.80  ? 130  ALA A CA    1 
ATOM   789  C  C     . ALA A 1 130 ? 43.246 56.237  81.611  1.00 35.29  ? 130  ALA A C     1 
ATOM   790  O  O     . ALA A 1 130 ? 42.714 55.180  81.246  1.00 29.53  ? 130  ALA A O     1 
ATOM   791  C  CB    . ALA A 1 130 ? 41.544 57.568  82.848  1.00 34.05  ? 130  ALA A CB    1 
ATOM   792  N  N     . ASN A 1 131 ? 44.523 56.342  82.018  1.00 35.39  ? 131  ASN A N     1 
ATOM   793  C  CA    . ASN A 1 131 ? 45.388 55.206  82.289  1.00 34.22  ? 131  ASN A CA    1 
ATOM   794  C  C     . ASN A 1 131 ? 45.571 54.310  81.083  1.00 34.25  ? 131  ASN A C     1 
ATOM   795  O  O     . ASN A 1 131 ? 45.414 53.103  81.200  1.00 32.95  ? 131  ASN A O     1 
ATOM   796  C  CB    . ASN A 1 131 ? 44.826 54.367  83.451  1.00 34.66  ? 131  ASN A CB    1 
ATOM   797  C  CG    . ASN A 1 131 ? 44.567 55.194  84.688  1.00 32.16  ? 131  ASN A CG    1 
ATOM   798  O  OD1   . ASN A 1 131 ? 43.460 55.195  85.235  1.00 32.73  ? 131  ASN A OD1   1 
ATOM   799  N  ND2   . ASN A 1 131 ? 45.590 55.902  85.139  1.00 27.58  ? 131  ASN A ND2   1 
ATOM   800  N  N     . VAL A 1 132 ? 45.896 54.897  79.934  1.00 33.91  ? 132  VAL A N     1 
ATOM   801  C  CA    . VAL A 1 132 ? 46.012 54.127  78.700  1.00 36.34  ? 132  VAL A CA    1 
ATOM   802  C  C     . VAL A 1 132 ? 47.124 53.086  78.759  1.00 39.91  ? 132  VAL A C     1 
ATOM   803  O  O     . VAL A 1 132 ? 47.094 52.132  77.993  1.00 39.05  ? 132  VAL A O     1 
ATOM   804  C  CB    . VAL A 1 132 ? 46.192 55.017  77.408  1.00 33.81  ? 132  VAL A CB    1 
ATOM   805  C  CG1   . VAL A 1 132 ? 44.896 55.784  77.100  1.00 31.06  ? 132  VAL A CG1   1 
ATOM   806  C  CG2   . VAL A 1 132 ? 47.396 55.944  77.525  1.00 32.56  ? 132  VAL A CG2   1 
ATOM   807  N  N     . ASP A 1 133 ? 48.108 53.285  79.637  1.00 41.52  ? 133  ASP A N     1 
ATOM   808  C  CA    . ASP A 1 133 ? 49.108 52.245  79.901  1.00 43.92  ? 133  ASP A CA    1 
ATOM   809  C  C     . ASP A 1 133 ? 48.507 50.944  80.452  1.00 42.84  ? 133  ASP A C     1 
ATOM   810  O  O     . ASP A 1 133 ? 48.812 49.858  79.955  1.00 44.02  ? 133  ASP A O     1 
ATOM   811  C  CB    . ASP A 1 133 ? 50.243 52.745  80.813  1.00 44.97  ? 133  ASP A CB    1 
ATOM   812  C  CG    . ASP A 1 133 ? 49.749 53.481  82.054  1.00 44.54  ? 133  ASP A CG    1 
ATOM   813  O  OD1   . ASP A 1 133 ? 48.526 53.727  82.197  1.00 39.70  ? 133  ASP A OD1   1 
ATOM   814  O  OD2   . ASP A 1 133 ? 50.550 53.845  82.940  1.00 42.06  ? 133  ASP A OD2   1 
ATOM   815  N  N     . LYS A 1 134 ? 47.641 51.051  81.452  1.00 44.92  ? 134  LYS A N     1 
ATOM   816  C  CA    . LYS A 1 134 ? 46.942 49.887  82.004  1.00 45.48  ? 134  LYS A CA    1 
ATOM   817  C  C     . LYS A 1 134 ? 45.911 49.337  81.035  1.00 44.96  ? 134  LYS A C     1 
ATOM   818  O  O     . LYS A 1 134 ? 45.828 48.122  80.842  1.00 49.40  ? 134  LYS A O     1 
ATOM   819  C  CB    . LYS A 1 134 ? 46.237 50.228  83.324  1.00 46.72  ? 134  LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 134 ? 47.159 50.739  84.416  1.00 49.49  ? 134  LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 134 ? 46.458 50.774  85.775  1.00 52.44  ? 134  LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 134 ? 47.119 49.853  86.813  1.00 54.69  ? 134  LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 134 ? 47.276 50.489  88.173  1.00 55.83  ? 134  LYS A NZ    1 
ATOM   824  N  N     . VAL A 1 135 ? 45.125 50.221  80.426  1.00 42.69  ? 135  VAL A N     1 
ATOM   825  C  CA    . VAL A 1 135 ? 43.992 49.791  79.609  1.00 40.91  ? 135  VAL A CA    1 
ATOM   826  C  C     . VAL A 1 135 ? 44.457 49.071  78.343  1.00 40.46  ? 135  VAL A C     1 
ATOM   827  O  O     . VAL A 1 135 ? 43.834 48.098  77.944  1.00 38.61  ? 135  VAL A O     1 
ATOM   828  C  CB    . VAL A 1 135 ? 43.072 50.979  79.217  1.00 40.46  ? 135  VAL A CB    1 
ATOM   829  C  CG1   . VAL A 1 135 ? 42.013 50.551  78.187  1.00 38.37  ? 135  VAL A CG1   1 
ATOM   830  C  CG2   . VAL A 1 135 ? 42.413 51.613  80.469  1.00 39.70  ? 135  VAL A CG2   1 
ATOM   831  N  N     . LEU A 1 136 ? 45.539 49.547  77.726  1.00 40.81  ? 136  LEU A N     1 
ATOM   832  C  CA    . LEU A 1 136 ? 45.991 49.035  76.430  1.00 43.63  ? 136  LEU A CA    1 
ATOM   833  C  C     . LEU A 1 136 ? 47.052 47.924  76.553  1.00 45.33  ? 136  LEU A C     1 
ATOM   834  O  O     . LEU A 1 136 ? 47.406 47.271  75.562  1.00 42.61  ? 136  LEU A O     1 
ATOM   835  C  CB    . LEU A 1 136 ? 46.505 50.179  75.540  1.00 42.95  ? 136  LEU A CB    1 
ATOM   836  C  CG    . LEU A 1 136 ? 45.425 51.172  75.088  1.00 44.16  ? 136  LEU A CG    1 
ATOM   837  C  CD1   . LEU A 1 136 ? 46.046 52.374  74.416  1.00 45.69  ? 136  LEU A CD1   1 
ATOM   838  C  CD2   . LEU A 1 136 ? 44.431 50.530  74.152  1.00 45.19  ? 136  LEU A CD2   1 
ATOM   839  N  N     . SER A 1 137 ? 47.533 47.729  77.778  1.00 47.40  ? 137  SER A N     1 
ATOM   840  C  CA    . SER A 1 137 ? 48.447 46.644  78.154  1.00 47.22  ? 137  SER A CA    1 
ATOM   841  C  C     . SER A 1 137 ? 48.109 45.270  77.553  1.00 44.00  ? 137  SER A C     1 
ATOM   842  O  O     . SER A 1 137 ? 48.982 44.643  76.971  1.00 42.12  ? 137  SER A O     1 
ATOM   843  C  CB    . SER A 1 137 ? 48.532 46.557  79.689  1.00 48.74  ? 137  SER A CB    1 
ATOM   844  O  OG    . SER A 1 137 ? 49.341 45.485  80.121  1.00 53.04  ? 137  SER A OG    1 
ATOM   845  N  N     . PRO A 1 138 ? 46.866 44.805  77.658  1.00 43.01  ? 138  PRO A N     1 
ATOM   846  C  CA    . PRO A 1 138 ? 46.523 43.471  77.153  1.00 42.79  ? 138  PRO A CA    1 
ATOM   847  C  C     . PRO A 1 138 ? 46.706 43.316  75.651  1.00 44.31  ? 138  PRO A C     1 
ATOM   848  O  O     . PRO A 1 138 ? 46.839 42.174  75.213  1.00 45.15  ? 138  PRO A O     1 
ATOM   849  C  CB    . PRO A 1 138 ? 45.039 43.322  77.513  1.00 43.87  ? 138  PRO A CB    1 
ATOM   850  C  CG    . PRO A 1 138 ? 44.797 44.321  78.572  1.00 44.23  ? 138  PRO A CG    1 
ATOM   851  C  CD    . PRO A 1 138 ? 45.693 45.467  78.252  1.00 44.42  ? 138  PRO A CD    1 
ATOM   852  N  N     . TYR A 1 139 ? 46.704 44.421  74.896  1.00 42.10  ? 139  TYR A N     1 
ATOM   853  C  CA    . TYR A 1 139 ? 46.841 44.378  73.438  1.00 40.85  ? 139  TYR A CA    1 
ATOM   854  C  C     . TYR A 1 139 ? 48.309 44.394  73.011  1.00 41.35  ? 139  TYR A C     1 
ATOM   855  O  O     . TYR A 1 139 ? 48.662 43.877  71.956  1.00 40.25  ? 139  TYR A O     1 
ATOM   856  C  CB    . TYR A 1 139 ? 45.986 45.486  72.796  1.00 38.85  ? 139  TYR A CB    1 
ATOM   857  C  CG    . TYR A 1 139 ? 44.608 45.430  73.402  1.00 37.09  ? 139  TYR A CG    1 
ATOM   858  C  CD1   . TYR A 1 139 ? 43.750 44.382  73.105  1.00 36.35  ? 139  TYR A CD1   1 
ATOM   859  C  CD2   . TYR A 1 139 ? 44.207 46.347  74.361  1.00 34.61  ? 139  TYR A CD2   1 
ATOM   860  C  CE1   . TYR A 1 139 ? 42.513 44.281  73.706  1.00 36.08  ? 139  TYR A CE1   1 
ATOM   861  C  CE2   . TYR A 1 139 ? 42.955 46.247  74.967  1.00 33.85  ? 139  TYR A CE2   1 
ATOM   862  C  CZ    . TYR A 1 139 ? 42.122 45.222  74.640  1.00 33.56  ? 139  TYR A CZ    1 
ATOM   863  O  OH    . TYR A 1 139 ? 40.885 45.115  75.242  1.00 38.74  ? 139  TYR A OH    1 
ATOM   864  N  N     . VAL A 1 140 ? 49.158 44.963  73.852  1.00 43.43  ? 140  VAL A N     1 
ATOM   865  C  CA    . VAL A 1 140 ? 50.596 44.810  73.719  1.00 46.08  ? 140  VAL A CA    1 
ATOM   866  C  C     . VAL A 1 140 ? 50.991 43.346  73.990  1.00 49.45  ? 140  VAL A C     1 
ATOM   867  O  O     . VAL A 1 140 ? 51.938 42.841  73.392  1.00 45.42  ? 140  VAL A O     1 
ATOM   868  C  CB    . VAL A 1 140 ? 51.345 45.729  74.691  1.00 46.97  ? 140  VAL A CB    1 
ATOM   869  C  CG1   . VAL A 1 140 ? 52.848 45.525  74.570  1.00 46.94  ? 140  VAL A CG1   1 
ATOM   870  C  CG2   . VAL A 1 140 ? 50.988 47.193  74.420  1.00 48.94  ? 140  VAL A CG2   1 
ATOM   871  N  N     . LYS A 1 141 ? 50.251 42.681  74.883  1.00 51.95  ? 141  LYS A N     1 
ATOM   872  C  CA    . LYS A 1 141 ? 50.482 41.274  75.208  1.00 54.25  ? 141  LYS A CA    1 
ATOM   873  C  C     . LYS A 1 141 ? 50.079 40.366  74.065  1.00 52.93  ? 141  LYS A C     1 
ATOM   874  O  O     . LYS A 1 141 ? 50.667 39.300  73.890  1.00 54.37  ? 141  LYS A O     1 
ATOM   875  C  CB    . LYS A 1 141 ? 49.722 40.846  76.479  1.00 57.17  ? 141  LYS A CB    1 
ATOM   876  C  CG    . LYS A 1 141 ? 50.461 41.156  77.789  1.00 60.17  ? 141  LYS A CG    1 
ATOM   877  C  CD    . LYS A 1 141 ? 49.733 40.589  79.017  1.00 62.83  ? 141  LYS A CD    1 
ATOM   878  C  CE    . LYS A 1 141 ? 49.664 41.598  80.171  1.00 64.34  ? 141  LYS A CE    1 
ATOM   879  N  NZ    . LYS A 1 141 ? 50.995 41.827  80.819  1.00 64.45  ? 141  LYS A NZ    1 
ATOM   880  N  N     . ARG A 1 142 ? 49.062 40.762  73.304  1.00 50.87  ? 142  ARG A N     1 
ATOM   881  C  CA    . ARG A 1 142 ? 48.617 39.944  72.187  1.00 49.44  ? 142  ARG A CA    1 
ATOM   882  C  C     . ARG A 1 142 ? 49.567 40.094  71.015  1.00 48.77  ? 142  ARG A C     1 
ATOM   883  O  O     . ARG A 1 142 ? 49.855 39.127  70.321  1.00 50.23  ? 142  ARG A O     1 
ATOM   884  C  CB    . ARG A 1 142 ? 47.171 40.252  71.802  1.00 49.94  ? 142  ARG A CB    1 
ATOM   885  C  CG    . ARG A 1 142 ? 46.179 39.444  72.621  1.00 52.23  ? 142  ARG A CG    1 
ATOM   886  C  CD    . ARG A 1 142 ? 45.087 40.242  73.302  1.00 55.30  ? 142  ARG A CD    1 
ATOM   887  N  NE    . ARG A 1 142 ? 43.826 40.116  72.575  1.00 58.00  ? 142  ARG A NE    1 
ATOM   888  C  CZ    . ARG A 1 142 ? 42.654 39.724  73.082  1.00 60.69  ? 142  ARG A CZ    1 
ATOM   889  N  NH1   . ARG A 1 142 ? 42.503 39.402  74.366  1.00 61.05  ? 142  ARG A NH1   1 
ATOM   890  N  NH2   . ARG A 1 142 ? 41.605 39.653  72.270  1.00 62.80  ? 142  ARG A NH2   1 
ATOM   891  N  N     . THR A 1 143 ? 50.077 41.303  70.822  1.00 49.09  ? 143  THR A N     1 
ATOM   892  C  CA    . THR A 1 143 ? 51.100 41.572  69.817  1.00 50.14  ? 143  THR A CA    1 
ATOM   893  C  C     . THR A 1 143 ? 52.369 40.775  70.105  1.00 51.74  ? 143  THR A C     1 
ATOM   894  O  O     . THR A 1 143 ? 52.979 40.245  69.186  1.00 53.80  ? 143  THR A O     1 
ATOM   895  C  CB    . THR A 1 143 ? 51.399 43.108  69.746  1.00 48.90  ? 143  THR A CB    1 
ATOM   896  O  OG1   . THR A 1 143 ? 50.402 43.745  68.942  1.00 50.12  ? 143  THR A OG1   1 
ATOM   897  C  CG2   . THR A 1 143 ? 52.699 43.437  69.008  1.00 45.91  ? 143  THR A CG2   1 
ATOM   898  N  N     . TYR A 1 144 ? 52.744 40.681  71.381  1.00 54.62  ? 144  TYR A N     1 
ATOM   899  C  CA    . TYR A 1 144 ? 53.963 39.978  71.798  1.00 55.50  ? 144  TYR A CA    1 
ATOM   900  C  C     . TYR A 1 144 ? 53.840 38.483  71.510  1.00 52.91  ? 144  TYR A C     1 
ATOM   901  O  O     . TYR A 1 144 ? 54.763 37.894  70.974  1.00 54.35  ? 144  TYR A O     1 
ATOM   902  C  CB    . TYR A 1 144 ? 54.269 40.210  73.292  1.00 56.23  ? 144  TYR A CB    1 
ATOM   903  C  CG    . TYR A 1 144 ? 55.578 39.587  73.768  1.00 57.82  ? 144  TYR A CG    1 
ATOM   904  C  CD1   . TYR A 1 144 ? 56.810 40.183  73.485  1.00 58.76  ? 144  TYR A CD1   1 
ATOM   905  C  CD2   . TYR A 1 144 ? 55.580 38.399  74.503  1.00 59.05  ? 144  TYR A CD2   1 
ATOM   906  C  CE1   . TYR A 1 144 ? 58.008 39.610  73.921  1.00 59.82  ? 144  TYR A CE1   1 
ATOM   907  C  CE2   . TYR A 1 144 ? 56.767 37.814  74.939  1.00 59.82  ? 144  TYR A CE2   1 
ATOM   908  C  CZ    . TYR A 1 144 ? 57.976 38.420  74.651  1.00 60.81  ? 144  TYR A CZ    1 
ATOM   909  O  OH    . TYR A 1 144 ? 59.140 37.833  75.089  1.00 60.67  ? 144  TYR A OH    1 
ATOM   910  N  N     . ALA A 1 145 ? 52.696 37.900  71.853  1.00 49.66  ? 145  ALA A N     1 
ATOM   911  C  CA    . ALA A 1 145 ? 52.412 36.494  71.597  1.00 50.45  ? 145  ALA A CA    1 
ATOM   912  C  C     . ALA A 1 145 ? 52.410 36.162  70.108  1.00 54.51  ? 145  ALA A C     1 
ATOM   913  O  O     . ALA A 1 145 ? 52.792 35.060  69.729  1.00 59.09  ? 145  ALA A O     1 
ATOM   914  C  CB    . ALA A 1 145 ? 51.075 36.098  72.214  1.00 48.18  ? 145  ALA A CB    1 
ATOM   915  N  N     . LYS A 1 146 ? 51.978 37.100  69.271  1.00 56.29  ? 146  LYS A N     1 
ATOM   916  C  CA    . LYS A 1 146 ? 51.946 36.889  67.819  1.00 57.49  ? 146  LYS A CA    1 
ATOM   917  C  C     . LYS A 1 146 ? 53.357 36.776  67.237  1.00 58.08  ? 146  LYS A C     1 
ATOM   918  O  O     . LYS A 1 146 ? 53.590 35.999  66.316  1.00 56.97  ? 146  LYS A O     1 
ATOM   919  C  CB    . LYS A 1 146 ? 51.212 38.039  67.103  1.00 56.37  ? 146  LYS A CB    1 
ATOM   920  C  CG    . LYS A 1 146 ? 49.744 37.778  66.802  1.00 56.11  ? 146  LYS A CG    1 
ATOM   921  C  CD    . LYS A 1 146 ? 49.065 39.042  66.282  1.00 55.35  ? 146  LYS A CD    1 
ATOM   922  C  CE    . LYS A 1 146 ? 47.585 38.818  66.014  1.00 55.34  ? 146  LYS A CE    1 
ATOM   923  N  NZ    . LYS A 1 146 ? 47.000 39.989  65.306  1.00 54.34  ? 146  LYS A NZ    1 
ATOM   924  N  N     . HIS A 1 147 ? 54.276 37.584  67.752  1.00 59.49  ? 147  HIS A N     1 
ATOM   925  C  CA    . HIS A 1 147 ? 55.657 37.582  67.283  1.00 62.20  ? 147  HIS A CA    1 
ATOM   926  C  C     . HIS A 1 147 ? 56.435 36.384  67.841  1.00 64.49  ? 147  HIS A C     1 
ATOM   927  O  O     . HIS A 1 147 ? 57.359 35.900  67.196  1.00 62.62  ? 147  HIS A O     1 
ATOM   928  C  CB    . HIS A 1 147 ? 56.361 38.882  67.675  1.00 61.19  ? 147  HIS A CB    1 
ATOM   929  C  CG    . HIS A 1 147 ? 55.873 40.076  66.923  1.00 61.42  ? 147  HIS A CG    1 
ATOM   930  N  ND1   . HIS A 1 147 ? 55.852 40.129  65.548  1.00 62.17  ? 147  HIS A ND1   1 
ATOM   931  C  CD2   . HIS A 1 147 ? 55.380 41.260  67.354  1.00 60.61  ? 147  HIS A CD2   1 
ATOM   932  C  CE1   . HIS A 1 147 ? 55.371 41.296  65.162  1.00 60.82  ? 147  HIS A CE1   1 
ATOM   933  N  NE2   . HIS A 1 147 ? 55.077 42.000  66.239  1.00 61.13  ? 147  HIS A NE2   1 
ATOM   934  N  N     . ILE A 1 148 ? 56.059 35.930  69.039  1.00 67.32  ? 148  ILE A N     1 
ATOM   935  C  CA    . ILE A 1 148 ? 56.611 34.715  69.635  1.00 70.34  ? 148  ILE A CA    1 
ATOM   936  C  C     . ILE A 1 148 ? 56.210 33.518  68.768  1.00 71.34  ? 148  ILE A C     1 
ATOM   937  O  O     . ILE A 1 148 ? 57.010 32.621  68.524  1.00 71.65  ? 148  ILE A O     1 
ATOM   938  C  CB    . ILE A 1 148 ? 56.102 34.545  71.109  1.00 71.83  ? 148  ILE A CB    1 
ATOM   939  C  CG1   . ILE A 1 148 ? 56.885 35.449  72.073  1.00 72.73  ? 148  ILE A CG1   1 
ATOM   940  C  CG2   . ILE A 1 148 ? 56.177 33.084  71.577  1.00 72.45  ? 148  ILE A CG2   1 
ATOM   941  C  CD1   . ILE A 1 148 ? 58.357 35.049  72.307  1.00 73.02  ? 148  ILE A CD1   1 
ATOM   942  N  N     . GLU A 1 149 ? 54.964 33.531  68.309  1.00 72.33  ? 149  GLU A N     1 
ATOM   943  C  CA    . GLU A 1 149 ? 54.433 32.513  67.420  1.00 74.36  ? 149  GLU A CA    1 
ATOM   944  C  C     . GLU A 1 149 ? 55.145 32.534  66.062  1.00 74.60  ? 149  GLU A C     1 
ATOM   945  O  O     . GLU A 1 149 ? 55.290 31.492  65.428  1.00 75.38  ? 149  GLU A O     1 
ATOM   946  C  CB    . GLU A 1 149 ? 52.920 32.718  67.268  1.00 76.17  ? 149  GLU A CB    1 
ATOM   947  C  CG    . GLU A 1 149 ? 52.246 32.025  66.089  1.00 79.12  ? 149  GLU A CG    1 
ATOM   948  C  CD    . GLU A 1 149 ? 50.788 32.447  65.943  1.00 81.89  ? 149  GLU A CD    1 
ATOM   949  O  OE1   . GLU A 1 149 ? 49.903 31.562  65.995  1.00 82.77  ? 149  GLU A OE1   1 
ATOM   950  O  OE2   . GLU A 1 149 ? 50.525 33.671  65.793  1.00 83.07  ? 149  GLU A OE2   1 
ATOM   951  N  N     . ASP A 1 150 ? 55.582 33.718  65.631  1.00 75.05  ? 150  ASP A N     1 
ATOM   952  C  CA    . ASP A 1 150 ? 56.323 33.888  64.375  1.00 75.71  ? 150  ASP A CA    1 
ATOM   953  C  C     . ASP A 1 150 ? 57.809 33.539  64.504  1.00 76.82  ? 150  ASP A C     1 
ATOM   954  O  O     . ASP A 1 150 ? 58.467 33.285  63.500  1.00 77.82  ? 150  ASP A O     1 
ATOM   955  C  CB    . ASP A 1 150 ? 56.224 35.337  63.869  1.00 75.68  ? 150  ASP A CB    1 
ATOM   956  C  CG    . ASP A 1 150 ? 54.994 35.591  63.015  1.00 75.61  ? 150  ASP A CG    1 
ATOM   957  O  OD1   . ASP A 1 150 ? 54.430 34.631  62.448  1.00 75.43  ? 150  ASP A OD1   1 
ATOM   958  O  OD2   . ASP A 1 150 ? 54.530 36.740  62.845  1.00 75.88  ? 150  ASP A OD2   1 
ATOM   959  N  N     . ALA A 1 151 ? 58.348 33.562  65.722  1.00 77.33  ? 151  ALA A N     1 
ATOM   960  C  CA    . ALA A 1 151 ? 59.744 33.182  65.944  1.00 77.97  ? 151  ALA A CA    1 
ATOM   961  C  C     . ALA A 1 151 ? 59.897 31.663  65.849  1.00 78.25  ? 151  ALA A C     1 
ATOM   962  O  O     . ALA A 1 151 ? 60.926 31.175  65.398  1.00 77.93  ? 151  ALA A O     1 
ATOM   963  C  CB    . ALA A 1 151 ? 60.242 33.688  67.287  1.00 77.69  ? 151  ALA A CB    1 
ATOM   964  N  N     . GLU A 1 152 ? 58.865 30.929  66.265  1.00 79.02  ? 152  GLU A N     1 
ATOM   965  C  CA    . GLU A 1 152 ? 58.837 29.478  66.123  1.00 81.08  ? 152  GLU A CA    1 
ATOM   966  C  C     . GLU A 1 152 ? 58.469 29.069  64.688  1.00 80.77  ? 152  GLU A C     1 
ATOM   967  O  O     . GLU A 1 152 ? 59.043 28.126  64.144  1.00 81.60  ? 152  GLU A O     1 
ATOM   968  C  CB    . GLU A 1 152 ? 57.896 28.841  67.166  1.00 83.35  ? 152  GLU A CB    1 
ATOM   969  C  CG    . GLU A 1 152 ? 56.513 28.449  66.670  1.00 86.05  ? 152  GLU A CG    1 
ATOM   970  C  CD    . GLU A 1 152 ? 55.582 28.022  67.794  1.00 88.34  ? 152  GLU A CD    1 
ATOM   971  O  OE1   . GLU A 1 152 ? 54.569 28.722  68.043  1.00 89.33  ? 152  GLU A OE1   1 
ATOM   972  O  OE2   . GLU A 1 152 ? 55.858 26.977  68.422  1.00 89.63  ? 152  GLU A OE2   1 
ATOM   973  N  N     . LYS A 1 153 ? 57.540 29.794  64.067  1.00 79.28  ? 153  LYS A N     1 
ATOM   974  C  CA    . LYS A 1 153 ? 57.072 29.458  62.726  1.00 77.77  ? 153  LYS A CA    1 
ATOM   975  C  C     . LYS A 1 153 ? 58.191 29.569  61.685  1.00 76.92  ? 153  LYS A C     1 
ATOM   976  O  O     . LYS A 1 153 ? 58.189 28.835  60.699  1.00 78.41  ? 153  LYS A O     1 
ATOM   977  C  CB    . LYS A 1 153 ? 55.885 30.352  62.336  1.00 78.43  ? 153  LYS A CB    1 
ATOM   978  C  CG    . LYS A 1 153 ? 55.324 30.109  60.927  1.00 77.96  ? 153  LYS A CG    1 
ATOM   979  C  CD    . LYS A 1 153 ? 53.797 30.158  60.904  1.00 78.55  ? 153  LYS A CD    1 
ATOM   980  C  CE    . LYS A 1 153 ? 53.228 29.767  59.536  1.00 78.55  ? 153  LYS A CE    1 
ATOM   981  N  NZ    . LYS A 1 153 ? 52.949 30.961  58.697  1.00 76.83  ? 153  LYS A NZ    1 
ATOM   982  N  N     . TRP A 1 154 ? 59.147 30.471  61.911  1.00 74.98  ? 154  TRP A N     1 
ATOM   983  C  CA    . TRP A 1 154 ? 60.198 30.767  60.929  1.00 73.94  ? 154  TRP A CA    1 
ATOM   984  C  C     . TRP A 1 154 ? 61.632 30.490  61.435  1.00 73.95  ? 154  TRP A C     1 
ATOM   985  O  O     . TRP A 1 154 ? 62.603 30.981  60.850  1.00 72.42  ? 154  TRP A O     1 
ATOM   986  C  CB    . TRP A 1 154 ? 60.076 32.227  60.447  1.00 73.15  ? 154  TRP A CB    1 
ATOM   987  C  CG    . TRP A 1 154 ? 58.771 32.529  59.762  1.00 72.68  ? 154  TRP A CG    1 
ATOM   988  C  CD1   . TRP A 1 154 ? 57.724 33.246  60.269  1.00 71.45  ? 154  TRP A CD1   1 
ATOM   989  C  CD2   . TRP A 1 154 ? 58.373 32.120  58.449  1.00 72.74  ? 154  TRP A CD2   1 
ATOM   990  N  NE1   . TRP A 1 154 ? 56.700 33.300  59.356  1.00 71.42  ? 154  TRP A NE1   1 
ATOM   991  C  CE2   . TRP A 1 154 ? 57.069 32.617  58.230  1.00 72.11  ? 154  TRP A CE2   1 
ATOM   992  C  CE3   . TRP A 1 154 ? 58.984 31.375  57.432  1.00 72.67  ? 154  TRP A CE3   1 
ATOM   993  C  CZ2   . TRP A 1 154 ? 56.368 32.397  57.042  1.00 72.85  ? 154  TRP A CZ2   1 
ATOM   994  C  CZ3   . TRP A 1 154 ? 58.286 31.154  56.250  1.00 73.70  ? 154  TRP A CZ3   1 
ATOM   995  C  CH2   . TRP A 1 154 ? 56.991 31.667  56.066  1.00 73.92  ? 154  TRP A CH2   1 
ATOM   996  N  N     . GLN A 1 155 ? 61.761 29.707  62.511  1.00 75.49  ? 155  GLN A N     1 
ATOM   997  C  CA    . GLN A 1 155 ? 63.068 29.213  62.979  1.00 76.46  ? 155  GLN A CA    1 
ATOM   998  C  C     . GLN A 1 155 ? 64.053 30.351  63.246  1.00 75.86  ? 155  GLN A C     1 
ATOM   999  O  O     . GLN A 1 155 ? 65.196 30.325  62.780  1.00 74.47  ? 155  GLN A O     1 
ATOM   1000 C  CB    . GLN A 1 155 ? 63.677 28.234  61.959  1.00 78.21  ? 155  GLN A CB    1 
ATOM   1001 C  CG    . GLN A 1 155 ? 62.708 27.201  61.375  1.00 79.10  ? 155  GLN A CG    1 
ATOM   1002 C  CD    . GLN A 1 155 ? 62.446 26.056  62.325  1.00 80.51  ? 155  GLN A CD    1 
ATOM   1003 O  OE1   . GLN A 1 155 ? 62.138 26.278  63.500  1.00 81.84  ? 155  GLN A OE1   1 
ATOM   1004 N  NE2   . GLN A 1 155 ? 62.568 24.827  61.827  1.00 80.15  ? 155  GLN A NE2   1 
ATOM   1005 N  N     . ILE A 1 156 ? 63.596 31.348  63.998  1.00 75.87  ? 156  ILE A N     1 
ATOM   1006 C  CA    . ILE A 1 156 ? 64.381 32.549  64.240  1.00 75.39  ? 156  ILE A CA    1 
ATOM   1007 C  C     . ILE A 1 156 ? 65.313 32.263  65.397  1.00 75.25  ? 156  ILE A C     1 
ATOM   1008 O  O     . ILE A 1 156 ? 64.870 31.819  66.458  1.00 75.05  ? 156  ILE A O     1 
ATOM   1009 C  CB    . ILE A 1 156 ? 63.471 33.764  64.520  1.00 74.94  ? 156  ILE A CB    1 
ATOM   1010 C  CG1   . ILE A 1 156 ? 62.429 33.901  63.402  1.00 75.42  ? 156  ILE A CG1   1 
ATOM   1011 C  CG2   . ILE A 1 156 ? 64.303 35.044  64.617  1.00 74.27  ? 156  ILE A CG2   1 
ATOM   1012 C  CD1   . ILE A 1 156 ? 61.659 35.219  63.399  1.00 75.87  ? 156  ILE A CD1   1 
ATOM   1013 N  N     . ALA A 1 157 ? 66.604 32.510  65.173  1.00 76.19  ? 157  ALA A N     1 
ATOM   1014 C  CA    . ALA A 1 157 ? 67.650 32.098  66.108  1.00 76.83  ? 157  ALA A CA    1 
ATOM   1015 C  C     . ALA A 1 157 ? 67.442 32.764  67.461  1.00 76.89  ? 157  ALA A C     1 
ATOM   1016 O  O     . ALA A 1 157 ? 67.189 32.091  68.463  1.00 77.12  ? 157  ALA A O     1 
ATOM   1017 C  CB    . ALA A 1 157 ? 69.039 32.429  65.548  1.00 76.28  ? 157  ALA A CB    1 
ATOM   1018 N  N     . ASP A 1 158 ? 67.517 34.092  67.463  1.00 76.21  ? 158  ASP A N     1 
ATOM   1019 C  CA    . ASP A 1 158 ? 67.349 34.895  68.670  1.00 75.54  ? 158  ASP A CA    1 
ATOM   1020 C  C     . ASP A 1 158 ? 65.844 35.216  68.870  1.00 76.01  ? 158  ASP A C     1 
ATOM   1021 O  O     . ASP A 1 158 ? 65.366 36.275  68.462  1.00 76.53  ? 158  ASP A O     1 
ATOM   1022 C  CB    . ASP A 1 158 ? 68.216 36.165  68.535  1.00 74.38  ? 158  ASP A CB    1 
ATOM   1023 C  CG    . ASP A 1 158 ? 68.554 36.806  69.872  1.00 74.37  ? 158  ASP A CG    1 
ATOM   1024 O  OD1   . ASP A 1 158 ? 67.996 36.391  70.914  1.00 74.11  ? 158  ASP A OD1   1 
ATOM   1025 O  OD2   . ASP A 1 158 ? 69.367 37.750  69.972  1.00 73.52  ? 158  ASP A OD2   1 
ATOM   1026 N  N     . ALA A 1 159 ? 65.109 34.291  69.497  1.00 75.54  ? 159  ALA A N     1 
ATOM   1027 C  CA    . ALA A 1 159 ? 63.637 34.348  69.567  1.00 74.18  ? 159  ALA A CA    1 
ATOM   1028 C  C     . ALA A 1 159 ? 63.078 35.411  70.531  1.00 74.83  ? 159  ALA A C     1 
ATOM   1029 O  O     . ALA A 1 159 ? 62.197 36.182  70.155  1.00 74.81  ? 159  ALA A O     1 
ATOM   1030 C  CB    . ALA A 1 159 ? 63.063 32.973  69.921  1.00 72.74  ? 159  ALA A CB    1 
ATOM   1031 N  N     . LEU A 1 160 ? 63.569 35.439  71.767  1.00 74.23  ? 160  LEU A N     1 
ATOM   1032 C  CA    . LEU A 1 160 ? 63.082 36.398  72.769  1.00 73.95  ? 160  LEU A CA    1 
ATOM   1033 C  C     . LEU A 1 160 ? 63.460 37.852  72.429  1.00 73.02  ? 160  LEU A C     1 
ATOM   1034 O  O     . LEU A 1 160 ? 62.843 38.789  72.939  1.00 73.18  ? 160  LEU A O     1 
ATOM   1035 C  CB    . LEU A 1 160 ? 63.578 36.024  74.183  1.00 74.58  ? 160  LEU A CB    1 
ATOM   1036 C  CG    . LEU A 1 160 ? 62.669 35.186  75.114  1.00 74.93  ? 160  LEU A CG    1 
ATOM   1037 C  CD1   . LEU A 1 160 ? 61.764 34.213  74.367  1.00 75.08  ? 160  LEU A CD1   1 
ATOM   1038 C  CD2   . LEU A 1 160 ? 63.504 34.423  76.151  1.00 75.09  ? 160  LEU A CD2   1 
ATOM   1039 N  N     . ASN A 1 161 ? 64.459 38.026  71.564  1.00 71.38  ? 161  ASN A N     1 
ATOM   1040 C  CA    . ASN A 1 161 ? 64.920 39.350  71.137  1.00 69.81  ? 161  ASN A CA    1 
ATOM   1041 C  C     . ASN A 1 161 ? 64.208 39.845  69.863  1.00 67.53  ? 161  ASN A C     1 
ATOM   1042 O  O     . ASN A 1 161 ? 64.243 41.035  69.547  1.00 65.92  ? 161  ASN A O     1 
ATOM   1043 C  CB    . ASN A 1 161 ? 66.435 39.313  70.906  1.00 70.00  ? 161  ASN A CB    1 
ATOM   1044 C  CG    . ASN A 1 161 ? 67.153 40.524  71.474  1.00 71.53  ? 161  ASN A CG    1 
ATOM   1045 O  OD1   . ASN A 1 161 ? 67.684 40.477  72.590  1.00 72.66  ? 161  ASN A OD1   1 
ATOM   1046 N  ND2   . ASN A 1 161 ? 67.202 41.608  70.699  1.00 70.16  ? 161  ASN A ND2   1 
ATOM   1047 N  N     . TYR A 1 162 ? 63.595 38.923  69.125  1.00 63.69  ? 162  TYR A N     1 
ATOM   1048 C  CA    . TYR A 1 162 ? 62.840 39.262  67.924  1.00 61.42  ? 162  TYR A CA    1 
ATOM   1049 C  C     . TYR A 1 162 ? 61.462 39.761  68.344  1.00 62.95  ? 162  TYR A C     1 
ATOM   1050 O  O     . TYR A 1 162 ? 60.997 40.789  67.863  1.00 61.45  ? 162  TYR A O     1 
ATOM   1051 C  CB    . TYR A 1 162 ? 62.713 38.043  67.003  1.00 57.82  ? 162  TYR A CB    1 
ATOM   1052 C  CG    . TYR A 1 162 ? 61.715 38.181  65.858  1.00 55.72  ? 162  TYR A CG    1 
ATOM   1053 C  CD1   . TYR A 1 162 ? 62.073 38.787  64.654  1.00 54.17  ? 162  TYR A CD1   1 
ATOM   1054 C  CD2   . TYR A 1 162 ? 60.408 37.686  65.977  1.00 55.19  ? 162  TYR A CD2   1 
ATOM   1055 C  CE1   . TYR A 1 162 ? 61.152 38.903  63.596  1.00 54.17  ? 162  TYR A CE1   1 
ATOM   1056 C  CE2   . TYR A 1 162 ? 59.485 37.798  64.926  1.00 54.00  ? 162  TYR A CE2   1 
ATOM   1057 C  CZ    . TYR A 1 162 ? 59.864 38.405  63.744  1.00 54.47  ? 162  TYR A CZ    1 
ATOM   1058 O  OH    . TYR A 1 162 ? 58.954 38.505  62.711  1.00 57.49  ? 162  TYR A OH    1 
ATOM   1059 N  N     . ALA A 1 163 ? 60.831 39.018  69.250  1.00 63.15  ? 163  ALA A N     1 
ATOM   1060 C  CA    . ALA A 1 163 ? 59.505 39.323  69.753  1.00 63.71  ? 163  ALA A CA    1 
ATOM   1061 C  C     . ALA A 1 163 ? 59.459 40.653  70.494  1.00 66.16  ? 163  ALA A C     1 
ATOM   1062 O  O     . ALA A 1 163 ? 58.484 41.394  70.362  1.00 67.17  ? 163  ALA A O     1 
ATOM   1063 C  CB    . ALA A 1 163 ? 59.030 38.207  70.667  1.00 63.61  ? 163  ALA A CB    1 
ATOM   1064 N  N     . GLN A 1 164 ? 60.502 40.936  71.278  1.00 66.07  ? 164  GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 164 ? 60.593 42.171  72.052  1.00 66.63  ? 164  GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 164 ? 60.871 43.368  71.142  1.00 65.72  ? 164  GLN A C     1 
ATOM   1067 O  O     . GLN A 1 164 ? 60.258 44.417  71.291  1.00 66.20  ? 164  GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 164 ? 61.688 42.067  73.129  1.00 68.96  ? 164  GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 164 ? 62.458 43.367  73.398  1.00 71.27  ? 164  GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 164 ? 63.260 43.318  74.681  1.00 73.72  ? 164  GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 164 ? 64.492 43.403  74.655  1.00 75.31  ? 164  GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 164 ? 62.568 43.184  75.809  1.00 74.39  ? 164  GLN A NE2   1 
ATOM   1073 N  N     . SER A 1 165 ? 61.816 43.209  70.226  1.00 63.00  ? 165  SER A N     1 
ATOM   1074 C  CA    . SER A 1 165 ? 62.201 44.279  69.314  1.00 60.97  ? 165  SER A CA    1 
ATOM   1075 C  C     . SER A 1 165 ? 61.060 44.662  68.355  1.00 60.76  ? 165  SER A C     1 
ATOM   1076 O  O     . SER A 1 165 ? 60.862 45.839  68.061  1.00 61.72  ? 165  SER A O     1 
ATOM   1077 C  CB    . SER A 1 165 ? 63.445 43.868  68.520  1.00 58.91  ? 165  SER A CB    1 
ATOM   1078 O  OG    . SER A 1 165 ? 63.755 44.829  67.532  1.00 58.85  ? 165  SER A OG    1 
ATOM   1079 N  N     . LYS A 1 166 ? 60.321 43.667  67.877  1.00 58.61  ? 166  LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 166 ? 59.219 43.897  66.958  1.00 59.65  ? 166  LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 166 ? 58.027 44.504  67.704  1.00 59.70  ? 166  LYS A C     1 
ATOM   1082 O  O     . LYS A 1 166 ? 57.299 45.327  67.145  1.00 58.39  ? 166  LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 166 ? 58.795 42.599  66.248  1.00 60.84  ? 166  LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 166 ? 59.690 42.217  65.065  1.00 63.19  ? 166  LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 166 ? 59.308 42.941  63.760  1.00 66.04  ? 166  LYS A CD    1 
ATOM   1086 C  CE    . LYS A 1 166 ? 59.633 42.110  62.500  1.00 66.79  ? 166  LYS A CE    1 
ATOM   1087 N  NZ    . LYS A 1 166 ? 58.817 42.505  61.308  1.00 66.34  ? 166  LYS A NZ    1 
ATOM   1088 N  N     . THR A 1 167 ? 57.832 44.093  68.955  1.00 56.88  ? 167  THR A N     1 
ATOM   1089 C  CA    . THR A 1 167 ? 56.743 44.605  69.764  1.00 55.87  ? 167  THR A CA    1 
ATOM   1090 C  C     . THR A 1 167 ? 57.009 46.071  70.093  1.00 58.23  ? 167  THR A C     1 
ATOM   1091 O  O     . THR A 1 167 ? 56.094 46.887  70.037  1.00 57.60  ? 167  THR A O     1 
ATOM   1092 C  CB    . THR A 1 167 ? 56.574 43.783  71.056  1.00 55.25  ? 167  THR A CB    1 
ATOM   1093 O  OG1   . THR A 1 167 ? 56.010 42.492  70.762  1.00 52.52  ? 167  THR A OG1   1 
ATOM   1094 C  CG2   . THR A 1 167 ? 55.552 44.439  71.990  1.00 54.58  ? 167  THR A CG2   1 
ATOM   1095 N  N     . GLU A 1 168 ? 58.263 46.394  70.418  1.00 59.25  ? 168  GLU A N     1 
ATOM   1096 C  CA    . GLU A 1 168 ? 58.678 47.768  70.701  1.00 60.31  ? 168  GLU A CA    1 
ATOM   1097 C  C     . GLU A 1 168 ? 58.343 48.671  69.519  1.00 59.54  ? 168  GLU A C     1 
ATOM   1098 O  O     . GLU A 1 168 ? 57.915 49.804  69.692  1.00 60.13  ? 168  GLU A O     1 
ATOM   1099 C  CB    . GLU A 1 168 ? 60.186 47.851  71.003  1.00 62.53  ? 168  GLU A CB    1 
ATOM   1100 C  CG    . GLU A 1 168 ? 60.531 48.390  72.397  1.00 66.76  ? 168  GLU A CG    1 
ATOM   1101 C  CD    . GLU A 1 168 ? 61.900 47.930  72.923  1.00 69.13  ? 168  GLU A CD    1 
ATOM   1102 O  OE1   . GLU A 1 168 ? 62.712 48.797  73.321  1.00 70.32  ? 168  GLU A OE1   1 
ATOM   1103 O  OE2   . GLU A 1 168 ? 62.166 46.703  72.959  1.00 70.66  ? 168  GLU A OE2   1 
ATOM   1104 N  N     . LYS A 1 169 ? 58.545 48.151  68.317  1.00 58.50  ? 169  LYS A N     1 
ATOM   1105 C  CA    . LYS A 1 169 ? 58.310 48.902  67.099  1.00 57.19  ? 169  LYS A CA    1 
ATOM   1106 C  C     . LYS A 1 169 ? 56.806 49.063  66.859  1.00 54.23  ? 169  LYS A C     1 
ATOM   1107 O  O     . LYS A 1 169 ? 56.361 50.135  66.471  1.00 54.04  ? 169  LYS A O     1 
ATOM   1108 C  CB    . LYS A 1 169 ? 58.978 48.195  65.912  1.00 58.30  ? 169  LYS A CB    1 
ATOM   1109 C  CG    . LYS A 1 169 ? 58.862 48.891  64.556  1.00 58.88  ? 169  LYS A CG    1 
ATOM   1110 C  CD    . LYS A 1 169 ? 59.637 50.214  64.519  1.00 61.03  ? 169  LYS A CD    1 
ATOM   1111 C  CE    . LYS A 1 169 ? 59.243 51.101  63.327  1.00 61.13  ? 169  LYS A CE    1 
ATOM   1112 N  NZ    . LYS A 1 169 ? 59.499 52.535  63.635  1.00 61.22  ? 169  LYS A NZ    1 
ATOM   1113 N  N     . ASP A 1 170 ? 56.036 48.008  67.102  1.00 48.63  ? 170  ASP A N     1 
ATOM   1114 C  CA    . ASP A 1 170 ? 54.596 48.034  66.867  1.00 48.33  ? 170  ASP A CA    1 
ATOM   1115 C  C     . ASP A 1 170 ? 53.894 49.026  67.805  1.00 48.65  ? 170  ASP A C     1 
ATOM   1116 O  O     . ASP A 1 170 ? 52.918 49.656  67.418  1.00 48.14  ? 170  ASP A O     1 
ATOM   1117 C  CB    . ASP A 1 170 ? 53.980 46.633  67.034  1.00 46.20  ? 170  ASP A CB    1 
ATOM   1118 C  CG    . ASP A 1 170 ? 54.104 45.767  65.772  1.00 47.32  ? 170  ASP A CG    1 
ATOM   1119 O  OD1   . ASP A 1 170 ? 54.678 46.234  64.764  1.00 45.68  ? 170  ASP A OD1   1 
ATOM   1120 O  OD2   . ASP A 1 170 ? 53.647 44.598  65.699  1.00 47.33  ? 170  ASP A OD2   1 
ATOM   1121 N  N     . VAL A 1 171 ? 54.408 49.157  69.023  1.00 47.80  ? 171  VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 171 ? 53.821 50.008  70.035  1.00 47.21  ? 171  VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 171 ? 54.173 51.441  69.706  1.00 48.03  ? 171  VAL A C     1 
ATOM   1124 O  O     . VAL A 1 171 ? 53.313 52.310  69.767  1.00 47.91  ? 171  VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 171 ? 54.331 49.651  71.447  1.00 47.83  ? 171  VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 171 ? 53.996 50.746  72.454  1.00 47.62  ? 171  VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 171 ? 53.747 48.331  71.902  1.00 49.33  ? 171  VAL A CG2   1 
ATOM   1128 N  N     . TYR A 1 172 ? 55.438 51.689  69.363  1.00 46.74  ? 172  TYR A N     1 
ATOM   1129 C  CA    . TYR A 1 172 ? 55.849 53.018  68.915  1.00 46.24  ? 172  TYR A CA    1 
ATOM   1130 C  C     . TYR A 1 172 ? 54.932 53.499  67.773  1.00 45.34  ? 172  TYR A C     1 
ATOM   1131 O  O     . TYR A 1 172 ? 54.518 54.652  67.746  1.00 45.54  ? 172  TYR A O     1 
ATOM   1132 C  CB    . TYR A 1 172 ? 57.329 53.060  68.468  1.00 44.31  ? 172  TYR A CB    1 
ATOM   1133 C  CG    . TYR A 1 172 ? 57.780 54.471  68.104  1.00 43.50  ? 172  TYR A CG    1 
ATOM   1134 C  CD1   . TYR A 1 172 ? 58.189 55.366  69.086  1.00 44.71  ? 172  TYR A CD1   1 
ATOM   1135 C  CD2   . TYR A 1 172 ? 57.745 54.925  66.785  1.00 43.26  ? 172  TYR A CD2   1 
ATOM   1136 C  CE1   . TYR A 1 172 ? 58.570 56.683  68.766  1.00 44.39  ? 172  TYR A CE1   1 
ATOM   1137 C  CE2   . TYR A 1 172 ? 58.136 56.241  66.453  1.00 43.94  ? 172  TYR A CE2   1 
ATOM   1138 C  CZ    . TYR A 1 172 ? 58.539 57.109  67.457  1.00 44.34  ? 172  TYR A CZ    1 
ATOM   1139 O  OH    . TYR A 1 172 ? 58.917 58.404  67.171  1.00 49.80  ? 172  TYR A OH    1 
ATOM   1140 N  N     . ASP A 1 173 ? 54.621 52.593  66.854  1.00 43.00  ? 173  ASP A N     1 
ATOM   1141 C  CA    . ASP A 1 173 ? 53.883 52.907  65.639  1.00 43.78  ? 173  ASP A CA    1 
ATOM   1142 C  C     . ASP A 1 173 ? 52.403 53.144  65.946  1.00 43.11  ? 173  ASP A C     1 
ATOM   1143 O  O     . ASP A 1 173 ? 51.765 53.962  65.303  1.00 42.00  ? 173  ASP A O     1 
ATOM   1144 C  CB    . ASP A 1 173 ? 54.017 51.752  64.610  1.00 42.78  ? 173  ASP A CB    1 
ATOM   1145 C  CG    . ASP A 1 173 ? 55.442 51.636  64.010  1.00 41.56  ? 173  ASP A CG    1 
ATOM   1146 O  OD1   . ASP A 1 173 ? 56.353 52.375  64.444  1.00 39.27  ? 173  ASP A OD1   1 
ATOM   1147 O  OD2   . ASP A 1 173 ? 55.742 50.830  63.101  1.00 40.55  ? 173  ASP A OD2   1 
ATOM   1148 N  N     . ALA A 1 174 ? 51.889 52.412  66.930  1.00 40.06  ? 174  ALA A N     1 
ATOM   1149 C  CA    . ALA A 1 174 ? 50.497 52.461  67.320  1.00 39.45  ? 174  ALA A CA    1 
ATOM   1150 C  C     . ALA A 1 174 ? 50.133 53.799  67.940  1.00 39.94  ? 174  ALA A C     1 
ATOM   1151 O  O     . ALA A 1 174 ? 49.009 54.273  67.748  1.00 41.91  ? 174  ALA A O     1 
ATOM   1152 C  CB    . ALA A 1 174 ? 50.196 51.351  68.297  1.00 37.83  ? 174  ALA A CB    1 
ATOM   1153 N  N     . PHE A 1 175 ? 51.087 54.386  68.666  1.00 36.13  ? 175  PHE A N     1 
ATOM   1154 C  CA    . PHE A 1 175 ? 50.914 55.655  69.352  1.00 37.90  ? 175  PHE A CA    1 
ATOM   1155 C  C     . PHE A 1 175 ? 51.361 56.842  68.504  1.00 37.87  ? 175  PHE A C     1 
ATOM   1156 O  O     . PHE A 1 175 ? 51.007 57.982  68.791  1.00 42.42  ? 175  PHE A O     1 
ATOM   1157 C  CB    . PHE A 1 175 ? 51.618 55.620  70.710  1.00 39.45  ? 175  PHE A CB    1 
ATOM   1158 C  CG    . PHE A 1 175 ? 50.841 54.866  71.719  1.00 40.81  ? 175  PHE A CG    1 
ATOM   1159 C  CD1   . PHE A 1 175 ? 51.087 53.517  71.935  1.00 38.35  ? 175  PHE A CD1   1 
ATOM   1160 C  CD2   . PHE A 1 175 ? 49.775 55.473  72.376  1.00 41.43  ? 175  PHE A CD2   1 
ATOM   1161 C  CE1   . PHE A 1 175 ? 50.321 52.804  72.809  1.00 38.18  ? 175  PHE A CE1   1 
ATOM   1162 C  CE2   . PHE A 1 175 ? 49.007 54.758  73.269  1.00 39.20  ? 175  PHE A CE2   1 
ATOM   1163 C  CZ    . PHE A 1 175 ? 49.281 53.422  73.487  1.00 38.95  ? 175  PHE A CZ    1 
ATOM   1164 N  N     . GLN A 1 176 ? 52.110 56.572  67.449  1.00 35.56  ? 176  GLN A N     1 
ATOM   1165 C  CA    . GLN A 1 176 ? 52.325 57.558  66.400  1.00 36.10  ? 176  GLN A CA    1 
ATOM   1166 C  C     . GLN A 1 176 ? 51.052 57.642  65.584  1.00 35.33  ? 176  GLN A C     1 
ATOM   1167 O  O     . GLN A 1 176 ? 50.630 58.702  65.167  1.00 37.15  ? 176  GLN A O     1 
ATOM   1168 C  CB    . GLN A 1 176 ? 53.469 57.128  65.478  1.00 35.78  ? 176  GLN A CB    1 
ATOM   1169 C  CG    . GLN A 1 176 ? 53.895 58.175  64.476  1.00 34.64  ? 176  GLN A CG    1 
ATOM   1170 C  CD    . GLN A 1 176 ? 54.830 57.617  63.416  1.00 37.27  ? 176  GLN A CD    1 
ATOM   1171 O  OE1   . GLN A 1 176 ? 54.538 56.586  62.828  1.00 35.00  ? 176  GLN A OE1   1 
ATOM   1172 N  NE2   . GLN A 1 176 ? 55.948 58.312  63.158  1.00 37.00  ? 176  GLN A NE2   1 
ATOM   1173 N  N     . ALA A 1 177 ? 50.443 56.501  65.335  1.00 36.13  ? 177  ALA A N     1 
ATOM   1174 C  CA    . ALA A 1 177 ? 49.182 56.479  64.634  1.00 36.67  ? 177  ALA A CA    1 
ATOM   1175 C  C     . ALA A 1 177 ? 48.175 57.325  65.447  1.00 37.49  ? 177  ALA A C     1 
ATOM   1176 O  O     . ALA A 1 177 ? 47.601 58.265  64.920  1.00 38.05  ? 177  ALA A O     1 
ATOM   1177 C  CB    . ALA A 1 177 ? 48.702 55.036  64.429  1.00 35.89  ? 177  ALA A CB    1 
ATOM   1178 N  N     . TYR A 1 178 ? 48.028 57.041  66.736  1.00 35.88  ? 178  TYR A N     1 
ATOM   1179 C  CA    . TYR A 1 178 ? 47.079 57.778  67.551  1.00 37.44  ? 178  TYR A CA    1 
ATOM   1180 C  C     . TYR A 1 178 ? 47.318 59.308  67.479  1.00 38.27  ? 178  TYR A C     1 
ATOM   1181 O  O     . TYR A 1 178 ? 46.393 60.077  67.224  1.00 39.23  ? 178  TYR A O     1 
ATOM   1182 C  CB    . TYR A 1 178 ? 47.087 57.309  69.016  1.00 35.45  ? 178  TYR A CB    1 
ATOM   1183 C  CG    . TYR A 1 178 ? 45.956 57.955  69.777  1.00 35.99  ? 178  TYR A CG    1 
ATOM   1184 C  CD1   . TYR A 1 178 ? 44.647 57.551  69.557  1.00 35.97  ? 178  TYR A CD1   1 
ATOM   1185 C  CD2   . TYR A 1 178 ? 46.178 59.019  70.651  1.00 36.72  ? 178  TYR A CD2   1 
ATOM   1186 C  CE1   . TYR A 1 178 ? 43.593 58.154  70.203  1.00 35.00  ? 178  TYR A CE1   1 
ATOM   1187 C  CE2   . TYR A 1 178 ? 45.106 59.639  71.314  1.00 34.32  ? 178  TYR A CE2   1 
ATOM   1188 C  CZ    . TYR A 1 178 ? 43.814 59.197  71.061  1.00 33.26  ? 178  TYR A CZ    1 
ATOM   1189 O  OH    . TYR A 1 178 ? 42.726 59.761  71.667  1.00 29.86  ? 178  TYR A OH    1 
ATOM   1190 N  N     . GLU A 1 179 ? 48.554 59.733  67.686  1.00 35.85  ? 179  GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 179 ? 48.870 61.145  67.813  1.00 37.11  ? 179  GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 179 ? 48.582 61.894  66.520  1.00 36.48  ? 179  GLU A C     1 
ATOM   1193 O  O     . GLU A 1 179 ? 48.208 63.058  66.547  1.00 36.75  ? 179  GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 179 ? 50.341 61.317  68.191  1.00 40.76  ? 179  GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 179 ? 50.734 62.756  68.494  1.00 45.26  ? 179  GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 179 ? 51.411 62.905  69.849  1.00 48.27  ? 179  GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 179 ? 50.785 62.562  70.887  1.00 51.53  ? 179  GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 179 ? 52.568 63.353  69.876  1.00 49.68  ? 179  GLU A OE2   1 
ATOM   1199 N  N     . TYR A 1 180 ? 48.765 61.209  65.396  1.00 34.82  ? 180  TYR A N     1 
ATOM   1200 C  CA    . TYR A 1 180 ? 48.528 61.770  64.084  1.00 34.82  ? 180  TYR A CA    1 
ATOM   1201 C  C     . TYR A 1 180 ? 47.036 61.705  63.730  1.00 36.88  ? 180  TYR A C     1 
ATOM   1202 O  O     . TYR A 1 180 ? 46.508 62.651  63.170  1.00 37.49  ? 180  TYR A O     1 
ATOM   1203 C  CB    . TYR A 1 180 ? 49.375 61.047  63.023  1.00 36.74  ? 180  TYR A CB    1 
ATOM   1204 C  CG    . TYR A 1 180 ? 50.781 61.590  62.883  1.00 36.43  ? 180  TYR A CG    1 
ATOM   1205 C  CD1   . TYR A 1 180 ? 51.783 61.237  63.784  1.00 38.72  ? 180  TYR A CD1   1 
ATOM   1206 C  CD2   . TYR A 1 180 ? 51.101 62.476  61.871  1.00 37.70  ? 180  TYR A CD2   1 
ATOM   1207 C  CE1   . TYR A 1 180 ? 53.080 61.741  63.664  1.00 39.27  ? 180  TYR A CE1   1 
ATOM   1208 C  CE2   . TYR A 1 180 ? 52.380 63.012  61.759  1.00 38.88  ? 180  TYR A CE2   1 
ATOM   1209 C  CZ    . TYR A 1 180 ? 53.366 62.632  62.651  1.00 38.41  ? 180  TYR A CZ    1 
ATOM   1210 O  OH    . TYR A 1 180 ? 54.624 63.144  62.519  1.00 35.81  ? 180  TYR A OH    1 
ATOM   1211 N  N     . GLU A 1 181 ? 46.355 60.611  64.054  1.00 37.79  ? 181  GLU A N     1 
ATOM   1212 C  CA    . GLU A 1 181 ? 44.924 60.503  63.758  1.00 42.71  ? 181  GLU A CA    1 
ATOM   1213 C  C     . GLU A 1 181 ? 44.145 61.646  64.436  1.00 41.39  ? 181  GLU A C     1 
ATOM   1214 O  O     . GLU A 1 181 ? 43.298 62.273  63.838  1.00 41.44  ? 181  GLU A O     1 
ATOM   1215 C  CB    . GLU A 1 181 ? 44.348 59.135  64.172  1.00 46.46  ? 181  GLU A CB    1 
ATOM   1216 C  CG    . GLU A 1 181 ? 44.994 57.918  63.493  1.00 50.46  ? 181  GLU A CG    1 
ATOM   1217 C  CD    . GLU A 1 181 ? 44.265 57.438  62.251  1.00 54.29  ? 181  GLU A CD    1 
ATOM   1218 O  OE1   . GLU A 1 181 ? 43.440 56.494  62.360  1.00 59.99  ? 181  GLU A OE1   1 
ATOM   1219 O  OE2   . GLU A 1 181 ? 44.545 57.981  61.155  1.00 55.78  ? 181  GLU A OE2   1 
ATOM   1220 N  N     . VAL A 1 182 ? 44.495 61.938  65.673  1.00 39.97  ? 182  VAL A N     1 
ATOM   1221 C  CA    . VAL A 1 182 ? 43.835 62.953  66.480  1.00 38.72  ? 182  VAL A CA    1 
ATOM   1222 C  C     . VAL A 1 182 ? 44.112 64.366  65.953  1.00 38.74  ? 182  VAL A C     1 
ATOM   1223 O  O     . VAL A 1 182 ? 43.381 65.306  66.257  1.00 37.14  ? 182  VAL A O     1 
ATOM   1224 C  CB    . VAL A 1 182 ? 44.320 62.809  67.945  1.00 39.41  ? 182  VAL A CB    1 
ATOM   1225 C  CG1   . VAL A 1 182 ? 44.143 64.079  68.747  1.00 41.36  ? 182  VAL A CG1   1 
ATOM   1226 C  CG2   . VAL A 1 182 ? 43.601 61.671  68.592  1.00 40.67  ? 182  VAL A CG2   1 
ATOM   1227 N  N     . ASN A 1 183 ? 45.181 64.510  65.178  1.00 38.67  ? 183  ASN A N     1 
ATOM   1228 C  CA    . ASN A 1 183 ? 45.537 65.781  64.575  1.00 37.50  ? 183  ASN A CA    1 
ATOM   1229 C  C     . ASN A 1 183 ? 45.148 65.905  63.098  1.00 37.93  ? 183  ASN A C     1 
ATOM   1230 O  O     . ASN A 1 183 ? 45.361 66.952  62.502  1.00 39.95  ? 183  ASN A O     1 
ATOM   1231 C  CB    . ASN A 1 183 ? 47.034 66.015  64.760  1.00 37.64  ? 183  ASN A CB    1 
ATOM   1232 C  CG    . ASN A 1 183 ? 47.345 66.641  66.089  1.00 38.76  ? 183  ASN A CG    1 
ATOM   1233 O  OD1   . ASN A 1 183 ? 47.193 67.849  66.256  1.00 41.88  ? 183  ASN A OD1   1 
ATOM   1234 N  ND2   . ASN A 1 183 ? 47.757 65.834  67.050  1.00 38.20  ? 183  ASN A ND2   1 
ATOM   1235 N  N     . THR A 1 184 ? 44.556 64.858  62.523  1.00 35.94  ? 184  THR A N     1 
ATOM   1236 C  CA    . THR A 1 184 ? 44.196 64.843  61.113  1.00 37.39  ? 184  THR A CA    1 
ATOM   1237 C  C     . THR A 1 184 ? 42.701 64.619  60.858  1.00 43.04  ? 184  THR A C     1 
ATOM   1238 O  O     . THR A 1 184 ? 42.272 64.503  59.707  1.00 47.48  ? 184  THR A O     1 
ATOM   1239 C  CB    . THR A 1 184 ? 44.993 63.754  60.383  1.00 38.35  ? 184  THR A CB    1 
ATOM   1240 O  OG1   . THR A 1 184 ? 44.917 62.510  61.101  1.00 38.86  ? 184  THR A OG1   1 
ATOM   1241 C  CG2   . THR A 1 184 ? 46.479 64.087  60.346  1.00 37.88  ? 184  THR A CG2   1 
ATOM   1242 N  N     . LEU A 1 185 ? 41.910 64.557  61.917  1.00 44.83  ? 185  LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 185 ? 40.484 64.311  61.781  1.00 49.58  ? 185  LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 185 ? 39.720 65.454  62.417  1.00 49.86  ? 185  LEU A C     1 
ATOM   1245 O  O     . LEU A 1 185 ? 40.083 65.940  63.482  1.00 49.70  ? 185  LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 185 ? 40.091 62.969  62.429  1.00 52.01  ? 185  LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 185 ? 40.158 62.857  63.969  1.00 52.08  ? 185  LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 185 ? 38.851 63.308  64.613  1.00 53.80  ? 185  LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 185 ? 40.504 61.429  64.449  1.00 52.49  ? 185  LEU A CD2   1 
ATOM   1250 N  N     . PHE A 1 186 ? 38.668 65.895  61.748  1.00 52.83  ? 186  PHE A N     1 
ATOM   1251 C  CA    . PHE A 1 186 ? 37.773 66.877  62.331  1.00 54.89  ? 186  PHE A CA    1 
ATOM   1252 C  C     . PHE A 1 186 ? 36.570 66.134  62.882  1.00 54.88  ? 186  PHE A C     1 
ATOM   1253 O  O     . PHE A 1 186 ? 36.103 65.158  62.296  1.00 55.02  ? 186  PHE A O     1 
ATOM   1254 C  CB    . PHE A 1 186 ? 37.325 67.912  61.298  1.00 55.73  ? 186  PHE A CB    1 
ATOM   1255 C  CG    . PHE A 1 186 ? 38.431 68.803  60.785  1.00 56.84  ? 186  PHE A CG    1 
ATOM   1256 C  CD1   . PHE A 1 186 ? 39.689 68.857  61.407  1.00 58.16  ? 186  PHE A CD1   1 
ATOM   1257 C  CD2   . PHE A 1 186 ? 38.208 69.605  59.661  1.00 56.67  ? 186  PHE A CD2   1 
ATOM   1258 C  CE1   . PHE A 1 186 ? 40.706 69.698  60.906  1.00 57.37  ? 186  PHE A CE1   1 
ATOM   1259 C  CE2   . PHE A 1 186 ? 39.216 70.435  59.164  1.00 55.84  ? 186  PHE A CE2   1 
ATOM   1260 C  CZ    . PHE A 1 186 ? 40.464 70.483  59.787  1.00 55.63  ? 186  PHE A CZ    1 
ATOM   1261 N  N     . SER A 1 187 ? 36.108 66.576  64.041  1.00 56.44  ? 187  SER A N     1 
ATOM   1262 C  CA    . SER A 1 187 ? 34.825 66.152  64.570  1.00 57.64  ? 187  SER A CA    1 
ATOM   1263 C  C     . SER A 1 187 ? 33.712 66.979  63.898  1.00 56.76  ? 187  SER A C     1 
ATOM   1264 O  O     . SER A 1 187 ? 33.998 67.839  63.068  1.00 55.03  ? 187  SER A O     1 
ATOM   1265 C  CB    . SER A 1 187 ? 34.810 66.301  66.097  1.00 57.76  ? 187  SER A CB    1 
ATOM   1266 O  OG    . SER A 1 187 ? 35.038 67.641  66.504  1.00 57.54  ? 187  SER A OG    1 
ATOM   1267 N  N     . SER A 1 188 ? 32.459 66.682  64.253  1.00 58.31  ? 188  SER A N     1 
ATOM   1268 C  CA    . SER A 1 188 ? 31.252 67.389  63.789  1.00 57.52  ? 188  SER A CA    1 
ATOM   1269 C  C     . SER A 1 188 ? 31.477 68.879  63.599  1.00 56.42  ? 188  SER A C     1 
ATOM   1270 O  O     . SER A 1 188 ? 31.095 69.433  62.581  1.00 55.71  ? 188  SER A O     1 
ATOM   1271 C  CB    . SER A 1 188 ? 30.096 67.170  64.802  1.00 59.19  ? 188  SER A CB    1 
ATOM   1272 O  OG    . SER A 1 188 ? 28.974 68.044  64.611  1.00 57.80  ? 188  SER A OG    1 
ATOM   1273 N  N     . ASN A 1 189 ? 32.111 69.510  64.585  1.00 56.29  ? 189  ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 189 ? 32.269 70.967  64.627  1.00 56.04  ? 189  ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 189 ? 33.418 71.558  63.775  1.00 53.63  ? 189  ASN A C     1 
ATOM   1276 O  O     . ASN A 1 189 ? 33.754 72.733  63.914  1.00 53.94  ? 189  ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 189 ? 32.394 71.419  66.099  1.00 57.17  ? 189  ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 189 ? 33.762 71.111  66.711  1.00 58.68  ? 189  ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 189 ? 34.511 70.265  66.217  1.00 59.47  ? 189  ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 189 ? 34.085 71.802  67.800  1.00 59.42  ? 189  ASN A ND2   1 
ATOM   1281 N  N     . GLY A 1 190 ? 34.012 70.750  62.905  1.00 52.44  ? 190  GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 190 ? 35.129 71.189  62.087  1.00 54.28  ? 190  GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 190 ? 36.470 71.418  62.771  1.00 55.39  ? 190  GLY A C     1 
ATOM   1284 O  O     . GLY A 1 190 ? 37.409 71.894  62.136  1.00 55.23  ? 190  GLY A O     1 
ATOM   1285 N  N     . GLN A 1 191 ? 36.583 71.071  64.047  1.00 56.89  ? 191  GLN A N     1 
ATOM   1286 C  CA    . GLN A 1 191 ? 37.834 71.255  64.772  1.00 57.03  ? 191  GLN A CA    1 
ATOM   1287 C  C     . GLN A 1 191 ? 38.503 69.917  65.072  1.00 55.09  ? 191  GLN A C     1 
ATOM   1288 O  O     . GLN A 1 191 ? 37.887 68.849  65.023  1.00 51.41  ? 191  GLN A O     1 
ATOM   1289 C  CB    . GLN A 1 191 ? 37.598 72.025  66.077  1.00 59.49  ? 191  GLN A CB    1 
ATOM   1290 C  CG    . GLN A 1 191 ? 37.298 73.521  65.879  1.00 61.71  ? 191  GLN A CG    1 
ATOM   1291 C  CD    . GLN A 1 191 ? 38.281 74.407  66.612  1.00 64.20  ? 191  GLN A CD    1 
ATOM   1292 O  OE1   . GLN A 1 191 ? 38.329 74.404  67.852  1.00 63.21  ? 191  GLN A OE1   1 
ATOM   1293 N  NE2   . GLN A 1 191 ? 39.089 75.150  65.856  1.00 66.56  ? 191  GLN A NE2   1 
ATOM   1294 N  N     . THR A 1 192 ? 39.788 70.005  65.373  1.00 53.48  ? 192  THR A N     1 
ATOM   1295 C  CA    . THR A 1 192 ? 40.552 68.880  65.878  1.00 50.74  ? 192  THR A CA    1 
ATOM   1296 C  C     . THR A 1 192 ? 40.025 68.570  67.289  1.00 47.97  ? 192  THR A C     1 
ATOM   1297 O  O     . THR A 1 192 ? 39.845 69.492  68.112  1.00 46.78  ? 192  THR A O     1 
ATOM   1298 C  CB    . THR A 1 192 ? 42.073 69.243  65.856  1.00 50.91  ? 192  THR A CB    1 
ATOM   1299 O  OG1   . THR A 1 192 ? 42.649 68.718  64.653  1.00 55.64  ? 192  THR A OG1   1 
ATOM   1300 C  CG2   . THR A 1 192 ? 42.867 68.581  66.986  1.00 50.70  ? 192  THR A CG2   1 
ATOM   1301 N  N     . PRO A 1 193 ? 39.759 67.291  67.567  1.00 43.23  ? 193  PRO A N     1 
ATOM   1302 C  CA    . PRO A 1 193 ? 39.143 66.905  68.839  1.00 42.03  ? 193  PRO A CA    1 
ATOM   1303 C  C     . PRO A 1 193 ? 40.001 67.272  70.039  1.00 40.56  ? 193  PRO A C     1 
ATOM   1304 O  O     . PRO A 1 193 ? 41.230 67.218  70.003  1.00 39.03  ? 193  PRO A O     1 
ATOM   1305 C  CB    . PRO A 1 193 ? 38.960 65.381  68.718  1.00 42.48  ? 193  PRO A CB    1 
ATOM   1306 C  CG    . PRO A 1 193 ? 39.859 64.955  67.637  1.00 43.19  ? 193  PRO A CG    1 
ATOM   1307 C  CD    . PRO A 1 193 ? 40.015 66.122  66.709  1.00 43.57  ? 193  PRO A CD    1 
ATOM   1308 N  N     . PHE A 1 194 ? 39.311 67.681  71.092  1.00 40.16  ? 194  PHE A N     1 
ATOM   1309 C  CA    . PHE A 1 194 ? 39.918 68.174  72.313  1.00 39.62  ? 194  PHE A CA    1 
ATOM   1310 C  C     . PHE A 1 194 ? 39.959 66.927  73.215  1.00 38.06  ? 194  PHE A C     1 
ATOM   1311 O  O     . PHE A 1 194 ? 38.925 66.469  73.692  1.00 36.70  ? 194  PHE A O     1 
ATOM   1312 C  CB    . PHE A 1 194 ? 39.050 69.354  72.801  1.00 42.50  ? 194  PHE A CB    1 
ATOM   1313 C  CG    . PHE A 1 194 ? 39.225 69.735  74.233  1.00 45.91  ? 194  PHE A CG    1 
ATOM   1314 C  CD1   . PHE A 1 194 ? 38.168 70.368  74.898  1.00 49.23  ? 194  PHE A CD1   1 
ATOM   1315 C  CD2   . PHE A 1 194 ? 40.419 69.510  74.919  1.00 47.28  ? 194  PHE A CD2   1 
ATOM   1316 C  CE1   . PHE A 1 194 ? 38.286 70.739  76.241  1.00 51.33  ? 194  PHE A CE1   1 
ATOM   1317 C  CE2   . PHE A 1 194 ? 40.551 69.882  76.254  1.00 49.54  ? 194  PHE A CE2   1 
ATOM   1318 C  CZ    . PHE A 1 194 ? 39.487 70.500  76.917  1.00 50.46  ? 194  PHE A CZ    1 
ATOM   1319 N  N     . VAL A 1 195 ? 41.158 66.355  73.371  1.00 35.63  ? 195  VAL A N     1 
ATOM   1320 C  CA    . VAL A 1 195 ? 41.331 65.043  73.978  1.00 36.17  ? 195  VAL A CA    1 
ATOM   1321 C  C     . VAL A 1 195 ? 42.549 65.012  74.897  1.00 36.06  ? 195  VAL A C     1 
ATOM   1322 O  O     . VAL A 1 195 ? 43.565 65.641  74.604  1.00 33.46  ? 195  VAL A O     1 
ATOM   1323 C  CB    . VAL A 1 195 ? 41.425 63.929  72.880  1.00 38.34  ? 195  VAL A CB    1 
ATOM   1324 C  CG1   . VAL A 1 195 ? 42.482 64.247  71.861  1.00 40.56  ? 195  VAL A CG1   1 
ATOM   1325 C  CG2   . VAL A 1 195 ? 41.671 62.538  73.497  1.00 37.57  ? 195  VAL A CG2   1 
ATOM   1326 N  N     . THR A 1 196 ? 42.425 64.323  76.034  1.00 36.74  ? 196  THR A N     1 
ATOM   1327 C  CA    . THR A 1 196 ? 43.562 64.108  76.934  1.00 37.29  ? 196  THR A CA    1 
ATOM   1328 C  C     . THR A 1 196 ? 43.776 62.623  77.261  1.00 37.06  ? 196  THR A C     1 
ATOM   1329 O  O     . THR A 1 196 ? 42.827 61.844  77.303  1.00 34.06  ? 196  THR A O     1 
ATOM   1330 C  CB    . THR A 1 196 ? 43.470 64.945  78.251  1.00 35.68  ? 196  THR A CB    1 
ATOM   1331 O  OG1   . THR A 1 196 ? 42.773 64.223  79.261  1.00 38.44  ? 196  THR A OG1   1 
ATOM   1332 C  CG2   . THR A 1 196 ? 42.696 66.211  78.086  1.00 32.84  ? 196  THR A CG2   1 
ATOM   1333 N  N     . ILE A 1 197 ? 45.039 62.284  77.524  1.00 38.23  ? 197  ILE A N     1 
ATOM   1334 C  CA    . ILE A 1 197 ? 45.532 60.913  77.705  1.00 39.59  ? 197  ILE A CA    1 
ATOM   1335 C  C     . ILE A 1 197 ? 46.360 60.895  78.978  1.00 36.71  ? 197  ILE A C     1 
ATOM   1336 O  O     . ILE A 1 197 ? 47.311 61.650  79.081  1.00 36.73  ? 197  ILE A O     1 
ATOM   1337 C  CB    . ILE A 1 197 ? 46.464 60.545  76.519  1.00 43.43  ? 197  ILE A CB    1 
ATOM   1338 C  CG1   . ILE A 1 197 ? 45.709 60.577  75.188  1.00 45.61  ? 197  ILE A CG1   1 
ATOM   1339 C  CG2   . ILE A 1 197 ? 47.095 59.192  76.712  1.00 46.35  ? 197  ILE A CG2   1 
ATOM   1340 C  CD1   . ILE A 1 197 ? 44.626 59.543  75.049  1.00 44.92  ? 197  ILE A CD1   1 
ATOM   1341 N  N     . THR A 1 198 ? 46.014 60.051  79.943  1.00 35.98  ? 198  THR A N     1 
ATOM   1342 C  CA    . THR A 1 198 ? 46.814 59.914  81.150  1.00 34.85  ? 198  THR A CA    1 
ATOM   1343 C  C     . THR A 1 198 ? 47.458 58.529  81.331  1.00 35.98  ? 198  THR A C     1 
ATOM   1344 O  O     . THR A 1 198 ? 46.987 57.515  80.810  1.00 34.73  ? 198  THR A O     1 
ATOM   1345 C  CB    . THR A 1 198 ? 45.997 60.279  82.397  1.00 33.96  ? 198  THR A CB    1 
ATOM   1346 O  OG1   . THR A 1 198 ? 45.081 59.232  82.704  1.00 31.37  ? 198  THR A OG1   1 
ATOM   1347 C  CG2   . THR A 1 198 ? 45.128 61.509  82.154  1.00 33.12  ? 198  THR A CG2   1 
ATOM   1348 N  N     . PHE A 1 199 ? 48.539 58.528  82.096  1.00 37.39  ? 199  PHE A N     1 
ATOM   1349 C  CA    . PHE A 1 199 ? 49.361 57.348  82.332  1.00 41.28  ? 199  PHE A CA    1 
ATOM   1350 C  C     . PHE A 1 199 ? 50.301 57.598  83.505  1.00 42.74  ? 199  PHE A C     1 
ATOM   1351 O  O     . PHE A 1 199 ? 50.435 58.727  83.975  1.00 42.79  ? 199  PHE A O     1 
ATOM   1352 C  CB    . PHE A 1 199 ? 50.199 57.040  81.090  1.00 41.81  ? 199  PHE A CB    1 
ATOM   1353 C  CG    . PHE A 1 199 ? 51.004 58.209  80.585  1.00 41.76  ? 199  PHE A CG    1 
ATOM   1354 C  CD1   . PHE A 1 199 ? 52.342 58.359  80.939  1.00 43.22  ? 199  PHE A CD1   1 
ATOM   1355 C  CD2   . PHE A 1 199 ? 50.432 59.152  79.736  1.00 43.29  ? 199  PHE A CD2   1 
ATOM   1356 C  CE1   . PHE A 1 199 ? 53.100 59.433  80.453  1.00 42.09  ? 199  PHE A CE1   1 
ATOM   1357 C  CE2   . PHE A 1 199 ? 51.178 60.232  79.249  1.00 43.23  ? 199  PHE A CE2   1 
ATOM   1358 C  CZ    . PHE A 1 199 ? 52.519 60.374  79.615  1.00 43.00  ? 199  PHE A CZ    1 
ATOM   1359 N  N     . GLY A 1 200 ? 50.956 56.543  83.972  1.00 42.11  ? 200  GLY A N     1 
ATOM   1360 C  CA    . GLY A 1 200 ? 52.044 56.681  84.926  1.00 42.20  ? 200  GLY A CA    1 
ATOM   1361 C  C     . GLY A 1 200 ? 51.967 55.783  86.142  1.00 42.09  ? 200  GLY A C     1 
ATOM   1362 O  O     . GLY A 1 200 ? 52.956 55.658  86.866  1.00 42.48  ? 200  GLY A O     1 
ATOM   1363 N  N     . THR A 1 201 ? 50.803 55.186  86.385  1.00 41.27  ? 201  THR A N     1 
ATOM   1364 C  CA    . THR A 1 201 ? 50.648 54.212  87.461  1.00 44.99  ? 201  THR A CA    1 
ATOM   1365 C  C     . THR A 1 201 ? 51.023 52.788  87.030  1.00 46.43  ? 201  THR A C     1 
ATOM   1366 O  O     . THR A 1 201 ? 50.922 51.868  87.825  1.00 49.48  ? 201  THR A O     1 
ATOM   1367 C  CB    . THR A 1 201 ? 49.198 54.208  88.042  1.00 45.15  ? 201  THR A CB    1 
ATOM   1368 O  OG1   . THR A 1 201 ? 48.320 53.444  87.200  1.00 50.11  ? 201  THR A OG1   1 
ATOM   1369 C  CG2   . THR A 1 201 ? 48.588 55.599  88.078  1.00 44.39  ? 201  THR A CG2   1 
ATOM   1370 N  N     . GLY A 1 202 ? 51.449 52.602  85.784  1.00 49.93  ? 202  GLY A N     1 
ATOM   1371 C  CA    . GLY A 1 202 ? 51.758 51.275  85.269  1.00 51.16  ? 202  GLY A CA    1 
ATOM   1372 C  C     . GLY A 1 202 ? 53.222 50.918  85.460  1.00 51.72  ? 202  GLY A C     1 
ATOM   1373 O  O     . GLY A 1 202 ? 54.086 51.723  85.117  1.00 48.60  ? 202  GLY A O     1 
ATOM   1374 N  N     . THR A 1 203 ? 53.493 49.725  86.008  1.00 54.00  ? 203  THR A N     1 
ATOM   1375 C  CA    . THR A 1 203 ? 54.868 49.243  86.270  1.00 55.90  ? 203  THR A CA    1 
ATOM   1376 C  C     . THR A 1 203 ? 55.262 47.936  85.562  1.00 55.30  ? 203  THR A C     1 
ATOM   1377 O  O     . THR A 1 203 ? 56.444 47.616  85.464  1.00 55.49  ? 203  THR A O     1 
ATOM   1378 C  CB    . THR A 1 203 ? 55.085 49.061  87.785  1.00 56.96  ? 203  THR A CB    1 
ATOM   1379 O  OG1   . THR A 1 203 ? 54.045 48.239  88.336  1.00 56.03  ? 203  THR A OG1   1 
ATOM   1380 C  CG2   . THR A 1 203 ? 54.944 50.392  88.519  1.00 57.65  ? 203  THR A CG2   1 
ATOM   1381 N  N     . ASP A 1 204 ? 54.273 47.177  85.109  1.00 55.21  ? 204  ASP A N     1 
ATOM   1382 C  CA    . ASP A 1 204 ? 54.483 46.018  84.248  1.00 57.29  ? 204  ASP A CA    1 
ATOM   1383 C  C     . ASP A 1 204 ? 55.207 46.417  82.960  1.00 55.50  ? 204  ASP A C     1 
ATOM   1384 O  O     . ASP A 1 204 ? 55.167 47.574  82.561  1.00 55.36  ? 204  ASP A O     1 
ATOM   1385 C  CB    . ASP A 1 204 ? 53.121 45.406  83.921  1.00 62.37  ? 204  ASP A CB    1 
ATOM   1386 C  CG    . ASP A 1 204 ? 53.227 44.014  83.367  1.00 67.53  ? 204  ASP A CG    1 
ATOM   1387 O  OD1   . ASP A 1 204 ? 53.306 43.867  82.126  1.00 70.38  ? 204  ASP A OD1   1 
ATOM   1388 O  OD2   . ASP A 1 204 ? 53.237 43.002  84.099  1.00 71.58  ? 204  ASP A OD2   1 
ATOM   1389 N  N     . TRP A 1 205 ? 55.872 45.474  82.302  1.00 54.53  ? 205  TRP A N     1 
ATOM   1390 C  CA    . TRP A 1 205 ? 56.716 45.822  81.148  1.00 52.97  ? 205  TRP A CA    1 
ATOM   1391 C  C     . TRP A 1 205 ? 55.929 46.387  79.943  1.00 51.55  ? 205  TRP A C     1 
ATOM   1392 O  O     . TRP A 1 205 ? 56.436 47.217  79.182  1.00 49.03  ? 205  TRP A O     1 
ATOM   1393 C  CB    . TRP A 1 205 ? 57.608 44.635  80.740  1.00 54.35  ? 205  TRP A CB    1 
ATOM   1394 C  CG    . TRP A 1 205 ? 56.884 43.453  80.143  1.00 56.96  ? 205  TRP A CG    1 
ATOM   1395 C  CD1   . TRP A 1 205 ? 56.389 42.359  80.808  1.00 58.14  ? 205  TRP A CD1   1 
ATOM   1396 C  CD2   . TRP A 1 205 ? 56.600 43.235  78.758  1.00 58.75  ? 205  TRP A CD2   1 
ATOM   1397 N  NE1   . TRP A 1 205 ? 55.808 41.484  79.919  1.00 58.24  ? 205  TRP A NE1   1 
ATOM   1398 C  CE2   . TRP A 1 205 ? 55.924 41.997  78.653  1.00 58.85  ? 205  TRP A CE2   1 
ATOM   1399 C  CE3   . TRP A 1 205 ? 56.848 43.964  77.584  1.00 59.61  ? 205  TRP A CE3   1 
ATOM   1400 C  CZ2   . TRP A 1 205 ? 55.491 41.480  77.427  1.00 58.46  ? 205  TRP A CZ2   1 
ATOM   1401 C  CZ3   . TRP A 1 205 ? 56.414 43.446  76.365  1.00 60.14  ? 205  TRP A CZ3   1 
ATOM   1402 C  CH2   . TRP A 1 205 ? 55.742 42.218  76.301  1.00 58.52  ? 205  TRP A CH2   1 
ATOM   1403 N  N     . THR A 1 206 ? 54.693 45.927  79.776  1.00 51.45  ? 206  THR A N     1 
ATOM   1404 C  CA    . THR A 1 206 ? 53.802 46.437  78.730  1.00 50.11  ? 206  THR A CA    1 
ATOM   1405 C  C     . THR A 1 206 ? 53.410 47.892  78.990  1.00 49.60  ? 206  THR A C     1 
ATOM   1406 O  O     . THR A 1 206 ? 53.397 48.712  78.073  1.00 48.53  ? 206  THR A O     1 
ATOM   1407 C  CB    . THR A 1 206 ? 52.539 45.591  78.663  1.00 50.13  ? 206  THR A CB    1 
ATOM   1408 O  OG1   . THR A 1 206 ? 52.038 45.367  79.983  1.00 48.66  ? 206  THR A OG1   1 
ATOM   1409 C  CG2   . THR A 1 206 ? 52.838 44.200  78.142  1.00 50.80  ? 206  THR A CG2   1 
ATOM   1410 N  N     . GLU A 1 207 ? 53.119 48.191  80.254  1.00 46.91  ? 207  GLU A N     1 
ATOM   1411 C  CA    . GLU A 1 207 ? 52.697 49.516  80.690  1.00 47.09  ? 207  GLU A CA    1 
ATOM   1412 C  C     . GLU A 1 207 ? 53.852 50.533  80.628  1.00 48.15  ? 207  GLU A C     1 
ATOM   1413 O  O     . GLU A 1 207 ? 53.648 51.700  80.297  1.00 47.27  ? 207  GLU A O     1 
ATOM   1414 C  CB    . GLU A 1 207 ? 52.124 49.431  82.111  1.00 47.38  ? 207  GLU A CB    1 
ATOM   1415 C  CG    . GLU A 1 207 ? 50.922 48.499  82.264  1.00 48.15  ? 207  GLU A CG    1 
ATOM   1416 C  CD    . GLU A 1 207 ? 50.614 48.104  83.709  1.00 51.77  ? 207  GLU A CD    1 
ATOM   1417 O  OE1   . GLU A 1 207 ? 51.513 48.191  84.571  1.00 53.53  ? 207  GLU A OE1   1 
ATOM   1418 O  OE2   . GLU A 1 207 ? 49.460 47.687  83.994  1.00 53.65  ? 207  GLU A OE2   1 
ATOM   1419 N  N     . ARG A 1 208 ? 55.068 50.083  80.933  1.00 49.06  ? 208  ARG A N     1 
ATOM   1420 C  CA    . ARG A 1 208 ? 56.261 50.915  80.756  1.00 47.79  ? 208  ARG A CA    1 
ATOM   1421 C  C     . ARG A 1 208 ? 56.431 51.232  79.277  1.00 43.81  ? 208  ARG A C     1 
ATOM   1422 O  O     . ARG A 1 208 ? 56.663 52.363  78.909  1.00 43.27  ? 208  ARG A O     1 
ATOM   1423 C  CB    . ARG A 1 208 ? 57.532 50.216  81.285  1.00 48.32  ? 208  ARG A CB    1 
ATOM   1424 C  CG    . ARG A 1 208 ? 57.587 49.999  82.815  1.00 50.80  ? 208  ARG A CG    1 
ATOM   1425 C  CD    . ARG A 1 208 ? 58.821 49.203  83.335  1.00 49.68  ? 208  ARG A CD    1 
ATOM   1426 N  NE    . ARG A 1 208 ? 60.026 49.587  82.607  1.00 47.85  ? 208  ARG A NE    1 
ATOM   1427 C  CZ    . ARG A 1 208 ? 60.804 50.609  82.917  1.00 50.51  ? 208  ARG A CZ    1 
ATOM   1428 N  NH1   . ARG A 1 208 ? 60.551 51.363  83.983  1.00 52.89  ? 208  ARG A NH1   1 
ATOM   1429 N  NH2   . ARG A 1 208 ? 61.861 50.880  82.163  1.00 51.18  ? 208  ARG A NH2   1 
ATOM   1430 N  N     . MET A 1 209 ? 56.296 50.227  78.428  1.00 42.07  ? 209  MET A N     1 
ATOM   1431 C  CA    . MET A 1 209 ? 56.533 50.405  76.996  1.00 44.33  ? 209  MET A CA    1 
ATOM   1432 C  C     . MET A 1 209 ? 55.558 51.415  76.362  1.00 43.74  ? 209  MET A C     1 
ATOM   1433 O  O     . MET A 1 209 ? 55.953 52.203  75.505  1.00 46.41  ? 209  MET A O     1 
ATOM   1434 C  CB    . MET A 1 209 ? 56.422 49.052  76.287  1.00 47.01  ? 209  MET A CB    1 
ATOM   1435 C  CG    . MET A 1 209 ? 57.033 49.016  74.915  1.00 49.90  ? 209  MET A CG    1 
ATOM   1436 S  SD    . MET A 1 209 ? 56.866 47.362  74.196  1.00 55.93  ? 209  MET A SD    1 
ATOM   1437 C  CE    . MET A 1 209 ? 58.127 46.415  75.115  1.00 55.33  ? 209  MET A CE    1 
ATOM   1438 N  N     . ILE A 1 210 ? 54.291 51.382  76.775  1.00 39.08  ? 210  ILE A N     1 
ATOM   1439 C  CA    . ILE A 1 210 ? 53.315 52.346  76.295  1.00 41.21  ? 210  ILE A CA    1 
ATOM   1440 C  C     . ILE A 1 210 ? 53.720 53.779  76.659  1.00 40.59  ? 210  ILE A C     1 
ATOM   1441 O  O     . ILE A 1 210 ? 53.703 54.669  75.799  1.00 37.43  ? 210  ILE A O     1 
ATOM   1442 C  CB    . ILE A 1 210 ? 51.896 52.020  76.839  1.00 42.22  ? 210  ILE A CB    1 
ATOM   1443 C  CG1   . ILE A 1 210 ? 51.329 50.800  76.114  1.00 38.18  ? 210  ILE A CG1   1 
ATOM   1444 C  CG2   . ILE A 1 210 ? 50.948 53.244  76.674  1.00 42.32  ? 210  ILE A CG2   1 
ATOM   1445 C  CD1   . ILE A 1 210 ? 50.233 50.141  76.835  1.00 39.67  ? 210  ILE A CD1   1 
ATOM   1446 N  N     . GLN A 1 211 ? 54.112 53.975  77.917  1.00 40.34  ? 211  GLN A N     1 
ATOM   1447 C  CA    . GLN A 1 211 ? 54.507 55.289  78.429  1.00 41.36  ? 211  GLN A CA    1 
ATOM   1448 C  C     . GLN A 1 211 ? 55.707 55.862  77.699  1.00 43.43  ? 211  GLN A C     1 
ATOM   1449 O  O     . GLN A 1 211 ? 55.786 57.078  77.446  1.00 45.03  ? 211  GLN A O     1 
ATOM   1450 C  CB    . GLN A 1 211 ? 54.812 55.205  79.925  1.00 42.07  ? 211  GLN A CB    1 
ATOM   1451 C  CG    . GLN A 1 211 ? 53.606 54.833  80.771  1.00 41.49  ? 211  GLN A CG    1 
ATOM   1452 C  CD    . GLN A 1 211 ? 53.942 54.666  82.236  1.00 42.57  ? 211  GLN A CD    1 
ATOM   1453 O  OE1   . GLN A 1 211 ? 54.460 55.577  82.862  1.00 46.46  ? 211  GLN A OE1   1 
ATOM   1454 N  NE2   . GLN A 1 211 ? 53.622 53.515  82.788  1.00 44.19  ? 211  GLN A NE2   1 
ATOM   1455 N  N     . LYS A 1 212 ? 56.642 54.990  77.348  1.00 45.82  ? 212  LYS A N     1 
ATOM   1456 C  CA    . LYS A 1 212 ? 57.844 55.419  76.640  1.00 47.50  ? 212  LYS A CA    1 
ATOM   1457 C  C     . LYS A 1 212 ? 57.469 55.754  75.212  1.00 42.43  ? 212  LYS A C     1 
ATOM   1458 O  O     . LYS A 1 212 ? 57.969 56.718  74.646  1.00 41.49  ? 212  LYS A O     1 
ATOM   1459 C  CB    . LYS A 1 212 ? 58.940 54.333  76.673  1.00 52.61  ? 212  LYS A CB    1 
ATOM   1460 C  CG    . LYS A 1 212 ? 59.744 54.268  77.973  1.00 55.57  ? 212  LYS A CG    1 
ATOM   1461 C  CD    . LYS A 1 212 ? 61.080 53.538  77.782  1.00 59.32  ? 212  LYS A CD    1 
ATOM   1462 C  CE    . LYS A 1 212 ? 61.777 53.246  79.122  1.00 60.38  ? 212  LYS A CE    1 
ATOM   1463 N  NZ    . LYS A 1 212 ? 63.271 53.377  79.019  1.00 61.88  ? 212  LYS A NZ    1 
ATOM   1464 N  N     . ALA A 1 213 ? 56.587 54.950  74.629  1.00 42.01  ? 213  ALA A N     1 
ATOM   1465 C  CA    . ALA A 1 213 ? 56.093 55.193  73.259  1.00 41.03  ? 213  ALA A CA    1 
ATOM   1466 C  C     . ALA A 1 213 ? 55.379 56.548  73.131  1.00 40.09  ? 213  ALA A C     1 
ATOM   1467 O  O     . ALA A 1 213 ? 55.639 57.305  72.198  1.00 39.97  ? 213  ALA A O     1 
ATOM   1468 C  CB    . ALA A 1 213 ? 55.174 54.105  72.844  1.00 39.59  ? 213  ALA A CB    1 
ATOM   1469 N  N     . ILE A 1 214 ? 54.504 56.848  74.084  1.00 38.59  ? 214  ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 214 ? 53.770 58.106  74.092  1.00 38.99  ? 214  ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 214 ? 54.745 59.278  74.199  1.00 39.75  ? 214  ILE A C     1 
ATOM   1472 O  O     . ILE A 1 214 ? 54.679 60.237  73.414  1.00 38.84  ? 214  ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 214 ? 52.731 58.129  75.260  1.00 38.95  ? 214  ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 214 ? 51.605 57.127  74.980  1.00 39.50  ? 214  ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 214 ? 52.150 59.531  75.422  1.00 39.91  ? 214  ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 214 ? 50.722 56.810  76.158  1.00 40.82  ? 214  ILE A CD1   1 
ATOM   1477 N  N     . LEU A 1 215 ? 55.675 59.173  75.148  1.00 39.57  ? 215  LEU A N     1 
ATOM   1478 C  CA    . LEU A 1 215 ? 56.599 60.261  75.440  1.00 39.46  ? 215  LEU A CA    1 
ATOM   1479 C  C     . LEU A 1 215 ? 57.599 60.472  74.332  1.00 38.35  ? 215  LEU A C     1 
ATOM   1480 O  O     . LEU A 1 215 ? 57.896 61.610  73.982  1.00 40.32  ? 215  LEU A O     1 
ATOM   1481 C  CB    . LEU A 1 215 ? 57.312 60.007  76.763  1.00 42.37  ? 215  LEU A CB    1 
ATOM   1482 C  CG    . LEU A 1 215 ? 56.354 60.111  77.954  1.00 42.01  ? 215  LEU A CG    1 
ATOM   1483 C  CD1   . LEU A 1 215 ? 56.972 59.524  79.206  1.00 41.57  ? 215  LEU A CD1   1 
ATOM   1484 C  CD2   . LEU A 1 215 ? 55.955 61.567  78.176  1.00 41.51  ? 215  LEU A CD2   1 
ATOM   1485 N  N     . LYS A 1 216 ? 58.080 59.388  73.744  1.00 39.81  ? 216  LYS A N     1 
ATOM   1486 C  CA    . LYS A 1 216 ? 59.008 59.484  72.621  1.00 42.58  ? 216  LYS A CA    1 
ATOM   1487 C  C     . LYS A 1 216 ? 58.365 60.071  71.361  1.00 41.10  ? 216  LYS A C     1 
ATOM   1488 O  O     . LYS A 1 216 ? 59.017 60.810  70.640  1.00 38.64  ? 216  LYS A O     1 
ATOM   1489 C  CB    . LYS A 1 216 ? 59.645 58.118  72.305  1.00 46.50  ? 216  LYS A CB    1 
ATOM   1490 C  CG    . LYS A 1 216 ? 61.114 57.979  72.746  1.00 49.91  ? 216  LYS A CG    1 
ATOM   1491 C  CD    . LYS A 1 216 ? 61.370 56.708  73.566  1.00 52.93  ? 216  LYS A CD    1 
ATOM   1492 C  CE    . LYS A 1 216 ? 61.874 55.543  72.709  1.00 53.61  ? 216  LYS A CE    1 
ATOM   1493 N  NZ    . LYS A 1 216 ? 62.457 54.463  73.567  1.00 55.19  ? 216  LYS A NZ    1 
ATOM   1494 N  N     . ASN A 1 217 ? 57.105 59.728  71.077  1.00 43.75  ? 217  ASN A N     1 
ATOM   1495 C  CA    . ASN A 1 217 ? 56.415 60.278  69.899  1.00 43.22  ? 217  ASN A CA    1 
ATOM   1496 C  C     . ASN A 1 217 ? 56.207 61.753  70.132  1.00 43.45  ? 217  ASN A C     1 
ATOM   1497 O  O     . ASN A 1 217 ? 56.399 62.587  69.254  1.00 41.96  ? 217  ASN A O     1 
ATOM   1498 C  CB    . ASN A 1 217 ? 55.062 59.627  69.681  1.00 45.73  ? 217  ASN A CB    1 
ATOM   1499 C  CG    . ASN A 1 217 ? 55.143 58.381  68.828  1.00 49.73  ? 217  ASN A CG    1 
ATOM   1500 O  OD1   . ASN A 1 217 ? 54.958 57.257  69.318  1.00 50.28  ? 217  ASN A OD1   1 
ATOM   1501 N  ND2   . ASN A 1 217 ? 55.406 58.570  67.540  1.00 50.00  ? 217  ASN A ND2   1 
ATOM   1502 N  N     . ARG A 1 218 ? 55.825 62.082  71.351  1.00 42.74  ? 218  ARG A N     1 
ATOM   1503 C  CA    . ARG A 1 218 ? 55.619 63.456  71.663  1.00 42.36  ? 218  ARG A CA    1 
ATOM   1504 C  C     . ARG A 1 218 ? 56.904 64.256  71.464  1.00 42.47  ? 218  ARG A C     1 
ATOM   1505 O  O     . ARG A 1 218 ? 56.860 65.286  70.802  1.00 37.71  ? 218  ARG A O     1 
ATOM   1506 C  CB    . ARG A 1 218 ? 55.061 63.620  73.072  1.00 43.91  ? 218  ARG A CB    1 
ATOM   1507 C  CG    . ARG A 1 218 ? 54.634 65.034  73.320  1.00 44.02  ? 218  ARG A CG    1 
ATOM   1508 C  CD    . ARG A 1 218 ? 53.750 65.599  72.211  1.00 44.72  ? 218  ARG A CD    1 
ATOM   1509 N  NE    . ARG A 1 218 ? 52.693 66.375  72.824  1.00 48.39  ? 218  ARG A NE    1 
ATOM   1510 C  CZ    . ARG A 1 218 ? 51.468 65.947  73.075  1.00 46.04  ? 218  ARG A CZ    1 
ATOM   1511 N  NH1   . ARG A 1 218 ? 51.054 64.731  72.752  1.00 44.81  ? 218  ARG A NH1   1 
ATOM   1512 N  NH2   . ARG A 1 218 ? 50.649 66.782  73.671  1.00 48.82  ? 218  ARG A NH2   1 
ATOM   1513 N  N     . ILE A 1 219 ? 58.039 63.762  71.992  1.00 43.58  ? 219  ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 219 ? 59.356 64.389  71.774  1.00 41.77  ? 219  ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 219 ? 59.675 64.561  70.290  1.00 40.43  ? 219  ILE A C     1 
ATOM   1516 O  O     . ILE A 1 219 ? 60.097 65.631  69.867  1.00 41.42  ? 219  ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 219 ? 60.506 63.596  72.478  1.00 44.61  ? 219  ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 219 ? 60.491 63.854  73.979  1.00 45.51  ? 219  ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 219 ? 61.904 63.990  71.940  1.00 44.12  ? 219  ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 219 ? 61.063 62.700  74.782  1.00 46.84  ? 219  ILE A CD1   1 
ATOM   1521 N  N     . LYS A 1 220 ? 59.471 63.528  69.489  1.00 40.93  ? 220  LYS A N     1 
ATOM   1522 C  CA    . LYS A 1 220 ? 59.784 63.648  68.066  1.00 45.91  ? 220  LYS A CA    1 
ATOM   1523 C  C     . LYS A 1 220 ? 58.981 64.791  67.406  1.00 45.99  ? 220  LYS A C     1 
ATOM   1524 O  O     . LYS A 1 220 ? 59.480 65.498  66.528  1.00 44.93  ? 220  LYS A O     1 
ATOM   1525 C  CB    . LYS A 1 220 ? 59.559 62.318  67.332  1.00 48.65  ? 220  LYS A CB    1 
ATOM   1526 C  CG    . LYS A 1 220 ? 59.812 62.404  65.820  1.00 52.88  ? 220  LYS A CG    1 
ATOM   1527 C  CD    . LYS A 1 220 ? 60.623 61.238  65.281  1.00 56.09  ? 220  LYS A CD    1 
ATOM   1528 C  CE    . LYS A 1 220 ? 60.738 61.309  63.755  1.00 57.57  ? 220  LYS A CE    1 
ATOM   1529 N  NZ    . LYS A 1 220 ? 62.164 61.313  63.296  1.00 57.16  ? 220  LYS A NZ    1 
ATOM   1530 N  N     . GLY A 1 221 ? 57.735 64.961  67.836  1.00 44.59  ? 221  GLY A N     1 
ATOM   1531 C  CA    . GLY A 1 221 ? 56.889 66.003  67.306  1.00 43.36  ? 221  GLY A CA    1 
ATOM   1532 C  C     . GLY A 1 221 ? 56.104 65.558  66.098  1.00 43.02  ? 221  GLY A C     1 
ATOM   1533 O  O     . GLY A 1 221 ? 56.203 64.423  65.632  1.00 46.49  ? 221  GLY A O     1 
ATOM   1534 N  N     . LEU A 1 222 ? 55.329 66.493  65.578  1.00 43.16  ? 222  LEU A N     1 
ATOM   1535 C  CA    . LEU A 1 222 ? 54.305 66.199  64.605  1.00 42.33  ? 222  LEU A CA    1 
ATOM   1536 C  C     . LEU A 1 222 ? 54.740 66.718  63.253  1.00 42.51  ? 222  LEU A C     1 
ATOM   1537 O  O     . LEU A 1 222 ? 55.057 67.896  63.091  1.00 42.55  ? 222  LEU A O     1 
ATOM   1538 C  CB    . LEU A 1 222 ? 53.003 66.864  65.041  1.00 42.55  ? 222  LEU A CB    1 
ATOM   1539 C  CG    . LEU A 1 222 ? 51.700 66.349  64.444  1.00 45.79  ? 222  LEU A CG    1 
ATOM   1540 C  CD1   . LEU A 1 222 ? 51.433 64.914  64.897  1.00 46.10  ? 222  LEU A CD1   1 
ATOM   1541 C  CD2   . LEU A 1 222 ? 50.535 67.278  64.825  1.00 46.35  ? 222  LEU A CD2   1 
ATOM   1542 N  N     . GLY A 1 223 ? 54.774 65.815  62.287  1.00 42.70  ? 223  GLY A N     1 
ATOM   1543 C  CA    . GLY A 1 223 ? 54.982 66.175  60.904  1.00 44.71  ? 223  GLY A CA    1 
ATOM   1544 C  C     . GLY A 1 223 ? 56.423 66.365  60.495  1.00 46.60  ? 223  GLY A C     1 
ATOM   1545 O  O     . GLY A 1 223 ? 57.357 66.193  61.288  1.00 46.38  ? 223  GLY A O     1 
ATOM   1546 N  N     . ARG A 1 224 ? 56.572 66.731  59.223  1.00 49.70  ? 224  ARG A N     1 
ATOM   1547 C  CA    . ARG A 1 224 ? 57.857 67.001  58.588  1.00 53.20  ? 224  ARG A CA    1 
ATOM   1548 C  C     . ARG A 1 224 ? 58.798 67.770  59.517  1.00 52.28  ? 224  ARG A C     1 
ATOM   1549 O  O     . ARG A 1 224 ? 59.924 67.330  59.756  1.00 51.72  ? 224  ARG A O     1 
ATOM   1550 C  CB    . ARG A 1 224 ? 57.621 67.795  57.290  1.00 55.41  ? 224  ARG A CB    1 
ATOM   1551 C  CG    . ARG A 1 224 ? 58.795 67.866  56.302  1.00 55.32  ? 224  ARG A CG    1 
ATOM   1552 C  CD    . ARG A 1 224 ? 58.494 68.734  55.080  1.00 55.24  ? 224  ARG A CD    1 
ATOM   1553 N  NE    . ARG A 1 224 ? 58.157 70.098  55.490  1.00 57.21  ? 224  ARG A NE    1 
ATOM   1554 C  CZ    . ARG A 1 224 ? 57.375 70.952  54.818  1.00 57.62  ? 224  ARG A CZ    1 
ATOM   1555 N  NH1   . ARG A 1 224 ? 56.820 70.623  53.655  1.00 59.20  ? 224  ARG A NH1   1 
ATOM   1556 N  NH2   . ARG A 1 224 ? 57.145 72.158  55.324  1.00 57.05  ? 224  ARG A NH2   1 
ATOM   1557 N  N     . ASP A 1 225 ? 58.306 68.891  60.054  1.00 52.42  ? 225  ASP A N     1 
ATOM   1558 C  CA    . ASP A 1 225 ? 59.119 69.840  60.831  1.00 52.17  ? 225  ASP A CA    1 
ATOM   1559 C  C     . ASP A 1 225 ? 59.183 69.564  62.340  1.00 49.57  ? 225  ASP A C     1 
ATOM   1560 O  O     . ASP A 1 225 ? 59.878 70.274  63.060  1.00 52.50  ? 225  ASP A O     1 
ATOM   1561 C  CB    . ASP A 1 225 ? 58.605 71.271  60.622  1.00 54.93  ? 225  ASP A CB    1 
ATOM   1562 C  CG    . ASP A 1 225 ? 58.487 71.651  59.151  1.00 57.55  ? 225  ASP A CG    1 
ATOM   1563 O  OD1   . ASP A 1 225 ? 59.529 71.751  58.464  1.00 58.37  ? 225  ASP A OD1   1 
ATOM   1564 O  OD2   . ASP A 1 225 ? 57.387 71.881  58.601  1.00 60.65  ? 225  ASP A OD2   1 
ATOM   1565 N  N     . GLY A 1 226 ? 58.455 68.558  62.819  1.00 47.15  ? 226  GLY A N     1 
ATOM   1566 C  CA    . GLY A 1 226 ? 58.485 68.178  64.222  1.00 44.71  ? 226  GLY A CA    1 
ATOM   1567 C  C     . GLY A 1 226 ? 57.904 69.228  65.160  1.00 43.84  ? 226  GLY A C     1 
ATOM   1568 O  O     . GLY A 1 226 ? 58.475 69.505  66.207  1.00 41.28  ? 226  GLY A O     1 
ATOM   1569 N  N     . ILE A 1 227 ? 56.760 69.805  64.798  1.00 44.31  ? 227  ILE A N     1 
ATOM   1570 C  CA    . ILE A 1 227 ? 56.160 70.874  65.601  1.00 43.61  ? 227  ILE A CA    1 
ATOM   1571 C  C     . ILE A 1 227 ? 55.519 70.351  66.874  1.00 41.38  ? 227  ILE A C     1 
ATOM   1572 O  O     . ILE A 1 227 ? 55.269 69.160  67.011  1.00 36.70  ? 227  ILE A O     1 
ATOM   1573 C  CB    . ILE A 1 227 ? 55.143 71.696  64.787  1.00 45.09  ? 227  ILE A CB    1 
ATOM   1574 C  CG1   . ILE A 1 227 ? 53.866 70.899  64.501  1.00 45.25  ? 227  ILE A CG1   1 
ATOM   1575 C  CG2   . ILE A 1 227 ? 55.786 72.203  63.491  1.00 45.44  ? 227  ILE A CG2   1 
ATOM   1576 C  CD1   . ILE A 1 227 ? 52.907 71.631  63.577  1.00 45.31  ? 227  ILE A CD1   1 
ATOM   1577 N  N     . THR A 1 228 ? 55.286 71.262  67.808  1.00 42.01  ? 228  THR A N     1 
ATOM   1578 C  CA    . THR A 1 228 ? 54.648 70.937  69.077  1.00 44.14  ? 228  THR A CA    1 
ATOM   1579 C  C     . THR A 1 228 ? 53.119 70.874  68.901  1.00 43.49  ? 228  THR A C     1 
ATOM   1580 O  O     . THR A 1 228 ? 52.497 71.888  68.572  1.00 44.38  ? 228  THR A O     1 
ATOM   1581 C  CB    . THR A 1 228 ? 55.009 72.004  70.120  1.00 44.70  ? 228  THR A CB    1 
ATOM   1582 O  OG1   . THR A 1 228 ? 56.430 72.005  70.349  1.00 44.40  ? 228  THR A OG1   1 
ATOM   1583 C  CG2   . THR A 1 228 ? 54.390 71.664  71.476  1.00 45.87  ? 228  THR A CG2   1 
ATOM   1584 N  N     . PRO A 1 229 ? 52.512 69.707  69.108  1.00 41.43  ? 229  PRO A N     1 
ATOM   1585 C  CA    . PRO A 1 229 ? 51.053 69.587  68.987  1.00 41.42  ? 229  PRO A CA    1 
ATOM   1586 C  C     . PRO A 1 229 ? 50.283 70.209  70.163  1.00 40.85  ? 229  PRO A C     1 
ATOM   1587 O  O     . PRO A 1 229 ? 50.760 70.178  71.294  1.00 40.03  ? 229  PRO A O     1 
ATOM   1588 C  CB    . PRO A 1 229 ? 50.820 68.068  68.937  1.00 40.74  ? 229  PRO A CB    1 
ATOM   1589 C  CG    . PRO A 1 229 ? 52.015 67.449  69.532  1.00 41.26  ? 229  PRO A CG    1 
ATOM   1590 C  CD    . PRO A 1 229 ? 53.147 68.424  69.462  1.00 41.03  ? 229  PRO A CD    1 
ATOM   1591 N  N     . ILE A 1 230 ? 49.091 70.736  69.891  1.00 42.30  ? 230  ILE A N     1 
ATOM   1592 C  CA    . ILE A 1 230 ? 48.210 71.236  70.959  1.00 41.82  ? 230  ILE A CA    1 
ATOM   1593 C  C     . ILE A 1 230 ? 47.547 70.071  71.702  1.00 38.46  ? 230  ILE A C     1 
ATOM   1594 O  O     . ILE A 1 230 ? 47.353 70.125  72.920  1.00 39.10  ? 230  ILE A O     1 
ATOM   1595 C  CB    . ILE A 1 230 ? 47.093 72.165  70.407  1.00 42.12  ? 230  ILE A CB    1 
ATOM   1596 C  CG1   . ILE A 1 230 ? 47.618 73.150  69.348  1.00 43.97  ? 230  ILE A CG1   1 
ATOM   1597 C  CG2   . ILE A 1 230 ? 46.432 72.925  71.555  1.00 43.12  ? 230  ILE A CG2   1 
ATOM   1598 C  CD1   . ILE A 1 230 ? 48.925 73.870  69.704  1.00 44.13  ? 230  ILE A CD1   1 
ATOM   1599 N  N     . PHE A 1 231 ? 47.186 69.036  70.953  1.00 32.91  ? 231  PHE A N     1 
ATOM   1600 C  CA    . PHE A 1 231 ? 46.507 67.860  71.492  1.00 34.57  ? 231  PHE A CA    1 
ATOM   1601 C  C     . PHE A 1 231 ? 47.147 66.583  70.928  1.00 32.65  ? 231  PHE A C     1 
ATOM   1602 O  O     . PHE A 1 231 ? 47.739 66.624  69.846  1.00 32.22  ? 231  PHE A O     1 
ATOM   1603 C  CB    . PHE A 1 231 ? 45.004 67.879  71.104  1.00 35.96  ? 231  PHE A CB    1 
ATOM   1604 C  CG    . PHE A 1 231 ? 44.213 69.020  71.702  1.00 38.29  ? 231  PHE A CG    1 
ATOM   1605 C  CD1   . PHE A 1 231 ? 43.592 69.959  70.887  1.00 42.59  ? 231  PHE A CD1   1 
ATOM   1606 C  CD2   . PHE A 1 231 ? 44.062 69.145  73.075  1.00 40.89  ? 231  PHE A CD2   1 
ATOM   1607 C  CE1   . PHE A 1 231 ? 42.822 71.019  71.448  1.00 41.35  ? 231  PHE A CE1   1 
ATOM   1608 C  CE2   . PHE A 1 231 ? 43.317 70.199  73.636  1.00 39.55  ? 231  PHE A CE2   1 
ATOM   1609 C  CZ    . PHE A 1 231 ? 42.698 71.126  72.818  1.00 40.59  ? 231  PHE A CZ    1 
ATOM   1610 N  N     . PRO A 1 232 ? 47.009 65.430  71.592  1.00 34.31  ? 232  PRO A N     1 
ATOM   1611 C  CA    . PRO A 1 232 ? 46.359 65.255  72.907  1.00 35.45  ? 232  PRO A CA    1 
ATOM   1612 C  C     . PRO A 1 232 ? 47.082 65.886  74.094  1.00 36.23  ? 232  PRO A C     1 
ATOM   1613 O  O     . PRO A 1 232 ? 48.299 65.940  74.076  1.00 37.16  ? 232  PRO A O     1 
ATOM   1614 C  CB    . PRO A 1 232 ? 46.395 63.728  73.102  1.00 35.26  ? 232  PRO A CB    1 
ATOM   1615 C  CG    . PRO A 1 232 ? 46.653 63.164  71.772  1.00 34.47  ? 232  PRO A CG    1 
ATOM   1616 C  CD    . PRO A 1 232 ? 47.454 64.149  71.024  1.00 33.60  ? 232  PRO A CD    1 
ATOM   1617 N  N     . LYS A 1 233 ? 46.356 66.326  75.120  1.00 36.36  ? 233  LYS A N     1 
ATOM   1618 C  CA    . LYS A 1 233 ? 46.997 66.671  76.388  1.00 36.95  ? 233  LYS A CA    1 
ATOM   1619 C  C     . LYS A 1 233 ? 47.547 65.378  76.959  1.00 37.49  ? 233  LYS A C     1 
ATOM   1620 O  O     . LYS A 1 233 ? 46.909 64.330  76.843  1.00 37.85  ? 233  LYS A O     1 
ATOM   1621 C  CB    . LYS A 1 233 ? 46.014 67.270  77.398  1.00 36.81  ? 233  LYS A CB    1 
ATOM   1622 C  CG    . LYS A 1 233 ? 45.511 68.655  77.065  1.00 38.61  ? 233  LYS A CG    1 
ATOM   1623 C  CD    . LYS A 1 233 ? 45.179 69.465  78.330  1.00 39.46  ? 233  LYS A CD    1 
ATOM   1624 C  CE    . LYS A 1 233 ? 44.165 70.585  78.041  1.00 39.85  ? 233  LYS A CE    1 
ATOM   1625 N  NZ    . LYS A 1 233 ? 44.199 71.722  79.028  1.00 36.16  ? 233  LYS A NZ    1 
ATOM   1626 N  N     . LEU A 1 234 ? 48.734 65.458  77.552  1.00 37.12  ? 234  LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 234 ? 49.321 64.336  78.280  1.00 36.27  ? 234  LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 234 ? 49.420 64.707  79.736  1.00 35.01  ? 234  LEU A C     1 
ATOM   1629 O  O     . LEU A 1 234 ? 49.848 65.792  80.054  1.00 34.60  ? 234  LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 234 ? 50.709 64.023  77.764  1.00 35.79  ? 234  LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 234 ? 50.874 63.864  76.260  1.00 36.08  ? 234  LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 234 ? 52.356 63.681  75.949  1.00 35.73  ? 234  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 234 ? 50.061 62.694  75.754  1.00 35.95  ? 234  LEU A CD2   1 
ATOM   1634 N  N     . VAL A 1 235 ? 48.983 63.821  80.615  1.00 35.18  ? 235  VAL A N     1 
ATOM   1635 C  CA    . VAL A 1 235 ? 49.164 64.012  82.044  1.00 37.58  ? 235  VAL A CA    1 
ATOM   1636 C  C     . VAL A 1 235 ? 49.725 62.712  82.622  1.00 39.81  ? 235  VAL A C     1 
ATOM   1637 O  O     . VAL A 1 235 ? 49.158 61.639  82.413  1.00 35.97  ? 235  VAL A O     1 
ATOM   1638 C  CB    . VAL A 1 235 ? 47.836 64.354  82.790  1.00 37.18  ? 235  VAL A CB    1 
ATOM   1639 C  CG1   . VAL A 1 235 ? 48.130 64.727  84.249  1.00 36.63  ? 235  VAL A CG1   1 
ATOM   1640 C  CG2   . VAL A 1 235 ? 47.078 65.476  82.106  1.00 36.34  ? 235  VAL A CG2   1 
ATOM   1641 N  N     . MET A 1 236 ? 50.827 62.814  83.359  1.00 41.80  ? 236  MET A N     1 
ATOM   1642 C  CA    . MET A 1 236 ? 51.393 61.659  84.028  1.00 42.47  ? 236  MET A CA    1 
ATOM   1643 C  C     . MET A 1 236 ? 51.238 61.722  85.538  1.00 41.19  ? 236  MET A C     1 
ATOM   1644 O  O     . MET A 1 236 ? 51.588 62.711  86.173  1.00 42.74  ? 236  MET A O     1 
ATOM   1645 C  CB    . MET A 1 236 ? 52.860 61.535  83.683  1.00 45.99  ? 236  MET A CB    1 
ATOM   1646 C  CG    . MET A 1 236 ? 53.567 60.452  84.466  1.00 47.60  ? 236  MET A CG    1 
ATOM   1647 S  SD    . MET A 1 236 ? 55.301 60.616  84.269  1.00 48.92  ? 236  MET A SD    1 
ATOM   1648 C  CE    . MET A 1 236 ? 55.460 59.974  82.768  1.00 48.11  ? 236  MET A CE    1 
ATOM   1649 N  N     . PHE A 1 237 ? 50.738 60.635  86.107  1.00 42.08  ? 237  PHE A N     1 
ATOM   1650 C  CA    . PHE A 1 237 ? 50.696 60.451  87.550  1.00 41.78  ? 237  PHE A CA    1 
ATOM   1651 C  C     . PHE A 1 237 ? 52.107 60.191  88.144  1.00 43.71  ? 237  PHE A C     1 
ATOM   1652 O  O     . PHE A 1 237 ? 52.938 59.499  87.539  1.00 40.65  ? 237  PHE A O     1 
ATOM   1653 C  CB    . PHE A 1 237 ? 49.765 59.298  87.870  1.00 41.40  ? 237  PHE A CB    1 
ATOM   1654 C  CG    . PHE A 1 237 ? 48.342 59.531  87.444  1.00 40.83  ? 237  PHE A CG    1 
ATOM   1655 C  CD1   . PHE A 1 237 ? 47.763 58.759  86.449  1.00 41.60  ? 237  PHE A CD1   1 
ATOM   1656 C  CD2   . PHE A 1 237 ? 47.579 60.515  88.047  1.00 40.87  ? 237  PHE A CD2   1 
ATOM   1657 C  CE1   . PHE A 1 237 ? 46.444 58.957  86.081  1.00 40.44  ? 237  PHE A CE1   1 
ATOM   1658 C  CE2   . PHE A 1 237 ? 46.275 60.722  87.676  1.00 40.23  ? 237  PHE A CE2   1 
ATOM   1659 C  CZ    . PHE A 1 237 ? 45.706 59.939  86.692  1.00 41.26  ? 237  PHE A CZ    1 
ATOM   1660 N  N     . VAL A 1 238 ? 52.367 60.775  89.315  1.00 45.46  ? 238  VAL A N     1 
ATOM   1661 C  CA    . VAL A 1 238 ? 53.645 60.623  90.017  1.00 47.43  ? 238  VAL A CA    1 
ATOM   1662 C  C     . VAL A 1 238 ? 53.404 60.137  91.432  1.00 47.98  ? 238  VAL A C     1 
ATOM   1663 O  O     . VAL A 1 238 ? 52.608 60.705  92.175  1.00 47.24  ? 238  VAL A O     1 
ATOM   1664 C  CB    . VAL A 1 238 ? 54.484 61.916  90.064  1.00 47.31  ? 238  VAL A CB    1 
ATOM   1665 C  CG1   . VAL A 1 238 ? 54.969 62.278  88.683  1.00 47.97  ? 238  VAL A CG1   1 
ATOM   1666 C  CG2   . VAL A 1 238 ? 53.697 63.075  90.672  1.00 49.41  ? 238  VAL A CG2   1 
ATOM   1667 N  N     . GLU A 1 239 ? 54.098 59.075  91.802  1.00 51.28  ? 239  GLU A N     1 
ATOM   1668 C  CA    . GLU A 1 239 ? 53.896 58.454  93.104  1.00 53.69  ? 239  GLU A CA    1 
ATOM   1669 C  C     . GLU A 1 239 ? 55.202 57.956  93.660  1.00 52.87  ? 239  GLU A C     1 
ATOM   1670 O  O     . GLU A 1 239 ? 56.095 57.585  92.904  1.00 51.29  ? 239  GLU A O     1 
ATOM   1671 C  CB    . GLU A 1 239 ? 52.932 57.283  92.972  1.00 55.55  ? 239  GLU A CB    1 
ATOM   1672 C  CG    . GLU A 1 239 ? 52.101 57.030  94.212  1.00 58.33  ? 239  GLU A CG    1 
ATOM   1673 C  CD    . GLU A 1 239 ? 50.979 56.044  93.964  1.00 60.89  ? 239  GLU A CD    1 
ATOM   1674 O  OE1   . GLU A 1 239 ? 50.633 55.797  92.779  1.00 63.09  ? 239  GLU A OE1   1 
ATOM   1675 O  OE2   . GLU A 1 239 ? 50.440 55.515  94.959  1.00 62.96  ? 239  GLU A OE2   1 
ATOM   1676 N  N     . GLU A 1 240 ? 55.302 57.958  94.985  1.00 55.43  ? 240  GLU A N     1 
ATOM   1677 C  CA    . GLU A 1 240 ? 56.417 57.331  95.682  1.00 57.08  ? 240  GLU A CA    1 
ATOM   1678 C  C     . GLU A 1 240 ? 56.178 55.829  95.571  1.00 56.36  ? 240  GLU A C     1 
ATOM   1679 O  O     . GLU A 1 240 ? 55.056 55.348  95.806  1.00 54.45  ? 240  GLU A O     1 
ATOM   1680 C  CB    . GLU A 1 240 ? 56.492 57.783  97.155  1.00 59.71  ? 240  GLU A CB    1 
ATOM   1681 C  CG    . GLU A 1 240 ? 56.900 56.694  98.151  1.00 62.60  ? 240  GLU A CG    1 
ATOM   1682 C  CD    . GLU A 1 240 ? 57.403 57.232  99.486  1.00 64.81  ? 240  GLU A CD    1 
ATOM   1683 O  OE1   . GLU A 1 240 ? 57.122 58.403  99.831  1.00 66.60  ? 240  GLU A OE1   1 
ATOM   1684 O  OE2   . GLU A 1 240 ? 58.089 56.467  100.199 1.00 65.39  ? 240  GLU A OE2   1 
ATOM   1685 N  N     . GLY A 1 241 ? 57.232 55.104  95.204  1.00 55.41  ? 241  GLY A N     1 
ATOM   1686 C  CA    . GLY A 1 241 ? 57.155 53.669  94.983  1.00 56.00  ? 241  GLY A CA    1 
ATOM   1687 C  C     . GLY A 1 241 ? 56.864 53.297  93.540  1.00 56.25  ? 241  GLY A C     1 
ATOM   1688 O  O     . GLY A 1 241 ? 56.765 52.103  93.224  1.00 55.80  ? 241  GLY A O     1 
ATOM   1689 N  N     . VAL A 1 242 ? 56.722 54.308  92.671  1.00 54.56  ? 242  VAL A N     1 
ATOM   1690 C  CA    . VAL A 1 242 ? 56.418 54.091  91.254  1.00 50.83  ? 242  VAL A CA    1 
ATOM   1691 C  C     . VAL A 1 242 ? 57.366 54.862  90.356  1.00 48.99  ? 242  VAL A C     1 
ATOM   1692 O  O     . VAL A 1 242 ? 58.075 54.260  89.564  1.00 47.41  ? 242  VAL A O     1 
ATOM   1693 C  CB    . VAL A 1 242 ? 54.958 54.454  90.897  1.00 50.18  ? 242  VAL A CB    1 
ATOM   1694 C  CG1   . VAL A 1 242 ? 54.709 54.257  89.401  1.00 50.88  ? 242  VAL A CG1   1 
ATOM   1695 C  CG2   . VAL A 1 242 ? 53.979 53.612  91.708  1.00 48.95  ? 242  VAL A CG2   1 
ATOM   1696 N  N     . ASN A 1 243 ? 57.387 56.187  90.461  1.00 51.36  ? 243  ASN A N     1 
ATOM   1697 C  CA    . ASN A 1 243 ? 58.248 56.980  89.571  1.00 51.79  ? 243  ASN A CA    1 
ATOM   1698 C  C     . ASN A 1 243 ? 58.773 58.319  90.086  1.00 52.68  ? 243  ASN A C     1 
ATOM   1699 O  O     . ASN A 1 243 ? 59.234 59.136  89.292  1.00 55.00  ? 243  ASN A O     1 
ATOM   1700 C  CB    . ASN A 1 243 ? 57.564 57.159  88.195  1.00 51.45  ? 243  ASN A CB    1 
ATOM   1701 C  CG    . ASN A 1 243 ? 56.298 58.032  88.239  1.00 50.10  ? 243  ASN A CG    1 
ATOM   1702 O  OD1   . ASN A 1 243 ? 55.741 58.351  87.189  1.00 53.27  ? 243  ASN A OD1   1 
ATOM   1703 N  ND2   . ASN A 1 243 ? 55.844 58.401  89.420  1.00 43.01  ? 243  ASN A ND2   1 
ATOM   1704 N  N     . LEU A 1 244 ? 58.761 58.523  91.400  1.00 55.44  ? 244  LEU A N     1 
ATOM   1705 C  CA    . LEU A 1 244 ? 59.128 59.816  91.990  1.00 57.81  ? 244  LEU A CA    1 
ATOM   1706 C  C     . LEU A 1 244 ? 60.611 59.967  92.405  1.00 59.29  ? 244  LEU A C     1 
ATOM   1707 O  O     . LEU A 1 244 ? 61.183 61.049  92.256  1.00 59.96  ? 244  LEU A O     1 
ATOM   1708 C  CB    . LEU A 1 244 ? 58.219 60.106  93.186  1.00 58.09  ? 244  LEU A CB    1 
ATOM   1709 C  CG    . LEU A 1 244 ? 58.274 61.523  93.762  1.00 59.45  ? 244  LEU A CG    1 
ATOM   1710 C  CD1   . LEU A 1 244 ? 57.751 62.534  92.757  1.00 59.36  ? 244  LEU A CD1   1 
ATOM   1711 C  CD2   . LEU A 1 244 ? 57.488 61.602  95.080  1.00 59.91  ? 244  LEU A CD2   1 
ATOM   1712 N  N     . TYR A 1 245 ? 61.224 58.895  92.914  1.00 61.68  ? 245  TYR A N     1 
ATOM   1713 C  CA    . TYR A 1 245 ? 62.587 58.943  93.479  1.00 63.38  ? 245  TYR A CA    1 
ATOM   1714 C  C     . TYR A 1 245 ? 63.558 58.054  92.716  1.00 64.28  ? 245  TYR A C     1 
ATOM   1715 O  O     . TYR A 1 245 ? 63.137 57.147  92.011  1.00 64.25  ? 245  TYR A O     1 
ATOM   1716 C  CB    . TYR A 1 245 ? 62.573 58.506  94.945  1.00 63.89  ? 245  TYR A CB    1 
ATOM   1717 C  CG    . TYR A 1 245 ? 61.780 59.421  95.859  1.00 63.99  ? 245  TYR A CG    1 
ATOM   1718 C  CD1   . TYR A 1 245 ? 60.646 58.959  96.525  1.00 63.74  ? 245  TYR A CD1   1 
ATOM   1719 C  CD2   . TYR A 1 245 ? 62.166 60.743  96.059  1.00 64.89  ? 245  TYR A CD2   1 
ATOM   1720 C  CE1   . TYR A 1 245 ? 59.919 59.784  97.363  1.00 64.02  ? 245  TYR A CE1   1 
ATOM   1721 C  CE2   . TYR A 1 245 ? 61.442 61.581  96.897  1.00 65.51  ? 245  TYR A CE2   1 
ATOM   1722 C  CZ    . TYR A 1 245 ? 60.319 61.092  97.544  1.00 65.16  ? 245  TYR A CZ    1 
ATOM   1723 O  OH    . TYR A 1 245 ? 59.592 61.907  98.377  1.00 65.85  ? 245  TYR A OH    1 
ATOM   1724 N  N     . LYS A 1 246 ? 64.856 58.316  92.877  1.00 67.61  ? 246  LYS A N     1 
ATOM   1725 C  CA    . LYS A 1 246 ? 65.924 57.557  92.194  1.00 69.56  ? 246  LYS A CA    1 
ATOM   1726 C  C     . LYS A 1 246 ? 65.695 56.043  92.136  1.00 68.16  ? 246  LYS A C     1 
ATOM   1727 O  O     . LYS A 1 246 ? 65.903 55.415  91.090  1.00 65.49  ? 246  LYS A O     1 
ATOM   1728 C  CB    . LYS A 1 246 ? 67.283 57.814  92.864  1.00 73.23  ? 246  LYS A CB    1 
ATOM   1729 C  CG    . LYS A 1 246 ? 68.250 58.637  92.015  1.00 76.20  ? 246  LYS A CG    1 
ATOM   1730 C  CD    . LYS A 1 246 ? 67.808 60.100  91.946  1.00 78.35  ? 246  LYS A CD    1 
ATOM   1731 C  CE    . LYS A 1 246 ? 68.793 60.971  91.166  1.00 79.04  ? 246  LYS A CE    1 
ATOM   1732 N  NZ    . LYS A 1 246 ? 68.361 62.397  91.167  1.00 79.31  ? 246  LYS A NZ    1 
ATOM   1733 N  N     . ASP A 1 247 ? 65.262 55.474  93.259  1.00 67.63  ? 247  ASP A N     1 
ATOM   1734 C  CA    . ASP A 1 247 ? 65.151 54.024  93.413  1.00 68.21  ? 247  ASP A CA    1 
ATOM   1735 C  C     . ASP A 1 247 ? 63.862 53.407  92.854  1.00 66.14  ? 247  ASP A C     1 
ATOM   1736 O  O     . ASP A 1 247 ? 63.753 52.180  92.756  1.00 65.23  ? 247  ASP A O     1 
ATOM   1737 C  CB    . ASP A 1 247 ? 65.296 53.655  94.898  1.00 70.08  ? 247  ASP A CB    1 
ATOM   1738 C  CG    . ASP A 1 247 ? 66.694 53.943  95.444  1.00 72.60  ? 247  ASP A CG    1 
ATOM   1739 O  OD1   . ASP A 1 247 ? 67.648 54.096  94.639  1.00 72.19  ? 247  ASP A OD1   1 
ATOM   1740 O  OD2   . ASP A 1 247 ? 66.929 54.032  96.672  1.00 75.04  ? 247  ASP A OD2   1 
ATOM   1741 N  N     . ASP A 1 248 ? 62.889 54.241  92.492  1.00 63.81  ? 248  ASP A N     1 
ATOM   1742 C  CA    . ASP A 1 248 ? 61.605 53.746  91.983  1.00 60.71  ? 248  ASP A CA    1 
ATOM   1743 C  C     . ASP A 1 248 ? 61.745 53.082  90.602  1.00 57.80  ? 248  ASP A C     1 
ATOM   1744 O  O     . ASP A 1 248 ? 62.570 53.511  89.791  1.00 55.59  ? 248  ASP A O     1 
ATOM   1745 C  CB    . ASP A 1 248 ? 60.585 54.886  91.916  1.00 60.30  ? 248  ASP A CB    1 
ATOM   1746 C  CG    . ASP A 1 248 ? 60.113 55.341  93.291  1.00 61.29  ? 248  ASP A CG    1 
ATOM   1747 O  OD1   . ASP A 1 248 ? 60.086 54.515  94.233  1.00 61.52  ? 248  ASP A OD1   1 
ATOM   1748 O  OD2   . ASP A 1 248 ? 59.741 56.512  93.526  1.00 59.71  ? 248  ASP A OD2   1 
ATOM   1749 N  N     . PRO A 1 249 ? 60.949 52.042  90.341  1.00 55.95  ? 249  PRO A N     1 
ATOM   1750 C  CA    . PRO A 1 249 ? 61.023 51.287  89.071  1.00 56.98  ? 249  PRO A CA    1 
ATOM   1751 C  C     . PRO A 1 249 ? 60.917 52.124  87.778  1.00 57.74  ? 249  PRO A C     1 
ATOM   1752 O  O     . PRO A 1 249 ? 61.683 51.897  86.837  1.00 58.33  ? 249  PRO A O     1 
ATOM   1753 C  CB    . PRO A 1 249 ? 59.833 50.316  89.146  1.00 56.14  ? 249  PRO A CB    1 
ATOM   1754 C  CG    . PRO A 1 249 ? 59.411 50.275  90.579  1.00 57.17  ? 249  PRO A CG    1 
ATOM   1755 C  CD    . PRO A 1 249 ? 59.928 51.501  91.255  1.00 56.32  ? 249  PRO A CD    1 
ATOM   1756 N  N     . ASN A 1 250 ? 59.973 53.060  87.726  1.00 56.17  ? 250  ASN A N     1 
ATOM   1757 C  CA    . ASN A 1 250 ? 59.752 53.864  86.521  1.00 55.12  ? 250  ASN A CA    1 
ATOM   1758 C  C     . ASN A 1 250 ? 60.447 55.226  86.583  1.00 52.90  ? 250  ASN A C     1 
ATOM   1759 O  O     . ASN A 1 250 ? 60.012 56.179  85.932  1.00 53.13  ? 250  ASN A O     1 
ATOM   1760 C  CB    . ASN A 1 250 ? 58.245 54.058  86.278  1.00 55.03  ? 250  ASN A CB    1 
ATOM   1761 C  CG    . ASN A 1 250 ? 57.525 52.764  85.962  1.00 54.22  ? 250  ASN A CG    1 
ATOM   1762 O  OD1   . ASN A 1 250 ? 58.139 51.763  85.617  1.00 55.06  ? 250  ASN A OD1   1 
ATOM   1763 N  ND2   . ASN A 1 250 ? 56.212 52.787  86.068  1.00 54.29  ? 250  ASN A ND2   1 
ATOM   1764 N  N     . TYR A 1 251 ? 61.525 55.317  87.354  1.00 49.06  ? 251  TYR A N     1 
ATOM   1765 C  CA    . TYR A 1 251 ? 62.247 56.568  87.485  1.00 48.49  ? 251  TYR A CA    1 
ATOM   1766 C  C     . TYR A 1 251 ? 62.872 56.976  86.163  1.00 48.19  ? 251  TYR A C     1 
ATOM   1767 O  O     . TYR A 1 251 ? 63.072 58.163  85.921  1.00 48.06  ? 251  TYR A O     1 
ATOM   1768 C  CB    . TYR A 1 251 ? 63.346 56.492  88.555  1.00 48.64  ? 251  TYR A CB    1 
ATOM   1769 C  CG    . TYR A 1 251 ? 64.008 57.844  88.792  1.00 48.94  ? 251  TYR A CG    1 
ATOM   1770 C  CD1   . TYR A 1 251 ? 63.366 58.823  89.547  1.00 50.84  ? 251  TYR A CD1   1 
ATOM   1771 C  CD2   . TYR A 1 251 ? 65.250 58.163  88.222  1.00 48.10  ? 251  TYR A CD2   1 
ATOM   1772 C  CE1   . TYR A 1 251 ? 63.949 60.076  89.760  1.00 51.48  ? 251  TYR A CE1   1 
ATOM   1773 C  CE2   . TYR A 1 251 ? 65.844 59.420  88.432  1.00 47.51  ? 251  TYR A CE2   1 
ATOM   1774 C  CZ    . TYR A 1 251 ? 65.182 60.368  89.202  1.00 48.69  ? 251  TYR A CZ    1 
ATOM   1775 O  OH    . TYR A 1 251 ? 65.720 61.612  89.427  1.00 47.72  ? 251  TYR A OH    1 
ATOM   1776 N  N     . ASP A 1 252 ? 63.213 56.006  85.319  1.00 49.45  ? 252  ASP A N     1 
ATOM   1777 C  CA    . ASP A 1 252 ? 63.725 56.347  83.988  1.00 52.00  ? 252  ASP A CA    1 
ATOM   1778 C  C     . ASP A 1 252 ? 62.640 57.018  83.124  1.00 52.38  ? 252  ASP A C     1 
ATOM   1779 O  O     . ASP A 1 252 ? 62.931 57.963  82.379  1.00 50.15  ? 252  ASP A O     1 
ATOM   1780 C  CB    . ASP A 1 252 ? 64.394 55.157  83.273  1.00 52.86  ? 252  ASP A CB    1 
ATOM   1781 C  CG    . ASP A 1 252 ? 63.458 53.986  83.037  1.00 55.23  ? 252  ASP A CG    1 
ATOM   1782 O  OD1   . ASP A 1 252 ? 62.475 53.810  83.791  1.00 55.59  ? 252  ASP A OD1   1 
ATOM   1783 O  OD2   . ASP A 1 252 ? 63.651 53.172  82.106  1.00 57.53  ? 252  ASP A OD2   1 
ATOM   1784 N  N     . ILE A 1 253 ? 61.398 56.551  83.257  1.00 51.97  ? 253  ILE A N     1 
ATOM   1785 C  CA    . ILE A 1 253 ? 60.270 57.169  82.563  1.00 52.58  ? 253  ILE A CA    1 
ATOM   1786 C  C     . ILE A 1 253 ? 60.035 58.597  83.062  1.00 51.69  ? 253  ILE A C     1 
ATOM   1787 O  O     . ILE A 1 253 ? 59.736 59.476  82.268  1.00 51.13  ? 253  ILE A O     1 
ATOM   1788 C  CB    . ILE A 1 253 ? 58.995 56.297  82.680  1.00 53.06  ? 253  ILE A CB    1 
ATOM   1789 C  CG1   . ILE A 1 253 ? 59.180 55.021  81.858  1.00 52.11  ? 253  ILE A CG1   1 
ATOM   1790 C  CG2   . ILE A 1 253 ? 57.754 57.068  82.201  1.00 53.86  ? 253  ILE A CG2   1 
ATOM   1791 C  CD1   . ILE A 1 253 ? 58.084 54.013  82.035  1.00 51.89  ? 253  ILE A CD1   1 
ATOM   1792 N  N     . LYS A 1 254 ? 60.196 58.841  84.358  1.00 51.24  ? 254  LYS A N     1 
ATOM   1793 C  CA    . LYS A 1 254 ? 60.089 60.209  84.878  1.00 51.22  ? 254  LYS A CA    1 
ATOM   1794 C  C     . LYS A 1 254 ? 61.070 61.152  84.177  1.00 50.09  ? 254  LYS A C     1 
ATOM   1795 O  O     . LYS A 1 254 ? 60.711 62.289  83.876  1.00 47.70  ? 254  LYS A O     1 
ATOM   1796 C  CB    . LYS A 1 254 ? 60.300 60.234  86.390  1.00 51.69  ? 254  LYS A CB    1 
ATOM   1797 C  CG    . LYS A 1 254 ? 59.991 61.573  87.063  1.00 52.24  ? 254  LYS A CG    1 
ATOM   1798 C  CD    . LYS A 1 254 ? 60.940 61.850  88.235  1.00 52.59  ? 254  LYS A CD    1 
ATOM   1799 C  CE    . LYS A 1 254 ? 60.518 63.063  89.047  1.00 53.29  ? 254  LYS A CE    1 
ATOM   1800 N  NZ    . LYS A 1 254 ? 61.060 63.027  90.446  1.00 53.93  ? 254  LYS A NZ    1 
ATOM   1801 N  N     . GLN A 1 255 ? 62.288 60.672  83.904  1.00 50.20  ? 255  GLN A N     1 
ATOM   1802 C  CA    . GLN A 1 255 ? 63.323 61.468  83.209  1.00 49.09  ? 255  GLN A CA    1 
ATOM   1803 C  C     . GLN A 1 255 ? 62.989 61.691  81.737  1.00 46.79  ? 255  GLN A C     1 
ATOM   1804 O  O     . GLN A 1 255 ? 63.270 62.741  81.182  1.00 50.23  ? 255  GLN A O     1 
ATOM   1805 C  CB    . GLN A 1 255 ? 64.707 60.796  83.320  1.00 51.59  ? 255  GLN A CB    1 
ATOM   1806 C  CG    . GLN A 1 255 ? 65.274 60.694  84.756  1.00 51.51  ? 255  GLN A CG    1 
ATOM   1807 C  CD    . GLN A 1 255 ? 65.557 62.053  85.391  1.00 51.04  ? 255  GLN A CD    1 
ATOM   1808 O  OE1   . GLN A 1 255 ? 65.964 63.000  84.704  1.00 50.79  ? 255  GLN A OE1   1 
ATOM   1809 N  NE2   . GLN A 1 255 ? 65.341 62.153  86.704  1.00 51.19  ? 255  GLN A NE2   1 
ATOM   1810 N  N     . LEU A 1 256 ? 62.396 60.696  81.099  1.00 45.75  ? 256  LEU A N     1 
ATOM   1811 C  CA    . LEU A 1 256 ? 61.869 60.861  79.753  1.00 46.32  ? 256  LEU A CA    1 
ATOM   1812 C  C     . LEU A 1 256 ? 60.778 61.948  79.715  1.00 44.67  ? 256  LEU A C     1 
ATOM   1813 O  O     . LEU A 1 256 ? 60.774 62.789  78.827  1.00 42.75  ? 256  LEU A O     1 
ATOM   1814 C  CB    . LEU A 1 256 ? 61.315 59.529  79.241  1.00 47.96  ? 256  LEU A CB    1 
ATOM   1815 C  CG    . LEU A 1 256 ? 61.093 59.362  77.737  1.00 48.66  ? 256  LEU A CG    1 
ATOM   1816 C  CD1   . LEU A 1 256 ? 62.195 60.033  76.916  1.00 48.68  ? 256  LEU A CD1   1 
ATOM   1817 C  CD2   . LEU A 1 256 ? 61.002 57.880  77.401  1.00 46.96  ? 256  LEU A CD2   1 
ATOM   1818 N  N     . ALA A 1 257 ? 59.897 61.947  80.714  1.00 43.44  ? 257  ALA A N     1 
ATOM   1819 C  CA    . ALA A 1 257 ? 58.808 62.918  80.820  1.00 42.23  ? 257  ALA A CA    1 
ATOM   1820 C  C     . ALA A 1 257 ? 59.308 64.329  81.063  1.00 45.16  ? 257  ALA A C     1 
ATOM   1821 O  O     . ALA A 1 257 ? 58.689 65.292  80.604  1.00 44.70  ? 257  ALA A O     1 
ATOM   1822 C  CB    . ALA A 1 257 ? 57.871 62.530  81.934  1.00 42.62  ? 257  ALA A CB    1 
ATOM   1823 N  N     . LEU A 1 258 ? 60.422 64.461  81.786  1.00 45.71  ? 258  LEU A N     1 
ATOM   1824 C  CA    . LEU A 1 258 ? 60.993 65.776  82.051  1.00 45.81  ? 258  LEU A CA    1 
ATOM   1825 C  C     . LEU A 1 258 ? 61.547 66.375  80.766  1.00 45.65  ? 258  LEU A C     1 
ATOM   1826 O  O     . LEU A 1 258 ? 61.352 67.560  80.494  1.00 46.34  ? 258  LEU A O     1 
ATOM   1827 C  CB    . LEU A 1 258 ? 62.084 65.697  83.116  1.00 47.56  ? 258  LEU A CB    1 
ATOM   1828 C  CG    . LEU A 1 258 ? 61.557 65.486  84.540  1.00 48.11  ? 258  LEU A CG    1 
ATOM   1829 C  CD1   . LEU A 1 258 ? 62.602 64.776  85.390  1.00 48.37  ? 258  LEU A CD1   1 
ATOM   1830 C  CD2   . LEU A 1 258 ? 61.158 66.803  85.187  1.00 48.29  ? 258  LEU A CD2   1 
ATOM   1831 N  N     . GLU A 1 259 ? 62.233 65.547  79.984  1.00 46.05  ? 259  GLU A N     1 
ATOM   1832 C  CA    . GLU A 1 259 ? 62.757 65.939  78.666  1.00 46.07  ? 259  GLU A CA    1 
ATOM   1833 C  C     . GLU A 1 259 ? 61.604 66.326  77.725  1.00 45.00  ? 259  GLU A C     1 
ATOM   1834 O  O     . GLU A 1 259 ? 61.655 67.352  77.045  1.00 46.91  ? 259  GLU A O     1 
ATOM   1835 C  CB    . GLU A 1 259 ? 63.581 64.779  78.070  1.00 45.60  ? 259  GLU A CB    1 
ATOM   1836 C  CG    . GLU A 1 259 ? 64.354 65.082  76.789  1.00 45.70  ? 259  GLU A CG    1 
ATOM   1837 C  CD    . GLU A 1 259 ? 64.719 63.825  75.990  1.00 45.77  ? 259  GLU A CD    1 
ATOM   1838 O  OE1   . GLU A 1 259 ? 64.787 62.727  76.582  1.00 47.04  ? 259  GLU A OE1   1 
ATOM   1839 O  OE2   . GLU A 1 259 ? 64.939 63.929  74.759  1.00 45.43  ? 259  GLU A OE2   1 
ATOM   1840 N  N     . CYS A 1 260 ? 60.554 65.517  77.708  1.00 45.12  ? 260  CYS A N     1 
ATOM   1841 C  CA    . CYS A 1 260 ? 59.363 65.811  76.901  1.00 44.15  ? 260  CYS A CA    1 
ATOM   1842 C  C     . CYS A 1 260 ? 58.700 67.143  77.305  1.00 42.90  ? 260  CYS A C     1 
ATOM   1843 O  O     . CYS A 1 260 ? 58.493 68.010  76.464  1.00 42.02  ? 260  CYS A O     1 
ATOM   1844 C  CB    . CYS A 1 260 ? 58.359 64.673  77.030  1.00 44.20  ? 260  CYS A CB    1 
ATOM   1845 S  SG    . CYS A 1 260 ? 56.943 64.831  75.933  1.00 45.64  ? 260  CYS A SG    1 
ATOM   1846 N  N     . ALA A 1 261 ? 58.383 67.307  78.588  1.00 39.93  ? 261  ALA A N     1 
ATOM   1847 C  CA    . ALA A 1 261 ? 57.866 68.582  79.086  1.00 40.82  ? 261  ALA A CA    1 
ATOM   1848 C  C     . ALA A 1 261 ? 58.685 69.784  78.637  1.00 43.15  ? 261  ALA A C     1 
ATOM   1849 O  O     . ALA A 1 261 ? 58.115 70.820  78.317  1.00 42.51  ? 261  ALA A O     1 
ATOM   1850 C  CB    . ALA A 1 261 ? 57.760 68.572  80.601  1.00 40.51  ? 261  ALA A CB    1 
ATOM   1851 N  N     . SER A 1 262 ? 60.014 69.645  78.614  1.00 44.67  ? 262  SER A N     1 
ATOM   1852 C  CA    . SER A 1 262 ? 60.912 70.756  78.284  1.00 44.75  ? 262  SER A CA    1 
ATOM   1853 C  C     . SER A 1 262 ? 60.960 71.073  76.787  1.00 45.44  ? 262  SER A C     1 
ATOM   1854 O  O     . SER A 1 262 ? 61.318 72.192  76.388  1.00 46.09  ? 262  SER A O     1 
ATOM   1855 C  CB    . SER A 1 262 ? 62.331 70.466  78.801  1.00 46.62  ? 262  SER A CB    1 
ATOM   1856 O  OG    . SER A 1 262 ? 63.006 69.504  77.996  1.00 47.95  ? 262  SER A OG    1 
ATOM   1857 N  N     . LYS A 1 263 ? 60.618 70.094  75.956  1.00 45.74  ? 263  LYS A N     1 
ATOM   1858 C  CA    . LYS A 1 263 ? 60.584 70.303  74.509  1.00 46.69  ? 263  LYS A CA    1 
ATOM   1859 C  C     . LYS A 1 263 ? 59.184 70.542  73.960  1.00 44.91  ? 263  LYS A C     1 
ATOM   1860 O  O     . LYS A 1 263 ? 59.043 71.095  72.875  1.00 48.45  ? 263  LYS A O     1 
ATOM   1861 C  CB    . LYS A 1 263 ? 61.217 69.116  73.781  1.00 48.75  ? 263  LYS A CB    1 
ATOM   1862 C  CG    . LYS A 1 263 ? 62.759 69.070  73.855  1.00 49.46  ? 263  LYS A CG    1 
ATOM   1863 C  CD    . LYS A 1 263 ? 63.277 67.697  73.443  1.00 50.75  ? 263  LYS A CD    1 
ATOM   1864 C  CE    . LYS A 1 263 ? 64.798 67.560  73.556  1.00 51.16  ? 263  LYS A CE    1 
ATOM   1865 N  NZ    . LYS A 1 263 ? 65.204 66.155  73.244  1.00 50.55  ? 263  LYS A NZ    1 
ATOM   1866 N  N     . ARG A 1 264 ? 58.155 70.125  74.691  1.00 43.42  ? 264  ARG A N     1 
ATOM   1867 C  CA    . ARG A 1 264 ? 56.781 70.109  74.159  1.00 43.93  ? 264  ARG A CA    1 
ATOM   1868 C  C     . ARG A 1 264 ? 55.703 70.493  75.194  1.00 43.24  ? 264  ARG A C     1 
ATOM   1869 O  O     . ARG A 1 264 ? 54.510 70.330  74.936  1.00 42.29  ? 264  ARG A O     1 
ATOM   1870 C  CB    . ARG A 1 264 ? 56.448 68.727  73.571  1.00 42.97  ? 264  ARG A CB    1 
ATOM   1871 C  CG    . ARG A 1 264 ? 57.575 68.037  72.804  1.00 43.99  ? 264  ARG A CG    1 
ATOM   1872 C  CD    . ARG A 1 264 ? 57.355 67.867  71.298  1.00 45.09  ? 264  ARG A CD    1 
ATOM   1873 N  NE    . ARG A 1 264 ? 57.726 69.045  70.531  1.00 48.02  ? 264  ARG A NE    1 
ATOM   1874 C  CZ    . ARG A 1 264 ? 58.448 69.050  69.407  1.00 48.49  ? 264  ARG A CZ    1 
ATOM   1875 N  NH1   . ARG A 1 264 ? 58.928 67.932  68.881  1.00 48.09  ? 264  ARG A NH1   1 
ATOM   1876 N  NH2   . ARG A 1 264 ? 58.702 70.208  68.806  1.00 50.79  ? 264  ARG A NH2   1 
ATOM   1877 N  N     . MET A 1 265 ? 56.138 71.020  76.338  1.00 42.53  ? 265  MET A N     1 
ATOM   1878 C  CA    . MET A 1 265 ? 55.284 71.408  77.460  1.00 41.50  ? 265  MET A CA    1 
ATOM   1879 C  C     . MET A 1 265 ? 54.632 70.260  78.212  1.00 41.42  ? 265  MET A C     1 
ATOM   1880 O  O     . MET A 1 265 ? 54.830 70.107  79.415  1.00 42.79  ? 265  MET A O     1 
ATOM   1881 C  CB    . MET A 1 265 ? 54.229 72.402  77.019  1.00 44.52  ? 265  MET A CB    1 
ATOM   1882 C  CG    . MET A 1 265 ? 53.942 73.462  78.062  1.00 46.33  ? 265  MET A CG    1 
ATOM   1883 S  SD    . MET A 1 265 ? 54.923 74.932  77.793  1.00 46.46  ? 265  MET A SD    1 
ATOM   1884 C  CE    . MET A 1 265 ? 54.113 75.685  76.388  1.00 46.01  ? 265  MET A CE    1 
ATOM   1885 N  N     . TYR A 1 266 ? 53.821 69.467  77.533  1.00 40.50  ? 266  TYR A N     1 
ATOM   1886 C  CA    . TYR A 1 266 ? 53.239 68.303  78.172  1.00 40.15  ? 266  TYR A CA    1 
ATOM   1887 C  C     . TYR A 1 266 ? 54.362 67.288  78.341  1.00 38.00  ? 266  TYR A C     1 
ATOM   1888 O  O     . TYR A 1 266 ? 55.302 67.326  77.568  1.00 35.67  ? 266  TYR A O     1 
ATOM   1889 C  CB    . TYR A 1 266 ? 52.097 67.752  77.323  1.00 38.94  ? 266  TYR A CB    1 
ATOM   1890 C  CG    . TYR A 1 266 ? 50.899 68.678  77.241  1.00 40.23  ? 266  TYR A CG    1 
ATOM   1891 C  CD1   . TYR A 1 266 ? 50.198 69.051  78.385  1.00 40.43  ? 266  TYR A CD1   1 
ATOM   1892 C  CD2   . TYR A 1 266 ? 50.458 69.173  76.014  1.00 40.93  ? 266  TYR A CD2   1 
ATOM   1893 C  CE1   . TYR A 1 266 ? 49.097 69.881  78.308  1.00 40.30  ? 266  TYR A CE1   1 
ATOM   1894 C  CE2   . TYR A 1 266 ? 49.354 70.007  75.930  1.00 40.84  ? 266  TYR A CE2   1 
ATOM   1895 C  CZ    . TYR A 1 266 ? 48.683 70.356  77.078  1.00 39.75  ? 266  TYR A CZ    1 
ATOM   1896 O  OH    . TYR A 1 266 ? 47.597 71.179  76.994  1.00 40.59  ? 266  TYR A OH    1 
ATOM   1897 N  N     . PRO A 1 267 ? 54.267 66.367  79.302  1.00 38.76  ? 267  PRO A N     1 
ATOM   1898 C  CA    . PRO A 1 267 ? 53.077 66.164  80.140  1.00 39.40  ? 267  PRO A CA    1 
ATOM   1899 C  C     . PRO A 1 267 ? 52.980 67.054  81.379  1.00 39.22  ? 267  PRO A C     1 
ATOM   1900 O  O     . PRO A 1 267 ? 53.982 67.362  82.020  1.00 41.46  ? 267  PRO A O     1 
ATOM   1901 C  CB    . PRO A 1 267 ? 53.232 64.711  80.580  1.00 39.56  ? 267  PRO A CB    1 
ATOM   1902 C  CG    . PRO A 1 267 ? 54.746 64.526  80.702  1.00 39.90  ? 267  PRO A CG    1 
ATOM   1903 C  CD    . PRO A 1 267 ? 55.331 65.401  79.629  1.00 39.44  ? 267  PRO A CD    1 
ATOM   1904 N  N     . ASP A 1 268 ? 51.761 67.474  81.691  1.00 39.94  ? 268  ASP A N     1 
ATOM   1905 C  CA    . ASP A 1 268 ? 51.413 67.954  83.022  1.00 40.35  ? 268  ASP A CA    1 
ATOM   1906 C  C     . ASP A 1 268 ? 51.546 66.750  83.953  1.00 39.86  ? 268  ASP A C     1 
ATOM   1907 O  O     . ASP A 1 268 ? 51.507 65.603  83.501  1.00 40.13  ? 268  ASP A O     1 
ATOM   1908 C  CB    . ASP A 1 268 ? 49.950 68.410  83.093  1.00 42.74  ? 268  ASP A CB    1 
ATOM   1909 C  CG    . ASP A 1 268 ? 49.617 69.594  82.176  1.00 44.87  ? 268  ASP A CG    1 
ATOM   1910 O  OD1   . ASP A 1 268 ? 50.497 70.431  81.879  1.00 40.87  ? 268  ASP A OD1   1 
ATOM   1911 O  OD2   . ASP A 1 268 ? 48.450 69.766  81.733  1.00 48.69  ? 268  ASP A OD2   1 
ATOM   1912 N  N     . ILE A 1 269 ? 51.661 66.999  85.251  1.00 37.26  ? 269  ILE A N     1 
ATOM   1913 C  CA    . ILE A 1 269 ? 51.677 65.907  86.214  1.00 36.65  ? 269  ILE A CA    1 
ATOM   1914 C  C     . ILE A 1 269 ? 50.581 66.050  87.246  1.00 36.30  ? 269  ILE A C     1 
ATOM   1915 O  O     . ILE A 1 269 ? 50.165 67.164  87.562  1.00 34.53  ? 269  ILE A O     1 
ATOM   1916 C  CB    . ILE A 1 269 ? 53.044 65.827  86.923  1.00 36.77  ? 269  ILE A CB    1 
ATOM   1917 C  CG1   . ILE A 1 269 ? 53.283 67.061  87.784  1.00 37.99  ? 269  ILE A CG1   1 
ATOM   1918 C  CG2   . ILE A 1 269 ? 54.160 65.648  85.900  1.00 36.84  ? 269  ILE A CG2   1 
ATOM   1919 C  CD1   . ILE A 1 269 ? 54.323 66.853  88.831  1.00 40.39  ? 269  ILE A CD1   1 
ATOM   1920 N  N     . ILE A 1 270 ? 50.122 64.911  87.759  1.00 35.85  ? 270  ILE A N     1 
ATOM   1921 C  CA    . ILE A 1 270 ? 49.250 64.878  88.920  1.00 38.80  ? 270  ILE A CA    1 
ATOM   1922 C  C     . ILE A 1 270 ? 49.917 64.113  90.057  1.00 39.08  ? 270  ILE A C     1 
ATOM   1923 O  O     . ILE A 1 270 ? 50.407 63.012  89.854  1.00 40.86  ? 270  ILE A O     1 
ATOM   1924 C  CB    . ILE A 1 270 ? 47.899 64.189  88.579  1.00 38.78  ? 270  ILE A CB    1 
ATOM   1925 C  CG1   . ILE A 1 270 ? 47.031 65.106  87.717  1.00 38.04  ? 270  ILE A CG1   1 
ATOM   1926 C  CG2   . ILE A 1 270 ? 47.149 63.825  89.868  1.00 39.05  ? 270  ILE A CG2   1 
ATOM   1927 C  CD1   . ILE A 1 270 ? 45.812 64.457  87.146  1.00 36.40  ? 270  ILE A CD1   1 
ATOM   1928 N  N     . SER A 1 271 ? 49.895 64.685  91.255  1.00 39.51  ? 271  SER A N     1 
ATOM   1929 C  CA    . SER A 1 271 ? 50.327 63.993  92.466  1.00 37.96  ? 271  SER A CA    1 
ATOM   1930 C  C     . SER A 1 271 ? 49.303 62.967  92.861  1.00 35.82  ? 271  SER A C     1 
ATOM   1931 O  O     . SER A 1 271 ? 48.234 63.321  93.343  1.00 36.49  ? 271  SER A O     1 
ATOM   1932 C  CB    . SER A 1 271 ? 50.477 64.977  93.629  1.00 40.43  ? 271  SER A CB    1 
ATOM   1933 O  OG    . SER A 1 271 ? 50.615 64.297  94.877  1.00 41.31  ? 271  SER A OG    1 
ATOM   1934 N  N     . ALA A 1 272 ? 49.645 61.698  92.701  1.00 35.80  ? 272  ALA A N     1 
ATOM   1935 C  CA    . ALA A 1 272 ? 48.741 60.606  93.040  1.00 35.30  ? 272  ALA A CA    1 
ATOM   1936 C  C     . ALA A 1 272 ? 48.295 60.679  94.489  1.00 37.96  ? 272  ALA A C     1 
ATOM   1937 O  O     . ALA A 1 272 ? 47.109 60.512  94.777  1.00 40.54  ? 272  ALA A O     1 
ATOM   1938 C  CB    . ALA A 1 272 ? 49.401 59.254  92.735  1.00 34.28  ? 272  ALA A CB    1 
ATOM   1939 N  N     . LYS A 1 273 ? 49.227 60.960  95.396  1.00 39.84  ? 273  LYS A N     1 
ATOM   1940 C  CA    . LYS A 1 273 ? 48.912 61.031  96.826  1.00 44.47  ? 273  LYS A CA    1 
ATOM   1941 C  C     . LYS A 1 273 ? 47.874 62.135  97.150  1.00 43.67  ? 273  LYS A C     1 
ATOM   1942 O  O     . LYS A 1 273 ? 46.861 61.863  97.783  1.00 43.16  ? 273  LYS A O     1 
ATOM   1943 C  CB    . LYS A 1 273 ? 50.212 61.232  97.637  1.00 49.20  ? 273  LYS A CB    1 
ATOM   1944 C  CG    . LYS A 1 273 ? 50.050 61.197  99.160  1.00 54.03  ? 273  LYS A CG    1 
ATOM   1945 C  CD    . LYS A 1 273 ? 51.407 61.338  99.900  1.00 58.43  ? 273  LYS A CD    1 
ATOM   1946 C  CE    . LYS A 1 273 ? 51.676 60.157  100.873 1.00 60.22  ? 273  LYS A CE    1 
ATOM   1947 N  NZ    . LYS A 1 273 ? 53.137 59.986  101.205 1.00 60.28  ? 273  LYS A NZ    1 
ATOM   1948 N  N     . ASN A 1 274 ? 48.126 63.372  96.719  1.00 42.89  ? 274  ASN A N     1 
ATOM   1949 C  CA    . ASN A 1 274 ? 47.180 64.468  96.967  1.00 42.24  ? 274  ASN A CA    1 
ATOM   1950 C  C     . ASN A 1 274 ? 45.869 64.279  96.207  1.00 40.31  ? 274  ASN A C     1 
ATOM   1951 O  O     . ASN A 1 274 ? 44.782 64.556  96.737  1.00 36.88  ? 274  ASN A O     1 
ATOM   1952 C  CB    . ASN A 1 274 ? 47.823 65.821  96.642  1.00 42.46  ? 274  ASN A CB    1 
ATOM   1953 C  CG    . ASN A 1 274 ? 48.964 66.156  97.599  1.00 43.26  ? 274  ASN A CG    1 
ATOM   1954 O  OD1   . ASN A 1 274 ? 48.864 65.878  98.794  1.00 42.70  ? 274  ASN A OD1   1 
ATOM   1955 N  ND2   . ASN A 1 274 ? 50.057 66.723  97.077  1.00 39.90  ? 274  ASN A ND2   1 
ATOM   1956 N  N     . ASN A 1 275 ? 45.972 63.752  94.989  1.00 38.57  ? 275  ASN A N     1 
ATOM   1957 C  CA    . ASN A 1 275 ? 44.810 63.543  94.139  1.00 37.77  ? 275  ASN A CA    1 
ATOM   1958 C  C     . ASN A 1 275 ? 43.793 62.625  94.813  1.00 39.64  ? 275  ASN A C     1 
ATOM   1959 O  O     . ASN A 1 275 ? 42.597 62.927  94.821  1.00 41.74  ? 275  ASN A O     1 
ATOM   1960 C  CB    . ASN A 1 275 ? 45.258 62.989  92.775  1.00 39.08  ? 275  ASN A CB    1 
ATOM   1961 C  CG    . ASN A 1 275 ? 44.103 62.745  91.823  1.00 37.98  ? 275  ASN A CG    1 
ATOM   1962 O  OD1   . ASN A 1 275 ? 43.495 61.690  91.852  1.00 39.04  ? 275  ASN A OD1   1 
ATOM   1963 N  ND2   . ASN A 1 275 ? 43.804 63.719  90.976  1.00 37.57  ? 275  ASN A ND2   1 
ATOM   1964 N  N     . LYS A 1 276 ? 44.267 61.518  95.393  1.00 40.40  ? 276  LYS A N     1 
ATOM   1965 C  CA    . LYS A 1 276 ? 43.389 60.538  96.062  1.00 39.45  ? 276  LYS A CA    1 
ATOM   1966 C  C     . LYS A 1 276 ? 42.777 61.069  97.359  1.00 36.41  ? 276  LYS A C     1 
ATOM   1967 O  O     . LYS A 1 276 ? 41.625 60.786  97.659  1.00 32.02  ? 276  LYS A O     1 
ATOM   1968 C  CB    . LYS A 1 276 ? 44.144 59.245  96.352  1.00 43.01  ? 276  LYS A CB    1 
ATOM   1969 C  CG    . LYS A 1 276 ? 44.474 58.418  95.110  1.00 45.25  ? 276  LYS A CG    1 
ATOM   1970 C  CD    . LYS A 1 276 ? 45.118 57.072  95.479  1.00 47.21  ? 276  LYS A CD    1 
ATOM   1971 C  CE    . LYS A 1 276 ? 46.528 57.238  96.049  1.00 47.19  ? 276  LYS A CE    1 
ATOM   1972 N  NZ    . LYS A 1 276 ? 47.407 56.107  95.650  1.00 49.00  ? 276  LYS A NZ    1 
ATOM   1973 N  N     . ALA A 1 277 ? 43.532 61.858  98.115  1.00 35.96  ? 277  ALA A N     1 
ATOM   1974 C  CA    . ALA A 1 277 ? 42.979 62.538  99.307  1.00 38.85  ? 277  ALA A CA    1 
ATOM   1975 C  C     . ALA A 1 277 ? 41.810 63.503  98.983  1.00 39.86  ? 277  ALA A C     1 
ATOM   1976 O  O     . ALA A 1 277 ? 40.789 63.511  99.680  1.00 39.86  ? 277  ALA A O     1 
ATOM   1977 C  CB    . ALA A 1 277 ? 44.086 63.281  100.058 1.00 37.41  ? 277  ALA A CB    1 
ATOM   1978 N  N     . ILE A 1 278 ? 41.964 64.294  97.921  1.00 39.29  ? 278  ILE A N     1 
ATOM   1979 C  CA    . ILE A 1 278 ? 40.949 65.263  97.503  1.00 39.40  ? 278  ILE A CA    1 
ATOM   1980 C  C     . ILE A 1 278 ? 39.725 64.588  96.894  1.00 40.25  ? 278  ILE A C     1 
ATOM   1981 O  O     . ILE A 1 278 ? 38.593 64.974  97.173  1.00 41.44  ? 278  ILE A O     1 
ATOM   1982 C  CB    . ILE A 1 278 ? 41.548 66.253  96.455  1.00 40.31  ? 278  ILE A CB    1 
ATOM   1983 C  CG1   . ILE A 1 278 ? 42.634 67.126  97.095  1.00 41.84  ? 278  ILE A CG1   1 
ATOM   1984 C  CG2   . ILE A 1 278 ? 40.467 67.111  95.829  1.00 37.24  ? 278  ILE A CG2   1 
ATOM   1985 C  CD1   . ILE A 1 278 ? 43.785 67.466  96.143  1.00 42.94  ? 278  ILE A CD1   1 
ATOM   1986 N  N     . THR A 1 279 ? 39.948 63.603  96.028  1.00 41.29  ? 279  THR A N     1 
ATOM   1987 C  CA    . THR A 1 279 ? 38.825 62.910  95.380  1.00 41.16  ? 279  THR A CA    1 
ATOM   1988 C  C     . THR A 1 279 ? 38.183 61.873  96.277  1.00 40.31  ? 279  THR A C     1 
ATOM   1989 O  O     . THR A 1 279 ? 37.001 61.580  96.131  1.00 45.30  ? 279  THR A O     1 
ATOM   1990 C  CB    . THR A 1 279 ? 39.270 62.231  94.099  1.00 40.75  ? 279  THR A CB    1 
ATOM   1991 O  OG1   . THR A 1 279 ? 40.332 61.310  94.390  1.00 42.02  ? 279  THR A OG1   1 
ATOM   1992 C  CG2   . THR A 1 279 ? 39.847 63.254  93.115  1.00 38.98  ? 279  THR A CG2   1 
ATOM   1993 N  N     . GLY A 1 280 ? 38.956 61.338  97.215  1.00 39.12  ? 280  GLY A N     1 
ATOM   1994 C  CA    . GLY A 1 280 ? 38.517 60.237  98.054  1.00 38.84  ? 280  GLY A CA    1 
ATOM   1995 C  C     . GLY A 1 280 ? 38.576 58.900  97.329  1.00 38.92  ? 280  GLY A C     1 
ATOM   1996 O  O     . GLY A 1 280 ? 37.915 57.967  97.729  1.00 39.12  ? 280  GLY A O     1 
ATOM   1997 N  N     . SER A 1 281 ? 39.389 58.818  96.279  1.00 41.14  ? 281  SER A N     1 
ATOM   1998 C  CA    . SER A 1 281 ? 39.411 57.676  95.361  1.00 41.58  ? 281  SER A CA    1 
ATOM   1999 C  C     . SER A 1 281 ? 40.576 56.753  95.706  1.00 43.14  ? 281  SER A C     1 
ATOM   2000 O  O     . SER A 1 281 ? 41.639 57.227  96.117  1.00 45.48  ? 281  SER A O     1 
ATOM   2001 C  CB    . SER A 1 281 ? 39.564 58.182  93.915  1.00 38.31  ? 281  SER A CB    1 
ATOM   2002 O  OG    . SER A 1 281 ? 39.557 57.132  92.959  1.00 34.36  ? 281  SER A OG    1 
ATOM   2003 N  N     . SER A 1 282 ? 40.376 55.448  95.530  1.00 42.22  ? 282  SER A N     1 
ATOM   2004 C  CA    . SER A 1 282 ? 41.434 54.454  95.750  1.00 44.06  ? 282  SER A CA    1 
ATOM   2005 C  C     . SER A 1 282 ? 42.492 54.495  94.651  1.00 46.71  ? 282  SER A C     1 
ATOM   2006 O  O     . SER A 1 282 ? 43.605 54.034  94.858  1.00 49.53  ? 282  SER A O     1 
ATOM   2007 C  CB    . SER A 1 282 ? 40.853 53.034  95.820  1.00 43.74  ? 282  SER A CB    1 
ATOM   2008 O  OG    . SER A 1 282 ? 39.799 52.954  96.770  1.00 43.64  ? 282  SER A OG    1 
ATOM   2009 N  N     . VAL A 1 283 ? 42.128 55.009  93.475  1.00 48.49  ? 283  VAL A N     1 
ATOM   2010 C  CA    . VAL A 1 283 ? 43.077 55.220  92.390  1.00 47.59  ? 283  VAL A CA    1 
ATOM   2011 C  C     . VAL A 1 283 ? 43.066 56.687  91.924  1.00 46.33  ? 283  VAL A C     1 
ATOM   2012 O  O     . VAL A 1 283 ? 42.071 57.397  92.093  1.00 44.96  ? 283  VAL A O     1 
ATOM   2013 C  CB    . VAL A 1 283 ? 42.803 54.270  91.217  1.00 51.65  ? 283  VAL A CB    1 
ATOM   2014 C  CG1   . VAL A 1 283 ? 43.027 52.804  91.661  1.00 52.45  ? 283  VAL A CG1   1 
ATOM   2015 C  CG2   . VAL A 1 283 ? 41.394 54.455  90.666  1.00 50.97  ? 283  VAL A CG2   1 
ATOM   2016 N  N     . PRO A 1 284 ? 44.188 57.156  91.387  1.00 44.48  ? 284  PRO A N     1 
ATOM   2017 C  CA    . PRO A 1 284 ? 44.288 58.533  90.882  1.00 42.98  ? 284  PRO A CA    1 
ATOM   2018 C  C     . PRO A 1 284 ? 43.187 58.884  89.876  1.00 41.27  ? 284  PRO A C     1 
ATOM   2019 O  O     . PRO A 1 284 ? 42.906 58.092  88.977  1.00 39.05  ? 284  PRO A O     1 
ATOM   2020 C  CB    . PRO A 1 284 ? 45.657 58.551  90.199  1.00 44.18  ? 284  PRO A CB    1 
ATOM   2021 C  CG    . PRO A 1 284 ? 46.443 57.502  90.926  1.00 44.35  ? 284  PRO A CG    1 
ATOM   2022 C  CD    . PRO A 1 284 ? 45.460 56.418  91.241  1.00 44.57  ? 284  PRO A CD    1 
ATOM   2023 N  N     . VAL A 1 285 ? 42.561 60.048  90.043  1.00 37.55  ? 285  VAL A N     1 
ATOM   2024 C  CA    . VAL A 1 285 ? 41.481 60.456  89.166  1.00 34.61  ? 285  VAL A CA    1 
ATOM   2025 C  C     . VAL A 1 285 ? 42.005 61.348  88.065  1.00 34.10  ? 285  VAL A C     1 
ATOM   2026 O  O     . VAL A 1 285 ? 42.468 62.461  88.336  1.00 37.59  ? 285  VAL A O     1 
ATOM   2027 C  CB    . VAL A 1 285 ? 40.382 61.193  89.922  1.00 34.28  ? 285  VAL A CB    1 
ATOM   2028 C  CG1   . VAL A 1 285 ? 39.218 61.495  88.983  1.00 33.50  ? 285  VAL A CG1   1 
ATOM   2029 C  CG2   . VAL A 1 285 ? 39.893 60.371  91.136  1.00 32.35  ? 285  VAL A CG2   1 
ATOM   2030 N  N     . SER A 1 286 ? 41.905 60.869  86.825  1.00 30.62  ? 286  SER A N     1 
ATOM   2031 C  CA    . SER A 1 286 ? 42.254 61.663  85.652  1.00 31.52  ? 286  SER A CA    1 
ATOM   2032 C  C     . SER A 1 286 ? 41.286 62.838  85.486  1.00 29.88  ? 286  SER A C     1 
ATOM   2033 O  O     . SER A 1 286 ? 40.109 62.733  85.843  1.00 30.95  ? 286  SER A O     1 
ATOM   2034 C  CB    . SER A 1 286 ? 42.209 60.799  84.385  1.00 33.41  ? 286  SER A CB    1 
ATOM   2035 O  OG    . SER A 1 286 ? 43.120 59.712  84.441  1.00 33.33  ? 286  SER A OG    1 
ATOM   2036 N  N     . PRO A 1 287 ? 41.753 63.952  84.945  1.00 29.96  ? 287  PRO A N     1 
ATOM   2037 C  CA    . PRO A 1 287 ? 40.846 65.067  84.635  1.00 31.49  ? 287  PRO A CA    1 
ATOM   2038 C  C     . PRO A 1 287 ? 40.085 64.788  83.344  1.00 31.18  ? 287  PRO A C     1 
ATOM   2039 O  O     . PRO A 1 287 ? 40.707 64.301  82.402  1.00 32.83  ? 287  PRO A O     1 
ATOM   2040 C  CB    . PRO A 1 287 ? 41.795 66.267  84.450  1.00 30.98  ? 287  PRO A CB    1 
ATOM   2041 C  CG    . PRO A 1 287 ? 43.135 65.665  84.044  1.00 30.94  ? 287  PRO A CG    1 
ATOM   2042 C  CD    . PRO A 1 287 ? 43.148 64.246  84.564  1.00 31.62  ? 287  PRO A CD    1 
ATOM   2043 N  N     . MET A 1 288 ? 38.779 65.057  83.323  1.00 31.35  ? 288  MET A N     1 
ATOM   2044 C  CA    . MET A 1 288 ? 37.982 65.099  82.098  1.00 30.70  ? 288  MET A CA    1 
ATOM   2045 C  C     . MET A 1 288 ? 38.208 66.451  81.400  1.00 34.68  ? 288  MET A C     1 
ATOM   2046 O  O     . MET A 1 288 ? 38.075 67.517  82.017  1.00 34.07  ? 288  MET A O     1 
ATOM   2047 C  CB    . MET A 1 288 ? 36.502 64.956  82.441  1.00 32.70  ? 288  MET A CB    1 
ATOM   2048 C  CG    . MET A 1 288 ? 36.153 63.757  83.274  1.00 30.37  ? 288  MET A CG    1 
ATOM   2049 S  SD    . MET A 1 288 ? 34.442 63.702  83.769  1.00 32.72  ? 288  MET A SD    1 
ATOM   2050 C  CE    . MET A 1 288 ? 34.382 65.205  84.944  1.00 32.18  ? 288  MET A CE    1 
ATOM   2051 N  N     . GLY A 1 289 ? 38.557 66.413  80.117  1.00 38.11  ? 289  GLY A N     1 
ATOM   2052 C  CA    . GLY A 1 289 ? 39.008 67.601  79.417  1.00 37.19  ? 289  GLY A CA    1 
ATOM   2053 C  C     . GLY A 1 289 ? 40.250 68.164  80.083  1.00 40.39  ? 289  GLY A C     1 
ATOM   2054 O  O     . GLY A 1 289 ? 41.129 67.402  80.497  1.00 40.88  ? 289  GLY A O     1 
ATOM   2055 N  N     . CYS A 1 290 ? 40.290 69.490  80.234  1.00 42.32  ? 290  CYS A N     1 
ATOM   2056 C  CA    . CYS A 1 290 ? 41.425 70.191  80.832  1.00 41.63  ? 290  CYS A CA    1 
ATOM   2057 C  C     . CYS A 1 290 ? 41.658 69.860  82.307  1.00 38.53  ? 290  CYS A C     1 
ATOM   2058 O  O     . CYS A 1 290 ? 42.762 69.454  82.676  1.00 39.40  ? 290  CYS A O     1 
ATOM   2059 C  CB    . CYS A 1 290 ? 41.263 71.709  80.695  1.00 44.43  ? 290  CYS A CB    1 
ATOM   2060 S  SG    . CYS A 1 290 ? 41.674 72.372  79.080  1.00 49.61  ? 290  CYS A SG    1 
ATOM   2061 N  N     . ARG A 1 291 ? 40.655 70.070  83.153  1.00 34.90  ? 291  ARG A N     1 
ATOM   2062 C  CA    . ARG A 1 291 ? 40.834 69.817  84.585  1.00 34.53  ? 291  ARG A CA    1 
ATOM   2063 C  C     . ARG A 1 291 ? 39.572 69.658  85.407  1.00 31.85  ? 291  ARG A C     1 
ATOM   2064 O  O     . ARG A 1 291 ? 39.529 70.123  86.535  1.00 36.27  ? 291  ARG A O     1 
ATOM   2065 C  CB    . ARG A 1 291 ? 41.670 70.935  85.221  1.00 38.04  ? 291  ARG A CB    1 
ATOM   2066 C  CG    . ARG A 1 291 ? 41.166 72.367  84.983  1.00 37.29  ? 291  ARG A CG    1 
ATOM   2067 C  CD    . ARG A 1 291 ? 42.024 73.070  83.993  1.00 39.26  ? 291  ARG A CD    1 
ATOM   2068 N  NE    . ARG A 1 291 ? 42.255 74.465  84.293  1.00 39.74  ? 291  ARG A NE    1 
ATOM   2069 C  CZ    . ARG A 1 291 ? 43.138 75.219  83.638  1.00 40.16  ? 291  ARG A CZ    1 
ATOM   2070 N  NH1   . ARG A 1 291 ? 43.895 74.704  82.654  1.00 35.83  ? 291  ARG A NH1   1 
ATOM   2071 N  NH2   . ARG A 1 291 ? 43.271 76.498  83.972  1.00 40.60  ? 291  ARG A NH2   1 
ATOM   2072 N  N     . SER A 1 292 ? 38.554 69.007  84.862  1.00 28.98  ? 292  SER A N     1 
ATOM   2073 C  CA    . SER A 1 292 ? 37.355 68.686  85.617  1.00 25.60  ? 292  SER A CA    1 
ATOM   2074 C  C     . SER A 1 292 ? 37.570 67.315  86.331  1.00 30.18  ? 292  SER A C     1 
ATOM   2075 O  O     . SER A 1 292 ? 37.838 66.285  85.687  1.00 28.94  ? 292  SER A O     1 
ATOM   2076 C  CB    . SER A 1 292 ? 36.166 68.655  84.662  1.00 24.63  ? 292  SER A CB    1 
ATOM   2077 O  OG    . SER A 1 292 ? 34.931 68.567  85.353  1.00 27.32  ? 292  SER A OG    1 
ATOM   2078 N  N     . PHE A 1 293 ? 37.487 67.324  87.661  1.00 30.42  ? 293  PHE A N     1 
ATOM   2079 C  CA    . PHE A 1 293 ? 37.718 66.144  88.483  1.00 29.58  ? 293  PHE A CA    1 
ATOM   2080 C  C     . PHE A 1 293 ? 36.417 65.674  89.087  1.00 30.63  ? 293  PHE A C     1 
ATOM   2081 O  O     . PHE A 1 293 ? 35.666 66.466  89.693  1.00 27.91  ? 293  PHE A O     1 
ATOM   2082 C  CB    . PHE A 1 293 ? 38.690 66.449  89.625  1.00 30.40  ? 293  PHE A CB    1 
ATOM   2083 C  CG    . PHE A 1 293 ? 40.108 66.629  89.182  1.00 29.97  ? 293  PHE A CG    1 
ATOM   2084 C  CD1   . PHE A 1 293 ? 40.702 67.889  89.203  1.00 27.35  ? 293  PHE A CD1   1 
ATOM   2085 C  CD2   . PHE A 1 293 ? 40.853 65.540  88.760  1.00 29.56  ? 293  PHE A CD2   1 
ATOM   2086 C  CE1   . PHE A 1 293 ? 42.013 68.059  88.792  1.00 28.32  ? 293  PHE A CE1   1 
ATOM   2087 C  CE2   . PHE A 1 293 ? 42.178 65.699  88.347  1.00 30.12  ? 293  PHE A CE2   1 
ATOM   2088 C  CZ    . PHE A 1 293 ? 42.753 66.971  88.354  1.00 29.60  ? 293  PHE A CZ    1 
ATOM   2089 N  N     . LEU A 1 294 ? 36.166 64.380  88.919  1.00 29.72  ? 294  LEU A N     1 
ATOM   2090 C  CA    . LEU A 1 294 ? 35.088 63.672  89.601  1.00 31.71  ? 294  LEU A CA    1 
ATOM   2091 C  C     . LEU A 1 294 ? 35.509 63.517  91.034  1.00 28.92  ? 294  LEU A C     1 
ATOM   2092 O  O     . LEU A 1 294 ? 36.712 63.501  91.294  1.00 29.28  ? 294  LEU A O     1 
ATOM   2093 C  CB    . LEU A 1 294 ? 34.933 62.255  89.002  1.00 32.36  ? 294  LEU A CB    1 
ATOM   2094 C  CG    . LEU A 1 294 ? 34.500 62.184  87.546  1.00 31.64  ? 294  LEU A CG    1 
ATOM   2095 C  CD1   . LEU A 1 294 ? 34.852 60.834  86.952  1.00 31.47  ? 294  LEU A CD1   1 
ATOM   2096 C  CD2   . LEU A 1 294 ? 32.994 62.462  87.437  1.00 32.62  ? 294  LEU A CD2   1 
ATOM   2097 N  N     . SER A 1 295 ? 34.557 63.396  91.961  1.00 29.59  ? 295  SER A N     1 
ATOM   2098 C  CA    . SER A 1 295 ? 34.881 62.779  93.263  1.00 35.38  ? 295  SER A CA    1 
ATOM   2099 C  C     . SER A 1 295 ? 34.407 61.318  93.321  1.00 35.36  ? 295  SER A C     1 
ATOM   2100 O  O     . SER A 1 295 ? 33.721 60.838  92.431  1.00 35.67  ? 295  SER A O     1 
ATOM   2101 C  CB    . SER A 1 295 ? 34.389 63.601  94.467  1.00 36.99  ? 295  SER A CB    1 
ATOM   2102 O  OG    . SER A 1 295 ? 33.074 63.250  94.855  1.00 44.13  ? 295  SER A OG    1 
ATOM   2103 N  N     . VAL A 1 296 ? 34.820 60.613  94.367  1.00 37.02  ? 296  VAL A N     1 
ATOM   2104 C  CA    . VAL A 1 296 ? 34.590 59.187  94.480  1.00 36.32  ? 296  VAL A CA    1 
ATOM   2105 C  C     . VAL A 1 296 ? 33.098 58.875  94.448  1.00 36.35  ? 296  VAL A C     1 
ATOM   2106 O  O     . VAL A 1 296 ? 32.276 59.611  95.020  1.00 35.82  ? 296  VAL A O     1 
ATOM   2107 C  CB    . VAL A 1 296 ? 35.258 58.621  95.765  1.00 40.58  ? 296  VAL A CB    1 
ATOM   2108 C  CG1   . VAL A 1 296 ? 34.550 59.129  97.028  1.00 40.73  ? 296  VAL A CG1   1 
ATOM   2109 C  CG2   . VAL A 1 296 ? 35.310 57.078  95.726  1.00 40.01  ? 296  VAL A CG2   1 
ATOM   2110 N  N     . TRP A 1 297 ? 32.754 57.797  93.739  1.00 34.43  ? 297  TRP A N     1 
ATOM   2111 C  CA    . TRP A 1 297 ? 31.372 57.332  93.631  1.00 30.72  ? 297  TRP A CA    1 
ATOM   2112 C  C     . TRP A 1 297 ? 31.341 55.818  93.483  1.00 34.21  ? 297  TRP A C     1 
ATOM   2113 O  O     . TRP A 1 297 ? 32.190 55.219  92.813  1.00 30.86  ? 297  TRP A O     1 
ATOM   2114 C  CB    . TRP A 1 297 ? 30.711 57.956  92.409  1.00 28.90  ? 297  TRP A CB    1 
ATOM   2115 C  CG    . TRP A 1 297 ? 29.272 57.606  92.191  1.00 24.67  ? 297  TRP A CG    1 
ATOM   2116 C  CD1   . TRP A 1 297 ? 28.203 58.213  92.737  1.00 23.84  ? 297  TRP A CD1   1 
ATOM   2117 C  CD2   . TRP A 1 297 ? 28.748 56.574  91.327  1.00 25.68  ? 297  TRP A CD2   1 
ATOM   2118 N  NE1   . TRP A 1 297 ? 27.038 57.638  92.278  1.00 26.86  ? 297  TRP A NE1   1 
ATOM   2119 C  CE2   . TRP A 1 297 ? 27.345 56.630  91.409  1.00 25.43  ? 297  TRP A CE2   1 
ATOM   2120 C  CE3   . TRP A 1 297 ? 29.327 55.601  90.504  1.00 23.86  ? 297  TRP A CE3   1 
ATOM   2121 C  CZ2   . TRP A 1 297 ? 26.512 55.753  90.713  1.00 25.44  ? 297  TRP A CZ2   1 
ATOM   2122 C  CZ3   . TRP A 1 297 ? 28.503 54.751  89.788  1.00 23.23  ? 297  TRP A CZ3   1 
ATOM   2123 C  CH2   . TRP A 1 297 ? 27.102 54.836  89.898  1.00 24.90  ? 297  TRP A CH2   1 
ATOM   2124 N  N     . LYS A 1 298 ? 30.327 55.211  94.086  1.00 35.21  ? 298  LYS A N     1 
ATOM   2125 C  CA    . LYS A 1 298 ? 30.213 53.775  94.129  1.00 36.00  ? 298  LYS A CA    1 
ATOM   2126 C  C     . LYS A 1 298 ? 28.905 53.363  93.502  1.00 36.01  ? 298  LYS A C     1 
ATOM   2127 O  O     . LYS A 1 298 ? 27.858 53.985  93.775  1.00 29.31  ? 298  LYS A O     1 
ATOM   2128 C  CB    . LYS A 1 298 ? 30.289 53.273  95.573  1.00 38.07  ? 298  LYS A CB    1 
ATOM   2129 C  CG    . LYS A 1 298 ? 31.701 53.208  96.108  1.00 41.54  ? 298  LYS A CG    1 
ATOM   2130 C  CD    . LYS A 1 298 ? 31.760 52.679  97.541  1.00 43.81  ? 298  LYS A CD    1 
ATOM   2131 C  CE    . LYS A 1 298 ? 33.192 52.763  98.098  1.00 45.06  ? 298  LYS A CE    1 
ATOM   2132 N  NZ    . LYS A 1 298 ? 33.238 52.488  99.565  1.00 47.21  ? 298  LYS A NZ    1 
ATOM   2133 N  N     . ASP A 1 299 ? 28.960 52.307  92.676  1.00 31.10  ? 299  ASP A N     1 
ATOM   2134 C  CA    . ASP A 1 299 ? 27.750 51.782  92.095  1.00 34.94  ? 299  ASP A CA    1 
ATOM   2135 C  C     . ASP A 1 299 ? 26.920 51.020  93.169  1.00 34.92  ? 299  ASP A C     1 
ATOM   2136 O  O     . ASP A 1 299 ? 27.246 51.047  94.351  1.00 32.90  ? 299  ASP A O     1 
ATOM   2137 C  CB    . ASP A 1 299 ? 28.072 50.965  90.835  1.00 37.64  ? 299  ASP A CB    1 
ATOM   2138 C  CG    . ASP A 1 299 ? 28.725 49.634  91.133  1.00 38.18  ? 299  ASP A CG    1 
ATOM   2139 O  OD1   . ASP A 1 299 ? 28.621 49.157  92.280  1.00 39.34  ? 299  ASP A OD1   1 
ATOM   2140 O  OD2   . ASP A 1 299 ? 29.375 49.005  90.271  1.00 38.01  ? 299  ASP A OD2   1 
ATOM   2141 N  N     . SER A 1 300 ? 25.849 50.366  92.742  1.00 36.00  ? 300  SER A N     1 
ATOM   2142 C  CA    . SER A 1 300 ? 24.882 49.751  93.639  1.00 37.26  ? 300  SER A CA    1 
ATOM   2143 C  C     . SER A 1 300 ? 25.459 48.549  94.417  1.00 36.72  ? 300  SER A C     1 
ATOM   2144 O  O     . SER A 1 300 ? 24.886 48.136  95.407  1.00 38.04  ? 300  SER A O     1 
ATOM   2145 C  CB    . SER A 1 300 ? 23.664 49.297  92.832  1.00 37.35  ? 300  SER A CB    1 
ATOM   2146 O  OG    . SER A 1 300 ? 24.014 48.215  91.959  1.00 37.86  ? 300  SER A OG    1 
ATOM   2147 N  N     . THR A 1 301 ? 26.578 47.994  93.958  1.00 34.31  ? 301  THR A N     1 
ATOM   2148 C  CA    . THR A 1 301 ? 27.269 46.926  94.679  1.00 34.07  ? 301  THR A CA    1 
ATOM   2149 C  C     . THR A 1 301 ? 28.599 47.355  95.321  1.00 34.66  ? 301  THR A C     1 
ATOM   2150 O  O     . THR A 1 301 ? 29.439 46.508  95.634  1.00 35.18  ? 301  THR A O     1 
ATOM   2151 C  CB    . THR A 1 301 ? 27.484 45.698  93.759  1.00 33.78  ? 301  THR A CB    1 
ATOM   2152 O  OG1   . THR A 1 301 ? 28.037 46.090  92.502  1.00 33.81  ? 301  THR A OG1   1 
ATOM   2153 C  CG2   . THR A 1 301 ? 26.158 45.081  93.384  1.00 35.60  ? 301  THR A CG2   1 
ATOM   2154 N  N     . GLY A 1 302 ? 28.782 48.663  95.533  1.00 32.43  ? 302  GLY A N     1 
ATOM   2155 C  CA    . GLY A 1 302 ? 29.930 49.176  96.256  1.00 30.49  ? 302  GLY A CA    1 
ATOM   2156 C  C     . GLY A 1 302 ? 31.251 49.285  95.515  1.00 34.93  ? 302  GLY A C     1 
ATOM   2157 O  O     . GLY A 1 302 ? 32.289 49.477  96.154  1.00 35.50  ? 302  GLY A O     1 
ATOM   2158 N  N     . ASN A 1 303 ? 31.236 49.183  94.184  1.00 37.91  ? 303  ASN A N     1 
ATOM   2159 C  CA    . ASN A 1 303 ? 32.462 49.315  93.393  1.00 36.67  ? 303  ASN A CA    1 
ATOM   2160 C  C     . ASN A 1 303 ? 32.749 50.760  93.033  1.00 36.74  ? 303  ASN A C     1 
ATOM   2161 O  O     . ASN A 1 303 ? 31.856 51.532  92.726  1.00 34.73  ? 303  ASN A O     1 
ATOM   2162 C  CB    . ASN A 1 303 ? 32.367 48.474  92.125  1.00 39.72  ? 303  ASN A CB    1 
ATOM   2163 C  CG    . ASN A 1 303 ? 32.359 46.971  92.426  1.00 39.88  ? 303  ASN A CG    1 
ATOM   2164 O  OD1   . ASN A 1 303 ? 31.304 46.332  92.479  1.00 39.81  ? 303  ASN A OD1   1 
ATOM   2165 N  ND2   . ASN A 1 303 ? 33.530 46.422  92.655  1.00 38.59  ? 303  ASN A ND2   1 
ATOM   2166 N  N     . GLU A 1 304 ? 34.011 51.136  93.076  1.00 39.00  ? 304  GLU A N     1 
ATOM   2167 C  CA    . GLU A 1 304 ? 34.368 52.511  92.808  1.00 39.41  ? 304  GLU A CA    1 
ATOM   2168 C  C     . GLU A 1 304 ? 34.455 52.645  91.302  1.00 37.80  ? 304  GLU A C     1 
ATOM   2169 O  O     . GLU A 1 304 ? 35.189 51.900  90.654  1.00 41.25  ? 304  GLU A O     1 
ATOM   2170 C  CB    . GLU A 1 304 ? 35.684 52.871  93.484  1.00 41.77  ? 304  GLU A CB    1 
ATOM   2171 C  CG    . GLU A 1 304 ? 35.534 53.140  94.971  1.00 45.96  ? 304  GLU A CG    1 
ATOM   2172 C  CD    . GLU A 1 304 ? 36.836 53.569  95.625  1.00 49.37  ? 304  GLU A CD    1 
ATOM   2173 O  OE1   . GLU A 1 304 ? 37.740 54.034  94.903  1.00 52.18  ? 304  GLU A OE1   1 
ATOM   2174 O  OE2   . GLU A 1 304 ? 36.962 53.435  96.864  1.00 53.07  ? 304  GLU A OE2   1 
ATOM   2175 N  N     . ILE A 1 305 ? 33.674 53.565  90.752  1.00 34.56  ? 305  ILE A N     1 
ATOM   2176 C  CA    . ILE A 1 305 ? 33.619 53.779  89.312  1.00 33.12  ? 305  ILE A CA    1 
ATOM   2177 C  C     . ILE A 1 305 ? 34.189 55.138  88.935  1.00 34.05  ? 305  ILE A C     1 
ATOM   2178 O  O     . ILE A 1 305 ? 33.888 56.168  89.566  1.00 27.74  ? 305  ILE A O     1 
ATOM   2179 C  CB    . ILE A 1 305 ? 32.173 53.653  88.781  1.00 29.37  ? 305  ILE A CB    1 
ATOM   2180 C  CG1   . ILE A 1 305 ? 31.571 52.275  89.148  1.00 27.02  ? 305  ILE A CG1   1 
ATOM   2181 C  CG2   . ILE A 1 305 ? 32.161 53.825  87.266  1.00 27.60  ? 305  ILE A CG2   1 
ATOM   2182 C  CD1   . ILE A 1 305 ? 32.247 51.054  88.445  1.00 21.89  ? 305  ILE A CD1   1 
ATOM   2183 N  N     . LEU A 1 306 ? 35.011 55.105  87.890  1.00 33.41  ? 306  LEU A N     1 
ATOM   2184 C  CA    . LEU A 1 306 ? 35.669 56.274  87.348  1.00 32.18  ? 306  LEU A CA    1 
ATOM   2185 C  C     . LEU A 1 306 ? 35.290 56.365  85.869  1.00 34.37  ? 306  LEU A C     1 
ATOM   2186 O  O     . LEU A 1 306 ? 34.545 57.254  85.453  1.00 32.10  ? 306  LEU A O     1 
ATOM   2187 C  CB    . LEU A 1 306 ? 37.179 56.133  87.537  1.00 32.28  ? 306  LEU A CB    1 
ATOM   2188 C  CG    . LEU A 1 306 ? 37.828 57.063  88.571  1.00 35.61  ? 306  LEU A CG    1 
ATOM   2189 C  CD1   . LEU A 1 306 ? 36.990 57.196  89.798  1.00 37.30  ? 306  LEU A CD1   1 
ATOM   2190 C  CD2   . LEU A 1 306 ? 39.243 56.617  88.943  1.00 36.18  ? 306  LEU A CD2   1 
ATOM   2191 N  N     . ASP A 1 307 ? 35.777 55.404  85.090  1.00 34.01  ? 307  ASP A N     1 
ATOM   2192 C  CA    . ASP A 1 307 ? 35.545 55.359  83.658  1.00 33.87  ? 307  ASP A CA    1 
ATOM   2193 C  C     . ASP A 1 307 ? 34.039 55.266  83.257  1.00 34.50  ? 307  ASP A C     1 
ATOM   2194 O  O     . ASP A 1 307 ? 33.260 54.494  83.812  1.00 31.90  ? 307  ASP A O     1 
ATOM   2195 C  CB    . ASP A 1 307 ? 36.398 54.250  83.052  1.00 35.11  ? 307  ASP A CB    1 
ATOM   2196 C  CG    . ASP A 1 307 ? 37.914 54.477  83.285  1.00 40.50  ? 307  ASP A CG    1 
ATOM   2197 O  OD1   . ASP A 1 307 ? 38.362 55.658  83.338  1.00 40.39  ? 307  ASP A OD1   1 
ATOM   2198 O  OD2   . ASP A 1 307 ? 38.728 53.535  83.443  1.00 40.68  ? 307  ASP A OD2   1 
ATOM   2199 N  N     . GLY A 1 308 ? 33.643 56.112  82.312  1.00 32.96  ? 308  GLY A N     1 
ATOM   2200 C  CA    . GLY A 1 308 ? 32.269 56.211  81.878  1.00 33.58  ? 308  GLY A CA    1 
ATOM   2201 C  C     . GLY A 1 308 ? 31.555 57.423  82.441  1.00 33.68  ? 308  GLY A C     1 
ATOM   2202 O  O     . GLY A 1 308 ? 30.510 57.818  81.920  1.00 37.90  ? 308  GLY A O     1 
ATOM   2203 N  N     . ARG A 1 309 ? 32.092 58.010  83.503  1.00 29.66  ? 309  ARG A N     1 
ATOM   2204 C  CA    . ARG A 1 309 ? 31.387 59.091  84.194  1.00 32.41  ? 309  ARG A CA    1 
ATOM   2205 C  C     . ARG A 1 309 ? 31.635 60.442  83.492  1.00 30.78  ? 309  ARG A C     1 
ATOM   2206 O  O     . ARG A 1 309 ? 32.641 60.612  82.775  1.00 28.70  ? 309  ARG A O     1 
ATOM   2207 C  CB    . ARG A 1 309 ? 31.784 59.151  85.669  1.00 34.14  ? 309  ARG A CB    1 
ATOM   2208 C  CG    . ARG A 1 309 ? 31.343 57.914  86.480  1.00 34.74  ? 309  ARG A CG    1 
ATOM   2209 C  CD    . ARG A 1 309 ? 31.871 57.879  87.917  1.00 34.92  ? 309  ARG A CD    1 
ATOM   2210 N  NE    . ARG A 1 309 ? 31.400 59.000  88.725  1.00 32.59  ? 309  ARG A NE    1 
ATOM   2211 C  CZ    . ARG A 1 309 ? 32.073 59.548  89.741  1.00 33.61  ? 309  ARG A CZ    1 
ATOM   2212 N  NH1   . ARG A 1 309 ? 33.237 59.060  90.140  1.00 33.56  ? 309  ARG A NH1   1 
ATOM   2213 N  NH2   . ARG A 1 309 ? 31.555 60.589  90.390  1.00 35.04  ? 309  ARG A NH2   1 
ATOM   2214 N  N     . ASN A 1 310 ? 30.711 61.380  83.678  1.00 26.94  ? 310  ASN A N     1 
ATOM   2215 C  CA    . ASN A 1 310 ? 30.782 62.655  82.960  1.00 30.67  ? 310  ASN A CA    1 
ATOM   2216 C  C     . ASN A 1 310 ? 30.406 63.894  83.779  1.00 28.64  ? 310  ASN A C     1 
ATOM   2217 O  O     . ASN A 1 310 ? 30.114 63.794  84.969  1.00 26.53  ? 310  ASN A O     1 
ATOM   2218 C  CB    . ASN A 1 310 ? 29.948 62.569  81.668  1.00 30.67  ? 310  ASN A CB    1 
ATOM   2219 C  CG    . ASN A 1 310 ? 28.479 62.467  81.924  1.00 32.36  ? 310  ASN A CG    1 
ATOM   2220 O  OD1   . ASN A 1 310 ? 28.055 62.149  83.018  1.00 36.64  ? 310  ASN A OD1   1 
ATOM   2221 N  ND2   . ASN A 1 310 ? 27.679 62.726  80.898  1.00 36.05  ? 310  ASN A ND2   1 
ATOM   2222 N  N     . ASN A 1 311 ? 30.447 65.048  83.111  1.00 28.61  ? 311  ASN A N     1 
ATOM   2223 C  CA    . ASN A 1 311 ? 30.043 66.346  83.648  1.00 28.98  ? 311  ASN A CA    1 
ATOM   2224 C  C     . ASN A 1 311 ? 28.951 66.927  82.763  1.00 30.33  ? 311  ASN A C     1 
ATOM   2225 O  O     . ASN A 1 311 ? 29.003 66.799  81.539  1.00 27.77  ? 311  ASN A O     1 
ATOM   2226 C  CB    . ASN A 1 311 ? 31.231 67.285  83.679  1.00 30.90  ? 311  ASN A CB    1 
ATOM   2227 C  CG    . ASN A 1 311 ? 30.896 68.668  84.248  1.00 33.58  ? 311  ASN A CG    1 
ATOM   2228 O  OD1   . ASN A 1 311 ? 31.000 68.904  85.465  1.00 31.60  ? 311  ASN A OD1   1 
ATOM   2229 N  ND2   . ASN A 1 311 ? 30.563 69.607  83.358  1.00 31.51  ? 311  ASN A ND2   1 
ATOM   2230 N  N     . LEU A 1 312 ? 27.975 67.569  83.401  1.00 29.51  ? 312  LEU A N     1 
ATOM   2231 C  CA    . LEU A 1 312 ? 26.730 67.994  82.780  1.00 29.97  ? 312  LEU A CA    1 
ATOM   2232 C  C     . LEU A 1 312 ? 26.776 69.471  82.334  1.00 31.99  ? 312  LEU A C     1 
ATOM   2233 O  O     . LEU A 1 312 ? 25.856 69.961  81.673  1.00 32.25  ? 312  LEU A O     1 
ATOM   2234 C  CB    . LEU A 1 312 ? 25.600 67.826  83.791  1.00 32.36  ? 312  LEU A CB    1 
ATOM   2235 C  CG    . LEU A 1 312 ? 24.792 66.531  83.792  1.00 34.65  ? 312  LEU A CG    1 
ATOM   2236 C  CD1   . LEU A 1 312 ? 25.651 65.315  83.534  1.00 36.61  ? 312  LEU A CD1   1 
ATOM   2237 C  CD2   . LEU A 1 312 ? 24.005 66.401  85.070  1.00 31.58  ? 312  LEU A CD2   1 
ATOM   2238 N  N     . GLY A 1 313 ? 27.820 70.189  82.721  1.00 29.27  ? 313  GLY A N     1 
ATOM   2239 C  CA    . GLY A 1 313 ? 27.930 71.584  82.332  1.00 33.75  ? 313  GLY A CA    1 
ATOM   2240 C  C     . GLY A 1 313 ? 28.545 72.545  83.338  1.00 31.97  ? 313  GLY A C     1 
ATOM   2241 O  O     . GLY A 1 313 ? 28.757 72.236  84.515  1.00 29.62  ? 313  GLY A O     1 
ATOM   2242 N  N     . VAL A 1 314 ? 28.825 73.737  82.845  1.00 31.34  ? 314  VAL A N     1 
ATOM   2243 C  CA    . VAL A 1 314 ? 29.525 74.745  83.629  1.00 32.83  ? 314  VAL A CA    1 
ATOM   2244 C  C     . VAL A 1 314 ? 28.747 76.035  83.556  1.00 32.50  ? 314  VAL A C     1 
ATOM   2245 O  O     . VAL A 1 314 ? 28.300 76.447  82.487  1.00 32.21  ? 314  VAL A O     1 
ATOM   2246 C  CB    . VAL A 1 314 ? 30.983 74.992  83.123  1.00 30.04  ? 314  VAL A CB    1 
ATOM   2247 C  CG1   . VAL A 1 314 ? 31.754 75.892  84.080  1.00 29.72  ? 314  VAL A CG1   1 
ATOM   2248 C  CG2   . VAL A 1 314 ? 31.707 73.689  82.953  1.00 27.94  ? 314  VAL A CG2   1 
ATOM   2249 N  N     . VAL A 1 315 ? 28.552 76.630  84.723  1.00 33.82  ? 315  VAL A N     1 
ATOM   2250 C  CA    . VAL A 1 315 ? 28.161 78.024  84.837  1.00 30.78  ? 315  VAL A CA    1 
ATOM   2251 C  C     . VAL A 1 315 ? 29.178 78.678  85.735  1.00 28.85  ? 315  VAL A C     1 
ATOM   2252 O  O     . VAL A 1 315 ? 29.490 78.130  86.785  1.00 27.14  ? 315  VAL A O     1 
ATOM   2253 C  CB    . VAL A 1 315 ? 26.784 78.180  85.445  1.00 29.97  ? 315  VAL A CB    1 
ATOM   2254 C  CG1   . VAL A 1 315 ? 26.524 79.663  85.801  1.00 35.07  ? 315  VAL A CG1   1 
ATOM   2255 C  CG2   . VAL A 1 315 ? 25.743 77.673  84.461  1.00 26.82  ? 315  VAL A CG2   1 
ATOM   2256 N  N     . THR A 1 316 ? 29.661 79.852  85.328  1.00 26.65  ? 316  THR A N     1 
ATOM   2257 C  CA    . THR A 1 316 ? 30.769 80.515  85.983  1.00 28.13  ? 316  THR A CA    1 
ATOM   2258 C  C     . THR A 1 316 ? 30.367 81.874  86.576  1.00 27.33  ? 316  THR A C     1 
ATOM   2259 O  O     . THR A 1 316 ? 29.727 82.690  85.920  1.00 26.47  ? 316  THR A O     1 
ATOM   2260 C  CB    . THR A 1 316 ? 31.966 80.662  84.993  1.00 29.23  ? 316  THR A CB    1 
ATOM   2261 O  OG1   . THR A 1 316 ? 32.626 79.389  84.817  1.00 29.46  ? 316  THR A OG1   1 
ATOM   2262 C  CG2   . THR A 1 316 ? 33.058 81.537  85.578  1.00 28.10  ? 316  THR A CG2   1 
ATOM   2263 N  N     . LEU A 1 317 ? 30.782 82.092  87.824  1.00 28.83  ? 317  LEU A N     1 
ATOM   2264 C  CA    . LEU A 1 317 ? 30.407 83.249  88.623  1.00 30.24  ? 317  LEU A CA    1 
ATOM   2265 C  C     . LEU A 1 317 ? 31.515 84.265  88.500  1.00 31.52  ? 317  LEU A C     1 
ATOM   2266 O  O     . LEU A 1 317 ? 32.676 83.963  88.831  1.00 31.17  ? 317  LEU A O     1 
ATOM   2267 C  CB    . LEU A 1 317 ? 30.242 82.871  90.101  1.00 32.40  ? 317  LEU A CB    1 
ATOM   2268 C  CG    . LEU A 1 317 ? 29.124 83.504  90.953  1.00 35.48  ? 317  LEU A CG    1 
ATOM   2269 C  CD1   . LEU A 1 317 ? 29.572 83.603  92.416  1.00 35.58  ? 317  LEU A CD1   1 
ATOM   2270 C  CD2   . LEU A 1 317 ? 28.610 84.880  90.472  1.00 33.47  ? 317  LEU A CD2   1 
ATOM   2271 N  N     . ASN A 1 318 ? 31.153 85.453  88.002  1.00 30.33  ? 318  ASN A N     1 
ATOM   2272 C  CA    . ASN A 1 318 ? 32.057 86.596  87.922  1.00 31.10  ? 318  ASN A CA    1 
ATOM   2273 C  C     . ASN A 1 318 ? 32.237 87.165  89.326  1.00 30.57  ? 318  ASN A C     1 
ATOM   2274 O  O     . ASN A 1 318 ? 31.410 87.953  89.788  1.00 29.83  ? 318  ASN A O     1 
ATOM   2275 C  CB    . ASN A 1 318 ? 31.467 87.663  86.974  1.00 31.98  ? 318  ASN A CB    1 
ATOM   2276 C  CG    . ASN A 1 318 ? 32.439 88.796  86.672  1.00 31.02  ? 318  ASN A CG    1 
ATOM   2277 O  OD1   . ASN A 1 318 ? 33.474 88.930  87.315  1.00 30.66  ? 318  ASN A OD1   1 
ATOM   2278 N  ND2   . ASN A 1 318 ? 32.107 89.607  85.676  1.00 26.18  ? 318  ASN A ND2   1 
ATOM   2279 N  N     . LEU A 1 319 ? 33.303 86.750  90.006  1.00 31.72  ? 319  LEU A N     1 
ATOM   2280 C  CA    . LEU A 1 319 ? 33.523 87.157  91.394  1.00 31.96  ? 319  LEU A CA    1 
ATOM   2281 C  C     . LEU A 1 319 ? 33.883 88.664  91.545  1.00 31.56  ? 319  LEU A C     1 
ATOM   2282 O  O     . LEU A 1 319 ? 33.300 89.359  92.368  1.00 33.49  ? 319  LEU A O     1 
ATOM   2283 C  CB    . LEU A 1 319 ? 34.528 86.233  92.092  1.00 29.69  ? 319  LEU A CB    1 
ATOM   2284 C  CG    . LEU A 1 319 ? 34.141 84.758  92.386  1.00 28.85  ? 319  LEU A CG    1 
ATOM   2285 C  CD1   . LEU A 1 319 ? 35.255 84.087  93.168  1.00 28.69  ? 319  LEU A CD1   1 
ATOM   2286 C  CD2   . LEU A 1 319 ? 32.844 84.552  93.161  1.00 26.42  ? 319  LEU A CD2   1 
ATOM   2287 N  N     . PRO A 1 320 ? 34.811 89.188  90.764  1.00 32.09  ? 320  PRO A N     1 
ATOM   2288 C  CA    . PRO A 1 320 ? 35.049 90.641  90.765  1.00 32.93  ? 320  PRO A CA    1 
ATOM   2289 C  C     . PRO A 1 320 ? 33.779 91.476  90.598  1.00 32.76  ? 320  PRO A C     1 
ATOM   2290 O  O     . PRO A 1 320 ? 33.590 92.421  91.338  1.00 38.71  ? 320  PRO A O     1 
ATOM   2291 C  CB    . PRO A 1 320 ? 36.010 90.833  89.606  1.00 29.71  ? 320  PRO A CB    1 
ATOM   2292 C  CG    . PRO A 1 320 ? 36.773 89.534  89.580  1.00 30.85  ? 320  PRO A CG    1 
ATOM   2293 C  CD    . PRO A 1 320 ? 35.768 88.482  89.893  1.00 32.83  ? 320  PRO A CD    1 
ATOM   2294 N  N     . ARG A 1 321 ? 32.906 91.107  89.682  1.00 32.36  ? 321  ARG A N     1 
ATOM   2295 C  CA    . ARG A 1 321 ? 31.677 91.852  89.482  1.00 30.79  ? 321  ARG A CA    1 
ATOM   2296 C  C     . ARG A 1 321 ? 30.804 91.900  90.743  1.00 32.18  ? 321  ARG A C     1 
ATOM   2297 O  O     . ARG A 1 321 ? 30.158 92.904  91.000  1.00 34.20  ? 321  ARG A O     1 
ATOM   2298 C  CB    . ARG A 1 321 ? 30.910 91.279  88.301  1.00 30.17  ? 321  ARG A CB    1 
ATOM   2299 C  CG    . ARG A 1 321 ? 29.651 92.013  87.933  1.00 31.01  ? 321  ARG A CG    1 
ATOM   2300 C  CD    . ARG A 1 321 ? 29.823 93.534  87.610  1.00 32.68  ? 321  ARG A CD    1 
ATOM   2301 N  NE    . ARG A 1 321 ? 28.541 94.011  87.086  1.00 33.85  ? 321  ARG A NE    1 
ATOM   2302 C  CZ    . ARG A 1 321 ? 28.158 93.900  85.829  1.00 34.69  ? 321  ARG A CZ    1 
ATOM   2303 N  NH1   . ARG A 1 321 ? 28.970 93.382  84.911  1.00 37.18  ? 321  ARG A NH1   1 
ATOM   2304 N  NH2   . ARG A 1 321 ? 26.949 94.301  85.484  1.00 35.30  ? 321  ARG A NH2   1 
ATOM   2305 N  N     . ILE A 1 322 ? 30.791 90.842  91.545  1.00 32.95  ? 322  ILE A N     1 
ATOM   2306 C  CA    . ILE A 1 322 ? 30.070 90.900  92.814  1.00 31.55  ? 322  ILE A CA    1 
ATOM   2307 C  C     . ILE A 1 322 ? 30.586 92.065  93.663  1.00 33.24  ? 322  ILE A C     1 
ATOM   2308 O  O     . ILE A 1 322 ? 29.798 92.843  94.199  1.00 30.02  ? 322  ILE A O     1 
ATOM   2309 C  CB    . ILE A 1 322 ? 30.216 89.618  93.610  1.00 31.68  ? 322  ILE A CB    1 
ATOM   2310 C  CG1   . ILE A 1 322 ? 29.917 88.385  92.726  1.00 33.86  ? 322  ILE A CG1   1 
ATOM   2311 C  CG2   . ILE A 1 322 ? 29.311 89.693  94.838  1.00 29.31  ? 322  ILE A CG2   1 
ATOM   2312 C  CD1   . ILE A 1 322 ? 29.604 87.071  93.496  1.00 32.69  ? 322  ILE A CD1   1 
ATOM   2313 N  N     . ALA A 1 323 ? 31.910 92.142  93.793  1.00 34.19  ? 323  ALA A N     1 
ATOM   2314 C  CA    . ALA A 1 323 ? 32.565 93.177  94.564  1.00 35.50  ? 323  ALA A CA    1 
ATOM   2315 C  C     . ALA A 1 323 ? 32.374 94.581  93.946  1.00 39.26  ? 323  ALA A C     1 
ATOM   2316 O  O     . ALA A 1 323 ? 32.064 95.538  94.671  1.00 38.35  ? 323  ALA A O     1 
ATOM   2317 C  CB    . ALA A 1 323 ? 34.043 92.859  94.705  1.00 35.37  ? 323  ALA A CB    1 
ATOM   2318 N  N     . LEU A 1 324 ? 32.550 94.706  92.630  1.00 37.72  ? 324  LEU A N     1 
ATOM   2319 C  CA    . LEU A 1 324 ? 32.364 95.994  91.957  1.00 39.57  ? 324  LEU A CA    1 
ATOM   2320 C  C     . LEU A 1 324 ? 30.952 96.536  92.189  1.00 38.97  ? 324  LEU A C     1 
ATOM   2321 O  O     . LEU A 1 324 ? 30.780 97.739  92.390  1.00 40.21  ? 324  LEU A O     1 
ATOM   2322 C  CB    . LEU A 1 324 ? 32.624 95.872  90.452  1.00 39.50  ? 324  LEU A CB    1 
ATOM   2323 C  CG    . LEU A 1 324 ? 34.087 95.717  90.022  1.00 41.38  ? 324  LEU A CG    1 
ATOM   2324 C  CD1   . LEU A 1 324 ? 34.160 95.235  88.583  1.00 41.72  ? 324  LEU A CD1   1 
ATOM   2325 C  CD2   . LEU A 1 324 ? 34.867 97.022  90.189  1.00 40.42  ? 324  LEU A CD2   1 
ATOM   2326 N  N     . ASP A 1 325 ? 29.960 95.643  92.159  1.00 34.70  ? 325  ASP A N     1 
ATOM   2327 C  CA    . ASP A 1 325 ? 28.545 96.004  92.324  1.00 35.85  ? 325  ASP A CA    1 
ATOM   2328 C  C     . ASP A 1 325 ? 28.204 96.260  93.786  1.00 35.58  ? 325  ASP A C     1 
ATOM   2329 O  O     . ASP A 1 325 ? 27.065 96.615  94.124  1.00 28.33  ? 325  ASP A O     1 
ATOM   2330 C  CB    . ASP A 1 325 ? 27.628 94.873  91.841  1.00 36.99  ? 325  ASP A CB    1 
ATOM   2331 C  CG    . ASP A 1 325 ? 27.583 94.749  90.345  1.00 38.79  ? 325  ASP A CG    1 
ATOM   2332 O  OD1   . ASP A 1 325 ? 28.196 95.580  89.644  1.00 39.66  ? 325  ASP A OD1   1 
ATOM   2333 O  OD2   . ASP A 1 325 ? 26.944 93.850  89.779  1.00 38.41  ? 325  ASP A OD2   1 
ATOM   2334 N  N     . SER A 1 326 ? 29.174 96.018  94.658  1.00 33.78  ? 326  SER A N     1 
ATOM   2335 C  CA    . SER A 1 326 ? 28.952 96.217  96.068  1.00 39.45  ? 326  SER A CA    1 
ATOM   2336 C  C     . SER A 1 326 ? 29.692 97.485  96.522  1.00 37.04  ? 326  SER A C     1 
ATOM   2337 O  O     . SER A 1 326 ? 29.645 97.855  97.674  1.00 35.52  ? 326  SER A O     1 
ATOM   2338 C  CB    . SER A 1 326 ? 29.316 94.942  96.843  1.00 38.56  ? 326  SER A CB    1 
ATOM   2339 O  OG    . SER A 1 326 ? 30.709 94.825  96.991  1.00 45.82  ? 326  SER A OG    1 
ATOM   2340 N  N     . TYR A 1 327 ? 30.314 98.174  95.574  1.00 38.69  ? 327  TYR A N     1 
ATOM   2341 C  CA    . TYR A 1 327 ? 30.891 99.480  95.822  1.00 39.48  ? 327  TYR A CA    1 
ATOM   2342 C  C     . TYR A 1 327 ? 29.781 100.521 95.897  1.00 41.37  ? 327  TYR A C     1 
ATOM   2343 O  O     . TYR A 1 327 ? 28.851 100.520 95.099  1.00 39.99  ? 327  TYR A O     1 
ATOM   2344 C  CB    . TYR A 1 327 ? 31.937 99.861  94.767  1.00 37.05  ? 327  TYR A CB    1 
ATOM   2345 C  CG    . TYR A 1 327 ? 33.349 99.530  95.195  1.00 35.56  ? 327  TYR A CG    1 
ATOM   2346 C  CD1   . TYR A 1 327 ? 33.749 98.224  95.332  1.00 35.70  ? 327  TYR A CD1   1 
ATOM   2347 C  CD2   . TYR A 1 327 ? 34.274 100.523 95.489  1.00 36.74  ? 327  TYR A CD2   1 
ATOM   2348 C  CE1   . TYR A 1 327 ? 35.027 97.899  95.739  1.00 34.93  ? 327  TYR A CE1   1 
ATOM   2349 C  CE2   . TYR A 1 327 ? 35.572 100.206 95.897  1.00 35.32  ? 327  TYR A CE2   1 
ATOM   2350 C  CZ    . TYR A 1 327 ? 35.937 98.879  96.016  1.00 34.76  ? 327  TYR A CZ    1 
ATOM   2351 O  OH    . TYR A 1 327 ? 37.208 98.501  96.413  1.00 32.42  ? 327  TYR A OH    1 
ATOM   2352 N  N     . ILE A 1 328 ? 29.872 101.349 96.931  1.00 44.39  ? 328  ILE A N     1 
ATOM   2353 C  CA    . ILE A 1 328 ? 29.023 102.508 97.136  1.00 46.39  ? 328  ILE A CA    1 
ATOM   2354 C  C     . ILE A 1 328 ? 29.989 103.676 97.025  1.00 44.16  ? 328  ILE A C     1 
ATOM   2355 O  O     . ILE A 1 328 ? 30.894 103.810 97.843  1.00 44.36  ? 328  ILE A O     1 
ATOM   2356 C  CB    . ILE A 1 328 ? 28.414 102.429 98.549  1.00 49.67  ? 328  ILE A CB    1 
ATOM   2357 C  CG1   . ILE A 1 328 ? 27.510 101.194 98.688  1.00 48.20  ? 328  ILE A CG1   1 
ATOM   2358 C  CG2   . ILE A 1 328 ? 27.704 103.721 98.907  1.00 49.87  ? 328  ILE A CG2   1 
ATOM   2359 C  CD1   . ILE A 1 328 ? 26.088 101.430 98.324  1.00 50.56  ? 328  ILE A CD1   1 
ATOM   2360 N  N     . GLY A 1 329 ? 29.842 104.489 95.991  1.00 45.18  ? 329  GLY A N     1 
ATOM   2361 C  CA    . GLY A 1 329 ? 30.856 105.480 95.668  1.00 43.32  ? 329  GLY A CA    1 
ATOM   2362 C  C     . GLY A 1 329 ? 32.155 104.764 95.346  1.00 44.51  ? 329  GLY A C     1 
ATOM   2363 O  O     . GLY A 1 329 ? 32.144 103.770 94.630  1.00 47.21  ? 329  GLY A O     1 
ATOM   2364 N  N     . THR A 1 330 ? 33.269 105.258 95.883  1.00 44.89  ? 330  THR A N     1 
ATOM   2365 C  CA    . THR A 1 330 ? 34.581 104.612 95.747  1.00 41.91  ? 330  THR A CA    1 
ATOM   2366 C  C     . THR A 1 330 ? 34.892 103.681 96.925  1.00 38.83  ? 330  THR A C     1 
ATOM   2367 O  O     . THR A 1 330 ? 36.042 103.403 97.213  1.00 34.89  ? 330  THR A O     1 
ATOM   2368 C  CB    . THR A 1 330 ? 35.686 105.692 95.647  1.00 44.14  ? 330  THR A CB    1 
ATOM   2369 O  OG1   . THR A 1 330 ? 35.681 106.508 96.826  1.00 45.78  ? 330  THR A OG1   1 
ATOM   2370 C  CG2   . THR A 1 330 ? 35.394 106.686 94.510  1.00 45.43  ? 330  THR A CG2   1 
ATOM   2371 N  N     . GLN A 1 331 ? 33.859 103.178 97.591  1.00 38.60  ? 331  GLN A N     1 
ATOM   2372 C  CA    . GLN A 1 331 ? 34.042 102.417 98.822  1.00 38.27  ? 331  GLN A CA    1 
ATOM   2373 C  C     . GLN A 1 331 ? 33.269 101.095 98.825  1.00 35.20  ? 331  GLN A C     1 
ATOM   2374 O  O     . GLN A 1 331 ? 32.061 101.068 98.592  1.00 32.51  ? 331  GLN A O     1 
ATOM   2375 C  CB    . GLN A 1 331 ? 33.586 103.296 99.971  1.00 39.44  ? 331  GLN A CB    1 
ATOM   2376 C  CG    . GLN A 1 331 ? 33.785 102.766 101.351 1.00 38.67  ? 331  GLN A CG    1 
ATOM   2377 C  CD    . GLN A 1 331 ? 33.514 103.855 102.380 1.00 39.05  ? 331  GLN A CD    1 
ATOM   2378 O  OE1   . GLN A 1 331 ? 34.454 104.430 102.921 1.00 36.41  ? 331  GLN A OE1   1 
ATOM   2379 N  NE2   . GLN A 1 331 ? 32.226 104.167 102.615 1.00 35.03  ? 331  GLN A NE2   1 
ATOM   2380 N  N     . PHE A 1 332 ? 33.993 100.011 99.079  1.00 34.92  ? 332  PHE A N     1 
ATOM   2381 C  CA    . PHE A 1 332 ? 33.424 98.674  99.257  1.00 35.15  ? 332  PHE A CA    1 
ATOM   2382 C  C     . PHE A 1 332 ? 32.452 98.660  100.421 1.00 35.11  ? 332  PHE A C     1 
ATOM   2383 O  O     . PHE A 1 332 ? 32.786 99.143  101.497 1.00 37.70  ? 332  PHE A O     1 
ATOM   2384 C  CB    . PHE A 1 332 ? 34.559 97.688  99.569  1.00 35.01  ? 332  PHE A CB    1 
ATOM   2385 C  CG    . PHE A 1 332 ? 34.137 96.238  99.637  1.00 34.74  ? 332  PHE A CG    1 
ATOM   2386 C  CD1   . PHE A 1 332 ? 33.587 95.602  98.533  1.00 34.46  ? 332  PHE A CD1   1 
ATOM   2387 C  CD2   . PHE A 1 332 ? 34.354 95.492  100.799 1.00 36.60  ? 332  PHE A CD2   1 
ATOM   2388 C  CE1   . PHE A 1 332 ? 33.225 94.255  98.585  1.00 35.83  ? 332  PHE A CE1   1 
ATOM   2389 C  CE2   . PHE A 1 332 ? 33.990 94.134  100.870 1.00 35.84  ? 332  PHE A CE2   1 
ATOM   2390 C  CZ    . PHE A 1 332 ? 33.433 93.514  99.750  1.00 36.62  ? 332  PHE A CZ    1 
ATOM   2391 N  N     . ASN A 1 333 ? 31.267 98.097  100.193 1.00 33.49  ? 333  ASN A N     1 
ATOM   2392 C  CA    . ASN A 1 333 ? 30.292 97.802  101.242 1.00 35.35  ? 333  ASN A CA    1 
ATOM   2393 C  C     . ASN A 1 333 ? 30.156 96.276  101.508 1.00 39.22  ? 333  ASN A C     1 
ATOM   2394 O  O     . ASN A 1 333 ? 29.556 95.553  100.697 1.00 36.88  ? 333  ASN A O     1 
ATOM   2395 C  CB    . ASN A 1 333 ? 28.923 98.384  100.864 1.00 32.29  ? 333  ASN A CB    1 
ATOM   2396 C  CG    . ASN A 1 333 ? 27.954 98.385  102.034 1.00 33.86  ? 333  ASN A CG    1 
ATOM   2397 O  OD1   . ASN A 1 333 ? 26.939 97.687  102.023 1.00 28.94  ? 333  ASN A OD1   1 
ATOM   2398 N  ND2   . ASN A 1 333 ? 28.261 99.194  103.057 1.00 35.61  ? 333  ASN A ND2   1 
ATOM   2399 N  N     . GLU A 1 334 ? 30.706 95.803  102.633 1.00 41.94  ? 334  GLU A N     1 
ATOM   2400 C  CA    . GLU A 1 334 ? 30.671 94.385  102.988 1.00 44.55  ? 334  GLU A CA    1 
ATOM   2401 C  C     . GLU A 1 334 ? 29.272 93.810  103.043 1.00 41.54  ? 334  GLU A C     1 
ATOM   2402 O  O     . GLU A 1 334 ? 29.058 92.691  102.610 1.00 43.54  ? 334  GLU A O     1 
ATOM   2403 C  CB    . GLU A 1 334 ? 31.392 94.092  104.319 1.00 51.24  ? 334  GLU A CB    1 
ATOM   2404 C  CG    . GLU A 1 334 ? 31.750 92.602  104.470 1.00 56.55  ? 334  GLU A CG    1 
ATOM   2405 C  CD    . GLU A 1 334 ? 32.377 92.230  105.813 1.00 61.45  ? 334  GLU A CD    1 
ATOM   2406 O  OE1   . GLU A 1 334 ? 31.635 91.805  106.743 1.00 63.46  ? 334  GLU A OE1   1 
ATOM   2407 O  OE2   . GLU A 1 334 ? 33.622 92.328  105.928 1.00 65.20  ? 334  GLU A OE2   1 
ATOM   2408 N  N     . GLN A 1 335 ? 28.312 94.560  103.560 1.00 40.01  ? 335  GLN A N     1 
ATOM   2409 C  CA    . GLN A 1 335 ? 26.959 94.039  103.690 1.00 38.69  ? 335  GLN A CA    1 
ATOM   2410 C  C     . GLN A 1 335 ? 26.326 93.810  102.327 1.00 37.36  ? 335  GLN A C     1 
ATOM   2411 O  O     . GLN A 1 335 ? 25.738 92.761  102.088 1.00 40.21  ? 335  GLN A O     1 
ATOM   2412 C  CB    . GLN A 1 335 ? 26.086 94.977  104.534 1.00 39.68  ? 335  GLN A CB    1 
ATOM   2413 C  CG    . GLN A 1 335 ? 24.635 94.502  104.727 1.00 38.73  ? 335  GLN A CG    1 
ATOM   2414 C  CD    . GLN A 1 335 ? 24.547 93.133  105.381 1.00 39.02  ? 335  GLN A CD    1 
ATOM   2415 O  OE1   . GLN A 1 335 ? 23.632 92.367  105.093 1.00 39.07  ? 335  GLN A OE1   1 
ATOM   2416 N  NE2   . GLN A 1 335 ? 25.500 92.823  106.254 1.00 39.86  ? 335  GLN A NE2   1 
ATOM   2417 N  N     . LYS A 1 336 ? 26.456 94.783  101.430 1.00 37.34  ? 336  LYS A N     1 
ATOM   2418 C  CA    . LYS A 1 336 ? 25.971 94.634  100.056 1.00 37.94  ? 336  LYS A CA    1 
ATOM   2419 C  C     . LYS A 1 336 ? 26.581 93.398  99.362  1.00 36.73  ? 336  LYS A C     1 
ATOM   2420 O  O     . LYS A 1 336 ? 25.883 92.700  98.627  1.00 33.01  ? 336  LYS A O     1 
ATOM   2421 C  CB    . LYS A 1 336 ? 26.250 95.886  99.223  1.00 37.83  ? 336  LYS A CB    1 
ATOM   2422 C  CG    . LYS A 1 336 ? 25.432 95.960  97.912  1.00 42.00  ? 336  LYS A CG    1 
ATOM   2423 C  CD    . LYS A 1 336 ? 23.929 96.244  98.172  1.00 43.77  ? 336  LYS A CD    1 
ATOM   2424 C  CE    . LYS A 1 336 ? 23.254 97.054  97.058  1.00 44.76  ? 336  LYS A CE    1 
ATOM   2425 N  NZ    . LYS A 1 336 ? 23.209 98.556  97.351  1.00 46.50  ? 336  LYS A NZ    1 
ATOM   2426 N  N     . PHE A 1 337 ? 27.860 93.138  99.629  1.00 34.68  ? 337  PHE A N     1 
ATOM   2427 C  CA    . PHE A 1 337 ? 28.589 92.029  99.040  1.00 39.08  ? 337  PHE A CA    1 
ATOM   2428 C  C     . PHE A 1 337 ? 28.011 90.696  99.486  1.00 39.53  ? 337  PHE A C     1 
ATOM   2429 O  O     . PHE A 1 337 ? 27.880 89.794  98.681  1.00 41.31  ? 337  PHE A O     1 
ATOM   2430 C  CB    . PHE A 1 337 ? 30.085 92.115  99.398  1.00 42.18  ? 337  PHE A CB    1 
ATOM   2431 C  CG    . PHE A 1 337 ? 30.932 90.982  98.839  1.00 42.19  ? 337  PHE A CG    1 
ATOM   2432 C  CD1   . PHE A 1 337 ? 31.438 91.047  97.553  1.00 41.75  ? 337  PHE A CD1   1 
ATOM   2433 C  CD2   . PHE A 1 337 ? 31.240 89.873  99.620  1.00 42.49  ? 337  PHE A CD2   1 
ATOM   2434 C  CE1   . PHE A 1 337 ? 32.233 90.010  97.039  1.00 43.74  ? 337  PHE A CE1   1 
ATOM   2435 C  CE2   . PHE A 1 337 ? 32.028 88.835  99.117  1.00 43.64  ? 337  PHE A CE2   1 
ATOM   2436 C  CZ    . PHE A 1 337 ? 32.523 88.900  97.827  1.00 41.97  ? 337  PHE A CZ    1 
ATOM   2437 N  N     . VAL A 1 338 ? 27.649 90.590  100.757 1.00 40.54  ? 338  VAL A N     1 
ATOM   2438 C  CA    . VAL A 1 338 ? 27.017 89.388  101.305 1.00 41.26  ? 338  VAL A CA    1 
ATOM   2439 C  C     . VAL A 1 338 ? 25.638 89.158  100.681 1.00 43.51  ? 338  VAL A C     1 
ATOM   2440 O  O     . VAL A 1 338 ? 25.221 88.008  100.469 1.00 44.83  ? 338  VAL A O     1 
ATOM   2441 C  CB    . VAL A 1 338 ? 26.888 89.493  102.863 1.00 42.69  ? 338  VAL A CB    1 
ATOM   2442 C  CG1   . VAL A 1 338 ? 25.842 88.514  103.437 1.00 41.17  ? 338  VAL A CG1   1 
ATOM   2443 C  CG2   . VAL A 1 338 ? 28.253 89.306  103.526 1.00 40.80  ? 338  VAL A CG2   1 
ATOM   2444 N  N     . GLU A 1 339 ? 24.928 90.238  100.379 1.00 42.77  ? 339  GLU A N     1 
ATOM   2445 C  CA    . GLU A 1 339 ? 23.571 90.103  99.829  1.00 43.22  ? 339  GLU A CA    1 
ATOM   2446 C  C     . GLU A 1 339 ? 23.592 89.649  98.367  1.00 40.14  ? 339  GLU A C     1 
ATOM   2447 O  O     . GLU A 1 339 ? 22.742 88.879  97.949  1.00 40.83  ? 339  GLU A O     1 
ATOM   2448 C  CB    . GLU A 1 339 ? 22.776 91.411  99.949  1.00 43.22  ? 339  GLU A CB    1 
ATOM   2449 C  CG    . GLU A 1 339 ? 22.078 91.619  101.289 1.00 45.01  ? 339  GLU A CG    1 
ATOM   2450 C  CD    . GLU A 1 339 ? 21.793 93.094  101.619 1.00 46.74  ? 339  GLU A CD    1 
ATOM   2451 O  OE1   . GLU A 1 339 ? 21.558 93.924  100.695 1.00 43.06  ? 339  GLU A OE1   1 
ATOM   2452 O  OE2   . GLU A 1 339 ? 21.798 93.419  102.832 1.00 50.20  ? 339  GLU A OE2   1 
ATOM   2453 N  N     . LEU A 1 340 ? 24.544 90.143  97.593  1.00 37.74  ? 340  LEU A N     1 
ATOM   2454 C  CA    . LEU A 1 340 ? 24.585 89.860  96.151  1.00 36.69  ? 340  LEU A CA    1 
ATOM   2455 C  C     . LEU A 1 340 ? 25.201 88.489  95.934  1.00 35.29  ? 340  LEU A C     1 
ATOM   2456 O  O     . LEU A 1 340 ? 24.786 87.781  95.045  1.00 33.55  ? 340  LEU A O     1 
ATOM   2457 C  CB    . LEU A 1 340 ? 25.408 90.905  95.387  1.00 34.54  ? 340  LEU A CB    1 
ATOM   2458 C  CG    . LEU A 1 340 ? 24.965 92.361  95.447  1.00 34.38  ? 340  LEU A CG    1 
ATOM   2459 C  CD1   . LEU A 1 340 ? 26.034 93.250  94.850  1.00 34.86  ? 340  LEU A CD1   1 
ATOM   2460 C  CD2   . LEU A 1 340 ? 23.643 92.559  94.722  1.00 36.58  ? 340  LEU A CD2   1 
ATOM   2461 N  N     . PHE A 1 341 ? 26.184 88.145  96.765  1.00 35.29  ? 341  PHE A N     1 
ATOM   2462 C  CA    . PHE A 1 341 ? 26.791 86.821  96.781  1.00 36.47  ? 341  PHE A CA    1 
ATOM   2463 C  C     . PHE A 1 341 ? 25.734 85.746  96.947  1.00 37.77  ? 341  PHE A C     1 
ATOM   2464 O  O     . PHE A 1 341 ? 25.624 84.849  96.110  1.00 35.28  ? 341  PHE A O     1 
ATOM   2465 C  CB    . PHE A 1 341 ? 27.849 86.703  97.881  1.00 34.42  ? 341  PHE A CB    1 
ATOM   2466 C  CG    . PHE A 1 341 ? 28.429 85.312  98.011  1.00 36.77  ? 341  PHE A CG    1 
ATOM   2467 C  CD1   . PHE A 1 341 ? 29.421 84.882  97.153  1.00 36.82  ? 341  PHE A CD1   1 
ATOM   2468 C  CD2   . PHE A 1 341 ? 27.961 84.428  98.988  1.00 36.60  ? 341  PHE A CD2   1 
ATOM   2469 C  CE1   . PHE A 1 341 ? 29.949 83.600  97.261  1.00 39.00  ? 341  PHE A CE1   1 
ATOM   2470 C  CE2   . PHE A 1 341 ? 28.491 83.148  99.109  1.00 37.52  ? 341  PHE A CE2   1 
ATOM   2471 C  CZ    . PHE A 1 341 ? 29.480 82.728  98.242  1.00 37.89  ? 341  PHE A CZ    1 
ATOM   2472 N  N     . ASN A 1 342 ? 24.940 85.855  98.006  1.00 40.82  ? 342  ASN A N     1 
ATOM   2473 C  CA    . ASN A 1 342 ? 23.845 84.897  98.258  1.00 42.50  ? 342  ASN A CA    1 
ATOM   2474 C  C     . ASN A 1 342 ? 22.836 84.848  97.114  1.00 40.48  ? 342  ASN A C     1 
ATOM   2475 O  O     . ASN A 1 342 ? 22.375 83.794  96.710  1.00 42.38  ? 342  ASN A O     1 
ATOM   2476 C  CB    . ASN A 1 342 ? 23.097 85.243  99.559  1.00 42.57  ? 342  ASN A CB    1 
ATOM   2477 C  CG    . ASN A 1 342 ? 23.953 85.047  100.800 1.00 44.24  ? 342  ASN A CG    1 
ATOM   2478 O  OD1   . ASN A 1 342 ? 25.077 84.571  100.723 1.00 47.21  ? 342  ASN A OD1   1 
ATOM   2479 N  ND2   . ASN A 1 342 ? 23.428 85.444  101.949 1.00 46.34  ? 342  ASN A ND2   1 
ATOM   2480 N  N     . GLU A 1 343 ? 22.493 86.015  96.608  1.00 38.74  ? 343  GLU A N     1 
ATOM   2481 C  CA    . GLU A 1 343 ? 21.531 86.139  95.525  1.00 38.53  ? 343  GLU A CA    1 
ATOM   2482 C  C     . GLU A 1 343 ? 22.099 85.522  94.214  1.00 35.58  ? 343  GLU A C     1 
ATOM   2483 O  O     . GLU A 1 343 ? 21.377 84.900  93.444  1.00 28.51  ? 343  GLU A O     1 
ATOM   2484 C  CB    . GLU A 1 343 ? 21.171 87.624  95.413  1.00 40.88  ? 343  GLU A CB    1 
ATOM   2485 C  CG    . GLU A 1 343 ? 20.600 88.145  94.107  1.00 46.34  ? 343  GLU A CG    1 
ATOM   2486 C  CD    . GLU A 1 343 ? 20.421 89.673  94.133  1.00 49.96  ? 343  GLU A CD    1 
ATOM   2487 O  OE1   . GLU A 1 343 ? 20.195 90.254  95.235  1.00 51.26  ? 343  GLU A OE1   1 
ATOM   2488 O  OE2   . GLU A 1 343 ? 20.506 90.300  93.049  1.00 52.25  ? 343  GLU A OE2   1 
ATOM   2489 N  N     . ARG A 1 344 ? 23.406 85.651  94.011  1.00 32.62  ? 344  ARG A N     1 
ATOM   2490 C  CA    . ARG A 1 344 ? 24.035 85.229  92.776  1.00 32.20  ? 344  ARG A CA    1 
ATOM   2491 C  C     . ARG A 1 344 ? 24.341 83.738  92.791  1.00 33.69  ? 344  ARG A C     1 
ATOM   2492 O  O     . ARG A 1 344 ? 24.360 83.105  91.753  1.00 32.52  ? 344  ARG A O     1 
ATOM   2493 C  CB    . ARG A 1 344 ? 25.294 86.050  92.492  1.00 31.14  ? 344  ARG A CB    1 
ATOM   2494 C  CG    . ARG A 1 344 ? 24.982 87.209  91.577  1.00 31.93  ? 344  ARG A CG    1 
ATOM   2495 C  CD    . ARG A 1 344 ? 25.989 88.301  91.518  1.00 33.18  ? 344  ARG A CD    1 
ATOM   2496 N  NE    . ARG A 1 344 ? 25.342 89.578  91.165  1.00 35.69  ? 344  ARG A NE    1 
ATOM   2497 C  CZ    . ARG A 1 344 ? 25.993 90.721  90.909  1.00 33.09  ? 344  ARG A CZ    1 
ATOM   2498 N  NH1   . ARG A 1 344 ? 27.322 90.794  90.894  1.00 34.28  ? 344  ARG A NH1   1 
ATOM   2499 N  NH2   . ARG A 1 344 ? 25.303 91.791  90.608  1.00 34.72  ? 344  ARG A NH2   1 
ATOM   2500 N  N     . MET A 1 345 ? 24.552 83.189  93.978  1.00 35.79  ? 345  MET A N     1 
ATOM   2501 C  CA    . MET A 1 345 ? 24.719 81.755  94.152  1.00 35.09  ? 345  MET A CA    1 
ATOM   2502 C  C     . MET A 1 345 ? 23.434 81.051  93.815  1.00 37.21  ? 345  MET A C     1 
ATOM   2503 O  O     . MET A 1 345 ? 23.457 80.075  93.073  1.00 36.08  ? 345  MET A O     1 
ATOM   2504 C  CB    . MET A 1 345 ? 25.116 81.434  95.577  1.00 33.91  ? 345  MET A CB    1 
ATOM   2505 C  CG    . MET A 1 345 ? 26.525 81.874  95.890  1.00 33.46  ? 345  MET A CG    1 
ATOM   2506 S  SD    . MET A 1 345 ? 27.734 80.940  94.997  1.00 36.40  ? 345  MET A SD    1 
ATOM   2507 C  CE    . MET A 1 345 ? 27.469 79.309  95.719  1.00 35.56  ? 345  MET A CE    1 
ATOM   2508 N  N     . ASP A 1 346 ? 22.322 81.551  94.357  1.00 36.85  ? 346  ASP A N     1 
ATOM   2509 C  CA    . ASP A 1 346 ? 20.995 81.043  94.017  1.00 37.80  ? 346  ASP A CA    1 
ATOM   2510 C  C     . ASP A 1 346 ? 20.775 81.092  92.513  1.00 36.85  ? 346  ASP A C     1 
ATOM   2511 O  O     . ASP A 1 346 ? 20.283 80.140  91.923  1.00 39.73  ? 346  ASP A O     1 
ATOM   2512 C  CB    . ASP A 1 346 ? 19.894 81.853  94.719  1.00 40.04  ? 346  ASP A CB    1 
ATOM   2513 C  CG    . ASP A 1 346 ? 19.728 81.479  96.202  1.00 45.29  ? 346  ASP A CG    1 
ATOM   2514 O  OD1   . ASP A 1 346 ? 20.707 81.022  96.842  1.00 45.05  ? 346  ASP A OD1   1 
ATOM   2515 O  OD2   . ASP A 1 346 ? 18.640 81.619  96.818  1.00 49.33  ? 346  ASP A OD2   1 
ATOM   2516 N  N     . LEU A 1 347 ? 21.145 82.211  91.903  1.00 34.99  ? 347  LEU A N     1 
ATOM   2517 C  CA    . LEU A 1 347 ? 20.998 82.409  90.466  1.00 34.39  ? 347  LEU A CA    1 
ATOM   2518 C  C     . LEU A 1 347 ? 21.746 81.347  89.649  1.00 33.96  ? 347  LEU A C     1 
ATOM   2519 O  O     . LEU A 1 347 ? 21.209 80.793  88.701  1.00 32.52  ? 347  LEU A O     1 
ATOM   2520 C  CB    . LEU A 1 347 ? 21.533 83.800  90.093  1.00 32.72  ? 347  LEU A CB    1 
ATOM   2521 C  CG    . LEU A 1 347 ? 21.643 84.171  88.620  1.00 32.18  ? 347  LEU A CG    1 
ATOM   2522 C  CD1   . LEU A 1 347 ? 20.275 84.343  88.032  1.00 34.39  ? 347  LEU A CD1   1 
ATOM   2523 C  CD2   . LEU A 1 347 ? 22.398 85.456  88.513  1.00 35.82  ? 347  LEU A CD2   1 
ATOM   2524 N  N     . CYS A 1 348 ? 22.995 81.098  90.014  1.00 34.45  ? 348  CYS A N     1 
ATOM   2525 C  CA    . CYS A 1 348 ? 23.818 80.083  89.371  1.00 37.19  ? 348  CYS A CA    1 
ATOM   2526 C  C     . CYS A 1 348 ? 23.195 78.672  89.464  1.00 37.35  ? 348  CYS A C     1 
ATOM   2527 O  O     . CYS A 1 348 ? 23.261 77.902  88.513  1.00 34.95  ? 348  CYS A O     1 
ATOM   2528 C  CB    . CYS A 1 348 ? 25.218 80.078  90.002  1.00 38.25  ? 348  CYS A CB    1 
ATOM   2529 S  SG    . CYS A 1 348 ? 26.267 81.433  89.445  1.00 38.36  ? 348  CYS A SG    1 
ATOM   2530 N  N     . PHE A 1 349 ? 22.597 78.352  90.610  1.00 35.81  ? 349  PHE A N     1 
ATOM   2531 C  CA    . PHE A 1 349 ? 21.887 77.089  90.805  1.00 35.57  ? 349  PHE A CA    1 
ATOM   2532 C  C     . PHE A 1 349 ? 20.704 76.990  89.847  1.00 38.27  ? 349  PHE A C     1 
ATOM   2533 O  O     . PHE A 1 349 ? 20.358 75.915  89.368  1.00 38.86  ? 349  PHE A O     1 
ATOM   2534 C  CB    . PHE A 1 349 ? 21.392 76.982  92.246  1.00 32.74  ? 349  PHE A CB    1 
ATOM   2535 C  CG    . PHE A 1 349 ? 20.418 75.875  92.476  1.00 31.92  ? 349  PHE A CG    1 
ATOM   2536 C  CD1   . PHE A 1 349 ? 20.868 74.579  92.689  1.00 31.08  ? 349  PHE A CD1   1 
ATOM   2537 C  CD2   . PHE A 1 349 ? 19.043 76.128  92.489  1.00 29.84  ? 349  PHE A CD2   1 
ATOM   2538 C  CE1   . PHE A 1 349 ? 19.966 73.535  92.901  1.00 30.69  ? 349  PHE A CE1   1 
ATOM   2539 C  CE2   . PHE A 1 349 ? 18.146 75.110  92.692  1.00 31.27  ? 349  PHE A CE2   1 
ATOM   2540 C  CZ    . PHE A 1 349 ? 18.608 73.796  92.911  1.00 32.23  ? 349  PHE A CZ    1 
ATOM   2541 N  N     . GLU A 1 350 ? 20.081 78.122  89.583  1.00 37.50  ? 350  GLU A N     1 
ATOM   2542 C  CA    . GLU A 1 350 ? 18.922 78.170  88.719  1.00 39.81  ? 350  GLU A CA    1 
ATOM   2543 C  C     . GLU A 1 350 ? 19.348 77.969  87.256  1.00 38.45  ? 350  GLU A C     1 
ATOM   2544 O  O     . GLU A 1 350 ? 18.612 77.379  86.460  1.00 33.68  ? 350  GLU A O     1 
ATOM   2545 C  CB    . GLU A 1 350 ? 18.210 79.516  88.912  1.00 43.91  ? 350  GLU A CB    1 
ATOM   2546 C  CG    . GLU A 1 350 ? 16.695 79.463  89.018  1.00 49.95  ? 350  GLU A CG    1 
ATOM   2547 C  CD    . GLU A 1 350 ? 16.184 78.591  90.149  1.00 54.61  ? 350  GLU A CD    1 
ATOM   2548 O  OE1   . GLU A 1 350 ? 16.017 79.113  91.276  1.00 58.42  ? 350  GLU A OE1   1 
ATOM   2549 O  OE2   . GLU A 1 350 ? 15.921 77.387  89.901  1.00 58.38  ? 350  GLU A OE2   1 
ATOM   2550 N  N     . ALA A 1 351 ? 20.541 78.455  86.915  1.00 34.81  ? 351  ALA A N     1 
ATOM   2551 C  CA    . ALA A 1 351 ? 21.055 78.355  85.558  1.00 32.42  ? 351  ALA A CA    1 
ATOM   2552 C  C     . ALA A 1 351 ? 21.524 76.926  85.312  1.00 30.59  ? 351  ALA A C     1 
ATOM   2553 O  O     . ALA A 1 351 ? 21.246 76.340  84.276  1.00 29.88  ? 351  ALA A O     1 
ATOM   2554 C  CB    . ALA A 1 351 ? 22.185 79.344  85.339  1.00 32.35  ? 351  ALA A CB    1 
ATOM   2555 N  N     . LEU A 1 352 ? 22.209 76.363  86.292  1.00 28.54  ? 352  LEU A N     1 
ATOM   2556 C  CA    . LEU A 1 352 ? 22.691 75.007  86.200  1.00 27.53  ? 352  LEU A CA    1 
ATOM   2557 C  C     . LEU A 1 352 ? 21.530 74.050  86.133  1.00 29.32  ? 352  LEU A C     1 
ATOM   2558 O  O     . LEU A 1 352 ? 21.509 73.178  85.282  1.00 32.08  ? 352  LEU A O     1 
ATOM   2559 C  CB    . LEU A 1 352 ? 23.615 74.690  87.357  1.00 28.91  ? 352  LEU A CB    1 
ATOM   2560 C  CG    . LEU A 1 352 ? 25.025 75.259  87.142  1.00 29.70  ? 352  LEU A CG    1 
ATOM   2561 C  CD1   . LEU A 1 352 ? 25.824 75.139  88.413  1.00 31.39  ? 352  LEU A CD1   1 
ATOM   2562 C  CD2   . LEU A 1 352 ? 25.771 74.577  86.001  1.00 29.40  ? 352  LEU A CD2   1 
ATOM   2563 N  N     . MET A 1 353 ? 20.523 74.265  86.964  1.00 32.59  ? 353  MET A N     1 
ATOM   2564 C  CA    . MET A 1 353 ? 19.331 73.429  86.954  1.00 33.94  ? 353  MET A CA    1 
ATOM   2565 C  C     . MET A 1 353 ? 18.485 73.597  85.715  1.00 34.14  ? 353  MET A C     1 
ATOM   2566 O  O     . MET A 1 353 ? 17.896 72.642  85.224  1.00 33.60  ? 353  MET A O     1 
ATOM   2567 C  CB    . MET A 1 353 ? 18.508 73.678  88.208  1.00 36.36  ? 353  MET A CB    1 
ATOM   2568 C  CG    . MET A 1 353 ? 19.226 73.116  89.451  1.00 38.03  ? 353  MET A CG    1 
ATOM   2569 S  SD    . MET A 1 353 ? 19.567 71.322  89.314  1.00 38.69  ? 353  MET A SD    1 
ATOM   2570 C  CE    . MET A 1 353 ? 17.856 70.743  89.357  1.00 42.14  ? 353  MET A CE    1 
ATOM   2571 N  N     . CYS A 1 354 ? 18.449 74.799  85.179  1.00 35.77  ? 354  CYS A N     1 
ATOM   2572 C  CA    . CYS A 1 354 ? 17.770 75.026  83.922  1.00 38.59  ? 354  CYS A CA    1 
ATOM   2573 C  C     . CYS A 1 354 ? 18.225 74.052  82.811  1.00 40.13  ? 354  CYS A C     1 
ATOM   2574 O  O     . CYS A 1 354 ? 17.400 73.472  82.120  1.00 42.57  ? 354  CYS A O     1 
ATOM   2575 C  CB    . CYS A 1 354 ? 18.034 76.450  83.484  1.00 42.93  ? 354  CYS A CB    1 
ATOM   2576 S  SG    . CYS A 1 354 ? 17.275 76.860  81.924  1.00 48.91  ? 354  CYS A SG    1 
ATOM   2577 N  N     . ARG A 1 355 ? 19.529 73.870  82.639  1.00 40.50  ? 355  ARG A N     1 
ATOM   2578 C  CA    . ARG A 1 355 ? 20.019 73.015  81.569  1.00 43.01  ? 355  ARG A CA    1 
ATOM   2579 C  C     . ARG A 1 355 ? 19.856 71.528  81.874  1.00 42.69  ? 355  ARG A C     1 
ATOM   2580 O  O     . ARG A 1 355 ? 19.554 70.743  80.981  1.00 44.27  ? 355  ARG A O     1 
ATOM   2581 C  CB    . ARG A 1 355 ? 21.464 73.342  81.179  1.00 47.62  ? 355  ARG A CB    1 
ATOM   2582 C  CG    . ARG A 1 355 ? 22.458 73.652  82.316  1.00 51.02  ? 355  ARG A CG    1 
ATOM   2583 C  CD    . ARG A 1 355 ? 23.623 74.592  81.908  1.00 52.28  ? 355  ARG A CD    1 
ATOM   2584 N  NE    . ARG A 1 355 ? 23.624 74.936  80.469  1.00 51.74  ? 355  ARG A NE    1 
ATOM   2585 C  CZ    . ARG A 1 355 ? 24.723 75.068  79.726  1.00 47.68  ? 355  ARG A CZ    1 
ATOM   2586 N  NH1   . ARG A 1 355 ? 25.923 74.925  80.259  1.00 45.44  ? 355  ARG A NH1   1 
ATOM   2587 N  NH2   . ARG A 1 355 ? 24.612 75.367  78.438  1.00 47.28  ? 355  ARG A NH2   1 
ATOM   2588 N  N     . ILE A 1 356 ? 20.032 71.146  83.131  1.00 41.13  ? 356  ILE A N     1 
ATOM   2589 C  CA    . ILE A 1 356 ? 19.788 69.771  83.556  1.00 40.71  ? 356  ILE A CA    1 
ATOM   2590 C  C     . ILE A 1 356 ? 18.321 69.377  83.323  1.00 40.97  ? 356  ILE A C     1 
ATOM   2591 O  O     . ILE A 1 356 ? 18.031 68.244  82.975  1.00 41.03  ? 356  ILE A O     1 
ATOM   2592 C  CB    . ILE A 1 356 ? 20.154 69.610  85.028  1.00 40.82  ? 356  ILE A CB    1 
ATOM   2593 C  CG1   . ILE A 1 356 ? 21.657 69.824  85.214  1.00 41.20  ? 356  ILE A CG1   1 
ATOM   2594 C  CG2   . ILE A 1 356 ? 19.736 68.237  85.548  1.00 40.80  ? 356  ILE A CG2   1 
ATOM   2595 C  CD1   . ILE A 1 356 ? 22.057 69.858  86.658  1.00 41.73  ? 356  ILE A CD1   1 
ATOM   2596 N  N     . SER A 1 357 ? 17.408 70.320  83.513  1.00 42.52  ? 357  SER A N     1 
ATOM   2597 C  CA    . SER A 1 357 ? 15.989 70.117  83.204  1.00 46.03  ? 357  SER A CA    1 
ATOM   2598 C  C     . SER A 1 357 ? 15.743 69.821  81.733  1.00 45.80  ? 357  SER A C     1 
ATOM   2599 O  O     . SER A 1 357 ? 14.848 69.064  81.403  1.00 44.87  ? 357  SER A O     1 
ATOM   2600 C  CB    . SER A 1 357 ? 15.162 71.357  83.584  1.00 47.83  ? 357  SER A CB    1 
ATOM   2601 O  OG    . SER A 1 357 ? 14.326 71.075  84.697  1.00 52.12  ? 357  SER A OG    1 
ATOM   2602 N  N     . SER A 1 358 ? 16.510 70.455  80.851  1.00 48.03  ? 358  SER A N     1 
ATOM   2603 C  CA    . SER A 1 358 ? 16.404 70.180  79.426  1.00 48.92  ? 358  SER A CA    1 
ATOM   2604 C  C     . SER A 1 358 ? 16.585 68.669  79.154  1.00 48.29  ? 358  SER A C     1 
ATOM   2605 O  O     . SER A 1 358 ? 15.914 68.116  78.282  1.00 53.07  ? 358  SER A O     1 
ATOM   2606 C  CB    . SER A 1 358 ? 17.411 71.029  78.621  1.00 50.03  ? 358  SER A CB    1 
ATOM   2607 O  OG    . SER A 1 358 ? 18.690 70.394  78.441  1.00 50.39  ? 358  SER A OG    1 
ATOM   2608 N  N     . LEU A 1 359 ? 17.459 68.012  79.919  1.00 43.27  ? 359  LEU A N     1 
ATOM   2609 C  CA    . LEU A 1 359 ? 17.742 66.574  79.757  1.00 41.84  ? 359  LEU A CA    1 
ATOM   2610 C  C     . LEU A 1 359 ? 16.581 65.625  80.073  1.00 39.03  ? 359  LEU A C     1 
ATOM   2611 O  O     . LEU A 1 359 ? 16.636 64.477  79.675  1.00 39.05  ? 359  LEU A O     1 
ATOM   2612 C  CB    . LEU A 1 359 ? 18.979 66.141  80.570  1.00 39.50  ? 359  LEU A CB    1 
ATOM   2613 C  CG    . LEU A 1 359 ? 20.293 66.889  80.306  1.00 39.46  ? 359  LEU A CG    1 
ATOM   2614 C  CD1   . LEU A 1 359 ? 21.395 66.451  81.278  1.00 38.31  ? 359  LEU A CD1   1 
ATOM   2615 C  CD2   . LEU A 1 359 ? 20.755 66.721  78.855  1.00 39.09  ? 359  LEU A CD2   1 
ATOM   2616 N  N     . LYS A 1 360 ? 15.544 66.084  80.768  1.00 41.12  ? 360  LYS A N     1 
ATOM   2617 C  CA    . LYS A 1 360 ? 14.356 65.242  81.053  1.00 42.87  ? 360  LYS A CA    1 
ATOM   2618 C  C     . LYS A 1 360 ? 13.623 64.808  79.779  1.00 39.81  ? 360  LYS A C     1 
ATOM   2619 O  O     . LYS A 1 360 ? 13.283 65.647  78.965  1.00 40.45  ? 360  LYS A O     1 
ATOM   2620 C  CB    . LYS A 1 360 ? 13.362 65.970  81.986  1.00 46.20  ? 360  LYS A CB    1 
ATOM   2621 C  CG    . LYS A 1 360 ? 13.732 65.908  83.489  1.00 49.97  ? 360  LYS A CG    1 
ATOM   2622 C  CD    . LYS A 1 360 ? 12.835 66.799  84.377  1.00 51.05  ? 360  LYS A CD    1 
ATOM   2623 C  CE    . LYS A 1 360 ? 13.574 67.262  85.648  1.00 52.03  ? 360  LYS A CE    1 
ATOM   2624 N  NZ    . LYS A 1 360 ? 12.961 68.456  86.295  1.00 50.49  ? 360  LYS A NZ    1 
ATOM   2625 N  N     . GLY A 1 361 ? 13.391 63.500  79.611  1.00 38.12  ? 361  GLY A N     1 
ATOM   2626 C  CA    . GLY A 1 361 ? 12.633 62.968  78.486  1.00 33.35  ? 361  GLY A CA    1 
ATOM   2627 C  C     . GLY A 1 361 ? 13.516 62.579  77.311  1.00 34.41  ? 361  GLY A C     1 
ATOM   2628 O  O     . GLY A 1 361 ? 13.078 61.915  76.373  1.00 36.94  ? 361  GLY A O     1 
ATOM   2629 N  N     . VAL A 1 362 ? 14.783 62.966  77.372  1.00 32.57  ? 362  VAL A N     1 
ATOM   2630 C  CA    . VAL A 1 362 ? 15.716 62.672  76.312  1.00 30.40  ? 362  VAL A CA    1 
ATOM   2631 C  C     . VAL A 1 362 ? 16.105 61.213  76.393  1.00 31.14  ? 362  VAL A C     1 
ATOM   2632 O  O     . VAL A 1 362 ? 16.338 60.678  77.473  1.00 35.97  ? 362  VAL A O     1 
ATOM   2633 C  CB    . VAL A 1 362 ? 16.918 63.597  76.384  1.00 31.68  ? 362  VAL A CB    1 
ATOM   2634 C  CG1   . VAL A 1 362 ? 17.991 63.190  75.393  1.00 31.56  ? 362  VAL A CG1   1 
ATOM   2635 C  CG2   . VAL A 1 362 ? 16.459 65.066  76.155  1.00 31.04  ? 362  VAL A CG2   1 
ATOM   2636 N  N     . LYS A 1 363 ? 16.157 60.585  75.225  1.00 30.81  ? 363  LYS A N     1 
ATOM   2637 C  CA    . LYS A 1 363 ? 16.287 59.146  75.057  1.00 29.44  ? 363  LYS A CA    1 
ATOM   2638 C  C     . LYS A 1 363 ? 17.720 58.852  74.598  1.00 32.85  ? 363  LYS A C     1 
ATOM   2639 O  O     . LYS A 1 363 ? 18.414 59.749  74.075  1.00 28.61  ? 363  LYS A O     1 
ATOM   2640 C  CB    . LYS A 1 363 ? 15.272 58.652  74.000  1.00 29.81  ? 363  LYS A CB    1 
ATOM   2641 C  CG    . LYS A 1 363 ? 13.760 58.728  74.409  1.00 31.96  ? 363  LYS A CG    1 
ATOM   2642 C  CD    . LYS A 1 363 ? 13.581 58.124  75.833  1.00 37.89  ? 363  LYS A CD    1 
ATOM   2643 C  CE    . LYS A 1 363 ? 12.169 57.654  76.170  1.00 38.88  ? 363  LYS A CE    1 
ATOM   2644 N  NZ    . LYS A 1 363 ? 11.227 58.748  75.984  1.00 42.89  ? 363  LYS A NZ    1 
ATOM   2645 N  N     . ALA A 1 364 ? 18.150 57.595  74.760  1.00 32.91  ? 364  ALA A N     1 
ATOM   2646 C  CA    . ALA A 1 364 ? 19.526 57.198  74.442  1.00 32.55  ? 364  ALA A CA    1 
ATOM   2647 C  C     . ALA A 1 364 ? 19.845 57.135  72.932  1.00 30.17  ? 364  ALA A C     1 
ATOM   2648 O  O     . ALA A 1 364 ? 21.009 56.987  72.547  1.00 28.01  ? 364  ALA A O     1 
ATOM   2649 C  CB    . ALA A 1 364 ? 19.844 55.870  75.102  1.00 33.03  ? 364  ALA A CB    1 
ATOM   2650 N  N     . THR A 1 365 ? 18.814 57.248  72.097  1.00 30.47  ? 365  THR A N     1 
ATOM   2651 C  CA    . THR A 1 365 ? 18.959 57.356  70.631  1.00 32.17  ? 365  THR A CA    1 
ATOM   2652 C  C     . THR A 1 365 ? 19.718 58.608  70.208  1.00 34.11  ? 365  THR A C     1 
ATOM   2653 O  O     . THR A 1 365 ? 20.232 58.691  69.081  1.00 35.09  ? 365  THR A O     1 
ATOM   2654 C  CB    . THR A 1 365 ? 17.566 57.409  69.955  1.00 31.41  ? 365  THR A CB    1 
ATOM   2655 O  OG1   . THR A 1 365 ? 16.726 58.345  70.654  1.00 32.78  ? 365  THR A OG1   1 
ATOM   2656 C  CG2   . THR A 1 365 ? 16.829 56.062  70.050  1.00 27.65  ? 365  THR A CG2   1 
ATOM   2657 N  N     . VAL A 1 366 ? 19.783 59.576  71.117  1.00 32.80  ? 366  VAL A N     1 
ATOM   2658 C  CA    . VAL A 1 366 ? 20.489 60.825  70.884  1.00 33.06  ? 366  VAL A CA    1 
ATOM   2659 C  C     . VAL A 1 366 ? 22.007 60.636  70.635  1.00 32.10  ? 366  VAL A C     1 
ATOM   2660 O  O     . VAL A 1 366 ? 22.625 61.387  69.865  1.00 31.12  ? 366  VAL A O     1 
ATOM   2661 C  CB    . VAL A 1 366 ? 20.154 61.812  72.050  1.00 36.80  ? 366  VAL A CB    1 
ATOM   2662 C  CG1   . VAL A 1 366 ? 21.323 62.039  73.029  1.00 35.83  ? 366  VAL A CG1   1 
ATOM   2663 C  CG2   . VAL A 1 366 ? 19.623 63.073  71.512  1.00 38.37  ? 366  VAL A CG2   1 
ATOM   2664 N  N     . ALA A 1 367 ? 22.604 59.634  71.270  1.00 28.84  ? 367  ALA A N     1 
ATOM   2665 C  CA    . ALA A 1 367 ? 24.054 59.418  71.169  1.00 25.69  ? 367  ALA A CA    1 
ATOM   2666 C  C     . ALA A 1 367 ? 24.410 57.987  71.515  1.00 28.07  ? 367  ALA A C     1 
ATOM   2667 O  O     . ALA A 1 367 ? 24.910 57.741  72.612  1.00 26.73  ? 367  ALA A O     1 
ATOM   2668 C  CB    . ALA A 1 367 ? 24.756 60.330  72.106  1.00 25.01  ? 367  ALA A CB    1 
ATOM   2669 N  N     . PRO A 1 368 ? 24.147 57.044  70.603  1.00 27.24  ? 368  PRO A N     1 
ATOM   2670 C  CA    . PRO A 1 368 ? 24.418 55.612  70.853  1.00 28.41  ? 368  PRO A CA    1 
ATOM   2671 C  C     . PRO A 1 368 ? 25.838 55.294  71.342  1.00 29.67  ? 368  PRO A C     1 
ATOM   2672 O  O     . PRO A 1 368 ? 25.998 54.453  72.221  1.00 32.43  ? 368  PRO A O     1 
ATOM   2673 C  CB    . PRO A 1 368 ? 24.163 54.956  69.482  1.00 27.98  ? 368  PRO A CB    1 
ATOM   2674 C  CG    . PRO A 1 368 ? 23.185 55.862  68.814  1.00 27.88  ? 368  PRO A CG    1 
ATOM   2675 C  CD    . PRO A 1 368 ? 23.553 57.269  69.277  1.00 26.02  ? 368  PRO A CD    1 
ATOM   2676 N  N     . ILE A 1 369 ? 26.854 55.943  70.792  1.00 29.26  ? 369  ILE A N     1 
ATOM   2677 C  CA    . ILE A 1 369 ? 28.215 55.670  71.218  1.00 31.65  ? 369  ILE A CA    1 
ATOM   2678 C  C     . ILE A 1 369 ? 28.362 55.959  72.717  1.00 35.07  ? 369  ILE A C     1 
ATOM   2679 O  O     . ILE A 1 369 ? 29.043 55.208  73.420  1.00 35.66  ? 369  ILE A O     1 
ATOM   2680 C  CB    . ILE A 1 369 ? 29.250 56.465  70.390  1.00 34.24  ? 369  ILE A CB    1 
ATOM   2681 C  CG1   . ILE A 1 369 ? 30.680 56.041  70.752  1.00 35.98  ? 369  ILE A CG1   1 
ATOM   2682 C  CG2   . ILE A 1 369 ? 29.101 57.993  70.587  1.00 34.99  ? 369  ILE A CG2   1 
ATOM   2683 C  CD1   . ILE A 1 369 ? 31.050 54.648  70.247  1.00 38.41  ? 369  ILE A CD1   1 
ATOM   2684 N  N     . LEU A 1 370 ? 27.734 57.042  73.195  1.00 30.74  ? 370  LEU A N     1 
ATOM   2685 C  CA    . LEU A 1 370 ? 27.808 57.410  74.603  1.00 25.69  ? 370  LEU A CA    1 
ATOM   2686 C  C     . LEU A 1 370 ? 26.967 56.503  75.475  1.00 25.85  ? 370  LEU A C     1 
ATOM   2687 O  O     . LEU A 1 370 ? 27.461 55.981  76.461  1.00 26.92  ? 370  LEU A O     1 
ATOM   2688 C  CB    . LEU A 1 370 ? 27.351 58.848  74.829  1.00 24.60  ? 370  LEU A CB    1 
ATOM   2689 C  CG    . LEU A 1 370 ? 28.112 59.974  74.139  1.00 24.45  ? 370  LEU A CG    1 
ATOM   2690 C  CD1   . LEU A 1 370 ? 27.509 61.313  74.532  1.00 21.51  ? 370  LEU A CD1   1 
ATOM   2691 C  CD2   . LEU A 1 370 ? 29.604 59.941  74.456  1.00 26.73  ? 370  LEU A CD2   1 
ATOM   2692 N  N     . TYR A 1 371 ? 25.695 56.331  75.118  1.00 26.12  ? 371  TYR A N     1 
ATOM   2693 C  CA    . TYR A 1 371 ? 24.702 55.728  76.012  1.00 27.77  ? 371  TYR A CA    1 
ATOM   2694 C  C     . TYR A 1 371 ? 24.409 54.238  75.775  1.00 31.39  ? 371  TYR A C     1 
ATOM   2695 O  O     . TYR A 1 371 ? 24.083 53.509  76.715  1.00 30.21  ? 371  TYR A O     1 
ATOM   2696 C  CB    . TYR A 1 371 ? 23.403 56.511  75.941  1.00 26.97  ? 371  TYR A CB    1 
ATOM   2697 C  CG    . TYR A 1 371 ? 23.568 57.949  76.379  1.00 28.64  ? 371  TYR A CG    1 
ATOM   2698 C  CD1   . TYR A 1 371 ? 23.446 58.981  75.472  1.00 25.93  ? 371  TYR A CD1   1 
ATOM   2699 C  CD2   . TYR A 1 371 ? 23.862 58.267  77.701  1.00 27.46  ? 371  TYR A CD2   1 
ATOM   2700 C  CE1   . TYR A 1 371 ? 23.608 60.280  75.857  1.00 27.03  ? 371  TYR A CE1   1 
ATOM   2701 C  CE2   . TYR A 1 371 ? 24.034 59.565  78.093  1.00 27.57  ? 371  TYR A CE2   1 
ATOM   2702 C  CZ    . TYR A 1 371 ? 23.905 60.571  77.154  1.00 27.28  ? 371  TYR A CZ    1 
ATOM   2703 O  OH    . TYR A 1 371 ? 24.049 61.876  77.505  1.00 24.71  ? 371  TYR A OH    1 
ATOM   2704 N  N     . GLN A 1 372 ? 24.511 53.785  74.536  1.00 32.01  ? 372  GLN A N     1 
ATOM   2705 C  CA    . GLN A 1 372 ? 24.131 52.415  74.216  1.00 34.37  ? 372  GLN A CA    1 
ATOM   2706 C  C     . GLN A 1 372 ? 25.326 51.475  74.139  1.00 36.33  ? 372  GLN A C     1 
ATOM   2707 O  O     . GLN A 1 372 ? 25.196 50.303  74.458  1.00 37.14  ? 372  GLN A O     1 
ATOM   2708 C  CB    . GLN A 1 372 ? 23.333 52.365  72.913  1.00 33.90  ? 372  GLN A CB    1 
ATOM   2709 C  CG    . GLN A 1 372 ? 21.977 53.055  72.986  1.00 33.77  ? 372  GLN A CG    1 
ATOM   2710 C  CD    . GLN A 1 372 ? 21.267 53.030  71.664  1.00 35.92  ? 372  GLN A CD    1 
ATOM   2711 O  OE1   . GLN A 1 372 ? 20.858 54.083  71.130  1.00 35.39  ? 372  GLN A OE1   1 
ATOM   2712 N  NE2   . GLN A 1 372 ? 21.133 51.834  71.101  1.00 32.73  ? 372  GLN A NE2   1 
ATOM   2713 N  N     . GLU A 1 373 ? 26.488 52.005  73.781  1.00 37.13  ? 373  GLU A N     1 
ATOM   2714 C  CA    . GLU A 1 373 ? 27.611 51.206  73.334  1.00 36.38  ? 373  GLU A CA    1 
ATOM   2715 C  C     . GLU A 1 373 ? 28.866 51.339  74.195  1.00 38.11  ? 373  GLU A C     1 
ATOM   2716 O  O     . GLU A 1 373 ? 29.938 50.905  73.793  1.00 41.07  ? 373  GLU A O     1 
ATOM   2717 C  CB    . GLU A 1 373 ? 27.932 51.582  71.874  1.00 38.55  ? 373  GLU A CB    1 
ATOM   2718 C  CG    . GLU A 1 373 ? 26.806 51.281  70.891  1.00 37.87  ? 373  GLU A CG    1 
ATOM   2719 C  CD    . GLU A 1 373 ? 26.414 49.804  70.900  1.00 39.00  ? 373  GLU A CD    1 
ATOM   2720 O  OE1   . GLU A 1 373 ? 25.222 49.460  70.697  1.00 40.26  ? 373  GLU A OE1   1 
ATOM   2721 O  OE2   . GLU A 1 373 ? 27.303 48.983  71.138  1.00 36.78  ? 373  GLU A OE2   1 
ATOM   2722 N  N     . GLY A 1 374 ? 28.758 51.946  75.369  1.00 38.91  ? 374  GLY A N     1 
ATOM   2723 C  CA    . GLY A 1 374 ? 29.777 51.751  76.387  1.00 38.76  ? 374  GLY A CA    1 
ATOM   2724 C  C     . GLY A 1 374 ? 30.649 52.915  76.798  1.00 36.99  ? 374  GLY A C     1 
ATOM   2725 O  O     . GLY A 1 374 ? 31.302 52.830  77.828  1.00 35.03  ? 374  GLY A O     1 
ATOM   2726 N  N     . ALA A 1 375 ? 30.684 53.990  76.022  1.00 34.28  ? 375  ALA A N     1 
ATOM   2727 C  CA    . ALA A 1 375 ? 31.506 55.153  76.387  1.00 32.05  ? 375  ALA A CA    1 
ATOM   2728 C  C     . ALA A 1 375 ? 31.201 55.696  77.790  1.00 28.81  ? 375  ALA A C     1 
ATOM   2729 O  O     . ALA A 1 375 ? 32.108 55.978  78.538  1.00 26.07  ? 375  ALA A O     1 
ATOM   2730 C  CB    . ALA A 1 375 ? 31.340 56.243  75.367  1.00 34.66  ? 375  ALA A CB    1 
ATOM   2731 N  N     . PHE A 1 376 ? 29.930 55.836  78.145  1.00 26.17  ? 376  PHE A N     1 
ATOM   2732 C  CA    . PHE A 1 376 ? 29.541 56.214  79.505  1.00 29.18  ? 376  PHE A CA    1 
ATOM   2733 C  C     . PHE A 1 376 ? 29.407 55.001  80.477  1.00 33.99  ? 376  PHE A C     1 
ATOM   2734 O  O     . PHE A 1 376 ? 28.732 55.083  81.517  1.00 31.58  ? 376  PHE A O     1 
ATOM   2735 C  CB    . PHE A 1 376 ? 28.222 57.018  79.462  1.00 29.61  ? 376  PHE A CB    1 
ATOM   2736 C  CG    . PHE A 1 376 ? 28.385 58.464  78.971  1.00 29.35  ? 376  PHE A CG    1 
ATOM   2737 C  CD1   . PHE A 1 376 ? 29.624 58.974  78.586  1.00 24.62  ? 376  PHE A CD1   1 
ATOM   2738 C  CD2   . PHE A 1 376 ? 27.287 59.306  78.919  1.00 26.54  ? 376  PHE A CD2   1 
ATOM   2739 C  CE1   . PHE A 1 376 ? 29.752 60.304  78.170  1.00 28.61  ? 376  PHE A CE1   1 
ATOM   2740 C  CE2   . PHE A 1 376 ? 27.421 60.629  78.489  1.00 26.25  ? 376  PHE A CE2   1 
ATOM   2741 C  CZ    . PHE A 1 376 ? 28.656 61.114  78.114  1.00 26.60  ? 376  PHE A CZ    1 
ATOM   2742 N  N     . GLY A 1 377 ? 30.022 53.875  80.120  1.00 36.09  ? 377  GLY A N     1 
ATOM   2743 C  CA    . GLY A 1 377 ? 30.219 52.774  81.039  1.00 39.45  ? 377  GLY A CA    1 
ATOM   2744 C  C     . GLY A 1 377 ? 29.013 51.901  81.315  1.00 41.80  ? 377  GLY A C     1 
ATOM   2745 O  O     . GLY A 1 377 ? 29.150 50.886  81.966  1.00 49.30  ? 377  GLY A O     1 
ATOM   2746 N  N     . VAL A 1 378 ? 27.834 52.293  80.865  1.00 43.78  ? 378  VAL A N     1 
ATOM   2747 C  CA    . VAL A 1 378 ? 26.669 51.431  80.973  1.00 46.00  ? 378  VAL A CA    1 
ATOM   2748 C  C     . VAL A 1 378 ? 25.876 51.440  79.681  1.00 46.56  ? 378  VAL A C     1 
ATOM   2749 O  O     . VAL A 1 378 ? 25.727 52.474  79.040  1.00 50.08  ? 378  VAL A O     1 
ATOM   2750 C  CB    . VAL A 1 378 ? 25.728 51.824  82.130  1.00 47.75  ? 378  VAL A CB    1 
ATOM   2751 C  CG1   . VAL A 1 378 ? 26.499 52.295  83.331  1.00 50.46  ? 378  VAL A CG1   1 
ATOM   2752 C  CG2   . VAL A 1 378 ? 24.752 52.868  81.706  1.00 49.54  ? 378  VAL A CG2   1 
ATOM   2753 N  N     . ARG A 1 379 ? 25.350 50.278  79.332  1.00 43.47  ? 379  ARG A N     1 
ATOM   2754 C  CA    . ARG A 1 379 ? 24.459 50.125  78.209  1.00 44.27  ? 379  ARG A CA    1 
ATOM   2755 C  C     . ARG A 1 379 ? 22.992 50.391  78.566  1.00 41.56  ? 379  ARG A C     1 
ATOM   2756 O  O     . ARG A 1 379 ? 22.343 49.590  79.239  1.00 41.61  ? 379  ARG A O     1 
ATOM   2757 C  CB    . ARG A 1 379 ? 24.597 48.710  77.664  1.00 48.97  ? 379  ARG A CB    1 
ATOM   2758 C  CG    . ARG A 1 379 ? 25.718 48.554  76.639  1.00 52.72  ? 379  ARG A CG    1 
ATOM   2759 C  CD    . ARG A 1 379 ? 27.145 48.453  77.150  1.00 52.55  ? 379  ARG A CD    1 
ATOM   2760 N  NE    . ARG A 1 379 ? 27.993 47.959  76.067  1.00 53.73  ? 379  ARG A NE    1 
ATOM   2761 C  CZ    . ARG A 1 379 ? 29.321 47.943  76.068  1.00 57.49  ? 379  ARG A CZ    1 
ATOM   2762 N  NH1   . ARG A 1 379 ? 30.019 48.399  77.106  1.00 61.10  ? 379  ARG A NH1   1 
ATOM   2763 N  NH2   . ARG A 1 379 ? 29.961 47.456  75.016  1.00 57.41  ? 379  ARG A NH2   1 
ATOM   2764 N  N     . LEU A 1 380 ? 22.489 51.528  78.099  1.00 38.30  ? 380  LEU A N     1 
ATOM   2765 C  CA    . LEU A 1 380 ? 21.062 51.849  78.100  1.00 36.56  ? 380  LEU A CA    1 
ATOM   2766 C  C     . LEU A 1 380 ? 20.420 51.293  76.822  1.00 36.00  ? 380  LEU A C     1 
ATOM   2767 O  O     . LEU A 1 380 ? 21.068 51.208  75.777  1.00 30.44  ? 380  LEU A O     1 
ATOM   2768 C  CB    . LEU A 1 380 ? 20.855 53.381  78.114  1.00 35.01  ? 380  LEU A CB    1 
ATOM   2769 C  CG    . LEU A 1 380 ? 20.749 54.157  79.434  1.00 33.99  ? 380  LEU A CG    1 
ATOM   2770 C  CD1   . LEU A 1 380 ? 21.731 53.690  80.435  1.00 34.43  ? 380  LEU A CD1   1 
ATOM   2771 C  CD2   . LEU A 1 380 ? 20.934 55.664  79.221  1.00 31.80  ? 380  LEU A CD2   1 
ATOM   2772 N  N     . LYS A 1 381 ? 19.143 50.937  76.910  1.00 38.76  ? 381  LYS A N     1 
ATOM   2773 C  CA    . LYS A 1 381 ? 18.331 50.616  75.735  1.00 40.80  ? 381  LYS A CA    1 
ATOM   2774 C  C     . LYS A 1 381 ? 17.947 51.898  75.002  1.00 40.21  ? 381  LYS A C     1 
ATOM   2775 O  O     . LYS A 1 381 ? 17.942 52.973  75.594  1.00 38.64  ? 381  LYS A O     1 
ATOM   2776 C  CB    . LYS A 1 381 ? 17.059 49.869  76.143  1.00 44.22  ? 381  LYS A CB    1 
ATOM   2777 C  CG    . LYS A 1 381 ? 17.256 48.357  76.286  1.00 48.16  ? 381  LYS A CG    1 
ATOM   2778 C  CD    . LYS A 1 381 ? 15.931 47.639  76.552  1.00 51.63  ? 381  LYS A CD    1 
ATOM   2779 C  CE    . LYS A 1 381 ? 16.154 46.232  77.137  1.00 55.68  ? 381  LYS A CE    1 
ATOM   2780 N  NZ    . LYS A 1 381 ? 17.122 45.369  76.360  1.00 56.11  ? 381  LYS A NZ    1 
ATOM   2781 N  N     . PRO A 1 382 ? 17.631 51.793  73.713  1.00 40.34  ? 382  PRO A N     1 
ATOM   2782 C  CA    . PRO A 1 382 ? 17.211 52.959  72.913  1.00 39.46  ? 382  PRO A CA    1 
ATOM   2783 C  C     . PRO A 1 382 ? 16.120 53.839  73.541  1.00 40.33  ? 382  PRO A C     1 
ATOM   2784 O  O     . PRO A 1 382 ? 16.166 55.074  73.411  1.00 40.50  ? 382  PRO A O     1 
ATOM   2785 C  CB    . PRO A 1 382 ? 16.696 52.315  71.618  1.00 39.26  ? 382  PRO A CB    1 
ATOM   2786 C  CG    . PRO A 1 382 ? 17.461 51.039  71.499  1.00 38.41  ? 382  PRO A CG    1 
ATOM   2787 C  CD    . PRO A 1 382 ? 17.710 50.562  72.904  1.00 37.49  ? 382  PRO A CD    1 
ATOM   2788 N  N     . ASP A 1 383 ? 15.160 53.215  74.219  1.00 40.92  ? 383  ASP A N     1 
ATOM   2789 C  CA    . ASP A 1 383 ? 14.004 53.930  74.761  1.00 41.67  ? 383  ASP A CA    1 
ATOM   2790 C  C     . ASP A 1 383 ? 14.168 54.349  76.231  1.00 36.76  ? 383  ASP A C     1 
ATOM   2791 O  O     . ASP A 1 383 ? 13.210 54.819  76.861  1.00 36.33  ? 383  ASP A O     1 
ATOM   2792 C  CB    . ASP A 1 383 ? 12.720 53.107  74.540  1.00 47.33  ? 383  ASP A CB    1 
ATOM   2793 C  CG    . ASP A 1 383 ? 12.758 51.725  75.233  1.00 55.85  ? 383  ASP A CG    1 
ATOM   2794 O  OD1   . ASP A 1 383 ? 13.683 50.903  74.945  1.00 58.14  ? 383  ASP A OD1   1 
ATOM   2795 O  OD2   . ASP A 1 383 ? 11.886 51.373  76.075  1.00 59.55  ? 383  ASP A OD2   1 
ATOM   2796 N  N     . ASP A 1 384 ? 15.375 54.178  76.775  1.00 32.27  ? 384  ASP A N     1 
ATOM   2797 C  CA    . ASP A 1 384 ? 15.705 54.606  78.131  1.00 32.95  ? 384  ASP A CA    1 
ATOM   2798 C  C     . ASP A 1 384 ? 16.001 56.116  78.188  1.00 35.36  ? 384  ASP A C     1 
ATOM   2799 O  O     . ASP A 1 384 ? 16.565 56.679  77.252  1.00 33.89  ? 384  ASP A O     1 
ATOM   2800 C  CB    . ASP A 1 384 ? 16.950 53.867  78.642  1.00 36.12  ? 384  ASP A CB    1 
ATOM   2801 C  CG    . ASP A 1 384 ? 16.673 52.418  79.085  1.00 37.77  ? 384  ASP A CG    1 
ATOM   2802 O  OD1   . ASP A 1 384 ? 15.487 51.992  79.131  1.00 35.94  ? 384  ASP A OD1   1 
ATOM   2803 O  OD2   . ASP A 1 384 ? 17.620 51.652  79.421  1.00 36.29  ? 384  ASP A OD2   1 
ATOM   2804 N  N     . ASP A 1 385 ? 15.636 56.754  79.299  1.00 37.57  ? 385  ASP A N     1 
ATOM   2805 C  CA    . ASP A 1 385 ? 15.969 58.159  79.557  1.00 38.05  ? 385  ASP A CA    1 
ATOM   2806 C  C     . ASP A 1 385 ? 17.401 58.294  80.053  1.00 37.14  ? 385  ASP A C     1 
ATOM   2807 O  O     . ASP A 1 385 ? 17.805 57.595  80.974  1.00 41.08  ? 385  ASP A O     1 
ATOM   2808 C  CB    . ASP A 1 385 ? 15.019 58.749  80.591  1.00 40.24  ? 385  ASP A CB    1 
ATOM   2809 C  CG    . ASP A 1 385 ? 13.597 58.874  80.078  1.00 43.17  ? 385  ASP A CG    1 
ATOM   2810 O  OD1   . ASP A 1 385 ? 13.373 58.732  78.862  1.00 47.10  ? 385  ASP A OD1   1 
ATOM   2811 O  OD2   . ASP A 1 385 ? 12.625 59.118  80.817  1.00 47.42  ? 385  ASP A OD2   1 
ATOM   2812 N  N     . ILE A 1 386 ? 18.162 59.203  79.454  1.00 34.61  ? 386  ILE A N     1 
ATOM   2813 C  CA    . ILE A 1 386 ? 19.586 59.332  79.763  1.00 33.97  ? 386  ILE A CA    1 
ATOM   2814 C  C     . ILE A 1 386 ? 19.859 60.006  81.104  1.00 32.45  ? 386  ILE A C     1 
ATOM   2815 O  O     . ILE A 1 386 ? 20.953 59.910  81.629  1.00 31.89  ? 386  ILE A O     1 
ATOM   2816 C  CB    . ILE A 1 386 ? 20.335 60.111  78.641  1.00 35.76  ? 386  ILE A CB    1 
ATOM   2817 C  CG1   . ILE A 1 386 ? 19.853 61.578  78.563  1.00 36.70  ? 386  ILE A CG1   1 
ATOM   2818 C  CG2   . ILE A 1 386 ? 20.168 59.416  77.300  1.00 34.11  ? 386  ILE A CG2   1 
ATOM   2819 C  CD1   . ILE A 1 386 ? 20.641 62.417  77.617  1.00 36.93  ? 386  ILE A CD1   1 
ATOM   2820 N  N     . ILE A 1 387 ? 18.890 60.724  81.644  1.00 33.06  ? 387  ILE A N     1 
ATOM   2821 C  CA    . ILE A 1 387 ? 19.168 61.549  82.819  1.00 34.36  ? 387  ILE A CA    1 
ATOM   2822 C  C     . ILE A 1 387 ? 19.318 60.704  84.079  1.00 32.61  ? 387  ILE A C     1 
ATOM   2823 O  O     . ILE A 1 387 ? 20.043 61.066  84.998  1.00 32.69  ? 387  ILE A O     1 
ATOM   2824 C  CB    . ILE A 1 387 ? 18.118 62.683  82.981  1.00 34.90  ? 387  ILE A CB    1 
ATOM   2825 C  CG1   . ILE A 1 387 ? 18.640 63.740  83.958  1.00 36.42  ? 387  ILE A CG1   1 
ATOM   2826 C  CG2   . ILE A 1 387 ? 16.758 62.129  83.435  1.00 36.06  ? 387  ILE A CG2   1 
ATOM   2827 C  CD1   . ILE A 1 387 ? 17.739 64.955  84.083  1.00 37.87  ? 387  ILE A CD1   1 
ATOM   2828 N  N     . GLU A 1 388 ? 18.676 59.542  84.102  1.00 37.69  ? 388  GLU A N     1 
ATOM   2829 C  CA    . GLU A 1 388 ? 18.773 58.637  85.255  1.00 35.48  ? 388  GLU A CA    1 
ATOM   2830 C  C     . GLU A 1 388 ? 20.217 58.166  85.467  1.00 33.27  ? 388  GLU A C     1 
ATOM   2831 O  O     . GLU A 1 388 ? 20.673 57.938  86.602  1.00 35.63  ? 388  GLU A O     1 
ATOM   2832 C  CB    . GLU A 1 388 ? 17.840 57.461  85.062  1.00 38.30  ? 388  GLU A CB    1 
ATOM   2833 C  CG    . GLU A 1 388 ? 16.380 57.816  84.761  1.00 42.88  ? 388  GLU A CG    1 
ATOM   2834 C  CD    . GLU A 1 388 ? 15.729 58.711  85.800  1.00 44.51  ? 388  GLU A CD    1 
ATOM   2835 O  OE1   . GLU A 1 388 ? 16.077 58.622  86.997  1.00 46.99  ? 388  GLU A OE1   1 
ATOM   2836 O  OE2   . GLU A 1 388 ? 14.860 59.519  85.414  1.00 46.79  ? 388  GLU A OE2   1 
ATOM   2837 N  N     . LEU A 1 389 ? 20.947 58.045  84.368  1.00 28.86  ? 389  LEU A N     1 
ATOM   2838 C  CA    . LEU A 1 389 ? 22.361 57.720  84.425  1.00 27.49  ? 389  LEU A CA    1 
ATOM   2839 C  C     . LEU A 1 389 ? 23.170 58.740  85.207  1.00 31.33  ? 389  LEU A C     1 
ATOM   2840 O  O     . LEU A 1 389 ? 24.170 58.386  85.826  1.00 34.62  ? 389  LEU A O     1 
ATOM   2841 C  CB    . LEU A 1 389 ? 22.923 57.589  83.013  1.00 26.65  ? 389  LEU A CB    1 
ATOM   2842 C  CG    . LEU A 1 389 ? 24.412 57.272  82.884  1.00 30.02  ? 389  LEU A CG    1 
ATOM   2843 C  CD1   . LEU A 1 389 ? 24.754 55.983  83.635  1.00 31.82  ? 389  LEU A CD1   1 
ATOM   2844 C  CD2   . LEU A 1 389 ? 24.758 57.133  81.424  1.00 29.93  ? 389  LEU A CD2   1 
ATOM   2845 N  N     . PHE A 1 390 ? 22.764 60.008  85.153  1.00 32.42  ? 390  PHE A N     1 
ATOM   2846 C  CA    . PHE A 1 390 ? 23.540 61.086  85.754  1.00 32.38  ? 390  PHE A CA    1 
ATOM   2847 C  C     . PHE A 1 390 ? 23.292 61.302  87.236  1.00 30.53  ? 390  PHE A C     1 
ATOM   2848 O  O     . PHE A 1 390 ? 24.125 61.900  87.909  1.00 33.63  ? 390  PHE A O     1 
ATOM   2849 C  CB    . PHE A 1 390 ? 23.278 62.407  85.015  1.00 31.87  ? 390  PHE A CB    1 
ATOM   2850 C  CG    . PHE A 1 390 ? 23.468 62.315  83.535  1.00 35.44  ? 390  PHE A CG    1 
ATOM   2851 C  CD1   . PHE A 1 390 ? 22.620 62.998  82.670  1.00 33.54  ? 390  PHE A CD1   1 
ATOM   2852 C  CD2   . PHE A 1 390 ? 24.499 61.531  82.989  1.00 36.46  ? 390  PHE A CD2   1 
ATOM   2853 C  CE1   . PHE A 1 390 ? 22.804 62.911  81.295  1.00 33.05  ? 390  PHE A CE1   1 
ATOM   2854 C  CE2   . PHE A 1 390 ? 24.676 61.448  81.622  1.00 35.60  ? 390  PHE A CE2   1 
ATOM   2855 C  CZ    . PHE A 1 390 ? 23.832 62.133  80.776  1.00 33.41  ? 390  PHE A CZ    1 
ATOM   2856 N  N     . LYS A 1 391 ? 22.141 60.854  87.719  1.00 32.11  ? 391  LYS A N     1 
ATOM   2857 C  CA    . LYS A 1 391 ? 21.660 61.127  89.078  1.00 33.30  ? 391  LYS A CA    1 
ATOM   2858 C  C     . LYS A 1 391 ? 22.485 60.502  90.205  1.00 33.47  ? 391  LYS A C     1 
ATOM   2859 O  O     . LYS A 1 391 ? 23.321 59.631  89.967  1.00 34.08  ? 391  LYS A O     1 
ATOM   2860 C  CB    . LYS A 1 391 ? 20.232 60.629  89.233  1.00 34.82  ? 391  LYS A CB    1 
ATOM   2861 C  CG    . LYS A 1 391 ? 19.219 61.318  88.369  1.00 38.14  ? 391  LYS A CG    1 
ATOM   2862 C  CD    . LYS A 1 391 ? 17.825 61.193  89.009  1.00 41.83  ? 391  LYS A CD    1 
ATOM   2863 C  CE    . LYS A 1 391 ? 16.794 62.072  88.327  1.00 42.78  ? 391  LYS A CE    1 
ATOM   2864 N  NZ    . LYS A 1 391 ? 15.802 61.203  87.625  1.00 45.75  ? 391  LYS A NZ    1 
ATOM   2865 N  N     . ASN A 1 392 ? 22.256 61.008  91.422  1.00 36.52  ? 392  ASN A N     1 
ATOM   2866 C  CA    . ASN A 1 392 ? 22.804 60.453  92.673  1.00 38.19  ? 392  ASN A CA    1 
ATOM   2867 C  C     . ASN A 1 392 ? 24.308 60.386  92.721  1.00 36.62  ? 392  ASN A C     1 
ATOM   2868 O  O     . ASN A 1 392 ? 24.885 59.486  93.334  1.00 35.68  ? 392  ASN A O     1 
ATOM   2869 C  CB    . ASN A 1 392 ? 22.190 59.078  92.995  1.00 38.25  ? 392  ASN A CB    1 
ATOM   2870 C  CG    . ASN A 1 392 ? 20.660 59.110  92.957  1.00 43.85  ? 392  ASN A CG    1 
ATOM   2871 O  OD1   . ASN A 1 392 ? 20.013 58.191  92.434  1.00 45.61  ? 392  ASN A OD1   1 
ATOM   2872 N  ND2   . ASN A 1 392 ? 20.074 60.193  93.484  1.00 42.47  ? 392  ASN A ND2   1 
ATOM   2873 N  N     . GLY A 1 393 ? 24.937 61.352  92.066  1.00 34.96  ? 393  GLY A N     1 
ATOM   2874 C  CA    . GLY A 1 393 ? 26.357 61.598  92.245  1.00 32.64  ? 393  GLY A CA    1 
ATOM   2875 C  C     . GLY A 1 393 ? 27.219 61.019  91.167  1.00 32.69  ? 393  GLY A C     1 
ATOM   2876 O  O     . GLY A 1 393 ? 28.439 61.186  91.208  1.00 36.50  ? 393  GLY A O     1 
ATOM   2877 N  N     . ARG A 1 394 ? 26.620 60.329  90.200  1.00 33.26  ? 394  ARG A N     1 
ATOM   2878 C  CA    . ARG A 1 394 ? 27.430 59.713  89.145  1.00 33.19  ? 394  ARG A CA    1 
ATOM   2879 C  C     . ARG A 1 394 ? 28.117 60.791  88.299  1.00 31.96  ? 394  ARG A C     1 
ATOM   2880 O  O     . ARG A 1 394 ? 29.344 60.809  88.180  1.00 30.71  ? 394  ARG A O     1 
ATOM   2881 C  CB    . ARG A 1 394 ? 26.594 58.782  88.275  1.00 34.54  ? 394  ARG A CB    1 
ATOM   2882 C  CG    . ARG A 1 394 ? 27.425 57.857  87.417  1.00 35.86  ? 394  ARG A CG    1 
ATOM   2883 C  CD    . ARG A 1 394 ? 26.623 56.718  86.798  1.00 36.76  ? 394  ARG A CD    1 
ATOM   2884 N  NE    . ARG A 1 394 ? 27.492 55.718  86.196  1.00 35.58  ? 394  ARG A NE    1 
ATOM   2885 C  CZ    . ARG A 1 394 ? 28.094 55.835  85.018  1.00 36.18  ? 394  ARG A CZ    1 
ATOM   2886 N  NH1   . ARG A 1 394 ? 27.930 56.921  84.280  1.00 37.85  ? 394  ARG A NH1   1 
ATOM   2887 N  NH2   . ARG A 1 394 ? 28.870 54.850  84.569  1.00 38.00  ? 394  ARG A NH2   1 
ATOM   2888 N  N     . SER A 1 395 ? 27.330 61.701  87.734  1.00 31.49  ? 395  SER A N     1 
ATOM   2889 C  CA    . SER A 1 395 ? 27.891 62.842  86.979  1.00 32.83  ? 395  SER A CA    1 
ATOM   2890 C  C     . SER A 1 395 ? 28.176 64.024  87.905  1.00 30.54  ? 395  SER A C     1 
ATOM   2891 O  O     . SER A 1 395 ? 27.445 64.247  88.864  1.00 29.71  ? 395  SER A O     1 
ATOM   2892 C  CB    . SER A 1 395 ? 26.912 63.319  85.895  1.00 30.78  ? 395  SER A CB    1 
ATOM   2893 O  OG    . SER A 1 395 ? 26.468 62.257  85.079  1.00 28.85  ? 395  SER A OG    1 
ATOM   2894 N  N     . SER A 1 396 ? 29.233 64.775  87.620  1.00 30.64  ? 396  SER A N     1 
ATOM   2895 C  CA    . SER A 1 396 ? 29.451 66.072  88.274  1.00 31.04  ? 396  SER A CA    1 
ATOM   2896 C  C     . SER A 1 396 ? 28.766 67.206  87.515  1.00 31.84  ? 396  SER A C     1 
ATOM   2897 O  O     . SER A 1 396 ? 28.348 67.039  86.376  1.00 30.64  ? 396  SER A O     1 
ATOM   2898 C  CB    . SER A 1 396 ? 30.936 66.384  88.420  1.00 30.42  ? 396  SER A CB    1 
ATOM   2899 O  OG    . SER A 1 396 ? 31.528 66.576  87.149  1.00 30.82  ? 396  SER A OG    1 
ATOM   2900 N  N     . VAL A 1 397 ? 28.653 68.353  88.186  1.00 32.98  ? 397  VAL A N     1 
ATOM   2901 C  CA    . VAL A 1 397 ? 28.048 69.570  87.649  1.00 30.07  ? 397  VAL A CA    1 
ATOM   2902 C  C     . VAL A 1 397 ? 28.869 70.708  88.226  1.00 31.75  ? 397  VAL A C     1 
ATOM   2903 O  O     . VAL A 1 397 ? 29.198 70.690  89.405  1.00 34.89  ? 397  VAL A O     1 
ATOM   2904 C  CB    . VAL A 1 397 ? 26.585 69.738  88.082  1.00 31.07  ? 397  VAL A CB    1 
ATOM   2905 C  CG1   . VAL A 1 397 ? 25.897 70.879  87.307  1.00 31.05  ? 397  VAL A CG1   1 
ATOM   2906 C  CG2   . VAL A 1 397 ? 25.819 68.440  87.896  1.00 29.83  ? 397  VAL A CG2   1 
ATOM   2907 N  N     . SER A 1 398 ? 29.176 71.701  87.400  1.00 29.91  ? 398  SER A N     1 
ATOM   2908 C  CA    . SER A 1 398 ? 30.263 72.613  87.657  1.00 30.91  ? 398  SER A CA    1 
ATOM   2909 C  C     . SER A 1 398 ? 29.797 74.039  87.939  1.00 31.00  ? 398  SER A C     1 
ATOM   2910 O  O     . SER A 1 398 ? 29.151 74.655  87.102  1.00 31.85  ? 398  SER A O     1 
ATOM   2911 C  CB    . SER A 1 398 ? 31.212 72.615  86.451  1.00 31.79  ? 398  SER A CB    1 
ATOM   2912 O  OG    . SER A 1 398 ? 32.104 71.525  86.498  1.00 28.87  ? 398  SER A OG    1 
ATOM   2913 N  N     . LEU A 1 399 ? 30.110 74.543  89.131  1.00 32.65  ? 399  LEU A N     1 
ATOM   2914 C  CA    . LEU A 1 399 ? 30.005 75.976  89.432  1.00 33.24  ? 399  LEU A CA    1 
ATOM   2915 C  C     . LEU A 1 399 ? 31.400 76.543  89.328  1.00 31.93  ? 399  LEU A C     1 
ATOM   2916 O  O     . LEU A 1 399 ? 32.221 76.345  90.209  1.00 34.51  ? 399  LEU A O     1 
ATOM   2917 C  CB    . LEU A 1 399 ? 29.443 76.231  90.832  1.00 33.08  ? 399  LEU A CB    1 
ATOM   2918 C  CG    . LEU A 1 399 ? 29.495 77.683  91.320  1.00 36.07  ? 399  LEU A CG    1 
ATOM   2919 C  CD1   . LEU A 1 399 ? 28.594 78.595  90.495  1.00 34.94  ? 399  LEU A CD1   1 
ATOM   2920 C  CD2   . LEU A 1 399 ? 29.116 77.772  92.791  1.00 36.64  ? 399  LEU A CD2   1 
ATOM   2921 N  N     . GLY A 1 400 ? 31.664 77.210  88.216  1.00 29.88  ? 400  GLY A N     1 
ATOM   2922 C  CA    . GLY A 1 400 ? 32.892 77.922  88.001  1.00 28.87  ? 400  GLY A CA    1 
ATOM   2923 C  C     . GLY A 1 400 ? 32.963 79.269  88.720  1.00 30.63  ? 400  GLY A C     1 
ATOM   2924 O  O     . GLY A 1 400 ? 31.960 79.815  89.210  1.00 29.25  ? 400  GLY A O     1 
ATOM   2925 N  N     . TYR A 1 401 ? 34.193 79.765  88.799  1.00 28.27  ? 401  TYR A N     1 
ATOM   2926 C  CA    . TYR A 1 401 ? 34.501 81.069  89.347  1.00 30.90  ? 401  TYR A CA    1 
ATOM   2927 C  C     . TYR A 1 401 ? 35.779 81.551  88.680  1.00 32.52  ? 401  TYR A C     1 
ATOM   2928 O  O     . TYR A 1 401 ? 36.469 80.781  88.002  1.00 31.80  ? 401  TYR A O     1 
ATOM   2929 C  CB    . TYR A 1 401 ? 34.718 81.011  90.861  1.00 27.80  ? 401  TYR A CB    1 
ATOM   2930 C  CG    . TYR A 1 401 ? 35.917 80.190  91.224  1.00 27.39  ? 401  TYR A CG    1 
ATOM   2931 C  CD1   . TYR A 1 401 ? 37.104 80.791  91.575  1.00 26.76  ? 401  TYR A CD1   1 
ATOM   2932 C  CD2   . TYR A 1 401 ? 35.870 78.794  91.193  1.00 28.93  ? 401  TYR A CD2   1 
ATOM   2933 C  CE1   . TYR A 1 401 ? 38.199 80.047  91.896  1.00 27.04  ? 401  TYR A CE1   1 
ATOM   2934 C  CE2   . TYR A 1 401 ? 36.975 78.038  91.506  1.00 25.61  ? 401  TYR A CE2   1 
ATOM   2935 C  CZ    . TYR A 1 401 ? 38.136 78.676  91.851  1.00 27.28  ? 401  TYR A CZ    1 
ATOM   2936 O  OH    . TYR A 1 401 ? 39.260 77.955  92.167  1.00 31.55  ? 401  TYR A OH    1 
ATOM   2937 N  N     . ILE A 1 402 ? 36.087 82.822  88.909  1.00 31.12  ? 402  ILE A N     1 
ATOM   2938 C  CA    . ILE A 1 402 ? 37.269 83.448  88.363  1.00 33.00  ? 402  ILE A CA    1 
ATOM   2939 C  C     . ILE A 1 402 ? 37.627 84.748  89.103  1.00 34.86  ? 402  ILE A C     1 
ATOM   2940 O  O     . ILE A 1 402 ? 36.754 85.404  89.673  1.00 32.37  ? 402  ILE A O     1 
ATOM   2941 C  CB    . ILE A 1 402 ? 37.038 83.745  86.855  1.00 31.41  ? 402  ILE A CB    1 
ATOM   2942 C  CG1   . ILE A 1 402 ? 38.247 84.418  86.227  1.00 31.93  ? 402  ILE A CG1   1 
ATOM   2943 C  CG2   . ILE A 1 402 ? 35.814 84.601  86.639  1.00 33.01  ? 402  ILE A CG2   1 
ATOM   2944 C  CD1   . ILE A 1 402 ? 38.306 84.219  84.724  1.00 33.47  ? 402  ILE A CD1   1 
ATOM   2945 N  N     . GLY A 1 403 ? 38.921 85.085  89.086  1.00 35.07  ? 403  GLY A N     1 
ATOM   2946 C  CA    . GLY A 1 403 ? 39.401 86.399  89.445  1.00 37.40  ? 403  GLY A CA    1 
ATOM   2947 C  C     . GLY A 1 403 ? 39.523 86.642  90.928  1.00 39.94  ? 403  GLY A C     1 
ATOM   2948 O  O     . GLY A 1 403 ? 39.130 87.690  91.409  1.00 41.60  ? 403  GLY A O     1 
ATOM   2949 N  N     . ILE A 1 404 ? 40.070 85.678  91.652  1.00 41.47  ? 404  ILE A N     1 
ATOM   2950 C  CA    . ILE A 1 404 ? 40.260 85.836  93.083  1.00 42.59  ? 404  ILE A CA    1 
ATOM   2951 C  C     . ILE A 1 404 ? 41.219 86.988  93.351  1.00 42.14  ? 404  ILE A C     1 
ATOM   2952 O  O     . ILE A 1 404 ? 40.998 87.783  94.234  1.00 40.74  ? 404  ILE A O     1 
ATOM   2953 C  CB    . ILE A 1 404 ? 40.730 84.498  93.724  1.00 42.73  ? 404  ILE A CB    1 
ATOM   2954 C  CG1   . ILE A 1 404 ? 39.500 83.602  93.924  1.00 45.98  ? 404  ILE A CG1   1 
ATOM   2955 C  CG2   . ILE A 1 404 ? 41.438 84.726  95.046  1.00 41.70  ? 404  ILE A CG2   1 
ATOM   2956 C  CD1   . ILE A 1 404 ? 39.772 82.298  94.603  1.00 48.14  ? 404  ILE A CD1   1 
ATOM   2957 N  N     . HIS A 1 405 ? 42.269 87.086  92.563  1.00 42.17  ? 405  HIS A N     1 
ATOM   2958 C  CA    . HIS A 1 405 ? 43.223 88.161  92.721  1.00 44.20  ? 405  HIS A CA    1 
ATOM   2959 C  C     . HIS A 1 405 ? 42.532 89.545  92.724  1.00 43.40  ? 405  HIS A C     1 
ATOM   2960 O  O     . HIS A 1 405 ? 42.698 90.338  93.644  1.00 43.47  ? 405  HIS A O     1 
ATOM   2961 C  CB    . HIS A 1 405 ? 44.242 88.066  91.598  1.00 46.01  ? 405  HIS A CB    1 
ATOM   2962 C  CG    . HIS A 1 405 ? 45.283 89.122  91.656  1.00 48.34  ? 405  HIS A CG    1 
ATOM   2963 N  ND1   . HIS A 1 405 ? 46.155 89.237  92.714  1.00 49.60  ? 405  HIS A ND1   1 
ATOM   2964 C  CD2   . HIS A 1 405 ? 45.582 90.125  90.799  1.00 48.80  ? 405  HIS A CD2   1 
ATOM   2965 C  CE1   . HIS A 1 405 ? 46.958 90.264  92.498  1.00 52.64  ? 405  HIS A CE1   1 
ATOM   2966 N  NE2   . HIS A 1 405 ? 46.628 90.821  91.345  1.00 49.62  ? 405  HIS A NE2   1 
ATOM   2967 N  N     . GLU A 1 406 ? 41.720 89.789  91.705  1.00 41.85  ? 406  GLU A N     1 
ATOM   2968 C  CA    . GLU A 1 406 ? 40.985 91.035  91.545  1.00 41.21  ? 406  GLU A CA    1 
ATOM   2969 C  C     . GLU A 1 406 ? 39.848 91.204  92.583  1.00 40.33  ? 406  GLU A C     1 
ATOM   2970 O  O     . GLU A 1 406 ? 39.449 92.320  92.917  1.00 39.17  ? 406  GLU A O     1 
ATOM   2971 C  CB    . GLU A 1 406 ? 40.436 91.122  90.111  1.00 42.40  ? 406  GLU A CB    1 
ATOM   2972 C  CG    . GLU A 1 406 ? 41.512 91.283  89.035  1.00 42.16  ? 406  GLU A CG    1 
ATOM   2973 C  CD    . GLU A 1 406 ? 42.103 89.965  88.537  1.00 44.41  ? 406  GLU A CD    1 
ATOM   2974 O  OE1   . GLU A 1 406 ? 41.574 88.887  88.903  1.00 44.78  ? 406  GLU A OE1   1 
ATOM   2975 O  OE2   . GLU A 1 406 ? 43.098 90.002  87.764  1.00 45.65  ? 406  GLU A OE2   1 
ATOM   2976 N  N     . LEU A 1 407 ? 39.343 90.095  93.100  1.00 39.90  ? 407  LEU A N     1 
ATOM   2977 C  CA    . LEU A 1 407 ? 38.406 90.116  94.220  1.00 39.04  ? 407  LEU A CA    1 
ATOM   2978 C  C     . LEU A 1 407 ? 39.102 90.609  95.493  1.00 37.51  ? 407  LEU A C     1 
ATOM   2979 O  O     . LEU A 1 407 ? 38.561 91.421  96.228  1.00 35.05  ? 407  LEU A O     1 
ATOM   2980 C  CB    . LEU A 1 407 ? 37.842 88.723  94.451  1.00 36.22  ? 407  LEU A CB    1 
ATOM   2981 C  CG    . LEU A 1 407 ? 36.848 88.579  95.593  1.00 36.56  ? 407  LEU A CG    1 
ATOM   2982 C  CD1   . LEU A 1 407 ? 35.554 89.267  95.278  1.00 36.27  ? 407  LEU A CD1   1 
ATOM   2983 C  CD2   . LEU A 1 407 ? 36.615 87.100  95.910  1.00 37.65  ? 407  LEU A CD2   1 
ATOM   2984 N  N     . ASN A 1 408 ? 40.303 90.103  95.743  1.00 37.44  ? 408  ASN A N     1 
ATOM   2985 C  CA    . ASN A 1 408 ? 41.072 90.465  96.926  1.00 35.77  ? 408  ASN A CA    1 
ATOM   2986 C  C     . ASN A 1 408 ? 41.419 91.954  96.954  1.00 38.75  ? 408  ASN A C     1 
ATOM   2987 O  O     . ASN A 1 408 ? 41.229 92.611  97.965  1.00 40.77  ? 408  ASN A O     1 
ATOM   2988 C  CB    . ASN A 1 408 ? 42.325 89.620  97.015  1.00 33.13  ? 408  ASN A CB    1 
ATOM   2989 C  CG    . ASN A 1 408 ? 42.024 88.149  97.324  1.00 34.74  ? 408  ASN A CG    1 
ATOM   2990 O  OD1   . ASN A 1 408 ? 40.943 87.803  97.813  1.00 32.42  ? 408  ASN A OD1   1 
ATOM   2991 N  ND2   . ASN A 1 408 ? 42.992 87.281  97.047  1.00 33.65  ? 408  ASN A ND2   1 
ATOM   2992 N  N     . ILE A 1 409 ? 41.889 92.481  95.831  1.00 41.76  ? 409  ILE A N     1 
ATOM   2993 C  CA    . ILE A 1 409 ? 42.107 93.920  95.660  1.00 42.77  ? 409  ILE A CA    1 
ATOM   2994 C  C     . ILE A 1 409 ? 40.840 94.730  95.947  1.00 43.15  ? 409  ILE A C     1 
ATOM   2995 O  O     . ILE A 1 409 ? 40.894 95.724  96.650  1.00 45.28  ? 409  ILE A O     1 
ATOM   2996 C  CB    . ILE A 1 409 ? 42.637 94.229  94.219  1.00 43.61  ? 409  ILE A CB    1 
ATOM   2997 C  CG1   . ILE A 1 409 ? 44.099 93.776  94.075  1.00 45.15  ? 409  ILE A CG1   1 
ATOM   2998 C  CG2   . ILE A 1 409 ? 42.534 95.735  93.893  1.00 41.55  ? 409  ILE A CG2   1 
ATOM   2999 C  CD1   . ILE A 1 409 ? 44.507 93.502  92.638  1.00 48.47  ? 409  ILE A CD1   1 
ATOM   3000 N  N     . LEU A 1 410 ? 39.702 94.295  95.413  1.00 42.23  ? 410  LEU A N     1 
ATOM   3001 C  CA    . LEU A 1 410 ? 38.463 95.054  95.546  1.00 40.71  ? 410  LEU A CA    1 
ATOM   3002 C  C     . LEU A 1 410 ? 37.937 95.105  96.986  1.00 41.82  ? 410  LEU A C     1 
ATOM   3003 O  O     . LEU A 1 410 ? 37.453 96.147  97.427  1.00 42.12  ? 410  LEU A O     1 
ATOM   3004 C  CB    . LEU A 1 410 ? 37.388 94.502  94.604  1.00 38.51  ? 410  LEU A CB    1 
ATOM   3005 C  CG    . LEU A 1 410 ? 37.586 94.841  93.126  1.00 39.36  ? 410  LEU A CG    1 
ATOM   3006 C  CD1   . LEU A 1 410 ? 36.765 93.918  92.214  1.00 37.48  ? 410  LEU A CD1   1 
ATOM   3007 C  CD2   . LEU A 1 410 ? 37.268 96.328  92.846  1.00 39.52  ? 410  LEU A CD2   1 
ATOM   3008 N  N     . VAL A 1 411 ? 38.035 93.991  97.710  1.00 42.56  ? 411  VAL A N     1 
ATOM   3009 C  CA    . VAL A 1 411 ? 37.573 93.926  99.098  1.00 42.73  ? 411  VAL A CA    1 
ATOM   3010 C  C     . VAL A 1 411 ? 38.640 94.352  100.108 1.00 42.83  ? 411  VAL A C     1 
ATOM   3011 O  O     . VAL A 1 411 ? 38.344 94.427  101.285 1.00 45.90  ? 411  VAL A O     1 
ATOM   3012 C  CB    . VAL A 1 411 ? 37.073 92.493  99.504  1.00 42.09  ? 411  VAL A CB    1 
ATOM   3013 C  CG1   . VAL A 1 411 ? 36.102 91.936  98.501  1.00 38.99  ? 411  VAL A CG1   1 
ATOM   3014 C  CG2   . VAL A 1 411 ? 38.239 91.538  99.714  1.00 44.58  ? 411  VAL A CG2   1 
ATOM   3015 N  N     . GLY A 1 412 ? 39.872 94.581  99.655  1.00 45.40  ? 412  GLY A N     1 
ATOM   3016 C  CA    . GLY A 1 412 ? 40.965 95.034  100.506 1.00 47.79  ? 412  GLY A CA    1 
ATOM   3017 C  C     . GLY A 1 412 ? 41.751 93.994  101.296 1.00 51.00  ? 412  GLY A C     1 
ATOM   3018 O  O     . GLY A 1 412 ? 42.694 94.348  101.999 1.00 54.28  ? 412  GLY A O     1 
ATOM   3019 N  N     . ARG A 1 413 ? 41.371 92.723  101.203 1.00 53.17  ? 413  ARG A N     1 
ATOM   3020 C  CA    . ARG A 1 413 ? 42.089 91.640  101.889 1.00 52.97  ? 413  ARG A CA    1 
ATOM   3021 C  C     . ARG A 1 413 ? 41.913 90.294  101.185 1.00 51.22  ? 413  ARG A C     1 
ATOM   3022 O  O     . ARG A 1 413 ? 41.108 90.164  100.268 1.00 48.84  ? 413  ARG A O     1 
ATOM   3023 C  CB    . ARG A 1 413 ? 41.644 91.535  103.351 1.00 55.04  ? 413  ARG A CB    1 
ATOM   3024 C  CG    . ARG A 1 413 ? 40.209 91.052  103.571 1.00 57.61  ? 413  ARG A CG    1 
ATOM   3025 C  CD    . ARG A 1 413 ? 39.765 91.089  105.031 1.00 59.35  ? 413  ARG A CD    1 
ATOM   3026 N  NE    . ARG A 1 413 ? 38.644 90.192  105.323 1.00 62.85  ? 413  ARG A NE    1 
ATOM   3027 C  CZ    . ARG A 1 413 ? 37.349 90.468  105.102 1.00 65.42  ? 413  ARG A CZ    1 
ATOM   3028 N  NH1   . ARG A 1 413 ? 36.963 91.624  104.560 1.00 64.65  ? 413  ARG A NH1   1 
ATOM   3029 N  NH2   . ARG A 1 413 ? 36.422 89.570  105.427 1.00 65.53  ? 413  ARG A NH2   1 
ATOM   3030 N  N     . ASP A 1 414 ? 42.690 89.302  101.612 1.00 51.44  ? 414  ASP A N     1 
ATOM   3031 C  CA    . ASP A 1 414 ? 42.640 87.956  101.029 1.00 50.20  ? 414  ASP A CA    1 
ATOM   3032 C  C     . ASP A 1 414 ? 41.439 87.173  101.555 1.00 46.81  ? 414  ASP A C     1 
ATOM   3033 O  O     . ASP A 1 414 ? 41.440 86.718  102.688 1.00 47.80  ? 414  ASP A O     1 
ATOM   3034 C  CB    . ASP A 1 414 ? 43.941 87.191  101.325 1.00 51.60  ? 414  ASP A CB    1 
ATOM   3035 C  CG    . ASP A 1 414 ? 44.030 85.840  100.595 1.00 54.03  ? 414  ASP A CG    1 
ATOM   3036 O  OD1   . ASP A 1 414 ? 43.109 85.451  99.833  1.00 54.92  ? 414  ASP A OD1   1 
ATOM   3037 O  OD2   . ASP A 1 414 ? 45.006 85.081  100.738 1.00 55.74  ? 414  ASP A OD2   1 
ATOM   3038 N  N     . ILE A 1 415 ? 40.416 87.020  100.723 1.00 44.03  ? 415  ILE A N     1 
ATOM   3039 C  CA    . ILE A 1 415 ? 39.231 86.246  101.089 1.00 42.70  ? 415  ILE A CA    1 
ATOM   3040 C  C     . ILE A 1 415 ? 39.033 84.978  100.238 1.00 40.97  ? 415  ILE A C     1 
ATOM   3041 O  O     . ILE A 1 415 ? 37.986 84.366  100.313 1.00 40.48  ? 415  ILE A O     1 
ATOM   3042 C  CB    . ILE A 1 415 ? 37.971 87.121  101.003 1.00 41.99  ? 415  ILE A CB    1 
ATOM   3043 C  CG1   . ILE A 1 415 ? 37.818 87.732  99.604  1.00 41.41  ? 415  ILE A CG1   1 
ATOM   3044 C  CG2   . ILE A 1 415 ? 38.019 88.206  102.067 1.00 43.70  ? 415  ILE A CG2   1 
ATOM   3045 C  CD1   . ILE A 1 415 ? 36.384 88.164  99.294  1.00 42.03  ? 415  ILE A CD1   1 
ATOM   3046 N  N     . GLY A 1 416 ? 40.039 84.589  99.460  1.00 39.39  ? 416  GLY A N     1 
ATOM   3047 C  CA    . GLY A 1 416 ? 39.928 83.493  98.514  1.00 42.01  ? 416  GLY A CA    1 
ATOM   3048 C  C     . GLY A 1 416 ? 39.534 82.148  99.100  1.00 41.88  ? 416  GLY A C     1 
ATOM   3049 O  O     . GLY A 1 416 ? 38.565 81.552  98.660  1.00 43.13  ? 416  GLY A O     1 
ATOM   3050 N  N     . ARG A 1 417 ? 40.264 81.680  100.101 1.00 44.37  ? 417  ARG A N     1 
ATOM   3051 C  CA    . ARG A 1 417 ? 39.962 80.395  100.745 1.00 46.41  ? 417  ARG A CA    1 
ATOM   3052 C  C     . ARG A 1 417 ? 38.632 80.436  101.478 1.00 45.76  ? 417  ARG A C     1 
ATOM   3053 O  O     . ARG A 1 417 ? 37.972 79.414  101.672 1.00 45.61  ? 417  ARG A O     1 
ATOM   3054 C  CB    . ARG A 1 417 ? 41.050 80.022  101.752 1.00 49.02  ? 417  ARG A CB    1 
ATOM   3055 C  CG    . ARG A 1 417 ? 42.459 79.974  101.198 1.00 53.03  ? 417  ARG A CG    1 
ATOM   3056 C  CD    . ARG A 1 417 ? 43.491 79.514  102.216 1.00 57.56  ? 417  ARG A CD    1 
ATOM   3057 N  NE    . ARG A 1 417 ? 44.550 80.511  102.409 1.00 64.35  ? 417  ARG A NE    1 
ATOM   3058 C  CZ    . ARG A 1 417 ? 44.652 81.368  103.442 1.00 66.92  ? 417  ARG A CZ    1 
ATOM   3059 N  NH1   . ARG A 1 417 ? 43.758 81.384  104.431 1.00 67.48  ? 417  ARG A NH1   1 
ATOM   3060 N  NH2   . ARG A 1 417 ? 45.671 82.221  103.486 1.00 67.58  ? 417  ARG A NH2   1 
ATOM   3061 N  N     . GLU A 1 418 ? 38.250 81.633  101.890 1.00 46.86  ? 418  GLU A N     1 
ATOM   3062 C  CA    . GLU A 1 418 ? 37.099 81.841  102.748 1.00 47.12  ? 418  GLU A CA    1 
ATOM   3063 C  C     . GLU A 1 418 ? 35.816 81.841  101.916 1.00 44.56  ? 418  GLU A C     1 
ATOM   3064 O  O     . GLU A 1 418 ? 34.829 81.200  102.279 1.00 42.39  ? 418  GLU A O     1 
ATOM   3065 C  CB    . GLU A 1 418 ? 37.263 83.172  103.505 1.00 51.03  ? 418  GLU A CB    1 
ATOM   3066 C  CG    . GLU A 1 418 ? 38.335 83.147  104.600 1.00 54.64  ? 418  GLU A CG    1 
ATOM   3067 C  CD    . GLU A 1 418 ? 39.782 83.436  104.134 1.00 58.66  ? 418  GLU A CD    1 
ATOM   3068 O  OE1   . GLU A 1 418 ? 40.113 83.435  102.907 1.00 55.19  ? 418  GLU A OE1   1 
ATOM   3069 O  OE2   . GLU A 1 418 ? 40.626 83.661  105.041 1.00 61.54  ? 418  GLU A OE2   1 
ATOM   3070 N  N     . ILE A 1 419 ? 35.839 82.563  100.796 1.00 41.33  ? 419  ILE A N     1 
ATOM   3071 C  CA    . ILE A 1 419 ? 34.674 82.654  99.917  1.00 38.58  ? 419  ILE A CA    1 
ATOM   3072 C  C     . ILE A 1 419 ? 34.444 81.334  99.172  1.00 32.52  ? 419  ILE A C     1 
ATOM   3073 O  O     . ILE A 1 419 ? 33.323 80.912  99.007  1.00 32.62  ? 419  ILE A O     1 
ATOM   3074 C  CB    . ILE A 1 419 ? 34.786 83.840  98.919  1.00 37.81  ? 419  ILE A CB    1 
ATOM   3075 C  CG1   . ILE A 1 419 ? 33.438 84.036  98.221  1.00 37.28  ? 419  ILE A CG1   1 
ATOM   3076 C  CG2   . ILE A 1 419 ? 35.923 83.622  97.868  1.00 37.29  ? 419  ILE A CG2   1 
ATOM   3077 C  CD1   . ILE A 1 419 ? 33.291 85.396  97.587  1.00 38.49  ? 419  ILE A CD1   1 
ATOM   3078 N  N     . LEU A 1 420 ? 35.516 80.699  98.751  1.00 29.66  ? 420  LEU A N     1 
ATOM   3079 C  CA    . LEU A 1 420 ? 35.444 79.388  98.109  1.00 35.49  ? 420  LEU A CA    1 
ATOM   3080 C  C     . LEU A 1 420 ? 34.940 78.313  99.059  1.00 36.81  ? 420  LEU A C     1 
ATOM   3081 O  O     . LEU A 1 420 ? 34.178 77.457  98.645  1.00 39.91  ? 420  LEU A O     1 
ATOM   3082 C  CB    . LEU A 1 420 ? 36.821 78.974  97.567  1.00 34.76  ? 420  LEU A CB    1 
ATOM   3083 C  CG    . LEU A 1 420 ? 37.105 79.182  96.082  1.00 35.44  ? 420  LEU A CG    1 
ATOM   3084 C  CD1   . LEU A 1 420 ? 36.322 80.295  95.433  1.00 36.00  ? 420  LEU A CD1   1 
ATOM   3085 C  CD2   . LEU A 1 420 ? 38.591 79.359  95.891  1.00 36.82  ? 420  LEU A CD2   1 
ATOM   3086 N  N     . THR A 1 421 ? 35.355 78.358  100.327 1.00 37.81  ? 421  THR A N     1 
ATOM   3087 C  CA    . THR A 1 421 ? 34.809 77.451  101.340 1.00 35.68  ? 421  THR A CA    1 
ATOM   3088 C  C     . THR A 1 421 ? 33.302 77.661  101.506 1.00 35.76  ? 421  THR A C     1 
ATOM   3089 O  O     . THR A 1 421 ? 32.547 76.696  101.684 1.00 38.65  ? 421  THR A O     1 
ATOM   3090 C  CB    . THR A 1 421 ? 35.527 77.619  102.704 1.00 36.74  ? 421  THR A CB    1 
ATOM   3091 O  OG1   . THR A 1 421 ? 36.844 77.055  102.647 1.00 35.26  ? 421  THR A OG1   1 
ATOM   3092 C  CG2   . THR A 1 421 ? 34.836 76.813  103.807 1.00 35.66  ? 421  THR A CG2   1 
ATOM   3093 N  N     . LYS A 1 422 ? 32.852 78.908  101.430 1.00 36.09  ? 422  LYS A N     1 
ATOM   3094 C  CA    . LYS A 1 422 ? 31.431 79.190  101.587 1.00 38.19  ? 422  LYS A CA    1 
ATOM   3095 C  C     . LYS A 1 422 ? 30.660 78.720  100.354 1.00 37.36  ? 422  LYS A C     1 
ATOM   3096 O  O     . LYS A 1 422 ? 29.511 78.301  100.467 1.00 33.95  ? 422  LYS A O     1 
ATOM   3097 C  CB    . LYS A 1 422 ? 31.164 80.681  101.837 1.00 40.10  ? 422  LYS A CB    1 
ATOM   3098 C  CG    . LYS A 1 422 ? 31.623 81.194  103.183 1.00 42.96  ? 422  LYS A CG    1 
ATOM   3099 C  CD    . LYS A 1 422 ? 30.725 82.328  103.730 1.00 46.97  ? 422  LYS A CD    1 
ATOM   3100 C  CE    . LYS A 1 422 ? 31.542 83.516  104.314 1.00 49.37  ? 422  LYS A CE    1 
ATOM   3101 N  NZ    . LYS A 1 422 ? 30.807 84.834  104.194 1.00 50.10  ? 422  LYS A NZ    1 
ATOM   3102 N  N     . MET A 1 423 ? 31.289 78.818  99.180  1.00 35.66  ? 423  MET A N     1 
ATOM   3103 C  CA    . MET A 1 423 ? 30.670 78.353  97.937  1.00 34.10  ? 423  MET A CA    1 
ATOM   3104 C  C     . MET A 1 423 ? 30.443 76.823  98.031  1.00 30.68  ? 423  MET A C     1 
ATOM   3105 O  O     . MET A 1 423 ? 29.348 76.333  97.762  1.00 28.37  ? 423  MET A O     1 
ATOM   3106 C  CB    . MET A 1 423 ? 31.526 78.749  96.726  1.00 33.82  ? 423  MET A CB    1 
ATOM   3107 C  CG    . MET A 1 423 ? 31.433 80.234  96.384  1.00 34.73  ? 423  MET A CG    1 
ATOM   3108 S  SD    . MET A 1 423 ? 32.498 80.798  95.038  1.00 34.31  ? 423  MET A SD    1 
ATOM   3109 C  CE    . MET A 1 423 ? 31.535 80.333  93.623  1.00 36.15  ? 423  MET A CE    1 
ATOM   3110 N  N     . ASN A 1 424 ? 31.437 76.091  98.512  1.00 29.93  ? 424  ASN A N     1 
ATOM   3111 C  CA    . ASN A 1 424 ? 31.247 74.658  98.821  1.00 33.54  ? 424  ASN A CA    1 
ATOM   3112 C  C     . ASN A 1 424 ? 30.074 74.332  99.749  1.00 35.20  ? 424  ASN A C     1 
ATOM   3113 O  O     . ASN A 1 424 ? 29.458 73.276  99.594  1.00 37.85  ? 424  ASN A O     1 
ATOM   3114 C  CB    . ASN A 1 424 ? 32.544 74.017  99.343  1.00 31.62  ? 424  ASN A CB    1 
ATOM   3115 C  CG    . ASN A 1 424 ? 33.451 73.557  98.203  1.00 33.30  ? 424  ASN A CG    1 
ATOM   3116 O  OD1   . ASN A 1 424 ? 32.962 73.239  97.097  1.00 34.34  ? 424  ASN A OD1   1 
ATOM   3117 N  ND2   . ASN A 1 424 ? 34.758 73.520  98.446  1.00 29.23  ? 424  ASN A ND2   1 
ATOM   3118 N  N     . ALA A 1 425 ? 29.763 75.226  100.689 1.00 34.71  ? 425  ALA A N     1 
ATOM   3119 C  CA    . ALA A 1 425 ? 28.664 75.015  101.633 1.00 32.55  ? 425  ALA A CA    1 
ATOM   3120 C  C     . ALA A 1 425 ? 27.316 75.102  100.931 1.00 34.16  ? 425  ALA A C     1 
ATOM   3121 O  O     . ALA A 1 425 ? 26.425 74.298  101.190 1.00 34.39  ? 425  ALA A O     1 
ATOM   3122 C  CB    . ALA A 1 425 ? 28.731 76.020  102.793 1.00 32.33  ? 425  ALA A CB    1 
ATOM   3123 N  N     . HIS A 1 426 ? 27.167 76.071  100.037 1.00 36.83  ? 426  HIS A N     1 
ATOM   3124 C  CA    . HIS A 1 426 ? 25.993 76.127  99.162  1.00 36.93  ? 426  HIS A CA    1 
ATOM   3125 C  C     . HIS A 1 426 ? 25.902 74.860  98.282  1.00 35.27  ? 426  HIS A C     1 
ATOM   3126 O  O     . HIS A 1 426 ? 24.849 74.271  98.134  1.00 30.90  ? 426  HIS A O     1 
ATOM   3127 C  CB    . HIS A 1 426 ? 26.031 77.378  98.281  1.00 37.18  ? 426  HIS A CB    1 
ATOM   3128 C  CG    . HIS A 1 426 ? 25.754 78.659  99.014  1.00 38.16  ? 426  HIS A CG    1 
ATOM   3129 N  ND1   . HIS A 1 426 ? 24.536 79.298  98.958  1.00 39.13  ? 426  HIS A ND1   1 
ATOM   3130 C  CD2   . HIS A 1 426 ? 26.545 79.433  99.794  1.00 38.53  ? 426  HIS A CD2   1 
ATOM   3131 C  CE1   . HIS A 1 426 ? 24.583 80.402  99.681  1.00 37.40  ? 426  HIS A CE1   1 
ATOM   3132 N  NE2   . HIS A 1 426 ? 25.792 80.509  100.197 1.00 36.12  ? 426  HIS A NE2   1 
ATOM   3133 N  N     . LEU A 1 427 ? 27.023 74.456  97.708  1.00 37.97  ? 427  LEU A N     1 
ATOM   3134 C  CA    . LEU A 1 427 ? 27.087 73.299  96.820  1.00 40.09  ? 427  LEU A CA    1 
ATOM   3135 C  C     . LEU A 1 427 ? 26.611 72.014  97.514  1.00 43.01  ? 427  LEU A C     1 
ATOM   3136 O  O     . LEU A 1 427 ? 25.881 71.218  96.934  1.00 40.53  ? 427  LEU A O     1 
ATOM   3137 C  CB    . LEU A 1 427 ? 28.526 73.127  96.311  1.00 39.33  ? 427  LEU A CB    1 
ATOM   3138 C  CG    . LEU A 1 427 ? 28.910 73.721  94.955  1.00 40.24  ? 427  LEU A CG    1 
ATOM   3139 C  CD1   . LEU A 1 427 ? 28.084 74.909  94.586  1.00 41.71  ? 427  LEU A CD1   1 
ATOM   3140 C  CD2   . LEU A 1 427 ? 30.398 74.062  94.904  1.00 40.18  ? 427  LEU A CD2   1 
ATOM   3141 N  N     . LYS A 1 428 ? 27.019 71.827  98.764  1.00 47.06  ? 428  LYS A N     1 
ATOM   3142 C  CA    . LYS A 1 428 ? 26.574 70.683  99.566  1.00 48.42  ? 428  LYS A CA    1 
ATOM   3143 C  C     . LYS A 1 428 ? 25.043 70.672  99.722  1.00 46.86  ? 428  LYS A C     1 
ATOM   3144 O  O     . LYS A 1 428 ? 24.430 69.616  99.684  1.00 45.94  ? 428  LYS A O     1 
ATOM   3145 C  CB    . LYS A 1 428 ? 27.239 70.720  100.939 1.00 49.34  ? 428  LYS A CB    1 
ATOM   3146 C  CG    . LYS A 1 428 ? 27.411 69.384  101.590 1.00 52.42  ? 428  LYS A CG    1 
ATOM   3147 C  CD    . LYS A 1 428 ? 27.882 69.549  103.037 1.00 55.25  ? 428  LYS A CD    1 
ATOM   3148 C  CE    . LYS A 1 428 ? 27.561 68.315  103.902 1.00 57.47  ? 428  LYS A CE    1 
ATOM   3149 N  NZ    . LYS A 1 428 ? 26.702 68.709  105.059 1.00 58.86  ? 428  LYS A NZ    1 
ATOM   3150 N  N     . GLN A 1 429 ? 24.439 71.844  99.896  1.00 44.99  ? 429  GLN A N     1 
ATOM   3151 C  CA    . GLN A 1 429 ? 22.981 71.957  100.038 1.00 47.61  ? 429  GLN A CA    1 
ATOM   3152 C  C     . GLN A 1 429 ? 22.282 71.600  98.745  1.00 44.29  ? 429  GLN A C     1 
ATOM   3153 O  O     . GLN A 1 429 ? 21.206 71.006  98.769  1.00 42.17  ? 429  GLN A O     1 
ATOM   3154 C  CB    . GLN A 1 429 ? 22.536 73.386  100.428 1.00 49.78  ? 429  GLN A CB    1 
ATOM   3155 C  CG    . GLN A 1 429 ? 23.121 73.919  101.718 1.00 53.82  ? 429  GLN A CG    1 
ATOM   3156 C  CD    . GLN A 1 429 ? 22.335 75.108  102.277 1.00 58.38  ? 429  GLN A CD    1 
ATOM   3157 O  OE1   . GLN A 1 429 ? 21.398 74.924  103.062 1.00 58.97  ? 429  GLN A OE1   1 
ATOM   3158 N  NE2   . GLN A 1 429 ? 22.721 76.328  101.877 1.00 58.90  ? 429  GLN A NE2   1 
ATOM   3159 N  N     . TRP A 1 430 ? 22.893 72.009  97.628  1.00 41.94  ? 430  TRP A N     1 
ATOM   3160 C  CA    . TRP A 1 430 ? 22.348 71.811  96.288  1.00 39.04  ? 430  TRP A CA    1 
ATOM   3161 C  C     . TRP A 1 430 ? 22.392 70.336  95.943  1.00 37.31  ? 430  TRP A C     1 
ATOM   3162 O  O     . TRP A 1 430 ? 21.470 69.796  95.360  1.00 37.59  ? 430  TRP A O     1 
ATOM   3163 C  CB    . TRP A 1 430 ? 23.187 72.555  95.242  1.00 38.74  ? 430  TRP A CB    1 
ATOM   3164 C  CG    . TRP A 1 430 ? 23.222 74.049  95.354  1.00 38.49  ? 430  TRP A CG    1 
ATOM   3165 C  CD1   . TRP A 1 430 ? 22.645 74.822  96.316  1.00 37.54  ? 430  TRP A CD1   1 
ATOM   3166 C  CD2   . TRP A 1 430 ? 23.888 74.950  94.462  1.00 38.44  ? 430  TRP A CD2   1 
ATOM   3167 N  NE1   . TRP A 1 430 ? 22.908 76.145  96.077  1.00 38.36  ? 430  TRP A NE1   1 
ATOM   3168 C  CE2   . TRP A 1 430 ? 23.677 76.256  94.951  1.00 38.23  ? 430  TRP A CE2   1 
ATOM   3169 C  CE3   . TRP A 1 430 ? 24.632 74.786  93.282  1.00 37.46  ? 430  TRP A CE3   1 
ATOM   3170 C  CZ2   . TRP A 1 430 ? 24.167 77.393  94.302  1.00 36.50  ? 430  TRP A CZ2   1 
ATOM   3171 C  CZ3   . TRP A 1 430 ? 25.140 75.912  92.649  1.00 38.22  ? 430  TRP A CZ3   1 
ATOM   3172 C  CH2   . TRP A 1 430 ? 24.902 77.200  93.158  1.00 36.95  ? 430  TRP A CH2   1 
ATOM   3173 N  N     . THR A 1 431 ? 23.508 69.714  96.285  1.00 36.60  ? 431  THR A N     1 
ATOM   3174 C  CA    . THR A 1 431 ? 23.706 68.290  96.102  1.00 39.11  ? 431  THR A CA    1 
ATOM   3175 C  C     . THR A 1 431 ? 22.686 67.448  96.845  1.00 40.08  ? 431  THR A C     1 
ATOM   3176 O  O     . THR A 1 431 ? 22.213 66.454  96.297  1.00 40.91  ? 431  THR A O     1 
ATOM   3177 C  CB    . THR A 1 431 ? 25.122 67.888  96.551  1.00 36.57  ? 431  THR A CB    1 
ATOM   3178 O  OG1   . THR A 1 431 ? 26.082 68.493  95.680  1.00 34.10  ? 431  THR A OG1   1 
ATOM   3179 C  CG2   . THR A 1 431 ? 25.351 66.370  96.388  1.00 35.57  ? 431  THR A CG2   1 
ATOM   3180 N  N     . GLU A 1 432 ? 22.362 67.847  98.077  1.00 43.32  ? 432  GLU A N     1 
ATOM   3181 C  CA    . GLU A 1 432 ? 21.448 67.097  98.950  1.00 46.02  ? 432  GLU A CA    1 
ATOM   3182 C  C     . GLU A 1 432 ? 19.993 67.319  98.546  1.00 47.44  ? 432  GLU A C     1 
ATOM   3183 O  O     . GLU A 1 432 ? 19.175 66.424  98.709  1.00 49.95  ? 432  GLU A O     1 
ATOM   3184 C  CB    . GLU A 1 432 ? 21.651 67.482  100.426 1.00 49.94  ? 432  GLU A CB    1 
ATOM   3185 C  CG    . GLU A 1 432 ? 22.973 66.981  101.025 1.00 53.69  ? 432  GLU A CG    1 
ATOM   3186 C  CD    . GLU A 1 432 ? 23.425 67.736  102.282 1.00 57.37  ? 432  GLU A CD    1 
ATOM   3187 O  OE1   . GLU A 1 432 ? 24.457 67.329  102.889 1.00 58.64  ? 432  GLU A OE1   1 
ATOM   3188 O  OE2   . GLU A 1 432 ? 22.770 68.740  102.663 1.00 58.47  ? 432  GLU A OE2   1 
ATOM   3189 N  N     . ARG A 1 433 ? 19.673 68.491  97.997  1.00 46.11  ? 433  ARG A N     1 
ATOM   3190 C  CA    . ARG A 1 433 ? 18.313 68.780  97.546  1.00 46.83  ? 433  ARG A CA    1 
ATOM   3191 C  C     . ARG A 1 433 ? 17.940 68.112  96.218  1.00 43.71  ? 433  ARG A C     1 
ATOM   3192 O  O     . ARG A 1 433 ? 16.758 67.815  95.988  1.00 40.17  ? 433  ARG A O     1 
ATOM   3193 C  CB    . ARG A 1 433 ? 18.102 70.289  97.398  1.00 51.95  ? 433  ARG A CB    1 
ATOM   3194 C  CG    . ARG A 1 433 ? 16.628 70.689  97.327  1.00 56.41  ? 433  ARG A CG    1 
ATOM   3195 C  CD    . ARG A 1 433 ? 16.231 71.523  96.104  1.00 59.30  ? 433  ARG A CD    1 
ATOM   3196 N  NE    . ARG A 1 433 ? 16.220 72.956  96.410  1.00 62.02  ? 433  ARG A NE    1 
ATOM   3197 C  CZ    . ARG A 1 433 ? 15.575 73.891  95.704  1.00 64.99  ? 433  ARG A CZ    1 
ATOM   3198 N  NH1   . ARG A 1 433 ? 14.866 73.571  94.622  1.00 65.40  ? 433  ARG A NH1   1 
ATOM   3199 N  NH2   . ARG A 1 433 ? 15.652 75.172  96.077  1.00 65.12  ? 433  ARG A NH2   1 
ATOM   3200 N  N     . THR A 1 434 ? 18.932 67.903  95.345  1.00 40.33  ? 434  THR A N     1 
ATOM   3201 C  CA    . THR A 1 434 ? 18.685 67.439  93.972  1.00 38.78  ? 434  THR A CA    1 
ATOM   3202 C  C     . THR A 1 434 ? 19.239 66.031  93.627  1.00 39.05  ? 434  THR A C     1 
ATOM   3203 O  O     . THR A 1 434 ? 18.790 65.402  92.672  1.00 38.19  ? 434  THR A O     1 
ATOM   3204 C  CB    . THR A 1 434 ? 19.242 68.469  92.950  1.00 36.42  ? 434  THR A CB    1 
ATOM   3205 O  OG1   . THR A 1 434 ? 20.674 68.518  93.024  1.00 36.14  ? 434  THR A OG1   1 
ATOM   3206 C  CG2   . THR A 1 434 ? 18.795 69.879  93.279  1.00 36.59  ? 434  THR A CG2   1 
ATOM   3207 N  N     . GLY A 1 435 ? 20.216 65.550  94.383  1.00 39.60  ? 435  GLY A N     1 
ATOM   3208 C  CA    . GLY A 1 435 ? 20.901 64.316  94.038  1.00 41.31  ? 435  GLY A CA    1 
ATOM   3209 C  C     . GLY A 1 435 ? 22.086 64.500  93.087  1.00 43.32  ? 435  GLY A C     1 
ATOM   3210 O  O     . GLY A 1 435 ? 22.938 63.600  92.985  1.00 47.96  ? 435  GLY A O     1 
ATOM   3211 N  N     . PHE A 1 436 ? 22.175 65.645  92.400  1.00 39.43  ? 436  PHE A N     1 
ATOM   3212 C  CA    . PHE A 1 436 ? 23.291 65.877  91.472  1.00 36.64  ? 436  PHE A CA    1 
ATOM   3213 C  C     . PHE A 1 436 ? 24.527 66.359  92.229  1.00 37.49  ? 436  PHE A C     1 
ATOM   3214 O  O     . PHE A 1 436 ? 24.417 67.112  93.189  1.00 41.15  ? 436  PHE A O     1 
ATOM   3215 C  CB    . PHE A 1 436 ? 22.886 66.842  90.370  1.00 32.12  ? 436  PHE A CB    1 
ATOM   3216 C  CG    . PHE A 1 436 ? 21.764 66.336  89.504  1.00 27.10  ? 436  PHE A CG    1 
ATOM   3217 C  CD1   . PHE A 1 436 ? 20.463 66.663  89.782  1.00 28.70  ? 436  PHE A CD1   1 
ATOM   3218 C  CD2   . PHE A 1 436 ? 22.023 65.558  88.392  1.00 28.56  ? 436  PHE A CD2   1 
ATOM   3219 C  CE1   . PHE A 1 436 ? 19.423 66.199  88.987  1.00 29.63  ? 436  PHE A CE1   1 
ATOM   3220 C  CE2   . PHE A 1 436 ? 21.000 65.092  87.590  1.00 27.23  ? 436  PHE A CE2   1 
ATOM   3221 C  CZ    . PHE A 1 436 ? 19.697 65.410  87.894  1.00 28.74  ? 436  PHE A CZ    1 
ATOM   3222 N  N     . ALA A 1 437 ? 25.702 65.894  91.825  1.00 38.53  ? 437  ALA A N     1 
ATOM   3223 C  CA    . ALA A 1 437 ? 26.941 66.165  92.572  1.00 36.79  ? 437  ALA A CA    1 
ATOM   3224 C  C     . ALA A 1 437 ? 27.593 67.443  92.077  1.00 36.86  ? 437  ALA A C     1 
ATOM   3225 O  O     . ALA A 1 437 ? 28.432 67.401  91.161  1.00 34.74  ? 437  ALA A O     1 
ATOM   3226 C  CB    . ALA A 1 437 ? 27.923 65.003  92.432  1.00 36.73  ? 437  ALA A CB    1 
ATOM   3227 N  N     . PHE A 1 438 ? 27.201 68.570  92.675  1.00 36.01  ? 438  PHE A N     1 
ATOM   3228 C  CA    . PHE A 1 438 ? 27.802 69.859  92.352  1.00 33.48  ? 438  PHE A CA    1 
ATOM   3229 C  C     . PHE A 1 438 ? 29.217 69.959  92.930  1.00 34.08  ? 438  PHE A C     1 
ATOM   3230 O  O     . PHE A 1 438 ? 29.490 69.508  94.037  1.00 37.59  ? 438  PHE A O     1 
ATOM   3231 C  CB    . PHE A 1 438 ? 26.937 70.999  92.870  1.00 33.56  ? 438  PHE A CB    1 
ATOM   3232 C  CG    . PHE A 1 438 ? 25.621 71.150  92.154  1.00 33.34  ? 438  PHE A CG    1 
ATOM   3233 C  CD1   . PHE A 1 438 ? 24.504 70.435  92.563  1.00 33.80  ? 438  PHE A CD1   1 
ATOM   3234 C  CD2   . PHE A 1 438 ? 25.498 72.022  91.079  1.00 32.90  ? 438  PHE A CD2   1 
ATOM   3235 C  CE1   . PHE A 1 438 ? 23.290 70.579  91.915  1.00 34.21  ? 438  PHE A CE1   1 
ATOM   3236 C  CE2   . PHE A 1 438 ? 24.273 72.179  90.416  1.00 33.50  ? 438  PHE A CE2   1 
ATOM   3237 C  CZ    . PHE A 1 438 ? 23.171 71.462  90.833  1.00 34.03  ? 438  PHE A CZ    1 
ATOM   3238 N  N     . SER A 1 439 ? 30.120 70.544  92.165  1.00 34.21  ? 439  SER A N     1 
ATOM   3239 C  CA    . SER A 1 439 ? 31.462 70.835  92.645  1.00 33.03  ? 439  SER A CA    1 
ATOM   3240 C  C     . SER A 1 439 ? 31.973 72.166  92.101  1.00 33.28  ? 439  SER A C     1 
ATOM   3241 O  O     . SER A 1 439 ? 31.501 72.672  91.076  1.00 28.79  ? 439  SER A O     1 
ATOM   3242 C  CB    . SER A 1 439 ? 32.418 69.712  92.273  1.00 30.72  ? 439  SER A CB    1 
ATOM   3243 O  OG    . SER A 1 439 ? 32.375 69.456  90.888  1.00 32.72  ? 439  SER A OG    1 
ATOM   3244 N  N     . LEU A 1 440 ? 32.950 72.703  92.821  1.00 34.89  ? 440  LEU A N     1 
ATOM   3245 C  CA    . LEU A 1 440 ? 33.562 73.995  92.555  1.00 33.67  ? 440  LEU A CA    1 
ATOM   3246 C  C     . LEU A 1 440 ? 34.655 73.793  91.535  1.00 33.68  ? 440  LEU A C     1 
ATOM   3247 O  O     . LEU A 1 440 ? 35.556 72.975  91.739  1.00 31.75  ? 440  LEU A O     1 
ATOM   3248 C  CB    . LEU A 1 440 ? 34.207 74.535  93.832  1.00 35.19  ? 440  LEU A CB    1 
ATOM   3249 C  CG    . LEU A 1 440 ? 33.888 75.915  94.399  1.00 36.44  ? 440  LEU A CG    1 
ATOM   3250 C  CD1   . LEU A 1 440 ? 35.100 76.358  95.194  1.00 38.30  ? 440  LEU A CD1   1 
ATOM   3251 C  CD2   . LEU A 1 440 ? 33.533 76.952  93.367  1.00 35.84  ? 440  LEU A CD2   1 
ATOM   3252 N  N     . TYR A 1 441 ? 34.597 74.586  90.469  1.00 34.59  ? 441  TYR A N     1 
ATOM   3253 C  CA    . TYR A 1 441 ? 35.389 74.375  89.270  1.00 33.36  ? 441  TYR A CA    1 
ATOM   3254 C  C     . TYR A 1 441 ? 36.172 75.630  88.918  1.00 32.04  ? 441  TYR A C     1 
ATOM   3255 O  O     . TYR A 1 441 ? 35.597 76.700  88.702  1.00 32.22  ? 441  TYR A O     1 
ATOM   3256 C  CB    . TYR A 1 441 ? 34.443 74.024  88.122  1.00 34.93  ? 441  TYR A CB    1 
ATOM   3257 C  CG    . TYR A 1 441 ? 35.115 73.765  86.799  1.00 34.70  ? 441  TYR A CG    1 
ATOM   3258 C  CD1   . TYR A 1 441 ? 35.990 72.691  86.644  1.00 35.17  ? 441  TYR A CD1   1 
ATOM   3259 C  CD2   . TYR A 1 441 ? 34.844 74.557  85.693  1.00 33.17  ? 441  TYR A CD2   1 
ATOM   3260 C  CE1   . TYR A 1 441 ? 36.599 72.427  85.421  1.00 34.94  ? 441  TYR A CE1   1 
ATOM   3261 C  CE2   . TYR A 1 441 ? 35.446 74.296  84.455  1.00 34.22  ? 441  TYR A CE2   1 
ATOM   3262 C  CZ    . TYR A 1 441 ? 36.327 73.236  84.331  1.00 33.82  ? 441  TYR A CZ    1 
ATOM   3263 O  OH    . TYR A 1 441 ? 36.933 72.971  83.130  1.00 32.60  ? 441  TYR A OH    1 
ATOM   3264 N  N     . SER A 1 442 ? 37.486 75.484  88.852  1.00 29.79  ? 442  SER A N     1 
ATOM   3265 C  CA    . SER A 1 442 ? 38.373 76.552  88.434  1.00 29.48  ? 442  SER A CA    1 
ATOM   3266 C  C     . SER A 1 442 ? 38.336 76.670  86.912  1.00 30.29  ? 442  SER A C     1 
ATOM   3267 O  O     . SER A 1 442 ? 39.128 76.015  86.195  1.00 29.45  ? 442  SER A O     1 
ATOM   3268 C  CB    . SER A 1 442 ? 39.790 76.252  88.922  1.00 29.78  ? 442  SER A CB    1 
ATOM   3269 O  OG    . SER A 1 442 ? 39.780 76.054  90.321  1.00 29.22  ? 442  SER A OG    1 
ATOM   3270 N  N     . THR A 1 443 ? 37.420 77.509  86.428  1.00 28.90  ? 443  THR A N     1 
ATOM   3271 C  CA    . THR A 1 443 ? 37.167 77.659  84.995  1.00 30.27  ? 443  THR A CA    1 
ATOM   3272 C  C     . THR A 1 443 ? 38.474 77.986  84.243  1.00 31.36  ? 443  THR A C     1 
ATOM   3273 O  O     . THR A 1 443 ? 39.173 78.927  84.624  1.00 32.84  ? 443  THR A O     1 
ATOM   3274 C  CB    . THR A 1 443 ? 36.117 78.742  84.766  1.00 31.22  ? 443  THR A CB    1 
ATOM   3275 O  OG1   . THR A 1 443 ? 34.959 78.470  85.562  1.00 28.96  ? 443  THR A OG1   1 
ATOM   3276 C  CG2   . THR A 1 443 ? 35.567 78.703  83.341  1.00 32.73  ? 443  THR A CG2   1 
ATOM   3277 N  N     . PRO A 1 444 ? 38.837 77.174  83.242  1.00 30.47  ? 444  PRO A N     1 
ATOM   3278 C  CA    . PRO A 1 444 ? 40.040 77.421  82.435  1.00 30.74  ? 444  PRO A CA    1 
ATOM   3279 C  C     . PRO A 1 444 ? 40.025 78.791  81.764  1.00 30.57  ? 444  PRO A C     1 
ATOM   3280 O  O     . PRO A 1 444 ? 41.064 79.439  81.748  1.00 28.08  ? 444  PRO A O     1 
ATOM   3281 C  CB    . PRO A 1 444 ? 40.020 76.295  81.405  1.00 29.59  ? 444  PRO A CB    1 
ATOM   3282 C  CG    . PRO A 1 444 ? 39.208 75.229  82.016  1.00 31.21  ? 444  PRO A CG    1 
ATOM   3283 C  CD    . PRO A 1 444 ? 38.177 75.915  82.850  1.00 32.20  ? 444  PRO A CD    1 
ATOM   3284 N  N     . ALA A 1 445 ? 38.867 79.203  81.249  1.00 31.44  ? 445  ALA A N     1 
ATOM   3285 C  CA    . ALA A 1 445 ? 38.607 80.596  80.860  1.00 33.41  ? 445  ALA A CA    1 
ATOM   3286 C  C     . ALA A 1 445 ? 39.659 81.177  79.929  1.00 35.86  ? 445  ALA A C     1 
ATOM   3287 O  O     . ALA A 1 445 ? 40.195 82.251  80.196  1.00 37.24  ? 445  ALA A O     1 
ATOM   3288 C  CB    . ALA A 1 445 ? 38.487 81.459  82.096  1.00 33.12  ? 445  ALA A CB    1 
ATOM   3289 N  N     . GLU A 1 446 ? 39.944 80.451  78.850  1.00 36.74  ? 446  GLU A N     1 
ATOM   3290 C  CA    . GLU A 1 446 ? 40.878 80.878  77.805  1.00 37.71  ? 446  GLU A CA    1 
ATOM   3291 C  C     . GLU A 1 446 ? 40.569 82.303  77.336  1.00 35.99  ? 446  GLU A C     1 
ATOM   3292 O  O     . GLU A 1 446 ? 41.447 83.149  77.310  1.00 37.57  ? 446  GLU A O     1 
ATOM   3293 C  CB    . GLU A 1 446 ? 40.804 79.899  76.613  1.00 39.55  ? 446  GLU A CB    1 
ATOM   3294 C  CG    . GLU A 1 446 ? 41.780 80.169  75.461  1.00 39.82  ? 446  GLU A CG    1 
ATOM   3295 C  CD    . GLU A 1 446 ? 43.217 79.755  75.768  1.00 41.99  ? 446  GLU A CD    1 
ATOM   3296 O  OE1   . GLU A 1 446 ? 43.436 78.961  76.709  1.00 42.57  ? 446  GLU A OE1   1 
ATOM   3297 O  OE2   . GLU A 1 446 ? 44.139 80.216  75.063  1.00 42.42  ? 446  GLU A OE2   1 
ATOM   3298 N  N     . ASN A 1 447 ? 39.321 82.550  76.970  1.00 36.05  ? 447  ASN A N     1 
ATOM   3299 C  CA    . ASN A 1 447 ? 38.867 83.885  76.564  1.00 38.47  ? 447  ASN A CA    1 
ATOM   3300 C  C     . ASN A 1 447 ? 37.821 84.559  77.493  1.00 38.42  ? 447  ASN A C     1 
ATOM   3301 O  O     . ASN A 1 447 ? 37.597 85.771  77.380  1.00 37.33  ? 447  ASN A O     1 
ATOM   3302 C  CB    . ASN A 1 447 ? 38.353 83.855  75.113  1.00 40.24  ? 447  ASN A CB    1 
ATOM   3303 C  CG    . ASN A 1 447 ? 39.466 83.540  74.104  1.00 41.38  ? 447  ASN A CG    1 
ATOM   3304 O  OD1   . ASN A 1 447 ? 40.274 84.399  73.776  1.00 44.34  ? 447  ASN A OD1   1 
ATOM   3305 N  ND2   . ASN A 1 447 ? 39.514 82.299  73.633  1.00 41.09  ? 447  ASN A ND2   1 
ATOM   3306 N  N     . LEU A 1 448 ? 37.210 83.799  78.408  1.00 34.40  ? 448  LEU A N     1 
ATOM   3307 C  CA    . LEU A 1 448 ? 36.309 84.363  79.409  1.00 32.44  ? 448  LEU A CA    1 
ATOM   3308 C  C     . LEU A 1 448 ? 37.012 85.386  80.308  1.00 33.28  ? 448  LEU A C     1 
ATOM   3309 O  O     . LEU A 1 448 ? 36.369 86.282  80.821  1.00 33.94  ? 448  LEU A O     1 
ATOM   3310 C  CB    . LEU A 1 448 ? 35.705 83.262  80.284  1.00 33.20  ? 448  LEU A CB    1 
ATOM   3311 C  CG    . LEU A 1 448 ? 34.641 83.661  81.314  1.00 33.25  ? 448  LEU A CG    1 
ATOM   3312 C  CD1   . LEU A 1 448 ? 33.407 84.226  80.598  1.00 34.13  ? 448  LEU A CD1   1 
ATOM   3313 C  CD2   . LEU A 1 448 ? 34.260 82.453  82.165  1.00 33.16  ? 448  LEU A CD2   1 
ATOM   3314 N  N     . CYS A 1 449 ? 38.321 85.249  80.500  1.00 34.00  ? 449  CYS A N     1 
ATOM   3315 C  CA    . CYS A 1 449 ? 39.094 86.244  81.222  1.00 35.83  ? 449  CYS A CA    1 
ATOM   3316 C  C     . CYS A 1 449 ? 38.909 87.661  80.633  1.00 38.42  ? 449  CYS A C     1 
ATOM   3317 O  O     . CYS A 1 449 ? 38.863 88.631  81.382  1.00 37.49  ? 449  CYS A O     1 
ATOM   3318 C  CB    . CYS A 1 449 ? 40.579 85.846  81.267  1.00 38.30  ? 449  CYS A CB    1 
ATOM   3319 S  SG    . CYS A 1 449 ? 41.435 85.804  79.678  1.00 41.48  ? 449  CYS A SG    1 
ATOM   3320 N  N     . TYR A 1 450 ? 38.767 87.763  79.307  1.00 38.43  ? 450  TYR A N     1 
ATOM   3321 C  CA    . TYR A 1 450 ? 38.558 89.039  78.613  1.00 37.43  ? 450  TYR A CA    1 
ATOM   3322 C  C     . TYR A 1 450 ? 37.100 89.410  78.568  1.00 36.93  ? 450  TYR A C     1 
ATOM   3323 O  O     . TYR A 1 450 ? 36.763 90.583  78.697  1.00 39.08  ? 450  TYR A O     1 
ATOM   3324 C  CB    . TYR A 1 450 ? 39.051 88.990  77.150  1.00 37.51  ? 450  TYR A CB    1 
ATOM   3325 C  CG    . TYR A 1 450 ? 40.493 88.618  76.982  1.00 38.49  ? 450  TYR A CG    1 
ATOM   3326 C  CD1   . TYR A 1 450 ? 40.863 87.385  76.438  1.00 41.48  ? 450  TYR A CD1   1 
ATOM   3327 C  CD2   . TYR A 1 450 ? 41.501 89.490  77.359  1.00 41.31  ? 450  TYR A CD2   1 
ATOM   3328 C  CE1   . TYR A 1 450 ? 42.215 87.036  76.288  1.00 40.54  ? 450  TYR A CE1   1 
ATOM   3329 C  CE2   . TYR A 1 450 ? 42.850 89.149  77.211  1.00 41.93  ? 450  TYR A CE2   1 
ATOM   3330 C  CZ    . TYR A 1 450 ? 43.188 87.926  76.681  1.00 41.18  ? 450  TYR A CZ    1 
ATOM   3331 O  OH    . TYR A 1 450 ? 44.503 87.613  76.542  1.00 44.51  ? 450  TYR A OH    1 
ATOM   3332 N  N     . ARG A 1 451 ? 36.237 88.429  78.321  1.00 34.35  ? 451  ARG A N     1 
ATOM   3333 C  CA    . ARG A 1 451 ? 34.804 88.700  78.198  1.00 33.17  ? 451  ARG A CA    1 
ATOM   3334 C  C     . ARG A 1 451 ? 34.259 89.400  79.454  1.00 34.62  ? 451  ARG A C     1 
ATOM   3335 O  O     . ARG A 1 451 ? 33.643 90.448  79.361  1.00 36.22  ? 451  ARG A O     1 
ATOM   3336 C  CB    . ARG A 1 451 ? 34.005 87.413  77.945  1.00 29.83  ? 451  ARG A CB    1 
ATOM   3337 C  CG    . ARG A 1 451 ? 32.556 87.677  77.521  1.00 28.50  ? 451  ARG A CG    1 
ATOM   3338 C  CD    . ARG A 1 451 ? 31.571 86.563  77.816  1.00 29.13  ? 451  ARG A CD    1 
ATOM   3339 N  NE    . ARG A 1 451 ? 30.211 86.928  77.412  1.00 27.82  ? 451  ARG A NE    1 
ATOM   3340 C  CZ    . ARG A 1 451 ? 29.138 86.934  78.198  1.00 32.10  ? 451  ARG A CZ    1 
ATOM   3341 N  NH1   . ARG A 1 451 ? 29.195 86.536  79.492  1.00 33.31  ? 451  ARG A NH1   1 
ATOM   3342 N  NH2   . ARG A 1 451 ? 27.972 87.316  77.674  1.00 31.93  ? 451  ARG A NH2   1 
ATOM   3343 N  N     . PHE A 1 452 ? 34.477 88.795  80.617  1.00 33.95  ? 452  PHE A N     1 
ATOM   3344 C  CA    . PHE A 1 452 ? 34.009 89.357  81.882  1.00 33.56  ? 452  PHE A CA    1 
ATOM   3345 C  C     . PHE A 1 452 ? 34.578 90.760  82.117  1.00 34.71  ? 452  PHE A C     1 
ATOM   3346 O  O     . PHE A 1 452 ? 33.830 91.664  82.450  1.00 34.54  ? 452  PHE A O     1 
ATOM   3347 C  CB    . PHE A 1 452 ? 34.384 88.455  83.060  1.00 29.80  ? 452  PHE A CB    1 
ATOM   3348 C  CG    . PHE A 1 452 ? 33.393 87.362  83.356  1.00 28.24  ? 452  PHE A CG    1 
ATOM   3349 C  CD1   . PHE A 1 452 ? 32.072 87.426  82.953  1.00 27.68  ? 452  PHE A CD1   1 
ATOM   3350 C  CD2   . PHE A 1 452 ? 33.791 86.271  84.092  1.00 31.32  ? 452  PHE A CD2   1 
ATOM   3351 C  CE1   . PHE A 1 452 ? 31.201 86.413  83.256  1.00 26.72  ? 452  PHE A CE1   1 
ATOM   3352 C  CE2   . PHE A 1 452 ? 32.909 85.260  84.394  1.00 29.63  ? 452  PHE A CE2   1 
ATOM   3353 C  CZ    . PHE A 1 452 ? 31.623 85.338  83.982  1.00 27.37  ? 452  PHE A CZ    1 
ATOM   3354 N  N     . CYS A 1 453 ? 35.885 90.921  81.924  1.00 35.35  ? 453  CYS A N     1 
ATOM   3355 C  CA    . CYS A 1 453 ? 36.552 92.210  82.066  1.00 39.76  ? 453  CYS A CA    1 
ATOM   3356 C  C     . CYS A 1 453 ? 36.027 93.286  81.110  1.00 40.96  ? 453  CYS A C     1 
ATOM   3357 O  O     . CYS A 1 453 ? 35.902 94.427  81.499  1.00 44.18  ? 453  CYS A O     1 
ATOM   3358 C  CB    . CYS A 1 453 ? 38.063 92.070  81.888  1.00 41.12  ? 453  CYS A CB    1 
ATOM   3359 S  SG    . CYS A 1 453 ? 38.927 93.616  82.307  1.00 44.84  ? 453  CYS A SG    1 
ATOM   3360 N  N     . LYS A 1 454 ? 35.694 92.908  79.882  1.00 44.50  ? 454  LYS A N     1 
ATOM   3361 C  CA    . LYS A 1 454 ? 35.143 93.838  78.893  1.00 46.25  ? 454  LYS A CA    1 
ATOM   3362 C  C     . LYS A 1 454 ? 33.762 94.308  79.318  1.00 44.05  ? 454  LYS A C     1 
ATOM   3363 O  O     . LYS A 1 454 ? 33.444 95.486  79.190  1.00 46.25  ? 454  LYS A O     1 
ATOM   3364 C  CB    . LYS A 1 454 ? 35.066 93.175  77.511  1.00 49.64  ? 454  LYS A CB    1 
ATOM   3365 C  CG    . LYS A 1 454 ? 34.563 94.064  76.364  1.00 53.02  ? 454  LYS A CG    1 
ATOM   3366 C  CD    . LYS A 1 454 ? 33.424 93.403  75.556  1.00 55.72  ? 454  LYS A CD    1 
ATOM   3367 C  CE    . LYS A 1 454 ? 33.120 94.173  74.261  1.00 57.55  ? 454  LYS A CE    1 
ATOM   3368 N  NZ    . LYS A 1 454 ? 31.693 94.012  73.793  1.00 57.68  ? 454  LYS A NZ    1 
ATOM   3369 N  N     . LEU A 1 455 ? 32.936 93.406  79.831  1.00 41.09  ? 455  LEU A N     1 
ATOM   3370 C  CA    . LEU A 1 455 ? 31.574 93.791  80.224  1.00 39.88  ? 455  LEU A CA    1 
ATOM   3371 C  C     . LEU A 1 455 ? 31.541 94.595  81.532  1.00 38.85  ? 455  LEU A C     1 
ATOM   3372 O  O     . LEU A 1 455 ? 30.658 95.418  81.736  1.00 37.87  ? 455  LEU A O     1 
ATOM   3373 C  CB    . LEU A 1 455 ? 30.677 92.565  80.342  1.00 37.39  ? 455  LEU A CB    1 
ATOM   3374 C  CG    . LEU A 1 455 ? 30.307 91.868  79.031  1.00 37.14  ? 455  LEU A CG    1 
ATOM   3375 C  CD1   . LEU A 1 455 ? 30.015 90.377  79.290  1.00 37.14  ? 455  LEU A CD1   1 
ATOM   3376 C  CD2   . LEU A 1 455 ? 29.106 92.540  78.370  1.00 36.18  ? 455  LEU A CD2   1 
ATOM   3377 N  N     . ASP A 1 456 ? 32.509 94.343  82.408  1.00 40.35  ? 456  ASP A N     1 
ATOM   3378 C  CA    . ASP A 1 456 ? 32.614 95.039  83.686  1.00 39.29  ? 456  ASP A CA    1 
ATOM   3379 C  C     . ASP A 1 456 ? 33.156 96.449  83.413  1.00 43.46  ? 456  ASP A C     1 
ATOM   3380 O  O     . ASP A 1 456 ? 32.875 97.394  84.155  1.00 45.64  ? 456  ASP A O     1 
ATOM   3381 C  CB    . ASP A 1 456 ? 33.559 94.283  84.646  1.00 37.56  ? 456  ASP A CB    1 
ATOM   3382 C  CG    . ASP A 1 456 ? 32.942 92.985  85.222  1.00 35.60  ? 456  ASP A CG    1 
ATOM   3383 O  OD1   . ASP A 1 456 ? 31.749 92.686  84.966  1.00 32.04  ? 456  ASP A OD1   1 
ATOM   3384 O  OD2   . ASP A 1 456 ? 33.590 92.201  85.956  1.00 32.75  ? 456  ASP A OD2   1 
ATOM   3385 N  N     . THR A 1 457 ? 33.934 96.570  82.338  1.00 43.04  ? 457  THR A N     1 
ATOM   3386 C  CA    . THR A 1 457 ? 34.478 97.843  81.891  1.00 41.66  ? 457  THR A CA    1 
ATOM   3387 C  C     . THR A 1 457 ? 33.386 98.709  81.262  1.00 42.09  ? 457  THR A C     1 
ATOM   3388 O  O     . THR A 1 457 ? 33.382 99.923  81.423  1.00 45.01  ? 457  THR A O     1 
ATOM   3389 C  CB    . THR A 1 457 ? 35.666 97.590  80.917  1.00 38.01  ? 457  THR A CB    1 
ATOM   3390 O  OG1   . THR A 1 457 ? 36.723 96.953  81.636  1.00 30.05  ? 457  THR A OG1   1 
ATOM   3391 C  CG2   . THR A 1 457 ? 36.304 98.903  80.436  1.00 36.35  ? 457  THR A CG2   1 
ATOM   3392 N  N     . GLU A 1 458 ? 32.431 98.086  80.589  1.00 44.82  ? 458  GLU A N     1 
ATOM   3393 C  CA    . GLU A 1 458 ? 31.324 98.835  80.011  1.00 46.78  ? 458  GLU A CA    1 
ATOM   3394 C  C     . GLU A 1 458 ? 30.526 99.543  81.091  1.00 48.23  ? 458  GLU A C     1 
ATOM   3395 O  O     . GLU A 1 458 ? 29.888 100.545 80.800  1.00 52.34  ? 458  GLU A O     1 
ATOM   3396 C  CB    . GLU A 1 458 ? 30.406 97.945  79.174  1.00 48.29  ? 458  GLU A CB    1 
ATOM   3397 C  CG    . GLU A 1 458 ? 30.871 97.730  77.735  1.00 51.66  ? 458  GLU A CG    1 
ATOM   3398 C  CD    . GLU A 1 458 ? 30.188 96.544  77.048  1.00 56.68  ? 458  GLU A CD    1 
ATOM   3399 O  OE1   . GLU A 1 458 ? 30.805 95.928  76.139  1.00 60.79  ? 458  GLU A OE1   1 
ATOM   3400 O  OE2   . GLU A 1 458 ? 29.029 96.219  77.407  1.00 58.42  ? 458  GLU A OE2   1 
ATOM   3401 N  N     . LYS A 1 459 ? 30.566 99.049  82.328  1.00 48.43  ? 459  LYS A N     1 
ATOM   3402 C  CA    . LYS A 1 459 ? 29.832 99.691  83.424  1.00 49.07  ? 459  LYS A CA    1 
ATOM   3403 C  C     . LYS A 1 459 ? 30.684 100.607 84.317  1.00 46.27  ? 459  LYS A C     1 
ATOM   3404 O  O     . LYS A 1 459 ? 30.212 101.654 84.725  1.00 45.12  ? 459  LYS A O     1 
ATOM   3405 C  CB    . LYS A 1 459 ? 29.083 98.655  84.281  1.00 50.48  ? 459  LYS A CB    1 
ATOM   3406 C  CG    . LYS A 1 459 ? 27.937 99.286  85.090  1.00 53.21  ? 459  LYS A CG    1 
ATOM   3407 C  CD    . LYS A 1 459 ? 27.272 98.338  86.103  1.00 55.08  ? 459  LYS A CD    1 
ATOM   3408 C  CE    . LYS A 1 459 ? 26.270 99.088  86.996  1.00 55.39  ? 459  LYS A CE    1 
ATOM   3409 N  NZ    . LYS A 1 459 ? 24.871 99.155  86.425  1.00 56.46  ? 459  LYS A NZ    1 
ATOM   3410 N  N     . TYR A 1 460 ? 31.918 100.206 84.599  1.00 43.37  ? 460  TYR A N     1 
ATOM   3411 C  CA    . TYR A 1 460 ? 32.770 100.833 85.607  1.00 42.99  ? 460  TYR A CA    1 
ATOM   3412 C  C     . TYR A 1 460 ? 34.071 101.441 85.060  1.00 44.56  ? 460  TYR A C     1 
ATOM   3413 O  O     . TYR A 1 460 ? 34.822 102.050 85.816  1.00 45.17  ? 460  TYR A O     1 
ATOM   3414 C  CB    . TYR A 1 460 ? 33.166 99.793  86.672  1.00 42.17  ? 460  TYR A CB    1 
ATOM   3415 C  CG    . TYR A 1 460 ? 32.012 99.295  87.495  1.00 42.51  ? 460  TYR A CG    1 
ATOM   3416 C  CD1   . TYR A 1 460 ? 31.416 98.041  87.239  1.00 40.47  ? 460  TYR A CD1   1 
ATOM   3417 C  CD2   . TYR A 1 460 ? 31.487 100.080 88.520  1.00 42.74  ? 460  TYR A CD2   1 
ATOM   3418 C  CE1   . TYR A 1 460 ? 30.328 97.592  88.000  1.00 38.99  ? 460  TYR A CE1   1 
ATOM   3419 C  CE2   . TYR A 1 460 ? 30.404 99.639  89.290  1.00 41.84  ? 460  TYR A CE2   1 
ATOM   3420 C  CZ    . TYR A 1 460 ? 29.831 98.399  89.034  1.00 39.95  ? 460  TYR A CZ    1 
ATOM   3421 O  OH    . TYR A 1 460 ? 28.757 97.997  89.801  1.00 35.87  ? 460  TYR A OH    1 
ATOM   3422 N  N     . GLY A 1 461 ? 34.362 101.242 83.777  1.00 44.52  ? 461  GLY A N     1 
ATOM   3423 C  CA    . GLY A 1 461 ? 35.551 101.807 83.161  1.00 44.44  ? 461  GLY A CA    1 
ATOM   3424 C  C     . GLY A 1 461 ? 36.858 101.158 83.582  1.00 45.12  ? 461  GLY A C     1 
ATOM   3425 O  O     . GLY A 1 461 ? 36.896 99.990  83.982  1.00 48.02  ? 461  GLY A O     1 
ATOM   3426 N  N     . SER A 1 462 ? 37.943 101.915 83.461  1.00 44.58  ? 462  SER A N     1 
ATOM   3427 C  CA    . SER A 1 462 ? 39.255 101.459 83.883  1.00 45.88  ? 462  SER A CA    1 
ATOM   3428 C  C     . SER A 1 462 ? 39.360 101.595 85.399  1.00 49.54  ? 462  SER A C     1 
ATOM   3429 O  O     . SER A 1 462 ? 39.280 102.703 85.938  1.00 51.70  ? 462  SER A O     1 
ATOM   3430 C  CB    . SER A 1 462 ? 40.360 102.264 83.187  1.00 46.10  ? 462  SER A CB    1 
ATOM   3431 O  OG    . SER A 1 462 ? 41.663 101.811 83.547  1.00 44.68  ? 462  SER A OG    1 
ATOM   3432 N  N     . VAL A 1 463 ? 39.527 100.460 86.078  1.00 50.13  ? 463  VAL A N     1 
ATOM   3433 C  CA    . VAL A 1 463 ? 39.644 100.410 87.532  1.00 48.50  ? 463  VAL A CA    1 
ATOM   3434 C  C     . VAL A 1 463 ? 41.031 99.893  87.840  1.00 51.07  ? 463  VAL A C     1 
ATOM   3435 O  O     . VAL A 1 463 ? 41.438 98.869  87.301  1.00 51.02  ? 463  VAL A O     1 
ATOM   3436 C  CB    . VAL A 1 463 ? 38.595 99.464  88.122  1.00 47.93  ? 463  VAL A CB    1 
ATOM   3437 C  CG1   . VAL A 1 463 ? 38.877 99.173  89.585  1.00 46.92  ? 463  VAL A CG1   1 
ATOM   3438 C  CG2   . VAL A 1 463 ? 37.185 100.036 87.925  1.00 46.52  ? 463  VAL A CG2   1 
ATOM   3439 N  N     . LYS A 1 464 ? 41.757 100.590 88.707  1.00 54.15  ? 464  LYS A N     1 
ATOM   3440 C  CA    . LYS A 1 464 ? 43.164 100.290 88.920  1.00 56.35  ? 464  LYS A CA    1 
ATOM   3441 C  C     . LYS A 1 464 ? 43.351 98.878  89.483  1.00 56.71  ? 464  LYS A C     1 
ATOM   3442 O  O     . LYS A 1 464 ? 42.679 98.487  90.434  1.00 55.02  ? 464  LYS A O     1 
ATOM   3443 C  CB    . LYS A 1 464 ? 43.816 101.334 89.839  1.00 59.10  ? 464  LYS A CB    1 
ATOM   3444 C  CG    . LYS A 1 464 ? 45.346 101.281 89.826  1.00 62.03  ? 464  LYS A CG    1 
ATOM   3445 C  CD    . LYS A 1 464 ? 45.993 102.331 90.736  1.00 64.51  ? 464  LYS A CD    1 
ATOM   3446 C  CE    . LYS A 1 464 ? 46.009 101.897 92.203  1.00 65.30  ? 464  LYS A CE    1 
ATOM   3447 N  NZ    . LYS A 1 464 ? 46.849 102.798 93.041  1.00 65.24  ? 464  LYS A NZ    1 
ATOM   3448 N  N     . ASP A 1 465 ? 44.282 98.139  88.875  1.00 57.98  ? 465  ASP A N     1 
ATOM   3449 C  CA    . ASP A 1 465 ? 44.641 96.755  89.232  1.00 58.21  ? 465  ASP A CA    1 
ATOM   3450 C  C     . ASP A 1 465 ? 43.574 95.679  88.968  1.00 57.24  ? 465  ASP A C     1 
ATOM   3451 O  O     . ASP A 1 465 ? 43.809 94.501  89.241  1.00 61.62  ? 465  ASP A O     1 
ATOM   3452 C  CB    . ASP A 1 465 ? 45.118 96.681  90.688  1.00 60.58  ? 465  ASP A CB    1 
ATOM   3453 C  CG    . ASP A 1 465 ? 46.374 97.503  90.933  1.00 62.76  ? 465  ASP A CG    1 
ATOM   3454 O  OD1   . ASP A 1 465 ? 47.351 97.329  90.163  1.00 61.85  ? 465  ASP A OD1   1 
ATOM   3455 O  OD2   . ASP A 1 465 ? 46.470 98.337  91.869  1.00 63.84  ? 465  ASP A OD2   1 
ATOM   3456 N  N     . VAL A 1 466 ? 42.428 96.070  88.419  1.00 54.45  ? 466  VAL A N     1 
ATOM   3457 C  CA    . VAL A 1 466 ? 41.309 95.160  88.234  1.00 52.44  ? 466  VAL A CA    1 
ATOM   3458 C  C     . VAL A 1 466 ? 40.949 95.035  86.757  1.00 51.88  ? 466  VAL A C     1 
ATOM   3459 O  O     . VAL A 1 466 ? 41.258 94.008  86.148  1.00 53.71  ? 466  VAL A O     1 
ATOM   3460 C  CB    . VAL A 1 466 ? 40.093 95.601  89.071  1.00 52.26  ? 466  VAL A CB    1 
ATOM   3461 C  CG1   . VAL A 1 466 ? 38.905 94.690  88.828  1.00 50.41  ? 466  VAL A CG1   1 
ATOM   3462 C  CG2   . VAL A 1 466 ? 40.463 95.618  90.557  1.00 52.67  ? 466  VAL A CG2   1 
ATOM   3463 N  N     . THR A 1 467 ? 40.315 96.062  86.179  1.00 50.86  ? 467  THR A N     1 
ATOM   3464 C  CA    . THR A 1 467 ? 39.923 96.025  84.766  1.00 49.05  ? 467  THR A CA    1 
ATOM   3465 C  C     . THR A 1 467 ? 40.905 96.724  83.820  1.00 50.32  ? 467  THR A C     1 
ATOM   3466 O  O     . THR A 1 467 ? 40.735 96.653  82.601  1.00 52.96  ? 467  THR A O     1 
ATOM   3467 C  CB    . THR A 1 467 ? 38.523 96.620  84.539  1.00 47.99  ? 467  THR A CB    1 
ATOM   3468 O  OG1   . THR A 1 467 ? 38.541 98.033  84.778  1.00 51.26  ? 467  THR A OG1   1 
ATOM   3469 C  CG2   . THR A 1 467 ? 37.520 96.090  85.527  1.00 48.71  ? 467  THR A CG2   1 
ATOM   3470 N  N     . ASP A 1 468 ? 41.915 97.394  84.362  1.00 50.04  ? 468  ASP A N     1 
ATOM   3471 C  CA    . ASP A 1 468 ? 42.796 98.239  83.541  1.00 51.57  ? 468  ASP A CA    1 
ATOM   3472 C  C     . ASP A 1 468 ? 43.646 97.444  82.546  1.00 50.34  ? 468  ASP A C     1 
ATOM   3473 O  O     . ASP A 1 468 ? 43.875 97.894  81.420  1.00 50.75  ? 468  ASP A O     1 
ATOM   3474 C  CB    . ASP A 1 468 ? 43.685 99.166  84.401  1.00 51.77  ? 468  ASP A CB    1 
ATOM   3475 C  CG    . ASP A 1 468 ? 44.542 98.417  85.438  1.00 53.96  ? 468  ASP A CG    1 
ATOM   3476 O  OD1   . ASP A 1 468 ? 44.544 97.164  85.515  1.00 56.03  ? 468  ASP A OD1   1 
ATOM   3477 O  OD2   . ASP A 1 468 ? 45.266 99.029  86.246  1.00 55.37  ? 468  ASP A OD2   1 
ATOM   3478 N  N     . LYS A 1 469 ? 44.090 96.260  82.958  1.00 47.09  ? 469  LYS A N     1 
ATOM   3479 C  CA    . LYS A 1 469 ? 44.899 95.405  82.099  1.00 45.10  ? 469  LYS A CA    1 
ATOM   3480 C  C     . LYS A 1 469 ? 44.067 94.710  80.987  1.00 41.39  ? 469  LYS A C     1 
ATOM   3481 O  O     . LYS A 1 469 ? 44.625 94.305  79.980  1.00 39.42  ? 469  LYS A O     1 
ATOM   3482 C  CB    . LYS A 1 469 ? 45.713 94.400  82.943  1.00 45.03  ? 469  LYS A CB    1 
ATOM   3483 C  CG    . LYS A 1 469 ? 44.907 93.363  83.732  1.00 46.69  ? 469  LYS A CG    1 
ATOM   3484 C  CD    . LYS A 1 469 ? 45.757 92.703  84.827  1.00 47.57  ? 469  LYS A CD    1 
ATOM   3485 C  CE    . LYS A 1 469 ? 44.984 91.582  85.545  1.00 48.76  ? 469  LYS A CE    1 
ATOM   3486 N  NZ    . LYS A 1 469 ? 43.727 92.084  86.196  1.00 49.88  ? 469  LYS A NZ    1 
ATOM   3487 N  N     . GLY A 1 470 ? 42.748 94.594  81.165  1.00 39.66  ? 470  GLY A N     1 
ATOM   3488 C  CA    . GLY A 1 470 ? 41.857 94.004  80.160  1.00 38.48  ? 470  GLY A CA    1 
ATOM   3489 C  C     . GLY A 1 470 ? 41.523 92.509  80.348  1.00 38.24  ? 470  GLY A C     1 
ATOM   3490 O  O     . GLY A 1 470 ? 40.840 91.921  79.508  1.00 37.47  ? 470  GLY A O     1 
ATOM   3491 N  N     . TRP A 1 471 ? 42.004 91.900  81.434  1.00 36.99  ? 471  TRP A N     1 
ATOM   3492 C  CA    . TRP A 1 471 ? 41.659 90.514  81.787  1.00 37.17  ? 471  TRP A CA    1 
ATOM   3493 C  C     . TRP A 1 471 ? 41.598 90.270  83.292  1.00 36.25  ? 471  TRP A C     1 
ATOM   3494 O  O     . TRP A 1 471 ? 42.214 90.976  84.075  1.00 41.28  ? 471  TRP A O     1 
ATOM   3495 C  CB    . TRP A 1 471 ? 42.639 89.519  81.166  1.00 37.36  ? 471  TRP A CB    1 
ATOM   3496 C  CG    . TRP A 1 471 ? 44.024 89.474  81.802  1.00 39.40  ? 471  TRP A CG    1 
ATOM   3497 C  CD1   . TRP A 1 471 ? 44.432 88.668  82.825  1.00 40.58  ? 471  TRP A CD1   1 
ATOM   3498 C  CD2   . TRP A 1 471 ? 45.177 90.238  81.416  1.00 43.05  ? 471  TRP A CD2   1 
ATOM   3499 N  NE1   . TRP A 1 471 ? 45.757 88.889  83.112  1.00 42.69  ? 471  TRP A NE1   1 
ATOM   3500 C  CE2   . TRP A 1 471 ? 46.242 89.850  82.265  1.00 44.15  ? 471  TRP A CE2   1 
ATOM   3501 C  CE3   . TRP A 1 471 ? 45.420 91.226  80.442  1.00 44.78  ? 471  TRP A CE3   1 
ATOM   3502 C  CZ2   . TRP A 1 471 ? 47.527 90.413  82.174  1.00 44.34  ? 471  TRP A CZ2   1 
ATOM   3503 C  CZ3   . TRP A 1 471 ? 46.709 91.782  80.345  1.00 44.41  ? 471  TRP A CZ3   1 
ATOM   3504 C  CH2   . TRP A 1 471 ? 47.739 91.375  81.214  1.00 44.60  ? 471  TRP A CH2   1 
ATOM   3505 N  N     . TYR A 1 472 ? 40.831 89.262  83.677  1.00 35.80  ? 472  TYR A N     1 
ATOM   3506 C  CA    . TYR A 1 472 ? 40.824 88.760  85.034  1.00 32.95  ? 472  TYR A CA    1 
ATOM   3507 C  C     . TYR A 1 472 ? 41.722 87.548  85.072  1.00 31.64  ? 472  TYR A C     1 
ATOM   3508 O  O     . TYR A 1 472 ? 41.892 86.843  84.064  1.00 29.12  ? 472  TYR A O     1 
ATOM   3509 C  CB    . TYR A 1 472 ? 39.416 88.368  85.485  1.00 33.40  ? 472  TYR A CB    1 
ATOM   3510 C  CG    . TYR A 1 472 ? 38.443 89.529  85.663  1.00 34.82  ? 472  TYR A CG    1 
ATOM   3511 C  CD1   . TYR A 1 472 ? 38.895 90.832  85.855  1.00 36.09  ? 472  TYR A CD1   1 
ATOM   3512 C  CD2   . TYR A 1 472 ? 37.069 89.311  85.673  1.00 34.51  ? 472  TYR A CD2   1 
ATOM   3513 C  CE1   . TYR A 1 472 ? 38.022 91.875  86.024  1.00 36.15  ? 472  TYR A CE1   1 
ATOM   3514 C  CE2   . TYR A 1 472 ? 36.187 90.349  85.854  1.00 36.41  ? 472  TYR A CE2   1 
ATOM   3515 C  CZ    . TYR A 1 472 ? 36.673 91.639  86.026  1.00 37.20  ? 472  TYR A CZ    1 
ATOM   3516 O  OH    . TYR A 1 472 ? 35.826 92.708  86.202  1.00 37.16  ? 472  TYR A OH    1 
ATOM   3517 N  N     . THR A 1 473 ? 42.273 87.322  86.258  1.00 29.23  ? 473  THR A N     1 
ATOM   3518 C  CA    . THR A 1 473 ? 43.218 86.273  86.527  1.00 31.34  ? 473  THR A CA    1 
ATOM   3519 C  C     . THR A 1 473 ? 42.456 84.990  86.746  1.00 31.38  ? 473  THR A C     1 
ATOM   3520 O  O     . THR A 1 473 ? 41.379 85.007  87.355  1.00 33.01  ? 473  THR A O     1 
ATOM   3521 C  CB    . THR A 1 473 ? 44.005 86.635  87.799  1.00 33.23  ? 473  THR A CB    1 
ATOM   3522 O  OG1   . THR A 1 473 ? 44.741 87.837  87.567  1.00 35.42  ? 473  THR A OG1   1 
ATOM   3523 C  CG2   . THR A 1 473 ? 45.069 85.600  88.123  1.00 33.16  ? 473  THR A CG2   1 
ATOM   3524 N  N     . ASN A 1 474 ? 43.014 83.876  86.270  1.00 29.49  ? 474  ASN A N     1 
ATOM   3525 C  CA    . ASN A 1 474 ? 42.350 82.579  86.397  1.00 28.22  ? 474  ASN A CA    1 
ATOM   3526 C  C     . ASN A 1 474 ? 42.122 82.166  87.843  1.00 27.11  ? 474  ASN A C     1 
ATOM   3527 O  O     . ASN A 1 474 ? 43.033 82.198  88.671  1.00 28.42  ? 474  ASN A O     1 
ATOM   3528 C  CB    . ASN A 1 474 ? 43.124 81.477  85.682  1.00 29.11  ? 474  ASN A CB    1 
ATOM   3529 C  CG    . ASN A 1 474 ? 42.308 80.199  85.530  1.00 29.94  ? 474  ASN A CG    1 
ATOM   3530 O  OD1   . ASN A 1 474 ? 41.622 80.017  84.528  1.00 33.54  ? 474  ASN A OD1   1 
ATOM   3531 N  ND2   . ASN A 1 474 ? 42.370 79.323  86.521  1.00 24.70  ? 474  ASN A ND2   1 
ATOM   3532 N  N     . SER A 1 475 ? 40.887 81.808  88.146  1.00 27.29  ? 475  SER A N     1 
ATOM   3533 C  CA    . SER A 1 475 ? 40.543 81.182  89.411  1.00 30.24  ? 475  SER A CA    1 
ATOM   3534 C  C     . SER A 1 475 ? 41.301 81.778  90.605  1.00 33.32  ? 475  SER A C     1 
ATOM   3535 O  O     . SER A 1 475 ? 41.088 82.932  90.942  1.00 39.02  ? 475  SER A O     1 
ATOM   3536 C  CB    . SER A 1 475 ? 40.731 79.650  89.318  1.00 28.85  ? 475  SER A CB    1 
ATOM   3537 O  OG    . SER A 1 475 ? 42.065 79.286  88.955  1.00 27.23  ? 475  SER A OG    1 
ATOM   3538 N  N     . PHE A 1 476 ? 42.172 80.993  91.226  1.00 35.62  ? 476  PHE A N     1 
ATOM   3539 C  CA    . PHE A 1 476 ? 42.863 81.357  92.463  1.00 36.14  ? 476  PHE A CA    1 
ATOM   3540 C  C     . PHE A 1 476 ? 44.323 81.608  92.174  1.00 34.61  ? 476  PHE A C     1 
ATOM   3541 O  O     . PHE A 1 476 ? 45.113 81.712  93.090  1.00 34.97  ? 476  PHE A O     1 
ATOM   3542 C  CB    . PHE A 1 476 ? 42.784 80.188  93.458  1.00 37.26  ? 476  PHE A CB    1 
ATOM   3543 C  CG    . PHE A 1 476 ? 43.308 78.878  92.897  1.00 34.85  ? 476  PHE A CG    1 
ATOM   3544 C  CD1   . PHE A 1 476 ? 44.673 78.624  92.823  1.00 35.15  ? 476  PHE A CD1   1 
ATOM   3545 C  CD2   . PHE A 1 476 ? 42.425 77.922  92.430  1.00 34.62  ? 476  PHE A CD2   1 
ATOM   3546 C  CE1   . PHE A 1 476 ? 45.137 77.419  92.306  1.00 36.35  ? 476  PHE A CE1   1 
ATOM   3547 C  CE2   . PHE A 1 476 ? 42.870 76.721  91.908  1.00 34.49  ? 476  PHE A CE2   1 
ATOM   3548 C  CZ    . PHE A 1 476 ? 44.228 76.467  91.840  1.00 36.83  ? 476  PHE A CZ    1 
ATOM   3549 N  N     . HIS A 1 477 ? 44.683 81.620  90.900  1.00 35.40  ? 477  HIS A N     1 
ATOM   3550 C  CA    . HIS A 1 477 ? 46.072 81.797  90.478  1.00 38.47  ? 477  HIS A CA    1 
ATOM   3551 C  C     . HIS A 1 477 ? 46.612 83.154  90.958  1.00 40.24  ? 477  HIS A C     1 
ATOM   3552 O  O     . HIS A 1 477 ? 45.890 84.153  90.939  1.00 37.50  ? 477  HIS A O     1 
ATOM   3553 C  CB    . HIS A 1 477 ? 46.177 81.684  88.936  1.00 34.36  ? 477  HIS A CB    1 
ATOM   3554 C  CG    . HIS A 1 477 ? 45.930 80.297  88.410  1.00 35.40  ? 477  HIS A CG    1 
ATOM   3555 N  ND1   . HIS A 1 477 ? 46.208 79.933  87.108  1.00 32.03  ? 477  HIS A ND1   1 
ATOM   3556 C  CD2   . HIS A 1 477 ? 45.446 79.182  89.018  1.00 32.92  ? 477  HIS A CD2   1 
ATOM   3557 C  CE1   . HIS A 1 477 ? 45.907 78.656  86.940  1.00 33.72  ? 477  HIS A CE1   1 
ATOM   3558 N  NE2   . HIS A 1 477 ? 45.433 78.180  88.080  1.00 31.52  ? 477  HIS A NE2   1 
ATOM   3559 N  N     . VAL A 1 478 ? 47.865 83.182  91.401  1.00 43.45  ? 478  VAL A N     1 
ATOM   3560 C  CA    . VAL A 1 478 ? 48.486 84.445  91.768  1.00 47.76  ? 478  VAL A CA    1 
ATOM   3561 C  C     . VAL A 1 478 ? 48.780 85.176  90.474  1.00 50.83  ? 478  VAL A C     1 
ATOM   3562 O  O     . VAL A 1 478 ? 49.127 84.549  89.466  1.00 53.40  ? 478  VAL A O     1 
ATOM   3563 C  CB    . VAL A 1 478 ? 49.761 84.329  92.707  1.00 48.68  ? 478  VAL A CB    1 
ATOM   3564 C  CG1   . VAL A 1 478 ? 50.154 82.911  92.994  1.00 50.30  ? 478  VAL A CG1   1 
ATOM   3565 C  CG2   . VAL A 1 478 ? 50.968 85.117  92.172  1.00 48.30  ? 478  VAL A CG2   1 
ATOM   3566 N  N     . SER A 1 479 ? 48.639 86.498  90.521  1.00 52.94  ? 479  SER A N     1 
ATOM   3567 C  CA    . SER A 1 479 ? 48.765 87.360  89.348  1.00 56.95  ? 479  SER A CA    1 
ATOM   3568 C  C     . SER A 1 479 ? 49.983 87.034  88.498  1.00 58.02  ? 479  SER A C     1 
ATOM   3569 O  O     . SER A 1 479 ? 51.075 86.798  89.023  1.00 55.78  ? 479  SER A O     1 
ATOM   3570 C  CB    . SER A 1 479 ? 48.832 88.836  89.770  1.00 58.30  ? 479  SER A CB    1 
ATOM   3571 O  OG    . SER A 1 479 ? 48.542 89.694  88.675  1.00 60.85  ? 479  SER A OG    1 
ATOM   3572 N  N     . VAL A 1 480 ? 49.780 87.044  87.180  1.00 62.49  ? 480  VAL A N     1 
ATOM   3573 C  CA    . VAL A 1 480 ? 50.858 86.794  86.223  1.00 66.97  ? 480  VAL A CA    1 
ATOM   3574 C  C     . VAL A 1 480 ? 51.845 87.964  86.163  1.00 69.62  ? 480  VAL A C     1 
ATOM   3575 O  O     . VAL A 1 480 ? 52.862 87.857  85.484  1.00 68.41  ? 480  VAL A O     1 
ATOM   3576 C  CB    . VAL A 1 480 ? 50.331 86.501  84.773  1.00 68.09  ? 480  VAL A CB    1 
ATOM   3577 C  CG1   . VAL A 1 480 ? 49.312 85.345  84.760  1.00 68.67  ? 480  VAL A CG1   1 
ATOM   3578 C  CG2   . VAL A 1 480 ? 49.753 87.760  84.117  1.00 67.98  ? 480  VAL A CG2   1 
ATOM   3579 N  N     . GLU A 1 481 ? 51.523 89.069  86.849  1.00 72.71  ? 481  GLU A N     1 
ATOM   3580 C  CA    . GLU A 1 481 ? 52.387 90.252  86.946  1.00 74.35  ? 481  GLU A CA    1 
ATOM   3581 C  C     . GLU A 1 481 ? 52.855 90.471  88.382  1.00 74.25  ? 481  GLU A C     1 
ATOM   3582 O  O     . GLU A 1 481 ? 52.931 91.611  88.852  1.00 76.23  ? 481  GLU A O     1 
ATOM   3583 C  CB    . GLU A 1 481 ? 51.641 91.515  86.471  1.00 76.11  ? 481  GLU A CB    1 
ATOM   3584 C  CG    . GLU A 1 481 ? 50.869 91.375  85.162  1.00 77.36  ? 481  GLU A CG    1 
ATOM   3585 C  CD    . GLU A 1 481 ? 50.118 92.648  84.785  1.00 79.42  ? 481  GLU A CD    1 
ATOM   3586 O  OE1   . GLU A 1 481 ? 50.309 93.139  83.642  1.00 80.54  ? 481  GLU A OE1   1 
ATOM   3587 O  OE2   . GLU A 1 481 ? 49.336 93.158  85.629  1.00 79.20  ? 481  GLU A OE2   1 
ATOM   3588 N  N     . GLU A 1 482 ? 53.153 89.388  89.087  1.00 72.88  ? 482  GLU A N     1 
ATOM   3589 C  CA    . GLU A 1 482 ? 53.681 89.487  90.442  1.00 72.20  ? 482  GLU A CA    1 
ATOM   3590 C  C     . GLU A 1 482 ? 55.047 88.822  90.471  1.00 73.88  ? 482  GLU A C     1 
ATOM   3591 O  O     . GLU A 1 482 ? 55.246 87.768  89.870  1.00 72.46  ? 482  GLU A O     1 
ATOM   3592 C  CB    . GLU A 1 482 ? 52.732 88.833  91.451  1.00 70.48  ? 482  GLU A CB    1 
ATOM   3593 C  CG    . GLU A 1 482 ? 53.116 89.063  92.911  1.00 68.67  ? 482  GLU A CG    1 
ATOM   3594 C  CD    . GLU A 1 482 ? 51.991 88.749  93.887  1.00 67.37  ? 482  GLU A CD    1 
ATOM   3595 O  OE1   . GLU A 1 482 ? 52.238 88.025  94.877  1.00 65.82  ? 482  GLU A OE1   1 
ATOM   3596 O  OE2   . GLU A 1 482 ? 50.858 89.230  93.677  1.00 67.39  ? 482  GLU A OE2   1 
ATOM   3597 N  N     . ASN A 1 483 ? 55.988 89.447  91.169  1.00 76.60  ? 483  ASN A N     1 
ATOM   3598 C  CA    . ASN A 1 483 ? 57.368 88.984  91.175  1.00 77.82  ? 483  ASN A CA    1 
ATOM   3599 C  C     . ASN A 1 483 ? 57.556 87.906  92.239  1.00 76.97  ? 483  ASN A C     1 
ATOM   3600 O  O     . ASN A 1 483 ? 57.806 88.210  93.405  1.00 78.93  ? 483  ASN A O     1 
ATOM   3601 C  CB    . ASN A 1 483 ? 58.317 90.173  91.397  1.00 79.20  ? 483  ASN A CB    1 
ATOM   3602 C  CG    . ASN A 1 483 ? 59.709 89.932  90.835  1.00 80.65  ? 483  ASN A CG    1 
ATOM   3603 O  OD1   . ASN A 1 483 ? 59.992 88.883  90.248  1.00 80.96  ? 483  ASN A OD1   1 
ATOM   3604 N  ND2   . ASN A 1 483 ? 60.590 90.912  91.018  1.00 82.35  ? 483  ASN A ND2   1 
ATOM   3605 N  N     . ILE A 1 484 ? 57.429 86.646  91.832  1.00 74.91  ? 484  ILE A N     1 
ATOM   3606 C  CA    . ILE A 1 484 ? 57.414 85.527  92.776  1.00 73.88  ? 484  ILE A CA    1 
ATOM   3607 C  C     . ILE A 1 484 ? 58.178 84.320  92.229  1.00 70.34  ? 484  ILE A C     1 
ATOM   3608 O  O     . ILE A 1 484 ? 58.228 84.098  91.021  1.00 69.81  ? 484  ILE A O     1 
ATOM   3609 C  CB    . ILE A 1 484 ? 55.927 85.189  93.136  1.00 76.97  ? 484  ILE A CB    1 
ATOM   3610 C  CG1   . ILE A 1 484 ? 55.581 85.719  94.536  1.00 79.44  ? 484  ILE A CG1   1 
ATOM   3611 C  CG2   . ILE A 1 484 ? 55.596 83.694  93.008  1.00 76.63  ? 484  ILE A CG2   1 
ATOM   3612 C  CD1   . ILE A 1 484 ? 55.924 84.778  95.677  1.00 80.44  ? 484  ILE A CD1   1 
ATOM   3613 N  N     . THR A 1 485 ? 58.780 83.546  93.123  1.00 66.65  ? 485  THR A N     1 
ATOM   3614 C  CA    . THR A 1 485 ? 59.554 82.383  92.710  1.00 65.37  ? 485  THR A CA    1 
ATOM   3615 C  C     . THR A 1 485 ? 58.624 81.182  92.489  1.00 62.71  ? 485  THR A C     1 
ATOM   3616 O  O     . THR A 1 485 ? 57.512 81.145  93.013  1.00 58.77  ? 485  THR A O     1 
ATOM   3617 C  CB    . THR A 1 485 ? 60.642 82.020  93.760  1.00 66.36  ? 485  THR A CB    1 
ATOM   3618 O  OG1   . THR A 1 485 ? 60.027 81.561  94.971  1.00 67.94  ? 485  THR A OG1   1 
ATOM   3619 C  CG2   . THR A 1 485 ? 61.453 83.244  94.184  1.00 66.08  ? 485  THR A CG2   1 
ATOM   3620 N  N     . PRO A 1 486 ? 59.079 80.211  91.706  1.00 59.69  ? 486  PRO A N     1 
ATOM   3621 C  CA    . PRO A 1 486 ? 58.361 78.946  91.540  1.00 59.16  ? 486  PRO A CA    1 
ATOM   3622 C  C     . PRO A 1 486 ? 57.846 78.353  92.843  1.00 57.91  ? 486  PRO A C     1 
ATOM   3623 O  O     . PRO A 1 486 ? 56.688 77.972  92.940  1.00 55.02  ? 486  PRO A O     1 
ATOM   3624 C  CB    . PRO A 1 486 ? 59.427 78.037  90.940  1.00 60.14  ? 486  PRO A CB    1 
ATOM   3625 C  CG    . PRO A 1 486 ? 60.246 78.964  90.121  1.00 60.89  ? 486  PRO A CG    1 
ATOM   3626 C  CD    . PRO A 1 486 ? 60.294 80.259  90.876  1.00 59.95  ? 486  PRO A CD    1 
ATOM   3627 N  N     . PHE A 1 487 ? 58.705 78.291  93.846  1.00 59.43  ? 487  PHE A N     1 
ATOM   3628 C  CA    . PHE A 1 487 ? 58.363 77.615  95.087  1.00 59.31  ? 487  PHE A CA    1 
ATOM   3629 C  C     . PHE A 1 487 ? 57.322 78.373  95.899  1.00 57.86  ? 487  PHE A C     1 
ATOM   3630 O  O     . PHE A 1 487 ? 56.483 77.758  96.537  1.00 57.84  ? 487  PHE A O     1 
ATOM   3631 C  CB    . PHE A 1 487 ? 59.631 77.357  95.905  1.00 60.43  ? 487  PHE A CB    1 
ATOM   3632 C  CG    . PHE A 1 487 ? 60.667 76.565  95.156  1.00 61.28  ? 487  PHE A CG    1 
ATOM   3633 C  CD1   . PHE A 1 487 ? 61.750 77.201  94.554  1.00 62.12  ? 487  PHE A CD1   1 
ATOM   3634 C  CD2   . PHE A 1 487 ? 60.536 75.184  95.018  1.00 60.78  ? 487  PHE A CD2   1 
ATOM   3635 C  CE1   . PHE A 1 487 ? 62.697 76.464  93.842  1.00 62.64  ? 487  PHE A CE1   1 
ATOM   3636 C  CE2   . PHE A 1 487 ? 61.474 74.443  94.317  1.00 60.88  ? 487  PHE A CE2   1 
ATOM   3637 C  CZ    . PHE A 1 487 ? 62.555 75.081  93.724  1.00 61.95  ? 487  PHE A CZ    1 
ATOM   3638 N  N     . GLU A 1 488 ? 57.366 79.703  95.861  1.00 58.03  ? 488  GLU A N     1 
ATOM   3639 C  CA    . GLU A 1 488 ? 56.458 80.519  96.663  1.00 57.86  ? 488  GLU A CA    1 
ATOM   3640 C  C     . GLU A 1 488 ? 55.072 80.612  96.028  1.00 53.98  ? 488  GLU A C     1 
ATOM   3641 O  O     . GLU A 1 488 ? 54.084 80.865  96.713  1.00 51.96  ? 488  GLU A O     1 
ATOM   3642 C  CB    . GLU A 1 488 ? 57.042 81.912  96.874  1.00 61.84  ? 488  GLU A CB    1 
ATOM   3643 C  CG    . GLU A 1 488 ? 58.094 81.971  97.976  1.00 66.11  ? 488  GLU A CG    1 
ATOM   3644 C  CD    . GLU A 1 488 ? 59.153 83.058  97.762  1.00 69.63  ? 488  GLU A CD    1 
ATOM   3645 O  OE1   . GLU A 1 488 ? 60.244 82.936  98.377  1.00 69.73  ? 488  GLU A OE1   1 
ATOM   3646 O  OE2   . GLU A 1 488 ? 58.908 84.031  96.989  1.00 71.15  ? 488  GLU A OE2   1 
ATOM   3647 N  N     . LYS A 1 489 ? 55.021 80.405  94.716  1.00 50.97  ? 489  LYS A N     1 
ATOM   3648 C  CA    . LYS A 1 489 ? 53.778 80.383  93.946  1.00 47.28  ? 489  LYS A CA    1 
ATOM   3649 C  C     . LYS A 1 489 ? 53.039 79.076  94.229  1.00 46.41  ? 489  LYS A C     1 
ATOM   3650 O  O     . LYS A 1 489 ? 51.821 79.071  94.419  1.00 48.16  ? 489  LYS A O     1 
ATOM   3651 C  CB    . LYS A 1 489 ? 54.085 80.518  92.442  1.00 46.84  ? 489  LYS A CB    1 
ATOM   3652 C  CG    . LYS A 1 489 ? 52.952 81.090  91.581  1.00 47.15  ? 489  LYS A CG    1 
ATOM   3653 C  CD    . LYS A 1 489 ? 53.362 81.176  90.109  1.00 45.87  ? 489  LYS A CD    1 
ATOM   3654 C  CE    . LYS A 1 489 ? 52.254 81.712  89.229  1.00 45.45  ? 489  LYS A CE    1 
ATOM   3655 N  NZ    . LYS A 1 489 ? 51.001 80.880  89.292  1.00 47.18  ? 489  LYS A NZ    1 
ATOM   3656 N  N     . ILE A 1 490 ? 53.778 77.968  94.269  1.00 44.57  ? 490  ILE A N     1 
ATOM   3657 C  CA    . ILE A 1 490 ? 53.182 76.673  94.587  1.00 44.90  ? 490  ILE A CA    1 
ATOM   3658 C  C     . ILE A 1 490 ? 52.559 76.711  95.975  1.00 46.98  ? 490  ILE A C     1 
ATOM   3659 O  O     . ILE A 1 490 ? 51.434 76.256  96.137  1.00 47.71  ? 490  ILE A O     1 
ATOM   3660 C  CB    . ILE A 1 490 ? 54.206 75.514  94.442  1.00 43.11  ? 490  ILE A CB    1 
ATOM   3661 C  CG1   . ILE A 1 490 ? 54.391 75.151  92.973  1.00 42.90  ? 490  ILE A CG1   1 
ATOM   3662 C  CG2   . ILE A 1 490 ? 53.765 74.249  95.185  1.00 44.44  ? 490  ILE A CG2   1 
ATOM   3663 C  CD1   . ILE A 1 490 ? 55.758 74.570  92.666  1.00 43.34  ? 490  ILE A CD1   1 
ATOM   3664 N  N     . SER A 1 491 ? 53.281 77.266  96.952  1.00 47.61  ? 491  SER A N     1 
ATOM   3665 C  CA    . SER A 1 491 ? 52.802 77.377  98.341  1.00 48.92  ? 491  SER A CA    1 
ATOM   3666 C  C     . SER A 1 491 ? 51.518 78.197  98.512  1.00 46.14  ? 491  SER A C     1 
ATOM   3667 O  O     . SER A 1 491 ? 50.614 77.799  99.232  1.00 46.57  ? 491  SER A O     1 
ATOM   3668 C  CB    . SER A 1 491 ? 53.894 77.992  99.228  1.00 50.94  ? 491  SER A CB    1 
ATOM   3669 O  OG    . SER A 1 491 ? 54.794 76.989  99.665  1.00 55.12  ? 491  SER A OG    1 
ATOM   3670 N  N     . ARG A 1 492 ? 51.472 79.350  97.861  1.00 45.82  ? 492  ARG A N     1 
ATOM   3671 C  CA    . ARG A 1 492 ? 50.310 80.233  97.868  1.00 47.34  ? 492  ARG A CA    1 
ATOM   3672 C  C     . ARG A 1 492 ? 49.068 79.583  97.237  1.00 46.89  ? 492  ARG A C     1 
ATOM   3673 O  O     . ARG A 1 492 ? 47.930 79.806  97.683  1.00 41.92  ? 492  ARG A O     1 
ATOM   3674 C  CB    . ARG A 1 492 ? 50.635 81.494  97.065  1.00 50.22  ? 492  ARG A CB    1 
ATOM   3675 C  CG    . ARG A 1 492 ? 51.505 82.476  97.784  1.00 52.12  ? 492  ARG A CG    1 
ATOM   3676 C  CD    . ARG A 1 492 ? 50.702 83.537  98.518  1.00 55.57  ? 492  ARG A CD    1 
ATOM   3677 N  NE    . ARG A 1 492 ? 49.940 84.405  97.620  1.00 55.86  ? 492  ARG A NE    1 
ATOM   3678 C  CZ    . ARG A 1 492 ? 50.478 85.301  96.795  1.00 55.22  ? 492  ARG A CZ    1 
ATOM   3679 N  NH1   . ARG A 1 492 ? 51.798 85.463  96.720  1.00 56.87  ? 492  ARG A NH1   1 
ATOM   3680 N  NH2   . ARG A 1 492 ? 49.690 86.046  96.038  1.00 54.51  ? 492  ARG A NH2   1 
ATOM   3681 N  N     . GLU A 1 493 ? 49.301 78.798  96.184  1.00 45.04  ? 493  GLU A N     1 
ATOM   3682 C  CA    . GLU A 1 493 ? 48.218 78.205  95.414  1.00 44.32  ? 493  GLU A CA    1 
ATOM   3683 C  C     . GLU A 1 493 ? 47.748 76.850  95.930  1.00 41.73  ? 493  GLU A C     1 
ATOM   3684 O  O     . GLU A 1 493 ? 46.565 76.540  95.824  1.00 44.43  ? 493  GLU A O     1 
ATOM   3685 C  CB    . GLU A 1 493 ? 48.614 78.118  93.940  1.00 43.63  ? 493  GLU A CB    1 
ATOM   3686 C  CG    . GLU A 1 493 ? 48.678 79.485  93.280  1.00 42.06  ? 493  GLU A CG    1 
ATOM   3687 C  CD    . GLU A 1 493 ? 48.905 79.405  91.794  1.00 40.97  ? 493  GLU A CD    1 
ATOM   3688 O  OE1   . GLU A 1 493 ? 49.151 80.474  91.179  1.00 40.03  ? 493  GLU A OE1   1 
ATOM   3689 O  OE2   . GLU A 1 493 ? 48.833 78.277  91.253  1.00 35.52  ? 493  GLU A OE2   1 
ATOM   3690 N  N     . ALA A 1 494 ? 48.642 76.078  96.541  1.00 41.80  ? 494  ALA A N     1 
ATOM   3691 C  CA    . ALA A 1 494 ? 48.334 74.700  96.978  1.00 42.00  ? 494  ALA A CA    1 
ATOM   3692 C  C     . ALA A 1 494 ? 47.020 74.525  97.752  1.00 42.02  ? 494  ALA A C     1 
ATOM   3693 O  O     . ALA A 1 494 ? 46.275 73.601  97.463  1.00 45.19  ? 494  ALA A O     1 
ATOM   3694 C  CB    . ALA A 1 494 ? 49.483 74.114  97.786  1.00 41.13  ? 494  ALA A CB    1 
ATOM   3695 N  N     . PRO A 1 495 ? 46.730 75.376  98.735  1.00 43.44  ? 495  PRO A N     1 
ATOM   3696 C  CA    . PRO A 1 495 ? 45.510 75.202  99.543  1.00 41.83  ? 495  PRO A CA    1 
ATOM   3697 C  C     . PRO A 1 495 ? 44.215 75.099  98.728  1.00 41.17  ? 495  PRO A C     1 
ATOM   3698 O  O     . PRO A 1 495 ? 43.244 74.443  99.137  1.00 40.89  ? 495  PRO A O     1 
ATOM   3699 C  CB    . PRO A 1 495 ? 45.497 76.460  100.414 1.00 42.23  ? 495  PRO A CB    1 
ATOM   3700 C  CG    . PRO A 1 495 ? 46.941 76.871  100.517 1.00 42.49  ? 495  PRO A CG    1 
ATOM   3701 C  CD    . PRO A 1 495 ? 47.533 76.530  99.195  1.00 43.46  ? 495  PRO A CD    1 
ATOM   3702 N  N     . TYR A 1 496 ? 44.211 75.755  97.576  1.00 39.58  ? 496  TYR A N     1 
ATOM   3703 C  CA    . TYR A 1 496 ? 43.026 75.859  96.741  1.00 37.81  ? 496  TYR A CA    1 
ATOM   3704 C  C     . TYR A 1 496 ? 42.692 74.573  95.990  1.00 37.62  ? 496  TYR A C     1 
ATOM   3705 O  O     . TYR A 1 496 ? 41.535 74.333  95.645  1.00 39.28  ? 496  TYR A O     1 
ATOM   3706 C  CB    . TYR A 1 496 ? 43.224 76.997  95.749  1.00 39.34  ? 496  TYR A CB    1 
ATOM   3707 C  CG    . TYR A 1 496 ? 43.241 78.360  96.395  1.00 39.29  ? 496  TYR A CG    1 
ATOM   3708 C  CD1   . TYR A 1 496 ? 44.437 79.010  96.702  1.00 39.41  ? 496  TYR A CD1   1 
ATOM   3709 C  CD2   . TYR A 1 496 ? 42.061 79.000  96.684  1.00 38.87  ? 496  TYR A CD2   1 
ATOM   3710 C  CE1   . TYR A 1 496 ? 44.442 80.271  97.295  1.00 38.36  ? 496  TYR A CE1   1 
ATOM   3711 C  CE2   . TYR A 1 496 ? 42.051 80.251  97.263  1.00 42.17  ? 496  TYR A CE2   1 
ATOM   3712 C  CZ    . TYR A 1 496 ? 43.240 80.889  97.570  1.00 40.45  ? 496  TYR A CZ    1 
ATOM   3713 O  OH    . TYR A 1 496 ? 43.173 82.142  98.147  1.00 41.08  ? 496  TYR A OH    1 
ATOM   3714 N  N     . HIS A 1 497 ? 43.699 73.757  95.712  1.00 37.76  ? 497  HIS A N     1 
ATOM   3715 C  CA    . HIS A 1 497 ? 43.465 72.450  95.116  1.00 38.81  ? 497  HIS A CA    1 
ATOM   3716 C  C     . HIS A 1 497 ? 42.603 71.569  96.039  1.00 39.52  ? 497  HIS A C     1 
ATOM   3717 O  O     . HIS A 1 497 ? 41.877 70.696  95.568  1.00 42.73  ? 497  HIS A O     1 
ATOM   3718 C  CB    . HIS A 1 497 ? 44.788 71.742  94.803  1.00 38.88  ? 497  HIS A CB    1 
ATOM   3719 C  CG    . HIS A 1 497 ? 45.603 72.403  93.728  1.00 38.04  ? 497  HIS A CG    1 
ATOM   3720 N  ND1   . HIS A 1 497 ? 46.252 71.688  92.743  1.00 35.60  ? 497  HIS A ND1   1 
ATOM   3721 C  CD2   . HIS A 1 497 ? 45.886 73.709  93.490  1.00 38.72  ? 497  HIS A CD2   1 
ATOM   3722 C  CE1   . HIS A 1 497 ? 46.897 72.522  91.946  1.00 37.36  ? 497  HIS A CE1   1 
ATOM   3723 N  NE2   . HIS A 1 497 ? 46.693 73.755  92.377  1.00 37.15  ? 497  HIS A NE2   1 
ATOM   3724 N  N     . PHE A 1 498 ? 42.671 71.814  97.346  1.00 38.19  ? 498  PHE A N     1 
ATOM   3725 C  CA    . PHE A 1 498 ? 41.917 71.031  98.343  1.00 36.20  ? 498  PHE A CA    1 
ATOM   3726 C  C     . PHE A 1 498 ? 40.536 71.583  98.613  1.00 34.79  ? 498  PHE A C     1 
ATOM   3727 O  O     . PHE A 1 498 ? 39.763 70.988  99.359  1.00 33.60  ? 498  PHE A O     1 
ATOM   3728 C  CB    . PHE A 1 498 ? 42.706 70.940  99.651  1.00 34.30  ? 498  PHE A CB    1 
ATOM   3729 C  CG    . PHE A 1 498 ? 44.017 70.262  99.482  1.00 36.35  ? 498  PHE A CG    1 
ATOM   3730 C  CD1   . PHE A 1 498 ? 45.127 70.980  99.063  1.00 37.76  ? 498  PHE A CD1   1 
ATOM   3731 C  CD2   . PHE A 1 498 ? 44.133 68.893  99.675  1.00 38.82  ? 498  PHE A CD2   1 
ATOM   3732 C  CE1   . PHE A 1 498 ? 46.342 70.350  98.858  1.00 38.61  ? 498  PHE A CE1   1 
ATOM   3733 C  CE2   . PHE A 1 498 ? 45.349 68.249  99.477  1.00 39.90  ? 498  PHE A CE2   1 
ATOM   3734 C  CZ    . PHE A 1 498 ? 46.457 68.983  99.073  1.00 40.28  ? 498  PHE A CZ    1 
ATOM   3735 N  N     . ILE A 1 499 ? 40.245 72.734  98.016  1.00 36.27  ? 499  ILE A N     1 
ATOM   3736 C  CA    . ILE A 1 499 ? 38.976 73.425  98.203  1.00 37.07  ? 499  ILE A CA    1 
ATOM   3737 C  C     . ILE A 1 499 ? 38.132 73.376  96.925  1.00 34.82  ? 499  ILE A C     1 
ATOM   3738 O  O     . ILE A 1 499 ? 36.963 73.010  96.983  1.00 33.40  ? 499  ILE A O     1 
ATOM   3739 C  CB    . ILE A 1 499 ? 39.229 74.892  98.631  1.00 38.91  ? 499  ILE A CB    1 
ATOM   3740 C  CG1   . ILE A 1 499 ? 39.912 74.937  99.994  1.00 40.80  ? 499  ILE A CG1   1 
ATOM   3741 C  CG2   . ILE A 1 499 ? 37.932 75.653  98.710  1.00 39.18  ? 499  ILE A CG2   1 
ATOM   3742 C  CD1   . ILE A 1 499 ? 40.467 76.323  100.351 1.00 41.33  ? 499  ILE A CD1   1 
ATOM   3743 N  N     . ALA A 1 500 ? 38.711 73.788  95.792  1.00 33.35  ? 500  ALA A N     1 
ATOM   3744 C  CA    . ALA A 1 500 ? 38.016 73.762  94.507  1.00 32.21  ? 500  ALA A CA    1 
ATOM   3745 C  C     . ALA A 1 500 ? 38.158 72.368  93.898  1.00 34.24  ? 500  ALA A C     1 
ATOM   3746 O  O     . ALA A 1 500 ? 38.836 72.180  92.887  1.00 33.60  ? 500  ALA A O     1 
ATOM   3747 C  CB    . ALA A 1 500 ? 38.581 74.831  93.571  1.00 31.75  ? 500  ALA A CB    1 
ATOM   3748 N  N     . THR A 1 501 ? 37.482 71.397  94.510  1.00 36.96  ? 501  THR A N     1 
ATOM   3749 C  CA    . THR A 1 501 ? 37.742 69.977  94.239  1.00 39.52  ? 501  THR A CA    1 
ATOM   3750 C  C     . THR A 1 501 ? 37.256 69.520  92.875  1.00 38.15  ? 501  THR A C     1 
ATOM   3751 O  O     . THR A 1 501 ? 37.675 68.475  92.410  1.00 41.73  ? 501  THR A O     1 
ATOM   3752 C  CB    . THR A 1 501 ? 37.096 69.081  95.303  1.00 39.00  ? 501  THR A CB    1 
ATOM   3753 O  OG1   . THR A 1 501 ? 35.662 69.190  95.226  1.00 41.87  ? 501  THR A OG1   1 
ATOM   3754 C  CG2   . THR A 1 501 ? 37.462 69.542  96.711  1.00 39.19  ? 501  THR A CG2   1 
ATOM   3755 N  N     . GLY A 1 502 ? 36.351 70.287  92.270  1.00 37.77  ? 502  GLY A N     1 
ATOM   3756 C  CA    . GLY A 1 502 ? 35.780 69.961  90.975  1.00 35.92  ? 502  GLY A CA    1 
ATOM   3757 C  C     . GLY A 1 502 ? 36.697 70.282  89.810  1.00 33.38  ? 502  GLY A C     1 
ATOM   3758 O  O     . GLY A 1 502 ? 36.434 69.873  88.695  1.00 32.45  ? 502  GLY A O     1 
ATOM   3759 N  N     . GLY A 1 503 ? 37.753 71.039  90.063  1.00 32.50  ? 503  GLY A N     1 
ATOM   3760 C  CA    . GLY A 1 503 ? 38.694 71.385  89.026  1.00 33.22  ? 503  GLY A CA    1 
ATOM   3761 C  C     . GLY A 1 503 ? 39.706 72.424  89.447  1.00 32.70  ? 503  GLY A C     1 
ATOM   3762 O  O     . GLY A 1 503 ? 39.376 73.441  90.010  1.00 34.61  ? 503  GLY A O     1 
ATOM   3763 N  N     . HIS A 1 504 ? 40.962 72.157  89.157  1.00 32.59  ? 504  HIS A N     1 
ATOM   3764 C  CA    . HIS A 1 504 ? 42.018 73.053  89.548  1.00 31.94  ? 504  HIS A CA    1 
ATOM   3765 C  C     . HIS A 1 504 ? 43.309 72.637  88.879  1.00 34.21  ? 504  HIS A C     1 
ATOM   3766 O  O     . HIS A 1 504 ? 43.493 71.465  88.522  1.00 35.00  ? 504  HIS A O     1 
ATOM   3767 C  CB    . HIS A 1 504 ? 42.198 72.976  91.054  1.00 34.45  ? 504  HIS A CB    1 
ATOM   3768 C  CG    . HIS A 1 504 ? 42.232 71.572  91.573  1.00 33.84  ? 504  HIS A CG    1 
ATOM   3769 N  ND1   . HIS A 1 504 ? 41.117 70.941  92.073  1.00 34.88  ? 504  HIS A ND1   1 
ATOM   3770 C  CD2   . HIS A 1 504 ? 43.234 70.667  91.630  1.00 30.97  ? 504  HIS A CD2   1 
ATOM   3771 C  CE1   . HIS A 1 504 ? 41.437 69.715  92.443  1.00 34.89  ? 504  HIS A CE1   1 
ATOM   3772 N  NE2   . HIS A 1 504 ? 42.716 69.523  92.178  1.00 31.21  ? 504  HIS A NE2   1 
ATOM   3773 N  N     . ILE A 1 505 ? 44.196 73.608  88.717  1.00 34.16  ? 505  ILE A N     1 
ATOM   3774 C  CA    . ILE A 1 505 ? 45.579 73.372  88.327  1.00 33.13  ? 505  ILE A CA    1 
ATOM   3775 C  C     . ILE A 1 505 ? 46.437 74.566  88.777  1.00 33.67  ? 505  ILE A C     1 
ATOM   3776 O  O     . ILE A 1 505 ? 45.909 75.654  89.041  1.00 31.50  ? 505  ILE A O     1 
ATOM   3777 C  CB    . ILE A 1 505 ? 45.684 73.167  86.791  1.00 34.72  ? 505  ILE A CB    1 
ATOM   3778 C  CG1   . ILE A 1 505 ? 47.060 72.611  86.402  1.00 37.52  ? 505  ILE A CG1   1 
ATOM   3779 C  CG2   . ILE A 1 505 ? 45.444 74.459  86.048  1.00 34.07  ? 505  ILE A CG2   1 
ATOM   3780 C  CD1   . ILE A 1 505 ? 47.159 72.142  84.966  1.00 39.26  ? 505  ILE A CD1   1 
ATOM   3781 N  N     . SER A 1 506 ? 47.750 74.354  88.872  1.00 34.44  ? 506  SER A N     1 
ATOM   3782 C  CA    . SER A 1 506 ? 48.701 75.446  89.081  1.00 35.27  ? 506  SER A CA    1 
ATOM   3783 C  C     . SER A 1 506 ? 49.785 75.407  88.025  1.00 36.73  ? 506  SER A C     1 
ATOM   3784 O  O     . SER A 1 506 ? 50.273 74.334  87.648  1.00 35.82  ? 506  SER A O     1 
ATOM   3785 C  CB    . SER A 1 506 ? 49.360 75.364  90.460  1.00 34.87  ? 506  SER A CB    1 
ATOM   3786 O  OG    . SER A 1 506 ? 48.463 75.796  91.462  1.00 34.89  ? 506  SER A OG    1 
ATOM   3787 N  N     . TYR A 1 507 ? 50.146 76.597  87.564  1.00 38.38  ? 507  TYR A N     1 
ATOM   3788 C  CA    . TYR A 1 507 ? 51.230 76.792  86.632  1.00 41.16  ? 507  TYR A CA    1 
ATOM   3789 C  C     . TYR A 1 507 ? 52.367 77.558  87.298  1.00 44.62  ? 507  TYR A C     1 
ATOM   3790 O  O     . TYR A 1 507 ? 52.164 78.362  88.216  1.00 44.60  ? 507  TYR A O     1 
ATOM   3791 C  CB    . TYR A 1 507 ? 50.746 77.587  85.423  1.00 40.46  ? 507  TYR A CB    1 
ATOM   3792 C  CG    . TYR A 1 507 ? 49.710 76.871  84.598  1.00 43.10  ? 507  TYR A CG    1 
ATOM   3793 C  CD1   . TYR A 1 507 ? 48.514 77.489  84.248  1.00 43.95  ? 507  TYR A CD1   1 
ATOM   3794 C  CD2   . TYR A 1 507 ? 49.929 75.573  84.162  1.00 43.64  ? 507  TYR A CD2   1 
ATOM   3795 C  CE1   . TYR A 1 507 ? 47.564 76.823  83.487  1.00 45.15  ? 507  TYR A CE1   1 
ATOM   3796 C  CE2   . TYR A 1 507 ? 49.003 74.911  83.407  1.00 44.08  ? 507  TYR A CE2   1 
ATOM   3797 C  CZ    . TYR A 1 507 ? 47.823 75.530  83.072  1.00 44.55  ? 507  TYR A CZ    1 
ATOM   3798 O  OH    . TYR A 1 507 ? 46.918 74.836  82.316  1.00 44.59  ? 507  TYR A OH    1 
ATOM   3799 N  N     . VAL A 1 508 ? 53.567 77.296  86.804  1.00 46.63  ? 508  VAL A N     1 
ATOM   3800 C  CA    . VAL A 1 508 ? 54.737 78.078  87.136  1.00 48.55  ? 508  VAL A CA    1 
ATOM   3801 C  C     . VAL A 1 508 ? 55.444 78.449  85.833  1.00 49.35  ? 508  VAL A C     1 
ATOM   3802 O  O     . VAL A 1 508 ? 55.594 77.598  84.953  1.00 51.66  ? 508  VAL A O     1 
ATOM   3803 C  CB    . VAL A 1 508 ? 55.642 77.263  88.046  1.00 50.01  ? 508  VAL A CB    1 
ATOM   3804 C  CG1   . VAL A 1 508 ? 57.089 77.604  87.830  1.00 52.72  ? 508  VAL A CG1   1 
ATOM   3805 C  CG2   . VAL A 1 508 ? 55.245 77.473  89.496  1.00 49.79  ? 508  VAL A CG2   1 
ATOM   3806 N  N     . GLU A 1 509 ? 55.856 79.713  85.712  1.00 48.85  ? 509  GLU A N     1 
ATOM   3807 C  CA    . GLU A 1 509 ? 56.597 80.193  84.544  1.00 51.28  ? 509  GLU A CA    1 
ATOM   3808 C  C     . GLU A 1 509 ? 58.105 79.967  84.742  1.00 51.30  ? 509  GLU A C     1 
ATOM   3809 O  O     . GLU A 1 509 ? 58.656 80.317  85.781  1.00 50.46  ? 509  GLU A O     1 
ATOM   3810 C  CB    . GLU A 1 509 ? 56.339 81.690  84.292  1.00 53.01  ? 509  GLU A CB    1 
ATOM   3811 C  CG    . GLU A 1 509 ? 54.875 82.100  84.132  1.00 54.51  ? 509  GLU A CG    1 
ATOM   3812 C  CD    . GLU A 1 509 ? 54.289 81.771  82.759  1.00 57.60  ? 509  GLU A CD    1 
ATOM   3813 O  OE1   . GLU A 1 509 ? 53.089 81.391  82.686  1.00 58.20  ? 509  GLU A OE1   1 
ATOM   3814 O  OE2   . GLU A 1 509 ? 55.015 81.897  81.745  1.00 58.45  ? 509  GLU A OE2   1 
ATOM   3815 N  N     . LEU A 1 510 ? 58.755 79.384  83.734  1.00 52.25  ? 510  LEU A N     1 
ATOM   3816 C  CA    . LEU A 1 510 ? 60.187 79.066  83.761  1.00 51.30  ? 510  LEU A CA    1 
ATOM   3817 C  C     . LEU A 1 510 ? 60.817 79.360  82.403  1.00 52.19  ? 510  LEU A C     1 
ATOM   3818 O  O     . LEU A 1 510 ? 60.138 79.281  81.383  1.00 52.60  ? 510  LEU A O     1 
ATOM   3819 C  CB    . LEU A 1 510 ? 60.381 77.579  84.067  1.00 50.69  ? 510  LEU A CB    1 
ATOM   3820 C  CG    . LEU A 1 510 ? 60.897 77.121  85.428  1.00 50.67  ? 510  LEU A CG    1 
ATOM   3821 C  CD1   . LEU A 1 510 ? 60.342 77.944  86.553  1.00 49.83  ? 510  LEU A CD1   1 
ATOM   3822 C  CD2   . LEU A 1 510 ? 60.558 75.645  85.627  1.00 51.19  ? 510  LEU A CD2   1 
ATOM   3823 N  N     . PRO A 1 511 ? 62.115 79.666  82.377  1.00 54.94  ? 511  PRO A N     1 
ATOM   3824 C  CA    . PRO A 1 511 ? 62.844 79.836  81.110  1.00 55.43  ? 511  PRO A CA    1 
ATOM   3825 C  C     . PRO A 1 511 ? 63.167 78.485  80.435  1.00 56.21  ? 511  PRO A C     1 
ATOM   3826 O  O     . PRO A 1 511 ? 62.651 77.449  80.859  1.00 56.77  ? 511  PRO A O     1 
ATOM   3827 C  CB    . PRO A 1 511 ? 64.126 80.554  81.553  1.00 55.57  ? 511  PRO A CB    1 
ATOM   3828 C  CG    . PRO A 1 511 ? 64.368 80.070  82.947  1.00 54.84  ? 511  PRO A CG    1 
ATOM   3829 C  CD    . PRO A 1 511 ? 62.999 79.864  83.546  1.00 55.59  ? 511  PRO A CD    1 
ATOM   3830 N  N     . ASP A 1 512 ? 63.997 78.491  79.394  1.00 56.74  ? 512  ASP A N     1 
ATOM   3831 C  CA    . ASP A 1 512 ? 64.448 77.247  78.764  1.00 56.71  ? 512  ASP A CA    1 
ATOM   3832 C  C     . ASP A 1 512 ? 65.046 76.325  79.823  1.00 55.87  ? 512  ASP A C     1 
ATOM   3833 O  O     . ASP A 1 512 ? 65.901 76.748  80.604  1.00 57.22  ? 512  ASP A O     1 
ATOM   3834 C  CB    . ASP A 1 512 ? 65.507 77.535  77.697  1.00 58.47  ? 512  ASP A CB    1 
ATOM   3835 C  CG    . ASP A 1 512 ? 65.661 76.403  76.700  1.00 59.61  ? 512  ASP A CG    1 
ATOM   3836 O  OD1   . ASP A 1 512 ? 65.460 75.224  77.057  1.00 59.25  ? 512  ASP A OD1   1 
ATOM   3837 O  OD2   . ASP A 1 512 ? 65.981 76.606  75.515  1.00 63.69  ? 512  ASP A OD2   1 
ATOM   3838 N  N     . MET A 1 513 ? 64.582 75.080  79.857  1.00 53.94  ? 513  MET A N     1 
ATOM   3839 C  CA    . MET A 1 513 ? 65.023 74.110  80.854  1.00 53.34  ? 513  MET A CA    1 
ATOM   3840 C  C     . MET A 1 513 ? 65.499 72.833  80.189  1.00 51.26  ? 513  MET A C     1 
ATOM   3841 O  O     . MET A 1 513 ? 65.609 71.797  80.845  1.00 48.60  ? 513  MET A O     1 
ATOM   3842 C  CB    . MET A 1 513 ? 63.882 73.767  81.824  1.00 55.29  ? 513  MET A CB    1 
ATOM   3843 C  CG    . MET A 1 513 ? 63.263 74.954  82.533  1.00 56.87  ? 513  MET A CG    1 
ATOM   3844 S  SD    . MET A 1 513 ? 64.362 75.764  83.724  1.00 58.11  ? 513  MET A SD    1 
ATOM   3845 C  CE    . MET A 1 513 ? 64.495 74.463  85.037  1.00 56.70  ? 513  MET A CE    1 
ATOM   3846 N  N     . LYS A 1 514 ? 65.783 72.903  78.894  1.00 51.30  ? 514  LYS A N     1 
ATOM   3847 C  CA    . LYS A 1 514 ? 66.176 71.718  78.143  1.00 53.64  ? 514  LYS A CA    1 
ATOM   3848 C  C     . LYS A 1 514 ? 67.535 71.177  78.592  1.00 55.27  ? 514  LYS A C     1 
ATOM   3849 O  O     . LYS A 1 514 ? 67.727 69.954  78.631  1.00 55.16  ? 514  LYS A O     1 
ATOM   3850 C  CB    . LYS A 1 514 ? 66.146 71.990  76.639  1.00 53.71  ? 514  LYS A CB    1 
ATOM   3851 C  CG    . LYS A 1 514 ? 64.717 72.028  76.086  1.00 53.74  ? 514  LYS A CG    1 
ATOM   3852 C  CD    . LYS A 1 514 ? 64.679 71.957  74.570  1.00 53.56  ? 514  LYS A CD    1 
ATOM   3853 C  CE    . LYS A 1 514 ? 65.141 73.258  73.941  1.00 53.65  ? 514  LYS A CE    1 
ATOM   3854 N  NZ    . LYS A 1 514 ? 64.340 74.438  74.367  1.00 53.46  ? 514  LYS A NZ    1 
ATOM   3855 N  N     . ASN A 1 515 ? 68.454 72.073  78.956  1.00 56.12  ? 515  ASN A N     1 
ATOM   3856 C  CA    . ASN A 1 515 ? 69.739 71.664  79.532  1.00 57.62  ? 515  ASN A CA    1 
ATOM   3857 C  C     . ASN A 1 515 ? 69.835 71.855  81.050  1.00 57.03  ? 515  ASN A C     1 
ATOM   3858 O  O     . ASN A 1 515 ? 70.928 71.927  81.601  1.00 57.48  ? 515  ASN A O     1 
ATOM   3859 C  CB    . ASN A 1 515 ? 70.874 72.368  78.799  1.00 59.03  ? 515  ASN A CB    1 
ATOM   3860 C  CG    . ASN A 1 515 ? 71.047 71.843  77.384  1.00 61.44  ? 515  ASN A CG    1 
ATOM   3861 O  OD1   . ASN A 1 515 ? 70.956 72.596  76.412  1.00 63.29  ? 515  ASN A OD1   1 
ATOM   3862 N  ND2   . ASN A 1 515 ? 71.275 70.534  77.261  1.00 61.60  ? 515  ASN A ND2   1 
ATOM   3863 N  N     . ASN A 1 516 ? 68.678 71.908  81.710  1.00 56.19  ? 516  ASN A N     1 
ATOM   3864 C  CA    . ASN A 1 516 ? 68.579 71.962  83.166  1.00 55.28  ? 516  ASN A CA    1 
ATOM   3865 C  C     . ASN A 1 516 ? 67.416 71.092  83.672  1.00 54.85  ? 516  ASN A C     1 
ATOM   3866 O  O     . ASN A 1 516 ? 66.550 71.550  84.420  1.00 56.66  ? 516  ASN A O     1 
ATOM   3867 C  CB    . ASN A 1 516 ? 68.410 73.418  83.631  1.00 55.88  ? 516  ASN A CB    1 
ATOM   3868 C  CG    . ASN A 1 516 ? 68.518 73.573  85.152  1.00 55.56  ? 516  ASN A CG    1 
ATOM   3869 O  OD1   . ASN A 1 516 ? 68.912 72.647  85.860  1.00 56.41  ? 516  ASN A OD1   1 
ATOM   3870 N  ND2   . ASN A 1 516 ? 68.159 74.747  85.650  1.00 54.83  ? 516  ASN A ND2   1 
ATOM   3871 N  N     . LEU A 1 517 ? 67.406 69.829  83.274  1.00 54.14  ? 517  LEU A N     1 
ATOM   3872 C  CA    . LEU A 1 517 ? 66.360 68.899  83.704  1.00 55.21  ? 517  LEU A CA    1 
ATOM   3873 C  C     . LEU A 1 517 ? 66.268 68.723  85.228  1.00 57.79  ? 517  LEU A C     1 
ATOM   3874 O  O     . LEU A 1 517 ? 65.231 68.298  85.742  1.00 58.35  ? 517  LEU A O     1 
ATOM   3875 C  CB    . LEU A 1 517 ? 66.547 67.538  83.020  1.00 55.01  ? 517  LEU A CB    1 
ATOM   3876 C  CG    . LEU A 1 517 ? 65.764 67.317  81.720  1.00 55.89  ? 517  LEU A CG    1 
ATOM   3877 C  CD1   . LEU A 1 517 ? 65.651 68.577  80.878  1.00 57.14  ? 517  LEU A CD1   1 
ATOM   3878 C  CD2   . LEU A 1 517 ? 66.382 66.201  80.893  1.00 55.96  ? 517  LEU A CD2   1 
ATOM   3879 N  N     . LYS A 1 518 ? 67.348 69.053  85.937  1.00 59.98  ? 518  LYS A N     1 
ATOM   3880 C  CA    . LYS A 1 518 ? 67.402 68.940  87.389  1.00 61.14  ? 518  LYS A CA    1 
ATOM   3881 C  C     . LYS A 1 518 ? 66.590 70.037  88.091  1.00 59.34  ? 518  LYS A C     1 
ATOM   3882 O  O     . LYS A 1 518 ? 65.897 69.769  89.071  1.00 59.73  ? 518  LYS A O     1 
ATOM   3883 C  CB    . LYS A 1 518 ? 68.865 68.979  87.860  1.00 65.02  ? 518  LYS A CB    1 
ATOM   3884 C  CG    . LYS A 1 518 ? 69.140 68.185  89.131  1.00 68.90  ? 518  LYS A CG    1 
ATOM   3885 C  CD    . LYS A 1 518 ? 68.919 66.677  88.935  1.00 71.12  ? 518  LYS A CD    1 
ATOM   3886 C  CE    . LYS A 1 518 ? 69.763 65.849  89.911  1.00 73.00  ? 518  LYS A CE    1 
ATOM   3887 N  NZ    . LYS A 1 518 ? 69.670 64.386  89.624  1.00 74.18  ? 518  LYS A NZ    1 
ATOM   3888 N  N     . GLY A 1 519 ? 66.693 71.271  87.604  1.00 56.26  ? 519  GLY A N     1 
ATOM   3889 C  CA    . GLY A 1 519 ? 65.892 72.367  88.126  1.00 55.61  ? 519  GLY A CA    1 
ATOM   3890 C  C     . GLY A 1 519 ? 64.401 72.144  87.903  1.00 55.79  ? 519  GLY A C     1 
ATOM   3891 O  O     . GLY A 1 519 ? 63.579 72.380  88.796  1.00 53.19  ? 519  GLY A O     1 
ATOM   3892 N  N     . LEU A 1 520 ? 64.060 71.679  86.704  1.00 55.33  ? 520  LEU A N     1 
ATOM   3893 C  CA    . LEU A 1 520 ? 62.686 71.339  86.365  1.00 56.12  ? 520  LEU A CA    1 
ATOM   3894 C  C     . LEU A 1 520 ? 62.157 70.270  87.303  1.00 57.05  ? 520  LEU A C     1 
ATOM   3895 O  O     . LEU A 1 520 ? 61.008 70.348  87.744  1.00 57.54  ? 520  LEU A O     1 
ATOM   3896 C  CB    . LEU A 1 520 ? 62.583 70.839  84.913  1.00 57.57  ? 520  LEU A CB    1 
ATOM   3897 C  CG    . LEU A 1 520 ? 61.314 71.093  84.070  1.00 56.43  ? 520  LEU A CG    1 
ATOM   3898 C  CD1   . LEU A 1 520 ? 61.120 69.981  83.040  1.00 55.43  ? 520  LEU A CD1   1 
ATOM   3899 C  CD2   . LEU A 1 520 ? 60.060 71.255  84.895  1.00 55.62  ? 520  LEU A CD2   1 
ATOM   3900 N  N     . GLU A 1 521 ? 62.991 69.276  87.611  1.00 56.62  ? 521  GLU A N     1 
ATOM   3901 C  CA    . GLU A 1 521 ? 62.555 68.151  88.443  1.00 55.79  ? 521  GLU A CA    1 
ATOM   3902 C  C     . GLU A 1 521 ? 62.285 68.603  89.870  1.00 54.63  ? 521  GLU A C     1 
ATOM   3903 O  O     . GLU A 1 521 ? 61.431 68.038  90.559  1.00 56.14  ? 521  GLU A O     1 
ATOM   3904 C  CB    . GLU A 1 521 ? 63.592 67.020  88.442  1.00 55.80  ? 521  GLU A CB    1 
ATOM   3905 C  CG    . GLU A 1 521 ? 63.196 65.842  89.328  1.00 55.47  ? 521  GLU A CG    1 
ATOM   3906 C  CD    . GLU A 1 521 ? 64.152 64.668  89.248  1.00 56.37  ? 521  GLU A CD    1 
ATOM   3907 O  OE1   . GLU A 1 521 ? 63.734 63.553  89.626  1.00 54.86  ? 521  GLU A OE1   1 
ATOM   3908 O  OE2   . GLU A 1 521 ? 65.315 64.859  88.829  1.00 59.33  ? 521  GLU A OE2   1 
ATOM   3909 N  N     . ALA A 1 522 ? 63.025 69.612  90.315  1.00 54.47  ? 522  ALA A N     1 
ATOM   3910 C  CA    . ALA A 1 522 ? 62.907 70.118  91.682  1.00 54.01  ? 522  ALA A CA    1 
ATOM   3911 C  C     . ALA A 1 522 ? 61.555 70.814  91.853  1.00 51.97  ? 522  ALA A C     1 
ATOM   3912 O  O     . ALA A 1 522 ? 60.925 70.720  92.900  1.00 53.56  ? 522  ALA A O     1 
ATOM   3913 C  CB    . ALA A 1 522 ? 64.066 71.068  91.999  1.00 52.93  ? 522  ALA A CB    1 
ATOM   3914 N  N     . VAL A 1 523 ? 61.110 71.482  90.794  1.00 50.11  ? 523  VAL A N     1 
ATOM   3915 C  CA    . VAL A 1 523 ? 59.792 72.103  90.754  1.00 48.79  ? 523  VAL A CA    1 
ATOM   3916 C  C     . VAL A 1 523 ? 58.663 71.053  90.674  1.00 47.96  ? 523  VAL A C     1 
ATOM   3917 O  O     . VAL A 1 523 ? 57.626 71.207  91.321  1.00 47.77  ? 523  VAL A O     1 
ATOM   3918 C  CB    . VAL A 1 523 ? 59.698 73.085  89.584  1.00 49.17  ? 523  VAL A CB    1 
ATOM   3919 C  CG1   . VAL A 1 523 ? 58.313 73.704  89.507  1.00 50.36  ? 523  VAL A CG1   1 
ATOM   3920 C  CG2   . VAL A 1 523 ? 60.743 74.173  89.739  1.00 49.24  ? 523  VAL A CG2   1 
ATOM   3921 N  N     . TRP A 1 524 ? 58.867 69.983  89.906  1.00 46.08  ? 524  TRP A N     1 
ATOM   3922 C  CA    . TRP A 1 524 ? 57.916 68.868  89.883  1.00 44.69  ? 524  TRP A CA    1 
ATOM   3923 C  C     . TRP A 1 524 ? 57.771 68.245  91.255  1.00 44.83  ? 524  TRP A C     1 
ATOM   3924 O  O     . TRP A 1 524 ? 56.657 67.977  91.683  1.00 43.66  ? 524  TRP A O     1 
ATOM   3925 C  CB    . TRP A 1 524 ? 58.337 67.773  88.893  1.00 44.93  ? 524  TRP A CB    1 
ATOM   3926 C  CG    . TRP A 1 524 ? 57.922 68.017  87.467  1.00 43.22  ? 524  TRP A CG    1 
ATOM   3927 C  CD1   . TRP A 1 524 ? 57.574 69.210  86.901  1.00 40.84  ? 524  TRP A CD1   1 
ATOM   3928 C  CD2   . TRP A 1 524 ? 57.834 67.041  86.428  1.00 42.39  ? 524  TRP A CD2   1 
ATOM   3929 N  NE1   . TRP A 1 524 ? 57.265 69.031  85.576  1.00 41.45  ? 524  TRP A NE1   1 
ATOM   3930 C  CE2   . TRP A 1 524 ? 57.425 67.707  85.258  1.00 41.12  ? 524  TRP A CE2   1 
ATOM   3931 C  CE3   . TRP A 1 524 ? 58.070 65.660  86.362  1.00 44.90  ? 524  TRP A CE3   1 
ATOM   3932 C  CZ2   . TRP A 1 524 ? 57.233 67.045  84.049  1.00 40.55  ? 524  TRP A CZ2   1 
ATOM   3933 C  CZ3   . TRP A 1 524 ? 57.888 65.003  85.151  1.00 42.67  ? 524  TRP A CZ3   1 
ATOM   3934 C  CH2   . TRP A 1 524 ? 57.466 65.696  84.016  1.00 41.65  ? 524  TRP A CH2   1 
ATOM   3935 N  N     . ASP A 1 525 ? 58.892 68.016  91.940  1.00 47.31  ? 525  ASP A N     1 
ATOM   3936 C  CA    . ASP A 1 525 ? 58.876 67.331  93.245  1.00 49.09  ? 525  ASP A CA    1 
ATOM   3937 C  C     . ASP A 1 525 ? 58.189 68.182  94.313  1.00 47.10  ? 525  ASP A C     1 
ATOM   3938 O  O     . ASP A 1 525 ? 57.427 67.668  95.135  1.00 45.82  ? 525  ASP A O     1 
ATOM   3939 C  CB    . ASP A 1 525 ? 60.297 66.992  93.719  1.00 51.32  ? 525  ASP A CB    1 
ATOM   3940 C  CG    . ASP A 1 525 ? 60.966 65.890  92.887  1.00 54.55  ? 525  ASP A CG    1 
ATOM   3941 O  OD1   . ASP A 1 525 ? 60.309 65.308  91.978  1.00 54.72  ? 525  ASP A OD1   1 
ATOM   3942 O  OD2   . ASP A 1 525 ? 62.165 65.553  93.083  1.00 53.71  ? 525  ASP A OD2   1 
ATOM   3943 N  N     . TYR A 1 526 ? 58.469 69.480  94.301  1.00 45.41  ? 526  TYR A N     1 
ATOM   3944 C  CA    . TYR A 1 526 ? 57.839 70.387  95.239  1.00 47.26  ? 526  TYR A CA    1 
ATOM   3945 C  C     . TYR A 1 526 ? 56.326 70.396  94.992  1.00 46.90  ? 526  TYR A C     1 
ATOM   3946 O  O     . TYR A 1 526 ? 55.541 70.215  95.928  1.00 47.20  ? 526  TYR A O     1 
ATOM   3947 C  CB    . TYR A 1 526 ? 58.424 71.790  95.098  1.00 49.84  ? 526  TYR A CB    1 
ATOM   3948 C  CG    . TYR A 1 526 ? 58.106 72.699  96.264  1.00 52.38  ? 526  TYR A CG    1 
ATOM   3949 C  CD1   . TYR A 1 526 ? 58.689 72.492  97.511  1.00 54.14  ? 526  TYR A CD1   1 
ATOM   3950 C  CD2   . TYR A 1 526 ? 57.223 73.773  96.121  1.00 53.57  ? 526  TYR A CD2   1 
ATOM   3951 C  CE1   . TYR A 1 526 ? 58.403 73.328  98.592  1.00 54.37  ? 526  TYR A CE1   1 
ATOM   3952 C  CE2   . TYR A 1 526 ? 56.930 74.610  97.190  1.00 54.38  ? 526  TYR A CE2   1 
ATOM   3953 C  CZ    . TYR A 1 526 ? 57.526 74.385  98.425  1.00 54.53  ? 526  TYR A CZ    1 
ATOM   3954 O  OH    . TYR A 1 526 ? 57.236 75.207  99.489  1.00 52.75  ? 526  TYR A OH    1 
ATOM   3955 N  N     . ALA A 1 527 ? 55.933 70.583  93.728  1.00 45.57  ? 527  ALA A N     1 
ATOM   3956 C  CA    . ALA A 1 527 ? 54.524 70.545  93.316  1.00 44.38  ? 527  ALA A CA    1 
ATOM   3957 C  C     . ALA A 1 527 ? 53.817 69.265  93.775  1.00 44.29  ? 527  ALA A C     1 
ATOM   3958 O  O     . ALA A 1 527 ? 52.733 69.326  94.364  1.00 42.21  ? 527  ALA A O     1 
ATOM   3959 C  CB    . ALA A 1 527 ? 54.410 70.694  91.805  1.00 43.15  ? 527  ALA A CB    1 
ATOM   3960 N  N     . ALA A 1 528 ? 54.456 68.117  93.536  1.00 44.86  ? 528  ALA A N     1 
ATOM   3961 C  CA    . ALA A 1 528 ? 53.856 66.813  93.815  1.00 46.49  ? 528  ALA A CA    1 
ATOM   3962 C  C     . ALA A 1 528 ? 53.595 66.611  95.306  1.00 47.46  ? 528  ALA A C     1 
ATOM   3963 O  O     . ALA A 1 528 ? 52.621 65.976  95.701  1.00 48.91  ? 528  ALA A O     1 
ATOM   3964 C  CB    . ALA A 1 528 ? 54.737 65.712  93.283  1.00 47.29  ? 528  ALA A CB    1 
ATOM   3965 N  N     . GLN A 1 529 ? 54.470 67.184  96.120  1.00 49.40  ? 529  GLN A N     1 
ATOM   3966 C  CA    . GLN A 1 529 ? 54.324 67.199  97.568  1.00 49.77  ? 529  GLN A CA    1 
ATOM   3967 C  C     . GLN A 1 529 ? 53.139 68.037  98.058  1.00 46.86  ? 529  GLN A C     1 
ATOM   3968 O  O     . GLN A 1 529 ? 52.400 67.591  98.928  1.00 48.17  ? 529  GLN A O     1 
ATOM   3969 C  CB    . GLN A 1 529 ? 55.635 67.711  98.206  1.00 51.81  ? 529  GLN A CB    1 
ATOM   3970 C  CG    . GLN A 1 529 ? 55.714 67.622  99.738  1.00 54.57  ? 529  GLN A CG    1 
ATOM   3971 C  CD    . GLN A 1 529 ? 55.382 66.234  100.313 1.00 56.32  ? 529  GLN A CD    1 
ATOM   3972 O  OE1   . GLN A 1 529 ? 54.788 66.140  101.390 1.00 58.89  ? 529  GLN A OE1   1 
ATOM   3973 N  NE2   . GLN A 1 529 ? 55.766 65.171  99.606  1.00 56.47  ? 529  GLN A NE2   1 
ATOM   3974 N  N     . HIS A 1 530 ? 52.940 69.234  97.506  1.00 46.33  ? 530  HIS A N     1 
ATOM   3975 C  CA    . HIS A 1 530 ? 51.959 70.179  98.082  1.00 46.05  ? 530  HIS A CA    1 
ATOM   3976 C  C     . HIS A 1 530 ? 50.607 70.321  97.362  1.00 45.97  ? 530  HIS A C     1 
ATOM   3977 O  O     . HIS A 1 530 ? 49.639 70.739  97.988  1.00 45.60  ? 530  HIS A O     1 
ATOM   3978 C  CB    . HIS A 1 530 ? 52.604 71.558  98.275  1.00 47.67  ? 530  HIS A CB    1 
ATOM   3979 C  CG    . HIS A 1 530 ? 53.740 71.540  99.243  1.00 50.41  ? 530  HIS A CG    1 
ATOM   3980 N  ND1   . HIS A 1 530 ? 55.054 71.407  98.844  1.00 52.21  ? 530  HIS A ND1   1 
ATOM   3981 C  CD2   . HIS A 1 530 ? 53.754 71.558  100.598 1.00 51.86  ? 530  HIS A CD2   1 
ATOM   3982 C  CE1   . HIS A 1 530 ? 55.832 71.373  99.913  1.00 53.95  ? 530  HIS A CE1   1 
ATOM   3983 N  NE2   . HIS A 1 530 ? 55.068 71.466  100.989 1.00 53.45  ? 530  HIS A NE2   1 
ATOM   3984 N  N     . LEU A 1 531 ? 50.524 69.973  96.078  1.00 43.86  ? 531  LEU A N     1 
ATOM   3985 C  CA    . LEU A 1 531 ? 49.285 70.179  95.330  1.00 44.38  ? 531  LEU A CA    1 
ATOM   3986 C  C     . LEU A 1 531 ? 48.871 68.960  94.474  1.00 44.93  ? 531  LEU A C     1 
ATOM   3987 O  O     . LEU A 1 531 ? 49.497 67.903  94.535  1.00 49.52  ? 531  LEU A O     1 
ATOM   3988 C  CB    . LEU A 1 531 ? 49.348 71.499  94.524  1.00 43.14  ? 531  LEU A CB    1 
ATOM   3989 C  CG    . LEU A 1 531 ? 50.624 71.885  93.780  1.00 41.48  ? 531  LEU A CG    1 
ATOM   3990 C  CD1   . LEU A 1 531 ? 50.805 70.987  92.600  1.00 43.70  ? 531  LEU A CD1   1 
ATOM   3991 C  CD2   . LEU A 1 531 ? 50.565 73.320  93.322  1.00 40.62  ? 531  LEU A CD2   1 
ATOM   3992 N  N     . ASP A 1 532 ? 47.782 69.111  93.727  1.00 44.12  ? 532  ASP A N     1 
ATOM   3993 C  CA    . ASP A 1 532 ? 47.151 68.023  92.989  1.00 43.96  ? 532  ASP A CA    1 
ATOM   3994 C  C     . ASP A 1 532 ? 47.686 67.973  91.557  1.00 42.07  ? 532  ASP A C     1 
ATOM   3995 O  O     . ASP A 1 532 ? 48.399 67.056  91.195  1.00 42.51  ? 532  ASP A O     1 
ATOM   3996 C  CB    . ASP A 1 532 ? 45.614 68.202  93.014  1.00 44.13  ? 532  ASP A CB    1 
ATOM   3997 C  CG    . ASP A 1 532 ? 44.857 67.071  92.289  1.00 48.82  ? 532  ASP A CG    1 
ATOM   3998 O  OD1   . ASP A 1 532 ? 45.488 66.043  91.979  1.00 50.72  ? 532  ASP A OD1   1 
ATOM   3999 O  OD2   . ASP A 1 532 ? 43.630 67.116  91.985  1.00 49.46  ? 532  ASP A OD2   1 
ATOM   4000 N  N     . TYR A 1 533 ? 47.355 68.976  90.759  1.00 40.42  ? 533  TYR A N     1 
ATOM   4001 C  CA    . TYR A 1 533 ? 47.537 68.910  89.317  1.00 39.19  ? 533  TYR A CA    1 
ATOM   4002 C  C     . TYR A 1 533 ? 48.389 70.093  88.938  1.00 39.12  ? 533  TYR A C     1 
ATOM   4003 O  O     . TYR A 1 533 ? 48.108 71.202  89.364  1.00 40.46  ? 533  TYR A O     1 
ATOM   4004 C  CB    . TYR A 1 533 ? 46.151 68.948  88.653  1.00 39.43  ? 533  TYR A CB    1 
ATOM   4005 C  CG    . TYR A 1 533 ? 46.089 68.866  87.142  1.00 37.49  ? 533  TYR A CG    1 
ATOM   4006 C  CD1   . TYR A 1 533 ? 47.168 68.450  86.376  1.00 37.25  ? 533  TYR A CD1   1 
ATOM   4007 C  CD2   . TYR A 1 533 ? 44.927 69.224  86.477  1.00 37.93  ? 533  TYR A CD2   1 
ATOM   4008 C  CE1   . TYR A 1 533 ? 47.090 68.398  84.996  1.00 37.20  ? 533  TYR A CE1   1 
ATOM   4009 C  CE2   . TYR A 1 533 ? 44.840 69.165  85.101  1.00 37.42  ? 533  TYR A CE2   1 
ATOM   4010 C  CZ    . TYR A 1 533 ? 45.914 68.753  84.362  1.00 36.61  ? 533  TYR A CZ    1 
ATOM   4011 O  OH    . TYR A 1 533 ? 45.811 68.722  82.992  1.00 36.33  ? 533  TYR A OH    1 
ATOM   4012 N  N     . PHE A 1 534 ? 49.445 69.850  88.158  1.00 37.71  ? 534  PHE A N     1 
ATOM   4013 C  CA    . PHE A 1 534 ? 50.493 70.835  87.960  1.00 37.03  ? 534  PHE A CA    1 
ATOM   4014 C  C     . PHE A 1 534 ? 51.088 70.773  86.561  1.00 37.78  ? 534  PHE A C     1 
ATOM   4015 O  O     . PHE A 1 534 ? 51.223 69.699  85.974  1.00 38.32  ? 534  PHE A O     1 
ATOM   4016 C  CB    . PHE A 1 534 ? 51.585 70.609  89.016  1.00 38.49  ? 534  PHE A CB    1 
ATOM   4017 C  CG    . PHE A 1 534 ? 52.715 71.604  88.965  1.00 36.27  ? 534  PHE A CG    1 
ATOM   4018 C  CD1   . PHE A 1 534 ? 52.549 72.889  89.463  1.00 36.99  ? 534  PHE A CD1   1 
ATOM   4019 C  CD2   . PHE A 1 534 ? 53.946 71.245  88.444  1.00 38.81  ? 534  PHE A CD2   1 
ATOM   4020 C  CE1   . PHE A 1 534 ? 53.587 73.819  89.436  1.00 37.41  ? 534  PHE A CE1   1 
ATOM   4021 C  CE2   . PHE A 1 534 ? 55.004 72.172  88.404  1.00 40.45  ? 534  PHE A CE2   1 
ATOM   4022 C  CZ    . PHE A 1 534 ? 54.815 73.470  88.906  1.00 38.37  ? 534  PHE A CZ    1 
ATOM   4023 N  N     . GLY A 1 535 ? 51.419 71.947  86.029  1.00 36.68  ? 535  GLY A N     1 
ATOM   4024 C  CA    . GLY A 1 535 ? 52.120 72.061  84.771  1.00 36.37  ? 535  GLY A CA    1 
ATOM   4025 C  C     . GLY A 1 535 ? 53.101 73.212  84.826  1.00 37.52  ? 535  GLY A C     1 
ATOM   4026 O  O     . GLY A 1 535 ? 52.978 74.070  85.689  1.00 36.31  ? 535  GLY A O     1 
ATOM   4027 N  N     . VAL A 1 536 ? 54.060 73.230  83.894  1.00 37.41  ? 536  VAL A N     1 
ATOM   4028 C  CA    . VAL A 1 536 ? 55.088 74.254  83.848  1.00 37.74  ? 536  VAL A CA    1 
ATOM   4029 C  C     . VAL A 1 536 ? 55.090 74.941  82.496  1.00 39.02  ? 536  VAL A C     1 
ATOM   4030 O  O     . VAL A 1 536 ? 55.285 74.298  81.473  1.00 38.90  ? 536  VAL A O     1 
ATOM   4031 C  CB    . VAL A 1 536 ? 56.491 73.639  84.108  1.00 39.74  ? 536  VAL A CB    1 
ATOM   4032 C  CG1   . VAL A 1 536 ? 57.582 74.712  84.072  1.00 39.82  ? 536  VAL A CG1   1 
ATOM   4033 C  CG2   . VAL A 1 536 ? 56.506 72.911  85.438  1.00 40.93  ? 536  VAL A CG2   1 
ATOM   4034 N  N     . ASN A 1 537 ? 54.897 76.255  82.501  1.00 41.41  ? 537  ASN A N     1 
ATOM   4035 C  CA    . ASN A 1 537 ? 54.919 77.045  81.277  1.00 42.99  ? 537  ASN A CA    1 
ATOM   4036 C  C     . ASN A 1 537 ? 56.324 77.514  80.926  1.00 46.13  ? 537  ASN A C     1 
ATOM   4037 O  O     . ASN A 1 537 ? 56.891 78.373  81.598  1.00 48.24  ? 537  ASN A O     1 
ATOM   4038 C  CB    . ASN A 1 537 ? 53.979 78.241  81.414  1.00 42.67  ? 537  ASN A CB    1 
ATOM   4039 C  CG    . ASN A 1 537 ? 52.529 77.819  81.567  1.00 42.94  ? 537  ASN A CG    1 
ATOM   4040 O  OD1   . ASN A 1 537 ? 52.160 76.700  81.227  1.00 42.76  ? 537  ASN A OD1   1 
ATOM   4041 N  ND2   . ASN A 1 537 ? 51.709 78.703  82.092  1.00 42.73  ? 537  ASN A ND2   1 
ATOM   4042 N  N     . MET A 1 538 ? 56.883 76.913  79.882  1.00 47.07  ? 538  MET A N     1 
ATOM   4043 C  CA    . MET A 1 538 ? 58.179 77.281  79.340  1.00 49.18  ? 538  MET A CA    1 
ATOM   4044 C  C     . MET A 1 538 ? 57.996 77.720  77.889  1.00 50.21  ? 538  MET A C     1 
ATOM   4045 O  O     . MET A 1 538 ? 56.925 77.512  77.314  1.00 51.74  ? 538  MET A O     1 
ATOM   4046 C  CB    . MET A 1 538 ? 59.120 76.073  79.399  1.00 49.98  ? 538  MET A CB    1 
ATOM   4047 C  CG    . MET A 1 538 ? 59.474 75.613  80.801  1.00 50.27  ? 538  MET A CG    1 
ATOM   4048 S  SD    . MET A 1 538 ? 60.042 73.888  80.841  1.00 52.31  ? 538  MET A SD    1 
ATOM   4049 C  CE    . MET A 1 538 ? 58.503 73.019  80.561  1.00 55.38  ? 538  MET A CE    1 
ATOM   4050 N  N     . PRO A 1 539 ? 59.016 78.334  77.287  1.00 51.87  ? 539  PRO A N     1 
ATOM   4051 C  CA    . PRO A 1 539 ? 58.959 78.649  75.853  1.00 54.04  ? 539  PRO A CA    1 
ATOM   4052 C  C     . PRO A 1 539 ? 59.416 77.465  75.023  1.00 53.54  ? 539  PRO A C     1 
ATOM   4053 O  O     . PRO A 1 539 ? 60.499 76.954  75.291  1.00 56.44  ? 539  PRO A O     1 
ATOM   4054 C  CB    . PRO A 1 539 ? 59.926 79.836  75.704  1.00 54.29  ? 539  PRO A CB    1 
ATOM   4055 C  CG    . PRO A 1 539 ? 60.870 79.738  76.873  1.00 53.49  ? 539  PRO A CG    1 
ATOM   4056 C  CD    . PRO A 1 539 ? 60.269 78.805  77.899  1.00 52.42  ? 539  PRO A CD    1 
ATOM   4057 N  N     . VAL A 1 540 ? 58.603 77.016  74.069  1.00 53.74  ? 540  VAL A N     1 
ATOM   4058 C  CA    . VAL A 1 540 ? 59.016 75.943  73.161  1.00 54.79  ? 540  VAL A CA    1 
ATOM   4059 C  C     . VAL A 1 540 ? 58.986 76.472  71.722  1.00 53.73  ? 540  VAL A C     1 
ATOM   4060 O  O     . VAL A 1 540 ? 57.940 76.560  71.082  1.00 53.00  ? 540  VAL A O     1 
ATOM   4061 C  CB    . VAL A 1 540 ? 58.231 74.588  73.397  1.00 54.17  ? 540  VAL A CB    1 
ATOM   4062 C  CG1   . VAL A 1 540 ? 58.076 74.318  74.883  1.00 54.83  ? 540  VAL A CG1   1 
ATOM   4063 C  CG2   . VAL A 1 540 ? 56.871 74.590  72.765  1.00 55.90  ? 540  VAL A CG2   1 
ATOM   4064 N  N     . ASP A 1 541 ? 60.160 76.867  71.242  1.00 54.38  ? 541  ASP A N     1 
ATOM   4065 C  CA    . ASP A 1 541 ? 60.292 77.437  69.909  1.00 55.30  ? 541  ASP A CA    1 
ATOM   4066 C  C     . ASP A 1 541 ? 61.232 76.610  69.054  1.00 55.34  ? 541  ASP A C     1 
ATOM   4067 O  O     . ASP A 1 541 ? 62.115 75.922  69.557  1.00 54.66  ? 541  ASP A O     1 
ATOM   4068 C  CB    . ASP A 1 541 ? 60.791 78.878  69.982  1.00 55.69  ? 541  ASP A CB    1 
ATOM   4069 C  CG    . ASP A 1 541 ? 59.936 79.750  70.891  1.00 58.06  ? 541  ASP A CG    1 
ATOM   4070 O  OD1   . ASP A 1 541 ? 58.681 79.693  70.816  1.00 57.37  ? 541  ASP A OD1   1 
ATOM   4071 O  OD2   . ASP A 1 541 ? 60.448 80.531  71.720  1.00 60.27  ? 541  ASP A OD2   1 
ATOM   4072 N  N     . LYS A 1 542 ? 61.030 76.695  67.751  1.00 58.71  ? 542  LYS A N     1 
ATOM   4073 C  CA    . LYS A 1 542 ? 61.860 75.998  66.782  1.00 62.36  ? 542  LYS A CA    1 
ATOM   4074 C  C     . LYS A 1 542 ? 61.964 76.875  65.546  1.00 63.75  ? 542  LYS A C     1 
ATOM   4075 O  O     . LYS A 1 542 ? 60.946 77.270  64.990  1.00 63.28  ? 542  LYS A O     1 
ATOM   4076 C  CB    . LYS A 1 542 ? 61.255 74.625  66.425  1.00 62.78  ? 542  LYS A CB    1 
ATOM   4077 C  CG    . LYS A 1 542 ? 62.250 73.640  65.781  1.00 64.57  ? 542  LYS A CG    1 
ATOM   4078 C  CD    . LYS A 1 542 ? 61.633 72.261  65.510  1.00 64.49  ? 542  LYS A CD    1 
ATOM   4079 C  CE    . LYS A 1 542 ? 62.107 71.215  66.524  1.00 65.42  ? 542  LYS A CE    1 
ATOM   4080 N  NZ    . LYS A 1 542 ? 61.524 69.861  66.274  1.00 65.05  ? 542  LYS A NZ    1 
ATOM   4081 N  N     . CYS A 1 543 ? 63.188 77.214  65.147  1.00 67.87  ? 543  CYS A N     1 
ATOM   4082 C  CA    . CYS A 1 543 ? 63.436 77.830  63.844  1.00 70.67  ? 543  CYS A CA    1 
ATOM   4083 C  C     . CYS A 1 543 ? 63.708 76.712  62.843  1.00 70.46  ? 543  CYS A C     1 
ATOM   4084 O  O     . CYS A 1 543 ? 64.591 75.888  63.060  1.00 69.82  ? 543  CYS A O     1 
ATOM   4085 C  CB    . CYS A 1 543 ? 64.623 78.799  63.896  1.00 72.07  ? 543  CYS A CB    1 
ATOM   4086 S  SG    . CYS A 1 543 ? 65.022 79.570  62.296  1.00 74.27  ? 543  CYS A SG    1 
ATOM   4087 N  N     . PHE A 1 544 ? 62.938 76.685  61.759  1.00 71.52  ? 544  PHE A N     1 
ATOM   4088 C  CA    . PHE A 1 544 ? 63.037 75.625  60.757  1.00 72.57  ? 544  PHE A CA    1 
ATOM   4089 C  C     . PHE A 1 544 ? 64.280 75.750  59.880  1.00 74.05  ? 544  PHE A C     1 
ATOM   4090 O  O     . PHE A 1 544 ? 64.862 74.741  59.484  1.00 74.01  ? 544  PHE A O     1 
ATOM   4091 C  CB    . PHE A 1 544 ? 61.798 75.625  59.859  1.00 72.74  ? 544  PHE A CB    1 
ATOM   4092 C  CG    . PHE A 1 544 ? 60.507 75.303  60.572  1.00 72.14  ? 544  PHE A CG    1 
ATOM   4093 C  CD1   . PHE A 1 544 ? 59.296 75.544  59.938  1.00 71.64  ? 544  PHE A CD1   1 
ATOM   4094 C  CD2   . PHE A 1 544 ? 60.492 74.748  61.855  1.00 71.82  ? 544  PHE A CD2   1 
ATOM   4095 C  CE1   . PHE A 1 544 ? 58.099 75.255  60.567  1.00 71.54  ? 544  PHE A CE1   1 
ATOM   4096 C  CE2   . PHE A 1 544 ? 59.296 74.456  62.488  1.00 70.76  ? 544  PHE A CE2   1 
ATOM   4097 C  CZ    . PHE A 1 544 ? 58.099 74.708  61.845  1.00 71.46  ? 544  PHE A CZ    1 
ATOM   4098 N  N     . THR A 1 545 ? 64.682 76.982  59.579  1.00 75.02  ? 545  THR A N     1 
ATOM   4099 C  CA    . THR A 1 545 ? 65.780 77.218  58.640  1.00 75.95  ? 545  THR A CA    1 
ATOM   4100 C  C     . THR A 1 545 ? 67.166 76.861  59.197  1.00 76.72  ? 545  THR A C     1 
ATOM   4101 O  O     . THR A 1 545 ? 68.012 76.345  58.461  1.00 76.48  ? 545  THR A O     1 
ATOM   4102 C  CB    . THR A 1 545 ? 65.763 78.672  58.148  1.00 75.49  ? 545  THR A CB    1 
ATOM   4103 O  OG1   . THR A 1 545 ? 65.790 79.566  59.266  1.00 74.26  ? 545  THR A OG1   1 
ATOM   4104 C  CG2   . THR A 1 545 ? 64.446 78.981  57.432  1.00 75.53  ? 545  THR A CG2   1 
ATOM   4105 N  N     . CYS A 1 546 ? 67.399 77.134  60.479  1.00 76.78  ? 546  CYS A N     1 
ATOM   4106 C  CA    . CYS A 1 546 ? 68.672 76.783  61.109  1.00 77.27  ? 546  CYS A CA    1 
ATOM   4107 C  C     . CYS A 1 546 ? 68.545 75.575  62.045  1.00 76.51  ? 546  CYS A C     1 
ATOM   4108 O  O     . CYS A 1 546 ? 69.353 74.646  61.960  1.00 78.66  ? 546  CYS A O     1 
ATOM   4109 C  CB    . CYS A 1 546 ? 69.301 77.990  61.817  1.00 78.63  ? 546  CYS A CB    1 
ATOM   4110 S  SG    . CYS A 1 546 ? 68.367 78.739  63.170  1.00 81.05  ? 546  CYS A SG    1 
ATOM   4111 N  N     . GLY A 1 547 ? 67.527 75.575  62.909  1.00 72.99  ? 547  GLY A N     1 
ATOM   4112 C  CA    . GLY A 1 547 ? 67.260 74.457  63.813  1.00 68.99  ? 547  GLY A CA    1 
ATOM   4113 C  C     . GLY A 1 547 ? 67.345 74.782  65.300  1.00 66.16  ? 547  GLY A C     1 
ATOM   4114 O  O     . GLY A 1 547 ? 67.262 73.880  66.140  1.00 64.47  ? 547  GLY A O     1 
ATOM   4115 N  N     . SER A 1 548 ? 67.515 76.063  65.623  1.00 64.12  ? 548  SER A N     1 
ATOM   4116 C  CA    . SER A 1 548 ? 67.583 76.536  67.002  1.00 63.47  ? 548  SER A CA    1 
ATOM   4117 C  C     . SER A 1 548 ? 66.339 76.140  67.791  1.00 63.73  ? 548  SER A C     1 
ATOM   4118 O  O     . SER A 1 548 ? 65.211 76.321  67.324  1.00 60.93  ? 548  SER A O     1 
ATOM   4119 C  CB    . SER A 1 548 ? 67.725 78.062  67.025  1.00 63.72  ? 548  SER A CB    1 
ATOM   4120 O  OG    . SER A 1 548 ? 67.590 78.585  68.340  1.00 63.90  ? 548  SER A OG    1 
ATOM   4121 N  N     . THR A 1 549 ? 66.550 75.591  68.983  1.00 64.43  ? 549  THR A N     1 
ATOM   4122 C  CA    . THR A 1 549 ? 65.454 75.313  69.902  1.00 65.63  ? 549  THR A CA    1 
ATOM   4123 C  C     . THR A 1 549 ? 65.525 76.246  71.126  1.00 67.25  ? 549  THR A C     1 
ATOM   4124 O  O     . THR A 1 549 ? 64.972 75.946  72.191  1.00 66.03  ? 549  THR A O     1 
ATOM   4125 C  CB    . THR A 1 549 ? 65.447 73.820  70.305  1.00 65.77  ? 549  THR A CB    1 
ATOM   4126 O  OG1   . THR A 1 549 ? 66.689 73.467  70.925  1.00 65.86  ? 549  THR A OG1   1 
ATOM   4127 C  CG2   . THR A 1 549 ? 65.364 72.911  69.075  1.00 65.52  ? 549  THR A CG2   1 
ATOM   4128 N  N     . HIS A 1 550 ? 66.198 77.385  70.954  1.00 68.00  ? 550  HIS A N     1 
ATOM   4129 C  CA    . HIS A 1 550 ? 66.284 78.403  71.994  1.00 70.59  ? 550  HIS A CA    1 
ATOM   4130 C  C     . HIS A 1 550 ? 65.026 79.252  71.967  1.00 70.02  ? 550  HIS A C     1 
ATOM   4131 O  O     . HIS A 1 550 ? 64.325 79.301  70.960  1.00 67.44  ? 550  HIS A O     1 
ATOM   4132 C  CB    . HIS A 1 550 ? 67.509 79.312  71.786  1.00 72.24  ? 550  HIS A CB    1 
ATOM   4133 C  CG    . HIS A 1 550 ? 68.821 78.612  71.957  1.00 73.57  ? 550  HIS A CG    1 
ATOM   4134 N  ND1   . HIS A 1 550 ? 69.250 78.122  73.171  1.00 74.35  ? 550  HIS A ND1   1 
ATOM   4135 C  CD2   . HIS A 1 550 ? 69.797 78.319  71.065  1.00 73.73  ? 550  HIS A CD2   1 
ATOM   4136 C  CE1   . HIS A 1 550 ? 70.433 77.555  73.020  1.00 74.52  ? 550  HIS A CE1   1 
ATOM   4137 N  NE2   . HIS A 1 550 ? 70.788 77.662  71.752  1.00 74.14  ? 550  HIS A NE2   1 
ATOM   4138 N  N     . GLU A 1 551 ? 64.753 79.927  73.079  1.00 71.33  ? 551  GLU A N     1 
ATOM   4139 C  CA    . GLU A 1 551 ? 63.661 80.887  73.131  1.00 72.53  ? 551  GLU A CA    1 
ATOM   4140 C  C     . GLU A 1 551 ? 63.910 82.016  72.135  1.00 73.60  ? 551  GLU A C     1 
ATOM   4141 O  O     . GLU A 1 551 ? 64.945 82.674  72.179  1.00 73.60  ? 551  GLU A O     1 
ATOM   4142 C  CB    . GLU A 1 551 ? 63.506 81.475  74.538  1.00 72.40  ? 551  GLU A CB    1 
ATOM   4143 C  CG    . GLU A 1 551 ? 62.767 82.810  74.556  1.00 72.46  ? 551  GLU A CG    1 
ATOM   4144 C  CD    . GLU A 1 551 ? 62.169 83.157  75.903  1.00 72.67  ? 551  GLU A CD    1 
ATOM   4145 O  OE1   . GLU A 1 551 ? 61.175 83.918  75.924  1.00 72.56  ? 551  GLU A OE1   1 
ATOM   4146 O  OE2   . GLU A 1 551 ? 62.694 82.678  76.930  1.00 71.55  ? 551  GLU A OE2   1 
ATOM   4147 N  N     . MET A 1 552 ? 62.950 82.220  71.242  1.00 74.85  ? 552  MET A N     1 
ATOM   4148 C  CA    . MET A 1 552 ? 62.921 83.385  70.372  1.00 76.90  ? 552  MET A CA    1 
ATOM   4149 C  C     . MET A 1 552 ? 62.675 84.650  71.186  1.00 78.42  ? 552  MET A C     1 
ATOM   4150 O  O     . MET A 1 552 ? 61.975 84.615  72.194  1.00 78.94  ? 552  MET A O     1 
ATOM   4151 C  CB    . MET A 1 552 ? 61.803 83.239  69.335  1.00 78.28  ? 552  MET A CB    1 
ATOM   4152 C  CG    . MET A 1 552 ? 62.285 83.088  67.901  1.00 80.03  ? 552  MET A CG    1 
ATOM   4153 S  SD    . MET A 1 552 ? 62.091 81.428  67.274  1.00 82.15  ? 552  MET A SD    1 
ATOM   4154 C  CE    . MET A 1 552 ? 62.601 81.625  65.587  1.00 82.21  ? 552  MET A CE    1 
ATOM   4155 N  N     . THR A 1 553 ? 63.248 85.766  70.741  1.00 81.10  ? 553  THR A N     1 
ATOM   4156 C  CA    . THR A 1 553 ? 63.047 87.062  71.396  1.00 81.92  ? 553  THR A CA    1 
ATOM   4157 C  C     . THR A 1 553 ? 61.872 87.796  70.741  1.00 83.51  ? 553  THR A C     1 
ATOM   4158 O  O     . THR A 1 553 ? 61.749 87.803  69.515  1.00 82.42  ? 553  THR A O     1 
ATOM   4159 C  CB    . THR A 1 553 ? 64.330 87.931  71.326  1.00 81.76  ? 553  THR A CB    1 
ATOM   4160 O  OG1   . THR A 1 553 ? 64.680 88.184  69.961  1.00 79.87  ? 553  THR A OG1   1 
ATOM   4161 C  CG2   . THR A 1 553 ? 65.546 87.187  71.899  1.00 81.93  ? 553  THR A CG2   1 
ATOM   4162 N  N     . PRO A 1 554 ? 61.008 88.404  71.552  1.00 86.45  ? 554  PRO A N     1 
ATOM   4163 C  CA    . PRO A 1 554 ? 59.787 89.054  71.050  1.00 89.14  ? 554  PRO A CA    1 
ATOM   4164 C  C     . PRO A 1 554 ? 59.950 90.494  70.524  1.00 92.06  ? 554  PRO A C     1 
ATOM   4165 O  O     . PRO A 1 554 ? 60.282 91.394  71.296  1.00 92.44  ? 554  PRO A O     1 
ATOM   4166 C  CB    . PRO A 1 554 ? 58.879 89.051  72.282  1.00 88.62  ? 554  PRO A CB    1 
ATOM   4167 C  CG    . PRO A 1 554 ? 59.822 89.146  73.442  1.00 87.97  ? 554  PRO A CG    1 
ATOM   4168 C  CD    . PRO A 1 554 ? 61.105 88.488  73.021  1.00 87.02  ? 554  PRO A CD    1 
ATOM   4169 N  N     . THR A 1 555 ? 59.705 90.690  69.226  1.00 95.51  ? 555  THR A N     1 
ATOM   4170 C  CA    . THR A 1 555 ? 59.618 92.024  68.607  1.00 98.13  ? 555  THR A CA    1 
ATOM   4171 C  C     . THR A 1 555 ? 58.161 92.499  68.525  1.00 99.66  ? 555  THR A C     1 
ATOM   4172 O  O     . THR A 1 555 ? 57.230 91.723  68.748  1.00 99.16  ? 555  THR A O     1 
ATOM   4173 C  CB    . THR A 1 555 ? 60.223 92.004  67.168  1.00 98.78  ? 555  THR A CB    1 
ATOM   4174 O  OG1   . THR A 1 555 ? 61.425 91.226  67.145  1.00 99.66  ? 555  THR A OG1   1 
ATOM   4175 C  CG2   . THR A 1 555 ? 60.687 93.399  66.719  1.00 99.23  ? 555  THR A CG2   1 
ATOM   4176 N  N     . GLU A 1 556 ? 57.979 93.778  68.193  1.00 101.41 ? 556  GLU A N     1 
ATOM   4177 C  CA    . GLU A 1 556 ? 56.649 94.359  67.971  1.00 101.94 ? 556  GLU A CA    1 
ATOM   4178 C  C     . GLU A 1 556 ? 55.990 93.787  66.704  1.00 101.38 ? 556  GLU A C     1 
ATOM   4179 O  O     . GLU A 1 556 ? 54.763 93.717  66.615  1.00 101.03 ? 556  GLU A O     1 
ATOM   4180 C  CB    . GLU A 1 556 ? 56.728 95.895  67.864  1.00 103.16 ? 556  GLU A CB    1 
ATOM   4181 C  CG    . GLU A 1 556 ? 57.479 96.612  68.990  1.00 103.71 ? 556  GLU A CG    1 
ATOM   4182 C  CD    . GLU A 1 556 ? 56.721 96.625  70.309  1.00 104.04 ? 556  GLU A CD    1 
ATOM   4183 O  OE1   . GLU A 1 556 ? 56.310 97.722  70.754  1.00 103.88 ? 556  GLU A OE1   1 
ATOM   4184 O  OE2   . GLU A 1 556 ? 56.547 95.541  70.908  1.00 103.82 ? 556  GLU A OE2   1 
ATOM   4185 N  N     . ASN A 1 557 ? 56.817 93.387  65.736  1.00 100.79 ? 557  ASN A N     1 
ATOM   4186 C  CA    . ASN A 1 557 ? 56.354 92.776  64.484  1.00 99.74  ? 557  ASN A CA    1 
ATOM   4187 C  C     . ASN A 1 557 ? 55.894 91.326  64.714  1.00 97.82  ? 557  ASN A C     1 
ATOM   4188 O  O     . ASN A 1 557 ? 54.788 90.950  64.323  1.00 98.60  ? 557  ASN A O     1 
ATOM   4189 C  CB    . ASN A 1 557 ? 57.480 92.821  63.422  1.00 100.36 ? 557  ASN A CB    1 
ATOM   4190 C  CG    . ASN A 1 557 ? 56.986 93.237  62.032  1.00 100.72 ? 557  ASN A CG    1 
ATOM   4191 O  OD1   . ASN A 1 557 ? 57.275 92.569  61.035  1.00 100.45 ? 557  ASN A OD1   1 
ATOM   4192 N  ND2   . ASN A 1 557 ? 56.267 94.353  61.961  1.00 100.43 ? 557  ASN A ND2   1 
ATOM   4193 N  N     . GLY A 1 558 ? 56.754 90.527  65.347  1.00 95.16  ? 558  GLY A N     1 
ATOM   4194 C  CA    . GLY A 1 558 ? 56.459 89.136  65.669  1.00 92.11  ? 558  GLY A CA    1 
ATOM   4195 C  C     . GLY A 1 558 ? 57.529 88.521  66.567  1.00 89.28  ? 558  GLY A C     1 
ATOM   4196 O  O     . GLY A 1 558 ? 57.911 89.111  67.570  1.00 89.04  ? 558  GLY A O     1 
ATOM   4197 N  N     . PHE A 1 559 ? 58.006 87.332  66.213  1.00 86.13  ? 559  PHE A N     1 
ATOM   4198 C  CA    . PHE A 1 559 ? 59.134 86.703  66.907  1.00 83.05  ? 559  PHE A CA    1 
ATOM   4199 C  C     . PHE A 1 559 ? 60.367 86.760  65.998  1.00 81.90  ? 559  PHE A C     1 
ATOM   4200 O  O     . PHE A 1 559 ? 60.227 86.813  64.773  1.00 81.16  ? 559  PHE A O     1 
ATOM   4201 C  CB    . PHE A 1 559 ? 58.808 85.244  67.240  1.00 80.74  ? 559  PHE A CB    1 
ATOM   4202 C  CG    . PHE A 1 559 ? 58.107 85.048  68.559  1.00 79.10  ? 559  PHE A CG    1 
ATOM   4203 C  CD1   . PHE A 1 559 ? 58.743 85.362  69.755  1.00 77.95  ? 559  PHE A CD1   1 
ATOM   4204 C  CD2   . PHE A 1 559 ? 56.824 84.514  68.604  1.00 77.40  ? 559  PHE A CD2   1 
ATOM   4205 C  CE1   . PHE A 1 559 ? 58.109 85.169  70.965  1.00 76.98  ? 559  PHE A CE1   1 
ATOM   4206 C  CE2   . PHE A 1 559 ? 56.186 84.320  69.808  1.00 77.03  ? 559  PHE A CE2   1 
ATOM   4207 C  CZ    . PHE A 1 559 ? 56.828 84.647  70.993  1.00 77.19  ? 559  PHE A CZ    1 
ATOM   4208 N  N     . VAL A 1 560 ? 61.565 86.740  66.587  1.00 80.59  ? 560  VAL A N     1 
ATOM   4209 C  CA    . VAL A 1 560 ? 62.810 86.717  65.804  1.00 79.92  ? 560  VAL A CA    1 
ATOM   4210 C  C     . VAL A 1 560 ? 63.861 85.771  66.379  1.00 78.65  ? 560  VAL A C     1 
ATOM   4211 O  O     . VAL A 1 560 ? 64.033 85.664  67.592  1.00 76.95  ? 560  VAL A O     1 
ATOM   4212 C  CB    . VAL A 1 560 ? 63.449 88.125  65.648  1.00 81.04  ? 560  VAL A CB    1 
ATOM   4213 C  CG1   . VAL A 1 560 ? 62.458 89.107  65.026  1.00 81.96  ? 560  VAL A CG1   1 
ATOM   4214 C  CG2   . VAL A 1 560 ? 63.966 88.651  66.981  1.00 81.19  ? 560  VAL A CG2   1 
ATOM   4215 N  N     . CYS A 1 561 ? 64.589 85.120  65.480  1.00 78.52  ? 561  CYS A N     1 
ATOM   4216 C  CA    . CYS A 1 561 ? 65.573 84.109  65.845  1.00 78.38  ? 561  CYS A CA    1 
ATOM   4217 C  C     . CYS A 1 561 ? 66.885 84.750  66.317  1.00 79.79  ? 561  CYS A C     1 
ATOM   4218 O  O     . CYS A 1 561 ? 67.531 85.476  65.565  1.00 80.05  ? 561  CYS A O     1 
ATOM   4219 C  CB    . CYS A 1 561 ? 65.820 83.199  64.642  1.00 76.95  ? 561  CYS A CB    1 
ATOM   4220 S  SG    . CYS A 1 561 ? 66.872 81.777  64.951  1.00 74.28  ? 561  CYS A SG    1 
ATOM   4221 N  N     . SER A 1 562 ? 67.257 84.473  67.568  1.00 82.04  ? 562  SER A N     1 
ATOM   4222 C  CA    . SER A 1 562 ? 68.473 85.003  68.191  1.00 83.71  ? 562  SER A CA    1 
ATOM   4223 C  C     . SER A 1 562 ? 69.719 84.824  67.326  1.00 85.93  ? 562  SER A C     1 
ATOM   4224 O  O     . SER A 1 562 ? 70.460 85.785  67.091  1.00 86.04  ? 562  SER A O     1 
ATOM   4225 C  CB    . SER A 1 562 ? 68.729 84.305  69.535  1.00 83.67  ? 562  SER A CB    1 
ATOM   4226 O  OG    . SER A 1 562 ? 67.736 84.624  70.489  1.00 84.85  ? 562  SER A OG    1 
ATOM   4227 N  N     . ILE A 1 563 ? 69.936 83.591  66.861  1.00 86.41  ? 563  ILE A N     1 
ATOM   4228 C  CA    . ILE A 1 563 ? 71.197 83.209  66.221  1.00 87.20  ? 563  ILE A CA    1 
ATOM   4229 C  C     . ILE A 1 563 ? 71.242 83.411  64.700  1.00 87.61  ? 563  ILE A C     1 
ATOM   4230 O  O     . ILE A 1 563 ? 72.301 83.741  64.163  1.00 88.99  ? 563  ILE A O     1 
ATOM   4231 C  CB    . ILE A 1 563 ? 71.611 81.753  66.602  1.00 87.50  ? 563  ILE A CB    1 
ATOM   4232 C  CG1   . ILE A 1 563 ? 70.594 80.714  66.105  1.00 87.79  ? 563  ILE A CG1   1 
ATOM   4233 C  CG2   . ILE A 1 563 ? 71.822 81.642  68.116  1.00 87.39  ? 563  ILE A CG2   1 
ATOM   4234 C  CD1   . ILE A 1 563 ? 71.193 79.651  65.193  1.00 87.68  ? 563  ILE A CD1   1 
ATOM   4235 N  N     . CYS A 1 564 ? 70.122 83.226  64.005  1.00 86.64  ? 564  CYS A N     1 
ATOM   4236 C  CA    . CYS A 1 564 ? 70.105 83.413  62.553  1.00 85.96  ? 564  CYS A CA    1 
ATOM   4237 C  C     . CYS A 1 564 ? 69.491 84.766  62.160  1.00 85.28  ? 564  CYS A C     1 
ATOM   4238 O  O     . CYS A 1 564 ? 70.117 85.544  61.444  1.00 86.22  ? 564  CYS A O     1 
ATOM   4239 C  CB    . CYS A 1 564 ? 69.445 82.213  61.852  1.00 86.36  ? 564  CYS A CB    1 
ATOM   4240 S  SG    . CYS A 1 564 ? 67.680 82.320  61.480  1.00 88.47  ? 564  CYS A SG    1 
ATOM   4241 N  N     . GLY A 1 565 ? 68.297 85.061  62.666  1.00 84.71  ? 565  GLY A N     1 
ATOM   4242 C  CA    . GLY A 1 565 ? 67.598 86.304  62.358  1.00 83.68  ? 565  GLY A CA    1 
ATOM   4243 C  C     . GLY A 1 565 ? 66.351 86.155  61.495  1.00 82.07  ? 565  GLY A C     1 
ATOM   4244 O  O     . GLY A 1 565 ? 65.905 87.127  60.889  1.00 81.70  ? 565  GLY A O     1 
ATOM   4245 N  N     . GLU A 1 566 ? 65.776 84.953  61.455  1.00 80.97  ? 566  GLU A N     1 
ATOM   4246 C  CA    . GLU A 1 566 ? 64.571 84.680  60.660  1.00 80.65  ? 566  GLU A CA    1 
ATOM   4247 C  C     . GLU A 1 566 ? 63.330 85.206  61.377  1.00 78.66  ? 566  GLU A C     1 
ATOM   4248 O  O     . GLU A 1 566 ? 63.228 85.097  62.602  1.00 77.45  ? 566  GLU A O     1 
ATOM   4249 C  CB    . GLU A 1 566 ? 64.428 83.172  60.402  1.00 80.65  ? 566  GLU A CB    1 
ATOM   4250 C  CG    . GLU A 1 566 ? 63.120 82.735  59.750  1.00 81.05  ? 566  GLU A CG    1 
ATOM   4251 C  CD    . GLU A 1 566 ? 63.091 82.942  58.244  1.00 81.51  ? 566  GLU A CD    1 
ATOM   4252 O  OE1   . GLU A 1 566 ? 63.537 82.033  57.509  1.00 80.57  ? 566  GLU A OE1   1 
ATOM   4253 O  OE2   . GLU A 1 566 ? 62.603 84.001  57.794  1.00 81.20  ? 566  GLU A OE2   1 
ATOM   4254 N  N     . THR A 1 567 ? 62.396 85.768  60.605  1.00 76.93  ? 567  THR A N     1 
ATOM   4255 C  CA    . THR A 1 567 ? 61.174 86.375  61.149  1.00 76.00  ? 567  THR A CA    1 
ATOM   4256 C  C     . THR A 1 567 ? 59.861 85.917  60.493  1.00 75.28  ? 567  THR A C     1 
ATOM   4257 O  O     . THR A 1 567 ? 58.796 86.388  60.882  1.00 75.48  ? 567  THR A O     1 
ATOM   4258 C  CB    . THR A 1 567 ? 61.264 87.917  61.050  1.00 75.97  ? 567  THR A CB    1 
ATOM   4259 O  OG1   . THR A 1 567 ? 61.241 88.320  59.675  1.00 73.49  ? 567  THR A OG1   1 
ATOM   4260 C  CG2   . THR A 1 567 ? 62.608 88.432  61.570  1.00 76.70  ? 567  THR A CG2   1 
ATOM   4261 N  N     . ASP A 1 568 ? 59.926 85.016  59.514  1.00 75.22  ? 568  ASP A N     1 
ATOM   4262 C  CA    . ASP A 1 568 ? 58.723 84.504  58.849  1.00 75.08  ? 568  ASP A CA    1 
ATOM   4263 C  C     . ASP A 1 568 ? 58.005 83.503  59.780  1.00 75.75  ? 568  ASP A C     1 
ATOM   4264 O  O     . ASP A 1 568 ? 58.628 82.530  60.231  1.00 73.19  ? 568  ASP A O     1 
ATOM   4265 C  CB    . ASP A 1 568 ? 59.088 83.833  57.514  1.00 74.14  ? 568  ASP A CB    1 
ATOM   4266 C  CG    . ASP A 1 568 ? 57.886 83.653  56.584  1.00 74.02  ? 568  ASP A CG    1 
ATOM   4267 O  OD1   . ASP A 1 568 ? 58.091 83.183  55.444  1.00 72.93  ? 568  ASP A OD1   1 
ATOM   4268 O  OD2   . ASP A 1 568 ? 56.708 83.945  56.890  1.00 73.72  ? 568  ASP A OD2   1 
ATOM   4269 N  N     . PRO A 1 569 ? 56.728 83.762  60.104  1.00 76.06  ? 569  PRO A N     1 
ATOM   4270 C  CA    . PRO A 1 569 ? 55.912 82.812  60.883  1.00 75.52  ? 569  PRO A CA    1 
ATOM   4271 C  C     . PRO A 1 569 ? 55.798 81.393  60.298  1.00 74.97  ? 569  PRO A C     1 
ATOM   4272 O  O     . PRO A 1 569 ? 55.686 80.440  61.073  1.00 72.72  ? 569  PRO A O     1 
ATOM   4273 C  CB    . PRO A 1 569 ? 54.532 83.489  60.922  1.00 75.72  ? 569  PRO A CB    1 
ATOM   4274 C  CG    . PRO A 1 569 ? 54.821 84.949  60.761  1.00 75.57  ? 569  PRO A CG    1 
ATOM   4275 C  CD    . PRO A 1 569 ? 55.980 85.006  59.820  1.00 75.47  ? 569  PRO A CD    1 
ATOM   4276 N  N     . LYS A 1 570 ? 55.830 81.254  58.973  1.00 75.28  ? 570  LYS A N     1 
ATOM   4277 C  CA    . LYS A 1 570 ? 55.723 79.937  58.331  1.00 75.62  ? 570  LYS A CA    1 
ATOM   4278 C  C     . LYS A 1 570 ? 57.026 79.118  58.438  1.00 73.63  ? 570  LYS A C     1 
ATOM   4279 O  O     . LYS A 1 570 ? 57.008 77.895  58.261  1.00 71.83  ? 570  LYS A O     1 
ATOM   4280 C  CB    . LYS A 1 570 ? 55.292 80.073  56.855  1.00 76.52  ? 570  LYS A CB    1 
ATOM   4281 C  CG    . LYS A 1 570 ? 54.021 80.917  56.628  1.00 77.93  ? 570  LYS A CG    1 
ATOM   4282 C  CD    . LYS A 1 570 ? 53.315 80.595  55.296  1.00 78.80  ? 570  LYS A CD    1 
ATOM   4283 C  CE    . LYS A 1 570 ? 52.154 79.601  55.482  1.00 79.47  ? 570  LYS A CE    1 
ATOM   4284 N  NZ    . LYS A 1 570 ? 50.860 80.278  55.798  1.00 79.06  ? 570  LYS A NZ    1 
ATOM   4285 N  N     . LYS A 1 571 ? 58.141 79.795  58.724  1.00 73.24  ? 571  LYS A N     1 
ATOM   4286 C  CA    . LYS A 1 571 ? 59.448 79.141  58.889  1.00 74.39  ? 571  LYS A CA    1 
ATOM   4287 C  C     . LYS A 1 571 ? 59.854 79.005  60.369  1.00 73.18  ? 571  LYS A C     1 
ATOM   4288 O  O     . LYS A 1 571 ? 61.044 78.964  60.692  1.00 73.97  ? 571  LYS A O     1 
ATOM   4289 C  CB    . LYS A 1 571 ? 60.539 79.895  58.099  1.00 75.88  ? 571  LYS A CB    1 
ATOM   4290 C  CG    . LYS A 1 571 ? 60.424 79.779  56.567  1.00 77.82  ? 571  LYS A CG    1 
ATOM   4291 C  CD    . LYS A 1 571 ? 60.993 78.444  56.031  1.00 79.19  ? 571  LYS A CD    1 
ATOM   4292 C  CE    . LYS A 1 571 ? 60.333 78.005  54.714  1.00 79.11  ? 571  LYS A CE    1 
ATOM   4293 N  NZ    . LYS A 1 571 ? 60.945 78.674  53.526  1.00 79.09  ? 571  LYS A NZ    1 
ATOM   4294 N  N     . MET A 1 572 ? 58.864 78.931  61.261  1.00 70.35  ? 572  MET A N     1 
ATOM   4295 C  CA    . MET A 1 572 ? 59.099 78.670  62.687  1.00 66.78  ? 572  MET A CA    1 
ATOM   4296 C  C     . MET A 1 572 ? 57.860 78.106  63.401  1.00 61.78  ? 572  MET A C     1 
ATOM   4297 O  O     . MET A 1 572 ? 56.746 78.202  62.892  1.00 61.49  ? 572  MET A O     1 
ATOM   4298 C  CB    . MET A 1 572 ? 59.550 79.953  63.386  1.00 68.29  ? 572  MET A CB    1 
ATOM   4299 C  CG    . MET A 1 572 ? 58.476 81.028  63.461  1.00 68.90  ? 572  MET A CG    1 
ATOM   4300 S  SD    . MET A 1 572 ? 59.145 82.658  63.725  1.00 70.84  ? 572  MET A SD    1 
ATOM   4301 C  CE    . MET A 1 572 ? 59.457 82.605  65.382  1.00 71.73  ? 572  MET A CE    1 
ATOM   4302 N  N     . ASN A 1 573 ? 58.073 77.520  64.578  1.00 58.20  ? 573  ASN A N     1 
ATOM   4303 C  CA    . ASN A 1 573 ? 56.998 77.015  65.447  1.00 53.92  ? 573  ASN A CA    1 
ATOM   4304 C  C     . ASN A 1 573 ? 57.163 77.587  66.845  1.00 50.84  ? 573  ASN A C     1 
ATOM   4305 O  O     . ASN A 1 573 ? 58.111 77.235  67.533  1.00 51.24  ? 573  ASN A O     1 
ATOM   4306 C  CB    . ASN A 1 573 ? 57.046 75.490  65.516  1.00 52.71  ? 573  ASN A CB    1 
ATOM   4307 C  CG    . ASN A 1 573 ? 55.805 74.888  66.155  1.00 52.96  ? 573  ASN A CG    1 
ATOM   4308 O  OD1   . ASN A 1 573 ? 55.882 74.230  67.189  1.00 50.64  ? 573  ASN A OD1   1 
ATOM   4309 N  ND2   . ASN A 1 573 ? 54.655 75.092  65.521  1.00 52.29  ? 573  ASN A ND2   1 
ATOM   4310 N  N     . THR A 1 574 ? 56.261 78.467  67.269  1.00 47.79  ? 574  THR A N     1 
ATOM   4311 C  CA    . THR A 1 574 ? 56.391 79.105  68.582  1.00 47.59  ? 574  THR A CA    1 
ATOM   4312 C  C     . THR A 1 574 ? 55.160 78.869  69.418  1.00 47.54  ? 574  THR A C     1 
ATOM   4313 O  O     . THR A 1 574 ? 54.094 79.352  69.081  1.00 49.36  ? 574  THR A O     1 
ATOM   4314 C  CB    . THR A 1 574 ? 56.592 80.610  68.436  1.00 46.57  ? 574  THR A CB    1 
ATOM   4315 O  OG1   . THR A 1 574 ? 55.533 81.172  67.640  1.00 44.02  ? 574  THR A OG1   1 
ATOM   4316 C  CG2   . THR A 1 574 ? 57.865 80.908  67.663  1.00 45.90  ? 574  THR A CG2   1 
ATOM   4317 N  N     . ILE A 1 575 ? 55.317 78.149  70.522  1.00 47.74  ? 575  ILE A N     1 
ATOM   4318 C  CA    . ILE A 1 575 ? 54.191 77.753  71.345  1.00 47.74  ? 575  ILE A CA    1 
ATOM   4319 C  C     . ILE A 1 575 ? 54.385 78.197  72.798  1.00 48.57  ? 575  ILE A C     1 
ATOM   4320 O  O     . ILE A 1 575 ? 55.430 77.948  73.407  1.00 47.52  ? 575  ILE A O     1 
ATOM   4321 C  CB    . ILE A 1 575 ? 53.976 76.223  71.251  1.00 47.29  ? 575  ILE A CB    1 
ATOM   4322 C  CG1   . ILE A 1 575 ? 53.638 75.805  69.815  1.00 47.93  ? 575  ILE A CG1   1 
ATOM   4323 C  CG2   . ILE A 1 575 ? 52.899 75.769  72.226  1.00 47.71  ? 575  ILE A CG2   1 
ATOM   4324 C  CD1   . ILE A 1 575 ? 52.250 76.211  69.309  1.00 48.38  ? 575  ILE A CD1   1 
ATOM   4325 N  N     . ARG A 1 576 ? 53.365 78.893  73.304  1.00 50.08  ? 576  ARG A N     1 
ATOM   4326 C  CA    . ARG A 1 576 ? 53.194 79.231  74.716  1.00 51.54  ? 576  ARG A CA    1 
ATOM   4327 C  C     . ARG A 1 576 ? 51.902 78.616  75.257  1.00 48.94  ? 576  ARG A C     1 
ATOM   4328 O  O     . ARG A 1 576 ? 51.005 78.245  74.515  1.00 48.92  ? 576  ARG A O     1 
ATOM   4329 C  CB    . ARG A 1 576 ? 53.067 80.748  74.898  1.00 53.35  ? 576  ARG A CB    1 
ATOM   4330 C  CG    . ARG A 1 576 ? 54.297 81.566  74.542  1.00 56.56  ? 576  ARG A CG    1 
ATOM   4331 C  CD    . ARG A 1 576 ? 55.478 81.357  75.455  1.00 58.00  ? 576  ARG A CD    1 
ATOM   4332 N  NE    . ARG A 1 576 ? 56.611 80.921  74.662  1.00 62.27  ? 576  ARG A NE    1 
ATOM   4333 C  CZ    . ARG A 1 576 ? 57.409 81.727  73.982  1.00 64.70  ? 576  ARG A CZ    1 
ATOM   4334 N  NH1   . ARG A 1 576 ? 57.236 83.042  74.002  1.00 67.50  ? 576  ARG A NH1   1 
ATOM   4335 N  NH2   . ARG A 1 576 ? 58.398 81.214  73.277  1.00 64.87  ? 576  ARG A NH2   1 
ATOM   4336 N  N     . ARG A 1 577 ? 51.802 78.560  76.570  1.00 47.93  ? 577  ARG A N     1 
ATOM   4337 C  CA    . ARG A 1 577 ? 50.543 78.340  77.240  1.00 47.18  ? 577  ARG A CA    1 
ATOM   4338 C  C     . ARG A 1 577 ? 50.283 79.613  78.021  1.00 47.16  ? 577  ARG A C     1 
ATOM   4339 O  O     . ARG A 1 577 ? 50.613 79.703  79.192  1.00 48.57  ? 577  ARG A O     1 
ATOM   4340 C  CB    . ARG A 1 577 ? 50.646 77.134  78.173  1.00 47.11  ? 577  ARG A CB    1 
ATOM   4341 C  CG    . ARG A 1 577 ? 49.356 76.802  78.887  1.00 47.03  ? 577  ARG A CG    1 
ATOM   4342 C  CD    . ARG A 1 577 ? 49.244 75.358  79.276  1.00 48.33  ? 577  ARG A CD    1 
ATOM   4343 N  NE    . ARG A 1 577 ? 50.374 74.976  80.104  1.00 48.72  ? 577  ARG A NE    1 
ATOM   4344 C  CZ    . ARG A 1 577 ? 50.735 73.728  80.351  1.00 49.73  ? 577  ARG A CZ    1 
ATOM   4345 N  NH1   . ARG A 1 577 ? 50.022 72.702  79.868  1.00 48.11  ? 577  ARG A NH1   1 
ATOM   4346 N  NH2   . ARG A 1 577 ? 51.810 73.513  81.113  1.00 48.87  ? 577  ARG A NH2   1 
ATOM   4347 N  N     . THR A 1 578 ? 49.719 80.617  77.369  1.00 50.20  ? 578  THR A N     1 
ATOM   4348 C  CA    . THR A 1 578 ? 49.521 81.901  78.035  1.00 52.90  ? 578  THR A CA    1 
ATOM   4349 C  C     . THR A 1 578 ? 48.299 81.832  78.966  1.00 53.18  ? 578  THR A C     1 
ATOM   4350 O  O     . THR A 1 578 ? 48.231 82.553  79.971  1.00 53.80  ? 578  THR A O     1 
ATOM   4351 C  CB    . THR A 1 578 ? 49.455 83.089  77.015  1.00 54.03  ? 578  THR A CB    1 
ATOM   4352 O  OG1   . THR A 1 578 ? 48.274 83.018  76.222  1.00 55.20  ? 578  THR A OG1   1 
ATOM   4353 C  CG2   . THR A 1 578 ? 50.595 83.006  75.977  1.00 55.27  ? 578  THR A CG2   1 
ATOM   4354 N  N     . CYS A 1 579 ? 47.376 80.918  78.661  1.00 52.48  ? 579  CYS A N     1 
ATOM   4355 C  CA    . CYS A 1 579 ? 46.192 80.685  79.494  1.00 51.93  ? 579  CYS A CA    1 
ATOM   4356 C  C     . CYS A 1 579 ? 46.029 79.218  79.892  1.00 51.30  ? 579  CYS A C     1 
ATOM   4357 O  O     . CYS A 1 579 ? 46.497 78.813  80.954  1.00 51.29  ? 579  CYS A O     1 
ATOM   4358 C  CB    . CYS A 1 579 ? 44.933 81.185  78.777  1.00 50.95  ? 579  CYS A CB    1 
ATOM   4359 S  SG    . CYS A 1 579 ? 44.879 82.977  78.614  1.00 50.50  ? 579  CYS A SG    1 
ATOM   4360 N  N     . ALA A 1 580 ? 45.383 78.436  79.023  1.00 51.19  ? 580  ALA A N     1 
ATOM   4361 C  CA    . ALA A 1 580 ? 44.956 77.066  79.320  1.00 48.97  ? 580  ALA A CA    1 
ATOM   4362 C  C     . ALA A 1 580 ? 45.488 76.083  78.284  1.00 46.34  ? 580  ALA A C     1 
ATOM   4363 O  O     . ALA A 1 580 ? 46.143 75.119  78.629  1.00 48.17  ? 580  ALA A O     1 
ATOM   4364 C  CB    . ALA A 1 580 ? 43.427 76.990  79.367  1.00 48.19  ? 580  ALA A CB    1 
ATOM   4365 N  N     . TYR A 1 581 ? 45.180 76.331  77.019  1.00 46.96  ? 581  TYR A N     1 
ATOM   4366 C  CA    . TYR A 1 581 ? 45.668 75.520  75.908  1.00 47.75  ? 581  TYR A CA    1 
ATOM   4367 C  C     . TYR A 1 581 ? 47.011 76.041  75.422  1.00 46.25  ? 581  TYR A C     1 
ATOM   4368 O  O     . TYR A 1 581 ? 47.357 77.198  75.632  1.00 44.48  ? 581  TYR A O     1 
ATOM   4369 C  CB    . TYR A 1 581 ? 44.671 75.556  74.742  1.00 49.25  ? 581  TYR A CB    1 
ATOM   4370 C  CG    . TYR A 1 581 ? 43.265 75.165  75.131  1.00 51.82  ? 581  TYR A CG    1 
ATOM   4371 C  CD1   . TYR A 1 581 ? 42.260 76.121  75.238  1.00 53.12  ? 581  TYR A CD1   1 
ATOM   4372 C  CD2   . TYR A 1 581 ? 42.941 73.835  75.396  1.00 53.37  ? 581  TYR A CD2   1 
ATOM   4373 C  CE1   . TYR A 1 581 ? 40.966 75.767  75.596  1.00 54.31  ? 581  TYR A CE1   1 
ATOM   4374 C  CE2   . TYR A 1 581 ? 41.650 73.468  75.758  1.00 54.25  ? 581  TYR A CE2   1 
ATOM   4375 C  CZ    . TYR A 1 581 ? 40.665 74.437  75.863  1.00 55.55  ? 581  TYR A CZ    1 
ATOM   4376 O  OH    . TYR A 1 581 ? 39.378 74.071  76.229  1.00 57.74  ? 581  TYR A OH    1 
ATOM   4377 N  N     . LEU A 1 582 ? 47.766 75.176  74.762  1.00 47.99  ? 582  LEU A N     1 
ATOM   4378 C  CA    . LEU A 1 582 ? 48.935 75.609  74.016  1.00 48.73  ? 582  LEU A CA    1 
ATOM   4379 C  C     . LEU A 1 582 ? 48.460 76.346  72.776  1.00 51.08  ? 582  LEU A C     1 
ATOM   4380 O  O     . LEU A 1 582 ? 47.388 76.042  72.224  1.00 53.79  ? 582  LEU A O     1 
ATOM   4381 C  CB    . LEU A 1 582 ? 49.789 74.417  73.595  1.00 48.55  ? 582  LEU A CB    1 
ATOM   4382 C  CG    . LEU A 1 582 ? 50.307 73.416  74.631  1.00 48.39  ? 582  LEU A CG    1 
ATOM   4383 C  CD1   . LEU A 1 582 ? 51.386 72.549  73.986  1.00 48.83  ? 582  LEU A CD1   1 
ATOM   4384 C  CD2   . LEU A 1 582 ? 50.851 74.104  75.851  1.00 48.59  ? 582  LEU A CD2   1 
ATOM   4385 N  N     . GLY A 1 583 ? 49.259 77.308  72.334  1.00 51.97  ? 583  GLY A N     1 
ATOM   4386 C  CA    . GLY A 1 583 ? 48.954 78.081  71.141  1.00 52.74  ? 583  GLY A CA    1 
ATOM   4387 C  C     . GLY A 1 583 ? 50.113 78.952  70.693  1.00 54.73  ? 583  GLY A C     1 
ATOM   4388 O  O     . GLY A 1 583 ? 51.051 79.184  71.456  1.00 53.18  ? 583  GLY A O     1 
ATOM   4389 N  N     . ASN A 1 584 ? 50.054 79.420  69.449  1.00 58.23  ? 584  ASN A N     1 
ATOM   4390 C  CA    . ASN A 1 584 ? 50.996 80.416  68.942  1.00 62.17  ? 584  ASN A CA    1 
ATOM   4391 C  C     . ASN A 1 584 ? 50.530 81.833  69.281  1.00 66.56  ? 584  ASN A C     1 
ATOM   4392 O  O     . ASN A 1 584 ? 49.483 82.254  68.801  1.00 67.85  ? 584  ASN A O     1 
ATOM   4393 C  CB    . ASN A 1 584 ? 51.119 80.277  67.424  1.00 62.88  ? 584  ASN A CB    1 
ATOM   4394 C  CG    . ASN A 1 584 ? 52.310 81.030  66.855  1.00 63.14  ? 584  ASN A CG    1 
ATOM   4395 O  OD1   . ASN A 1 584 ? 53.072 80.481  66.065  1.00 63.51  ? 584  ASN A OD1   1 
ATOM   4396 N  ND2   . ASN A 1 584 ? 52.469 82.293  67.244  1.00 63.70  ? 584  ASN A ND2   1 
ATOM   4397 N  N     . PRO A 1 585 ? 51.287 82.578  70.088  1.00 72.38  ? 585  PRO A N     1 
ATOM   4398 C  CA    . PRO A 1 585 ? 50.994 84.002  70.298  1.00 77.16  ? 585  PRO A CA    1 
ATOM   4399 C  C     . PRO A 1 585 ? 51.634 84.868  69.195  1.00 82.75  ? 585  PRO A C     1 
ATOM   4400 O  O     . PRO A 1 585 ? 52.843 84.767  68.939  1.00 84.32  ? 585  PRO A O     1 
ATOM   4401 C  CB    . PRO A 1 585 ? 51.614 84.287  71.665  1.00 75.60  ? 585  PRO A CB    1 
ATOM   4402 C  CG    . PRO A 1 585 ? 52.752 83.320  71.767  1.00 74.43  ? 585  PRO A CG    1 
ATOM   4403 C  CD    . PRO A 1 585 ? 52.461 82.149  70.862  1.00 73.00  ? 585  PRO A CD    1 
ATOM   4404 N  N     . ASN A 1 586 ? 50.819 85.705  68.551  1.00 86.77  ? 586  ASN A N     1 
ATOM   4405 C  CA    . ASN A 1 586 ? 51.242 86.464  67.368  1.00 90.16  ? 586  ASN A CA    1 
ATOM   4406 C  C     . ASN A 1 586 ? 51.666 87.908  67.706  1.00 92.09  ? 586  ASN A C     1 
ATOM   4407 O  O     . ASN A 1 586 ? 50.830 88.818  67.824  1.00 93.67  ? 586  ASN A O     1 
ATOM   4408 C  CB    . ASN A 1 586 ? 50.118 86.460  66.308  1.00 90.23  ? 586  ASN A CB    1 
ATOM   4409 C  CG    . ASN A 1 586 ? 49.603 85.052  65.994  1.00 90.22  ? 586  ASN A CG    1 
ATOM   4410 O  OD1   . ASN A 1 586 ? 50.387 84.125  65.781  1.00 90.53  ? 586  ASN A OD1   1 
ATOM   4411 N  ND2   . ASN A 1 586 ? 48.281 84.893  65.969  1.00 89.24  ? 586  ASN A ND2   1 
HETATM 4412 P  PG    . DGT B 2 .   ? 43.984 39.695  63.031  1.00 47.58  ? 1587 DGT A PG    1 
HETATM 4413 O  O1G   . DGT B 2 .   ? 42.578 39.331  63.624  1.00 49.31  ? 1587 DGT A O1G   1 
HETATM 4414 O  O2G   . DGT B 2 .   ? 45.111 39.279  64.077  1.00 48.09  ? 1587 DGT A O2G   1 
HETATM 4415 O  O3G   . DGT B 2 .   ? 44.130 38.946  61.639  1.00 50.86  ? 1587 DGT A O3G   1 
HETATM 4416 O  O3B   . DGT B 2 .   ? 44.135 41.276  62.787  1.00 50.24  ? 1587 DGT A O3B   1 
HETATM 4417 P  PB    . DGT B 2 .   ? 42.983 42.162  62.056  1.00 52.24  ? 1587 DGT A PB    1 
HETATM 4418 O  O1B   . DGT B 2 .   ? 43.743 43.115  61.001  1.00 43.02  ? 1587 DGT A O1B   1 
HETATM 4419 O  O2B   . DGT B 2 .   ? 41.895 41.157  61.480  1.00 43.80  ? 1587 DGT A O2B   1 
HETATM 4420 O  O3A   . DGT B 2 .   ? 42.334 43.192  63.173  1.00 43.27  ? 1587 DGT A O3A   1 
HETATM 4421 P  PA    . DGT B 2 .   ? 41.669 42.824  64.585  1.00 34.58  ? 1587 DGT A PA    1 
HETATM 4422 O  O1A   . DGT B 2 .   ? 41.488 41.244  64.717  1.00 43.25  ? 1587 DGT A O1A   1 
HETATM 4423 O  O2A   . DGT B 2 .   ? 42.494 43.333  65.823  1.00 35.89  ? 1587 DGT A O2A   1 
HETATM 4424 O  "O5'" . DGT B 2 .   ? 40.187 43.442  64.606  1.00 40.56  ? 1587 DGT A "O5'" 1 
HETATM 4425 C  "C5'" . DGT B 2 .   ? 39.315 43.428  65.748  1.00 39.25  ? 1587 DGT A "C5'" 1 
HETATM 4426 C  "C4'" . DGT B 2 .   ? 38.103 44.306  65.417  1.00 41.41  ? 1587 DGT A "C4'" 1 
HETATM 4427 O  "O4'" . DGT B 2 .   ? 38.517 45.625  65.002  1.00 43.15  ? 1587 DGT A "O4'" 1 
HETATM 4428 C  "C3'" . DGT B 2 .   ? 37.379 43.696  64.250  1.00 42.06  ? 1587 DGT A "C3'" 1 
HETATM 4429 O  "O3'" . DGT B 2 .   ? 35.982 43.707  64.575  1.00 42.79  ? 1587 DGT A "O3'" 1 
HETATM 4430 C  "C2'" . DGT B 2 .   ? 37.538 44.644  63.096  1.00 42.27  ? 1587 DGT A "C2'" 1 
HETATM 4431 C  "C1'" . DGT B 2 .   ? 38.182 45.901  63.632  1.00 40.76  ? 1587 DGT A "C1'" 1 
HETATM 4432 N  N9    . DGT B 2 .   ? 39.367 46.448  62.940  1.00 39.64  ? 1587 DGT A N9    1 
HETATM 4433 C  C8    . DGT B 2 .   ? 40.455 45.848  62.387  1.00 39.36  ? 1587 DGT A C8    1 
HETATM 4434 N  N7    . DGT B 2 .   ? 41.358 46.766  61.890  1.00 36.84  ? 1587 DGT A N7    1 
HETATM 4435 C  C5    . DGT B 2 .   ? 40.834 47.988  62.161  1.00 39.24  ? 1587 DGT A C5    1 
HETATM 4436 C  C6    . DGT B 2 .   ? 41.127 49.430  61.986  1.00 38.29  ? 1587 DGT A C6    1 
HETATM 4437 O  O6    . DGT B 2 .   ? 42.179 49.789  61.425  1.00 43.42  ? 1587 DGT A O6    1 
HETATM 4438 N  N1    . DGT B 2 .   ? 40.279 50.365  62.408  1.00 38.48  ? 1587 DGT A N1    1 
HETATM 4439 C  C2    . DGT B 2 .   ? 39.118 50.081  63.018  1.00 40.41  ? 1587 DGT A C2    1 
HETATM 4440 N  N2    . DGT B 2 .   ? 38.325 51.093  63.431  1.00 42.35  ? 1587 DGT A N2    1 
HETATM 4441 N  N3    . DGT B 2 .   ? 38.726 48.815  63.255  1.00 40.19  ? 1587 DGT A N3    1 
HETATM 4442 C  C4    . DGT B 2 .   ? 39.578 47.742  62.816  1.00 39.12  ? 1587 DGT A C4    1 
HETATM 4443 P  PG    . DGT C 2 .   ? 32.266 78.871  76.218  1.00 42.89  ? 1588 DGT A PG    1 
HETATM 4444 O  O1G   . DGT C 2 .   ? 31.153 79.985  76.366  1.00 44.21  ? 1588 DGT A O1G   1 
HETATM 4445 O  O2G   . DGT C 2 .   ? 33.145 78.551  77.503  1.00 44.56  ? 1588 DGT A O2G   1 
HETATM 4446 O  O3G   . DGT C 2 .   ? 31.600 77.506  75.758  1.00 47.64  ? 1588 DGT A O3G   1 
HETATM 4447 O  O3B   . DGT C 2 .   ? 33.211 79.424  75.063  1.00 49.27  ? 1588 DGT A O3B   1 
HETATM 4448 P  PB    . DGT C 2 .   ? 34.610 78.768  74.667  1.00 45.90  ? 1588 DGT A PB    1 
HETATM 4449 O  O1B   . DGT C 2 .   ? 34.597 77.173  74.731  1.00 50.92  ? 1588 DGT A O1B   1 
HETATM 4450 O  O2B   . DGT C 2 .   ? 34.904 79.361  73.231  1.00 49.47  ? 1588 DGT A O2B   1 
HETATM 4451 O  O3A   . DGT C 2 .   ? 35.682 79.283  75.741  1.00 51.62  ? 1588 DGT A O3A   1 
HETATM 4452 P  PA    . DGT C 2 .   ? 36.293 80.771  75.717  1.00 54.26  ? 1588 DGT A PA    1 
HETATM 4453 O  O1A   . DGT C 2 .   ? 36.826 81.090  77.182  1.00 50.15  ? 1588 DGT A O1A   1 
HETATM 4454 O  O2A   . DGT C 2 .   ? 37.451 80.843  74.624  1.00 53.48  ? 1588 DGT A O2A   1 
HETATM 4455 O  "O5'" . DGT C 2 .   ? 35.068 81.728  75.281  1.00 56.17  ? 1588 DGT A "O5'" 1 
HETATM 4456 C  "C5'" . DGT C 2 .   ? 34.201 82.274  76.270  1.00 59.86  ? 1588 DGT A "C5'" 1 
HETATM 4457 C  "C4'" . DGT C 2 .   ? 33.306 83.380  75.714  1.00 62.41  ? 1588 DGT A "C4'" 1 
HETATM 4458 O  "O4'" . DGT C 2 .   ? 34.029 84.594  75.478  1.00 64.13  ? 1588 DGT A "O4'" 1 
HETATM 4459 C  "C3'" . DGT C 2 .   ? 32.567 83.020  74.433  1.00 63.25  ? 1588 DGT A "C3'" 1 
HETATM 4460 O  "O3'" . DGT C 2 .   ? 31.175 82.994  74.711  1.00 62.65  ? 1588 DGT A "O3'" 1 
HETATM 4461 C  "C2'" . DGT C 2 .   ? 32.894 84.114  73.428  1.00 64.73  ? 1588 DGT A "C2'" 1 
HETATM 4462 C  "C1'" . DGT C 2 .   ? 33.803 85.105  74.157  1.00 66.88  ? 1588 DGT A "C1'" 1 
HETATM 4463 N  N9    . DGT C 2 .   ? 35.124 85.396  73.513  1.00 70.60  ? 1588 DGT A N9    1 
HETATM 4464 C  C8    . DGT C 2 .   ? 35.944 84.585  72.778  1.00 70.61  ? 1588 DGT A C8    1 
HETATM 4465 N  N7    . DGT C 2 .   ? 37.088 85.251  72.377  1.00 72.83  ? 1588 DGT A N7    1 
HETATM 4466 C  C5    . DGT C 2 .   ? 37.028 86.519  72.862  1.00 72.76  ? 1588 DGT A C5    1 
HETATM 4467 C  C6    . DGT C 2 .   ? 37.806 87.806  72.885  1.00 73.38  ? 1588 DGT A C6    1 
HETATM 4468 O  O6    . DGT C 2 .   ? 38.913 87.924  72.312  1.00 72.57  ? 1588 DGT A O6    1 
HETATM 4469 N  N1    . DGT C 2 .   ? 37.324 88.886  73.533  1.00 73.92  ? 1588 DGT A N1    1 
HETATM 4470 C  C2    . DGT C 2 .   ? 36.144 88.892  74.184  1.00 73.40  ? 1588 DGT A C2    1 
HETATM 4471 N  N2    . DGT C 2 .   ? 35.763 90.040  74.793  1.00 74.34  ? 1588 DGT A N2    1 
HETATM 4472 N  N3    . DGT C 2 .   ? 35.343 87.792  74.245  1.00 73.07  ? 1588 DGT A N3    1 
HETATM 4473 C  C4    . DGT C 2 .   ? 35.765 86.571  73.584  1.00 72.49  ? 1588 DGT A C4    1 
HETATM 4474 ZN ZN    . ZN  D 3 .   ? 67.179 80.462  63.229  1.00 82.16  ? 1589 ZN  A ZN    1 
HETATM 4475 MN MN    . MN  E 4 .   ? 41.115 40.225  63.381  1.00 51.15  ? 1590 MN  A MN    1 
HETATM 4476 O  O     . HOH F 5 .   ? 39.192 82.373  56.681  1.00 44.24  ? 2001 HOH A O     1 
HETATM 4477 O  O     . HOH F 5 .   ? 41.663 81.608  56.803  1.00 56.18  ? 2002 HOH A O     1 
HETATM 4478 O  O     . HOH F 5 .   ? 28.247 71.003  64.739  1.00 38.83  ? 2003 HOH A O     1 
HETATM 4479 O  O     . HOH F 5 .   ? 27.028 71.137  61.532  0.50 35.80  ? 2004 HOH A O     1 
HETATM 4480 O  O     . HOH F 5 .   ? 28.598 79.949  67.177  1.00 58.98  ? 2005 HOH A O     1 
HETATM 4481 O  O     . HOH F 5 .   ? 22.838 72.501  69.528  1.00 19.89  ? 2006 HOH A O     1 
HETATM 4482 O  O     . HOH F 5 .   ? 28.947 80.485  69.617  1.00 53.89  ? 2007 HOH A O     1 
HETATM 4483 O  O     . HOH F 5 .   ? 15.636 83.724  77.274  1.00 39.93  ? 2008 HOH A O     1 
HETATM 4484 O  O     . HOH F 5 .   ? 11.790 81.861  78.841  1.00 47.77  ? 2009 HOH A O     1 
HETATM 4485 O  O     . HOH F 5 .   ? 11.400 83.962  80.993  1.00 47.46  ? 2010 HOH A O     1 
HETATM 4486 O  O     . HOH F 5 .   ? 12.693 85.741  83.700  1.00 47.04  ? 2011 HOH A O     1 
HETATM 4487 O  O     . HOH F 5 .   ? 18.214 88.808  77.428  1.00 61.07  ? 2012 HOH A O     1 
HETATM 4488 O  O     . HOH F 5 .   ? 49.384 50.870  64.078  1.00 47.55  ? 2013 HOH A O     1 
HETATM 4489 O  O     . HOH F 5 .   ? 28.393 80.365  76.151  1.00 29.10  ? 2014 HOH A O     1 
HETATM 4490 O  O     . HOH F 5 .   ? 32.581 74.523  78.710  1.00 36.53  ? 2015 HOH A O     1 
HETATM 4491 O  O     . HOH F 5 .   ? 31.028 74.796  73.239  1.00 52.16  ? 2016 HOH A O     1 
HETATM 4492 O  O     . HOH F 5 .   ? 34.502 73.481  76.063  1.00 45.52  ? 2017 HOH A O     1 
HETATM 4493 O  O     . HOH F 5 .   ? 21.446 76.335  73.138  1.00 28.89  ? 2018 HOH A O     1 
HETATM 4494 O  O     . HOH F 5 .   ? 28.541 76.546  67.397  1.00 32.23  ? 2019 HOH A O     1 
HETATM 4495 O  O     . HOH F 5 .   ? 22.234 70.108  77.478  1.00 40.42  ? 2020 HOH A O     1 
HETATM 4496 O  O     . HOH F 5 .   ? 33.171 65.148  98.392  1.00 45.25  ? 2021 HOH A O     1 
HETATM 4497 O  O     . HOH F 5 .   ? 18.527 70.180  75.720  1.00 38.76  ? 2022 HOH A O     1 
HETATM 4498 O  O     . HOH F 5 .   ? 25.275 62.466  95.719  1.00 41.41  ? 2023 HOH A O     1 
HETATM 4499 O  O     . HOH F 5 .   ? 29.946 64.335  78.425  1.00 21.49  ? 2024 HOH A O     1 
HETATM 4500 O  O     . HOH F 5 .   ? 26.405 64.516  75.380  1.00 17.52  ? 2025 HOH A O     1 
HETATM 4501 O  O     . HOH F 5 .   ? 34.599 71.732  81.605  1.00 39.03  ? 2026 HOH A O     1 
HETATM 4502 O  O     . HOH F 5 .   ? 38.831 56.930  80.741  1.00 39.87  ? 2027 HOH A O     1 
HETATM 4503 O  O     . HOH F 5 .   ? 31.888 50.351  78.710  1.00 34.76  ? 2028 HOH A O     1 
HETATM 4504 O  O     . HOH F 5 .   ? 36.097 49.982  82.942  1.00 42.74  ? 2029 HOH A O     1 
HETATM 4505 O  O     . HOH F 5 .   ? 32.373 48.864  81.935  1.00 37.42  ? 2030 HOH A O     1 
HETATM 4506 O  O     . HOH F 5 .   ? 38.769 52.737  80.388  1.00 46.13  ? 2031 HOH A O     1 
HETATM 4507 O  O     . HOH F 5 .   ? 41.133 44.223  79.364  1.00 60.49  ? 2032 HOH A O     1 
HETATM 4508 O  O     . HOH F 5 .   ? 34.630 45.028  81.016  1.00 54.84  ? 2033 HOH A O     1 
HETATM 4509 O  O     . HOH F 5 .   ? 34.764 69.722  99.393  1.00 43.99  ? 2034 HOH A O     1 
HETATM 4510 O  O     . HOH F 5 .   ? 24.152 50.534  61.241  1.00 51.56  ? 2035 HOH A O     1 
HETATM 4511 O  O     . HOH F 5 .   ? 28.227 53.769  68.499  1.00 50.40  ? 2036 HOH A O     1 
HETATM 4512 O  O     . HOH F 5 .   ? 51.063 89.290  74.897  1.00 52.81  ? 2037 HOH A O     1 
HETATM 4513 O  O     . HOH F 5 .   ? 48.922 86.824  74.226  1.00 63.62  ? 2038 HOH A O     1 
HETATM 4514 O  O     . HOH F 5 .   ? 52.536 89.816  76.978  1.00 54.81  ? 2039 HOH A O     1 
HETATM 4515 O  O     . HOH F 5 .   ? 28.885 55.676  66.595  1.00 37.49  ? 2040 HOH A O     1 
HETATM 4516 O  O     . HOH F 5 .   ? 25.254 52.556  56.587  1.00 76.94  ? 2041 HOH A O     1 
HETATM 4517 O  O     . HOH F 5 .   ? 33.089 103.597 80.027  1.00 42.57  ? 2042 HOH A O     1 
HETATM 4518 O  O     . HOH F 5 .   ? 28.553 45.362  61.860  1.00 56.32  ? 2043 HOH A O     1 
HETATM 4519 O  O     . HOH F 5 .   ? 31.145 43.068  69.110  1.00 55.54  ? 2044 HOH A O     1 
HETATM 4520 O  O     . HOH F 5 .   ? 38.267 39.772  65.564  1.00 49.54  ? 2045 HOH A O     1 
HETATM 4521 O  O     . HOH F 5 .   ? 48.039 45.970  64.167  1.00 52.67  ? 2046 HOH A O     1 
HETATM 4522 O  O     . HOH F 5 .   ? 50.130 46.500  65.630  1.00 40.65  ? 2047 HOH A O     1 
HETATM 4523 O  O     . HOH F 5 .   ? 47.051 51.944  64.665  1.00 45.66  ? 2048 HOH A O     1 
HETATM 4524 O  O     . HOH F 5 .   ? 27.624 67.244  67.377  1.00 42.37  ? 2049 HOH A O     1 
HETATM 4525 O  O     . HOH F 5 .   ? 25.767 59.364  66.173  1.00 60.60  ? 2050 HOH A O     1 
HETATM 4526 O  O     . HOH F 5 .   ? 33.522 67.810  71.969  1.00 46.04  ? 2051 HOH A O     1 
HETATM 4527 O  O     . HOH F 5 .   ? 25.146 71.973  79.291  1.00 47.78  ? 2052 HOH A O     1 
HETATM 4528 O  O     . HOH F 5 .   ? 28.389 73.759  79.834  1.00 26.30  ? 2053 HOH A O     1 
HETATM 4529 O  O     . HOH F 5 .   ? 35.370 70.168  78.403  1.00 39.08  ? 2054 HOH A O     1 
HETATM 4530 O  O     . HOH F 5 .   ? 34.777 63.616  99.048  1.00 32.73  ? 2055 HOH A O     1 
HETATM 4531 O  O     . HOH F 5 .   ? 40.526 54.554  79.444  1.00 37.17  ? 2056 HOH A O     1 
HETATM 4532 O  O     . HOH F 5 .   ? 41.417 53.930  83.171  1.00 32.44  ? 2057 HOH A O     1 
HETATM 4533 O  O     . HOH F 5 .   ? 45.061 55.782  87.850  1.00 44.22  ? 2058 HOH A O     1 
HETATM 4534 O  O     . HOH F 5 .   ? 48.113 55.031  84.648  1.00 39.16  ? 2059 HOH A O     1 
HETATM 4535 O  O     . HOH F 5 .   ? 27.638 63.029  95.518  1.00 41.35  ? 2060 HOH A O     1 
HETATM 4536 O  O     . HOH F 5 .   ? 41.941 46.702  79.043  1.00 49.79  ? 2061 HOH A O     1 
HETATM 4537 O  O     . HOH F 5 .   ? 23.884 53.463  91.378  1.00 30.47  ? 2062 HOH A O     1 
HETATM 4538 O  O     . HOH F 5 .   ? 30.105 48.682  86.103  1.00 43.20  ? 2063 HOH A O     1 
HETATM 4539 O  O     . HOH F 5 .   ? 46.055 39.492  76.885  1.00 48.31  ? 2064 HOH A O     1 
HETATM 4540 O  O     . HOH F 5 .   ? 40.294 46.804  77.114  1.00 53.51  ? 2065 HOH A O     1 
HETATM 4541 O  O     . HOH F 5 .   ? 48.123 37.227  70.630  1.00 53.60  ? 2066 HOH A O     1 
HETATM 4542 O  O     . HOH F 5 .   ? 50.803 44.063  66.396  1.00 43.93  ? 2067 HOH A O     1 
HETATM 4543 O  O     . HOH F 5 .   ? 22.604 93.761  86.924  1.00 43.76  ? 2068 HOH A O     1 
HETATM 4544 O  O     . HOH F 5 .   ? 23.601 46.771  75.415  1.00 41.67  ? 2069 HOH A O     1 
HETATM 4545 O  O     . HOH F 5 .   ? 57.260 45.470  64.364  1.00 63.14  ? 2070 HOH A O     1 
HETATM 4546 O  O     . HOH F 5 .   ? 51.462 48.882  65.745  1.00 48.49  ? 2071 HOH A O     1 
HETATM 4547 O  O     . HOH F 5 .   ? 54.693 51.309  60.532  1.00 39.94  ? 2072 HOH A O     1 
HETATM 4548 O  O     . HOH F 5 .   ? 58.394 48.638  61.697  1.00 43.00  ? 2073 HOH A O     1 
HETATM 4549 O  O     . HOH F 5 .   ? 50.195 58.620  71.171  1.00 40.10  ? 2074 HOH A O     1 
HETATM 4550 O  O     . HOH F 5 .   ? 30.236 72.506  103.243 1.00 41.99  ? 2075 HOH A O     1 
HETATM 4551 O  O     . HOH F 5 .   ? 52.439 60.819  71.957  1.00 46.48  ? 2076 HOH A O     1 
HETATM 4552 O  O     . HOH F 5 .   ? 45.833 54.965  62.430  1.00 57.45  ? 2077 HOH A O     1 
HETATM 4553 O  O     . HOH F 5 .   ? 32.913 67.838  98.530  1.00 37.94  ? 2078 HOH A O     1 
HETATM 4554 O  O     . HOH F 5 .   ? 32.205 68.018  67.553  1.00 62.58  ? 2079 HOH A O     1 
HETATM 4555 O  O     . HOH F 5 .   ? 46.911 90.694  76.651  1.00 47.78  ? 2080 HOH A O     1 
HETATM 4556 O  O     . HOH F 5 .   ? 46.304 86.865  79.785  1.00 41.83  ? 2081 HOH A O     1 
HETATM 4557 O  O     . HOH F 5 .   ? 49.596 87.778  76.423  1.00 37.37  ? 2082 HOH A O     1 
HETATM 4558 O  O     . HOH F 5 .   ? 30.442 71.013  60.928  1.00 31.00  ? 2083 HOH A O     1 
HETATM 4559 O  O     . HOH F 5 .   ? 36.612 97.115  76.996  1.00 42.73  ? 2084 HOH A O     1 
HETATM 4560 O  O     . HOH F 5 .   ? 32.061 103.981 82.168  1.00 41.24  ? 2085 HOH A O     1 
HETATM 4561 O  O     . HOH F 5 .   ? 39.062 71.856  70.152  1.00 53.60  ? 2086 HOH A O     1 
HETATM 4562 O  O     . HOH F 5 .   ? 36.375 66.191  72.906  1.00 34.78  ? 2087 HOH A O     1 
HETATM 4563 O  O     . HOH F 5 .   ? 44.250 85.422  79.990  1.00 33.23  ? 2088 HOH A O     1 
HETATM 4564 O  O     . HOH F 5 .   ? 55.246 55.833  85.539  1.00 43.27  ? 2089 HOH A O     1 
HETATM 4565 O  O     . HOH F 5 .   ? 47.909 47.105  86.382  1.00 65.27  ? 2090 HOH A O     1 
HETATM 4566 O  O     . HOH F 5 .   ? 60.067 46.766  81.392  1.00 61.50  ? 2091 HOH A O     1 
HETATM 4567 O  O     . HOH F 5 .   ? 64.528 57.044  73.713  1.00 66.25  ? 2092 HOH A O     1 
HETATM 4568 O  O     . HOH F 5 .   ? 52.813 69.061  73.157  1.00 32.65  ? 2093 HOH A O     1 
HETATM 4569 O  O     . HOH F 5 .   ? 52.541 73.905  66.963  1.00 57.92  ? 2094 HOH A O     1 
HETATM 4570 O  O     . HOH F 5 .   ? 52.930 57.327  89.116  1.00 48.95  ? 2095 HOH A O     1 
HETATM 4571 O  O     . HOH F 5 .   ? 52.059 61.268  94.748  1.00 45.70  ? 2096 HOH A O     1 
HETATM 4572 O  O     . HOH F 5 .   ? 47.998 55.091  93.102  1.00 46.72  ? 2097 HOH A O     1 
HETATM 4573 O  O     . HOH F 5 .   ? 53.607 59.670  96.511  1.00 45.51  ? 2098 HOH A O     1 
HETATM 4574 O  O     . HOH F 5 .   ? 60.451 55.711  96.546  1.00 56.21  ? 2099 HOH A O     1 
HETATM 4575 O  O     . HOH F 5 .   ? 61.985 74.033  78.333  1.00 41.27  ? 2100 HOH A O     1 
HETATM 4576 O  O     . HOH F 5 .   ? 55.540 71.551  81.375  1.00 37.94  ? 2101 HOH A O     1 
HETATM 4577 O  O     . HOH F 5 .   ? 46.772 72.446  74.793  1.00 35.21  ? 2102 HOH A O     1 
HETATM 4578 O  O     . HOH F 5 .   ? 46.920 72.528  78.918  1.00 31.32  ? 2103 HOH A O     1 
HETATM 4579 O  O     . HOH F 5 .   ? 55.191 69.848  83.393  1.00 50.74  ? 2104 HOH A O     1 
HETATM 4580 O  O     . HOH F 5 .   ? 52.879 70.842  81.544  1.00 32.31  ? 2105 HOH A O     1 
HETATM 4581 O  O     . HOH F 5 .   ? 47.056 71.965  81.772  1.00 43.12  ? 2106 HOH A O     1 
HETATM 4582 O  O     . HOH F 5 .   ? 36.873 63.413  99.979  1.00 40.49  ? 2107 HOH A O     1 
HETATM 4583 O  O     . HOH F 5 .   ? 36.268 65.535  95.900  1.00 53.64  ? 2108 HOH A O     1 
HETATM 4584 O  O     . HOH F 5 .   ? 37.641 55.699  92.398  1.00 32.56  ? 2109 HOH A O     1 
HETATM 4585 O  O     . HOH F 5 .   ? 41.906 58.050  86.062  1.00 31.73  ? 2110 HOH A O     1 
HETATM 4586 O  O     . HOH F 5 .   ? 37.730 63.566  86.544  1.00 29.89  ? 2111 HOH A O     1 
HETATM 4587 O  O     . HOH F 5 .   ? 44.434 71.489  82.011  1.00 42.86  ? 2112 HOH A O     1 
HETATM 4588 O  O     . HOH F 5 .   ? 41.851 76.684  86.155  1.00 29.36  ? 2113 HOH A O     1 
HETATM 4589 O  O     . HOH F 5 .   ? 43.869 78.381  82.145  1.00 40.93  ? 2114 HOH A O     1 
HETATM 4590 O  O     . HOH F 5 .   ? 33.605 70.717  84.229  1.00 31.45  ? 2115 HOH A O     1 
HETATM 4591 O  O     . HOH F 5 .   ? 33.620 66.866  91.251  1.00 31.10  ? 2116 HOH A O     1 
HETATM 4592 O  O     . HOH F 5 .   ? 30.447 63.382  95.420  1.00 33.05  ? 2117 HOH A O     1 
HETATM 4593 O  O     . HOH F 5 .   ? 31.839 63.575  90.942  1.00 28.08  ? 2118 HOH A O     1 
HETATM 4594 O  O     . HOH F 5 .   ? 25.449 53.787  93.409  1.00 30.52  ? 2119 HOH A O     1 
HETATM 4595 O  O     . HOH F 5 .   ? 27.850 56.499  95.714  1.00 46.32  ? 2120 HOH A O     1 
HETATM 4596 O  O     . HOH F 5 .   ? 29.688 46.463  88.687  1.00 40.98  ? 2121 HOH A O     1 
HETATM 4597 O  O     . HOH F 5 .   ? 26.150 47.395  90.790  1.00 52.31  ? 2122 HOH A O     1 
HETATM 4598 O  O     . HOH F 5 .   ? 24.633 51.220  90.152  1.00 32.37  ? 2123 HOH A O     1 
HETATM 4599 O  O     . HOH F 5 .   ? 35.075 56.536  92.065  1.00 38.78  ? 2124 HOH A O     1 
HETATM 4600 O  O     . HOH F 5 .   ? 36.466 53.029  86.596  1.00 31.64  ? 2125 HOH A O     1 
HETATM 4601 O  O     . HOH F 5 .   ? 38.127 51.137  83.911  1.00 36.82  ? 2126 HOH A O     1 
HETATM 4602 O  O     . HOH F 5 .   ? 32.549 51.919  84.109  1.00 31.72  ? 2127 HOH A O     1 
HETATM 4603 O  O     . HOH F 5 .   ? 40.080 56.143  85.679  1.00 42.56  ? 2128 HOH A O     1 
HETATM 4604 O  O     . HOH F 5 .   ? 28.467 59.399  81.952  1.00 30.10  ? 2129 HOH A O     1 
HETATM 4605 O  O     . HOH F 5 .   ? 27.721 59.791  84.485  1.00 42.22  ? 2130 HOH A O     1 
HETATM 4606 O  O     . HOH F 5 .   ? 28.816 88.444  89.559  1.00 21.71  ? 2131 HOH A O     1 
HETATM 4607 O  O     . HOH F 5 .   ? 28.758 99.761  92.264  1.00 41.93  ? 2132 HOH A O     1 
HETATM 4608 O  O     . HOH F 5 .   ? 34.270 101.203 91.487  1.00 30.80  ? 2133 HOH A O     1 
HETATM 4609 O  O     . HOH F 5 .   ? 25.096 94.593  87.993  1.00 40.35  ? 2134 HOH A O     1 
HETATM 4610 O  O     . HOH F 5 .   ? 26.549 99.259  95.392  1.00 40.93  ? 2135 HOH A O     1 
HETATM 4611 O  O     . HOH F 5 .   ? 36.137 100.631 92.297  1.00 39.78  ? 2136 HOH A O     1 
HETATM 4612 O  O     . HOH F 5 .   ? 38.256 101.022 92.992  1.00 58.45  ? 2137 HOH A O     1 
HETATM 4613 O  O     . HOH F 5 .   ? 32.196 102.020 91.374  1.00 42.39  ? 2138 HOH A O     1 
HETATM 4614 O  O     . HOH F 5 .   ? 30.290 103.292 101.103 1.00 63.15  ? 2139 HOH A O     1 
HETATM 4615 O  O     . HOH F 5 .   ? 36.675 100.160 99.987  1.00 39.60  ? 2140 HOH A O     1 
HETATM 4616 O  O     . HOH F 5 .   ? 34.436 99.414  103.469 1.00 37.19  ? 2141 HOH A O     1 
HETATM 4617 O  O     . HOH F 5 .   ? 24.446 97.635  102.868 1.00 30.36  ? 2142 HOH A O     1 
HETATM 4618 O  O     . HOH F 5 .   ? 20.493 98.666  96.964  1.00 33.24  ? 2143 HOH A O     1 
HETATM 4619 O  O     . HOH F 5 .   ? 23.439 101.702 97.125  1.00 44.80  ? 2144 HOH A O     1 
HETATM 4620 O  O     . HOH F 5 .   ? 19.160 95.030  103.444 1.00 42.50  ? 2145 HOH A O     1 
HETATM 4621 O  O     . HOH F 5 .   ? 21.308 96.460  103.896 1.00 46.80  ? 2146 HOH A O     1 
HETATM 4622 O  O     . HOH F 5 .   ? 22.460 96.713  100.970 1.00 49.04  ? 2147 HOH A O     1 
HETATM 4623 O  O     . HOH F 5 .   ? 22.668 90.706  91.431  1.00 35.96  ? 2148 HOH A O     1 
HETATM 4624 O  O     . HOH F 5 .   ? 20.763 93.328  96.353  1.00 52.08  ? 2149 HOH A O     1 
HETATM 4625 O  O     . HOH F 5 .   ? 18.878 85.077  93.063  1.00 40.36  ? 2150 HOH A O     1 
HETATM 4626 O  O     . HOH F 5 .   ? 17.811 89.082  92.760  1.00 60.03  ? 2151 HOH A O     1 
HETATM 4627 O  O     . HOH F 5 .   ? 18.096 78.182  95.866  1.00 55.00  ? 2152 HOH A O     1 
HETATM 4628 O  O     . HOH F 5 .   ? 16.028 76.912  87.026  1.00 33.93  ? 2153 HOH A O     1 
HETATM 4629 O  O     . HOH F 5 .   ? 16.530 61.885  80.040  1.00 26.17  ? 2154 HOH A O     1 
HETATM 4630 O  O     . HOH F 5 .   ? 15.761 68.547  87.550  1.00 59.09  ? 2155 HOH A O     1 
HETATM 4631 O  O     . HOH F 5 .   ? 13.488 61.986  81.841  1.00 49.23  ? 2156 HOH A O     1 
HETATM 4632 O  O     . HOH F 5 .   ? 19.638 56.364  67.472  1.00 31.58  ? 2157 HOH A O     1 
HETATM 4633 O  O     . HOH F 5 .   ? 26.674 57.579  68.352  1.00 29.83  ? 2158 HOH A O     1 
HETATM 4634 O  O     . HOH F 5 .   ? 23.905 63.960  75.906  1.00 23.22  ? 2159 HOH A O     1 
HETATM 4635 O  O     . HOH F 5 .   ? 19.789 53.970  68.660  1.00 29.66  ? 2160 HOH A O     1 
HETATM 4636 O  O     . HOH F 5 .   ? 25.326 47.223  73.704  1.00 42.77  ? 2161 HOH A O     1 
HETATM 4637 O  O     . HOH F 5 .   ? 23.792 51.220  68.937  1.00 47.49  ? 2162 HOH A O     1 
HETATM 4638 O  O     . HOH F 5 .   ? 30.045 48.356  81.650  1.00 32.69  ? 2163 HOH A O     1 
HETATM 4639 O  O     . HOH F 5 .   ? 29.634 51.527  84.691  1.00 35.93  ? 2164 HOH A O     1 
HETATM 4640 O  O     . HOH F 5 .   ? 27.286 53.165  77.316  1.00 32.38  ? 2165 HOH A O     1 
HETATM 4641 O  O     . HOH F 5 .   ? 29.828 47.539  79.385  1.00 46.37  ? 2166 HOH A O     1 
HETATM 4642 O  O     . HOH F 5 .   ? 20.235 48.071  79.266  1.00 41.89  ? 2167 HOH A O     1 
HETATM 4643 O  O     . HOH F 5 .   ? 18.059 49.006  79.969  1.00 29.31  ? 2168 HOH A O     1 
HETATM 4644 O  O     . HOH F 5 .   ? 18.257 51.838  81.952  1.00 34.41  ? 2169 HOH A O     1 
HETATM 4645 O  O     . HOH F 5 .   ? 22.946 57.418  88.189  1.00 43.42  ? 2170 HOH A O     1 
HETATM 4646 O  O     . HOH F 5 .   ? 28.290 52.675  86.957  1.00 27.44  ? 2171 HOH A O     1 
HETATM 4647 O  O     . HOH F 5 .   ? 25.299 63.565  89.855  1.00 24.53  ? 2172 HOH A O     1 
HETATM 4648 O  O     . HOH F 5 .   ? 33.944 67.325  87.691  1.00 39.10  ? 2173 HOH A O     1 
HETATM 4649 O  O     . HOH F 5 .   ? 33.467 70.413  88.485  1.00 28.73  ? 2174 HOH A O     1 
HETATM 4650 O  O     . HOH F 5 .   ? 38.586 80.864  86.379  1.00 26.11  ? 2175 HOH A O     1 
HETATM 4651 O  O     . HOH F 5 .   ? 42.761 83.297  101.430 1.00 38.55  ? 2176 HOH A O     1 
HETATM 4652 O  O     . HOH F 5 .   ? 45.696 78.084  103.770 1.00 66.27  ? 2177 HOH A O     1 
HETATM 4653 O  O     . HOH F 5 .   ? 33.029 73.884  103.049 1.00 36.85  ? 2178 HOH A O     1 
HETATM 4654 O  O     . HOH F 5 .   ? 34.051 85.474  104.462 1.00 61.13  ? 2179 HOH A O     1 
HETATM 4655 O  O     . HOH F 5 .   ? 31.020 86.182  101.907 1.00 33.63  ? 2180 HOH A O     1 
HETATM 4656 O  O     . HOH F 5 .   ? 33.409 85.846  102.352 1.00 35.58  ? 2181 HOH A O     1 
HETATM 4657 O  O     . HOH F 5 .   ? 28.775 85.620  102.667 1.00 41.84  ? 2182 HOH A O     1 
HETATM 4658 O  O     . HOH F 5 .   ? 28.203 84.547  104.568 1.00 38.69  ? 2183 HOH A O     1 
HETATM 4659 O  O     . HOH F 5 .   ? 29.996 70.602  98.865  1.00 41.44  ? 2184 HOH A O     1 
HETATM 4660 O  O     . HOH F 5 .   ? 25.257 77.299  103.688 1.00 52.73  ? 2185 HOH A O     1 
HETATM 4661 O  O     . HOH F 5 .   ? 18.945 76.127  96.291  1.00 58.81  ? 2186 HOH A O     1 
HETATM 4662 O  O     . HOH F 5 .   ? 31.435 66.312  91.708  1.00 29.65  ? 2187 HOH A O     1 
HETATM 4663 O  O     . HOH F 5 .   ? 31.343 70.322  96.523  1.00 46.03  ? 2188 HOH A O     1 
HETATM 4664 O  O     . HOH F 5 .   ? 30.665 66.409  94.542  1.00 47.79  ? 2189 HOH A O     1 
HETATM 4665 O  O     . HOH F 5 .   ? 37.941 70.784  81.917  1.00 34.38  ? 2190 HOH A O     1 
HETATM 4666 O  O     . HOH F 5 .   ? 36.468 77.924  80.005  1.00 35.39  ? 2191 HOH A O     1 
HETATM 4667 O  O     . HOH F 5 .   ? 46.477 79.682  76.012  1.00 48.29  ? 2192 HOH A O     1 
HETATM 4668 O  O     . HOH F 5 .   ? 38.487 77.784  77.918  1.00 34.42  ? 2193 HOH A O     1 
HETATM 4669 O  O     . HOH F 5 .   ? 47.330 88.424  77.813  1.00 36.04  ? 2194 HOH A O     1 
HETATM 4670 O  O     . HOH F 5 .   ? 45.529 90.527  74.904  1.00 50.57  ? 2195 HOH A O     1 
HETATM 4671 O  O     . HOH F 5 .   ? 34.301 97.303  77.405  1.00 40.37  ? 2196 HOH A O     1 
HETATM 4672 O  O     . HOH F 5 .   ? 22.851 96.977  85.701  1.00 54.23  ? 2197 HOH A O     1 
HETATM 4673 O  O     . HOH F 5 .   ? 33.080 104.885 84.615  1.00 56.04  ? 2198 HOH A O     1 
HETATM 4674 O  O     . HOH F 5 .   ? 42.796 99.102  93.122  1.00 47.76  ? 2199 HOH A O     1 
HETATM 4675 O  O     . HOH F 5 .   ? 43.349 84.699  82.808  1.00 41.19  ? 2200 HOH A O     1 
HETATM 4676 O  O     . HOH F 5 .   ? 41.898 82.298  82.703  1.00 29.49  ? 2201 HOH A O     1 
HETATM 4677 O  O     . HOH F 5 .   ? 45.684 84.237  84.899  1.00 38.91  ? 2202 HOH A O     1 
HETATM 4678 O  O     . HOH F 5 .   ? 43.315 84.654  90.835  1.00 34.09  ? 2203 HOH A O     1 
HETATM 4679 O  O     . HOH F 5 .   ? 46.985 81.845  85.440  1.00 46.02  ? 2204 HOH A O     1 
HETATM 4680 O  O     . HOH F 5 .   ? 49.445 82.322  87.263  1.00 51.56  ? 2205 HOH A O     1 
HETATM 4681 O  O     . HOH F 5 .   ? 48.491 78.768  88.659  1.00 44.28  ? 2206 HOH A O     1 
HETATM 4682 O  O     . HOH F 5 .   ? 36.436 69.974  100.994 1.00 43.70  ? 2207 HOH A O     1 
HETATM 4683 O  O     . HOH F 5 .   ? 33.937 71.288  95.334  1.00 30.20  ? 2208 HOH A O     1 
HETATM 4684 O  O     . HOH F 5 .   ? 42.973 76.248  88.490  1.00 32.72  ? 2209 HOH A O     1 
HETATM 4685 O  O     . HOH F 5 .   ? 61.842 74.646  74.110  1.00 51.28  ? 2210 HOH A O     1 
HETATM 4686 O  O     . HOH F 5 .   ? 65.987 68.704  77.225  1.00 54.49  ? 2211 HOH A O     1 
HETATM 4687 O  O     . HOH F 5 .   ? 54.406 78.835  77.909  1.00 43.35  ? 2212 HOH A O     1 
HETATM 4688 O  O     . HOH F 5 .   ? 62.375 77.091  73.453  1.00 52.16  ? 2213 HOH A O     1 
HETATM 4689 O  O     . HOH F 5 .   ? 62.054 74.073  71.797  1.00 50.79  ? 2214 HOH A O     1 
HETATM 4690 O  O     . HOH F 5 .   ? 64.645 80.853  77.777  1.00 63.52  ? 2215 HOH A O     1 
HETATM 4691 O  O     . HOH F 5 .   ? 44.196 81.181  81.857  1.00 45.38  ? 2216 HOH A O     1 
HETATM 4692 O  O     . HOH F 5 .   ? 48.934 79.417  81.261  1.00 40.06  ? 2217 HOH A O     1 
HETATM 4693 O  O     . HOH F 5 .   ? 37.748 76.682  75.269  1.00 55.13  ? 2218 HOH A O     1 
HETATM 4694 O  O     . HOH F 5 .   ? 48.087 89.203  67.567  1.00 83.19  ? 2219 HOH A O     1 
HETATM 4695 O  O     . HOH F 5 .   ? 34.909 42.238  62.992  1.00 40.03  ? 2220 HOH A O     1 
HETATM 4696 O  O     . HOH F 5 .   ? 43.567 46.256  60.683  1.00 39.19  ? 2221 HOH A O     1 
HETATM 4697 O  O     . HOH F 5 .   ? 44.931 42.783  65.116  1.00 36.58  ? 2222 HOH A O     1 
HETATM 4698 O  O     . HOH F 5 .   ? 43.461 41.247  59.507  1.00 50.66  ? 2223 HOH A O     1 
HETATM 4699 O  O     . HOH F 5 .   ? 35.189 79.800  78.598  1.00 45.62  ? 2224 HOH A O     1 
HETATM 4700 O  O     . HOH F 5 .   ? 35.098 87.147  70.292  1.00 52.60  ? 2225 HOH A O     1 
HETATM 4701 O  O     . HOH F 5 .   ? 28.348 83.071  74.967  1.00 40.14  ? 2226 HOH A O     1 
HETATM 4702 O  O     . HOH F 5 .   ? 32.856 89.229  74.226  1.00 60.70  ? 2227 HOH A O     1 
HETATM 4703 O  O     . HOH F 5 .   ? 33.960 75.484  77.189  1.00 48.14  ? 2228 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   GLU 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  ILE 11  11  ?   ?   ?   A . n 
A 1 12  HIS 12  12  ?   ?   ?   A . n 
A 1 13  LYS 13  13  ?   ?   ?   A . n 
A 1 14  THR 14  14  ?   ?   ?   A . n 
A 1 15  ASN 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  ?   ?   ?   A . n 
A 1 17  ASP 17  17  ?   ?   ?   A . n 
A 1 18  LEU 18  18  ?   ?   ?   A . n 
A 1 19  LEU 19  19  ?   ?   ?   A . n 
A 1 20  ASN 20  20  ?   ?   ?   A . n 
A 1 21  GLU 21  21  ?   ?   ?   A . n 
A 1 22  ASN 22  22  ?   ?   ?   A . n 
A 1 23  ALA 23  23  ?   ?   ?   A . n 
A 1 24  ASN 24  24  ?   ?   ?   A . n 
A 1 25  LYS 25  25  ?   ?   ?   A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  MET 37  37  37  MET MET A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  MET 55  55  55  MET MET A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 TRP 154 154 154 TRP TRP A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 TRP 205 205 205 TRP TRP A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 MET 209 209 209 MET MET A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLY 223 223 223 GLY GLY A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 MET 236 236 236 MET MET A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 TYR 245 245 245 TYR TYR A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 ASP 247 247 247 ASP ASP A . n 
A 1 248 ASP 248 248 248 ASP ASP A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 TYR 251 251 251 TYR TYR A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 CYS 260 260 260 CYS CYS A . n 
A 1 261 ALA 261 261 261 ALA ALA A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 ARG 264 264 264 ARG ARG A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 ILE 278 278 278 ILE ILE A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 PRO 287 287 287 PRO PRO A . n 
A 1 288 MET 288 288 288 MET MET A . n 
A 1 289 GLY 289 289 289 GLY GLY A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 SER 292 292 292 SER SER A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 TRP 297 297 297 TRP TRP A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 SER 300 300 300 SER SER A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ASN 303 303 303 ASN ASN A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 GLY 313 313 313 GLY GLY A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 THR 316 316 316 THR THR A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 ASN 318 318 318 ASN ASN A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ALA 323 323 323 ALA ALA A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 ASP 325 325 325 ASP ASP A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 ILE 328 328 328 ILE ILE A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 PHE 332 332 332 PHE PHE A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 VAL 338 338 338 VAL VAL A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 PHE 341 341 341 PHE PHE A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 MET 345 345 345 MET MET A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 LEU 347 347 347 LEU LEU A . n 
A 1 348 CYS 348 348 348 CYS CYS A . n 
A 1 349 PHE 349 349 349 PHE PHE A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 CYS 354 354 354 CYS CYS A . n 
A 1 355 ARG 355 355 355 ARG ARG A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 SER 358 358 358 SER SER A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 LYS 360 360 360 LYS LYS A . n 
A 1 361 GLY 361 361 361 GLY GLY A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 LYS 363 363 363 LYS LYS A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 THR 365 365 365 THR THR A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 TYR 371 371 371 TYR TYR A . n 
A 1 372 GLN 372 372 372 GLN GLN A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 ARG 379 379 379 ARG ARG A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 LYS 381 381 381 LYS LYS A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ASP 385 385 385 ASP ASP A . n 
A 1 386 ILE 386 386 386 ILE ILE A . n 
A 1 387 ILE 387 387 387 ILE ILE A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 PHE 390 390 390 PHE PHE A . n 
A 1 391 LYS 391 391 391 LYS LYS A . n 
A 1 392 ASN 392 392 392 ASN ASN A . n 
A 1 393 GLY 393 393 393 GLY GLY A . n 
A 1 394 ARG 394 394 394 ARG ARG A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 SER 396 396 396 SER SER A . n 
A 1 397 VAL 397 397 397 VAL VAL A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 TYR 401 401 401 TYR TYR A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 GLU 406 406 406 GLU GLU A . n 
A 1 407 LEU 407 407 407 LEU LEU A . n 
A 1 408 ASN 408 408 408 ASN ASN A . n 
A 1 409 ILE 409 409 409 ILE ILE A . n 
A 1 410 LEU 410 410 410 LEU LEU A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 ARG 413 413 413 ARG ARG A . n 
A 1 414 ASP 414 414 414 ASP ASP A . n 
A 1 415 ILE 415 415 415 ILE ILE A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 GLU 418 418 418 GLU GLU A . n 
A 1 419 ILE 419 419 419 ILE ILE A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 THR 421 421 421 THR THR A . n 
A 1 422 LYS 422 422 422 LYS LYS A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 ALA 425 425 425 ALA ALA A . n 
A 1 426 HIS 426 426 426 HIS HIS A . n 
A 1 427 LEU 427 427 427 LEU LEU A . n 
A 1 428 LYS 428 428 428 LYS LYS A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 THR 431 431 431 THR THR A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 THR 434 434 434 THR THR A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 PHE 436 436 436 PHE PHE A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 PHE 438 438 438 PHE PHE A . n 
A 1 439 SER 439 439 439 SER SER A . n 
A 1 440 LEU 440 440 440 LEU LEU A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 SER 442 442 442 SER SER A . n 
A 1 443 THR 443 443 443 THR THR A . n 
A 1 444 PRO 444 444 444 PRO PRO A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 ASN 447 447 447 ASN ASN A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 CYS 449 449 449 CYS CYS A . n 
A 1 450 TYR 450 450 450 TYR TYR A . n 
A 1 451 ARG 451 451 451 ARG ARG A . n 
A 1 452 PHE 452 452 452 PHE PHE A . n 
A 1 453 CYS 453 453 453 CYS CYS A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 LEU 455 455 455 LEU LEU A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 THR 457 457 457 THR THR A . n 
A 1 458 GLU 458 458 458 GLU GLU A . n 
A 1 459 LYS 459 459 459 LYS LYS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 GLY 461 461 461 GLY GLY A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 LYS 464 464 464 LYS LYS A . n 
A 1 465 ASP 465 465 465 ASP ASP A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 LYS 469 469 469 LYS LYS A . n 
A 1 470 GLY 470 470 470 GLY GLY A . n 
A 1 471 TRP 471 471 471 TRP TRP A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 SER 475 475 475 SER SER A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 HIS 477 477 477 HIS HIS A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 SER 479 479 479 SER SER A . n 
A 1 480 VAL 480 480 480 VAL VAL A . n 
A 1 481 GLU 481 481 481 GLU GLU A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 THR 485 485 485 THR THR A . n 
A 1 486 PRO 486 486 486 PRO PRO A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 GLU 488 488 488 GLU GLU A . n 
A 1 489 LYS 489 489 489 LYS LYS A . n 
A 1 490 ILE 490 490 490 ILE ILE A . n 
A 1 491 SER 491 491 491 SER SER A . n 
A 1 492 ARG 492 492 492 ARG ARG A . n 
A 1 493 GLU 493 493 493 GLU GLU A . n 
A 1 494 ALA 494 494 494 ALA ALA A . n 
A 1 495 PRO 495 495 495 PRO PRO A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 HIS 497 497 497 HIS HIS A . n 
A 1 498 PHE 498 498 498 PHE PHE A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 ALA 500 500 500 ALA ALA A . n 
A 1 501 THR 501 501 501 THR THR A . n 
A 1 502 GLY 502 502 502 GLY GLY A . n 
A 1 503 GLY 503 503 503 GLY GLY A . n 
A 1 504 HIS 504 504 504 HIS HIS A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 SER 506 506 506 SER SER A . n 
A 1 507 TYR 507 507 507 TYR TYR A . n 
A 1 508 VAL 508 508 508 VAL VAL A . n 
A 1 509 GLU 509 509 509 GLU GLU A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 PRO 511 511 511 PRO PRO A . n 
A 1 512 ASP 512 512 512 ASP ASP A . n 
A 1 513 MET 513 513 513 MET MET A . n 
A 1 514 LYS 514 514 514 LYS LYS A . n 
A 1 515 ASN 515 515 515 ASN ASN A . n 
A 1 516 ASN 516 516 516 ASN ASN A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 GLY 519 519 519 GLY GLY A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 GLU 521 521 521 GLU GLU A . n 
A 1 522 ALA 522 522 522 ALA ALA A . n 
A 1 523 VAL 523 523 523 VAL VAL A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 TYR 526 526 526 TYR TYR A . n 
A 1 527 ALA 527 527 527 ALA ALA A . n 
A 1 528 ALA 528 528 528 ALA ALA A . n 
A 1 529 GLN 529 529 529 GLN GLN A . n 
A 1 530 HIS 530 530 530 HIS HIS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 ASP 532 532 532 ASP ASP A . n 
A 1 533 TYR 533 533 533 TYR TYR A . n 
A 1 534 PHE 534 534 534 PHE PHE A . n 
A 1 535 GLY 535 535 535 GLY GLY A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 MET 538 538 538 MET MET A . n 
A 1 539 PRO 539 539 539 PRO PRO A . n 
A 1 540 VAL 540 540 540 VAL VAL A . n 
A 1 541 ASP 541 541 541 ASP ASP A . n 
A 1 542 LYS 542 542 542 LYS LYS A . n 
A 1 543 CYS 543 543 543 CYS CYS A . n 
A 1 544 PHE 544 544 544 PHE PHE A . n 
A 1 545 THR 545 545 545 THR THR A . n 
A 1 546 CYS 546 546 546 CYS CYS A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 SER 548 548 548 SER SER A . n 
A 1 549 THR 549 549 549 THR THR A . n 
A 1 550 HIS 550 550 550 HIS HIS A . n 
A 1 551 GLU 551 551 551 GLU GLU A . n 
A 1 552 MET 552 552 552 MET MET A . n 
A 1 553 THR 553 553 553 THR THR A . n 
A 1 554 PRO 554 554 554 PRO PRO A . n 
A 1 555 THR 555 555 555 THR THR A . n 
A 1 556 GLU 556 556 556 GLU GLU A . n 
A 1 557 ASN 557 557 557 ASN ASN A . n 
A 1 558 GLY 558 558 558 GLY GLY A . n 
A 1 559 PHE 559 559 559 PHE PHE A . n 
A 1 560 VAL 560 560 560 VAL VAL A . n 
A 1 561 CYS 561 561 561 CYS CYS A . n 
A 1 562 SER 562 562 562 SER SER A . n 
A 1 563 ILE 563 563 563 ILE ILE A . n 
A 1 564 CYS 564 564 564 CYS CYS A . n 
A 1 565 GLY 565 565 565 GLY GLY A . n 
A 1 566 GLU 566 566 566 GLU GLU A . n 
A 1 567 THR 567 567 567 THR THR A . n 
A 1 568 ASP 568 568 568 ASP ASP A . n 
A 1 569 PRO 569 569 569 PRO PRO A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 LYS 571 571 571 LYS LYS A . n 
A 1 572 MET 572 572 572 MET MET A . n 
A 1 573 ASN 573 573 573 ASN ASN A . n 
A 1 574 THR 574 574 574 THR THR A . n 
A 1 575 ILE 575 575 575 ILE ILE A . n 
A 1 576 ARG 576 576 576 ARG ARG A . n 
A 1 577 ARG 577 577 577 ARG ARG A . n 
A 1 578 THR 578 578 578 THR THR A . n 
A 1 579 CYS 579 579 579 CYS CYS A . n 
A 1 580 ALA 580 580 580 ALA ALA A . n 
A 1 581 TYR 581 581 581 TYR TYR A . n 
A 1 582 LEU 582 582 582 LEU LEU A . n 
A 1 583 GLY 583 583 583 GLY GLY A . n 
A 1 584 ASN 584 584 584 ASN ASN A . n 
A 1 585 PRO 585 585 585 PRO PRO A . n 
A 1 586 ASN 586 586 586 ASN ASN A . n 
A 1 587 GLU 587 587 ?   ?   ?   A . n 
A 1 588 ARG 588 588 ?   ?   ?   A . n 
A 1 589 GLY 589 589 ?   ?   ?   A . n 
A 1 590 PHE 590 590 ?   ?   ?   A . n 
A 1 591 ASN 591 591 ?   ?   ?   A . n 
A 1 592 LEU 592 592 ?   ?   ?   A . n 
A 1 593 GLY 593 593 ?   ?   ?   A . n 
A 1 594 LYS 594 594 ?   ?   ?   A . n 
A 1 595 ASN 595 595 ?   ?   ?   A . n 
A 1 596 LYS 596 596 ?   ?   ?   A . n 
A 1 597 GLU 597 597 ?   ?   ?   A . n 
A 1 598 ILE 598 598 ?   ?   ?   A . n 
A 1 599 MET 599 599 ?   ?   ?   A . n 
A 1 600 HIS 600 600 ?   ?   ?   A . n 
A 1 601 ARG 601 601 ?   ?   ?   A . n 
A 1 602 VAL 602 602 ?   ?   ?   A . n 
A 1 603 LYS 603 603 ?   ?   ?   A . n 
A 1 604 HIS 604 604 ?   ?   ?   A . n 
A 1 605 GLN 605 605 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DGT 1   1587 1587 DGT DGT A . 
C 2 DGT 1   1588 1588 DGT DGT A . 
D 3 ZN  1   1589 1589 ZN  ZN  A . 
E 4 MN  1   1590 1590 MN  MN  A . 
F 5 HOH 1   2001 2001 HOH HOH A . 
F 5 HOH 2   2002 2002 HOH HOH A . 
F 5 HOH 3   2003 2003 HOH HOH A . 
F 5 HOH 4   2004 2004 HOH HOH A . 
F 5 HOH 5   2005 2005 HOH HOH A . 
F 5 HOH 6   2006 2006 HOH HOH A . 
F 5 HOH 7   2007 2007 HOH HOH A . 
F 5 HOH 8   2008 2008 HOH HOH A . 
F 5 HOH 9   2009 2009 HOH HOH A . 
F 5 HOH 10  2010 2010 HOH HOH A . 
F 5 HOH 11  2011 2011 HOH HOH A . 
F 5 HOH 12  2012 2012 HOH HOH A . 
F 5 HOH 13  2013 2013 HOH HOH A . 
F 5 HOH 14  2014 2014 HOH HOH A . 
F 5 HOH 15  2015 2015 HOH HOH A . 
F 5 HOH 16  2016 2016 HOH HOH A . 
F 5 HOH 17  2017 2017 HOH HOH A . 
F 5 HOH 18  2018 2018 HOH HOH A . 
F 5 HOH 19  2019 2019 HOH HOH A . 
F 5 HOH 20  2020 2020 HOH HOH A . 
F 5 HOH 21  2021 2021 HOH HOH A . 
F 5 HOH 22  2022 2022 HOH HOH A . 
F 5 HOH 23  2023 2023 HOH HOH A . 
F 5 HOH 24  2024 2024 HOH HOH A . 
F 5 HOH 25  2025 2025 HOH HOH A . 
F 5 HOH 26  2026 2026 HOH HOH A . 
F 5 HOH 27  2027 2027 HOH HOH A . 
F 5 HOH 28  2028 2028 HOH HOH A . 
F 5 HOH 29  2029 2029 HOH HOH A . 
F 5 HOH 30  2030 2030 HOH HOH A . 
F 5 HOH 31  2031 2031 HOH HOH A . 
F 5 HOH 32  2032 2032 HOH HOH A . 
F 5 HOH 33  2033 2033 HOH HOH A . 
F 5 HOH 34  2034 2034 HOH HOH A . 
F 5 HOH 35  2035 2035 HOH HOH A . 
F 5 HOH 36  2036 2036 HOH HOH A . 
F 5 HOH 37  2037 2037 HOH HOH A . 
F 5 HOH 38  2038 2038 HOH HOH A . 
F 5 HOH 39  2039 2039 HOH HOH A . 
F 5 HOH 40  2040 2040 HOH HOH A . 
F 5 HOH 41  2041 2041 HOH HOH A . 
F 5 HOH 42  2042 2042 HOH HOH A . 
F 5 HOH 43  2043 2043 HOH HOH A . 
F 5 HOH 44  2044 2044 HOH HOH A . 
F 5 HOH 45  2045 2045 HOH HOH A . 
F 5 HOH 46  2046 2046 HOH HOH A . 
F 5 HOH 47  2047 2047 HOH HOH A . 
F 5 HOH 48  2048 2048 HOH HOH A . 
F 5 HOH 49  2049 2049 HOH HOH A . 
F 5 HOH 50  2050 2050 HOH HOH A . 
F 5 HOH 51  2051 2051 HOH HOH A . 
F 5 HOH 52  2052 2052 HOH HOH A . 
F 5 HOH 53  2053 2053 HOH HOH A . 
F 5 HOH 54  2054 2054 HOH HOH A . 
F 5 HOH 55  2055 2055 HOH HOH A . 
F 5 HOH 56  2056 2056 HOH HOH A . 
F 5 HOH 57  2057 2057 HOH HOH A . 
F 5 HOH 58  2058 2058 HOH HOH A . 
F 5 HOH 59  2059 2059 HOH HOH A . 
F 5 HOH 60  2060 2060 HOH HOH A . 
F 5 HOH 61  2061 2061 HOH HOH A . 
F 5 HOH 62  2062 2062 HOH HOH A . 
F 5 HOH 63  2063 2063 HOH HOH A . 
F 5 HOH 64  2064 2064 HOH HOH A . 
F 5 HOH 65  2065 2065 HOH HOH A . 
F 5 HOH 66  2066 2066 HOH HOH A . 
F 5 HOH 67  2067 2067 HOH HOH A . 
F 5 HOH 68  2068 2068 HOH HOH A . 
F 5 HOH 69  2069 2069 HOH HOH A . 
F 5 HOH 70  2070 2070 HOH HOH A . 
F 5 HOH 71  2071 2071 HOH HOH A . 
F 5 HOH 72  2072 2072 HOH HOH A . 
F 5 HOH 73  2073 2073 HOH HOH A . 
F 5 HOH 74  2074 2074 HOH HOH A . 
F 5 HOH 75  2075 2075 HOH HOH A . 
F 5 HOH 76  2076 2076 HOH HOH A . 
F 5 HOH 77  2077 2077 HOH HOH A . 
F 5 HOH 78  2078 2078 HOH HOH A . 
F 5 HOH 79  2079 2079 HOH HOH A . 
F 5 HOH 80  2080 2080 HOH HOH A . 
F 5 HOH 81  2081 2081 HOH HOH A . 
F 5 HOH 82  2082 2082 HOH HOH A . 
F 5 HOH 83  2083 2083 HOH HOH A . 
F 5 HOH 84  2084 2084 HOH HOH A . 
F 5 HOH 85  2085 2085 HOH HOH A . 
F 5 HOH 86  2086 2086 HOH HOH A . 
F 5 HOH 87  2087 2087 HOH HOH A . 
F 5 HOH 88  2088 2088 HOH HOH A . 
F 5 HOH 89  2089 2089 HOH HOH A . 
F 5 HOH 90  2090 2090 HOH HOH A . 
F 5 HOH 91  2091 2091 HOH HOH A . 
F 5 HOH 92  2092 2092 HOH HOH A . 
F 5 HOH 93  2093 2093 HOH HOH A . 
F 5 HOH 94  2094 2094 HOH HOH A . 
F 5 HOH 95  2095 2095 HOH HOH A . 
F 5 HOH 96  2096 2096 HOH HOH A . 
F 5 HOH 97  2097 2097 HOH HOH A . 
F 5 HOH 98  2098 2098 HOH HOH A . 
F 5 HOH 99  2099 2099 HOH HOH A . 
F 5 HOH 100 2100 2100 HOH HOH A . 
F 5 HOH 101 2101 2101 HOH HOH A . 
F 5 HOH 102 2102 2102 HOH HOH A . 
F 5 HOH 103 2103 2103 HOH HOH A . 
F 5 HOH 104 2104 2104 HOH HOH A . 
F 5 HOH 105 2105 2105 HOH HOH A . 
F 5 HOH 106 2106 2106 HOH HOH A . 
F 5 HOH 107 2107 2107 HOH HOH A . 
F 5 HOH 108 2108 2108 HOH HOH A . 
F 5 HOH 109 2109 2109 HOH HOH A . 
F 5 HOH 110 2110 2110 HOH HOH A . 
F 5 HOH 111 2111 2111 HOH HOH A . 
F 5 HOH 112 2112 2112 HOH HOH A . 
F 5 HOH 113 2113 2113 HOH HOH A . 
F 5 HOH 114 2114 2114 HOH HOH A . 
F 5 HOH 115 2115 2115 HOH HOH A . 
F 5 HOH 116 2116 2116 HOH HOH A . 
F 5 HOH 117 2117 2117 HOH HOH A . 
F 5 HOH 118 2118 2118 HOH HOH A . 
F 5 HOH 119 2119 2119 HOH HOH A . 
F 5 HOH 120 2120 2120 HOH HOH A . 
F 5 HOH 121 2121 2121 HOH HOH A . 
F 5 HOH 122 2122 2122 HOH HOH A . 
F 5 HOH 123 2123 2123 HOH HOH A . 
F 5 HOH 124 2124 2124 HOH HOH A . 
F 5 HOH 125 2125 2125 HOH HOH A . 
F 5 HOH 126 2126 2126 HOH HOH A . 
F 5 HOH 127 2127 2127 HOH HOH A . 
F 5 HOH 128 2128 2128 HOH HOH A . 
F 5 HOH 129 2129 2129 HOH HOH A . 
F 5 HOH 130 2130 2130 HOH HOH A . 
F 5 HOH 131 2131 2131 HOH HOH A . 
F 5 HOH 132 2132 2132 HOH HOH A . 
F 5 HOH 133 2133 2133 HOH HOH A . 
F 5 HOH 134 2134 2134 HOH HOH A . 
F 5 HOH 135 2135 2135 HOH HOH A . 
F 5 HOH 136 2136 2136 HOH HOH A . 
F 5 HOH 137 2137 2137 HOH HOH A . 
F 5 HOH 138 2138 2138 HOH HOH A . 
F 5 HOH 139 2139 2139 HOH HOH A . 
F 5 HOH 140 2140 2140 HOH HOH A . 
F 5 HOH 141 2141 2141 HOH HOH A . 
F 5 HOH 142 2142 2142 HOH HOH A . 
F 5 HOH 143 2143 2143 HOH HOH A . 
F 5 HOH 144 2144 2144 HOH HOH A . 
F 5 HOH 145 2145 2145 HOH HOH A . 
F 5 HOH 146 2146 2146 HOH HOH A . 
F 5 HOH 147 2147 2147 HOH HOH A . 
F 5 HOH 148 2148 2148 HOH HOH A . 
F 5 HOH 149 2149 2149 HOH HOH A . 
F 5 HOH 150 2150 2150 HOH HOH A . 
F 5 HOH 151 2151 2151 HOH HOH A . 
F 5 HOH 152 2152 2152 HOH HOH A . 
F 5 HOH 153 2153 2153 HOH HOH A . 
F 5 HOH 154 2154 2154 HOH HOH A . 
F 5 HOH 155 2155 2155 HOH HOH A . 
F 5 HOH 156 2156 2156 HOH HOH A . 
F 5 HOH 157 2157 2157 HOH HOH A . 
F 5 HOH 158 2158 2158 HOH HOH A . 
F 5 HOH 159 2159 2159 HOH HOH A . 
F 5 HOH 160 2160 2160 HOH HOH A . 
F 5 HOH 161 2161 2161 HOH HOH A . 
F 5 HOH 162 2162 2162 HOH HOH A . 
F 5 HOH 163 2163 2163 HOH HOH A . 
F 5 HOH 164 2164 2164 HOH HOH A . 
F 5 HOH 165 2165 2165 HOH HOH A . 
F 5 HOH 166 2166 2166 HOH HOH A . 
F 5 HOH 167 2167 2167 HOH HOH A . 
F 5 HOH 168 2168 2168 HOH HOH A . 
F 5 HOH 169 2169 2169 HOH HOH A . 
F 5 HOH 170 2170 2170 HOH HOH A . 
F 5 HOH 171 2171 2171 HOH HOH A . 
F 5 HOH 172 2172 2172 HOH HOH A . 
F 5 HOH 173 2173 2173 HOH HOH A . 
F 5 HOH 174 2174 2174 HOH HOH A . 
F 5 HOH 175 2175 2175 HOH HOH A . 
F 5 HOH 176 2176 2176 HOH HOH A . 
F 5 HOH 177 2177 2177 HOH HOH A . 
F 5 HOH 178 2178 2178 HOH HOH A . 
F 5 HOH 179 2179 2179 HOH HOH A . 
F 5 HOH 180 2180 2180 HOH HOH A . 
F 5 HOH 181 2181 2181 HOH HOH A . 
F 5 HOH 182 2182 2182 HOH HOH A . 
F 5 HOH 183 2183 2183 HOH HOH A . 
F 5 HOH 184 2184 2184 HOH HOH A . 
F 5 HOH 185 2185 2185 HOH HOH A . 
F 5 HOH 186 2186 2186 HOH HOH A . 
F 5 HOH 187 2187 2187 HOH HOH A . 
F 5 HOH 188 2188 2188 HOH HOH A . 
F 5 HOH 189 2189 2189 HOH HOH A . 
F 5 HOH 190 2190 2190 HOH HOH A . 
F 5 HOH 191 2191 2191 HOH HOH A . 
F 5 HOH 192 2192 2192 HOH HOH A . 
F 5 HOH 193 2193 2193 HOH HOH A . 
F 5 HOH 194 2194 2194 HOH HOH A . 
F 5 HOH 195 2195 2195 HOH HOH A . 
F 5 HOH 196 2196 2196 HOH HOH A . 
F 5 HOH 197 2197 2197 HOH HOH A . 
F 5 HOH 198 2198 2198 HOH HOH A . 
F 5 HOH 199 2199 2199 HOH HOH A . 
F 5 HOH 200 2200 2200 HOH HOH A . 
F 5 HOH 201 2201 2201 HOH HOH A . 
F 5 HOH 202 2202 2202 HOH HOH A . 
F 5 HOH 203 2203 2203 HOH HOH A . 
F 5 HOH 204 2204 2204 HOH HOH A . 
F 5 HOH 205 2205 2205 HOH HOH A . 
F 5 HOH 206 2206 2206 HOH HOH A . 
F 5 HOH 207 2207 2207 HOH HOH A . 
F 5 HOH 208 2208 2208 HOH HOH A . 
F 5 HOH 209 2209 2209 HOH HOH A . 
F 5 HOH 210 2210 2210 HOH HOH A . 
F 5 HOH 211 2211 2211 HOH HOH A . 
F 5 HOH 212 2212 2212 HOH HOH A . 
F 5 HOH 213 2213 2213 HOH HOH A . 
F 5 HOH 214 2214 2214 HOH HOH A . 
F 5 HOH 215 2215 2215 HOH HOH A . 
F 5 HOH 216 2216 2216 HOH HOH A . 
F 5 HOH 217 2217 2217 HOH HOH A . 
F 5 HOH 218 2218 2218 HOH HOH A . 
F 5 HOH 219 2219 2219 HOH HOH A . 
F 5 HOH 220 2220 2220 HOH HOH A . 
F 5 HOH 221 2221 2221 HOH HOH A . 
F 5 HOH 222 2222 2222 HOH HOH A . 
F 5 HOH 223 2223 2223 HOH HOH A . 
F 5 HOH 224 2224 2224 HOH HOH A . 
F 5 HOH 225 2225 2225 HOH HOH A . 
F 5 HOH 226 2226 2226 HOH HOH A . 
F 5 HOH 227 2227 2227 HOH HOH A . 
F 5 HOH 228 2228 2228 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 98.1630000000 -1.0000000000 
0.0000000000 0.0000000000 98.1630000000 0.0000000000 0.0000000000 -1.0000000000 123.0655000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2004 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O1G ? B DGT .   ? A DGT 1587 ? 1_555 MN ? E MN . ? A MN 1590 ? 1_555 O1A ? B DGT .   ? A DGT 1587 ? 1_555 90.8  ? 
2 O1G ? B DGT .   ? A DGT 1587 ? 1_555 MN ? E MN . ? A MN 1590 ? 1_555 O2B ? B DGT .   ? A DGT 1587 ? 1_555 92.3  ? 
3 O1A ? B DGT .   ? A DGT 1587 ? 1_555 MN ? E MN . ? A MN 1590 ? 1_555 O2B ? B DGT .   ? A DGT 1587 ? 1_555 109.5 ? 
4 SG  ? A CYS 564 ? A CYS 564  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 561 ? A CYS 561  ? 1_555 97.3  ? 
5 SG  ? A CYS 564 ? A CYS 564  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 546 ? A CYS 546  ? 1_555 117.4 ? 
6 SG  ? A CYS 561 ? A CYS 561  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 546 ? A CYS 546  ? 1_555 126.6 ? 
7 SG  ? A CYS 564 ? A CYS 564  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 543 ? A CYS 543  ? 1_555 99.7  ? 
8 SG  ? A CYS 561 ? A CYS 561  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 543 ? A CYS 543  ? 1_555 112.6 ? 
9 SG  ? A CYS 546 ? A CYS 546  ? 1_555 ZN ? D ZN . ? A ZN 1589 ? 1_555 SG  ? A CYS 543 ? A CYS 543  ? 1_555 100.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-27 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 1 4 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source   
2 5 'Structure model' citation        
3 5 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 5 'Structure model' '_citation.page_last'                  
3 5 'Structure model' '_citation.pdbx_database_id_PubMed'    
4 5 'Structure model' '_citation.title'                      
5 5 'Structure model' '_citation_author.name'                
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
CNS       phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             1HK8 
_pdbx_entry_details.compound_details     
;CATALYTIC ACTIVITY INVOLVES 2'-DEOXYRIBONUCLEOSIDE TRIPHOSPHATE
 + OXIDIZED THIOREDOXIN + H(2)O = RIBONUCLEOSIDE TRIPHOSPHATE +
 REDUCED THIOREDOXIN.

 ENGINEERED MUTATION GLY 580 ALA
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2133 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2136 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 218 ? ? CZ A ARG 218 ? ? NH2 A ARG 218 ? ? 117.29 120.30 -3.01 0.50 N 
2 1 CB A ASP 532 ? ? CG A ASP 532 ? ? OD2 A ASP 532 ? ? 124.27 118.30 5.97  0.90 N 
3 1 CB A ASP 568 ? ? CG A ASP 568 ? ? OD2 A ASP 568 ? ? 124.28 118.30 5.98  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 27  ? ? -177.98 -60.22  
2  1 PRO A 75  ? ? -77.16  47.32   
3  1 ASN A 78  ? ? -101.54 -95.78  
4  1 VAL A 242 ? ? -129.94 -60.84  
5  1 ASN A 243 ? ? -151.34 19.07   
6  1 ARG A 264 ? ? -142.66 11.88   
7  1 MET A 265 ? ? 69.41   -60.55  
8  1 ARG A 291 ? ? -161.48 38.32   
9  1 LEU A 306 ? ? -123.65 -67.69  
10 1 ALA A 367 ? ? -158.58 75.43   
11 1 VAL A 466 ? ? -119.51 -74.05  
12 1 SER A 475 ? ? 39.28   -113.57 
13 1 PRO A 511 ? ? -76.21  -169.92 
14 1 ASN A 516 ? ? -140.32 53.72   
15 1 ASP A 532 ? ? -93.21  -68.33  
16 1 CYS A 579 ? ? -126.61 -86.00  
17 1 ALA A 580 ? ? -125.44 -56.23  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2037 ? 6.97 . 
2 1 O ? A HOH 2039 ? 7.77 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A ILE 3   ? A ILE 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 A LYS 5   ? A LYS 5   
6  1 Y 1 A GLU 6   ? A GLU 6   
7  1 Y 1 A ILE 7   ? A ILE 7   
8  1 Y 1 A GLU 8   ? A GLU 8   
9  1 Y 1 A GLY 9   ? A GLY 9   
10 1 Y 1 A LEU 10  ? A LEU 10  
11 1 Y 1 A ILE 11  ? A ILE 11  
12 1 Y 1 A HIS 12  ? A HIS 12  
13 1 Y 1 A LYS 13  ? A LYS 13  
14 1 Y 1 A THR 14  ? A THR 14  
15 1 Y 1 A ASN 15  ? A ASN 15  
16 1 Y 1 A LYS 16  ? A LYS 16  
17 1 Y 1 A ASP 17  ? A ASP 17  
18 1 Y 1 A LEU 18  ? A LEU 18  
19 1 Y 1 A LEU 19  ? A LEU 19  
20 1 Y 1 A ASN 20  ? A ASN 20  
21 1 Y 1 A GLU 21  ? A GLU 21  
22 1 Y 1 A ASN 22  ? A ASN 22  
23 1 Y 1 A ALA 23  ? A ALA 23  
24 1 Y 1 A ASN 24  ? A ASN 24  
25 1 Y 1 A LYS 25  ? A LYS 25  
26 1 Y 1 A GLU 587 ? A GLU 587 
27 1 Y 1 A ARG 588 ? A ARG 588 
28 1 Y 1 A GLY 589 ? A GLY 589 
29 1 Y 1 A PHE 590 ? A PHE 590 
30 1 Y 1 A ASN 591 ? A ASN 591 
31 1 Y 1 A LEU 592 ? A LEU 592 
32 1 Y 1 A GLY 593 ? A GLY 593 
33 1 Y 1 A LYS 594 ? A LYS 594 
34 1 Y 1 A ASN 595 ? A ASN 595 
35 1 Y 1 A LYS 596 ? A LYS 596 
36 1 Y 1 A GLU 597 ? A GLU 597 
37 1 Y 1 A ILE 598 ? A ILE 598 
38 1 Y 1 A MET 599 ? A MET 599 
39 1 Y 1 A HIS 600 ? A HIS 600 
40 1 Y 1 A ARG 601 ? A ARG 601 
41 1 Y 1 A VAL 602 ? A VAL 602 
42 1 Y 1 A LYS 603 ? A LYS 603 
43 1 Y 1 A HIS 604 ? A HIS 604 
44 1 Y 1 A GLN 605 ? A GLN 605 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
3 'ZINC ION'                          ZN  
4 'MANGANESE (II) ION'                MN  
5 water                               HOH 
#