data_1HKC
# 
_entry.id   1HKC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HKC         
WWPDB D_1000173886 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HKC 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aleshin, A.E.'  1 
'Honzatko, R.B.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Regulation of hexokinase I: crystal structure of recombinant human brain hexokinase complexed with glucose and phosphate.' 
J.Mol.Biol.  282 345 357 1998 JMOBAK UK 0022-2836 0070 ? 9735292 10.1006/jmbi.1998.2017 
1       
;The Mechanism of Regulation of Hexokinase: New Insights from the Crystal Structure of Recombinant Human Brain Hexokinase Complexed with Glucose and Glucose-6-Phosphate
;
Structure    6   39  ?   1998 STRUE6 UK 0969-2126 2005 ? ?       ?                      
2       'Crystallization and Preliminary X-Ray Analysis of Human Brain Hexokinase' 'FEBS Lett.' 391 9   ?   1996 FEBLAL NE 
0014-5793 0165 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Aleshin, A.E.'   1  ? 
primary 'Zeng, C.'        2  ? 
primary 'Bartunik, H.D.'  3  ? 
primary 'Fromm, H.J.'     4  ? 
primary 'Honzatko, R.B.'  5  ? 
1       'Aleshin, A.E.'   6  ? 
1       'Zeng, C.'        7  ? 
1       'Bourenkov, G.P.' 8  ? 
1       'Bartunik, H.D.'  9  ? 
1       'Fromm, H.J.'     10 ? 
1       'Honzatko, R.B.'  11 ? 
2       'Aleshin, A.E.'   12 ? 
2       'Zeng, C.'        13 ? 
2       'Fromm, H.J.'     14 ? 
2       'Honzatko, R.B.'  15 ? 
# 
_cell.entry_id           1HKC 
_cell.length_a           175.090 
_cell.length_b           175.090 
_cell.length_c           99.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HKC 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'D-GLUCOSE 6-PHOSPHOTRANSFERASE' 102624.055 1   2.7.1.1 ? ? ? 
2 non-polymer man beta-D-glucopyranose             180.156    1   ?       ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                  94.971     2   ?       ? ? ? 
4 non-polymer syn 'POTASSIUM ION'                  39.098     2   ?       ? ? ? 
5 water       nat water                            18.015     150 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HEXOKINASE I, HEXOKINASE TYPE I, HUMAN BRAIN HEXOKINASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   ALA n 
1 4   ALA n 
1 5   GLN n 
1 6   LEU n 
1 7   LEU n 
1 8   ALA n 
1 9   TYR n 
1 10  TYR n 
1 11  PHE n 
1 12  THR n 
1 13  GLU n 
1 14  LEU n 
1 15  LYS n 
1 16  ASP n 
1 17  ASP n 
1 18  GLN n 
1 19  VAL n 
1 20  LYS n 
1 21  LYS n 
1 22  ILE n 
1 23  ASP n 
1 24  LYS n 
1 25  TYR n 
1 26  LEU n 
1 27  TYR n 
1 28  ALA n 
1 29  MET n 
1 30  ARG n 
1 31  LEU n 
1 32  SER n 
1 33  ASP n 
1 34  GLU n 
1 35  THR n 
1 36  LEU n 
1 37  ILE n 
1 38  ASP n 
1 39  ILE n 
1 40  MET n 
1 41  THR n 
1 42  ARG n 
1 43  PHE n 
1 44  ARG n 
1 45  LYS n 
1 46  GLU n 
1 47  MET n 
1 48  LYS n 
1 49  ASN n 
1 50  GLY n 
1 51  LEU n 
1 52  SER n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ASN n 
1 57  PRO n 
1 58  THR n 
1 59  ALA n 
1 60  THR n 
1 61  VAL n 
1 62  LYS n 
1 63  MET n 
1 64  LEU n 
1 65  PRO n 
1 66  THR n 
1 67  PHE n 
1 68  VAL n 
1 69  ARG n 
1 70  SER n 
1 71  ILE n 
1 72  PRO n 
1 73  ASP n 
1 74  GLY n 
1 75  SER n 
1 76  GLU n 
1 77  LYS n 
1 78  GLY n 
1 79  ASP n 
1 80  PHE n 
1 81  ILE n 
1 82  ALA n 
1 83  LEU n 
1 84  ASP n 
1 85  LEU n 
1 86  GLY n 
1 87  GLY n 
1 88  SER n 
1 89  SER n 
1 90  PHE n 
1 91  ARG n 
1 92  ILE n 
1 93  LEU n 
1 94  ARG n 
1 95  VAL n 
1 96  GLN n 
1 97  VAL n 
1 98  ASN n 
1 99  HIS n 
1 100 GLU n 
1 101 LYS n 
1 102 ASN n 
1 103 GLN n 
1 104 ASN n 
1 105 VAL n 
1 106 HIS n 
1 107 MET n 
1 108 GLU n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 TYR n 
1 113 ASP n 
1 114 THR n 
1 115 PRO n 
1 116 GLU n 
1 117 ASN n 
1 118 ILE n 
1 119 VAL n 
1 120 HIS n 
1 121 GLY n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 GLN n 
1 126 LEU n 
1 127 PHE n 
1 128 ASP n 
1 129 HIS n 
1 130 VAL n 
1 131 ALA n 
1 132 GLU n 
1 133 CYS n 
1 134 LEU n 
1 135 GLY n 
1 136 ASP n 
1 137 PHE n 
1 138 MET n 
1 139 GLU n 
1 140 LYS n 
1 141 ARG n 
1 142 LYS n 
1 143 ILE n 
1 144 LYS n 
1 145 ASP n 
1 146 LYS n 
1 147 LYS n 
1 148 LEU n 
1 149 PRO n 
1 150 VAL n 
1 151 GLY n 
1 152 PHE n 
1 153 THR n 
1 154 PHE n 
1 155 SER n 
1 156 PHE n 
1 157 PRO n 
1 158 CYS n 
1 159 GLN n 
1 160 GLN n 
1 161 SER n 
1 162 LYS n 
1 163 ILE n 
1 164 ASP n 
1 165 GLU n 
1 166 ALA n 
1 167 ILE n 
1 168 LEU n 
1 169 ILE n 
1 170 THR n 
1 171 TRP n 
1 172 THR n 
1 173 LYS n 
1 174 ARG n 
1 175 PHE n 
1 176 LYS n 
1 177 ALA n 
1 178 SER n 
1 179 GLY n 
1 180 VAL n 
1 181 GLU n 
1 182 GLY n 
1 183 ALA n 
1 184 ASP n 
1 185 VAL n 
1 186 VAL n 
1 187 LYS n 
1 188 LEU n 
1 189 LEU n 
1 190 ASN n 
1 191 LYS n 
1 192 ALA n 
1 193 ILE n 
1 194 LYS n 
1 195 LYS n 
1 196 ARG n 
1 197 GLY n 
1 198 ASP n 
1 199 TYR n 
1 200 ASP n 
1 201 ALA n 
1 202 ASN n 
1 203 ILE n 
1 204 VAL n 
1 205 ALA n 
1 206 VAL n 
1 207 VAL n 
1 208 ASN n 
1 209 ASP n 
1 210 THR n 
1 211 VAL n 
1 212 GLY n 
1 213 THR n 
1 214 MET n 
1 215 MET n 
1 216 THR n 
1 217 CYS n 
1 218 GLY n 
1 219 TYR n 
1 220 ASP n 
1 221 ASP n 
1 222 GLN n 
1 223 HIS n 
1 224 CYS n 
1 225 GLU n 
1 226 VAL n 
1 227 GLY n 
1 228 LEU n 
1 229 ILE n 
1 230 ILE n 
1 231 GLY n 
1 232 THR n 
1 233 GLY n 
1 234 THR n 
1 235 ASN n 
1 236 ALA n 
1 237 CYS n 
1 238 TYR n 
1 239 MET n 
1 240 GLU n 
1 241 GLU n 
1 242 LEU n 
1 243 ARG n 
1 244 HIS n 
1 245 ILE n 
1 246 ASP n 
1 247 LEU n 
1 248 VAL n 
1 249 GLU n 
1 250 GLY n 
1 251 ASP n 
1 252 GLU n 
1 253 GLY n 
1 254 ARG n 
1 255 MET n 
1 256 CYS n 
1 257 ILE n 
1 258 ASN n 
1 259 THR n 
1 260 GLU n 
1 261 TRP n 
1 262 GLY n 
1 263 ALA n 
1 264 PHE n 
1 265 GLY n 
1 266 ASP n 
1 267 ASP n 
1 268 GLY n 
1 269 SER n 
1 270 LEU n 
1 271 GLU n 
1 272 ASP n 
1 273 ILE n 
1 274 ARG n 
1 275 THR n 
1 276 GLU n 
1 277 PHE n 
1 278 ASP n 
1 279 ARG n 
1 280 GLU n 
1 281 ILE n 
1 282 ASP n 
1 283 ARG n 
1 284 GLY n 
1 285 SER n 
1 286 LEU n 
1 287 ASN n 
1 288 PRO n 
1 289 GLY n 
1 290 LYS n 
1 291 GLN n 
1 292 LEU n 
1 293 PHE n 
1 294 GLU n 
1 295 LYS n 
1 296 MET n 
1 297 VAL n 
1 298 SER n 
1 299 GLY n 
1 300 MET n 
1 301 TYR n 
1 302 LEU n 
1 303 GLY n 
1 304 GLU n 
1 305 LEU n 
1 306 VAL n 
1 307 ARG n 
1 308 LEU n 
1 309 ILE n 
1 310 LEU n 
1 311 VAL n 
1 312 LYS n 
1 313 MET n 
1 314 ALA n 
1 315 LYS n 
1 316 GLU n 
1 317 GLY n 
1 318 LEU n 
1 319 LEU n 
1 320 PHE n 
1 321 GLU n 
1 322 GLY n 
1 323 ARG n 
1 324 ILE n 
1 325 THR n 
1 326 PRO n 
1 327 GLU n 
1 328 LEU n 
1 329 LEU n 
1 330 THR n 
1 331 ARG n 
1 332 GLY n 
1 333 LYS n 
1 334 PHE n 
1 335 ASN n 
1 336 THR n 
1 337 SER n 
1 338 ASP n 
1 339 VAL n 
1 340 SER n 
1 341 ALA n 
1 342 ILE n 
1 343 GLU n 
1 344 LYS n 
1 345 ASN n 
1 346 LYS n 
1 347 GLU n 
1 348 GLY n 
1 349 LEU n 
1 350 HIS n 
1 351 ASN n 
1 352 ALA n 
1 353 LYS n 
1 354 GLU n 
1 355 ILE n 
1 356 LEU n 
1 357 THR n 
1 358 ARG n 
1 359 LEU n 
1 360 GLY n 
1 361 VAL n 
1 362 GLU n 
1 363 PRO n 
1 364 SER n 
1 365 ASP n 
1 366 ASP n 
1 367 ASP n 
1 368 CYS n 
1 369 VAL n 
1 370 SER n 
1 371 VAL n 
1 372 GLN n 
1 373 HIS n 
1 374 VAL n 
1 375 CYS n 
1 376 THR n 
1 377 ILE n 
1 378 VAL n 
1 379 SER n 
1 380 PHE n 
1 381 ARG n 
1 382 SER n 
1 383 ALA n 
1 384 ASN n 
1 385 LEU n 
1 386 VAL n 
1 387 ALA n 
1 388 ALA n 
1 389 THR n 
1 390 LEU n 
1 391 GLY n 
1 392 ALA n 
1 393 ILE n 
1 394 LEU n 
1 395 ASN n 
1 396 ARG n 
1 397 LEU n 
1 398 ARG n 
1 399 ASP n 
1 400 ASN n 
1 401 LYS n 
1 402 GLY n 
1 403 THR n 
1 404 PRO n 
1 405 ARG n 
1 406 LEU n 
1 407 ARG n 
1 408 THR n 
1 409 THR n 
1 410 VAL n 
1 411 GLY n 
1 412 VAL n 
1 413 ASP n 
1 414 GLY n 
1 415 SER n 
1 416 LEU n 
1 417 TYR n 
1 418 LYS n 
1 419 THR n 
1 420 HIS n 
1 421 PRO n 
1 422 GLN n 
1 423 TYR n 
1 424 SER n 
1 425 ARG n 
1 426 ARG n 
1 427 PHE n 
1 428 HIS n 
1 429 LYS n 
1 430 THR n 
1 431 LEU n 
1 432 ARG n 
1 433 ARG n 
1 434 LEU n 
1 435 VAL n 
1 436 PRO n 
1 437 ASP n 
1 438 SER n 
1 439 ASP n 
1 440 VAL n 
1 441 ARG n 
1 442 PHE n 
1 443 LEU n 
1 444 LEU n 
1 445 SER n 
1 446 GLU n 
1 447 SER n 
1 448 GLY n 
1 449 SER n 
1 450 GLY n 
1 451 LYS n 
1 452 GLY n 
1 453 ALA n 
1 454 ALA n 
1 455 MET n 
1 456 VAL n 
1 457 THR n 
1 458 ALA n 
1 459 VAL n 
1 460 ALA n 
1 461 TYR n 
1 462 ARG n 
1 463 LEU n 
1 464 ALA n 
1 465 GLU n 
1 466 GLN n 
1 467 HIS n 
1 468 ARG n 
1 469 GLN n 
1 470 ILE n 
1 471 GLU n 
1 472 GLU n 
1 473 THR n 
1 474 LEU n 
1 475 ALA n 
1 476 HIS n 
1 477 PHE n 
1 478 HIS n 
1 479 LEU n 
1 480 THR n 
1 481 LYS n 
1 482 ASP n 
1 483 MET n 
1 484 LEU n 
1 485 LEU n 
1 486 GLU n 
1 487 VAL n 
1 488 LYS n 
1 489 LYS n 
1 490 ARG n 
1 491 MET n 
1 492 ARG n 
1 493 ALA n 
1 494 GLU n 
1 495 MET n 
1 496 GLU n 
1 497 LEU n 
1 498 GLY n 
1 499 LEU n 
1 500 ARG n 
1 501 LYS n 
1 502 GLN n 
1 503 THR n 
1 504 HIS n 
1 505 ASN n 
1 506 ASN n 
1 507 ALA n 
1 508 VAL n 
1 509 VAL n 
1 510 LYS n 
1 511 MET n 
1 512 LEU n 
1 513 PRO n 
1 514 SER n 
1 515 PHE n 
1 516 VAL n 
1 517 ARG n 
1 518 ARG n 
1 519 THR n 
1 520 PRO n 
1 521 ASP n 
1 522 GLY n 
1 523 THR n 
1 524 GLU n 
1 525 ASN n 
1 526 GLY n 
1 527 ASP n 
1 528 PHE n 
1 529 LEU n 
1 530 ALA n 
1 531 LEU n 
1 532 ASP n 
1 533 LEU n 
1 534 GLY n 
1 535 GLY n 
1 536 THR n 
1 537 ASN n 
1 538 PHE n 
1 539 ARG n 
1 540 VAL n 
1 541 LEU n 
1 542 LEU n 
1 543 VAL n 
1 544 LYS n 
1 545 ILE n 
1 546 ARG n 
1 547 SER n 
1 548 GLY n 
1 549 LYS n 
1 550 LYS n 
1 551 ARG n 
1 552 THR n 
1 553 VAL n 
1 554 GLU n 
1 555 MET n 
1 556 HIS n 
1 557 ASN n 
1 558 LYS n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 ILE n 
1 563 PRO n 
1 564 ILE n 
1 565 GLU n 
1 566 ILE n 
1 567 MET n 
1 568 GLN n 
1 569 GLY n 
1 570 THR n 
1 571 GLY n 
1 572 GLU n 
1 573 GLU n 
1 574 LEU n 
1 575 PHE n 
1 576 ASP n 
1 577 HIS n 
1 578 ILE n 
1 579 VAL n 
1 580 SER n 
1 581 CYS n 
1 582 ILE n 
1 583 SER n 
1 584 ASP n 
1 585 PHE n 
1 586 LEU n 
1 587 ASP n 
1 588 TYR n 
1 589 MET n 
1 590 GLY n 
1 591 ILE n 
1 592 LYS n 
1 593 GLY n 
1 594 PRO n 
1 595 ARG n 
1 596 MET n 
1 597 PRO n 
1 598 LEU n 
1 599 GLY n 
1 600 PHE n 
1 601 THR n 
1 602 PHE n 
1 603 SER n 
1 604 PHE n 
1 605 PRO n 
1 606 CYS n 
1 607 GLN n 
1 608 GLN n 
1 609 THR n 
1 610 SER n 
1 611 LEU n 
1 612 ASP n 
1 613 ALA n 
1 614 GLY n 
1 615 ILE n 
1 616 LEU n 
1 617 ILE n 
1 618 THR n 
1 619 TRP n 
1 620 THR n 
1 621 LYS n 
1 622 GLY n 
1 623 PHE n 
1 624 LYS n 
1 625 ALA n 
1 626 THR n 
1 627 ASP n 
1 628 CYS n 
1 629 VAL n 
1 630 GLY n 
1 631 HIS n 
1 632 ASP n 
1 633 VAL n 
1 634 VAL n 
1 635 THR n 
1 636 LEU n 
1 637 LEU n 
1 638 ARG n 
1 639 ASP n 
1 640 ALA n 
1 641 ILE n 
1 642 LYS n 
1 643 ARG n 
1 644 ARG n 
1 645 GLU n 
1 646 GLU n 
1 647 PHE n 
1 648 ASP n 
1 649 LEU n 
1 650 ASP n 
1 651 VAL n 
1 652 VAL n 
1 653 ALA n 
1 654 VAL n 
1 655 VAL n 
1 656 ASN n 
1 657 ASP n 
1 658 THR n 
1 659 VAL n 
1 660 GLY n 
1 661 THR n 
1 662 MET n 
1 663 MET n 
1 664 THR n 
1 665 CYS n 
1 666 ALA n 
1 667 TYR n 
1 668 GLU n 
1 669 GLU n 
1 670 PRO n 
1 671 THR n 
1 672 CYS n 
1 673 GLU n 
1 674 VAL n 
1 675 GLY n 
1 676 LEU n 
1 677 ILE n 
1 678 VAL n 
1 679 GLY n 
1 680 THR n 
1 681 GLY n 
1 682 SER n 
1 683 ASN n 
1 684 ALA n 
1 685 CYS n 
1 686 TYR n 
1 687 MET n 
1 688 GLU n 
1 689 GLU n 
1 690 MET n 
1 691 LYS n 
1 692 ASN n 
1 693 VAL n 
1 694 GLU n 
1 695 MET n 
1 696 VAL n 
1 697 GLU n 
1 698 GLY n 
1 699 ASP n 
1 700 GLN n 
1 701 GLY n 
1 702 GLN n 
1 703 MET n 
1 704 CYS n 
1 705 ILE n 
1 706 ASN n 
1 707 MET n 
1 708 GLU n 
1 709 TRP n 
1 710 GLY n 
1 711 ALA n 
1 712 PHE n 
1 713 GLY n 
1 714 ASP n 
1 715 ASN n 
1 716 GLY n 
1 717 CYS n 
1 718 LEU n 
1 719 ASP n 
1 720 ASP n 
1 721 ILE n 
1 722 ARG n 
1 723 THR n 
1 724 HIS n 
1 725 TYR n 
1 726 ASP n 
1 727 ARG n 
1 728 LEU n 
1 729 VAL n 
1 730 ASN n 
1 731 GLU n 
1 732 TYR n 
1 733 SER n 
1 734 LEU n 
1 735 ASN n 
1 736 ALA n 
1 737 GLY n 
1 738 LYS n 
1 739 GLN n 
1 740 ARG n 
1 741 TYR n 
1 742 GLU n 
1 743 LYS n 
1 744 MET n 
1 745 ILE n 
1 746 SER n 
1 747 GLY n 
1 748 MET n 
1 749 TYR n 
1 750 LEU n 
1 751 GLY n 
1 752 GLU n 
1 753 ILE n 
1 754 VAL n 
1 755 ARG n 
1 756 ASN n 
1 757 ILE n 
1 758 LEU n 
1 759 ILE n 
1 760 ASP n 
1 761 PHE n 
1 762 THR n 
1 763 LYS n 
1 764 LYS n 
1 765 GLY n 
1 766 PHE n 
1 767 LEU n 
1 768 PHE n 
1 769 ARG n 
1 770 GLY n 
1 771 GLN n 
1 772 ILE n 
1 773 SER n 
1 774 GLU n 
1 775 THR n 
1 776 LEU n 
1 777 LYS n 
1 778 THR n 
1 779 ARG n 
1 780 GLY n 
1 781 ILE n 
1 782 PHE n 
1 783 GLU n 
1 784 THR n 
1 785 LYS n 
1 786 PHE n 
1 787 LEU n 
1 788 SER n 
1 789 GLN n 
1 790 ILE n 
1 791 GLU n 
1 792 SER n 
1 793 ASP n 
1 794 ARG n 
1 795 LEU n 
1 796 ALA n 
1 797 LEU n 
1 798 LEU n 
1 799 GLN n 
1 800 VAL n 
1 801 ARG n 
1 802 ALA n 
1 803 ILE n 
1 804 LEU n 
1 805 GLN n 
1 806 GLN n 
1 807 LEU n 
1 808 GLY n 
1 809 LEU n 
1 810 ASN n 
1 811 SER n 
1 812 THR n 
1 813 CYS n 
1 814 ASP n 
1 815 ASP n 
1 816 SER n 
1 817 ILE n 
1 818 LEU n 
1 819 VAL n 
1 820 LYS n 
1 821 THR n 
1 822 VAL n 
1 823 CYS n 
1 824 GLY n 
1 825 VAL n 
1 826 VAL n 
1 827 SER n 
1 828 ARG n 
1 829 ARG n 
1 830 ALA n 
1 831 ALA n 
1 832 GLN n 
1 833 LEU n 
1 834 CYS n 
1 835 GLY n 
1 836 ALA n 
1 837 GLY n 
1 838 MET n 
1 839 ALA n 
1 840 ALA n 
1 841 VAL n 
1 842 VAL n 
1 843 ASP n 
1 844 LYS n 
1 845 ILE n 
1 846 ARG n 
1 847 GLU n 
1 848 ASN n 
1 849 ARG n 
1 850 GLY n 
1 851 LEU n 
1 852 ASP n 
1 853 ARG n 
1 854 LEU n 
1 855 ASN n 
1 856 VAL n 
1 857 THR n 
1 858 VAL n 
1 859 GLY n 
1 860 VAL n 
1 861 ASP n 
1 862 GLY n 
1 863 THR n 
1 864 LEU n 
1 865 TYR n 
1 866 LYS n 
1 867 LEU n 
1 868 HIS n 
1 869 PRO n 
1 870 HIS n 
1 871 PHE n 
1 872 SER n 
1 873 ARG n 
1 874 ILE n 
1 875 MET n 
1 876 HIS n 
1 877 GLN n 
1 878 THR n 
1 879 VAL n 
1 880 LYS n 
1 881 GLU n 
1 882 LEU n 
1 883 SER n 
1 884 PRO n 
1 885 LYS n 
1 886 CYS n 
1 887 ASN n 
1 888 VAL n 
1 889 SER n 
1 890 PHE n 
1 891 LEU n 
1 892 LEU n 
1 893 SER n 
1 894 GLU n 
1 895 ASP n 
1 896 GLY n 
1 897 SER n 
1 898 GLY n 
1 899 LYS n 
1 900 GLY n 
1 901 ALA n 
1 902 ALA n 
1 903 LEU n 
1 904 ILE n 
1 905 THR n 
1 906 ALA n 
1 907 VAL n 
1 908 GLY n 
1 909 VAL n 
1 910 ARG n 
1 911 LEU n 
1 912 ARG n 
1 913 THR n 
1 914 GLU n 
1 915 ALA n 
1 916 SER n 
1 917 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                BRAIN 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    'CYTOPLASM SURFACE OF MITOCHONDRIA' 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-11A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HXK1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P19367 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETMKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HKC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 917 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P19367 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  917 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       917 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1HKC 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      776 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P19367 
_struct_ref_seq_dif.db_mon_id                    MET 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          776 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            776 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
K   non-polymer                  . 'POTASSIUM ION'      ? 'K 1'            39.098  
LEU 'L-peptide linking'          y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'          y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PO4 non-polymer                  . 'PHOSPHATE ION'      ? 'O4 P -3'        94.971  
PRO 'L-peptide linking'          y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HKC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.3 
_exptl_crystal.density_percent_sol   70. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;HEXOKINASE WAS CRYSTALLIZED BY HANGING DROP METHOD AT ROOM TEMPERATURE BY MIXING 20 MG/ ML OF PROTEIN IN 25 MM POTASSIUM PHOSPHATE WITH A PRECIPITANT SOLUTION CONTAINING 5% PEG 8000 AND 0.1 M NA CACODYLATE, PH 6.5. PROTEIN SAMPLES CONTAINED A TRACE AMOUNT OF GLUCOSE LEFT AFTER PURIFICATION.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-02 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1HKC 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             99 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   42845 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.0850000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.5 
_reflns.B_iso_Wilson_estimate        51.7 
_reflns.pdbx_redundancy              4.2 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   95.7 
_reflns_shell.Rmerge_I_obs           0.3300000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.9 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1HKC 
_refine.ls_number_reflns_obs                     40612 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.00100 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.1740000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1740000 
_refine.ls_R_factor_R_free                       0.2410000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  4128 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.0 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1HKB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1HKC 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.45 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7033 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             150 
_refine_hist.number_atoms_total               7207 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.1   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.57  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             3.49  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            5.39  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             5.90  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            9.25  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             5941 
_refine_ls_shell.R_factor_R_work                  0.2500000 
_refine_ls_shell.percent_reflns_obs               96.5 
_refine_ls_shell.R_factor_R_free                  0.3280000 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            10.2 
_refine_ls_shell.number_reflns_R_free             676 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PAR.HK            TOPH19.SOL   'X-RAY DIFFRACTION' 
3 ?                 TOP.HK       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1HKC 
_struct.title                     'RECOMBINANT HUMAN HEXOKINASE TYPE I COMPLEXED WITH GLUCOSE AND PHOSPHATE' 
_struct.pdbx_descriptor           'D-GLUCOSE 6-PHOSPHOTRANSFERASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HKC 
_struct_keywords.pdbx_keywords   PHOSPHOTRANSFERASE 
_struct_keywords.text            'PHOSPHOTRANSFERASE, GLYCOLYSIS, ALLOSTERIC ENZYME, GLUCOSE, PHOSPHATE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 17  ? TYR A 25  ? ASP A 17  TYR A 25  1 ? 9  
HELX_P HELX_P2  2  TYR A 27  ? MET A 29  ? TYR A 27  MET A 29  5 ? 3  
HELX_P HELX_P3  3  ASP A 33  ? LEU A 51  ? ASP A 33  LEU A 51  1 ? 19 
HELX_P HELX_P4  4  ASN A 56  ? THR A 58  ? ASN A 56  THR A 58  5 ? 3  
HELX_P HELX_P5  5  GLY A 123 ? GLU A 139 ? GLY A 123 GLU A 139 1 ? 17 
HELX_P HELX_P6  6  VAL A 185 ? ARG A 196 ? VAL A 185 ARG A 196 1 ? 12 
HELX_P HELX_P7  7  ASP A 209 ? GLY A 218 ? ASP A 209 GLY A 218 1 ? 10 
HELX_P HELX_P8  8  LEU A 242 ? HIS A 244 ? LEU A 242 HIS A 244 5 ? 3  
HELX_P HELX_P9  9  TRP A 261 ? ALA A 263 ? TRP A 261 ALA A 263 5 ? 3  
HELX_P HELX_P10 10 GLU A 276 ? ARG A 283 ? GLU A 276 ARG A 283 1 ? 8  
HELX_P HELX_P11 11 GLU A 294 ? MET A 296 ? GLU A 294 MET A 296 5 ? 3  
HELX_P HELX_P12 12 GLY A 299 ? LYS A 315 ? GLY A 299 LYS A 315 1 ? 17 
HELX_P HELX_P13 13 PHE A 320 ? GLY A 322 ? PHE A 320 GLY A 322 5 ? 3  
HELX_P HELX_P14 14 THR A 336 ? ILE A 342 ? THR A 336 ILE A 342 1 ? 7  
HELX_P HELX_P15 15 GLY A 348 ? LEU A 359 ? GLY A 348 LEU A 359 1 ? 12 
HELX_P HELX_P16 16 ASP A 365 ? ASN A 400 ? ASP A 365 ASN A 400 1 ? 36 
HELX_P HELX_P17 17 SER A 415 ? THR A 419 ? SER A 415 THR A 419 1 ? 5  
HELX_P HELX_P18 18 TYR A 423 ? LEU A 434 ? TYR A 423 LEU A 434 1 ? 12 
HELX_P HELX_P19 19 GLY A 450 ? PHE A 477 ? GLY A 450 PHE A 477 1 ? 28 
HELX_P HELX_P20 20 LYS A 481 ? LEU A 499 ? LYS A 481 LEU A 499 1 ? 19 
HELX_P HELX_P21 21 HIS A 504 ? ASN A 506 ? HIS A 504 ASN A 506 5 ? 3  
HELX_P HELX_P22 22 ILE A 564 ? MET A 567 ? ILE A 564 MET A 567 1 ? 4  
HELX_P HELX_P23 23 LEU A 574 ? TYR A 588 ? LEU A 574 TYR A 588 1 ? 15 
HELX_P HELX_P24 24 VAL A 633 ? ARG A 644 ? VAL A 633 ARG A 644 1 ? 12 
HELX_P HELX_P25 25 ASP A 657 ? ALA A 666 ? ASP A 657 ALA A 666 1 ? 10 
HELX_P HELX_P26 26 MET A 690 ? ASN A 692 ? MET A 690 ASN A 692 5 ? 3  
HELX_P HELX_P27 27 TRP A 709 ? ALA A 711 ? TRP A 709 ALA A 711 5 ? 3  
HELX_P HELX_P28 28 HIS A 724 ? GLU A 731 ? HIS A 724 GLU A 731 1 ? 8  
HELX_P HELX_P29 29 LEU A 750 ? LYS A 763 ? LEU A 750 LYS A 763 1 ? 14 
HELX_P HELX_P30 30 PHE A 768 ? GLY A 770 ? PHE A 768 GLY A 770 5 ? 3  
HELX_P HELX_P31 31 THR A 784 ? ILE A 790 ? THR A 784 ILE A 790 1 ? 7  
HELX_P HELX_P32 32 LEU A 797 ? LEU A 807 ? LEU A 797 LEU A 807 1 ? 11 
HELX_P HELX_P33 33 CYS A 813 ? ARG A 849 ? CYS A 813 ARG A 849 1 ? 37 
HELX_P HELX_P34 34 THR A 863 ? LEU A 867 ? THR A 863 LEU A 867 1 ? 5  
HELX_P HELX_P35 35 PHE A 871 ? LEU A 882 ? PHE A 871 LEU A 882 1 ? 12 
HELX_P HELX_P36 36 LYS A 899 ? ARG A 912 ? LYS A 899 ARG A 912 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A LEU 242 O   ? ? ? 1_555 E K   . K ? ? A LEU 242 A K   921  1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc2  metalc ? ? A ILE 245 O   ? ? ? 1_555 E K   . K ? ? A ILE 245 A K   921  1_555 ? ? ? ? ? ? ? 3.209 ? ? 
metalc3  metalc ? ? A VAL 248 O   ? ? ? 1_555 E K   . K ? ? A VAL 248 A K   921  1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc4  metalc ? ? A GLY 250 O   ? ? ? 1_555 E K   . K ? ? A GLY 250 A K   921  1_555 ? ? ? ? ? ? ? 3.187 ? ? 
metalc5  metalc ? ? A MET 690 O   ? ? ? 1_555 F K   . K ? ? A MET 690 A K   922  1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc6  metalc ? ? A VAL 693 O   ? ? ? 1_555 F K   . K ? ? A VAL 693 A K   922  1_555 ? ? ? ? ? ? ? 3.118 ? ? 
metalc7  metalc ? ? A VAL 696 O   ? ? ? 1_555 F K   . K ? ? A VAL 696 A K   922  1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc8  metalc ? ? A GLY 698 O   ? ? ? 1_555 F K   . K ? ? A GLY 698 A K   922  1_555 ? ? ? ? ? ? ? 3.220 ? ? 
metalc9  metalc ? ? A ASP 699 OD1 ? ? ? 1_555 F K   . K ? ? A ASP 699 A K   922  1_555 ? ? ? ? ? ? ? 3.502 ? ? 
metalc10 metalc ? ? E K   .   K   ? ? ? 1_555 G HOH . O ? ? A K   921 A HOH 1058 1_555 ? ? ? ? ? ? ? 3.269 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 202 ? VAL A 207 ? ASN A 202 VAL A 207 
A 2 PRO A 149 ? PHE A 154 ? PRO A 149 PHE A 154 
A 3 GLY A 78  ? LEU A 85  ? GLY A 78  LEU A 85  
A 4 PHE A 90  ? VAL A 97  ? PHE A 90  VAL A 97  
A 5 HIS A 106 ? TYR A 112 ? HIS A 106 TYR A 112 
B 1 ARG A 254 ? ASN A 258 ? ARG A 254 ASN A 258 
B 2 THR A 234 ? GLU A 241 ? THR A 234 GLU A 241 
B 3 CYS A 224 ? ILE A 230 ? CYS A 224 ILE A 230 
B 4 LEU A 406 ? ASP A 413 ? LEU A 406 ASP A 413 
B 5 SER A 438 ? LEU A 444 ? SER A 438 LEU A 444 
C 1 LEU A 649 ? VAL A 655 ? LEU A 649 VAL A 655 
C 2 MET A 596 ? PHE A 602 ? MET A 596 PHE A 602 
C 3 GLY A 526 ? LEU A 533 ? GLY A 526 LEU A 533 
C 4 ASN A 537 ? ARG A 546 ? ASN A 537 ARG A 546 
C 5 THR A 552 ? ALA A 561 ? THR A 552 ALA A 561 
D 1 GLN A 702 ? ASN A 706 ? GLN A 702 ASN A 706 
D 2 SER A 682 ? GLU A 689 ? SER A 682 GLU A 689 
D 3 CYS A 672 ? VAL A 678 ? CYS A 672 VAL A 678 
D 4 LEU A 854 ? ASP A 861 ? LEU A 854 ASP A 861 
D 5 CYS A 886 ? LEU A 892 ? CYS A 886 LEU A 892 
E 1 PRO A 605 ? GLN A 608 ? PRO A 605 GLN A 608 
E 2 GLY A 614 ? THR A 618 ? GLY A 614 THR A 618 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASN A 202 ? O ASN A 202 N VAL A 150 ? N VAL A 150 
A 2 3 O PRO A 149 ? O PRO A 149 N ILE A 81  ? N ILE A 81  
A 3 4 O GLY A 78  ? O GLY A 78  N VAL A 97  ? N VAL A 97  
A 4 5 O PHE A 90  ? O PHE A 90  N TYR A 112 ? N TYR A 112 
B 1 2 O MET A 255 ? O MET A 255 N GLU A 240 ? N GLU A 240 
B 2 3 O ASN A 235 ? O ASN A 235 N ILE A 229 ? N ILE A 229 
B 3 4 O GLU A 225 ? O GLU A 225 N THR A 409 ? N THR A 409 
B 4 5 O LEU A 406 ? O LEU A 406 N ASP A 439 ? N ASP A 439 
C 1 2 O ASP A 650 ? O ASP A 650 N MET A 596 ? N MET A 596 
C 2 3 O PRO A 597 ? O PRO A 597 N LEU A 529 ? N LEU A 529 
C 3 4 O GLY A 526 ? O GLY A 526 N ILE A 545 ? N ILE A 545 
C 4 5 O PHE A 538 ? O PHE A 538 N TYR A 560 ? N TYR A 560 
D 1 2 O MET A 703 ? O MET A 703 N GLU A 688 ? N GLU A 688 
D 2 3 O ASN A 683 ? O ASN A 683 N ILE A 677 ? N ILE A 677 
D 3 4 O GLU A 673 ? O GLU A 673 N THR A 857 ? N THR A 857 
D 4 5 O LEU A 854 ? O LEU A 854 N ASN A 887 ? N ASN A 887 
E 1 2 O PRO A 605 ? O PRO A 605 N THR A 618 ? N THR A 618 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
GLN Unknown ? ? ? ? 7 'GLUCOSE BINDING SITE IN N-TERMINAL DOMAIN.'   
PIN Unknown ? ? ? ? 3 'PHOSPHATE BINDING SITE IN N-TERMINAL DOMAIN.' 
PIC Unknown ? ? ? ? 2 'PHOSPHATE BINDING SITE IN C-TERMINAL DOMAIN.' 
MEN Unknown ? ? ? ? 4 'METAL ION BINDING SITE IN N-TERMINAL DOMAIN.' 
MEC Unknown ? ? ? ? 4 'METAL ION BINDING SITE IN C-TERMINAL DOMAIN.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  GLN 7 THR A 172 ? THR A 172 . ? 1_555 ? 
2  GLN 7 LYS A 173 ? LYS A 173 . ? 1_555 ? 
3  GLN 7 ASP A 209 ? ASP A 209 . ? 1_555 ? 
4  GLN 7 ASN A 235 ? ASN A 235 . ? 1_555 ? 
5  GLN 7 GLU A 260 ? GLU A 260 . ? 1_555 ? 
6  GLN 7 GLN A 291 ? GLN A 291 . ? 1_555 ? 
7  GLN 7 GLU A 294 ? GLU A 294 . ? 1_555 ? 
8  PIN 3 SER A 88  ? SER A 88  . ? 1_555 ? 
9  PIN 3 THR A 232 ? THR A 232 . ? 1_555 ? 
10 PIN 3 SER A 415 ? SER A 415 . ? 1_555 ? 
11 PIC 2 THR A 680 ? THR A 680 . ? 1_555 ? 
12 PIC 2 THR A 863 ? THR A 863 . ? 1_555 ? 
13 MEN 4 LEU A 242 ? LEU A 242 . ? 1_555 ? 
14 MEN 4 ILE A 245 ? ILE A 245 . ? 1_555 ? 
15 MEN 4 VAL A 248 ? VAL A 248 . ? 1_555 ? 
16 MEN 4 GLY A 250 ? GLY A 250 . ? 1_555 ? 
17 MEC 4 MET A 690 ? MET A 690 . ? 1_555 ? 
18 MEC 4 VAL A 693 ? VAL A 693 . ? 1_555 ? 
19 MEC 4 VAL A 696 ? VAL A 696 . ? 1_555 ? 
20 MEC 4 GLY A 698 ? GLY A 698 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HKC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HKC 
_atom_sites.fract_transf_matrix[1][1]   0.005711 
_atom_sites.fract_transf_matrix[1][2]   0.003297 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006595 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010053 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 16  ? 15.598  104.680 -16.651 1.00 93.73  ? 16   ASP A N   1 
ATOM   2    C CA  . ASP A 1 16  ? 16.036  106.074 -16.350 1.00 93.22  ? 16   ASP A CA  1 
ATOM   3    C C   . ASP A 1 16  ? 15.668  106.998 -17.497 1.00 91.15  ? 16   ASP A C   1 
ATOM   4    O O   . ASP A 1 16  ? 15.027  108.030 -17.296 1.00 91.55  ? 16   ASP A O   1 
ATOM   5    C CB  . ASP A 1 16  ? 17.547  106.122 -16.125 1.00 96.38  ? 16   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 16  ? 18.037  107.512 -15.761 1.00 100.00 ? 16   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 16  ? 18.056  108.393 -16.650 1.00 100.00 ? 16   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 16  ? 18.401  107.726 -14.584 1.00 100.00 ? 16   ASP A OD2 1 
ATOM   9    N N   . ASP A 1 17  ? 16.088  106.627 -18.701 1.00 87.86  ? 17   ASP A N   1 
ATOM   10   C CA  . ASP A 1 17  ? 15.788  107.418 -19.885 1.00 85.95  ? 17   ASP A CA  1 
ATOM   11   C C   . ASP A 1 17  ? 14.331  107.861 -19.807 1.00 82.69  ? 17   ASP A C   1 
ATOM   12   O O   . ASP A 1 17  ? 14.014  109.033 -20.018 1.00 85.11  ? 17   ASP A O   1 
ATOM   13   C CB  . ASP A 1 17  ? 16.020  106.581 -21.152 1.00 88.48  ? 17   ASP A CB  1 
ATOM   14   C CG  . ASP A 1 17  ? 15.517  107.270 -22.416 1.00 88.60  ? 17   ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 17  ? 16.119  108.286 -22.827 1.00 88.00  ? 17   ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 17  ? 14.520  106.792 -23.001 1.00 88.69  ? 17   ASP A OD2 1 
ATOM   17   N N   . GLN A 1 18  ? 13.450  106.923 -19.477 1.00 76.53  ? 18   GLN A N   1 
ATOM   18   C CA  . GLN A 1 18  ? 12.032  107.225 -19.378 1.00 71.88  ? 18   GLN A CA  1 
ATOM   19   C C   . GLN A 1 18  ? 11.780  108.314 -18.345 1.00 64.70  ? 18   GLN A C   1 
ATOM   20   O O   . GLN A 1 18  ? 11.149  109.328 -18.640 1.00 63.61  ? 18   GLN A O   1 
ATOM   21   C CB  . GLN A 1 18  ? 11.244  105.961 -19.017 1.00 76.19  ? 18   GLN A CB  1 
ATOM   22   C CG  . GLN A 1 18  ? 10.831  105.113 -20.224 1.00 87.52  ? 18   GLN A CG  1 
ATOM   23   C CD  . GLN A 1 18  ? 10.154  105.922 -21.336 1.00 93.35  ? 18   GLN A CD  1 
ATOM   24   O OE1 . GLN A 1 18  ? 10.736  106.857 -21.889 1.00 96.93  ? 18   GLN A OE1 1 
ATOM   25   N NE2 . GLN A 1 18  ? 8.919   105.554 -21.670 1.00 96.02  ? 18   GLN A NE2 1 
ATOM   26   N N   . VAL A 1 19  ? 12.285  108.104 -17.136 1.00 55.61  ? 19   VAL A N   1 
ATOM   27   C CA  . VAL A 1 19  ? 12.103  109.067 -16.063 1.00 45.86  ? 19   VAL A CA  1 
ATOM   28   C C   . VAL A 1 19  ? 12.579  110.440 -16.495 1.00 43.91  ? 19   VAL A C   1 
ATOM   29   O O   . VAL A 1 19  ? 11.921  111.446 -16.237 1.00 44.54  ? 19   VAL A O   1 
ATOM   30   C CB  . VAL A 1 19  ? 12.872  108.637 -14.799 1.00 43.02  ? 19   VAL A CB  1 
ATOM   31   C CG1 . VAL A 1 19  ? 13.089  109.825 -13.884 1.00 43.29  ? 19   VAL A CG1 1 
ATOM   32   C CG2 . VAL A 1 19  ? 12.102  107.550 -14.077 1.00 35.36  ? 19   VAL A CG2 1 
ATOM   33   N N   . LYS A 1 20  ? 13.724  110.479 -17.162 1.00 44.93  ? 20   LYS A N   1 
ATOM   34   C CA  . LYS A 1 20  ? 14.282  111.738 -17.626 1.00 49.95  ? 20   LYS A CA  1 
ATOM   35   C C   . LYS A 1 20  ? 13.382  112.394 -18.672 1.00 49.67  ? 20   LYS A C   1 
ATOM   36   O O   . LYS A 1 20  ? 13.293  113.620 -18.745 1.00 49.27  ? 20   LYS A O   1 
ATOM   37   C CB  . LYS A 1 20  ? 15.678  111.508 -18.208 1.00 57.08  ? 20   LYS A CB  1 
ATOM   38   C CG  . LYS A 1 20  ? 16.517  112.772 -18.354 1.00 73.20  ? 20   LYS A CG  1 
ATOM   39   C CD  . LYS A 1 20  ? 16.504  113.617 -17.081 1.00 85.15  ? 20   LYS A CD  1 
ATOM   40   C CE  . LYS A 1 20  ? 16.707  115.100 -17.395 1.00 90.81  ? 20   LYS A CE  1 
ATOM   41   N NZ  . LYS A 1 20  ? 16.039  115.996 -16.405 1.00 95.85  ? 20   LYS A NZ  1 
ATOM   42   N N   . LYS A 1 21  ? 12.708  111.575 -19.474 1.00 47.95  ? 21   LYS A N   1 
ATOM   43   C CA  . LYS A 1 21  ? 11.823  112.088 -20.513 1.00 48.91  ? 21   LYS A CA  1 
ATOM   44   C C   . LYS A 1 21  ? 10.564  112.713 -19.926 1.00 47.92  ? 21   LYS A C   1 
ATOM   45   O O   . LYS A 1 21  ? 9.932   113.563 -20.555 1.00 49.02  ? 21   LYS A O   1 
ATOM   46   C CB  . LYS A 1 21  ? 11.444  110.967 -21.479 1.00 56.86  ? 21   LYS A CB  1 
ATOM   47   C CG  . LYS A 1 21  ? 12.599  110.516 -22.357 1.00 69.04  ? 21   LYS A CG  1 
ATOM   48   C CD  . LYS A 1 21  ? 12.127  109.598 -23.472 1.00 80.03  ? 21   LYS A CD  1 
ATOM   49   C CE  . LYS A 1 21  ? 13.068  109.655 -24.670 1.00 88.68  ? 21   LYS A CE  1 
ATOM   50   N NZ  . LYS A 1 21  ? 13.031  110.983 -25.350 1.00 92.78  ? 21   LYS A NZ  1 
ATOM   51   N N   . ILE A 1 22  ? 10.199  112.284 -18.721 1.00 43.08  ? 22   ILE A N   1 
ATOM   52   C CA  . ILE A 1 22  ? 9.021   112.819 -18.043 1.00 36.18  ? 22   ILE A CA  1 
ATOM   53   C C   . ILE A 1 22  ? 9.389   114.112 -17.317 1.00 33.86  ? 22   ILE A C   1 
ATOM   54   O O   . ILE A 1 22  ? 8.639   115.089 -17.338 1.00 31.78  ? 22   ILE A O   1 
ATOM   55   C CB  . ILE A 1 22  ? 8.465   111.825 -17.008 1.00 33.25  ? 22   ILE A CB  1 
ATOM   56   C CG1 . ILE A 1 22  ? 8.141   110.490 -17.682 1.00 29.10  ? 22   ILE A CG1 1 
ATOM   57   C CG2 . ILE A 1 22  ? 7.233   112.415 -16.340 1.00 33.97  ? 22   ILE A CG2 1 
ATOM   58   C CD1 . ILE A 1 22  ? 6.880   110.508 -18.510 1.00 24.13  ? 22   ILE A CD1 1 
ATOM   59   N N   . ASP A 1 23  ? 10.552  114.107 -16.674 1.00 32.81  ? 23   ASP A N   1 
ATOM   60   C CA  . ASP A 1 23  ? 11.031  115.273 -15.943 1.00 32.18  ? 23   ASP A CA  1 
ATOM   61   C C   . ASP A 1 23  ? 11.017  116.534 -16.805 1.00 33.40  ? 23   ASP A C   1 
ATOM   62   O O   . ASP A 1 23  ? 10.640  117.606 -16.341 1.00 36.19  ? 23   ASP A O   1 
ATOM   63   C CB  . ASP A 1 23  ? 12.446  115.013 -15.419 1.00 28.87  ? 23   ASP A CB  1 
ATOM   64   C CG  . ASP A 1 23  ? 12.446  114.239 -14.116 1.00 32.21  ? 23   ASP A CG  1 
ATOM   65   O OD1 . ASP A 1 23  ? 11.353  114.036 -13.548 1.00 31.33  ? 23   ASP A OD1 1 
ATOM   66   O OD2 . ASP A 1 23  ? 13.533  113.832 -13.656 1.00 32.72  ? 23   ASP A OD2 1 
ATOM   67   N N   . LYS A 1 24  ? 11.425  116.404 -18.061 1.00 34.73  ? 24   LYS A N   1 
ATOM   68   C CA  . LYS A 1 24  ? 11.454  117.544 -18.967 1.00 34.06  ? 24   LYS A CA  1 
ATOM   69   C C   . LYS A 1 24  ? 10.050  117.890 -19.440 1.00 27.91  ? 24   LYS A C   1 
ATOM   70   O O   . LYS A 1 24  ? 9.706   119.058 -19.587 1.00 27.33  ? 24   LYS A O   1 
ATOM   71   C CB  . LYS A 1 24  ? 12.349  117.234 -20.169 1.00 42.96  ? 24   LYS A CB  1 
ATOM   72   C CG  . LYS A 1 24  ? 13.622  116.474 -19.808 1.00 56.29  ? 24   LYS A CG  1 
ATOM   73   C CD  . LYS A 1 24  ? 14.537  116.301 -21.018 1.00 67.11  ? 24   LYS A CD  1 
ATOM   74   C CE  . LYS A 1 24  ? 15.794  115.506 -20.666 1.00 69.84  ? 24   LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 24  ? 16.904  116.378 -20.178 1.00 71.40  ? 24   LYS A NZ  1 
ATOM   76   N N   . TYR A 1 25  ? 9.244   116.862 -19.678 1.00 24.94  ? 25   TYR A N   1 
ATOM   77   C CA  . TYR A 1 25  ? 7.872   117.044 -20.136 1.00 24.45  ? 25   TYR A CA  1 
ATOM   78   C C   . TYR A 1 25  ? 7.074   117.769 -19.061 1.00 23.94  ? 25   TYR A C   1 
ATOM   79   O O   . TYR A 1 25  ? 6.273   118.650 -19.354 1.00 29.27  ? 25   TYR A O   1 
ATOM   80   C CB  . TYR A 1 25  ? 7.232   115.680 -20.428 1.00 25.84  ? 25   TYR A CB  1 
ATOM   81   C CG  . TYR A 1 25  ? 5.893   115.741 -21.137 1.00 28.67  ? 25   TYR A CG  1 
ATOM   82   C CD1 . TYR A 1 25  ? 5.819   115.806 -22.525 1.00 33.91  ? 25   TYR A CD1 1 
ATOM   83   C CD2 . TYR A 1 25  ? 4.702   115.707 -20.423 1.00 32.19  ? 25   TYR A CD2 1 
ATOM   84   C CE1 . TYR A 1 25  ? 4.590   115.834 -23.184 1.00 34.15  ? 25   TYR A CE1 1 
ATOM   85   C CE2 . TYR A 1 25  ? 3.467   115.733 -21.073 1.00 34.75  ? 25   TYR A CE2 1 
ATOM   86   C CZ  . TYR A 1 25  ? 3.419   115.798 -22.453 1.00 35.04  ? 25   TYR A CZ  1 
ATOM   87   O OH  . TYR A 1 25  ? 2.206   115.848 -23.102 1.00 33.21  ? 25   TYR A OH  1 
ATOM   88   N N   . LEU A 1 26  ? 7.304   117.396 -17.809 1.00 19.13  ? 26   LEU A N   1 
ATOM   89   C CA  . LEU A 1 26  ? 6.596   118.010 -16.702 1.00 16.63  ? 26   LEU A CA  1 
ATOM   90   C C   . LEU A 1 26  ? 7.493   118.956 -15.918 1.00 19.17  ? 26   LEU A C   1 
ATOM   91   O O   . LEU A 1 26  ? 7.299   119.150 -14.718 1.00 22.47  ? 26   LEU A O   1 
ATOM   92   C CB  . LEU A 1 26  ? 6.066   116.920 -15.778 1.00 10.59  ? 26   LEU A CB  1 
ATOM   93   C CG  . LEU A 1 26  ? 5.057   116.001 -16.459 1.00 9.34   ? 26   LEU A CG  1 
ATOM   94   C CD1 . LEU A 1 26  ? 4.516   115.007 -15.460 1.00 11.39  ? 26   LEU A CD1 1 
ATOM   95   C CD2 . LEU A 1 26  ? 3.929   116.832 -17.045 1.00 14.02  ? 26   LEU A CD2 1 
ATOM   96   N N   . TYR A 1 27  ? 8.462   119.557 -16.597 1.00 19.45  ? 27   TYR A N   1 
ATOM   97   C CA  . TYR A 1 27  ? 9.391   120.451 -15.924 1.00 25.34  ? 27   TYR A CA  1 
ATOM   98   C C   . TYR A 1 27  ? 8.678   121.515 -15.098 1.00 25.40  ? 27   TYR A C   1 
ATOM   99   O O   . TYR A 1 27  ? 9.126   121.863 -14.005 1.00 27.32  ? 27   TYR A O   1 
ATOM   100  C CB  . TYR A 1 27  ? 10.333  121.116 -16.939 1.00 32.21  ? 27   TYR A CB  1 
ATOM   101  C CG  . TYR A 1 27  ? 9.788   122.393 -17.543 1.00 48.05  ? 27   TYR A CG  1 
ATOM   102  C CD1 . TYR A 1 27  ? 8.988   122.360 -18.691 1.00 54.01  ? 27   TYR A CD1 1 
ATOM   103  C CD2 . TYR A 1 27  ? 10.041  123.635 -16.951 1.00 50.12  ? 27   TYR A CD2 1 
ATOM   104  C CE1 . TYR A 1 27  ? 8.449   123.530 -19.232 1.00 56.29  ? 27   TYR A CE1 1 
ATOM   105  C CE2 . TYR A 1 27  ? 9.506   124.811 -17.484 1.00 53.71  ? 27   TYR A CE2 1 
ATOM   106  C CZ  . TYR A 1 27  ? 8.710   124.749 -18.622 1.00 56.22  ? 27   TYR A CZ  1 
ATOM   107  O OH  . TYR A 1 27  ? 8.165   125.901 -19.142 1.00 62.29  ? 27   TYR A OH  1 
ATOM   108  N N   . ALA A 1 28  ? 7.557   122.013 -15.607 1.00 20.11  ? 28   ALA A N   1 
ATOM   109  C CA  . ALA A 1 28  ? 6.815   123.063 -14.925 1.00 17.80  ? 28   ALA A CA  1 
ATOM   110  C C   . ALA A 1 28  ? 6.169   122.642 -13.617 1.00 21.29  ? 28   ALA A C   1 
ATOM   111  O O   . ALA A 1 28  ? 5.658   123.485 -12.877 1.00 23.27  ? 28   ALA A O   1 
ATOM   112  C CB  . ALA A 1 28  ? 5.763   123.620 -15.850 1.00 25.36  ? 28   ALA A CB  1 
ATOM   113  N N   . MET A 1 29  ? 6.163   121.345 -13.337 1.00 17.51  ? 29   MET A N   1 
ATOM   114  C CA  . MET A 1 29  ? 5.574   120.855 -12.097 1.00 20.77  ? 29   MET A CA  1 
ATOM   115  C C   . MET A 1 29  ? 6.662   120.576 -11.057 1.00 22.62  ? 29   MET A C   1 
ATOM   116  O O   . MET A 1 29  ? 6.388   120.120 -9.940  1.00 26.00  ? 29   MET A O   1 
ATOM   117  C CB  . MET A 1 29  ? 4.757   119.595 -12.370 1.00 15.88  ? 29   MET A CB  1 
ATOM   118  C CG  . MET A 1 29  ? 3.490   119.885 -13.138 1.00 17.10  ? 29   MET A CG  1 
ATOM   119  S SD  . MET A 1 29  ? 2.170   118.786 -12.682 1.00 17.20  ? 29   MET A SD  1 
ATOM   120  C CE  . MET A 1 29  ? 0.961   119.196 -13.895 1.00 23.22  ? 29   MET A CE  1 
ATOM   121  N N   . ARG A 1 30  ? 7.902   120.858 -11.437 1.00 17.00  ? 30   ARG A N   1 
ATOM   122  C CA  . ARG A 1 30  ? 9.037   120.665 -10.554 1.00 12.50  ? 30   ARG A CA  1 
ATOM   123  C C   . ARG A 1 30  ? 9.508   122.025 -10.040 1.00 16.33  ? 30   ARG A C   1 
ATOM   124  O O   . ARG A 1 30  ? 10.318  122.703 -10.678 1.00 21.45  ? 30   ARG A O   1 
ATOM   125  C CB  . ARG A 1 30  ? 10.157  119.962 -11.308 1.00 6.36   ? 30   ARG A CB  1 
ATOM   126  C CG  . ARG A 1 30  ? 9.658   118.835 -12.178 1.00 12.86  ? 30   ARG A CG  1 
ATOM   127  C CD  . ARG A 1 30  ? 10.798  117.958 -12.638 1.00 32.01  ? 30   ARG A CD  1 
ATOM   128  N NE  . ARG A 1 30  ? 11.127  116.946 -11.644 1.00 54.92  ? 30   ARG A NE  1 
ATOM   129  C CZ  . ARG A 1 30  ? 12.336  116.788 -11.110 1.00 66.83  ? 30   ARG A CZ  1 
ATOM   130  N NH1 . ARG A 1 30  ? 13.336  117.583 -11.478 1.00 70.90  ? 30   ARG A NH1 1 
ATOM   131  N NH2 . ARG A 1 30  ? 12.543  115.833 -10.211 1.00 73.49  ? 30   ARG A NH2 1 
ATOM   132  N N   . LEU A 1 31  ? 8.995   122.415 -8.878  1.00 14.79  ? 31   LEU A N   1 
ATOM   133  C CA  . LEU A 1 31  ? 9.332   123.696 -8.276  1.00 11.81  ? 31   LEU A CA  1 
ATOM   134  C C   . LEU A 1 31  ? 10.698  123.717 -7.581  1.00 13.90  ? 31   LEU A C   1 
ATOM   135  O O   . LEU A 1 31  ? 11.080  122.775 -6.891  1.00 19.91  ? 31   LEU A O   1 
ATOM   136  C CB  . LEU A 1 31  ? 8.223   124.093 -7.303  1.00 8.33   ? 31   LEU A CB  1 
ATOM   137  C CG  . LEU A 1 31  ? 6.820   123.934 -7.890  1.00 5.00   ? 31   LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 31  ? 5.780   124.384 -6.894  1.00 10.33  ? 31   LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 31  ? 6.721   124.741 -9.155  1.00 5.00   ? 31   LEU A CD2 1 
ATOM   140  N N   . SER A 1 32  ? 11.437  124.799 -7.786  1.00 15.08  ? 32   SER A N   1 
ATOM   141  C CA  . SER A 1 32  ? 12.754  124.959 -7.190  1.00 12.61  ? 32   SER A CA  1 
ATOM   142  C C   . SER A 1 32  ? 12.582  125.592 -5.826  1.00 13.96  ? 32   SER A C   1 
ATOM   143  O O   . SER A 1 32  ? 11.552  126.215 -5.556  1.00 16.62  ? 32   SER A O   1 
ATOM   144  C CB  . SER A 1 32  ? 13.607  125.874 -8.055  1.00 12.89  ? 32   SER A CB  1 
ATOM   145  O OG  . SER A 1 32  ? 13.090  127.193 -8.021  1.00 14.70  ? 32   SER A OG  1 
ATOM   146  N N   . ASP A 1 33  ? 13.580  125.437 -4.962  1.00 16.45  ? 33   ASP A N   1 
ATOM   147  C CA  . ASP A 1 33  ? 13.492  126.025 -3.635  1.00 20.07  ? 33   ASP A CA  1 
ATOM   148  C C   . ASP A 1 33  ? 13.354  127.530 -3.815  1.00 20.74  ? 33   ASP A C   1 
ATOM   149  O O   . ASP A 1 33  ? 12.646  128.196 -3.063  1.00 21.88  ? 33   ASP A O   1 
ATOM   150  C CB  . ASP A 1 33  ? 14.736  125.699 -2.809  1.00 26.86  ? 33   ASP A CB  1 
ATOM   151  C CG  . ASP A 1 33  ? 14.787  124.240 -2.369  1.00 34.86  ? 33   ASP A CG  1 
ATOM   152  O OD1 . ASP A 1 33  ? 13.855  123.473 -2.702  1.00 43.72  ? 33   ASP A OD1 1 
ATOM   153  O OD2 . ASP A 1 33  ? 15.764  123.856 -1.690  1.00 37.33  ? 33   ASP A OD2 1 
ATOM   154  N N   . GLU A 1 34  ? 14.028  128.063 -4.827  1.00 20.76  ? 34   GLU A N   1 
ATOM   155  C CA  . GLU A 1 34  ? 13.946  129.491 -5.102  1.00 25.30  ? 34   GLU A CA  1 
ATOM   156  C C   . GLU A 1 34  ? 12.470  129.817 -5.268  1.00 21.15  ? 34   GLU A C   1 
ATOM   157  O O   . GLU A 1 34  ? 11.967  130.779 -4.692  1.00 25.30  ? 34   GLU A O   1 
ATOM   158  C CB  . GLU A 1 34  ? 14.702  129.838 -6.388  1.00 34.51  ? 34   GLU A CB  1 
ATOM   159  C CG  . GLU A 1 34  ? 16.216  129.639 -6.310  1.00 50.39  ? 34   GLU A CG  1 
ATOM   160  C CD  . GLU A 1 34  ? 16.632  128.169 -6.347  1.00 60.26  ? 34   GLU A CD  1 
ATOM   161  O OE1 . GLU A 1 34  ? 16.021  127.388 -7.111  1.00 59.62  ? 34   GLU A OE1 1 
ATOM   162  O OE2 . GLU A 1 34  ? 17.576  127.795 -5.611  1.00 66.42  ? 34   GLU A OE2 1 
ATOM   163  N N   . THR A 1 35  ? 11.781  128.990 -6.046  1.00 16.74  ? 35   THR A N   1 
ATOM   164  C CA  . THR A 1 35  ? 10.359  129.172 -6.297  1.00 14.72  ? 35   THR A CA  1 
ATOM   165  C C   . THR A 1 35  ? 9.508   129.013 -5.047  1.00 14.94  ? 35   THR A C   1 
ATOM   166  O O   . THR A 1 35  ? 8.615   129.821 -4.786  1.00 18.15  ? 35   THR A O   1 
ATOM   167  C CB  . THR A 1 35  ? 9.844   128.169 -7.318  1.00 14.08  ? 35   THR A CB  1 
ATOM   168  O OG1 . THR A 1 35  ? 10.693  128.181 -8.470  1.00 22.32  ? 35   THR A OG1 1 
ATOM   169  C CG2 . THR A 1 35  ? 8.426   128.523 -7.723  1.00 8.68   ? 35   THR A CG2 1 
ATOM   170  N N   . LEU A 1 36  ? 9.768   127.957 -4.288  1.00 13.15  ? 36   LEU A N   1 
ATOM   171  C CA  . LEU A 1 36  ? 9.014   127.703 -3.072  1.00 12.31  ? 36   LEU A CA  1 
ATOM   172  C C   . LEU A 1 36  ? 9.109   128.865 -2.081  1.00 15.52  ? 36   LEU A C   1 
ATOM   173  O O   . LEU A 1 36  ? 8.098   129.321 -1.545  1.00 16.64  ? 36   LEU A O   1 
ATOM   174  C CB  . LEU A 1 36  ? 9.506   126.411 -2.429  1.00 8.72   ? 36   LEU A CB  1 
ATOM   175  C CG  . LEU A 1 36  ? 9.146   125.155 -3.222  1.00 8.32   ? 36   LEU A CG  1 
ATOM   176  C CD1 . LEU A 1 36  ? 9.496   123.919 -2.403  1.00 7.14   ? 36   LEU A CD1 1 
ATOM   177  C CD2 . LEU A 1 36  ? 7.661   125.168 -3.559  1.00 5.00   ? 36   LEU A CD2 1 
ATOM   178  N N   . ILE A 1 37  ? 10.321  129.353 -1.843  1.00 17.09  ? 37   ILE A N   1 
ATOM   179  C CA  . ILE A 1 37  ? 10.511  130.462 -0.916  1.00 15.18  ? 37   ILE A CA  1 
ATOM   180  C C   . ILE A 1 37  ? 9.714   131.667 -1.395  1.00 17.97  ? 37   ILE A C   1 
ATOM   181  O O   . ILE A 1 37  ? 9.119   132.393 -0.598  1.00 22.18  ? 37   ILE A O   1 
ATOM   182  C CB  . ILE A 1 37  ? 11.993  130.845 -0.805  1.00 14.74  ? 37   ILE A CB  1 
ATOM   183  C CG1 . ILE A 1 37  ? 12.760  129.739 -0.084  1.00 8.33   ? 37   ILE A CG1 1 
ATOM   184  C CG2 . ILE A 1 37  ? 12.143  132.141 -0.043  1.00 15.11  ? 37   ILE A CG2 1 
ATOM   185  C CD1 . ILE A 1 37  ? 14.224  129.704 -0.467  1.00 15.57  ? 37   ILE A CD1 1 
ATOM   186  N N   . ASP A 1 38  ? 9.709   131.879 -2.704  1.00 17.77  ? 38   ASP A N   1 
ATOM   187  C CA  . ASP A 1 38  ? 8.961   132.982 -3.282  1.00 16.59  ? 38   ASP A CA  1 
ATOM   188  C C   . ASP A 1 38  ? 7.490   132.783 -2.897  1.00 15.16  ? 38   ASP A C   1 
ATOM   189  O O   . ASP A 1 38  ? 6.850   133.673 -2.351  1.00 18.54  ? 38   ASP A O   1 
ATOM   190  C CB  . ASP A 1 38  ? 9.146   132.979 -4.807  1.00 20.91  ? 38   ASP A CB  1 
ATOM   191  C CG  . ASP A 1 38  ? 8.271   134.003 -5.515  1.00 30.10  ? 38   ASP A CG  1 
ATOM   192  O OD1 . ASP A 1 38  ? 7.769   134.933 -4.850  1.00 34.54  ? 38   ASP A OD1 1 
ATOM   193  O OD2 . ASP A 1 38  ? 8.089   133.873 -6.747  1.00 30.42  ? 38   ASP A OD2 1 
ATOM   194  N N   . ILE A 1 39  ? 6.960   131.599 -3.158  1.00 14.95  ? 39   ILE A N   1 
ATOM   195  C CA  . ILE A 1 39  ? 5.576   131.315 -2.828  1.00 13.45  ? 39   ILE A CA  1 
ATOM   196  C C   . ILE A 1 39  ? 5.348   131.505 -1.336  1.00 13.98  ? 39   ILE A C   1 
ATOM   197  O O   . ILE A 1 39  ? 4.311   132.014 -0.915  1.00 18.55  ? 39   ILE A O   1 
ATOM   198  C CB  . ILE A 1 39  ? 5.219   129.881 -3.221  1.00 12.97  ? 39   ILE A CB  1 
ATOM   199  C CG1 . ILE A 1 39  ? 5.401   129.725 -4.733  1.00 7.21   ? 39   ILE A CG1 1 
ATOM   200  C CG2 . ILE A 1 39  ? 3.808   129.545 -2.749  1.00 9.60   ? 39   ILE A CG2 1 
ATOM   201  C CD1 . ILE A 1 39  ? 4.632   128.579 -5.337  1.00 23.24  ? 39   ILE A CD1 1 
ATOM   202  N N   . MET A 1 40  ? 6.321   131.094 -0.534  1.00 14.59  ? 40   MET A N   1 
ATOM   203  C CA  . MET A 1 40  ? 6.214   131.238 0.912   1.00 17.24  ? 40   MET A CA  1 
ATOM   204  C C   . MET A 1 40  ? 6.015   132.707 1.241   1.00 17.41  ? 40   MET A C   1 
ATOM   205  O O   . MET A 1 40  ? 5.196   133.071 2.083   1.00 18.77  ? 40   MET A O   1 
ATOM   206  C CB  . MET A 1 40  ? 7.485   130.739 1.587   1.00 20.34  ? 40   MET A CB  1 
ATOM   207  C CG  . MET A 1 40  ? 7.377   130.656 3.092   1.00 20.57  ? 40   MET A CG  1 
ATOM   208  S SD  . MET A 1 40  ? 8.917   130.121 3.815   1.00 22.89  ? 40   MET A SD  1 
ATOM   209  C CE  . MET A 1 40  ? 9.031   128.448 3.179   1.00 21.58  ? 40   MET A CE  1 
ATOM   210  N N   . THR A 1 41  ? 6.777   133.545 0.551   1.00 15.12  ? 41   THR A N   1 
ATOM   211  C CA  . THR A 1 41  ? 6.716   134.982 0.729   1.00 13.05  ? 41   THR A CA  1 
ATOM   212  C C   . THR A 1 41  ? 5.387   135.577 0.249   1.00 16.24  ? 41   THR A C   1 
ATOM   213  O O   . THR A 1 41  ? 4.841   136.475 0.894   1.00 21.77  ? 41   THR A O   1 
ATOM   214  C CB  . THR A 1 41  ? 7.878   135.649 -0.019  1.00 14.42  ? 41   THR A CB  1 
ATOM   215  O OG1 . THR A 1 41  ? 9.119   135.107 0.454   1.00 19.73  ? 41   THR A OG1 1 
ATOM   216  C CG2 . THR A 1 41  ? 7.862   137.147 0.192   1.00 15.42  ? 41   THR A CG2 1 
ATOM   217  N N   . ARG A 1 42  ? 4.867   135.082 -0.873  1.00 13.00  ? 42   ARG A N   1 
ATOM   218  C CA  . ARG A 1 42  ? 3.603   135.584 -1.411  1.00 11.89  ? 42   ARG A CA  1 
ATOM   219  C C   . ARG A 1 42  ? 2.480   135.321 -0.420  1.00 16.09  ? 42   ARG A C   1 
ATOM   220  O O   . ARG A 1 42  ? 1.592   136.157 -0.225  1.00 12.70  ? 42   ARG A O   1 
ATOM   221  C CB  . ARG A 1 42  ? 3.261   134.890 -2.729  1.00 13.97  ? 42   ARG A CB  1 
ATOM   222  C CG  . ARG A 1 42  ? 4.174   135.229 -3.892  1.00 17.40  ? 42   ARG A CG  1 
ATOM   223  C CD  . ARG A 1 42  ? 3.711   134.530 -5.164  1.00 13.50  ? 42   ARG A CD  1 
ATOM   224  N NE  . ARG A 1 42  ? 4.825   134.102 -6.003  1.00 22.11  ? 42   ARG A NE  1 
ATOM   225  C CZ  . ARG A 1 42  ? 4.685   133.619 -7.235  1.00 26.12  ? 42   ARG A CZ  1 
ATOM   226  N NH1 . ARG A 1 42  ? 3.478   133.505 -7.771  1.00 22.89  ? 42   ARG A NH1 1 
ATOM   227  N NH2 . ARG A 1 42  ? 5.751   133.238 -7.926  1.00 28.23  ? 42   ARG A NH2 1 
ATOM   228  N N   . PHE A 1 43  ? 2.513   134.149 0.203   1.00 15.99  ? 43   PHE A N   1 
ATOM   229  C CA  . PHE A 1 43  ? 1.483   133.802 1.163   1.00 12.32  ? 43   PHE A CA  1 
ATOM   230  C C   . PHE A 1 43  ? 1.562   134.678 2.411   1.00 19.09  ? 43   PHE A C   1 
ATOM   231  O O   . PHE A 1 43  ? 0.535   135.073 2.981   1.00 14.48  ? 43   PHE A O   1 
ATOM   232  C CB  . PHE A 1 43  ? 1.596   132.336 1.565   1.00 5.25   ? 43   PHE A CB  1 
ATOM   233  C CG  . PHE A 1 43  ? 0.403   131.846 2.313   1.00 8.14   ? 43   PHE A CG  1 
ATOM   234  C CD1 . PHE A 1 43  ? -0.842  131.810 1.699   1.00 6.57   ? 43   PHE A CD1 1 
ATOM   235  C CD2 . PHE A 1 43  ? 0.495   131.512 3.653   1.00 8.38   ? 43   PHE A CD2 1 
ATOM   236  C CE1 . PHE A 1 43  ? -1.972  131.459 2.410   1.00 5.00   ? 43   PHE A CE1 1 
ATOM   237  C CE2 . PHE A 1 43  ? -0.636  131.160 4.371   1.00 5.64   ? 43   PHE A CE2 1 
ATOM   238  C CZ  . PHE A 1 43  ? -1.868  131.136 3.748   1.00 5.00   ? 43   PHE A CZ  1 
ATOM   239  N N   . ARG A 1 44  ? 2.783   134.975 2.838   1.00 21.78  ? 44   ARG A N   1 
ATOM   240  C CA  . ARG A 1 44  ? 2.974   135.799 4.018   1.00 27.42  ? 44   ARG A CA  1 
ATOM   241  C C   . ARG A 1 44  ? 2.249   137.109 3.802   1.00 27.38  ? 44   ARG A C   1 
ATOM   242  O O   . ARG A 1 44  ? 1.626   137.640 4.719   1.00 30.61  ? 44   ARG A O   1 
ATOM   243  C CB  . ARG A 1 44  ? 4.461   136.053 4.268   1.00 33.48  ? 44   ARG A CB  1 
ATOM   244  C CG  . ARG A 1 44  ? 5.112   135.016 5.179   1.00 49.11  ? 44   ARG A CG  1 
ATOM   245  C CD  . ARG A 1 44  ? 6.078   135.654 6.175   1.00 62.08  ? 44   ARG A CD  1 
ATOM   246  N NE  . ARG A 1 44  ? 5.391   136.279 7.307   1.00 70.20  ? 44   ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 44  ? 6.008   136.842 8.344   1.00 71.20  ? 44   ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 44  ? 7.335   136.864 8.405   1.00 68.13  ? 44   ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 44  ? 5.295   137.394 9.319   1.00 76.16  ? 44   ARG A NH2 1 
ATOM   250  N N   . LYS A 1 45  ? 2.321   137.613 2.574   1.00 29.67  ? 45   LYS A N   1 
ATOM   251  C CA  . LYS A 1 45  ? 1.672   138.871 2.214   1.00 30.81  ? 45   LYS A CA  1 
ATOM   252  C C   . LYS A 1 45  ? 0.157   138.711 2.180   1.00 28.81  ? 45   LYS A C   1 
ATOM   253  O O   . LYS A 1 45  ? -0.584  139.625 2.542   1.00 30.33  ? 45   LYS A O   1 
ATOM   254  C CB  . LYS A 1 45  ? 2.177   139.351 0.849   1.00 34.86  ? 45   LYS A CB  1 
ATOM   255  C CG  . LYS A 1 45  ? 1.585   140.671 0.387   1.00 48.64  ? 45   LYS A CG  1 
ATOM   256  C CD  . LYS A 1 45  ? 0.544   140.448 -0.699  1.00 58.12  ? 45   LYS A CD  1 
ATOM   257  C CE  . LYS A 1 45  ? 0.188   141.744 -1.416  1.00 65.06  ? 45   LYS A CE  1 
ATOM   258  N NZ  . LYS A 1 45  ? -0.580  141.482 -2.669  1.00 70.55  ? 45   LYS A NZ  1 
ATOM   259  N N   . GLU A 1 46  ? -0.306  137.546 1.744   1.00 28.65  ? 46   GLU A N   1 
ATOM   260  C CA  . GLU A 1 46  ? -1.737  137.294 1.683   1.00 24.61  ? 46   GLU A CA  1 
ATOM   261  C C   . GLU A 1 46  ? -2.283  137.197 3.097   1.00 23.97  ? 46   GLU A C   1 
ATOM   262  O O   . GLU A 1 46  ? -3.451  137.496 3.341   1.00 29.87  ? 46   GLU A O   1 
ATOM   263  C CB  . GLU A 1 46  ? -2.026  135.998 0.922   1.00 22.80  ? 46   GLU A CB  1 
ATOM   264  C CG  . GLU A 1 46  ? -1.677  136.044 -0.557  1.00 25.22  ? 46   GLU A CG  1 
ATOM   265  C CD  . GLU A 1 46  ? -2.312  137.216 -1.281  1.00 32.19  ? 46   GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 46  ? -3.397  137.669 -0.860  1.00 37.24  ? 46   GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 46  ? -1.722  137.687 -2.277  1.00 38.47  ? 46   GLU A OE2 1 
ATOM   268  N N   . MET A 1 47  ? -1.434  136.773 4.028   1.00 23.01  ? 47   MET A N   1 
ATOM   269  C CA  . MET A 1 47  ? -1.838  136.645 5.427   1.00 24.27  ? 47   MET A CA  1 
ATOM   270  C C   . MET A 1 47  ? -1.991  138.026 6.069   1.00 23.95  ? 47   MET A C   1 
ATOM   271  O O   . MET A 1 47  ? -2.926  138.284 6.826   1.00 19.72  ? 47   MET A O   1 
ATOM   272  C CB  . MET A 1 47  ? -0.799  135.833 6.186   1.00 22.41  ? 47   MET A CB  1 
ATOM   273  C CG  . MET A 1 47  ? -1.028  134.344 6.130   1.00 22.08  ? 47   MET A CG  1 
ATOM   274  S SD  . MET A 1 47  ? 0.026   133.537 7.313   1.00 24.71  ? 47   MET A SD  1 
ATOM   275  C CE  . MET A 1 47  ? 1.561   133.642 6.476   1.00 26.83  ? 47   MET A CE  1 
ATOM   276  N N   . LYS A 1 48  ? -1.055  138.910 5.759   1.00 23.12  ? 48   LYS A N   1 
ATOM   277  C CA  . LYS A 1 48  ? -1.087  140.260 6.275   1.00 22.52  ? 48   LYS A CA  1 
ATOM   278  C C   . LYS A 1 48  ? -2.356  140.960 5.772   1.00 23.15  ? 48   LYS A C   1 
ATOM   279  O O   . LYS A 1 48  ? -3.133  141.502 6.560   1.00 25.17  ? 48   LYS A O   1 
ATOM   280  C CB  . LYS A 1 48  ? 0.168   141.003 5.814   1.00 27.97  ? 48   LYS A CB  1 
ATOM   281  C CG  . LYS A 1 48  ? 0.102   142.508 5.967   1.00 51.78  ? 48   LYS A CG  1 
ATOM   282  C CD  . LYS A 1 48  ? 1.117   143.209 5.071   1.00 64.28  ? 48   LYS A CD  1 
ATOM   283  C CE  . LYS A 1 48  ? 0.800   144.700 4.941   1.00 72.86  ? 48   LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 48  ? 1.979   145.564 5.258   1.00 75.59  ? 48   LYS A NZ  1 
ATOM   285  N N   . ASN A 1 49  ? -2.581  140.927 4.463   1.00 18.27  ? 49   ASN A N   1 
ATOM   286  C CA  . ASN A 1 49  ? -3.749  141.577 3.881   1.00 16.63  ? 49   ASN A CA  1 
ATOM   287  C C   . ASN A 1 49  ? -5.067  141.102 4.465   1.00 16.09  ? 49   ASN A C   1 
ATOM   288  O O   . ASN A 1 49  ? -5.939  141.909 4.756   1.00 28.37  ? 49   ASN A O   1 
ATOM   289  C CB  . ASN A 1 49  ? -3.779  141.368 2.373   1.00 18.81  ? 49   ASN A CB  1 
ATOM   290  C CG  . ASN A 1 49  ? -2.706  142.145 1.657   1.00 26.92  ? 49   ASN A CG  1 
ATOM   291  O OD1 . ASN A 1 49  ? -1.994  142.946 2.261   1.00 37.08  ? 49   ASN A OD1 1 
ATOM   292  N ND2 . ASN A 1 49  ? -2.582  141.913 0.356   1.00 36.53  ? 49   ASN A ND2 1 
ATOM   293  N N   . GLY A 1 50  ? -5.224  139.795 4.626   1.00 14.57  ? 50   GLY A N   1 
ATOM   294  C CA  . GLY A 1 50  ? -6.465  139.273 5.169   1.00 12.00  ? 50   GLY A CA  1 
ATOM   295  C C   . GLY A 1 50  ? -6.735  139.707 6.600   1.00 15.16  ? 50   GLY A C   1 
ATOM   296  O O   . GLY A 1 50  ? -7.891  139.866 7.005   1.00 10.79  ? 50   GLY A O   1 
ATOM   297  N N   . LEU A 1 51  ? -5.668  139.901 7.372   1.00 16.38  ? 51   LEU A N   1 
ATOM   298  C CA  . LEU A 1 51  ? -5.805  140.312 8.768   1.00 20.45  ? 51   LEU A CA  1 
ATOM   299  C C   . LEU A 1 51  ? -6.079  141.810 8.875   1.00 17.91  ? 51   LEU A C   1 
ATOM   300  O O   . LEU A 1 51  ? -6.852  142.248 9.725   1.00 16.65  ? 51   LEU A O   1 
ATOM   301  C CB  . LEU A 1 51  ? -4.536  139.947 9.560   1.00 19.09  ? 51   LEU A CB  1 
ATOM   302  C CG  . LEU A 1 51  ? -4.473  138.510 10.101  1.00 14.48  ? 51   LEU A CG  1 
ATOM   303  C CD1 . LEU A 1 51  ? -3.165  138.263 10.821  1.00 8.88   ? 51   LEU A CD1 1 
ATOM   304  C CD2 . LEU A 1 51  ? -5.635  138.280 11.040  1.00 15.48  ? 51   LEU A CD2 1 
ATOM   305  N N   . SER A 1 52  ? -5.446  142.581 7.997   1.00 18.42  ? 52   SER A N   1 
ATOM   306  C CA  . SER A 1 52  ? -5.601  144.029 7.972   1.00 22.97  ? 52   SER A CA  1 
ATOM   307  C C   . SER A 1 52  ? -7.005  144.442 7.576   1.00 26.74  ? 52   SER A C   1 
ATOM   308  O O   . SER A 1 52  ? -7.578  143.894 6.638   1.00 30.87  ? 52   SER A O   1 
ATOM   309  C CB  . SER A 1 52  ? -4.622  144.647 6.986   1.00 24.40  ? 52   SER A CB  1 
ATOM   310  O OG  . SER A 1 52  ? -5.332  145.240 5.917   1.00 34.09  ? 52   SER A OG  1 
ATOM   311  N N   . ARG A 1 53  ? -7.542  145.434 8.275   1.00 31.49  ? 53   ARG A N   1 
ATOM   312  C CA  . ARG A 1 53  ? -8.890  145.914 8.004   1.00 38.34  ? 53   ARG A CA  1 
ATOM   313  C C   . ARG A 1 53  ? -8.967  146.720 6.717   1.00 34.99  ? 53   ARG A C   1 
ATOM   314  O O   . ARG A 1 53  ? -10.050 146.963 6.188   1.00 32.19  ? 53   ARG A O   1 
ATOM   315  C CB  . ARG A 1 53  ? -9.384  146.770 9.170   1.00 48.77  ? 53   ARG A CB  1 
ATOM   316  C CG  . ARG A 1 53  ? -8.699  148.115 9.270   1.00 59.60  ? 53   ARG A CG  1 
ATOM   317  C CD  . ARG A 1 53  ? -9.411  149.025 10.253  1.00 71.03  ? 53   ARG A CD  1 
ATOM   318  N NE  . ARG A 1 53  ? -8.763  150.329 10.319  1.00 81.82  ? 53   ARG A NE  1 
ATOM   319  C CZ  . ARG A 1 53  ? -8.658  151.157 9.285   1.00 86.77  ? 53   ARG A CZ  1 
ATOM   320  N NH1 . ARG A 1 53  ? -9.161  150.817 8.105   1.00 89.61  ? 53   ARG A NH1 1 
ATOM   321  N NH2 . ARG A 1 53  ? -8.039  152.321 9.429   1.00 91.37  ? 53   ARG A NH2 1 
ATOM   322  N N   . ASP A 1 54  ? -7.815  147.137 6.215   1.00 32.97  ? 54   ASP A N   1 
ATOM   323  C CA  . ASP A 1 54  ? -7.790  147.923 4.998   1.00 33.46  ? 54   ASP A CA  1 
ATOM   324  C C   . ASP A 1 54  ? -7.902  147.057 3.755   1.00 34.07  ? 54   ASP A C   1 
ATOM   325  O O   . ASP A 1 54  ? -8.617  147.403 2.821   1.00 40.61  ? 54   ASP A O   1 
ATOM   326  C CB  . ASP A 1 54  ? -6.507  148.752 4.934   1.00 35.81  ? 54   ASP A CB  1 
ATOM   327  C CG  . ASP A 1 54  ? -6.694  150.156 5.475   1.00 39.48  ? 54   ASP A CG  1 
ATOM   328  O OD1 . ASP A 1 54  ? -7.848  150.535 5.775   1.00 32.63  ? 54   ASP A OD1 1 
ATOM   329  O OD2 . ASP A 1 54  ? -5.681  150.881 5.597   1.00 44.61  ? 54   ASP A OD2 1 
ATOM   330  N N   . PHE A 1 55  ? -7.210  145.924 3.747   1.00 32.36  ? 55   PHE A N   1 
ATOM   331  C CA  . PHE A 1 55  ? -7.235  145.042 2.587   1.00 33.00  ? 55   PHE A CA  1 
ATOM   332  C C   . PHE A 1 55  ? -8.126  143.828 2.724   1.00 30.19  ? 55   PHE A C   1 
ATOM   333  O O   . PHE A 1 55  ? -8.357  143.113 1.754   1.00 33.65  ? 55   PHE A O   1 
ATOM   334  C CB  . PHE A 1 55  ? -5.823  144.587 2.259   1.00 34.71  ? 55   PHE A CB  1 
ATOM   335  C CG  . PHE A 1 55  ? -4.895  145.713 2.000   1.00 43.19  ? 55   PHE A CG  1 
ATOM   336  C CD1 . PHE A 1 55  ? -4.402  146.471 3.052   1.00 45.10  ? 55   PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1 55  ? -4.551  146.055 0.701   1.00 47.56  ? 55   PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1 55  ? -3.579  147.561 2.817   1.00 54.27  ? 55   PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1 55  ? -3.730  147.143 0.450   1.00 54.58  ? 55   PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1 55  ? -3.242  147.902 1.512   1.00 56.16  ? 55   PHE A CZ  1 
ATOM   341  N N   . ASN A 1 56  ? -8.632  143.589 3.923   1.00 24.30  ? 56   ASN A N   1 
ATOM   342  C CA  . ASN A 1 56  ? -9.481  142.437 4.128   1.00 23.80  ? 56   ASN A CA  1 
ATOM   343  C C   . ASN A 1 56  ? -10.625 142.363 3.120   1.00 26.69  ? 56   ASN A C   1 
ATOM   344  O O   . ASN A 1 56  ? -10.899 141.298 2.579   1.00 31.73  ? 56   ASN A O   1 
ATOM   345  C CB  . ASN A 1 56  ? -10.039 142.436 5.545   1.00 19.34  ? 56   ASN A CB  1 
ATOM   346  C CG  . ASN A 1 56  ? -11.029 141.317 5.772   1.00 22.00  ? 56   ASN A CG  1 
ATOM   347  O OD1 . ASN A 1 56  ? -12.237 141.494 5.585   1.00 23.97  ? 56   ASN A OD1 1 
ATOM   348  N ND2 . ASN A 1 56  ? -10.527 140.154 6.178   1.00 18.46  ? 56   ASN A ND2 1 
ATOM   349  N N   . PRO A 1 57  ? -11.304 143.492 2.850   1.00 32.79  ? 57   PRO A N   1 
ATOM   350  C CA  . PRO A 1 57  ? -12.426 143.526 1.899   1.00 32.97  ? 57   PRO A CA  1 
ATOM   351  C C   . PRO A 1 57  ? -12.216 142.796 0.575   1.00 32.32  ? 57   PRO A C   1 
ATOM   352  O O   . PRO A 1 57  ? -13.134 142.161 0.057   1.00 32.78  ? 57   PRO A O   1 
ATOM   353  C CB  . PRO A 1 57  ? -12.666 145.018 1.680   1.00 32.41  ? 57   PRO A CB  1 
ATOM   354  C CG  . PRO A 1 57  ? -12.230 145.646 2.950   1.00 36.18  ? 57   PRO A CG  1 
ATOM   355  C CD  . PRO A 1 57  ? -11.063 144.821 3.444   1.00 38.60  ? 57   PRO A CD  1 
ATOM   356  N N   . THR A 1 58  ? -11.010 142.884 0.028   1.00 29.85  ? 58   THR A N   1 
ATOM   357  C CA  . THR A 1 58  ? -10.718 142.245 -1.248  1.00 28.81  ? 58   THR A CA  1 
ATOM   358  C C   . THR A 1 58  ? -9.598  141.211 -1.192  1.00 29.75  ? 58   THR A C   1 
ATOM   359  O O   . THR A 1 58  ? -8.928  140.968 -2.198  1.00 33.41  ? 58   THR A O   1 
ATOM   360  C CB  . THR A 1 58  ? -10.325 143.296 -2.292  1.00 33.97  ? 58   THR A CB  1 
ATOM   361  O OG1 . THR A 1 58  ? -9.008  143.784 -2.003  1.00 32.28  ? 58   THR A OG1 1 
ATOM   362  C CG2 . THR A 1 58  ? -11.310 144.455 -2.274  1.00 42.06  ? 58   THR A CG2 1 
ATOM   363  N N   . ALA A 1 59  ? -9.398  140.598 -0.030  1.00 23.62  ? 59   ALA A N   1 
ATOM   364  C CA  . ALA A 1 59  ? -8.345  139.608 0.124   1.00 17.53  ? 59   ALA A CA  1 
ATOM   365  C C   . ALA A 1 59  ? -8.857  138.202 -0.161  1.00 18.99  ? 59   ALA A C   1 
ATOM   366  O O   . ALA A 1 59  ? -9.968  137.856 0.238   1.00 21.17  ? 59   ALA A O   1 
ATOM   367  C CB  . ALA A 1 59  ? -7.778  139.685 1.517   1.00 22.03  ? 59   ALA A CB  1 
ATOM   368  N N   . THR A 1 60  ? -8.045  137.394 -0.848  1.00 18.46  ? 60   THR A N   1 
ATOM   369  C CA  . THR A 1 60  ? -8.430  136.024 -1.191  1.00 17.96  ? 60   THR A CA  1 
ATOM   370  C C   . THR A 1 60  ? -8.180  135.027 -0.062  1.00 19.08  ? 60   THR A C   1 
ATOM   371  O O   . THR A 1 60  ? -8.825  133.985 -0.002  1.00 24.35  ? 60   THR A O   1 
ATOM   372  C CB  . THR A 1 60  ? -7.726  135.542 -2.474  1.00 16.40  ? 60   THR A CB  1 
ATOM   373  O OG1 . THR A 1 60  ? -6.309  135.714 -2.355  1.00 18.14  ? 60   THR A OG1 1 
ATOM   374  C CG2 . THR A 1 60  ? -8.215  136.345 -3.652  1.00 20.06  ? 60   THR A CG2 1 
ATOM   375  N N   . VAL A 1 61  ? -7.227  135.329 0.816   1.00 19.99  ? 61   VAL A N   1 
ATOM   376  C CA  . VAL A 1 61  ? -6.975  134.474 1.976   1.00 17.99  ? 61   VAL A CA  1 
ATOM   377  C C   . VAL A 1 61  ? -7.750  135.187 3.106   1.00 18.06  ? 61   VAL A C   1 
ATOM   378  O O   . VAL A 1 61  ? -7.262  136.138 3.720   1.00 12.51  ? 61   VAL A O   1 
ATOM   379  C CB  . VAL A 1 61  ? -5.468  134.392 2.308   1.00 16.96  ? 61   VAL A CB  1 
ATOM   380  C CG1 . VAL A 1 61  ? -5.233  133.382 3.411   1.00 13.49  ? 61   VAL A CG1 1 
ATOM   381  C CG2 . VAL A 1 61  ? -4.698  133.968 1.076   1.00 14.10  ? 61   VAL A CG2 1 
ATOM   382  N N   . LYS A 1 62  ? -8.970  134.720 3.346   1.00 15.68  ? 62   LYS A N   1 
ATOM   383  C CA  . LYS A 1 62  ? -9.873  135.307 4.323   1.00 17.29  ? 62   LYS A CA  1 
ATOM   384  C C   . LYS A 1 62  ? -9.400  135.465 5.767   1.00 21.77  ? 62   LYS A C   1 
ATOM   385  O O   . LYS A 1 62  ? -9.856  136.371 6.457   1.00 28.16  ? 62   LYS A O   1 
ATOM   386  C CB  . LYS A 1 62  ? -11.197 134.542 4.305   1.00 18.49  ? 62   LYS A CB  1 
ATOM   387  C CG  . LYS A 1 62  ? -11.795 134.346 2.923   1.00 21.44  ? 62   LYS A CG  1 
ATOM   388  C CD  . LYS A 1 62  ? -12.628 133.054 2.858   1.00 27.86  ? 62   LYS A CD  1 
ATOM   389  C CE  . LYS A 1 62  ? -12.759 132.515 1.429   1.00 24.77  ? 62   LYS A CE  1 
ATOM   390  N NZ  . LYS A 1 62  ? -12.320 131.089 1.321   1.00 26.95  ? 62   LYS A NZ  1 
ATOM   391  N N   . MET A 1 63  ? -8.511  134.594 6.239   1.00 22.82  ? 63   MET A N   1 
ATOM   392  C CA  . MET A 1 63  ? -8.013  134.681 7.620   1.00 16.62  ? 63   MET A CA  1 
ATOM   393  C C   . MET A 1 63  ? -9.151  134.938 8.607   1.00 17.90  ? 63   MET A C   1 
ATOM   394  O O   . MET A 1 63  ? -9.133  135.918 9.355   1.00 18.06  ? 63   MET A O   1 
ATOM   395  C CB  . MET A 1 63  ? -6.985  135.803 7.744   1.00 10.73  ? 63   MET A CB  1 
ATOM   396  C CG  . MET A 1 63  ? -5.825  135.692 6.776   1.00 10.07  ? 63   MET A CG  1 
ATOM   397  S SD  . MET A 1 63  ? -4.666  134.423 7.292   1.00 18.87  ? 63   MET A SD  1 
ATOM   398  C CE  . MET A 1 63  ? -3.426  135.381 8.119   1.00 22.61  ? 63   MET A CE  1 
ATOM   399  N N   . LEU A 1 64  ? -10.132 134.044 8.606   1.00 19.85  ? 64   LEU A N   1 
ATOM   400  C CA  . LEU A 1 64  ? -11.302 134.169 9.466   1.00 22.01  ? 64   LEU A CA  1 
ATOM   401  C C   . LEU A 1 64  ? -11.084 133.842 10.938  1.00 27.22  ? 64   LEU A C   1 
ATOM   402  O O   . LEU A 1 64  ? -10.395 132.879 11.273  1.00 32.17  ? 64   LEU A O   1 
ATOM   403  C CB  . LEU A 1 64  ? -12.428 133.272 8.946   1.00 19.09  ? 64   LEU A CB  1 
ATOM   404  C CG  . LEU A 1 64  ? -12.803 133.332 7.466   1.00 18.70  ? 64   LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 64  ? -13.211 131.956 6.973   1.00 23.11  ? 64   LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 64  ? -13.949 134.300 7.285   1.00 20.20  ? 64   LEU A CD2 1 
ATOM   407  N N   . PRO A 1 65  ? -11.666 134.658 11.839  1.00 30.45  ? 65   PRO A N   1 
ATOM   408  C CA  . PRO A 1 65  ? -11.558 134.458 13.292  1.00 27.51  ? 65   PRO A CA  1 
ATOM   409  C C   . PRO A 1 65  ? -12.484 133.311 13.690  1.00 28.40  ? 65   PRO A C   1 
ATOM   410  O O   . PRO A 1 65  ? -13.638 133.272 13.271  1.00 32.76  ? 65   PRO A O   1 
ATOM   411  C CB  . PRO A 1 65  ? -12.011 135.790 13.876  1.00 28.24  ? 65   PRO A CB  1 
ATOM   412  C CG  . PRO A 1 65  ? -12.895 136.384 12.838  1.00 24.77  ? 65   PRO A CG  1 
ATOM   413  C CD  . PRO A 1 65  ? -12.432 135.874 11.503  1.00 28.15  ? 65   PRO A CD  1 
ATOM   414  N N   . THR A 1 66  ? -11.979 132.382 14.494  1.00 28.49  ? 66   THR A N   1 
ATOM   415  C CA  . THR A 1 66  ? -12.754 131.217 14.907  1.00 29.00  ? 66   THR A CA  1 
ATOM   416  C C   . THR A 1 66  ? -13.411 131.381 16.257  1.00 33.77  ? 66   THR A C   1 
ATOM   417  O O   . THR A 1 66  ? -14.285 130.601 16.644  1.00 37.77  ? 66   THR A O   1 
ATOM   418  C CB  . THR A 1 66  ? -11.860 129.997 14.998  1.00 28.43  ? 66   THR A CB  1 
ATOM   419  O OG1 . THR A 1 66  ? -10.713 130.323 15.790  1.00 24.38  ? 66   THR A OG1 1 
ATOM   420  C CG2 . THR A 1 66  ? -11.417 129.565 13.619  1.00 31.89  ? 66   THR A CG2 1 
ATOM   421  N N   . PHE A 1 67  ? -12.966 132.398 16.978  1.00 36.70  ? 67   PHE A N   1 
ATOM   422  C CA  . PHE A 1 67  ? -13.474 132.678 18.300  1.00 31.11  ? 67   PHE A CA  1 
ATOM   423  C C   . PHE A 1 67  ? -13.131 131.564 19.259  1.00 29.87  ? 67   PHE A C   1 
ATOM   424  O O   . PHE A 1 67  ? -13.922 131.194 20.121  1.00 34.17  ? 67   PHE A O   1 
ATOM   425  C CB  . PHE A 1 67  ? -14.970 132.958 18.246  1.00 30.96  ? 67   PHE A CB  1 
ATOM   426  C CG  . PHE A 1 67  ? -15.269 134.316 17.715  1.00 38.46  ? 67   PHE A CG  1 
ATOM   427  C CD1 . PHE A 1 67  ? -14.812 135.442 18.395  1.00 41.78  ? 67   PHE A CD1 1 
ATOM   428  C CD2 . PHE A 1 67  ? -15.873 134.482 16.482  1.00 38.62  ? 67   PHE A CD2 1 
ATOM   429  C CE1 . PHE A 1 67  ? -14.943 136.707 17.850  1.00 41.57  ? 67   PHE A CE1 1 
ATOM   430  C CE2 . PHE A 1 67  ? -16.005 135.745 15.932  1.00 43.53  ? 67   PHE A CE2 1 
ATOM   431  C CZ  . PHE A 1 67  ? -15.536 136.861 16.619  1.00 45.62  ? 67   PHE A CZ  1 
ATOM   432  N N   . VAL A 1 68  ? -11.941 131.010 19.057  1.00 28.63  ? 68   VAL A N   1 
ATOM   433  C CA  . VAL A 1 68  ? -11.372 129.994 19.933  1.00 26.15  ? 68   VAL A CA  1 
ATOM   434  C C   . VAL A 1 68  ? -10.074 130.618 20.424  1.00 26.82  ? 68   VAL A C   1 
ATOM   435  O O   . VAL A 1 68  ? -9.130  130.790 19.651  1.00 26.32  ? 68   VAL A O   1 
ATOM   436  C CB  . VAL A 1 68  ? -11.077 128.668 19.196  1.00 23.22  ? 68   VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 68  ? -10.069 127.833 19.987  1.00 18.34  ? 68   VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 68  ? -12.370 127.883 19.029  1.00 19.53  ? 68   VAL A CG2 1 
ATOM   439  N N   . ARG A 1 69  ? -10.046 130.978 21.702  1.00 28.51  ? 69   ARG A N   1 
ATOM   440  C CA  . ARG A 1 69  ? -8.899  131.659 22.278  1.00 32.35  ? 69   ARG A CA  1 
ATOM   441  C C   . ARG A 1 69  ? -7.841  130.838 23.002  1.00 36.52  ? 69   ARG A C   1 
ATOM   442  O O   . ARG A 1 69  ? -6.841  131.397 23.455  1.00 39.25  ? 69   ARG A O   1 
ATOM   443  C CB  . ARG A 1 69  ? -9.415  132.768 23.191  1.00 32.54  ? 69   ARG A CB  1 
ATOM   444  C CG  . ARG A 1 69  ? -10.390 133.692 22.488  1.00 35.43  ? 69   ARG A CG  1 
ATOM   445  C CD  . ARG A 1 69  ? -11.350 134.365 23.450  1.00 41.60  ? 69   ARG A CD  1 
ATOM   446  N NE  . ARG A 1 69  ? -12.305 135.233 22.758  1.00 48.01  ? 69   ARG A NE  1 
ATOM   447  C CZ  . ARG A 1 69  ? -12.001 136.418 22.233  1.00 49.07  ? 69   ARG A CZ  1 
ATOM   448  N NH1 . ARG A 1 69  ? -10.765 136.890 22.316  1.00 47.05  ? 69   ARG A NH1 1 
ATOM   449  N NH2 . ARG A 1 69  ? -12.936 137.135 21.621  1.00 55.57  ? 69   ARG A NH2 1 
ATOM   450  N N   . SER A 1 70  ? -8.039  129.526 23.104  1.00 42.23  ? 70   SER A N   1 
ATOM   451  C CA  . SER A 1 70  ? -7.063  128.673 23.783  1.00 46.07  ? 70   SER A CA  1 
ATOM   452  C C   . SER A 1 70  ? -7.334  127.191 23.573  1.00 44.89  ? 70   SER A C   1 
ATOM   453  O O   . SER A 1 70  ? -8.460  126.802 23.261  1.00 41.92  ? 70   SER A O   1 
ATOM   454  C CB  . SER A 1 70  ? -7.056  128.968 25.287  1.00 51.58  ? 70   SER A CB  1 
ATOM   455  O OG  . SER A 1 70  ? -6.951  127.775 26.050  1.00 57.63  ? 70   SER A OG  1 
ATOM   456  N N   . ILE A 1 71  ? -6.297  126.371 23.746  1.00 44.80  ? 71   ILE A N   1 
ATOM   457  C CA  . ILE A 1 71  ? -6.428  124.926 23.596  1.00 47.96  ? 71   ILE A CA  1 
ATOM   458  C C   . ILE A 1 71  ? -6.830  124.317 24.940  1.00 51.22  ? 71   ILE A C   1 
ATOM   459  O O   . ILE A 1 71  ? -6.679  124.953 25.984  1.00 53.39  ? 71   ILE A O   1 
ATOM   460  C CB  . ILE A 1 71  ? -5.106  124.277 23.105  1.00 44.73  ? 71   ILE A CB  1 
ATOM   461  C CG1 . ILE A 1 71  ? -3.917  124.814 23.906  1.00 47.51  ? 71   ILE A CG1 1 
ATOM   462  C CG2 . ILE A 1 71  ? -4.913  124.565 21.622  1.00 44.66  ? 71   ILE A CG2 1 
ATOM   463  C CD1 . ILE A 1 71  ? -2.608  124.065 23.655  1.00 38.67  ? 71   ILE A CD1 1 
ATOM   464  N N   . PRO A 1 72  ? -7.349  123.078 24.932  1.00 55.19  ? 72   PRO A N   1 
ATOM   465  C CA  . PRO A 1 72  ? -7.770  122.408 26.168  1.00 57.00  ? 72   PRO A CA  1 
ATOM   466  C C   . PRO A 1 72  ? -6.778  122.569 27.311  1.00 58.15  ? 72   PRO A C   1 
ATOM   467  O O   . PRO A 1 72  ? -5.592  122.280 27.153  1.00 58.61  ? 72   PRO A O   1 
ATOM   468  C CB  . PRO A 1 72  ? -7.918  120.947 25.750  1.00 55.61  ? 72   PRO A CB  1 
ATOM   469  C CG  . PRO A 1 72  ? -8.272  121.016 24.316  1.00 56.04  ? 72   PRO A CG  1 
ATOM   470  C CD  . PRO A 1 72  ? -7.560  122.223 23.751  1.00 56.11  ? 72   PRO A CD  1 
ATOM   471  N N   . ASP A 1 73  ? -7.268  123.031 28.458  1.00 59.55  ? 73   ASP A N   1 
ATOM   472  C CA  . ASP A 1 73  ? -6.414  123.217 29.627  1.00 61.68  ? 73   ASP A CA  1 
ATOM   473  C C   . ASP A 1 73  ? -6.526  122.024 30.568  1.00 60.52  ? 73   ASP A C   1 
ATOM   474  O O   . ASP A 1 73  ? -6.021  122.058 31.689  1.00 65.42  ? 73   ASP A O   1 
ATOM   475  C CB  . ASP A 1 73  ? -6.781  124.509 30.373  1.00 59.63  ? 73   ASP A CB  1 
ATOM   476  C CG  . ASP A 1 73  ? -8.242  124.559 30.788  1.00 61.31  ? 73   ASP A CG  1 
ATOM   477  O OD1 . ASP A 1 73  ? -8.807  123.496 31.133  1.00 57.50  ? 73   ASP A OD1 1 
ATOM   478  O OD2 . ASP A 1 73  ? -8.824  125.667 30.770  1.00 60.60  ? 73   ASP A OD2 1 
ATOM   479  N N   . GLY A 1 74  ? -7.189  120.972 30.100  1.00 59.84  ? 74   GLY A N   1 
ATOM   480  C CA  . GLY A 1 74  ? -7.353  119.778 30.909  1.00 58.38  ? 74   GLY A CA  1 
ATOM   481  C C   . GLY A 1 74  ? -8.623  119.787 31.738  1.00 56.26  ? 74   GLY A C   1 
ATOM   482  O O   . GLY A 1 74  ? -9.317  118.774 31.839  1.00 57.46  ? 74   GLY A O   1 
ATOM   483  N N   . SER A 1 75  ? -8.931  120.938 32.325  1.00 54.82  ? 75   SER A N   1 
ATOM   484  C CA  . SER A 1 75  ? -10.116 121.092 33.162  1.00 54.91  ? 75   SER A CA  1 
ATOM   485  C C   . SER A 1 75  ? -11.395 120.697 32.431  1.00 56.43  ? 75   SER A C   1 
ATOM   486  O O   . SER A 1 75  ? -12.488 120.766 32.993  1.00 57.97  ? 75   SER A O   1 
ATOM   487  C CB  . SER A 1 75  ? -10.231 122.542 33.636  1.00 54.17  ? 75   SER A CB  1 
ATOM   488  O OG  . SER A 1 75  ? -10.926 123.332 32.683  1.00 55.59  ? 75   SER A OG  1 
ATOM   489  N N   . GLU A 1 76  ? -11.254 120.284 31.178  1.00 59.16  ? 76   GLU A N   1 
ATOM   490  C CA  . GLU A 1 76  ? -12.401 119.897 30.370  1.00 59.35  ? 76   GLU A CA  1 
ATOM   491  C C   . GLU A 1 76  ? -12.993 118.567 30.813  1.00 59.29  ? 76   GLU A C   1 
ATOM   492  O O   . GLU A 1 76  ? -12.284 117.565 30.943  1.00 59.07  ? 76   GLU A O   1 
ATOM   493  C CB  . GLU A 1 76  ? -11.999 119.830 28.894  1.00 58.10  ? 76   GLU A CB  1 
ATOM   494  C CG  . GLU A 1 76  ? -11.790 121.193 28.257  1.00 54.25  ? 76   GLU A CG  1 
ATOM   495  C CD  . GLU A 1 76  ? -10.355 121.671 28.358  1.00 53.16  ? 76   GLU A CD  1 
ATOM   496  O OE1 . GLU A 1 76  ? -9.495  120.889 28.816  1.00 52.18  ? 76   GLU A OE1 1 
ATOM   497  O OE2 . GLU A 1 76  ? -10.086 122.829 27.978  1.00 52.97  ? 76   GLU A OE2 1 
ATOM   498  N N   . LYS A 1 77  ? -14.303 118.574 31.041  1.00 59.57  ? 77   LYS A N   1 
ATOM   499  C CA  . LYS A 1 77  ? -15.021 117.384 31.474  1.00 60.71  ? 77   LYS A CA  1 
ATOM   500  C C   . LYS A 1 77  ? -16.483 117.466 31.042  1.00 58.13  ? 77   LYS A C   1 
ATOM   501  O O   . LYS A 1 77  ? -17.087 118.540 31.066  1.00 59.80  ? 77   LYS A O   1 
ATOM   502  C CB  . LYS A 1 77  ? -14.926 117.242 33.002  1.00 66.70  ? 77   LYS A CB  1 
ATOM   503  C CG  . LYS A 1 77  ? -16.219 116.821 33.699  1.00 72.83  ? 77   LYS A CG  1 
ATOM   504  C CD  . LYS A 1 77  ? -16.051 115.489 34.425  1.00 79.52  ? 77   LYS A CD  1 
ATOM   505  C CE  . LYS A 1 77  ? -17.392 114.792 34.632  1.00 81.94  ? 77   LYS A CE  1 
ATOM   506  N NZ  . LYS A 1 77  ? -17.238 113.326 34.871  1.00 84.45  ? 77   LYS A NZ  1 
ATOM   507  N N   . GLY A 1 78  ? -17.042 116.327 30.644  1.00 54.78  ? 78   GLY A N   1 
ATOM   508  C CA  . GLY A 1 78  ? -18.429 116.285 30.225  1.00 48.81  ? 78   GLY A CA  1 
ATOM   509  C C   . GLY A 1 78  ? -18.745 115.122 29.305  1.00 49.05  ? 78   GLY A C   1 
ATOM   510  O O   . GLY A 1 78  ? -17.926 114.224 29.105  1.00 46.47  ? 78   GLY A O   1 
ATOM   511  N N   . ASP A 1 79  ? -19.952 115.148 28.751  1.00 50.83  ? 79   ASP A N   1 
ATOM   512  C CA  . ASP A 1 79  ? -20.431 114.122 27.829  1.00 52.25  ? 79   ASP A CA  1 
ATOM   513  C C   . ASP A 1 79  ? -21.240 114.847 26.747  1.00 53.94  ? 79   ASP A C   1 
ATOM   514  O O   . ASP A 1 79  ? -22.267 115.467 27.047  1.00 53.90  ? 79   ASP A O   1 
ATOM   515  C CB  . ASP A 1 79  ? -21.310 113.119 28.582  1.00 53.63  ? 79   ASP A CB  1 
ATOM   516  C CG  . ASP A 1 79  ? -21.819 111.997 27.695  1.00 56.07  ? 79   ASP A CG  1 
ATOM   517  O OD1 . ASP A 1 79  ? -21.279 111.807 26.586  1.00 61.76  ? 79   ASP A OD1 1 
ATOM   518  O OD2 . ASP A 1 79  ? -22.766 111.301 28.112  1.00 56.10  ? 79   ASP A OD2 1 
ATOM   519  N N   . PHE A 1 80  ? -20.762 114.779 25.502  1.00 52.07  ? 80   PHE A N   1 
ATOM   520  C CA  . PHE A 1 80  ? -21.418 115.448 24.374  1.00 47.69  ? 80   PHE A CA  1 
ATOM   521  C C   . PHE A 1 80  ? -21.320 114.688 23.056  1.00 44.48  ? 80   PHE A C   1 
ATOM   522  O O   . PHE A 1 80  ? -20.593 113.701 22.938  1.00 45.69  ? 80   PHE A O   1 
ATOM   523  C CB  . PHE A 1 80  ? -20.832 116.857 24.151  1.00 45.51  ? 80   PHE A CB  1 
ATOM   524  C CG  . PHE A 1 80  ? -19.711 117.219 25.090  1.00 40.51  ? 80   PHE A CG  1 
ATOM   525  C CD1 . PHE A 1 80  ? -18.560 116.439 25.167  1.00 35.73  ? 80   PHE A CD1 1 
ATOM   526  C CD2 . PHE A 1 80  ? -19.818 118.339 25.909  1.00 39.48  ? 80   PHE A CD2 1 
ATOM   527  C CE1 . PHE A 1 80  ? -17.535 116.768 26.050  1.00 37.56  ? 80   PHE A CE1 1 
ATOM   528  C CE2 . PHE A 1 80  ? -18.800 118.677 26.794  1.00 38.55  ? 80   PHE A CE2 1 
ATOM   529  C CZ  . PHE A 1 80  ? -17.656 117.889 26.867  1.00 38.89  ? 80   PHE A CZ  1 
ATOM   530  N N   . ILE A 1 81  ? -22.068 115.169 22.067  1.00 41.75  ? 81   ILE A N   1 
ATOM   531  C CA  . ILE A 1 81  ? -22.080 114.587 20.730  1.00 38.97  ? 81   ILE A CA  1 
ATOM   532  C C   . ILE A 1 81  ? -21.247 115.472 19.812  1.00 34.39  ? 81   ILE A C   1 
ATOM   533  O O   . ILE A 1 81  ? -20.907 116.604 20.156  1.00 35.38  ? 81   ILE A O   1 
ATOM   534  C CB  . ILE A 1 81  ? -23.505 114.517 20.134  1.00 42.61  ? 81   ILE A CB  1 
ATOM   535  C CG1 . ILE A 1 81  ? -24.511 114.088 21.207  1.00 42.03  ? 81   ILE A CG1 1 
ATOM   536  C CG2 . ILE A 1 81  ? -23.521 113.561 18.944  1.00 40.70  ? 81   ILE A CG2 1 
ATOM   537  C CD1 . ILE A 1 81  ? -24.263 112.703 21.769  1.00 46.22  ? 81   ILE A CD1 1 
ATOM   538  N N   . ALA A 1 82  ? -20.931 114.961 18.634  1.00 29.26  ? 82   ALA A N   1 
ATOM   539  C CA  . ALA A 1 82  ? -20.137 115.721 17.692  1.00 27.50  ? 82   ALA A CA  1 
ATOM   540  C C   . ALA A 1 82  ? -20.463 115.298 16.275  1.00 27.82  ? 82   ALA A C   1 
ATOM   541  O O   . ALA A 1 82  ? -20.490 114.111 15.960  1.00 31.08  ? 82   ALA A O   1 
ATOM   542  C CB  . ALA A 1 82  ? -18.660 115.509 17.975  1.00 19.37  ? 82   ALA A CB  1 
ATOM   543  N N   . LEU A 1 83  ? -20.728 116.280 15.424  1.00 27.75  ? 83   LEU A N   1 
ATOM   544  C CA  . LEU A 1 83  ? -21.033 116.019 14.029  1.00 27.20  ? 83   LEU A CA  1 
ATOM   545  C C   . LEU A 1 83  ? -19.820 116.442 13.215  1.00 26.35  ? 83   LEU A C   1 
ATOM   546  O O   . LEU A 1 83  ? -19.125 117.395 13.576  1.00 29.46  ? 83   LEU A O   1 
ATOM   547  C CB  . LEU A 1 83  ? -22.252 116.835 13.586  1.00 28.49  ? 83   LEU A CB  1 
ATOM   548  C CG  . LEU A 1 83  ? -23.650 116.371 13.997  1.00 26.32  ? 83   LEU A CG  1 
ATOM   549  C CD1 . LEU A 1 83  ? -23.609 115.679 15.341  1.00 26.35  ? 83   LEU A CD1 1 
ATOM   550  C CD2 . LEU A 1 83  ? -24.568 117.576 14.056  1.00 31.04  ? 83   LEU A CD2 1 
ATOM   551  N N   . ASP A 1 84  ? -19.549 115.728 12.132  1.00 24.74  ? 84   ASP A N   1 
ATOM   552  C CA  . ASP A 1 84  ? -18.424 116.081 11.277  1.00 24.62  ? 84   ASP A CA  1 
ATOM   553  C C   . ASP A 1 84  ? -18.845 115.943 9.830   1.00 24.16  ? 84   ASP A C   1 
ATOM   554  O O   . ASP A 1 84  ? -18.881 114.837 9.296   1.00 26.01  ? 84   ASP A O   1 
ATOM   555  C CB  . ASP A 1 84  ? -17.226 115.186 11.546  1.00 23.01  ? 84   ASP A CB  1 
ATOM   556  C CG  . ASP A 1 84  ? -16.008 115.619 10.768  1.00 30.12  ? 84   ASP A CG  1 
ATOM   557  O OD1 . ASP A 1 84  ? -16.166 116.446 9.850   1.00 40.54  ? 84   ASP A OD1 1 
ATOM   558  O OD2 . ASP A 1 84  ? -14.892 115.145 11.066  1.00 40.79  ? 84   ASP A OD2 1 
ATOM   559  N N   . LEU A 1 85  ? -19.144 117.077 9.201   1.00 22.20  ? 85   LEU A N   1 
ATOM   560  C CA  . LEU A 1 85  ? -19.604 117.105 7.819   1.00 23.23  ? 85   LEU A CA  1 
ATOM   561  C C   . LEU A 1 85  ? -18.767 118.006 6.916   1.00 25.94  ? 85   LEU A C   1 
ATOM   562  O O   . LEU A 1 85  ? -18.425 119.128 7.292   1.00 27.32  ? 85   LEU A O   1 
ATOM   563  C CB  . LEU A 1 85  ? -21.064 117.567 7.798   1.00 22.62  ? 85   LEU A CB  1 
ATOM   564  C CG  . LEU A 1 85  ? -21.739 117.827 6.456   1.00 21.08  ? 85   LEU A CG  1 
ATOM   565  C CD1 . LEU A 1 85  ? -22.158 116.509 5.852   1.00 22.25  ? 85   LEU A CD1 1 
ATOM   566  C CD2 . LEU A 1 85  ? -22.953 118.729 6.660   1.00 22.36  ? 85   LEU A CD2 1 
ATOM   567  N N   . GLY A 1 86  ? -18.439 117.514 5.724   1.00 26.29  ? 86   GLY A N   1 
ATOM   568  C CA  . GLY A 1 86  ? -17.659 118.311 4.792   1.00 25.58  ? 86   GLY A CA  1 
ATOM   569  C C   . GLY A 1 86  ? -16.353 117.688 4.334   1.00 27.89  ? 86   GLY A C   1 
ATOM   570  O O   . GLY A 1 86  ? -15.697 118.202 3.426   1.00 25.63  ? 86   GLY A O   1 
ATOM   571  N N   . GLY A 1 87  ? -15.967 116.582 4.963   1.00 32.76  ? 87   GLY A N   1 
ATOM   572  C CA  . GLY A 1 87  ? -14.730 115.916 4.592   1.00 30.81  ? 87   GLY A CA  1 
ATOM   573  C C   . GLY A 1 87  ? -14.978 114.697 3.729   1.00 32.66  ? 87   GLY A C   1 
ATOM   574  O O   . GLY A 1 87  ? -15.966 114.637 2.998   1.00 32.01  ? 87   GLY A O   1 
ATOM   575  N N   . SER A 1 88  ? -14.085 113.718 3.811   1.00 34.89  ? 88   SER A N   1 
ATOM   576  C CA  . SER A 1 88  ? -14.231 112.502 3.025   1.00 37.79  ? 88   SER A CA  1 
ATOM   577  C C   . SER A 1 88  ? -15.526 111.781 3.383   1.00 36.05  ? 88   SER A C   1 
ATOM   578  O O   . SER A 1 88  ? -16.225 111.285 2.503   1.00 40.83  ? 88   SER A O   1 
ATOM   579  C CB  . SER A 1 88  ? -13.040 111.572 3.252   1.00 39.05  ? 88   SER A CB  1 
ATOM   580  O OG  . SER A 1 88  ? -12.588 111.639 4.592   1.00 50.52  ? 88   SER A OG  1 
ATOM   581  N N   . SER A 1 89  ? -15.848 111.728 4.671   1.00 33.54  ? 89   SER A N   1 
ATOM   582  C CA  . SER A 1 89  ? -17.069 111.065 5.111   1.00 34.29  ? 89   SER A CA  1 
ATOM   583  C C   . SER A 1 89  ? -17.769 111.773 6.278   1.00 32.32  ? 89   SER A C   1 
ATOM   584  O O   . SER A 1 89  ? -17.131 112.423 7.101   1.00 38.37  ? 89   SER A O   1 
ATOM   585  C CB  . SER A 1 89  ? -16.761 109.610 5.478   1.00 31.54  ? 89   SER A CB  1 
ATOM   586  O OG  . SER A 1 89  ? -16.370 109.488 6.830   1.00 34.16  ? 89   SER A OG  1 
ATOM   587  N N   . PHE A 1 90  ? -19.090 111.639 6.328   1.00 29.58  ? 90   PHE A N   1 
ATOM   588  C CA  . PHE A 1 90  ? -19.915 112.246 7.367   1.00 27.57  ? 90   PHE A CA  1 
ATOM   589  C C   . PHE A 1 90  ? -20.069 111.273 8.525   1.00 29.72  ? 90   PHE A C   1 
ATOM   590  O O   . PHE A 1 90  ? -20.770 110.270 8.413   1.00 26.49  ? 90   PHE A O   1 
ATOM   591  C CB  . PHE A 1 90  ? -21.296 112.592 6.786   1.00 30.06  ? 90   PHE A CB  1 
ATOM   592  C CG  . PHE A 1 90  ? -22.331 112.990 7.817   1.00 27.94  ? 90   PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 90  ? -22.043 113.930 8.801   1.00 32.60  ? 90   PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 90  ? -23.614 112.458 7.767   1.00 24.13  ? 90   PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 90  ? -23.023 114.335 9.714   1.00 29.07  ? 90   PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 90  ? -24.595 112.858 8.675   1.00 21.46  ? 90   PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 90  ? -24.299 113.795 9.646   1.00 21.12  ? 90   PHE A CZ  1 
ATOM   598  N N   . ARG A 1 91  ? -19.408 111.567 9.638   1.00 31.91  ? 91   ARG A N   1 
ATOM   599  C CA  . ARG A 1 91  ? -19.494 110.703 10.803  1.00 35.60  ? 91   ARG A CA  1 
ATOM   600  C C   . ARG A 1 91  ? -20.086 111.431 11.997  1.00 36.20  ? 91   ARG A C   1 
ATOM   601  O O   . ARG A 1 91  ? -20.102 112.661 12.044  1.00 38.53  ? 91   ARG A O   1 
ATOM   602  C CB  . ARG A 1 91  ? -18.110 110.175 11.167  1.00 40.56  ? 91   ARG A CB  1 
ATOM   603  C CG  . ARG A 1 91  ? -17.135 111.244 11.600  1.00 53.61  ? 91   ARG A CG  1 
ATOM   604  C CD  . ARG A 1 91  ? -15.753 110.660 11.860  1.00 65.17  ? 91   ARG A CD  1 
ATOM   605  N NE  . ARG A 1 91  ? -15.247 109.903 10.715  1.00 75.25  ? 91   ARG A NE  1 
ATOM   606  C CZ  . ARG A 1 91  ? -14.819 110.448 9.579   1.00 80.93  ? 91   ARG A CZ  1 
ATOM   607  N NH1 . ARG A 1 91  ? -14.830 111.768 9.418   1.00 80.97  ? 91   ARG A NH1 1 
ATOM   608  N NH2 . ARG A 1 91  ? -14.372 109.672 8.599   1.00 84.10  ? 91   ARG A NH2 1 
ATOM   609  N N   . ILE A 1 92  ? -20.583 110.665 12.960  1.00 36.16  ? 92   ILE A N   1 
ATOM   610  C CA  . ILE A 1 92  ? -21.152 111.246 14.169  1.00 37.81  ? 92   ILE A CA  1 
ATOM   611  C C   . ILE A 1 92  ? -20.512 110.592 15.385  1.00 35.54  ? 92   ILE A C   1 
ATOM   612  O O   . ILE A 1 92  ? -20.554 109.373 15.539  1.00 36.91  ? 92   ILE A O   1 
ATOM   613  C CB  . ILE A 1 92  ? -22.680 111.051 14.235  1.00 39.23  ? 92   ILE A CB  1 
ATOM   614  C CG1 . ILE A 1 92  ? -23.320 111.546 12.932  1.00 38.64  ? 92   ILE A CG1 1 
ATOM   615  C CG2 . ILE A 1 92  ? -23.243 111.799 15.447  1.00 33.94  ? 92   ILE A CG2 1 
ATOM   616  C CD1 . ILE A 1 92  ? -24.789 111.924 13.063  1.00 37.81  ? 92   ILE A CD1 1 
ATOM   617  N N   . LEU A 1 93  ? -19.921 111.410 16.247  1.00 35.98  ? 93   LEU A N   1 
ATOM   618  C CA  . LEU A 1 93  ? -19.255 110.899 17.432  1.00 37.47  ? 93   LEU A CA  1 
ATOM   619  C C   . LEU A 1 93  ? -19.890 111.316 18.738  1.00 41.04  ? 93   LEU A C   1 
ATOM   620  O O   . LEU A 1 93  ? -20.520 112.366 18.842  1.00 41.18  ? 93   LEU A O   1 
ATOM   621  C CB  . LEU A 1 93  ? -17.796 111.352 17.464  1.00 36.00  ? 93   LEU A CB  1 
ATOM   622  C CG  . LEU A 1 93  ? -17.038 111.479 16.147  1.00 38.97  ? 93   LEU A CG  1 
ATOM   623  C CD1 . LEU A 1 93  ? -17.383 112.788 15.455  1.00 35.18  ? 93   LEU A CD1 1 
ATOM   624  C CD2 . LEU A 1 93  ? -15.556 111.405 16.447  1.00 40.81  ? 93   LEU A CD2 1 
ATOM   625  N N   . ARG A 1 94  ? -19.718 110.461 19.735  1.00 48.19  ? 94   ARG A N   1 
ATOM   626  C CA  . ARG A 1 94  ? -20.193 110.736 21.074  1.00 52.80  ? 94   ARG A CA  1 
ATOM   627  C C   . ARG A 1 94  ? -18.920 110.679 21.902  1.00 52.70  ? 94   ARG A C   1 
ATOM   628  O O   . ARG A 1 94  ? -18.425 109.596 22.213  1.00 55.60  ? 94   ARG A O   1 
ATOM   629  C CB  . ARG A 1 94  ? -21.169 109.669 21.546  1.00 56.37  ? 94   ARG A CB  1 
ATOM   630  C CG  . ARG A 1 94  ? -21.981 110.098 22.761  1.00 61.98  ? 94   ARG A CG  1 
ATOM   631  C CD  . ARG A 1 94  ? -22.262 108.927 23.686  1.00 63.85  ? 94   ARG A CD  1 
ATOM   632  N NE  . ARG A 1 94  ? -22.598 109.361 25.039  1.00 67.43  ? 94   ARG A NE  1 
ATOM   633  C CZ  . ARG A 1 94  ? -23.278 108.619 25.907  1.00 67.83  ? 94   ARG A CZ  1 
ATOM   634  N NH1 . ARG A 1 94  ? -23.694 107.409 25.559  1.00 67.62  ? 94   ARG A NH1 1 
ATOM   635  N NH2 . ARG A 1 94  ? -23.540 109.083 27.120  1.00 68.16  ? 94   ARG A NH2 1 
ATOM   636  N N   . VAL A 1 95  ? -18.375 111.848 22.219  1.00 50.50  ? 95   VAL A N   1 
ATOM   637  C CA  . VAL A 1 95  ? -17.148 111.939 22.997  1.00 46.83  ? 95   VAL A CA  1 
ATOM   638  C C   . VAL A 1 95  ? -17.470 112.133 24.467  1.00 49.25  ? 95   VAL A C   1 
ATOM   639  O O   . VAL A 1 95  ? -18.428 112.823 24.821  1.00 45.41  ? 95   VAL A O   1 
ATOM   640  C CB  . VAL A 1 95  ? -16.262 113.112 22.511  1.00 41.96  ? 95   VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 95  ? -14.974 113.172 23.321  1.00 37.95  ? 95   VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 95  ? -15.945 112.941 21.038  1.00 38.48  ? 95   VAL A CG2 1 
ATOM   643  N N   . GLN A 1 96  ? -16.664 111.511 25.318  1.00 53.76  ? 96   GLN A N   1 
ATOM   644  C CA  . GLN A 1 96  ? -16.852 111.606 26.755  1.00 60.97  ? 96   GLN A CA  1 
ATOM   645  C C   . GLN A 1 96  ? -15.538 111.912 27.455  1.00 62.87  ? 96   GLN A C   1 
ATOM   646  O O   . GLN A 1 96  ? -14.706 111.026 27.651  1.00 62.94  ? 96   GLN A O   1 
ATOM   647  C CB  . GLN A 1 96  ? -17.429 110.300 27.295  1.00 67.12  ? 96   GLN A CB  1 
ATOM   648  C CG  . GLN A 1 96  ? -18.220 110.467 28.578  1.00 81.24  ? 96   GLN A CG  1 
ATOM   649  C CD  . GLN A 1 96  ? -19.326 109.439 28.717  1.00 87.68  ? 96   GLN A CD  1 
ATOM   650  O OE1 . GLN A 1 96  ? -19.435 108.514 27.908  1.00 92.37  ? 96   GLN A OE1 1 
ATOM   651  N NE2 . GLN A 1 96  ? -20.154 109.595 29.747  1.00 88.40  ? 96   GLN A NE2 1 
ATOM   652  N N   . VAL A 1 97  ? -15.354 113.177 27.821  1.00 69.78  ? 97   VAL A N   1 
ATOM   653  C CA  . VAL A 1 97  ? -14.147 113.625 28.514  1.00 73.69  ? 97   VAL A CA  1 
ATOM   654  C C   . VAL A 1 97  ? -14.482 113.759 29.995  1.00 76.62  ? 97   VAL A C   1 
ATOM   655  O O   . VAL A 1 97  ? -15.210 114.669 30.384  1.00 75.93  ? 97   VAL A O   1 
ATOM   656  C CB  . VAL A 1 97  ? -13.672 115.000 27.987  1.00 71.71  ? 97   VAL A CB  1 
ATOM   657  C CG1 . VAL A 1 97  ? -12.302 115.334 28.554  1.00 70.67  ? 97   VAL A CG1 1 
ATOM   658  C CG2 . VAL A 1 97  ? -13.633 114.987 26.469  1.00 70.32  ? 97   VAL A CG2 1 
ATOM   659  N N   . ASN A 1 98  ? -13.957 112.855 30.817  1.00 81.24  ? 98   ASN A N   1 
ATOM   660  C CA  . ASN A 1 98  ? -14.240 112.887 32.248  1.00 87.37  ? 98   ASN A CA  1 
ATOM   661  C C   . ASN A 1 98  ? -12.995 112.993 33.113  1.00 90.90  ? 98   ASN A C   1 
ATOM   662  O O   . ASN A 1 98  ? -11.874 113.063 32.605  1.00 91.21  ? 98   ASN A O   1 
ATOM   663  C CB  . ASN A 1 98  ? -15.042 111.647 32.657  1.00 87.60  ? 98   ASN A CB  1 
ATOM   664  C CG  . ASN A 1 98  ? -14.396 110.354 32.201  1.00 89.55  ? 98   ASN A CG  1 
ATOM   665  O OD1 . ASN A 1 98  ? -13.462 110.358 31.397  1.00 90.52  ? 98   ASN A OD1 1 
ATOM   666  N ND2 . ASN A 1 98  ? -14.894 109.236 32.714  1.00 89.39  ? 98   ASN A ND2 1 
ATOM   667  N N   . HIS A 1 99  ? -13.206 113.005 34.427  1.00 95.61  ? 99   HIS A N   1 
ATOM   668  C CA  . HIS A 1 99  ? -12.112 113.107 35.388  1.00 99.48  ? 99   HIS A CA  1 
ATOM   669  C C   . HIS A 1 99  ? -11.542 111.735 35.758  1.00 100.00 ? 99   HIS A C   1 
ATOM   670  O O   . HIS A 1 99  ? -12.271 110.829 36.172  1.00 100.00 ? 99   HIS A O   1 
ATOM   671  C CB  . HIS A 1 99  ? -12.579 113.853 36.653  1.00 100.00 ? 99   HIS A CB  1 
ATOM   672  C CG  . HIS A 1 99  ? -13.519 113.067 37.518  1.00 100.00 ? 99   HIS A CG  1 
ATOM   673  N ND1 . HIS A 1 99  ? -14.343 112.080 37.020  1.00 100.00 ? 99   HIS A ND1 1 
ATOM   674  C CD2 . HIS A 1 99  ? -13.764 113.126 38.849  1.00 100.00 ? 99   HIS A CD2 1 
ATOM   675  C CE1 . HIS A 1 99  ? -15.055 111.564 38.006  1.00 100.00 ? 99   HIS A CE1 1 
ATOM   676  N NE2 . HIS A 1 99  ? -14.723 112.181 39.127  1.00 100.00 ? 99   HIS A NE2 1 
ATOM   677  N N   . GLU A 1 100 ? -10.230 111.590 35.590  1.00 99.99  ? 100  GLU A N   1 
ATOM   678  C CA  . GLU A 1 100 ? -9.545  110.339 35.898  1.00 100.00 ? 100  GLU A CA  1 
ATOM   679  C C   . GLU A 1 100 ? -8.137  110.605 36.439  1.00 100.00 ? 100  GLU A C   1 
ATOM   680  O O   . GLU A 1 100 ? -7.655  111.741 36.433  1.00 100.00 ? 100  GLU A O   1 
ATOM   681  C CB  . GLU A 1 100 ? -9.462  109.453 34.643  1.00 100.00 ? 100  GLU A CB  1 
ATOM   682  C CG  . GLU A 1 100 ? -10.565 109.691 33.611  1.00 100.00 ? 100  GLU A CG  1 
ATOM   683  C CD  . GLU A 1 100 ? -11.496 108.498 33.454  1.00 100.00 ? 100  GLU A CD  1 
ATOM   684  O OE1 . GLU A 1 100 ? -12.016 108.003 34.480  1.00 100.00 ? 100  GLU A OE1 1 
ATOM   685  O OE2 . GLU A 1 100 ? -11.705 108.060 32.301  1.00 100.00 ? 100  GLU A OE2 1 
ATOM   686  N N   . LYS A 1 101 ? -7.483  109.544 36.905  1.00 99.99  ? 101  LYS A N   1 
ATOM   687  C CA  . LYS A 1 101 ? -6.133  109.648 37.446  1.00 100.00 ? 101  LYS A CA  1 
ATOM   688  C C   . LYS A 1 101 ? -5.092  109.319 36.377  1.00 100.00 ? 101  LYS A C   1 
ATOM   689  O O   . LYS A 1 101 ? -4.417  108.287 36.446  1.00 100.00 ? 101  LYS A O   1 
ATOM   690  C CB  . LYS A 1 101 ? -5.969  108.699 38.637  1.00 100.00 ? 101  LYS A CB  1 
ATOM   691  C CG  . LYS A 1 101 ? -6.767  109.102 39.872  1.00 100.00 ? 101  LYS A CG  1 
ATOM   692  C CD  . LYS A 1 101 ? -6.065  108.665 41.155  1.00 100.00 ? 101  LYS A CD  1 
ATOM   693  C CE  . LYS A 1 101 ? -4.854  109.542 41.451  1.00 100.00 ? 101  LYS A CE  1 
ATOM   694  N NZ  . LYS A 1 101 ? -3.879  108.884 42.366  1.00 100.00 ? 101  LYS A NZ  1 
ATOM   695  N N   . ASN A 1 102 ? -4.979  110.202 35.389  1.00 100.00 ? 102  ASN A N   1 
ATOM   696  C CA  . ASN A 1 102 ? -4.027  110.038 34.293  1.00 100.00 ? 102  ASN A CA  1 
ATOM   697  C C   . ASN A 1 102 ? -4.436  108.969 33.282  1.00 100.00 ? 102  ASN A C   1 
ATOM   698  O O   . ASN A 1 102 ? -3.581  108.326 32.668  1.00 100.00 ? 102  ASN A O   1 
ATOM   699  C CB  . ASN A 1 102 ? -2.633  109.714 34.843  1.00 100.00 ? 102  ASN A CB  1 
ATOM   700  C CG  . ASN A 1 102 ? -1.520  110.278 33.980  1.00 100.00 ? 102  ASN A CG  1 
ATOM   701  O OD1 . ASN A 1 102 ? -0.337  110.054 34.246  1.00 100.00 ? 102  ASN A OD1 1 
ATOM   702  N ND2 . ASN A 1 102 ? -1.893  111.016 32.937  1.00 100.00 ? 102  ASN A ND2 1 
ATOM   703  N N   . GLN A 1 103 ? -5.738  108.772 33.112  1.00 99.24  ? 103  GLN A N   1 
ATOM   704  C CA  . GLN A 1 103 ? -6.219  107.791 32.150  1.00 99.06  ? 103  GLN A CA  1 
ATOM   705  C C   . GLN A 1 103 ? -7.009  108.475 31.031  1.00 100.00 ? 103  GLN A C   1 
ATOM   706  O O   . GLN A 1 103 ? -7.628  109.521 31.236  1.00 100.00 ? 103  GLN A O   1 
ATOM   707  C CB  . GLN A 1 103 ? -7.037  106.706 32.856  1.00 98.19  ? 103  GLN A CB  1 
ATOM   708  C CG  . GLN A 1 103 ? -6.156  105.551 33.331  1.00 96.56  ? 103  GLN A CG  1 
ATOM   709  C CD  . GLN A 1 103 ? -6.934  104.400 33.937  1.00 98.47  ? 103  GLN A CD  1 
ATOM   710  O OE1 . GLN A 1 103 ? -6.364  103.357 34.264  1.00 98.16  ? 103  GLN A OE1 1 
ATOM   711  N NE2 . GLN A 1 103 ? -8.240  104.583 34.094  1.00 99.71  ? 103  GLN A NE2 1 
ATOM   712  N N   . ASN A 1 104 ? -6.970  107.864 29.849  1.00 100.00 ? 104  ASN A N   1 
ATOM   713  C CA  . ASN A 1 104 ? -7.588  108.384 28.626  1.00 100.00 ? 104  ASN A CA  1 
ATOM   714  C C   . ASN A 1 104 ? -9.071  108.771 28.682  1.00 99.99  ? 104  ASN A C   1 
ATOM   715  O O   . ASN A 1 104 ? -9.738  108.662 29.720  1.00 100.00 ? 104  ASN A O   1 
ATOM   716  C CB  . ASN A 1 104 ? -7.356  107.387 27.481  1.00 99.83  ? 104  ASN A CB  1 
ATOM   717  C CG  . ASN A 1 104 ? -5.884  107.146 27.204  1.00 99.89  ? 104  ASN A CG  1 
ATOM   718  O OD1 . ASN A 1 104 ? -5.509  106.171 26.553  1.00 99.63  ? 104  ASN A OD1 1 
ATOM   719  N ND2 . ASN A 1 104 ? -5.039  108.041 27.699  1.00 100.00 ? 104  ASN A ND2 1 
ATOM   720  N N   . VAL A 1 105 ? -9.554  109.230 27.523  1.00 99.99  ? 105  VAL A N   1 
ATOM   721  C CA  . VAL A 1 105 ? -10.935 109.668 27.297  1.00 99.17  ? 105  VAL A CA  1 
ATOM   722  C C   . VAL A 1 105 ? -11.636 108.699 26.334  1.00 97.66  ? 105  VAL A C   1 
ATOM   723  O O   . VAL A 1 105 ? -11.019 108.192 25.392  1.00 96.82  ? 105  VAL A O   1 
ATOM   724  C CB  . VAL A 1 105 ? -10.955 111.092 26.679  1.00 98.12  ? 105  VAL A CB  1 
ATOM   725  C CG1 . VAL A 1 105 ? -12.266 111.345 25.952  1.00 96.97  ? 105  VAL A CG1 1 
ATOM   726  C CG2 . VAL A 1 105 ? -10.738 112.127 27.765  1.00 99.79  ? 105  VAL A CG2 1 
ATOM   727  N N   . HIS A 1 106 ? -12.923 108.454 26.567  1.00 95.20  ? 106  HIS A N   1 
ATOM   728  C CA  . HIS A 1 106 ? -13.692 107.539 25.726  1.00 93.48  ? 106  HIS A CA  1 
ATOM   729  C C   . HIS A 1 106 ? -14.532 108.248 24.667  1.00 89.90  ? 106  HIS A C   1 
ATOM   730  O O   . HIS A 1 106 ? -15.020 109.359 24.880  1.00 90.54  ? 106  HIS A O   1 
ATOM   731  C CB  . HIS A 1 106 ? -14.608 106.666 26.596  1.00 95.74  ? 106  HIS A CB  1 
ATOM   732  C CG  . HIS A 1 106 ? -15.401 105.659 25.821  1.00 98.68  ? 106  HIS A CG  1 
ATOM   733  N ND1 . HIS A 1 106 ? -14.933 104.395 25.539  1.00 99.78  ? 106  HIS A ND1 1 
ATOM   734  C CD2 . HIS A 1 106 ? -16.635 105.737 25.259  1.00 99.98  ? 106  HIS A CD2 1 
ATOM   735  C CE1 . HIS A 1 106 ? -15.838 103.736 24.840  1.00 100.00 ? 106  HIS A CE1 1 
ATOM   736  N NE2 . HIS A 1 106 ? -16.879 104.525 24.655  1.00 100.00 ? 106  HIS A NE2 1 
ATOM   737  N N   . MET A 1 107 ? -14.699 107.587 23.525  1.00 86.17  ? 107  MET A N   1 
ATOM   738  C CA  . MET A 1 107 ? -15.490 108.129 22.428  1.00 82.17  ? 107  MET A CA  1 
ATOM   739  C C   . MET A 1 107 ? -15.751 107.082 21.346  1.00 77.57  ? 107  MET A C   1 
ATOM   740  O O   . MET A 1 107 ? -14.936 106.188 21.116  1.00 72.72  ? 107  MET A O   1 
ATOM   741  C CB  . MET A 1 107 ? -14.785 109.348 21.821  1.00 85.86  ? 107  MET A CB  1 
ATOM   742  C CG  . MET A 1 107 ? -13.629 109.016 20.892  1.00 88.02  ? 107  MET A CG  1 
ATOM   743  S SD  . MET A 1 107 ? -13.490 110.191 19.540  1.00 90.07  ? 107  MET A SD  1 
ATOM   744  C CE  . MET A 1 107 ? -12.038 111.132 20.042  1.00 91.60  ? 107  MET A CE  1 
ATOM   745  N N   . GLU A 1 108 ? -16.900 107.199 20.692  1.00 76.27  ? 108  GLU A N   1 
ATOM   746  C CA  . GLU A 1 108 ? -17.285 106.280 19.629  1.00 75.11  ? 108  GLU A CA  1 
ATOM   747  C C   . GLU A 1 108 ? -17.860 107.095 18.480  1.00 74.92  ? 108  GLU A C   1 
ATOM   748  O O   . GLU A 1 108 ? -18.445 108.154 18.700  1.00 79.83  ? 108  GLU A O   1 
ATOM   749  C CB  . GLU A 1 108 ? -18.331 105.293 20.138  1.00 74.89  ? 108  GLU A CB  1 
ATOM   750  C CG  . GLU A 1 108 ? -19.626 105.949 20.575  1.00 78.91  ? 108  GLU A CG  1 
ATOM   751  C CD  . GLU A 1 108 ? -20.492 105.024 21.403  1.00 84.67  ? 108  GLU A CD  1 
ATOM   752  O OE1 . GLU A 1 108 ? -20.008 104.530 22.447  1.00 88.07  ? 108  GLU A OE1 1 
ATOM   753  O OE2 . GLU A 1 108 ? -21.657 104.791 21.009  1.00 87.27  ? 108  GLU A OE2 1 
ATOM   754  N N   . SER A 1 109 ? -17.702 106.597 17.259  1.00 71.11  ? 109  SER A N   1 
ATOM   755  C CA  . SER A 1 109 ? -18.197 107.305 16.086  1.00 67.74  ? 109  SER A CA  1 
ATOM   756  C C   . SER A 1 109 ? -18.930 106.394 15.113  1.00 66.69  ? 109  SER A C   1 
ATOM   757  O O   . SER A 1 109 ? -18.791 105.173 15.161  1.00 70.46  ? 109  SER A O   1 
ATOM   758  C CB  . SER A 1 109 ? -17.031 107.973 15.357  1.00 66.27  ? 109  SER A CB  1 
ATOM   759  O OG  . SER A 1 109 ? -16.360 107.043 14.524  1.00 61.06  ? 109  SER A OG  1 
ATOM   760  N N   . GLU A 1 110 ? -19.711 107.000 14.228  1.00 64.58  ? 110  GLU A N   1 
ATOM   761  C CA  . GLU A 1 110 ? -20.452 106.252 13.225  1.00 60.38  ? 110  GLU A CA  1 
ATOM   762  C C   . GLU A 1 110 ? -20.560 107.062 11.942  1.00 53.07  ? 110  GLU A C   1 
ATOM   763  O O   . GLU A 1 110 ? -20.936 108.231 11.966  1.00 52.40  ? 110  GLU A O   1 
ATOM   764  C CB  . GLU A 1 110 ? -21.843 105.894 13.744  1.00 66.55  ? 110  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 110 ? -22.089 104.393 13.799  1.00 76.46  ? 110  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 110 ? -23.558 104.045 13.826  1.00 81.47  ? 110  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 110 ? -24.249 104.491 14.766  1.00 87.66  ? 110  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 110 ? -24.019 103.329 12.910  1.00 82.93  ? 110  GLU A OE2 1 
ATOM   769  N N   . VAL A 1 111 ? -20.221 106.426 10.826  1.00 47.44  ? 111  VAL A N   1 
ATOM   770  C CA  . VAL A 1 111 ? -20.250 107.068 9.522   1.00 47.38  ? 111  VAL A CA  1 
ATOM   771  C C   . VAL A 1 111 ? -21.565 106.816 8.802   1.00 51.44  ? 111  VAL A C   1 
ATOM   772  O O   . VAL A 1 111 ? -21.994 105.672 8.664   1.00 56.54  ? 111  VAL A O   1 
ATOM   773  C CB  . VAL A 1 111 ? -19.106 106.553 8.631   1.00 43.71  ? 111  VAL A CB  1 
ATOM   774  C CG1 . VAL A 1 111 ? -19.092 107.309 7.317   1.00 54.63  ? 111  VAL A CG1 1 
ATOM   775  C CG2 . VAL A 1 111 ? -17.780 106.716 9.342   1.00 46.73  ? 111  VAL A CG2 1 
ATOM   776  N N   . TYR A 1 112 ? -22.199 107.892 8.342   1.00 52.61  ? 112  TYR A N   1 
ATOM   777  C CA  . TYR A 1 112 ? -23.466 107.792 7.627   1.00 52.34  ? 112  TYR A CA  1 
ATOM   778  C C   . TYR A 1 112 ? -23.258 108.119 6.154   1.00 54.28  ? 112  TYR A C   1 
ATOM   779  O O   . TYR A 1 112 ? -22.673 109.143 5.811   1.00 53.92  ? 112  TYR A O   1 
ATOM   780  C CB  . TYR A 1 112 ? -24.494 108.751 8.234   1.00 49.62  ? 112  TYR A CB  1 
ATOM   781  C CG  . TYR A 1 112 ? -24.918 108.383 9.639   1.00 49.43  ? 112  TYR A CG  1 
ATOM   782  C CD1 . TYR A 1 112 ? -24.117 108.700 10.736  1.00 51.77  ? 112  TYR A CD1 1 
ATOM   783  C CD2 . TYR A 1 112 ? -26.118 107.716 9.875   1.00 49.69  ? 112  TYR A CD2 1 
ATOM   784  C CE1 . TYR A 1 112 ? -24.502 108.359 12.036  1.00 49.83  ? 112  TYR A CE1 1 
ATOM   785  C CE2 . TYR A 1 112 ? -26.512 107.371 11.169  1.00 47.95  ? 112  TYR A CE2 1 
ATOM   786  C CZ  . TYR A 1 112 ? -25.700 107.695 12.242  1.00 47.71  ? 112  TYR A CZ  1 
ATOM   787  O OH  . TYR A 1 112 ? -26.087 107.356 13.519  1.00 45.23  ? 112  TYR A OH  1 
ATOM   788  N N   . ASP A 1 113 ? -23.730 107.237 5.281   1.00 59.52  ? 113  ASP A N   1 
ATOM   789  C CA  . ASP A 1 113 ? -23.586 107.448 3.849   1.00 62.98  ? 113  ASP A CA  1 
ATOM   790  C C   . ASP A 1 113 ? -24.381 108.670 3.414   1.00 61.86  ? 113  ASP A C   1 
ATOM   791  O O   . ASP A 1 113 ? -25.550 108.814 3.765   1.00 65.93  ? 113  ASP A O   1 
ATOM   792  C CB  . ASP A 1 113 ? -24.082 106.222 3.081   1.00 71.94  ? 113  ASP A CB  1 
ATOM   793  C CG  . ASP A 1 113 ? -24.134 106.459 1.580   1.00 81.34  ? 113  ASP A CG  1 
ATOM   794  O OD1 . ASP A 1 113 ? -23.102 106.885 1.013   1.00 84.10  ? 113  ASP A OD1 1 
ATOM   795  O OD2 . ASP A 1 113 ? -25.203 106.221 0.970   1.00 85.57  ? 113  ASP A OD2 1 
ATOM   796  N N   . THR A 1 114 ? -23.745 109.550 2.650   1.00 59.53  ? 114  THR A N   1 
ATOM   797  C CA  . THR A 1 114 ? -24.419 110.746 2.169   1.00 60.56  ? 114  THR A CA  1 
ATOM   798  C C   . THR A 1 114 ? -24.340 110.793 0.653   1.00 62.57  ? 114  THR A C   1 
ATOM   799  O O   . THR A 1 114 ? -23.329 111.201 0.086   1.00 65.25  ? 114  THR A O   1 
ATOM   800  C CB  . THR A 1 114 ? -23.784 112.026 2.735   1.00 60.81  ? 114  THR A CB  1 
ATOM   801  O OG1 . THR A 1 114 ? -23.916 112.032 4.160   1.00 64.38  ? 114  THR A OG1 1 
ATOM   802  C CG2 . THR A 1 114 ? -24.475 113.257 2.168   1.00 59.85  ? 114  THR A CG2 1 
ATOM   803  N N   . PRO A 1 115 ? -25.415 110.366 -0.021  1.00 62.43  ? 115  PRO A N   1 
ATOM   804  C CA  . PRO A 1 115 ? -25.521 110.336 -1.482  1.00 63.20  ? 115  PRO A CA  1 
ATOM   805  C C   . PRO A 1 115 ? -24.946 111.570 -2.174  1.00 64.10  ? 115  PRO A C   1 
ATOM   806  O O   . PRO A 1 115 ? -25.224 112.699 -1.781  1.00 65.09  ? 115  PRO A O   1 
ATOM   807  C CB  . PRO A 1 115 ? -27.016 110.188 -1.717  1.00 67.16  ? 115  PRO A CB  1 
ATOM   808  C CG  . PRO A 1 115 ? -27.484 109.409 -0.530  1.00 67.39  ? 115  PRO A CG  1 
ATOM   809  C CD  . PRO A 1 115 ? -26.639 109.862 0.626   1.00 63.40  ? 115  PRO A CD  1 
ATOM   810  N N   . GLU A 1 116 ? -24.145 111.347 -3.211  1.00 65.58  ? 116  GLU A N   1 
ATOM   811  C CA  . GLU A 1 116 ? -23.539 112.448 -3.943  1.00 69.78  ? 116  GLU A CA  1 
ATOM   812  C C   . GLU A 1 116 ? -24.612 113.390 -4.466  1.00 70.41  ? 116  GLU A C   1 
ATOM   813  O O   . GLU A 1 116 ? -24.353 114.571 -4.700  1.00 73.01  ? 116  GLU A O   1 
ATOM   814  C CB  . GLU A 1 116 ? -22.705 111.919 -5.112  1.00 77.06  ? 116  GLU A CB  1 
ATOM   815  C CG  . GLU A 1 116 ? -22.017 113.010 -5.933  1.00 89.80  ? 116  GLU A CG  1 
ATOM   816  C CD  . GLU A 1 116 ? -20.649 113.402 -5.384  1.00 96.94  ? 116  GLU A CD  1 
ATOM   817  O OE1 . GLU A 1 116 ? -20.445 113.299 -4.154  1.00 99.14  ? 116  GLU A OE1 1 
ATOM   818  O OE2 . GLU A 1 116 ? -19.779 113.815 -6.185  1.00 99.89  ? 116  GLU A OE2 1 
ATOM   819  N N   . ASN A 1 117 ? -25.820 112.866 -4.646  1.00 69.34  ? 117  ASN A N   1 
ATOM   820  C CA  . ASN A 1 117 ? -26.926 113.676 -5.138  1.00 66.27  ? 117  ASN A CA  1 
ATOM   821  C C   . ASN A 1 117 ? -27.652 114.363 -3.987  1.00 62.67  ? 117  ASN A C   1 
ATOM   822  O O   . ASN A 1 117 ? -28.742 114.909 -4.167  1.00 66.52  ? 117  ASN A O   1 
ATOM   823  C CB  . ASN A 1 117 ? -27.906 112.811 -5.935  1.00 69.00  ? 117  ASN A CB  1 
ATOM   824  C CG  . ASN A 1 117 ? -28.512 111.701 -5.103  1.00 73.21  ? 117  ASN A CG  1 
ATOM   825  O OD1 . ASN A 1 117 ? -29.211 111.957 -4.121  1.00 74.99  ? 117  ASN A OD1 1 
ATOM   826  N ND2 . ASN A 1 117 ? -28.250 110.456 -5.493  1.00 75.40  ? 117  ASN A ND2 1 
ATOM   827  N N   . ILE A 1 118 ? -27.043 114.328 -2.805  1.00 57.46  ? 118  ILE A N   1 
ATOM   828  C CA  . ILE A 1 118 ? -27.607 114.963 -1.615  1.00 50.40  ? 118  ILE A CA  1 
ATOM   829  C C   . ILE A 1 118 ? -26.801 116.219 -1.281  1.00 48.26  ? 118  ILE A C   1 
ATOM   830  O O   . ILE A 1 118 ? -27.339 117.175 -0.719  1.00 47.77  ? 118  ILE A O   1 
ATOM   831  C CB  . ILE A 1 118 ? -27.576 114.016 -0.391  1.00 49.48  ? 118  ILE A CB  1 
ATOM   832  C CG1 . ILE A 1 118 ? -28.794 113.097 -0.414  1.00 48.29  ? 118  ILE A CG1 1 
ATOM   833  C CG2 . ILE A 1 118 ? -27.566 114.822 0.903   1.00 47.36  ? 118  ILE A CG2 1 
ATOM   834  C CD1 . ILE A 1 118 ? -28.947 112.260 0.843   1.00 53.32  ? 118  ILE A CD1 1 
ATOM   835  N N   . VAL A 1 119 ? -25.513 116.205 -1.621  1.00 43.46  ? 119  VAL A N   1 
ATOM   836  C CA  . VAL A 1 119 ? -24.645 117.347 -1.361  1.00 42.81  ? 119  VAL A CA  1 
ATOM   837  C C   . VAL A 1 119 ? -24.701 118.332 -2.524  1.00 46.41  ? 119  VAL A C   1 
ATOM   838  O O   . VAL A 1 119 ? -23.991 119.335 -2.536  1.00 45.79  ? 119  VAL A O   1 
ATOM   839  C CB  . VAL A 1 119 ? -23.170 116.912 -1.115  1.00 40.54  ? 119  VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 119 ? -23.120 115.796 -0.078  1.00 33.69  ? 119  VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 119 ? -22.523 116.465 -2.416  1.00 38.92  ? 119  VAL A CG2 1 
ATOM   842  N N   . HIS A 1 120 ? -25.546 118.031 -3.506  1.00 52.31  ? 120  HIS A N   1 
ATOM   843  C CA  . HIS A 1 120 ? -25.731 118.898 -4.670  1.00 57.80  ? 120  HIS A CA  1 
ATOM   844  C C   . HIS A 1 120 ? -27.197 119.304 -4.738  1.00 57.46  ? 120  HIS A C   1 
ATOM   845  O O   . HIS A 1 120 ? -27.635 119.936 -5.700  1.00 58.79  ? 120  HIS A O   1 
ATOM   846  C CB  . HIS A 1 120 ? -25.351 118.175 -5.964  1.00 59.92  ? 120  HIS A CB  1 
ATOM   847  C CG  . HIS A 1 120 ? -23.902 117.825 -6.056  1.00 65.12  ? 120  HIS A CG  1 
ATOM   848  N ND1 . HIS A 1 120 ? -23.458 116.606 -6.523  1.00 68.74  ? 120  HIS A ND1 1 
ATOM   849  C CD2 . HIS A 1 120 ? -22.792 118.527 -5.721  1.00 68.25  ? 120  HIS A CD2 1 
ATOM   850  C CE1 . HIS A 1 120 ? -22.140 116.572 -6.470  1.00 70.48  ? 120  HIS A CE1 1 
ATOM   851  N NE2 . HIS A 1 120 ? -21.710 117.723 -5.988  1.00 70.00  ? 120  HIS A NE2 1 
ATOM   852  N N   . GLY A 1 121 ? -27.948 118.927 -3.705  1.00 57.05  ? 121  GLY A N   1 
ATOM   853  C CA  . GLY A 1 121 ? -29.360 119.248 -3.647  1.00 52.07  ? 121  GLY A CA  1 
ATOM   854  C C   . GLY A 1 121 ? -29.656 120.557 -2.941  1.00 48.82  ? 121  GLY A C   1 
ATOM   855  O O   . GLY A 1 121 ? -28.895 121.519 -3.041  1.00 45.16  ? 121  GLY A O   1 
ATOM   856  N N   . SER A 1 122 ? -30.773 120.588 -2.224  1.00 46.45  ? 122  SER A N   1 
ATOM   857  C CA  . SER A 1 122 ? -31.186 121.782 -1.505  1.00 44.59  ? 122  SER A CA  1 
ATOM   858  C C   . SER A 1 122 ? -30.667 121.769 -0.075  1.00 46.66  ? 122  SER A C   1 
ATOM   859  O O   . SER A 1 122 ? -30.484 120.704 0.525   1.00 44.84  ? 122  SER A O   1 
ATOM   860  C CB  . SER A 1 122 ? -32.714 121.882 -1.494  1.00 43.79  ? 122  SER A CB  1 
ATOM   861  O OG  . SER A 1 122 ? -33.294 120.815 -0.754  1.00 39.06  ? 122  SER A OG  1 
ATOM   862  N N   . GLY A 1 123 ? -30.430 122.958 0.466   1.00 45.94  ? 123  GLY A N   1 
ATOM   863  C CA  . GLY A 1 123 ? -29.952 123.051 1.828   1.00 48.68  ? 123  GLY A CA  1 
ATOM   864  C C   . GLY A 1 123 ? -30.897 122.278 2.718   1.00 50.28  ? 123  GLY A C   1 
ATOM   865  O O   . GLY A 1 123 ? -30.468 121.536 3.598   1.00 53.33  ? 123  GLY A O   1 
ATOM   866  N N   . SER A 1 124 ? -32.191 122.445 2.464   1.00 54.42  ? 124  SER A N   1 
ATOM   867  C CA  . SER A 1 124 ? -33.243 121.775 3.228   1.00 59.45  ? 124  SER A CA  1 
ATOM   868  C C   . SER A 1 124 ? -33.048 120.259 3.339   1.00 58.64  ? 124  SER A C   1 
ATOM   869  O O   . SER A 1 124 ? -32.977 119.706 4.442   1.00 58.35  ? 124  SER A O   1 
ATOM   870  C CB  . SER A 1 124 ? -34.606 122.069 2.594   1.00 61.12  ? 124  SER A CB  1 
ATOM   871  O OG  . SER A 1 124 ? -34.470 122.376 1.216   1.00 66.81  ? 124  SER A OG  1 
ATOM   872  N N   . GLN A 1 125 ? -32.978 119.589 2.193   1.00 55.62  ? 125  GLN A N   1 
ATOM   873  C CA  . GLN A 1 125 ? -32.785 118.149 2.184   1.00 49.99  ? 125  GLN A CA  1 
ATOM   874  C C   . GLN A 1 125 ? -31.511 117.776 2.939   1.00 45.81  ? 125  GLN A C   1 
ATOM   875  O O   . GLN A 1 125 ? -31.514 116.838 3.730   1.00 46.33  ? 125  GLN A O   1 
ATOM   876  C CB  . GLN A 1 125 ? -32.690 117.633 0.749   1.00 55.92  ? 125  GLN A CB  1 
ATOM   877  C CG  . GLN A 1 125 ? -33.943 117.830 -0.084  1.00 63.25  ? 125  GLN A CG  1 
ATOM   878  C CD  . GLN A 1 125 ? -33.832 117.161 -1.443  1.00 69.85  ? 125  GLN A CD  1 
ATOM   879  O OE1 . GLN A 1 125 ? -34.409 116.097 -1.672  1.00 73.18  ? 125  GLN A OE1 1 
ATOM   880  N NE2 . GLN A 1 125 ? -33.081 117.779 -2.351  1.00 71.07  ? 125  GLN A NE2 1 
ATOM   881  N N   . LEU A 1 126 ? -30.431 118.522 2.705   1.00 38.89  ? 126  LEU A N   1 
ATOM   882  C CA  . LEU A 1 126 ? -29.151 118.241 3.352   1.00 34.03  ? 126  LEU A CA  1 
ATOM   883  C C   . LEU A 1 126 ? -29.183 118.293 4.874   1.00 32.72  ? 126  LEU A C   1 
ATOM   884  O O   . LEU A 1 126 ? -28.641 117.411 5.547   1.00 27.30  ? 126  LEU A O   1 
ATOM   885  C CB  . LEU A 1 126 ? -28.066 119.205 2.851   1.00 31.01  ? 126  LEU A CB  1 
ATOM   886  C CG  . LEU A 1 126 ? -26.749 119.139 3.640   1.00 27.55  ? 126  LEU A CG  1 
ATOM   887  C CD1 . LEU A 1 126 ? -26.134 117.757 3.508   1.00 26.36  ? 126  LEU A CD1 1 
ATOM   888  C CD2 . LEU A 1 126 ? -25.785 120.192 3.132   1.00 26.03  ? 126  LEU A CD2 1 
ATOM   889  N N   . PHE A 1 127 ? -29.809 119.328 5.421   1.00 32.96  ? 127  PHE A N   1 
ATOM   890  C CA  . PHE A 1 127 ? -29.863 119.472 6.867   1.00 38.33  ? 127  PHE A CA  1 
ATOM   891  C C   . PHE A 1 127 ? -30.877 118.535 7.485   1.00 40.34  ? 127  PHE A C   1 
ATOM   892  O O   . PHE A 1 127 ? -30.771 118.177 8.657   1.00 43.72  ? 127  PHE A O   1 
ATOM   893  C CB  . PHE A 1 127 ? -30.131 120.934 7.242   1.00 37.59  ? 127  PHE A CB  1 
ATOM   894  C CG  . PHE A 1 127 ? -28.928 121.813 7.059   1.00 33.53  ? 127  PHE A CG  1 
ATOM   895  C CD1 . PHE A 1 127 ? -27.825 121.673 7.894   1.00 29.78  ? 127  PHE A CD1 1 
ATOM   896  C CD2 . PHE A 1 127 ? -28.845 122.690 5.985   1.00 33.69  ? 127  PHE A CD2 1 
ATOM   897  C CE1 . PHE A 1 127 ? -26.658 122.383 7.657   1.00 29.07  ? 127  PHE A CE1 1 
ATOM   898  C CE2 . PHE A 1 127 ? -27.677 123.407 5.738   1.00 33.67  ? 127  PHE A CE2 1 
ATOM   899  C CZ  . PHE A 1 127 ? -26.581 123.250 6.576   1.00 31.93  ? 127  PHE A CZ  1 
ATOM   900  N N   . ASP A 1 128 ? -31.855 118.124 6.689   1.00 42.27  ? 128  ASP A N   1 
ATOM   901  C CA  . ASP A 1 128 ? -32.858 117.188 7.168   1.00 44.62  ? 128  ASP A CA  1 
ATOM   902  C C   . ASP A 1 128 ? -32.213 115.799 7.206   1.00 45.18  ? 128  ASP A C   1 
ATOM   903  O O   . ASP A 1 128 ? -32.566 114.949 8.030   1.00 47.55  ? 128  ASP A O   1 
ATOM   904  C CB  . ASP A 1 128 ? -34.064 117.202 6.238   1.00 43.84  ? 128  ASP A CB  1 
ATOM   905  C CG  . ASP A 1 128 ? -35.132 118.165 6.705   1.00 47.23  ? 128  ASP A CG  1 
ATOM   906  O OD1 . ASP A 1 128 ? -35.402 118.208 7.927   1.00 51.68  ? 128  ASP A OD1 1 
ATOM   907  O OD2 . ASP A 1 128 ? -35.698 118.881 5.855   1.00 48.83  ? 128  ASP A OD2 1 
ATOM   908  N N   . HIS A 1 129 ? -31.256 115.594 6.306   1.00 43.99  ? 129  HIS A N   1 
ATOM   909  C CA  . HIS A 1 129 ? -30.510 114.347 6.207   1.00 42.27  ? 129  HIS A CA  1 
ATOM   910  C C   . HIS A 1 129 ? -29.613 114.261 7.429   1.00 41.72  ? 129  HIS A C   1 
ATOM   911  O O   . HIS A 1 129 ? -29.536 113.223 8.087   1.00 38.22  ? 129  HIS A O   1 
ATOM   912  C CB  . HIS A 1 129 ? -29.655 114.360 4.938   1.00 47.39  ? 129  HIS A CB  1 
ATOM   913  C CG  . HIS A 1 129 ? -28.747 113.176 4.796   1.00 53.01  ? 129  HIS A CG  1 
ATOM   914  N ND1 . HIS A 1 129 ? -29.122 111.898 5.151   1.00 54.29  ? 129  HIS A ND1 1 
ATOM   915  C CD2 . HIS A 1 129 ? -27.487 113.076 4.309   1.00 52.27  ? 129  HIS A CD2 1 
ATOM   916  C CE1 . HIS A 1 129 ? -28.133 111.063 4.890   1.00 54.98  ? 129  HIS A CE1 1 
ATOM   917  N NE2 . HIS A 1 129 ? -27.128 111.752 4.378   1.00 53.42  ? 129  HIS A NE2 1 
ATOM   918  N N   . VAL A 1 130 ? -28.936 115.368 7.723   1.00 41.13  ? 130  VAL A N   1 
ATOM   919  C CA  . VAL A 1 130 ? -28.042 115.442 8.867   1.00 40.22  ? 130  VAL A CA  1 
ATOM   920  C C   . VAL A 1 130 ? -28.853 115.242 10.144  1.00 42.35  ? 130  VAL A C   1 
ATOM   921  O O   . VAL A 1 130 ? -28.403 114.582 11.080  1.00 43.42  ? 130  VAL A O   1 
ATOM   922  C CB  . VAL A 1 130 ? -27.326 116.810 8.926   1.00 38.71  ? 130  VAL A CB  1 
ATOM   923  C CG1 . VAL A 1 130 ? -26.505 116.909 10.197  1.00 31.59  ? 130  VAL A CG1 1 
ATOM   924  C CG2 . VAL A 1 130 ? -26.433 116.986 7.704   1.00 38.15  ? 130  VAL A CG2 1 
ATOM   925  N N   . ALA A 1 131 ? -30.051 115.816 10.175  1.00 42.53  ? 131  ALA A N   1 
ATOM   926  C CA  . ALA A 1 131 ? -30.924 115.689 11.333  1.00 45.21  ? 131  ALA A CA  1 
ATOM   927  C C   . ALA A 1 131 ? -31.365 114.239 11.457  1.00 48.70  ? 131  ALA A C   1 
ATOM   928  O O   . ALA A 1 131 ? -31.297 113.642 12.536  1.00 49.05  ? 131  ALA A O   1 
ATOM   929  C CB  . ALA A 1 131 ? -32.134 116.587 11.170  1.00 45.44  ? 131  ALA A CB  1 
ATOM   930  N N   . GLU A 1 132 ? -31.819 113.685 10.336  1.00 50.40  ? 132  GLU A N   1 
ATOM   931  C CA  . GLU A 1 132 ? -32.280 112.303 10.270  1.00 51.31  ? 132  GLU A CA  1 
ATOM   932  C C   . GLU A 1 132 ? -31.205 111.341 10.768  1.00 47.74  ? 132  GLU A C   1 
ATOM   933  O O   . GLU A 1 132 ? -31.502 110.365 11.452  1.00 44.15  ? 132  GLU A O   1 
ATOM   934  C CB  . GLU A 1 132 ? -32.664 111.957 8.829   1.00 52.89  ? 132  GLU A CB  1 
ATOM   935  C CG  . GLU A 1 132 ? -32.584 110.479 8.495   1.00 63.59  ? 132  GLU A CG  1 
ATOM   936  C CD  . GLU A 1 132 ? -33.352 110.128 7.237   1.00 71.28  ? 132  GLU A CD  1 
ATOM   937  O OE1 . GLU A 1 132 ? -34.155 110.968 6.778   1.00 77.87  ? 132  GLU A OE1 1 
ATOM   938  O OE2 . GLU A 1 132 ? -33.153 109.015 6.705   1.00 75.23  ? 132  GLU A OE2 1 
ATOM   939  N N   . CYS A 1 133 ? -29.956 111.626 10.417  1.00 47.13  ? 133  CYS A N   1 
ATOM   940  C CA  . CYS A 1 133 ? -28.838 110.793 10.828  1.00 47.60  ? 133  CYS A CA  1 
ATOM   941  C C   . CYS A 1 133 ? -28.526 110.994 12.310  1.00 52.51  ? 133  CYS A C   1 
ATOM   942  O O   . CYS A 1 133 ? -28.098 110.059 12.993  1.00 56.69  ? 133  CYS A O   1 
ATOM   943  C CB  . CYS A 1 133 ? -27.603 111.126 9.992   1.00 43.05  ? 133  CYS A CB  1 
ATOM   944  S SG  . CYS A 1 133 ? -27.667 110.514 8.296   1.00 40.16  ? 133  CYS A SG  1 
ATOM   945  N N   . LEU A 1 134 ? -28.740 112.214 12.801  1.00 50.40  ? 134  LEU A N   1 
ATOM   946  C CA  . LEU A 1 134 ? -28.476 112.534 14.200  1.00 45.13  ? 134  LEU A CA  1 
ATOM   947  C C   . LEU A 1 134 ? -29.405 111.753 15.116  1.00 48.16  ? 134  LEU A C   1 
ATOM   948  O O   . LEU A 1 134 ? -28.950 110.961 15.939  1.00 49.49  ? 134  LEU A O   1 
ATOM   949  C CB  . LEU A 1 134 ? -28.654 114.033 14.448  1.00 38.40  ? 134  LEU A CB  1 
ATOM   950  C CG  . LEU A 1 134 ? -28.507 114.534 15.892  1.00 39.05  ? 134  LEU A CG  1 
ATOM   951  C CD1 . LEU A 1 134 ? -27.327 113.869 16.594  1.00 34.56  ? 134  LEU A CD1 1 
ATOM   952  C CD2 . LEU A 1 134 ? -28.319 116.032 15.866  1.00 37.42  ? 134  LEU A CD2 1 
ATOM   953  N N   . GLY A 1 135 ? -30.707 111.980 14.965  1.00 51.96  ? 135  GLY A N   1 
ATOM   954  C CA  . GLY A 1 135 ? -31.687 111.291 15.789  1.00 53.84  ? 135  GLY A CA  1 
ATOM   955  C C   . GLY A 1 135 ? -31.476 109.791 15.852  1.00 54.44  ? 135  GLY A C   1 
ATOM   956  O O   . GLY A 1 135 ? -31.575 109.188 16.919  1.00 54.86  ? 135  GLY A O   1 
ATOM   957  N N   . ASP A 1 136 ? -31.190 109.185 14.705  1.00 58.93  ? 136  ASP A N   1 
ATOM   958  C CA  . ASP A 1 136 ? -30.954 107.749 14.637  1.00 61.68  ? 136  ASP A CA  1 
ATOM   959  C C   . ASP A 1 136 ? -29.775 107.371 15.535  1.00 59.99  ? 136  ASP A C   1 
ATOM   960  O O   . ASP A 1 136 ? -29.860 106.438 16.332  1.00 59.00  ? 136  ASP A O   1 
ATOM   961  C CB  . ASP A 1 136 ? -30.667 107.340 13.189  1.00 70.04  ? 136  ASP A CB  1 
ATOM   962  C CG  . ASP A 1 136 ? -30.052 105.956 13.080  1.00 80.06  ? 136  ASP A CG  1 
ATOM   963  O OD1 . ASP A 1 136 ? -28.831 105.824 13.319  1.00 84.61  ? 136  ASP A OD1 1 
ATOM   964  O OD2 . ASP A 1 136 ? -30.790 105.000 12.751  1.00 86.99  ? 136  ASP A OD2 1 
ATOM   965  N N   . PHE A 1 137 ? -28.678 108.111 15.401  1.00 56.93  ? 137  PHE A N   1 
ATOM   966  C CA  . PHE A 1 137 ? -27.478 107.870 16.191  1.00 53.90  ? 137  PHE A CA  1 
ATOM   967  C C   . PHE A 1 137 ? -27.766 107.880 17.692  1.00 56.58  ? 137  PHE A C   1 
ATOM   968  O O   . PHE A 1 137 ? -27.325 106.990 18.419  1.00 54.13  ? 137  PHE A O   1 
ATOM   969  C CB  . PHE A 1 137 ? -26.425 108.931 15.866  1.00 44.98  ? 137  PHE A CB  1 
ATOM   970  C CG  . PHE A 1 137 ? -25.198 108.853 16.729  1.00 40.79  ? 137  PHE A CG  1 
ATOM   971  C CD1 . PHE A 1 137 ? -25.132 109.551 17.936  1.00 37.20  ? 137  PHE A CD1 1 
ATOM   972  C CD2 . PHE A 1 137 ? -24.106 108.084 16.336  1.00 36.14  ? 137  PHE A CD2 1 
ATOM   973  C CE1 . PHE A 1 137 ? -23.995 109.485 18.741  1.00 34.76  ? 137  PHE A CE1 1 
ATOM   974  C CE2 . PHE A 1 137 ? -22.963 108.010 17.131  1.00 35.20  ? 137  PHE A CE2 1 
ATOM   975  C CZ  . PHE A 1 137 ? -22.908 108.713 18.338  1.00 36.58  ? 137  PHE A CZ  1 
ATOM   976  N N   . MET A 1 138 ? -28.496 108.894 18.152  1.00 61.30  ? 138  MET A N   1 
ATOM   977  C CA  . MET A 1 138 ? -28.833 109.021 19.568  1.00 64.61  ? 138  MET A CA  1 
ATOM   978  C C   . MET A 1 138 ? -29.821 107.952 19.997  1.00 67.53  ? 138  MET A C   1 
ATOM   979  O O   . MET A 1 138 ? -29.717 107.404 21.092  1.00 68.92  ? 138  MET A O   1 
ATOM   980  C CB  . MET A 1 138 ? -29.443 110.391 19.867  1.00 63.59  ? 138  MET A CB  1 
ATOM   981  C CG  . MET A 1 138 ? -28.900 111.529 19.039  1.00 67.92  ? 138  MET A CG  1 
ATOM   982  S SD  . MET A 1 138 ? -29.854 113.030 19.316  1.00 77.53  ? 138  MET A SD  1 
ATOM   983  C CE  . MET A 1 138 ? -29.417 113.407 21.030  1.00 72.17  ? 138  MET A CE  1 
ATOM   984  N N   . GLU A 1 139 ? -30.792 107.668 19.135  1.00 71.04  ? 139  GLU A N   1 
ATOM   985  C CA  . GLU A 1 139 ? -31.796 106.663 19.440  1.00 76.01  ? 139  GLU A CA  1 
ATOM   986  C C   . GLU A 1 139 ? -31.164 105.281 19.532  1.00 75.91  ? 139  GLU A C   1 
ATOM   987  O O   . GLU A 1 139 ? -31.400 104.549 20.492  1.00 76.60  ? 139  GLU A O   1 
ATOM   988  C CB  . GLU A 1 139 ? -32.888 106.661 18.376  1.00 80.14  ? 139  GLU A CB  1 
ATOM   989  C CG  . GLU A 1 139 ? -34.276 106.452 18.952  1.00 90.93  ? 139  GLU A CG  1 
ATOM   990  C CD  . GLU A 1 139 ? -35.314 106.189 17.885  1.00 97.08  ? 139  GLU A CD  1 
ATOM   991  O OE1 . GLU A 1 139 ? -34.968 106.275 16.685  1.00 100.00 ? 139  GLU A OE1 1 
ATOM   992  O OE2 . GLU A 1 139 ? -36.474 105.897 18.247  1.00 100.00 ? 139  GLU A OE2 1 
ATOM   993  N N   . LYS A 1 140 ? -30.364 104.928 18.530  1.00 74.54  ? 140  LYS A N   1 
ATOM   994  C CA  . LYS A 1 140 ? -29.688 103.637 18.515  1.00 72.63  ? 140  LYS A CA  1 
ATOM   995  C C   . LYS A 1 140 ? -28.845 103.500 19.776  1.00 73.07  ? 140  LYS A C   1 
ATOM   996  O O   . LYS A 1 140 ? -28.423 102.403 20.137  1.00 76.84  ? 140  LYS A O   1 
ATOM   997  C CB  . LYS A 1 140 ? -28.795 103.521 17.283  1.00 75.52  ? 140  LYS A CB  1 
ATOM   998  C CG  . LYS A 1 140 ? -28.325 102.106 16.994  1.00 80.83  ? 140  LYS A CG  1 
ATOM   999  C CD  . LYS A 1 140 ? -27.987 101.932 15.519  1.00 87.33  ? 140  LYS A CD  1 
ATOM   1000 C CE  . LYS A 1 140 ? -26.579 102.414 15.220  1.00 89.42  ? 140  LYS A CE  1 
ATOM   1001 N NZ  . LYS A 1 140 ? -25.645 102.090 16.334  1.00 92.25  ? 140  LYS A NZ  1 
ATOM   1002 N N   . ARG A 1 141 ? -28.601 104.629 20.432  1.00 71.17  ? 141  ARG A N   1 
ATOM   1003 C CA  . ARG A 1 141 ? -27.832 104.665 21.667  1.00 70.71  ? 141  ARG A CA  1 
ATOM   1004 C C   . ARG A 1 141 ? -28.768 105.120 22.785  1.00 73.66  ? 141  ARG A C   1 
ATOM   1005 O O   . ARG A 1 141 ? -28.352 105.298 23.929  1.00 77.15  ? 141  ARG A O   1 
ATOM   1006 C CB  . ARG A 1 141 ? -26.661 105.640 21.538  1.00 65.45  ? 141  ARG A CB  1 
ATOM   1007 C CG  . ARG A 1 141 ? -25.335 104.983 21.205  1.00 57.77  ? 141  ARG A CG  1 
ATOM   1008 C CD  . ARG A 1 141 ? -24.468 105.918 20.383  1.00 55.17  ? 141  ARG A CD  1 
ATOM   1009 N NE  . ARG A 1 141 ? -23.664 105.209 19.389  1.00 54.59  ? 141  ARG A NE  1 
ATOM   1010 C CZ  . ARG A 1 141 ? -24.041 104.988 18.132  1.00 52.93  ? 141  ARG A CZ  1 
ATOM   1011 N NH1 . ARG A 1 141 ? -25.220 105.417 17.699  1.00 51.43  ? 141  ARG A NH1 1 
ATOM   1012 N NH2 . ARG A 1 141 ? -23.230 104.345 17.302  1.00 52.40  ? 141  ARG A NH2 1 
ATOM   1013 N N   . LYS A 1 142 ? -30.034 105.314 22.428  1.00 75.15  ? 142  LYS A N   1 
ATOM   1014 C CA  . LYS A 1 142 ? -31.074 105.729 23.363  1.00 79.77  ? 142  LYS A CA  1 
ATOM   1015 C C   . LYS A 1 142 ? -30.680 106.847 24.329  1.00 80.99  ? 142  LYS A C   1 
ATOM   1016 O O   . LYS A 1 142 ? -31.186 106.908 25.449  1.00 82.15  ? 142  LYS A O   1 
ATOM   1017 C CB  . LYS A 1 142 ? -31.564 104.516 24.161  1.00 86.48  ? 142  LYS A CB  1 
ATOM   1018 C CG  . LYS A 1 142 ? -31.996 103.331 23.302  1.00 93.37  ? 142  LYS A CG  1 
ATOM   1019 C CD  . LYS A 1 142 ? -31.120 102.103 23.553  1.00 98.22  ? 142  LYS A CD  1 
ATOM   1020 C CE  . LYS A 1 142 ? -31.125 101.147 22.357  1.00 100.00 ? 142  LYS A CE  1 
ATOM   1021 N NZ  . LYS A 1 142 ? -29.896 100.293 22.285  1.00 100.00 ? 142  LYS A NZ  1 
ATOM   1022 N N   . ILE A 1 143 ? -29.779 107.727 23.902  1.00 81.39  ? 143  ILE A N   1 
ATOM   1023 C CA  . ILE A 1 143 ? -29.356 108.848 24.741  1.00 77.29  ? 143  ILE A CA  1 
ATOM   1024 C C   . ILE A 1 143 ? -30.116 110.084 24.286  1.00 77.67  ? 143  ILE A C   1 
ATOM   1025 O O   . ILE A 1 143 ? -29.737 111.214 24.600  1.00 77.06  ? 143  ILE A O   1 
ATOM   1026 C CB  . ILE A 1 143 ? -27.848 109.131 24.605  1.00 76.91  ? 143  ILE A CB  1 
ATOM   1027 C CG1 . ILE A 1 143 ? -27.392 108.862 23.169  1.00 76.53  ? 143  ILE A CG1 1 
ATOM   1028 C CG2 . ILE A 1 143 ? -27.069 108.266 25.582  1.00 77.24  ? 143  ILE A CG2 1 
ATOM   1029 C CD1 . ILE A 1 143 ? -26.260 109.753 22.714  1.00 74.96  ? 143  ILE A CD1 1 
ATOM   1030 N N   . LYS A 1 144 ? -31.193 109.841 23.544  1.00 78.42  ? 144  LYS A N   1 
ATOM   1031 C CA  . LYS A 1 144 ? -32.053 110.886 22.996  1.00 79.37  ? 144  LYS A CA  1 
ATOM   1032 C C   . LYS A 1 144 ? -32.842 111.638 24.068  1.00 82.46  ? 144  LYS A C   1 
ATOM   1033 O O   . LYS A 1 144 ? -33.477 112.657 23.786  1.00 80.49  ? 144  LYS A O   1 
ATOM   1034 C CB  . LYS A 1 144 ? -33.016 110.259 21.985  1.00 76.91  ? 144  LYS A CB  1 
ATOM   1035 C CG  . LYS A 1 144 ? -33.842 111.258 21.199  1.00 78.33  ? 144  LYS A CG  1 
ATOM   1036 C CD  . LYS A 1 144 ? -34.864 110.549 20.324  1.00 78.12  ? 144  LYS A CD  1 
ATOM   1037 C CE  . LYS A 1 144 ? -34.188 109.761 19.217  1.00 74.35  ? 144  LYS A CE  1 
ATOM   1038 N NZ  . LYS A 1 144 ? -35.063 109.647 18.020  1.00 74.58  ? 144  LYS A NZ  1 
ATOM   1039 N N   . ASP A 1 145 ? -32.799 111.131 25.297  1.00 89.11  ? 145  ASP A N   1 
ATOM   1040 C CA  . ASP A 1 145 ? -33.510 111.748 26.414  1.00 94.54  ? 145  ASP A CA  1 
ATOM   1041 C C   . ASP A 1 145 ? -32.673 112.846 27.066  1.00 95.84  ? 145  ASP A C   1 
ATOM   1042 O O   . ASP A 1 145 ? -33.150 113.964 27.261  1.00 98.48  ? 145  ASP A O   1 
ATOM   1043 C CB  . ASP A 1 145 ? -33.872 110.686 27.457  1.00 97.41  ? 145  ASP A CB  1 
ATOM   1044 C CG  . ASP A 1 145 ? -32.744 109.699 27.702  1.00 100.00 ? 145  ASP A CG  1 
ATOM   1045 O OD1 . ASP A 1 145 ? -32.616 108.732 26.919  1.00 100.00 ? 145  ASP A OD1 1 
ATOM   1046 O OD2 . ASP A 1 145 ? -31.985 109.891 28.677  1.00 100.00 ? 145  ASP A OD2 1 
ATOM   1047 N N   . LYS A 1 146 ? -31.430 112.522 27.412  1.00 95.61  ? 146  LYS A N   1 
ATOM   1048 C CA  . LYS A 1 146 ? -30.538 113.502 28.023  1.00 94.85  ? 146  LYS A CA  1 
ATOM   1049 C C   . LYS A 1 146 ? -30.014 114.422 26.929  1.00 95.98  ? 146  LYS A C   1 
ATOM   1050 O O   . LYS A 1 146 ? -29.134 114.035 26.156  1.00 98.71  ? 146  LYS A O   1 
ATOM   1051 C CB  . LYS A 1 146 ? -29.359 112.814 28.711  1.00 93.29  ? 146  LYS A CB  1 
ATOM   1052 C CG  . LYS A 1 146 ? -29.569 111.337 28.986  1.00 96.57  ? 146  LYS A CG  1 
ATOM   1053 C CD  . LYS A 1 146 ? -28.347 110.520 28.597  1.00 96.73  ? 146  LYS A CD  1 
ATOM   1054 C CE  . LYS A 1 146 ? -27.096 111.020 29.308  1.00 98.52  ? 146  LYS A CE  1 
ATOM   1055 N NZ  . LYS A 1 146 ? -26.153 109.913 29.626  1.00 97.62  ? 146  LYS A NZ  1 
ATOM   1056 N N   . LYS A 1 147 ? -30.563 115.631 26.861  1.00 95.02  ? 147  LYS A N   1 
ATOM   1057 C CA  . LYS A 1 147 ? -30.150 116.607 25.856  1.00 93.56  ? 147  LYS A CA  1 
ATOM   1058 C C   . LYS A 1 147 ? -28.666 116.934 26.007  1.00 90.37  ? 147  LYS A C   1 
ATOM   1059 O O   . LYS A 1 147 ? -28.294 117.891 26.692  1.00 92.96  ? 147  LYS A O   1 
ATOM   1060 C CB  . LYS A 1 147 ? -30.975 117.894 25.986  1.00 96.73  ? 147  LYS A CB  1 
ATOM   1061 C CG  . LYS A 1 147 ? -32.479 117.676 26.060  1.00 99.86  ? 147  LYS A CG  1 
ATOM   1062 C CD  . LYS A 1 147 ? -33.136 118.654 27.028  1.00 100.00 ? 147  LYS A CD  1 
ATOM   1063 C CE  . LYS A 1 147 ? -33.138 118.116 28.454  1.00 100.00 ? 147  LYS A CE  1 
ATOM   1064 N NZ  . LYS A 1 147 ? -33.018 119.209 29.462  1.00 99.74  ? 147  LYS A NZ  1 
ATOM   1065 N N   . LEU A 1 148 ? -27.826 116.131 25.362  1.00 81.10  ? 148  LEU A N   1 
ATOM   1066 C CA  . LEU A 1 148 ? -26.383 116.322 25.415  1.00 69.55  ? 148  LEU A CA  1 
ATOM   1067 C C   . LEU A 1 148 ? -25.961 117.509 24.555  1.00 64.90  ? 148  LEU A C   1 
ATOM   1068 O O   . LEU A 1 148 ? -26.569 117.784 23.518  1.00 65.99  ? 148  LEU A O   1 
ATOM   1069 C CB  . LEU A 1 148 ? -25.677 115.055 24.928  1.00 64.22  ? 148  LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 148 ? -25.845 113.818 25.810  1.00 56.62  ? 148  LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 148 ? -25.104 112.640 25.202  1.00 55.36  ? 148  LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 148 ? -25.315 114.121 27.200  1.00 57.72  ? 148  LEU A CD2 1 
ATOM   1073 N N   . PRO A 1 149 ? -24.916 118.239 24.979  1.00 59.88  ? 149  PRO A N   1 
ATOM   1074 C CA  . PRO A 1 149 ? -24.493 119.380 24.164  1.00 54.21  ? 149  PRO A CA  1 
ATOM   1075 C C   . PRO A 1 149 ? -24.034 118.821 22.833  1.00 49.95  ? 149  PRO A C   1 
ATOM   1076 O O   . PRO A 1 149 ? -23.528 117.703 22.768  1.00 49.71  ? 149  PRO A O   1 
ATOM   1077 C CB  . PRO A 1 149 ? -23.337 119.996 24.951  1.00 53.59  ? 149  PRO A CB  1 
ATOM   1078 C CG  . PRO A 1 149 ? -23.432 119.407 26.322  1.00 58.31  ? 149  PRO A CG  1 
ATOM   1079 C CD  . PRO A 1 149 ? -24.072 118.064 26.172  1.00 58.34  ? 149  PRO A CD  1 
ATOM   1080 N N   . VAL A 1 150 ? -24.219 119.583 21.769  1.00 46.55  ? 150  VAL A N   1 
ATOM   1081 C CA  . VAL A 1 150 ? -23.809 119.105 20.466  1.00 40.87  ? 150  VAL A CA  1 
ATOM   1082 C C   . VAL A 1 150 ? -22.773 120.012 19.825  1.00 39.34  ? 150  VAL A C   1 
ATOM   1083 O O   . VAL A 1 150 ? -22.931 121.234 19.782  1.00 32.22  ? 150  VAL A O   1 
ATOM   1084 C CB  . VAL A 1 150 ? -25.024 118.954 19.529  1.00 38.75  ? 150  VAL A CB  1 
ATOM   1085 C CG1 . VAL A 1 150 ? -24.563 118.750 18.088  1.00 37.66  ? 150  VAL A CG1 1 
ATOM   1086 C CG2 . VAL A 1 150 ? -25.874 117.781 19.991  1.00 36.25  ? 150  VAL A CG2 1 
ATOM   1087 N N   . GLY A 1 151 ? -21.696 119.387 19.360  1.00 39.28  ? 151  GLY A N   1 
ATOM   1088 C CA  . GLY A 1 151 ? -20.632 120.108 18.692  1.00 38.40  ? 151  GLY A CA  1 
ATOM   1089 C C   . GLY A 1 151 ? -20.778 119.830 17.208  1.00 38.19  ? 151  GLY A C   1 
ATOM   1090 O O   . GLY A 1 151 ? -21.227 118.750 16.819  1.00 37.24  ? 151  GLY A O   1 
ATOM   1091 N N   . PHE A 1 152 ? -20.399 120.796 16.378  1.00 35.99  ? 152  PHE A N   1 
ATOM   1092 C CA  . PHE A 1 152 ? -20.519 120.647 14.936  1.00 30.45  ? 152  PHE A CA  1 
ATOM   1093 C C   . PHE A 1 152 ? -19.260 121.085 14.194  1.00 29.80  ? 152  PHE A C   1 
ATOM   1094 O O   . PHE A 1 152 ? -18.878 122.262 14.230  1.00 26.85  ? 152  PHE A O   1 
ATOM   1095 C CB  . PHE A 1 152 ? -21.729 121.454 14.446  1.00 31.90  ? 152  PHE A CB  1 
ATOM   1096 C CG  . PHE A 1 152 ? -22.098 121.213 13.001  1.00 33.47  ? 152  PHE A CG  1 
ATOM   1097 C CD1 . PHE A 1 152 ? -21.421 120.269 12.227  1.00 31.66  ? 152  PHE A CD1 1 
ATOM   1098 C CD2 . PHE A 1 152 ? -23.119 121.955 12.409  1.00 27.28  ? 152  PHE A CD2 1 
ATOM   1099 C CE1 . PHE A 1 152 ? -21.752 120.072 10.893  1.00 28.00  ? 152  PHE A CE1 1 
ATOM   1100 C CE2 . PHE A 1 152 ? -23.456 121.764 11.077  1.00 24.01  ? 152  PHE A CE2 1 
ATOM   1101 C CZ  . PHE A 1 152 ? -22.771 120.822 10.317  1.00 26.42  ? 152  PHE A CZ  1 
ATOM   1102 N N   . THR A 1 153 ? -18.614 120.123 13.535  1.00 26.13  ? 153  THR A N   1 
ATOM   1103 C CA  . THR A 1 153 ? -17.418 120.399 12.744  1.00 19.54  ? 153  THR A CA  1 
ATOM   1104 C C   . THR A 1 153 ? -17.904 120.484 11.301  1.00 17.86  ? 153  THR A C   1 
ATOM   1105 O O   . THR A 1 153 ? -18.354 119.499 10.725  1.00 19.26  ? 153  THR A O   1 
ATOM   1106 C CB  . THR A 1 153 ? -16.372 119.288 12.889  1.00 14.29  ? 153  THR A CB  1 
ATOM   1107 O OG1 . THR A 1 153 ? -15.957 119.214 14.257  1.00 26.36  ? 153  THR A OG1 1 
ATOM   1108 C CG2 . THR A 1 153 ? -15.156 119.581 12.043  1.00 7.83   ? 153  THR A CG2 1 
ATOM   1109 N N   . PHE A 1 154 ? -17.824 121.692 10.754  1.00 16.28  ? 154  PHE A N   1 
ATOM   1110 C CA  . PHE A 1 154 ? -18.266 122.031 9.408   1.00 13.80  ? 154  PHE A CA  1 
ATOM   1111 C C   . PHE A 1 154 ? -17.035 122.596 8.693   1.00 20.27  ? 154  PHE A C   1 
ATOM   1112 O O   . PHE A 1 154 ? -16.591 123.702 9.012   1.00 27.47  ? 154  PHE A O   1 
ATOM   1113 C CB  . PHE A 1 154 ? -19.356 123.099 9.539   1.00 9.29   ? 154  PHE A CB  1 
ATOM   1114 C CG  . PHE A 1 154 ? -20.185 123.304 8.304   1.00 19.09  ? 154  PHE A CG  1 
ATOM   1115 C CD1 . PHE A 1 154 ? -20.901 122.255 7.737   1.00 18.73  ? 154  PHE A CD1 1 
ATOM   1116 C CD2 . PHE A 1 154 ? -20.302 124.577 7.741   1.00 15.04  ? 154  PHE A CD2 1 
ATOM   1117 C CE1 . PHE A 1 154 ? -21.726 122.474 6.628   1.00 16.98  ? 154  PHE A CE1 1 
ATOM   1118 C CE2 . PHE A 1 154 ? -21.120 124.804 6.637   1.00 10.79  ? 154  PHE A CE2 1 
ATOM   1119 C CZ  . PHE A 1 154 ? -21.834 123.754 6.080   1.00 12.17  ? 154  PHE A CZ  1 
ATOM   1120 N N   . SER A 1 155 ? -16.487 121.847 7.733   1.00 21.58  ? 155  SER A N   1 
ATOM   1121 C CA  . SER A 1 155 ? -15.287 122.275 6.996   1.00 20.93  ? 155  SER A CA  1 
ATOM   1122 C C   . SER A 1 155 ? -15.528 123.107 5.737   1.00 21.16  ? 155  SER A C   1 
ATOM   1123 O O   . SER A 1 155 ? -15.403 122.612 4.619   1.00 22.36  ? 155  SER A O   1 
ATOM   1124 C CB  . SER A 1 155 ? -14.428 121.061 6.624   1.00 18.63  ? 155  SER A CB  1 
ATOM   1125 O OG  . SER A 1 155 ? -15.172 119.861 6.724   1.00 26.26  ? 155  SER A OG  1 
ATOM   1126 N N   . PHE A 1 156 ? -15.865 124.376 5.934   1.00 24.62  ? 156  PHE A N   1 
ATOM   1127 C CA  . PHE A 1 156 ? -16.105 125.319 4.846   1.00 23.61  ? 156  PHE A CA  1 
ATOM   1128 C C   . PHE A 1 156 ? -15.889 126.719 5.422   1.00 24.62  ? 156  PHE A C   1 
ATOM   1129 O O   . PHE A 1 156 ? -16.012 126.919 6.626   1.00 26.28  ? 156  PHE A O   1 
ATOM   1130 C CB  . PHE A 1 156 ? -17.537 125.197 4.325   1.00 19.08  ? 156  PHE A CB  1 
ATOM   1131 C CG  . PHE A 1 156 ? -17.880 123.837 3.805   1.00 16.55  ? 156  PHE A CG  1 
ATOM   1132 C CD1 . PHE A 1 156 ? -17.442 123.429 2.554   1.00 14.84  ? 156  PHE A CD1 1 
ATOM   1133 C CD2 . PHE A 1 156 ? -18.645 122.961 4.568   1.00 18.49  ? 156  PHE A CD2 1 
ATOM   1134 C CE1 . PHE A 1 156 ? -17.758 122.166 2.067   1.00 15.04  ? 156  PHE A CE1 1 
ATOM   1135 C CE2 . PHE A 1 156 ? -18.969 121.694 4.090   1.00 16.69  ? 156  PHE A CE2 1 
ATOM   1136 C CZ  . PHE A 1 156 ? -18.524 121.296 2.837   1.00 17.98  ? 156  PHE A CZ  1 
ATOM   1137 N N   . PRO A 1 157 ? -15.553 127.701 4.575   1.00 24.31  ? 157  PRO A N   1 
ATOM   1138 C CA  . PRO A 1 157 ? -15.343 129.050 5.109   1.00 27.27  ? 157  PRO A CA  1 
ATOM   1139 C C   . PRO A 1 157 ? -16.643 129.633 5.647   1.00 29.70  ? 157  PRO A C   1 
ATOM   1140 O O   . PRO A 1 157 ? -17.599 129.847 4.899   1.00 31.60  ? 157  PRO A O   1 
ATOM   1141 C CB  . PRO A 1 157 ? -14.802 129.836 3.918   1.00 28.64  ? 157  PRO A CB  1 
ATOM   1142 C CG  . PRO A 1 157 ? -15.265 129.083 2.722   1.00 31.93  ? 157  PRO A CG  1 
ATOM   1143 C CD  . PRO A 1 157 ? -15.349 127.639 3.119   1.00 27.52  ? 157  PRO A CD  1 
ATOM   1144 N N   . CYS A 1 158 ? -16.665 129.885 6.954   1.00 31.02  ? 158  CYS A N   1 
ATOM   1145 C CA  . CYS A 1 158 ? -17.838 130.427 7.628   1.00 26.99  ? 158  CYS A CA  1 
ATOM   1146 C C   . CYS A 1 158 ? -17.549 131.751 8.308   1.00 27.21  ? 158  CYS A C   1 
ATOM   1147 O O   . CYS A 1 158 ? -16.450 131.976 8.818   1.00 28.65  ? 158  CYS A O   1 
ATOM   1148 C CB  . CYS A 1 158 ? -18.331 129.447 8.688   1.00 26.17  ? 158  CYS A CB  1 
ATOM   1149 S SG  . CYS A 1 158 ? -19.282 128.074 8.044   1.00 30.23  ? 158  CYS A SG  1 
ATOM   1150 N N   . GLN A 1 159 ? -18.544 132.629 8.307   1.00 29.42  ? 159  GLN A N   1 
ATOM   1151 C CA  . GLN A 1 159 ? -18.421 133.921 8.960   1.00 28.65  ? 159  GLN A CA  1 
ATOM   1152 C C   . GLN A 1 159 ? -19.125 133.727 10.277  1.00 24.91  ? 159  GLN A C   1 
ATOM   1153 O O   . GLN A 1 159 ? -20.240 133.219 10.305  1.00 20.38  ? 159  GLN A O   1 
ATOM   1154 C CB  . GLN A 1 159 ? -19.137 135.013 8.170   1.00 38.02  ? 159  GLN A CB  1 
ATOM   1155 C CG  . GLN A 1 159 ? -18.848 136.424 8.667   1.00 53.33  ? 159  GLN A CG  1 
ATOM   1156 C CD  . GLN A 1 159 ? -19.994 137.023 9.477   1.00 65.34  ? 159  GLN A CD  1 
ATOM   1157 O OE1 . GLN A 1 159 ? -19.818 137.415 10.638  1.00 67.05  ? 159  GLN A OE1 1 
ATOM   1158 N NE2 . GLN A 1 159 ? -21.174 137.101 8.866   1.00 70.12  ? 159  GLN A NE2 1 
ATOM   1159 N N   . GLN A 1 160 ? -18.468 134.105 11.366  1.00 30.34  ? 160  GLN A N   1 
ATOM   1160 C CA  . GLN A 1 160 ? -19.060 133.970 12.688  1.00 31.46  ? 160  GLN A CA  1 
ATOM   1161 C C   . GLN A 1 160 ? -18.540 135.028 13.639  1.00 33.37  ? 160  GLN A C   1 
ATOM   1162 O O   . GLN A 1 160 ? -17.363 135.375 13.601  1.00 32.20  ? 160  GLN A O   1 
ATOM   1163 C CB  . GLN A 1 160 ? -18.772 132.587 13.272  1.00 32.21  ? 160  GLN A CB  1 
ATOM   1164 C CG  . GLN A 1 160 ? -17.371 132.069 13.044  1.00 30.65  ? 160  GLN A CG  1 
ATOM   1165 C CD  . GLN A 1 160 ? -17.243 130.585 13.360  1.00 36.11  ? 160  GLN A CD  1 
ATOM   1166 O OE1 . GLN A 1 160 ? -16.307 129.927 12.910  1.00 48.57  ? 160  GLN A OE1 1 
ATOM   1167 N NE2 . GLN A 1 160 ? -18.184 130.053 14.138  1.00 28.95  ? 160  GLN A NE2 1 
ATOM   1168 N N   . SER A 1 161 ? -19.432 135.541 14.481  1.00 34.93  ? 161  SER A N   1 
ATOM   1169 C CA  . SER A 1 161 ? -19.074 136.550 15.466  1.00 34.82  ? 161  SER A CA  1 
ATOM   1170 C C   . SER A 1 161 ? -19.187 135.944 16.864  1.00 34.95  ? 161  SER A C   1 
ATOM   1171 O O   . SER A 1 161 ? -19.055 136.640 17.869  1.00 37.04  ? 161  SER A O   1 
ATOM   1172 C CB  . SER A 1 161 ? -19.988 137.766 15.337  1.00 37.74  ? 161  SER A CB  1 
ATOM   1173 O OG  . SER A 1 161 ? -21.332 137.440 15.641  1.00 55.31  ? 161  SER A OG  1 
ATOM   1174 N N   . LYS A 1 162 ? -19.434 134.638 16.908  1.00 33.01  ? 162  LYS A N   1 
ATOM   1175 C CA  . LYS A 1 162 ? -19.557 133.900 18.158  1.00 32.83  ? 162  LYS A CA  1 
ATOM   1176 C C   . LYS A 1 162 ? -19.527 132.406 17.850  1.00 33.09  ? 162  LYS A C   1 
ATOM   1177 O O   . LYS A 1 162 ? -19.996 131.981 16.803  1.00 35.77  ? 162  LYS A O   1 
ATOM   1178 C CB  . LYS A 1 162 ? -20.861 134.268 18.871  1.00 32.92  ? 162  LYS A CB  1 
ATOM   1179 C CG  . LYS A 1 162 ? -22.083 134.300 17.977  1.00 36.42  ? 162  LYS A CG  1 
ATOM   1180 C CD  . LYS A 1 162 ? -23.333 134.623 18.781  1.00 38.20  ? 162  LYS A CD  1 
ATOM   1181 C CE  . LYS A 1 162 ? -24.483 133.684 18.428  1.00 47.56  ? 162  LYS A CE  1 
ATOM   1182 N NZ  . LYS A 1 162 ? -25.469 134.290 17.477  1.00 51.74  ? 162  LYS A NZ  1 
ATOM   1183 N N   . ILE A 1 163 ? -18.992 131.616 18.774  1.00 32.74  ? 163  ILE A N   1 
ATOM   1184 C CA  . ILE A 1 163 ? -18.868 130.173 18.592  1.00 34.16  ? 163  ILE A CA  1 
ATOM   1185 C C   . ILE A 1 163 ? -20.093 129.406 18.084  1.00 32.93  ? 163  ILE A C   1 
ATOM   1186 O O   . ILE A 1 163 ? -19.942 128.435 17.346  1.00 34.09  ? 163  ILE A O   1 
ATOM   1187 C CB  . ILE A 1 163 ? -18.378 129.479 19.904  1.00 38.22  ? 163  ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 163 ? -17.612 128.198 19.565  1.00 41.20  ? 163  ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 163 ? -19.565 129.117 20.800  1.00 38.17  ? 163  ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 163 ? -16.157 128.424 19.221  1.00 44.78  ? 163  ILE A CD1 1 
ATOM   1191 N N   . ASP A 1 164 ? -21.296 129.821 18.462  1.00 31.85  ? 164  ASP A N   1 
ATOM   1192 C CA  . ASP A 1 164 ? -22.486 129.086 18.036  1.00 32.74  ? 164  ASP A CA  1 
ATOM   1193 C C   . ASP A 1 164 ? -23.246 129.702 16.877  1.00 31.77  ? 164  ASP A C   1 
ATOM   1194 O O   . ASP A 1 164 ? -24.468 129.610 16.797  1.00 32.18  ? 164  ASP A O   1 
ATOM   1195 C CB  . ASP A 1 164 ? -23.432 128.861 19.225  1.00 39.92  ? 164  ASP A CB  1 
ATOM   1196 C CG  . ASP A 1 164 ? -24.053 130.148 19.737  1.00 47.52  ? 164  ASP A CG  1 
ATOM   1197 O OD1 . ASP A 1 164 ? -23.316 131.138 19.956  1.00 49.43  ? 164  ASP A OD1 1 
ATOM   1198 O OD2 . ASP A 1 164 ? -25.289 130.163 19.924  1.00 48.84  ? 164  ASP A OD2 1 
ATOM   1199 N N   . GLU A 1 165 ? -22.506 130.324 15.971  1.00 33.74  ? 165  GLU A N   1 
ATOM   1200 C CA  . GLU A 1 165 ? -23.079 130.938 14.781  1.00 32.87  ? 165  GLU A CA  1 
ATOM   1201 C C   . GLU A 1 165 ? -22.104 130.633 13.651  1.00 31.61  ? 165  GLU A C   1 
ATOM   1202 O O   . GLU A 1 165 ? -20.896 130.648 13.867  1.00 32.48  ? 165  GLU A O   1 
ATOM   1203 C CB  . GLU A 1 165 ? -23.210 132.442 14.981  1.00 29.90  ? 165  GLU A CB  1 
ATOM   1204 C CG  . GLU A 1 165 ? -23.141 133.246 13.712  1.00 35.62  ? 165  GLU A CG  1 
ATOM   1205 C CD  . GLU A 1 165 ? -23.055 134.730 13.987  1.00 42.71  ? 165  GLU A CD  1 
ATOM   1206 O OE1 . GLU A 1 165 ? -24.076 135.306 14.419  1.00 44.01  ? 165  GLU A OE1 1 
ATOM   1207 O OE2 . GLU A 1 165 ? -21.970 135.317 13.772  1.00 39.74  ? 165  GLU A OE2 1 
ATOM   1208 N N   . ALA A 1 166 ? -22.611 130.331 12.458  1.00 30.68  ? 166  ALA A N   1 
ATOM   1209 C CA  . ALA A 1 166 ? -21.726 130.023 11.337  1.00 27.93  ? 166  ALA A CA  1 
ATOM   1210 C C   . ALA A 1 166 ? -22.378 130.321 10.003  1.00 27.93  ? 166  ALA A C   1 
ATOM   1211 O O   . ALA A 1 166 ? -23.112 129.496 9.459   1.00 33.88  ? 166  ALA A O   1 
ATOM   1212 C CB  . ALA A 1 166 ? -21.298 128.560 11.388  1.00 22.90  ? 166  ALA A CB  1 
ATOM   1213 N N   . ILE A 1 167 ? -22.103 131.506 9.475   1.00 25.52  ? 167  ILE A N   1 
ATOM   1214 C CA  . ILE A 1 167 ? -22.661 131.916 8.195   1.00 25.15  ? 167  ILE A CA  1 
ATOM   1215 C C   . ILE A 1 167 ? -21.750 131.427 7.073   1.00 24.39  ? 167  ILE A C   1 
ATOM   1216 O O   . ILE A 1 167 ? -20.630 131.914 6.919   1.00 23.35  ? 167  ILE A O   1 
ATOM   1217 C CB  . ILE A 1 167 ? -22.793 133.453 8.126   1.00 26.79  ? 167  ILE A CB  1 
ATOM   1218 C CG1 . ILE A 1 167 ? -24.076 133.882 8.836   1.00 22.08  ? 167  ILE A CG1 1 
ATOM   1219 C CG2 . ILE A 1 167 ? -22.809 133.928 6.680   1.00 25.22  ? 167  ILE A CG2 1 
ATOM   1220 C CD1 . ILE A 1 167 ? -23.843 134.467 10.201  1.00 19.78  ? 167  ILE A CD1 1 
ATOM   1221 N N   . LEU A 1 168 ? -22.240 130.466 6.295   1.00 21.57  ? 168  LEU A N   1 
ATOM   1222 C CA  . LEU A 1 168 ? -21.467 129.903 5.192   1.00 19.72  ? 168  LEU A CA  1 
ATOM   1223 C C   . LEU A 1 168 ? -21.073 130.963 4.173   1.00 18.25  ? 168  LEU A C   1 
ATOM   1224 O O   . LEU A 1 168 ? -21.931 131.573 3.540   1.00 20.36  ? 168  LEU A O   1 
ATOM   1225 C CB  . LEU A 1 168 ? -22.260 128.793 4.480   1.00 18.28  ? 168  LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 168 ? -21.606 128.251 3.197   1.00 19.14  ? 168  LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 168 ? -20.308 127.541 3.553   1.00 17.58  ? 168  LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 168 ? -22.549 127.310 2.472   1.00 9.80   ? 168  LEU A CD2 1 
ATOM   1229 N N   . ILE A 1 169 ? -19.775 131.188 4.016   1.00 14.01  ? 169  ILE A N   1 
ATOM   1230 C CA  . ILE A 1 169 ? -19.322 132.159 3.040   1.00 14.37  ? 169  ILE A CA  1 
ATOM   1231 C C   . ILE A 1 169 ? -19.616 131.547 1.676   1.00 18.83  ? 169  ILE A C   1 
ATOM   1232 O O   . ILE A 1 169 ? -20.340 132.127 0.875   1.00 27.01  ? 169  ILE A O   1 
ATOM   1233 C CB  . ILE A 1 169 ? -17.822 132.436 3.175   1.00 14.70  ? 169  ILE A CB  1 
ATOM   1234 C CG1 . ILE A 1 169 ? -17.558 133.259 4.437   1.00 8.91   ? 169  ILE A CG1 1 
ATOM   1235 C CG2 . ILE A 1 169 ? -17.335 133.204 1.974   1.00 6.47   ? 169  ILE A CG2 1 
ATOM   1236 C CD1 . ILE A 1 169 ? -16.112 133.282 4.839   1.00 17.64  ? 169  ILE A CD1 1 
ATOM   1237 N N   . THR A 1 170 ? -19.054 130.369 1.422   1.00 22.61  ? 170  THR A N   1 
ATOM   1238 C CA  . THR A 1 170 ? -19.283 129.644 0.170   1.00 24.16  ? 170  THR A CA  1 
ATOM   1239 C C   . THR A 1 170 ? -18.965 128.167 0.356   1.00 24.40  ? 170  THR A C   1 
ATOM   1240 O O   . THR A 1 170 ? -18.407 127.761 1.374   1.00 25.81  ? 170  THR A O   1 
ATOM   1241 C CB  . THR A 1 170 ? -18.398 130.144 -0.982  1.00 21.47  ? 170  THR A CB  1 
ATOM   1242 O OG1 . THR A 1 170 ? -17.045 129.751 -0.742  1.00 22.26  ? 170  THR A OG1 1 
ATOM   1243 C CG2 . THR A 1 170 ? -18.464 131.649 -1.105  1.00 35.98  ? 170  THR A CG2 1 
ATOM   1244 N N   . TRP A 1 171 ? -19.322 127.371 -0.645  1.00 24.34  ? 171  TRP A N   1 
ATOM   1245 C CA  . TRP A 1 171 ? -19.070 125.937 -0.624  1.00 18.64  ? 171  TRP A CA  1 
ATOM   1246 C C   . TRP A 1 171 ? -17.700 125.685 -1.239  1.00 23.09  ? 171  TRP A C   1 
ATOM   1247 O O   . TRP A 1 171 ? -17.193 126.509 -2.007  1.00 20.95  ? 171  TRP A O   1 
ATOM   1248 C CB  . TRP A 1 171 ? -20.103 125.198 -1.463  1.00 18.19  ? 171  TRP A CB  1 
ATOM   1249 C CG  . TRP A 1 171 ? -21.440 125.033 -0.833  1.00 23.26  ? 171  TRP A CG  1 
ATOM   1250 C CD1 . TRP A 1 171 ? -22.632 125.486 -1.320  1.00 24.88  ? 171  TRP A CD1 1 
ATOM   1251 C CD2 . TRP A 1 171 ? -21.743 124.310 0.363   1.00 26.39  ? 171  TRP A CD2 1 
ATOM   1252 N NE1 . TRP A 1 171 ? -23.660 125.086 -0.505  1.00 24.76  ? 171  TRP A NE1 1 
ATOM   1253 C CE2 . TRP A 1 171 ? -23.145 124.358 0.536   1.00 26.35  ? 171  TRP A CE2 1 
ATOM   1254 C CE3 . TRP A 1 171 ? -20.970 123.615 1.303   1.00 27.32  ? 171  TRP A CE3 1 
ATOM   1255 C CZ2 . TRP A 1 171 ? -23.790 123.748 1.617   1.00 26.34  ? 171  TRP A CZ2 1 
ATOM   1256 C CZ3 . TRP A 1 171 ? -21.612 123.006 2.376   1.00 27.25  ? 171  TRP A CZ3 1 
ATOM   1257 C CH2 . TRP A 1 171 ? -23.011 123.075 2.520   1.00 25.51  ? 171  TRP A CH2 1 
ATOM   1258 N N   . THR A 1 172 ? -17.110 124.543 -0.900  1.00 21.60  ? 172  THR A N   1 
ATOM   1259 C CA  . THR A 1 172 ? -15.813 124.144 -1.430  1.00 18.33  ? 172  THR A CA  1 
ATOM   1260 C C   . THR A 1 172 ? -15.832 122.627 -1.546  1.00 22.49  ? 172  THR A C   1 
ATOM   1261 O O   . THR A 1 172 ? -16.796 121.989 -1.135  1.00 29.64  ? 172  THR A O   1 
ATOM   1262 C CB  . THR A 1 172 ? -14.663 124.568 -0.505  1.00 14.09  ? 172  THR A CB  1 
ATOM   1263 O OG1 . THR A 1 172 ? -14.841 123.975 0.786   1.00 19.26  ? 172  THR A OG1 1 
ATOM   1264 C CG2 . THR A 1 172 ? -14.630 126.069 -0.360  1.00 5.00   ? 172  THR A CG2 1 
ATOM   1265 N N   . LYS A 1 173 ? -14.774 122.052 -2.104  1.00 21.70  ? 173  LYS A N   1 
ATOM   1266 C CA  . LYS A 1 173 ? -14.696 120.607 -2.263  1.00 22.00  ? 173  LYS A CA  1 
ATOM   1267 C C   . LYS A 1 173 ? -15.863 120.065 -3.098  1.00 24.22  ? 173  LYS A C   1 
ATOM   1268 O O   . LYS A 1 173 ? -16.067 120.526 -4.215  1.00 28.34  ? 173  LYS A O   1 
ATOM   1269 C CB  . LYS A 1 173 ? -14.623 119.942 -0.888  1.00 17.23  ? 173  LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 173 ? -13.330 120.289 -0.149  1.00 17.94  ? 173  LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 173 ? -13.351 119.832 1.299   1.00 16.84  ? 173  LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 173 ? -13.999 120.861 2.212   1.00 15.60  ? 173  LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 173 ? -14.277 120.292 3.561   1.00 11.85  ? 173  LYS A NZ  1 
ATOM   1274 N N   . ARG A 1 174 ? -16.634 119.108 -2.589  1.00 22.77  ? 174  ARG A N   1 
ATOM   1275 C CA  . ARG A 1 174 ? -17.725 118.577 -3.408  1.00 26.11  ? 174  ARG A CA  1 
ATOM   1276 C C   . ARG A 1 174 ? -19.155 118.930 -3.017  1.00 26.93  ? 174  ARG A C   1 
ATOM   1277 O O   . ARG A 1 174 ? -20.103 118.323 -3.517  1.00 30.84  ? 174  ARG A O   1 
ATOM   1278 C CB  . ARG A 1 174 ? -17.619 117.051 -3.542  1.00 26.86  ? 174  ARG A CB  1 
ATOM   1279 C CG  . ARG A 1 174 ? -16.858 116.333 -2.461  1.00 38.04  ? 174  ARG A CG  1 
ATOM   1280 C CD  . ARG A 1 174 ? -17.119 114.838 -2.578  1.00 45.53  ? 174  ARG A CD  1 
ATOM   1281 N NE  . ARG A 1 174 ? -16.036 114.022 -2.028  1.00 56.34  ? 174  ARG A NE  1 
ATOM   1282 C CZ  . ARG A 1 174 ? -14.829 113.898 -2.574  1.00 58.78  ? 174  ARG A CZ  1 
ATOM   1283 N NH1 . ARG A 1 174 ? -14.529 114.539 -3.695  1.00 65.10  ? 174  ARG A NH1 1 
ATOM   1284 N NH2 . ARG A 1 174 ? -13.920 113.118 -2.004  1.00 61.91  ? 174  ARG A NH2 1 
ATOM   1285 N N   . PHE A 1 175 ? -19.326 119.900 -2.131  1.00 22.73  ? 175  PHE A N   1 
ATOM   1286 C CA  . PHE A 1 175 ? -20.668 120.293 -1.738  1.00 18.75  ? 175  PHE A CA  1 
ATOM   1287 C C   . PHE A 1 175 ? -21.153 121.427 -2.627  1.00 18.44  ? 175  PHE A C   1 
ATOM   1288 O O   . PHE A 1 175 ? -20.363 122.229 -3.122  1.00 22.44  ? 175  PHE A O   1 
ATOM   1289 C CB  . PHE A 1 175 ? -20.695 120.715 -0.276  1.00 18.96  ? 175  PHE A CB  1 
ATOM   1290 C CG  . PHE A 1 175 ? -20.746 119.561 0.680   1.00 21.83  ? 175  PHE A CG  1 
ATOM   1291 C CD1 . PHE A 1 175 ? -19.732 118.606 0.692   1.00 21.65  ? 175  PHE A CD1 1 
ATOM   1292 C CD2 . PHE A 1 175 ? -21.807 119.423 1.566   1.00 23.25  ? 175  PHE A CD2 1 
ATOM   1293 C CE1 . PHE A 1 175 ? -19.777 117.527 1.576   1.00 21.30  ? 175  PHE A CE1 1 
ATOM   1294 C CE2 . PHE A 1 175 ? -21.861 118.345 2.456   1.00 27.03  ? 175  PHE A CE2 1 
ATOM   1295 C CZ  . PHE A 1 175 ? -20.842 117.396 2.459   1.00 19.54  ? 175  PHE A CZ  1 
ATOM   1296 N N   . LYS A 1 176 ? -22.460 121.476 -2.834  1.00 25.29  ? 176  LYS A N   1 
ATOM   1297 C CA  . LYS A 1 176 ? -23.075 122.485 -3.678  1.00 25.67  ? 176  LYS A CA  1 
ATOM   1298 C C   . LYS A 1 176 ? -24.576 122.505 -3.428  1.00 28.04  ? 176  LYS A C   1 
ATOM   1299 O O   . LYS A 1 176 ? -25.366 122.572 -4.365  1.00 32.83  ? 176  LYS A O   1 
ATOM   1300 C CB  . LYS A 1 176 ? -22.802 122.157 -5.145  1.00 29.02  ? 176  LYS A CB  1 
ATOM   1301 C CG  . LYS A 1 176 ? -23.101 123.290 -6.101  1.00 33.72  ? 176  LYS A CG  1 
ATOM   1302 C CD  . LYS A 1 176 ? -21.929 124.237 -6.204  1.00 42.69  ? 176  LYS A CD  1 
ATOM   1303 C CE  . LYS A 1 176 ? -21.975 125.036 -7.495  1.00 49.30  ? 176  LYS A CE  1 
ATOM   1304 N NZ  . LYS A 1 176 ? -20.796 125.940 -7.629  1.00 55.79  ? 176  LYS A NZ  1 
ATOM   1305 N N   . ALA A 1 177 ? -24.965 122.435 -2.158  1.00 30.10  ? 177  ALA A N   1 
ATOM   1306 C CA  . ALA A 1 177 ? -26.374 122.453 -1.789  1.00 29.71  ? 177  ALA A CA  1 
ATOM   1307 C C   . ALA A 1 177 ? -26.841 123.898 -1.810  1.00 32.34  ? 177  ALA A C   1 
ATOM   1308 O O   . ALA A 1 177 ? -26.228 124.762 -1.188  1.00 41.40  ? 177  ALA A O   1 
ATOM   1309 C CB  . ALA A 1 177 ? -26.559 121.862 -0.406  1.00 27.07  ? 177  ALA A CB  1 
ATOM   1310 N N   . SER A 1 178 ? -27.926 124.162 -2.525  1.00 32.69  ? 178  SER A N   1 
ATOM   1311 C CA  . SER A 1 178 ? -28.451 125.519 -2.634  1.00 32.77  ? 178  SER A CA  1 
ATOM   1312 C C   . SER A 1 178 ? -29.203 125.985 -1.394  1.00 36.73  ? 178  SER A C   1 
ATOM   1313 O O   . SER A 1 178 ? -29.619 125.183 -0.554  1.00 38.00  ? 178  SER A O   1 
ATOM   1314 C CB  . SER A 1 178 ? -29.376 125.630 -3.853  1.00 33.88  ? 178  SER A CB  1 
ATOM   1315 O OG  . SER A 1 178 ? -30.578 124.894 -3.669  1.00 29.76  ? 178  SER A OG  1 
ATOM   1316 N N   . GLY A 1 179 ? -29.369 127.299 -1.292  1.00 40.12  ? 179  GLY A N   1 
ATOM   1317 C CA  . GLY A 1 179 ? -30.089 127.880 -0.176  1.00 41.21  ? 179  GLY A CA  1 
ATOM   1318 C C   . GLY A 1 179 ? -29.360 127.889 1.151   1.00 42.07  ? 179  GLY A C   1 
ATOM   1319 O O   . GLY A 1 179 ? -29.975 128.152 2.184   1.00 47.86  ? 179  GLY A O   1 
ATOM   1320 N N   . VAL A 1 180 ? -28.060 127.607 1.135   1.00 38.47  ? 180  VAL A N   1 
ATOM   1321 C CA  . VAL A 1 180 ? -27.280 127.595 2.369   1.00 29.79  ? 180  VAL A CA  1 
ATOM   1322 C C   . VAL A 1 180 ? -26.258 128.723 2.406   1.00 31.30  ? 180  VAL A C   1 
ATOM   1323 O O   . VAL A 1 180 ? -26.112 129.398 3.422   1.00 32.51  ? 180  VAL A O   1 
ATOM   1324 C CB  . VAL A 1 180 ? -26.530 126.264 2.556   1.00 25.27  ? 180  VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 180 ? -25.836 126.252 3.913   1.00 16.04  ? 180  VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 180 ? -27.497 125.096 2.432   1.00 23.67  ? 180  VAL A CG2 1 
ATOM   1327 N N   . GLU A 1 181 ? -25.546 128.927 1.303   1.00 29.82  ? 181  GLU A N   1 
ATOM   1328 C CA  . GLU A 1 181 ? -24.549 129.985 1.260   1.00 30.10  ? 181  GLU A CA  1 
ATOM   1329 C C   . GLU A 1 181 ? -25.186 131.281 1.759   1.00 31.96  ? 181  GLU A C   1 
ATOM   1330 O O   . GLU A 1 181 ? -26.343 131.573 1.454   1.00 38.12  ? 181  GLU A O   1 
ATOM   1331 C CB  . GLU A 1 181 ? -24.025 130.170 -0.166  1.00 27.90  ? 181  GLU A CB  1 
ATOM   1332 C CG  . GLU A 1 181 ? -22.828 129.295 -0.522  1.00 38.49  ? 181  GLU A CG  1 
ATOM   1333 C CD  . GLU A 1 181 ? -22.282 129.598 -1.912  1.00 46.31  ? 181  GLU A CD  1 
ATOM   1334 O OE1 . GLU A 1 181 ? -22.416 130.756 -2.357  1.00 54.36  ? 181  GLU A OE1 1 
ATOM   1335 O OE2 . GLU A 1 181 ? -21.724 128.686 -2.565  1.00 47.69  ? 181  GLU A OE2 1 
ATOM   1336 N N   . GLY A 1 182 ? -24.438 132.045 2.546   1.00 29.82  ? 182  GLY A N   1 
ATOM   1337 C CA  . GLY A 1 182 ? -24.963 133.295 3.059   1.00 19.93  ? 182  GLY A CA  1 
ATOM   1338 C C   . GLY A 1 182 ? -25.923 133.141 4.220   1.00 19.30  ? 182  GLY A C   1 
ATOM   1339 O O   . GLY A 1 182 ? -26.397 134.133 4.767   1.00 27.18  ? 182  GLY A O   1 
ATOM   1340 N N   . ALA A 1 183 ? -26.216 131.906 4.606   1.00 16.57  ? 183  ALA A N   1 
ATOM   1341 C CA  . ALA A 1 183 ? -27.126 131.669 5.718   1.00 18.00  ? 183  ALA A CA  1 
ATOM   1342 C C   . ALA A 1 183 ? -26.403 131.070 6.926   1.00 26.69  ? 183  ALA A C   1 
ATOM   1343 O O   . ALA A 1 183 ? -25.240 130.678 6.841   1.00 34.43  ? 183  ALA A O   1 
ATOM   1344 C CB  . ALA A 1 183 ? -28.242 130.755 5.276   1.00 20.60  ? 183  ALA A CB  1 
ATOM   1345 N N   . ASP A 1 184 ? -27.096 131.007 8.056   1.00 28.29  ? 184  ASP A N   1 
ATOM   1346 C CA  . ASP A 1 184 ? -26.511 130.459 9.268   1.00 28.65  ? 184  ASP A CA  1 
ATOM   1347 C C   . ASP A 1 184 ? -26.871 128.994 9.368   1.00 29.81  ? 184  ASP A C   1 
ATOM   1348 O O   . ASP A 1 184 ? -28.004 128.654 9.698   1.00 33.94  ? 184  ASP A O   1 
ATOM   1349 C CB  . ASP A 1 184 ? -27.037 131.196 10.495  1.00 32.22  ? 184  ASP A CB  1 
ATOM   1350 C CG  . ASP A 1 184 ? -26.297 130.817 11.763  1.00 37.78  ? 184  ASP A CG  1 
ATOM   1351 O OD1 . ASP A 1 184 ? -25.688 129.726 11.799  1.00 42.39  ? 184  ASP A OD1 1 
ATOM   1352 O OD2 . ASP A 1 184 ? -26.324 131.611 12.728  1.00 42.88  ? 184  ASP A OD2 1 
ATOM   1353 N N   . VAL A 1 185 ? -25.898 128.133 9.087   1.00 28.70  ? 185  VAL A N   1 
ATOM   1354 C CA  . VAL A 1 185 ? -26.110 126.693 9.124   1.00 25.00  ? 185  VAL A CA  1 
ATOM   1355 C C   . VAL A 1 185 ? -26.673 126.213 10.450  1.00 22.68  ? 185  VAL A C   1 
ATOM   1356 O O   . VAL A 1 185 ? -27.423 125.244 10.488  1.00 27.43  ? 185  VAL A O   1 
ATOM   1357 C CB  . VAL A 1 185 ? -24.804 125.935 8.829   1.00 21.79  ? 185  VAL A CB  1 
ATOM   1358 C CG1 . VAL A 1 185 ? -24.170 126.483 7.568   1.00 27.86  ? 185  VAL A CG1 1 
ATOM   1359 C CG2 . VAL A 1 185 ? -23.848 126.070 9.990   1.00 19.99  ? 185  VAL A CG2 1 
ATOM   1360 N N   . VAL A 1 186 ? -26.324 126.885 11.540  1.00 20.60  ? 186  VAL A N   1 
ATOM   1361 C CA  . VAL A 1 186 ? -26.835 126.474 12.841  1.00 27.24  ? 186  VAL A CA  1 
ATOM   1362 C C   . VAL A 1 186 ? -28.355 126.622 12.875  1.00 32.42  ? 186  VAL A C   1 
ATOM   1363 O O   . VAL A 1 186 ? -29.064 125.709 13.301  1.00 35.53  ? 186  VAL A O   1 
ATOM   1364 C CB  . VAL A 1 186 ? -26.220 127.301 13.983  1.00 28.38  ? 186  VAL A CB  1 
ATOM   1365 C CG1 . VAL A 1 186 ? -26.995 127.063 15.262  1.00 30.65  ? 186  VAL A CG1 1 
ATOM   1366 C CG2 . VAL A 1 186 ? -24.759 126.907 14.183  1.00 27.06  ? 186  VAL A CG2 1 
ATOM   1367 N N   . LYS A 1 187 ? -28.855 127.768 12.424  1.00 34.36  ? 187  LYS A N   1 
ATOM   1368 C CA  . LYS A 1 187 ? -30.295 127.995 12.392  1.00 36.51  ? 187  LYS A CA  1 
ATOM   1369 C C   . LYS A 1 187 ? -30.920 126.991 11.433  1.00 38.04  ? 187  LYS A C   1 
ATOM   1370 O O   . LYS A 1 187 ? -31.972 126.420 11.718  1.00 38.60  ? 187  LYS A O   1 
ATOM   1371 C CB  . LYS A 1 187 ? -30.611 129.416 11.917  1.00 41.40  ? 187  LYS A CB  1 
ATOM   1372 C CG  . LYS A 1 187 ? -29.572 130.453 12.317  1.00 56.28  ? 187  LYS A CG  1 
ATOM   1373 C CD  . LYS A 1 187 ? -30.194 131.828 12.573  1.00 64.01  ? 187  LYS A CD  1 
ATOM   1374 C CE  . LYS A 1 187 ? -29.802 132.364 13.951  1.00 70.90  ? 187  LYS A CE  1 
ATOM   1375 N NZ  . LYS A 1 187 ? -29.466 133.820 13.942  1.00 75.69  ? 187  LYS A NZ  1 
ATOM   1376 N N   . LEU A 1 188 ? -30.254 126.782 10.300  1.00 40.38  ? 188  LEU A N   1 
ATOM   1377 C CA  . LEU A 1 188 ? -30.716 125.856 9.269   1.00 39.82  ? 188  LEU A CA  1 
ATOM   1378 C C   . LEU A 1 188 ? -30.819 124.437 9.800   1.00 41.88  ? 188  LEU A C   1 
ATOM   1379 O O   . LEU A 1 188 ? -31.703 123.679 9.398   1.00 39.47  ? 188  LEU A O   1 
ATOM   1380 C CB  . LEU A 1 188 ? -29.758 125.876 8.078   1.00 36.12  ? 188  LEU A CB  1 
ATOM   1381 C CG  . LEU A 1 188 ? -29.790 127.127 7.202   1.00 36.25  ? 188  LEU A CG  1 
ATOM   1382 C CD1 . LEU A 1 188 ? -28.908 126.927 5.979   1.00 33.62  ? 188  LEU A CD1 1 
ATOM   1383 C CD2 . LEU A 1 188 ? -31.220 127.413 6.794   1.00 32.89  ? 188  LEU A CD2 1 
ATOM   1384 N N   . LEU A 1 189 ? -29.897 124.079 10.692  1.00 45.66  ? 189  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 189 ? -29.878 122.750 11.290  1.00 48.14  ? 189  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 189 ? -30.957 122.686 12.357  1.00 51.04  ? 189  LEU A C   1 
ATOM   1387 O O   . LEU A 1 189 ? -31.754 121.749 12.393  1.00 55.71  ? 189  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 189 ? -28.510 122.460 11.916  1.00 45.13  ? 189  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 189 ? -28.314 121.055 12.493  1.00 45.54  ? 189  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 189 ? -28.609 120.005 11.427  1.00 43.74  ? 189  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 189 ? -26.889 120.910 13.006  1.00 47.62  ? 189  LEU A CD2 1 
ATOM   1392 N N   . ASN A 1 190 ? -30.977 123.691 13.226  1.00 51.69  ? 190  ASN A N   1 
ATOM   1393 C CA  . ASN A 1 190 ? -31.975 123.755 14.279  1.00 54.42  ? 190  ASN A CA  1 
ATOM   1394 C C   . ASN A 1 190 ? -33.350 123.707 13.617  1.00 57.59  ? 190  ASN A C   1 
ATOM   1395 O O   . ASN A 1 190 ? -34.311 123.183 14.181  1.00 60.60  ? 190  ASN A O   1 
ATOM   1396 C CB  . ASN A 1 190 ? -31.815 125.053 15.073  1.00 56.95  ? 190  ASN A CB  1 
ATOM   1397 C CG  . ASN A 1 190 ? -30.626 125.016 16.020  1.00 57.95  ? 190  ASN A CG  1 
ATOM   1398 O OD1 . ASN A 1 190 ? -30.297 123.975 16.586  1.00 59.06  ? 190  ASN A OD1 1 
ATOM   1399 N ND2 . ASN A 1 190 ? -29.975 126.160 16.196  1.00 61.31  ? 190  ASN A ND2 1 
ATOM   1400 N N   . LYS A 1 191 ? -33.423 124.250 12.406  1.00 60.79  ? 191  LYS A N   1 
ATOM   1401 C CA  . LYS A 1 191 ? -34.656 124.280 11.627  1.00 62.17  ? 191  LYS A CA  1 
ATOM   1402 C C   . LYS A 1 191 ? -35.088 122.868 11.255  1.00 59.89  ? 191  LYS A C   1 
ATOM   1403 O O   . LYS A 1 191 ? -36.265 122.523 11.357  1.00 59.35  ? 191  LYS A O   1 
ATOM   1404 C CB  . LYS A 1 191 ? -34.445 125.094 10.346  1.00 68.92  ? 191  LYS A CB  1 
ATOM   1405 C CG  . LYS A 1 191 ? -35.698 125.762 9.798   1.00 78.09  ? 191  LYS A CG  1 
ATOM   1406 C CD  . LYS A 1 191 ? -35.572 127.286 9.859   1.00 90.45  ? 191  LYS A CD  1 
ATOM   1407 C CE  . LYS A 1 191 ? -36.416 127.978 8.789   1.00 96.99  ? 191  LYS A CE  1 
ATOM   1408 N NZ  . LYS A 1 191 ? -36.196 129.459 8.750   1.00 98.33  ? 191  LYS A NZ  1 
ATOM   1409 N N   . ALA A 1 192 ? -34.123 122.061 10.821  1.00 57.04  ? 192  ALA A N   1 
ATOM   1410 C CA  . ALA A 1 192 ? -34.378 120.687 10.412  1.00 56.84  ? 192  ALA A CA  1 
ATOM   1411 C C   . ALA A 1 192 ? -34.677 119.778 11.599  1.00 58.92  ? 192  ALA A C   1 
ATOM   1412 O O   . ALA A 1 192 ? -35.529 118.892 11.513  1.00 60.64  ? 192  ALA A O   1 
ATOM   1413 C CB  . ALA A 1 192 ? -33.187 120.155 9.638   1.00 56.20  ? 192  ALA A CB  1 
ATOM   1414 N N   . ILE A 1 193 ? -33.967 119.993 12.703  1.00 58.08  ? 193  ILE A N   1 
ATOM   1415 C CA  . ILE A 1 193 ? -34.167 119.195 13.909  1.00 56.86  ? 193  ILE A CA  1 
ATOM   1416 C C   . ILE A 1 193 ? -35.576 119.426 14.446  1.00 61.88  ? 193  ILE A C   1 
ATOM   1417 O O   . ILE A 1 193 ? -36.182 118.538 15.054  1.00 64.07  ? 193  ILE A O   1 
ATOM   1418 C CB  . ILE A 1 193 ? -33.132 119.570 14.993  1.00 50.42  ? 193  ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 193 ? -31.779 118.953 14.641  1.00 45.63  ? 193  ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 193 ? -33.584 119.077 16.350  1.00 43.29  ? 193  ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 193 ? -30.611 119.570 15.368  1.00 45.91  ? 193  ILE A CD1 1 
ATOM   1422 N N   . LYS A 1 194 ? -36.090 120.628 14.209  1.00 66.40  ? 194  LYS A N   1 
ATOM   1423 C CA  . LYS A 1 194 ? -37.428 120.994 14.647  1.00 72.18  ? 194  LYS A CA  1 
ATOM   1424 C C   . LYS A 1 194 ? -38.468 120.321 13.759  1.00 72.94  ? 194  LYS A C   1 
ATOM   1425 O O   . LYS A 1 194 ? -39.353 119.622 14.249  1.00 75.12  ? 194  LYS A O   1 
ATOM   1426 C CB  . LYS A 1 194 ? -37.606 122.517 14.589  1.00 78.23  ? 194  LYS A CB  1 
ATOM   1427 C CG  . LYS A 1 194 ? -39.050 122.983 14.412  1.00 84.52  ? 194  LYS A CG  1 
ATOM   1428 C CD  . LYS A 1 194 ? -39.352 124.212 15.263  1.00 90.74  ? 194  LYS A CD  1 
ATOM   1429 C CE  . LYS A 1 194 ? -40.751 124.753 14.989  1.00 92.72  ? 194  LYS A CE  1 
ATOM   1430 N NZ  . LYS A 1 194 ? -40.839 126.225 15.223  1.00 94.51  ? 194  LYS A NZ  1 
ATOM   1431 N N   . LYS A 1 195 ? -38.355 120.538 12.453  1.00 73.92  ? 195  LYS A N   1 
ATOM   1432 C CA  . LYS A 1 195 ? -39.287 119.960 11.492  1.00 75.65  ? 195  LYS A CA  1 
ATOM   1433 C C   . LYS A 1 195 ? -39.676 118.538 11.877  1.00 75.23  ? 195  LYS A C   1 
ATOM   1434 O O   . LYS A 1 195 ? -40.835 118.145 11.750  1.00 78.93  ? 195  LYS A O   1 
ATOM   1435 C CB  . LYS A 1 195 ? -38.669 119.959 10.091  1.00 78.45  ? 195  LYS A CB  1 
ATOM   1436 C CG  . LYS A 1 195 ? -39.658 119.637 8.975   1.00 80.30  ? 195  LYS A CG  1 
ATOM   1437 C CD  . LYS A 1 195 ? -39.296 118.338 8.262   1.00 83.09  ? 195  LYS A CD  1 
ATOM   1438 C CE  . LYS A 1 195 ? -39.389 118.489 6.750   1.00 85.37  ? 195  LYS A CE  1 
ATOM   1439 N NZ  . LYS A 1 195 ? -38.776 119.761 6.267   1.00 86.74  ? 195  LYS A NZ  1 
ATOM   1440 N N   . ARG A 1 196 ? -38.704 117.767 12.347  1.00 74.26  ? 196  ARG A N   1 
ATOM   1441 C CA  . ARG A 1 196 ? -38.969 116.395 12.747  1.00 75.38  ? 196  ARG A CA  1 
ATOM   1442 C C   . ARG A 1 196 ? -39.452 116.347 14.188  1.00 78.17  ? 196  ARG A C   1 
ATOM   1443 O O   . ARG A 1 196 ? -40.380 115.608 14.515  1.00 79.44  ? 196  ARG A O   1 
ATOM   1444 C CB  . ARG A 1 196 ? -37.708 115.546 12.579  1.00 76.76  ? 196  ARG A CB  1 
ATOM   1445 C CG  . ARG A 1 196 ? -36.745 115.570 13.755  1.00 75.09  ? 196  ARG A CG  1 
ATOM   1446 C CD  . ARG A 1 196 ? -35.557 114.665 13.480  1.00 77.29  ? 196  ARG A CD  1 
ATOM   1447 N NE  . ARG A 1 196 ? -35.953 113.384 12.893  1.00 80.05  ? 196  ARG A NE  1 
ATOM   1448 C CZ  . ARG A 1 196 ? -36.045 113.150 11.585  1.00 82.73  ? 196  ARG A CZ  1 
ATOM   1449 N NH1 . ARG A 1 196 ? -35.769 114.115 10.712  1.00 83.87  ? 196  ARG A NH1 1 
ATOM   1450 N NH2 . ARG A 1 196 ? -36.411 111.951 11.148  1.00 79.74  ? 196  ARG A NH2 1 
ATOM   1451 N N   . GLY A 1 197 ? -38.821 117.142 15.048  1.00 80.49  ? 197  GLY A N   1 
ATOM   1452 C CA  . GLY A 1 197 ? -39.213 117.178 16.444  1.00 81.78  ? 197  GLY A CA  1 
ATOM   1453 C C   . GLY A 1 197 ? -39.088 115.832 17.128  1.00 82.78  ? 197  GLY A C   1 
ATOM   1454 O O   . GLY A 1 197 ? -39.609 115.631 18.225  1.00 83.18  ? 197  GLY A O   1 
ATOM   1455 N N   . ASP A 1 198 ? -38.404 114.903 16.474  1.00 81.66  ? 198  ASP A N   1 
ATOM   1456 C CA  . ASP A 1 198 ? -38.206 113.578 17.037  1.00 79.75  ? 198  ASP A CA  1 
ATOM   1457 C C   . ASP A 1 198 ? -37.436 113.741 18.340  1.00 79.09  ? 198  ASP A C   1 
ATOM   1458 O O   . ASP A 1 198 ? -37.713 113.055 19.324  1.00 77.97  ? 198  ASP A O   1 
ATOM   1459 C CB  . ASP A 1 198 ? -37.412 112.710 16.057  1.00 85.50  ? 198  ASP A CB  1 
ATOM   1460 C CG  . ASP A 1 198 ? -37.060 111.345 16.626  1.00 89.57  ? 198  ASP A CG  1 
ATOM   1461 O OD1 . ASP A 1 198 ? -37.298 111.109 17.829  1.00 93.12  ? 198  ASP A OD1 1 
ATOM   1462 O OD2 . ASP A 1 198 ? -36.539 110.504 15.862  1.00 92.26  ? 198  ASP A OD2 1 
ATOM   1463 N N   . TYR A 1 199 ? -36.482 114.668 18.344  1.00 77.65  ? 199  TYR A N   1 
ATOM   1464 C CA  . TYR A 1 199 ? -35.662 114.915 19.526  1.00 77.61  ? 199  TYR A CA  1 
ATOM   1465 C C   . TYR A 1 199 ? -35.398 116.395 19.791  1.00 80.83  ? 199  TYR A C   1 
ATOM   1466 O O   . TYR A 1 199 ? -36.087 117.269 19.260  1.00 83.74  ? 199  TYR A O   1 
ATOM   1467 C CB  . TYR A 1 199 ? -34.322 114.186 19.389  1.00 70.96  ? 199  TYR A CB  1 
ATOM   1468 C CG  . TYR A 1 199 ? -33.551 114.515 18.128  1.00 62.55  ? 199  TYR A CG  1 
ATOM   1469 C CD1 . TYR A 1 199 ? -34.006 114.091 16.882  1.00 61.82  ? 199  TYR A CD1 1 
ATOM   1470 C CD2 . TYR A 1 199 ? -32.344 115.212 18.183  1.00 60.49  ? 199  TYR A CD2 1 
ATOM   1471 C CE1 . TYR A 1 199 ? -33.278 114.346 15.722  1.00 57.48  ? 199  TYR A CE1 1 
ATOM   1472 C CE2 . TYR A 1 199 ? -31.607 115.473 17.025  1.00 58.66  ? 199  TYR A CE2 1 
ATOM   1473 C CZ  . TYR A 1 199 ? -32.082 115.031 15.797  1.00 55.36  ? 199  TYR A CZ  1 
ATOM   1474 O OH  . TYR A 1 199 ? -31.356 115.244 14.649  1.00 45.46  ? 199  TYR A OH  1 
ATOM   1475 N N   . ASP A 1 200 ? -34.401 116.657 20.632  1.00 83.80  ? 200  ASP A N   1 
ATOM   1476 C CA  . ASP A 1 200 ? -33.992 118.014 20.976  1.00 84.98  ? 200  ASP A CA  1 
ATOM   1477 C C   . ASP A 1 200 ? -32.462 118.070 21.034  1.00 84.64  ? 200  ASP A C   1 
ATOM   1478 O O   . ASP A 1 200 ? -31.834 117.388 21.851  1.00 84.54  ? 200  ASP A O   1 
ATOM   1479 C CB  . ASP A 1 200 ? -34.588 118.433 22.323  1.00 88.70  ? 200  ASP A CB  1 
ATOM   1480 C CG  . ASP A 1 200 ? -34.932 119.914 22.374  1.00 92.98  ? 200  ASP A CG  1 
ATOM   1481 O OD1 . ASP A 1 200 ? -34.889 120.573 21.311  1.00 92.99  ? 200  ASP A OD1 1 
ATOM   1482 O OD2 . ASP A 1 200 ? -35.244 120.420 23.473  1.00 94.79  ? 200  ASP A OD2 1 
ATOM   1483 N N   . ALA A 1 201 ? -31.872 118.879 20.155  1.00 82.51  ? 201  ALA A N   1 
ATOM   1484 C CA  . ALA A 1 201 ? -30.422 119.020 20.078  1.00 78.05  ? 201  ALA A CA  1 
ATOM   1485 C C   . ALA A 1 201 ? -29.937 120.391 20.538  1.00 75.36  ? 201  ALA A C   1 
ATOM   1486 O O   . ALA A 1 201 ? -30.616 121.405 20.360  1.00 74.11  ? 201  ALA A O   1 
ATOM   1487 C CB  . ALA A 1 201 ? -29.947 118.747 18.656  1.00 78.07  ? 201  ALA A CB  1 
ATOM   1488 N N   . ASN A 1 202 ? -28.735 120.399 21.108  1.00 75.30  ? 202  ASN A N   1 
ATOM   1489 C CA  . ASN A 1 202 ? -28.106 121.603 21.645  1.00 71.18  ? 202  ASN A CA  1 
ATOM   1490 C C   . ASN A 1 202 ? -26.802 121.962 20.916  1.00 64.81  ? 202  ASN A C   1 
ATOM   1491 O O   . ASN A 1 202 ? -25.713 121.706 21.431  1.00 65.98  ? 202  ASN A O   1 
ATOM   1492 C CB  . ASN A 1 202 ? -27.818 121.375 23.138  1.00 77.81  ? 202  ASN A CB  1 
ATOM   1493 C CG  . ASN A 1 202 ? -27.653 122.666 23.916  1.00 81.95  ? 202  ASN A CG  1 
ATOM   1494 O OD1 . ASN A 1 202 ? -27.222 122.650 25.070  1.00 85.20  ? 202  ASN A OD1 1 
ATOM   1495 N ND2 . ASN A 1 202 ? -27.995 123.790 23.295  1.00 85.98  ? 202  ASN A ND2 1 
ATOM   1496 N N   . ILE A 1 203 ? -26.908 122.551 19.725  1.00 57.02  ? 203  ILE A N   1 
ATOM   1497 C CA  . ILE A 1 203 ? -25.716 122.939 18.963  1.00 50.52  ? 203  ILE A CA  1 
ATOM   1498 C C   . ILE A 1 203 ? -25.048 124.118 19.670  1.00 47.59  ? 203  ILE A C   1 
ATOM   1499 O O   . ILE A 1 203 ? -25.363 125.277 19.415  1.00 47.61  ? 203  ILE A O   1 
ATOM   1500 C CB  . ILE A 1 203 ? -26.076 123.334 17.508  1.00 47.21  ? 203  ILE A CB  1 
ATOM   1501 C CG1 . ILE A 1 203 ? -26.418 122.080 16.702  1.00 48.64  ? 203  ILE A CG1 1 
ATOM   1502 C CG2 . ILE A 1 203 ? -24.901 124.022 16.837  1.00 46.23  ? 203  ILE A CG2 1 
ATOM   1503 C CD1 . ILE A 1 203 ? -27.722 122.175 15.951  1.00 48.43  ? 203  ILE A CD1 1 
ATOM   1504 N N   . VAL A 1 204 ? -24.120 123.811 20.565  1.00 47.26  ? 204  VAL A N   1 
ATOM   1505 C CA  . VAL A 1 204 ? -23.444 124.842 21.338  1.00 46.68  ? 204  VAL A CA  1 
ATOM   1506 C C   . VAL A 1 204 ? -22.297 125.509 20.605  1.00 42.53  ? 204  VAL A C   1 
ATOM   1507 O O   . VAL A 1 204 ? -21.949 126.653 20.902  1.00 41.62  ? 204  VAL A O   1 
ATOM   1508 C CB  . VAL A 1 204 ? -22.898 124.268 22.666  1.00 48.22  ? 204  VAL A CB  1 
ATOM   1509 C CG1 . VAL A 1 204 ? -24.046 123.889 23.578  1.00 49.28  ? 204  VAL A CG1 1 
ATOM   1510 C CG2 . VAL A 1 204 ? -22.019 123.061 22.386  1.00 48.81  ? 204  VAL A CG2 1 
ATOM   1511 N N   . ALA A 1 205 ? -21.707 124.797 19.649  1.00 37.40  ? 205  ALA A N   1 
ATOM   1512 C CA  . ALA A 1 205 ? -20.582 125.345 18.907  1.00 36.62  ? 205  ALA A CA  1 
ATOM   1513 C C   . ALA A 1 205 ? -20.459 124.790 17.502  1.00 34.62  ? 205  ALA A C   1 
ATOM   1514 O O   . ALA A 1 205 ? -20.950 123.706 17.206  1.00 37.18  ? 205  ALA A O   1 
ATOM   1515 C CB  . ALA A 1 205 ? -19.283 125.089 19.668  1.00 33.01  ? 205  ALA A CB  1 
ATOM   1516 N N   . VAL A 1 206 ? -19.804 125.562 16.642  1.00 34.25  ? 206  VAL A N   1 
ATOM   1517 C CA  . VAL A 1 206 ? -19.538 125.177 15.261  1.00 30.33  ? 206  VAL A CA  1 
ATOM   1518 C C   . VAL A 1 206 ? -18.068 125.502 15.041  1.00 31.78  ? 206  VAL A C   1 
ATOM   1519 O O   . VAL A 1 206 ? -17.642 126.638 15.255  1.00 34.13  ? 206  VAL A O   1 
ATOM   1520 C CB  . VAL A 1 206 ? -20.359 125.991 14.262  1.00 22.98  ? 206  VAL A CB  1 
ATOM   1521 C CG1 . VAL A 1 206 ? -19.837 125.748 12.864  1.00 19.36  ? 206  VAL A CG1 1 
ATOM   1522 C CG2 . VAL A 1 206 ? -21.818 125.607 14.359  1.00 23.70  ? 206  VAL A CG2 1 
ATOM   1523 N N   . VAL A 1 207 ? -17.291 124.513 14.621  1.00 30.80  ? 207  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 207 ? -15.867 124.732 14.410  1.00 29.56  ? 207  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 207 ? -15.373 124.147 13.096  1.00 25.17  ? 207  VAL A C   1 
ATOM   1526 O O   . VAL A 1 207 ? -15.952 123.200 12.567  1.00 30.42  ? 207  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 207 ? -15.041 124.116 15.571  1.00 31.01  ? 207  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 207 ? -15.655 124.502 16.905  1.00 35.06  ? 207  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 207 ? -15.000 122.602 15.443  1.00 34.15  ? 207  VAL A CG2 1 
ATOM   1530 N N   . ASN A 1 208 ? -14.302 124.718 12.565  1.00 19.78  ? 208  ASN A N   1 
ATOM   1531 C CA  . ASN A 1 208 ? -13.728 124.214 11.327  1.00 23.96  ? 208  ASN A CA  1 
ATOM   1532 C C   . ASN A 1 208 ? -12.916 122.968 11.669  1.00 25.26  ? 208  ASN A C   1 
ATOM   1533 O O   . ASN A 1 208 ? -12.506 122.794 12.818  1.00 30.71  ? 208  ASN A O   1 
ATOM   1534 C CB  . ASN A 1 208 ? -12.818 125.261 10.704  1.00 25.03  ? 208  ASN A CB  1 
ATOM   1535 C CG  . ASN A 1 208 ? -12.395 124.897 9.313   1.00 16.58  ? 208  ASN A CG  1 
ATOM   1536 O OD1 . ASN A 1 208 ? -11.283 124.425 9.097   1.00 22.31  ? 208  ASN A OD1 1 
ATOM   1537 N ND2 . ASN A 1 208 ? -13.283 125.114 8.352   1.00 14.35  ? 208  ASN A ND2 1 
ATOM   1538 N N   . ASP A 1 209 ? -12.674 122.104 10.688  1.00 19.35  ? 209  ASP A N   1 
ATOM   1539 C CA  . ASP A 1 209 ? -11.917 120.888 10.955  1.00 17.86  ? 209  ASP A CA  1 
ATOM   1540 C C   . ASP A 1 209 ? -10.475 121.174 11.361  1.00 20.93  ? 209  ASP A C   1 
ATOM   1541 O O   . ASP A 1 209 ? -9.881  120.432 12.145  1.00 21.25  ? 209  ASP A O   1 
ATOM   1542 C CB  . ASP A 1 209 ? -11.948 119.953 9.745   1.00 21.31  ? 209  ASP A CB  1 
ATOM   1543 C CG  . ASP A 1 209 ? -11.679 120.671 8.438   1.00 26.89  ? 209  ASP A CG  1 
ATOM   1544 O OD1 . ASP A 1 209 ? -11.636 121.922 8.440   1.00 25.46  ? 209  ASP A OD1 1 
ATOM   1545 O OD2 . ASP A 1 209 ? -11.513 119.975 7.408   1.00 21.39  ? 209  ASP A OD2 1 
ATOM   1546 N N   . THR A 1 210 ? -9.903  122.245 10.828  1.00 22.93  ? 210  THR A N   1 
ATOM   1547 C CA  . THR A 1 210 ? -8.536  122.593 11.186  1.00 23.60  ? 210  THR A CA  1 
ATOM   1548 C C   . THR A 1 210 ? -8.523  122.945 12.670  1.00 27.21  ? 210  THR A C   1 
ATOM   1549 O O   . THR A 1 210 ? -7.592  122.587 13.390  1.00 31.16  ? 210  THR A O   1 
ATOM   1550 C CB  . THR A 1 210 ? -8.028  123.802 10.385  1.00 24.71  ? 210  THR A CB  1 
ATOM   1551 O OG1 . THR A 1 210 ? -9.001  124.855 10.428  1.00 26.03  ? 210  THR A OG1 1 
ATOM   1552 C CG2 . THR A 1 210 ? -7.779  123.408 8.943   1.00 31.83  ? 210  THR A CG2 1 
ATOM   1553 N N   . VAL A 1 211 ? -9.564  123.641 13.122  1.00 25.25  ? 211  VAL A N   1 
ATOM   1554 C CA  . VAL A 1 211 ? -9.664  124.032 14.526  1.00 20.04  ? 211  VAL A CA  1 
ATOM   1555 C C   . VAL A 1 211 ? -9.789  122.783 15.392  1.00 18.47  ? 211  VAL A C   1 
ATOM   1556 O O   . VAL A 1 211 ? -9.113  122.653 16.413  1.00 18.34  ? 211  VAL A O   1 
ATOM   1557 C CB  . VAL A 1 211 ? -10.885 124.956 14.778  1.00 17.61  ? 211  VAL A CB  1 
ATOM   1558 C CG1 . VAL A 1 211 ? -11.180 125.021 16.263  1.00 13.50  ? 211  VAL A CG1 1 
ATOM   1559 C CG2 . VAL A 1 211 ? -10.604 126.359 14.250  1.00 14.13  ? 211  VAL A CG2 1 
ATOM   1560 N N   . GLY A 1 212 ? -10.655 121.867 14.977  1.00 17.89  ? 212  GLY A N   1 
ATOM   1561 C CA  . GLY A 1 212 ? -10.831 120.640 15.723  1.00 17.68  ? 212  GLY A CA  1 
ATOM   1562 C C   . GLY A 1 212 ? -9.520  119.886 15.867  1.00 21.74  ? 212  GLY A C   1 
ATOM   1563 O O   . GLY A 1 212 ? -9.199  119.388 16.948  1.00 21.84  ? 212  GLY A O   1 
ATOM   1564 N N   . THR A 1 213 ? -8.753  119.805 14.780  1.00 23.63  ? 213  THR A N   1 
ATOM   1565 C CA  . THR A 1 213 ? -7.476  119.091 14.797  1.00 20.70  ? 213  THR A CA  1 
ATOM   1566 C C   . THR A 1 213 ? -6.503  119.741 15.778  1.00 20.71  ? 213  THR A C   1 
ATOM   1567 O O   . THR A 1 213 ? -5.864  119.050 16.573  1.00 21.81  ? 213  THR A O   1 
ATOM   1568 C CB  . THR A 1 213 ? -6.850  119.041 13.378  1.00 19.07  ? 213  THR A CB  1 
ATOM   1569 O OG1 . THR A 1 213 ? -7.699  118.275 12.515  1.00 13.52  ? 213  THR A OG1 1 
ATOM   1570 C CG2 . THR A 1 213 ? -5.473  118.386 13.409  1.00 16.99  ? 213  THR A CG2 1 
ATOM   1571 N N   . MET A 1 214 ? -6.397  121.067 15.728  1.00 16.39  ? 214  MET A N   1 
ATOM   1572 C CA  . MET A 1 214 ? -5.514  121.792 16.633  1.00 17.65  ? 214  MET A CA  1 
ATOM   1573 C C   . MET A 1 214 ? -5.942  121.561 18.079  1.00 21.39  ? 214  MET A C   1 
ATOM   1574 O O   . MET A 1 214 ? -5.104  121.411 18.968  1.00 23.89  ? 214  MET A O   1 
ATOM   1575 C CB  . MET A 1 214 ? -5.548  123.290 16.335  1.00 16.98  ? 214  MET A CB  1 
ATOM   1576 C CG  . MET A 1 214 ? -4.513  124.092 17.113  1.00 15.59  ? 214  MET A CG  1 
ATOM   1577 S SD  . MET A 1 214 ? -4.857  125.869 17.150  1.00 22.66  ? 214  MET A SD  1 
ATOM   1578 C CE  . MET A 1 214 ? -6.608  125.877 17.537  1.00 13.63  ? 214  MET A CE  1 
ATOM   1579 N N   . MET A 1 215 ? -7.250  121.536 18.314  1.00 17.44  ? 215  MET A N   1 
ATOM   1580 C CA  . MET A 1 215 ? -7.759  121.316 19.657  1.00 20.73  ? 215  MET A CA  1 
ATOM   1581 C C   . MET A 1 215 ? -7.464  119.892 20.113  1.00 28.20  ? 215  MET A C   1 
ATOM   1582 O O   . MET A 1 215 ? -6.882  119.669 21.179  1.00 30.01  ? 215  MET A O   1 
ATOM   1583 C CB  . MET A 1 215 ? -9.264  121.558 19.696  1.00 19.34  ? 215  MET A CB  1 
ATOM   1584 C CG  . MET A 1 215 ? -9.658  123.010 19.542  1.00 25.63  ? 215  MET A CG  1 
ATOM   1585 S SD  . MET A 1 215 ? -8.815  124.099 20.704  1.00 31.72  ? 215  MET A SD  1 
ATOM   1586 C CE  . MET A 1 215 ? -10.103 124.268 21.965  1.00 26.47  ? 215  MET A CE  1 
ATOM   1587 N N   . THR A 1 216 ? -7.866  118.928 19.291  1.00 30.69  ? 216  THR A N   1 
ATOM   1588 C CA  . THR A 1 216 ? -7.666  117.519 19.595  1.00 30.48  ? 216  THR A CA  1 
ATOM   1589 C C   . THR A 1 216 ? -6.222  117.176 19.925  1.00 31.76  ? 216  THR A C   1 
ATOM   1590 O O   . THR A 1 216 ? -5.964  116.271 20.712  1.00 37.74  ? 216  THR A O   1 
ATOM   1591 C CB  . THR A 1 216 ? -8.109  116.643 18.420  1.00 29.23  ? 216  THR A CB  1 
ATOM   1592 O OG1 . THR A 1 216 ? -9.523  116.769 18.244  1.00 37.15  ? 216  THR A OG1 1 
ATOM   1593 C CG2 . THR A 1 216 ? -7.779  115.188 18.675  1.00 29.75  ? 216  THR A CG2 1 
ATOM   1594 N N   . CYS A 1 217 ? -5.281  117.899 19.334  1.00 30.48  ? 217  CYS A N   1 
ATOM   1595 C CA  . CYS A 1 217 ? -3.876  117.622 19.575  1.00 31.48  ? 217  CYS A CA  1 
ATOM   1596 C C   . CYS A 1 217 ? -3.266  118.498 20.658  1.00 33.78  ? 217  CYS A C   1 
ATOM   1597 O O   . CYS A 1 217 ? -2.278  118.114 21.281  1.00 32.60  ? 217  CYS A O   1 
ATOM   1598 C CB  . CYS A 1 217 ? -3.091  117.763 18.268  1.00 34.46  ? 217  CYS A CB  1 
ATOM   1599 S SG  . CYS A 1 217 ? -3.430  116.420 17.093  1.00 36.23  ? 217  CYS A SG  1 
ATOM   1600 N N   . GLY A 1 218 ? -3.851  119.673 20.873  1.00 38.34  ? 218  GLY A N   1 
ATOM   1601 C CA  . GLY A 1 218 ? -3.351  120.573 21.899  1.00 40.85  ? 218  GLY A CA  1 
ATOM   1602 C C   . GLY A 1 218 ? -3.698  119.999 23.260  1.00 45.16  ? 218  GLY A C   1 
ATOM   1603 O O   . GLY A 1 218 ? -3.068  120.300 24.276  1.00 40.69  ? 218  GLY A O   1 
ATOM   1604 N N   . TYR A 1 219 ? -4.728  119.163 23.271  1.00 46.91  ? 219  TYR A N   1 
ATOM   1605 C CA  . TYR A 1 219 ? -5.166  118.509 24.487  1.00 50.66  ? 219  TYR A CA  1 
ATOM   1606 C C   . TYR A 1 219 ? -4.024  117.628 25.010  1.00 52.09  ? 219  TYR A C   1 
ATOM   1607 O O   . TYR A 1 219 ? -3.757  117.596 26.213  1.00 55.77  ? 219  TYR A O   1 
ATOM   1608 C CB  . TYR A 1 219 ? -6.403  117.662 24.188  1.00 54.34  ? 219  TYR A CB  1 
ATOM   1609 C CG  . TYR A 1 219 ? -6.894  116.875 25.368  1.00 61.47  ? 219  TYR A CG  1 
ATOM   1610 C CD1 . TYR A 1 219 ? -7.752  117.449 26.301  1.00 65.80  ? 219  TYR A CD1 1 
ATOM   1611 C CD2 . TYR A 1 219 ? -6.489  115.559 25.563  1.00 64.19  ? 219  TYR A CD2 1 
ATOM   1612 C CE1 . TYR A 1 219 ? -8.193  116.729 27.407  1.00 72.50  ? 219  TYR A CE1 1 
ATOM   1613 C CE2 . TYR A 1 219 ? -6.922  114.829 26.662  1.00 71.88  ? 219  TYR A CE2 1 
ATOM   1614 C CZ  . TYR A 1 219 ? -7.773  115.419 27.581  1.00 73.83  ? 219  TYR A CZ  1 
ATOM   1615 O OH  . TYR A 1 219 ? -8.193  114.699 28.677  1.00 80.99  ? 219  TYR A OH  1 
ATOM   1616 N N   . ASP A 1 220 ? -3.349  116.932 24.093  1.00 51.30  ? 220  ASP A N   1 
ATOM   1617 C CA  . ASP A 1 220 ? -2.232  116.043 24.424  1.00 46.54  ? 220  ASP A CA  1 
ATOM   1618 C C   . ASP A 1 220 ? -0.901  116.781 24.387  1.00 44.47  ? 220  ASP A C   1 
ATOM   1619 O O   . ASP A 1 220 ? 0.130   116.238 24.784  1.00 45.57  ? 220  ASP A O   1 
ATOM   1620 C CB  . ASP A 1 220 ? -2.166  114.870 23.440  1.00 47.93  ? 220  ASP A CB  1 
ATOM   1621 C CG  . ASP A 1 220 ? -3.493  114.154 23.288  1.00 54.62  ? 220  ASP A CG  1 
ATOM   1622 O OD1 . ASP A 1 220 ? -4.246  114.072 24.283  1.00 59.05  ? 220  ASP A OD1 1 
ATOM   1623 O OD2 . ASP A 1 220 ? -3.784  113.672 22.172  1.00 57.52  ? 220  ASP A OD2 1 
ATOM   1624 N N   . ASP A 1 221 ? -0.919  118.011 23.892  1.00 40.13  ? 221  ASP A N   1 
ATOM   1625 C CA  . ASP A 1 221 ? 0.297   118.804 23.818  1.00 38.02  ? 221  ASP A CA  1 
ATOM   1626 C C   . ASP A 1 221 ? -0.032  120.287 23.901  1.00 40.68  ? 221  ASP A C   1 
ATOM   1627 O O   . ASP A 1 221 ? -0.536  120.885 22.949  1.00 41.86  ? 221  ASP A O   1 
ATOM   1628 C CB  . ASP A 1 221 ? 1.047   118.499 22.524  1.00 33.71  ? 221  ASP A CB  1 
ATOM   1629 C CG  . ASP A 1 221 ? 2.415   119.153 22.480  1.00 36.36  ? 221  ASP A CG  1 
ATOM   1630 O OD1 . ASP A 1 221 ? 2.617   120.154 23.205  1.00 36.63  ? 221  ASP A OD1 1 
ATOM   1631 O OD2 . ASP A 1 221 ? 3.285   118.667 21.724  1.00 32.03  ? 221  ASP A OD2 1 
ATOM   1632 N N   . GLN A 1 222 ? 0.265   120.878 25.050  1.00 45.09  ? 222  GLN A N   1 
ATOM   1633 C CA  . GLN A 1 222 ? -0.021  122.283 25.283  1.00 48.69  ? 222  GLN A CA  1 
ATOM   1634 C C   . GLN A 1 222 ? 0.801   123.205 24.402  1.00 45.49  ? 222  GLN A C   1 
ATOM   1635 O O   . GLN A 1 222 ? 0.725   124.424 24.538  1.00 46.33  ? 222  GLN A O   1 
ATOM   1636 C CB  . GLN A 1 222 ? 0.225   122.626 26.754  1.00 56.07  ? 222  GLN A CB  1 
ATOM   1637 C CG  . GLN A 1 222 ? -0.741  121.956 27.722  1.00 69.91  ? 222  GLN A CG  1 
ATOM   1638 C CD  . GLN A 1 222 ? -2.200  122.282 27.427  1.00 78.56  ? 222  GLN A CD  1 
ATOM   1639 O OE1 . GLN A 1 222 ? -2.619  123.442 27.503  1.00 83.21  ? 222  GLN A OE1 1 
ATOM   1640 N NE2 . GLN A 1 222 ? -2.982  121.255 27.091  1.00 80.92  ? 222  GLN A NE2 1 
ATOM   1641 N N   . HIS A 1 223 ? 1.586   122.625 23.498  1.00 41.21  ? 223  HIS A N   1 
ATOM   1642 C CA  . HIS A 1 223 ? 2.426   123.420 22.606  1.00 42.35  ? 223  HIS A CA  1 
ATOM   1643 C C   . HIS A 1 223 ? 1.784   123.629 21.240  1.00 36.96  ? 223  HIS A C   1 
ATOM   1644 O O   . HIS A 1 223 ? 2.360   124.273 20.367  1.00 34.53  ? 223  HIS A O   1 
ATOM   1645 C CB  . HIS A 1 223 ? 3.792   122.751 22.423  1.00 50.35  ? 223  HIS A CB  1 
ATOM   1646 C CG  . HIS A 1 223 ? 4.777   123.082 23.500  1.00 57.45  ? 223  HIS A CG  1 
ATOM   1647 N ND1 . HIS A 1 223 ? 5.051   122.227 24.547  1.00 59.00  ? 223  HIS A ND1 1 
ATOM   1648 C CD2 . HIS A 1 223 ? 5.553   124.175 23.692  1.00 58.13  ? 223  HIS A CD2 1 
ATOM   1649 C CE1 . HIS A 1 223 ? 5.952   122.781 25.339  1.00 60.80  ? 223  HIS A CE1 1 
ATOM   1650 N NE2 . HIS A 1 223 ? 6.272   123.963 24.842  1.00 57.67  ? 223  HIS A NE2 1 
ATOM   1651 N N   . CYS A 1 224 ? 0.584   123.093 21.061  1.00 33.09  ? 224  CYS A N   1 
ATOM   1652 C CA  . CYS A 1 224 ? -0.112  123.222 19.792  1.00 33.15  ? 224  CYS A CA  1 
ATOM   1653 C C   . CYS A 1 224 ? -0.619  124.629 19.500  1.00 33.00  ? 224  CYS A C   1 
ATOM   1654 O O   . CYS A 1 224 ? -1.292  125.240 20.332  1.00 34.07  ? 224  CYS A O   1 
ATOM   1655 C CB  . CYS A 1 224 ? -1.280  122.247 19.734  1.00 33.79  ? 224  CYS A CB  1 
ATOM   1656 S SG  . CYS A 1 224 ? -1.521  121.591 18.089  1.00 34.00  ? 224  CYS A SG  1 
ATOM   1657 N N   . GLU A 1 225 ? -0.291  125.130 18.312  1.00 30.94  ? 225  GLU A N   1 
ATOM   1658 C CA  . GLU A 1 225 ? -0.717  126.458 17.880  1.00 31.12  ? 225  GLU A CA  1 
ATOM   1659 C C   . GLU A 1 225 ? -1.137  126.448 16.420  1.00 31.30  ? 225  GLU A C   1 
ATOM   1660 O O   . GLU A 1 225 ? -1.472  127.493 15.862  1.00 31.62  ? 225  GLU A O   1 
ATOM   1661 C CB  . GLU A 1 225 ? 0.410   127.472 18.035  1.00 29.20  ? 225  GLU A CB  1 
ATOM   1662 C CG  . GLU A 1 225 ? 1.241   127.323 19.279  1.00 33.90  ? 225  GLU A CG  1 
ATOM   1663 C CD  . GLU A 1 225 ? 2.393   128.299 19.292  1.00 37.84  ? 225  GLU A CD  1 
ATOM   1664 O OE1 . GLU A 1 225 ? 3.343   128.103 18.506  1.00 35.33  ? 225  GLU A OE1 1 
ATOM   1665 O OE2 . GLU A 1 225 ? 2.345   129.265 20.083  1.00 42.25  ? 225  GLU A OE2 1 
ATOM   1666 N N   . VAL A 1 226 ? -1.104  125.270 15.803  1.00 31.47  ? 226  VAL A N   1 
ATOM   1667 C CA  . VAL A 1 226 ? -1.462  125.129 14.398  1.00 23.50  ? 226  VAL A CA  1 
ATOM   1668 C C   . VAL A 1 226 ? -2.196  123.828 14.077  1.00 23.40  ? 226  VAL A C   1 
ATOM   1669 O O   . VAL A 1 226 ? -1.832  122.753 14.549  1.00 20.97  ? 226  VAL A O   1 
ATOM   1670 C CB  . VAL A 1 226 ? -0.208  125.202 13.492  1.00 19.54  ? 226  VAL A CB  1 
ATOM   1671 C CG1 . VAL A 1 226 ? -0.631  125.357 12.050  1.00 20.97  ? 226  VAL A CG1 1 
ATOM   1672 C CG2 . VAL A 1 226 ? 0.687   126.371 13.903  1.00 17.34  ? 226  VAL A CG2 1 
ATOM   1673 N N   . GLY A 1 227 ? -3.246  123.948 13.274  1.00 23.82  ? 227  GLY A N   1 
ATOM   1674 C CA  . GLY A 1 227 ? -4.009  122.792 12.849  1.00 20.89  ? 227  GLY A CA  1 
ATOM   1675 C C   . GLY A 1 227 ? -3.857  122.715 11.339  1.00 18.91  ? 227  GLY A C   1 
ATOM   1676 O O   . GLY A 1 227 ? -4.125  123.687 10.636  1.00 24.49  ? 227  GLY A O   1 
ATOM   1677 N N   . LEU A 1 228 ? -3.438  121.565 10.829  1.00 15.73  ? 228  LEU A N   1 
ATOM   1678 C CA  . LEU A 1 228 ? -3.230  121.421 9.398   1.00 10.74  ? 228  LEU A CA  1 
ATOM   1679 C C   . LEU A 1 228 ? -4.019  120.274 8.809   1.00 8.07   ? 228  LEU A C   1 
ATOM   1680 O O   . LEU A 1 228 ? -3.907  119.146 9.266   1.00 15.61  ? 228  LEU A O   1 
ATOM   1681 C CB  . LEU A 1 228 ? -1.734  121.219 9.132   1.00 9.09   ? 228  LEU A CB  1 
ATOM   1682 C CG  . LEU A 1 228 ? -1.209  120.712 7.790   1.00 6.15   ? 228  LEU A CG  1 
ATOM   1683 C CD1 . LEU A 1 228 ? -1.243  121.815 6.757   1.00 5.00   ? 228  LEU A CD1 1 
ATOM   1684 C CD2 . LEU A 1 228 ? 0.221   120.235 7.979   1.00 12.13  ? 228  LEU A CD2 1 
ATOM   1685 N N   . ILE A 1 229 ? -4.824  120.567 7.793   1.00 13.66  ? 229  ILE A N   1 
ATOM   1686 C CA  . ILE A 1 229 ? -5.604  119.536 7.116   1.00 13.40  ? 229  ILE A CA  1 
ATOM   1687 C C   . ILE A 1 229 ? -5.096  119.320 5.687   1.00 12.25  ? 229  ILE A C   1 
ATOM   1688 O O   . ILE A 1 229 ? -4.905  120.272 4.930   1.00 15.89  ? 229  ILE A O   1 
ATOM   1689 C CB  . ILE A 1 229 ? -7.098  119.906 7.048   1.00 8.07   ? 229  ILE A CB  1 
ATOM   1690 C CG1 . ILE A 1 229 ? -7.691  119.907 8.455   1.00 18.91  ? 229  ILE A CG1 1 
ATOM   1691 C CG2 . ILE A 1 229 ? -7.847  118.923 6.180   1.00 5.00   ? 229  ILE A CG2 1 
ATOM   1692 C CD1 . ILE A 1 229 ? -7.918  118.527 9.038   1.00 21.14  ? 229  ILE A CD1 1 
ATOM   1693 N N   . ILE A 1 230 ? -4.858  118.063 5.333   1.00 12.13  ? 230  ILE A N   1 
ATOM   1694 C CA  . ILE A 1 230 ? -4.418  117.703 3.989   1.00 12.06  ? 230  ILE A CA  1 
ATOM   1695 C C   . ILE A 1 230 ? -5.156  116.427 3.584   1.00 12.17  ? 230  ILE A C   1 
ATOM   1696 O O   . ILE A 1 230 ? -4.651  115.317 3.772   1.00 18.88  ? 230  ILE A O   1 
ATOM   1697 C CB  . ILE A 1 230 ? -2.908  117.423 3.922   1.00 10.56  ? 230  ILE A CB  1 
ATOM   1698 C CG1 . ILE A 1 230 ? -2.132  118.560 4.583   1.00 8.37   ? 230  ILE A CG1 1 
ATOM   1699 C CG2 . ILE A 1 230 ? -2.482  117.254 2.467   1.00 7.67   ? 230  ILE A CG2 1 
ATOM   1700 C CD1 . ILE A 1 230 ? -0.634  118.297 4.643   1.00 5.39   ? 230  ILE A CD1 1 
ATOM   1701 N N   . GLY A 1 231 ? -6.357  116.587 3.040   1.00 5.06   ? 231  GLY A N   1 
ATOM   1702 C CA  . GLY A 1 231 ? -7.135  115.435 2.627   1.00 5.00   ? 231  GLY A CA  1 
ATOM   1703 C C   . GLY A 1 231 ? -7.923  115.806 1.393   1.00 5.07   ? 231  GLY A C   1 
ATOM   1704 O O   . GLY A 1 231 ? -7.353  116.296 0.424   1.00 12.47  ? 231  GLY A O   1 
ATOM   1705 N N   . THR A 1 232 ? -9.227  115.561 1.415   1.00 5.00   ? 232  THR A N   1 
ATOM   1706 C CA  . THR A 1 232 ? -10.079 115.913 0.293   1.00 5.00   ? 232  THR A CA  1 
ATOM   1707 C C   . THR A 1 232 ? -9.740  117.359 -0.058  1.00 11.23  ? 232  THR A C   1 
ATOM   1708 O O   . THR A 1 232 ? -9.441  117.680 -1.212  1.00 15.48  ? 232  THR A O   1 
ATOM   1709 C CB  . THR A 1 232 ? -11.548 115.811 0.684   1.00 6.92   ? 232  THR A CB  1 
ATOM   1710 O OG1 . THR A 1 232 ? -11.877 114.437 0.924   1.00 18.39  ? 232  THR A OG1 1 
ATOM   1711 C CG2 . THR A 1 232 ? -12.431 116.357 -0.418  1.00 19.78  ? 232  THR A CG2 1 
ATOM   1712 N N   . GLY A 1 233 ? -9.783  118.224 0.953   1.00 10.73  ? 233  GLY A N   1 
ATOM   1713 C CA  . GLY A 1 233 ? -9.433  119.619 0.763   1.00 5.00   ? 233  GLY A CA  1 
ATOM   1714 C C   . GLY A 1 233 ? -8.167  119.880 1.566   1.00 10.85  ? 233  GLY A C   1 
ATOM   1715 O O   . GLY A 1 233 ? -7.604  118.953 2.148   1.00 13.00  ? 233  GLY A O   1 
ATOM   1716 N N   . THR A 1 234 ? -7.695  121.120 1.585   1.00 9.22   ? 234  THR A N   1 
ATOM   1717 C CA  . THR A 1 234 ? -6.514  121.465 2.361   1.00 5.07   ? 234  THR A CA  1 
ATOM   1718 C C   . THR A 1 234 ? -6.736  122.843 2.993   1.00 13.63  ? 234  THR A C   1 
ATOM   1719 O O   . THR A 1 234 ? -7.301  123.743 2.367   1.00 17.71  ? 234  THR A O   1 
ATOM   1720 C CB  . THR A 1 234 ? -5.260  121.489 1.504   1.00 5.00   ? 234  THR A CB  1 
ATOM   1721 O OG1 . THR A 1 234 ? -4.164  121.940 2.300   1.00 10.23  ? 234  THR A OG1 1 
ATOM   1722 C CG2 . THR A 1 234 ? -5.431  122.424 0.342   1.00 5.18   ? 234  THR A CG2 1 
ATOM   1723 N N   . ASN A 1 235 ? -6.282  123.000 4.232   1.00 12.94  ? 235  ASN A N   1 
ATOM   1724 C CA  . ASN A 1 235 ? -6.479  124.238 4.976   1.00 6.95   ? 235  ASN A CA  1 
ATOM   1725 C C   . ASN A 1 235 ? -5.613  124.228 6.239   1.00 10.00  ? 235  ASN A C   1 
ATOM   1726 O O   . ASN A 1 235 ? -5.200  123.165 6.707   1.00 11.05  ? 235  ASN A O   1 
ATOM   1727 C CB  . ASN A 1 235 ? -7.953  124.345 5.361   1.00 5.00   ? 235  ASN A CB  1 
ATOM   1728 C CG  . ASN A 1 235 ? -8.311  125.695 5.905   1.00 5.00   ? 235  ASN A CG  1 
ATOM   1729 O OD1 . ASN A 1 235 ? -7.576  126.666 5.730   1.00 5.00   ? 235  ASN A OD1 1 
ATOM   1730 N ND2 . ASN A 1 235 ? -9.453  125.773 6.573   1.00 7.91   ? 235  ASN A ND2 1 
ATOM   1731 N N   . ALA A 1 236 ? -5.336  125.406 6.786   1.00 5.54   ? 236  ALA A N   1 
ATOM   1732 C CA  . ALA A 1 236 ? -4.521  125.509 7.991   1.00 6.07   ? 236  ALA A CA  1 
ATOM   1733 C C   . ALA A 1 236 ? -5.021  126.636 8.864   1.00 9.09   ? 236  ALA A C   1 
ATOM   1734 O O   . ALA A 1 236 ? -5.412  127.692 8.370   1.00 13.07  ? 236  ALA A O   1 
ATOM   1735 C CB  . ALA A 1 236 ? -3.057  125.754 7.629   1.00 5.00   ? 236  ALA A CB  1 
ATOM   1736 N N   . CYS A 1 237 ? -5.018  126.404 10.168  1.00 12.49  ? 237  CYS A N   1 
ATOM   1737 C CA  . CYS A 1 237 ? -5.439  127.414 11.129  1.00 13.71  ? 237  CYS A CA  1 
ATOM   1738 C C   . CYS A 1 237 ? -4.303  127.539 12.132  1.00 13.94  ? 237  CYS A C   1 
ATOM   1739 O O   . CYS A 1 237 ? -3.551  126.590 12.347  1.00 10.13  ? 237  CYS A O   1 
ATOM   1740 C CB  . CYS A 1 237 ? -6.728  126.989 11.836  1.00 16.68  ? 237  CYS A CB  1 
ATOM   1741 S SG  . CYS A 1 237 ? -6.506  125.843 13.220  1.00 19.07  ? 237  CYS A SG  1 
ATOM   1742 N N   . TYR A 1 238 ? -4.159  128.713 12.728  1.00 16.51  ? 238  TYR A N   1 
ATOM   1743 C CA  . TYR A 1 238 ? -3.100  128.915 13.695  1.00 13.72  ? 238  TYR A CA  1 
ATOM   1744 C C   . TYR A 1 238 ? -3.548  129.873 14.785  1.00 15.64  ? 238  TYR A C   1 
ATOM   1745 O O   . TYR A 1 238 ? -4.659  130.407 14.729  1.00 19.81  ? 238  TYR A O   1 
ATOM   1746 C CB  . TYR A 1 238 ? -1.851  129.434 12.985  1.00 12.87  ? 238  TYR A CB  1 
ATOM   1747 C CG  . TYR A 1 238 ? -1.933  130.873 12.519  1.00 14.58  ? 238  TYR A CG  1 
ATOM   1748 C CD1 . TYR A 1 238 ? -2.762  131.242 11.460  1.00 13.75  ? 238  TYR A CD1 1 
ATOM   1749 C CD2 . TYR A 1 238 ? -1.163  131.863 13.128  1.00 15.09  ? 238  TYR A CD2 1 
ATOM   1750 C CE1 . TYR A 1 238 ? -2.820  132.568 11.023  1.00 18.64  ? 238  TYR A CE1 1 
ATOM   1751 C CE2 . TYR A 1 238 ? -1.213  133.189 12.699  1.00 15.23  ? 238  TYR A CE2 1 
ATOM   1752 C CZ  . TYR A 1 238 ? -2.042  133.535 11.651  1.00 17.17  ? 238  TYR A CZ  1 
ATOM   1753 O OH  . TYR A 1 238 ? -2.113  134.851 11.257  1.00 23.74  ? 238  TYR A OH  1 
ATOM   1754 N N   . MET A 1 239 ? -2.694  130.068 15.787  1.00 17.31  ? 239  MET A N   1 
ATOM   1755 C CA  . MET A 1 239 ? -2.997  130.964 16.903  1.00 16.41  ? 239  MET A CA  1 
ATOM   1756 C C   . MET A 1 239 ? -2.302  132.298 16.679  1.00 15.88  ? 239  MET A C   1 
ATOM   1757 O O   . MET A 1 239 ? -1.075  132.395 16.742  1.00 14.51  ? 239  MET A O   1 
ATOM   1758 C CB  . MET A 1 239 ? -2.545  130.334 18.217  1.00 18.36  ? 239  MET A CB  1 
ATOM   1759 C CG  . MET A 1 239 ? -3.423  129.167 18.656  1.00 15.72  ? 239  MET A CG  1 
ATOM   1760 S SD  . MET A 1 239 ? -5.008  129.732 19.289  1.00 31.27  ? 239  MET A SD  1 
ATOM   1761 C CE  . MET A 1 239 ? -5.824  128.209 19.577  1.00 32.32  ? 239  MET A CE  1 
ATOM   1762 N N   . GLU A 1 240 ? -3.110  133.322 16.423  1.00 16.98  ? 240  GLU A N   1 
ATOM   1763 C CA  . GLU A 1 240 ? -2.629  134.664 16.118  1.00 18.48  ? 240  GLU A CA  1 
ATOM   1764 C C   . GLU A 1 240 ? -2.930  135.640 17.242  1.00 19.57  ? 240  GLU A C   1 
ATOM   1765 O O   . GLU A 1 240 ? -3.895  135.451 17.982  1.00 23.24  ? 240  GLU A O   1 
ATOM   1766 C CB  . GLU A 1 240 ? -3.290  135.138 14.815  1.00 19.66  ? 240  GLU A CB  1 
ATOM   1767 C CG  . GLU A 1 240 ? -3.010  136.573 14.434  1.00 17.54  ? 240  GLU A CG  1 
ATOM   1768 C CD  . GLU A 1 240 ? -1.560  136.800 14.107  1.00 19.11  ? 240  GLU A CD  1 
ATOM   1769 O OE1 . GLU A 1 240 ? -1.132  136.432 12.990  1.00 18.81  ? 240  GLU A OE1 1 
ATOM   1770 O OE2 . GLU A 1 240 ? -0.848  137.345 14.976  1.00 24.00  ? 240  GLU A OE2 1 
ATOM   1771 N N   . GLU A 1 241 ? -2.110  136.685 17.351  1.00 19.25  ? 241  GLU A N   1 
ATOM   1772 C CA  . GLU A 1 241 ? -2.253  137.707 18.386  1.00 21.39  ? 241  GLU A CA  1 
ATOM   1773 C C   . GLU A 1 241 ? -3.447  138.609 18.146  1.00 23.93  ? 241  GLU A C   1 
ATOM   1774 O O   . GLU A 1 241 ? -3.563  139.218 17.080  1.00 26.91  ? 241  GLU A O   1 
ATOM   1775 C CB  . GLU A 1 241 ? -1.000  138.581 18.450  1.00 24.50  ? 241  GLU A CB  1 
ATOM   1776 C CG  . GLU A 1 241 ? 0.267   137.854 18.855  1.00 36.37  ? 241  GLU A CG  1 
ATOM   1777 C CD  . GLU A 1 241 ? 0.128   137.132 20.181  1.00 46.25  ? 241  GLU A CD  1 
ATOM   1778 O OE1 . GLU A 1 241 ? 0.078   137.818 21.225  1.00 55.88  ? 241  GLU A OE1 1 
ATOM   1779 O OE2 . GLU A 1 241 ? 0.071   135.882 20.183  1.00 48.97  ? 241  GLU A OE2 1 
ATOM   1780 N N   . LEU A 1 242 ? -4.322  138.714 19.145  1.00 25.37  ? 242  LEU A N   1 
ATOM   1781 C CA  . LEU A 1 242 ? -5.505  139.557 19.024  1.00 23.17  ? 242  LEU A CA  1 
ATOM   1782 C C   . LEU A 1 242 ? -5.114  140.948 18.547  1.00 27.91  ? 242  LEU A C   1 
ATOM   1783 O O   . LEU A 1 242 ? -5.803  141.538 17.740  1.00 33.93  ? 242  LEU A O   1 
ATOM   1784 C CB  . LEU A 1 242 ? -6.242  139.653 20.359  1.00 22.74  ? 242  LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 242 ? -7.780  139.664 20.343  1.00 27.87  ? 242  LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 242 ? -8.311  139.641 18.927  1.00 31.27  ? 242  LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 242 ? -8.295  138.457 21.097  1.00 29.32  ? 242  LEU A CD2 1 
ATOM   1788 N N   . ARG A 1 243 ? -3.993  141.465 19.034  1.00 34.23  ? 243  ARG A N   1 
ATOM   1789 C CA  . ARG A 1 243 ? -3.530  142.789 18.623  1.00 36.99  ? 243  ARG A CA  1 
ATOM   1790 C C   . ARG A 1 243 ? -3.078  142.798 17.159  1.00 39.99  ? 243  ARG A C   1 
ATOM   1791 O O   . ARG A 1 243 ? -2.364  143.706 16.725  1.00 45.40  ? 243  ARG A O   1 
ATOM   1792 C CB  . ARG A 1 243 ? -2.368  143.241 19.512  1.00 39.81  ? 243  ARG A CB  1 
ATOM   1793 C CG  . ARG A 1 243 ? -1.316  142.170 19.736  1.00 51.11  ? 243  ARG A CG  1 
ATOM   1794 C CD  . ARG A 1 243 ? 0.070   142.765 19.923  1.00 60.46  ? 243  ARG A CD  1 
ATOM   1795 N NE  . ARG A 1 243 ? 1.091   141.726 20.040  1.00 71.34  ? 243  ARG A NE  1 
ATOM   1796 C CZ  . ARG A 1 243 ? 2.280   141.773 19.447  1.00 77.86  ? 243  ARG A CZ  1 
ATOM   1797 N NH1 . ARG A 1 243 ? 2.608   142.814 18.689  1.00 78.35  ? 243  ARG A NH1 1 
ATOM   1798 N NH2 . ARG A 1 243 ? 3.140   140.774 19.601  1.00 79.55  ? 243  ARG A NH2 1 
ATOM   1799 N N   . HIS A 1 244 ? -3.487  141.785 16.401  1.00 37.91  ? 244  HIS A N   1 
ATOM   1800 C CA  . HIS A 1 244 ? -3.120  141.690 14.991  1.00 31.04  ? 244  HIS A CA  1 
ATOM   1801 C C   . HIS A 1 244 ? -4.349  141.413 14.158  1.00 24.77  ? 244  HIS A C   1 
ATOM   1802 O O   . HIS A 1 244 ? -4.309  141.509 12.935  1.00 26.46  ? 244  HIS A O   1 
ATOM   1803 C CB  . HIS A 1 244 ? -2.115  140.569 14.781  1.00 33.44  ? 244  HIS A CB  1 
ATOM   1804 C CG  . HIS A 1 244 ? -0.728  140.925 15.196  1.00 39.57  ? 244  HIS A CG  1 
ATOM   1805 N ND1 . HIS A 1 244 ? -0.027  141.964 14.622  1.00 44.64  ? 244  HIS A ND1 1 
ATOM   1806 C CD2 . HIS A 1 244 ? 0.092   140.385 16.126  1.00 41.13  ? 244  HIS A CD2 1 
ATOM   1807 C CE1 . HIS A 1 244 ? 1.168   142.045 15.184  1.00 47.65  ? 244  HIS A CE1 1 
ATOM   1808 N NE2 . HIS A 1 244 ? 1.263   141.099 16.098  1.00 47.72  ? 244  HIS A NE2 1 
ATOM   1809 N N   . ILE A 1 245 ? -5.435  141.075 14.848  1.00 18.36  ? 245  ILE A N   1 
ATOM   1810 C CA  . ILE A 1 245 ? -6.716  140.762 14.237  1.00 15.55  ? 245  ILE A CA  1 
ATOM   1811 C C   . ILE A 1 245 ? -7.621  142.002 14.183  1.00 20.41  ? 245  ILE A C   1 
ATOM   1812 O O   . ILE A 1 245 ? -8.663  142.049 14.837  1.00 25.83  ? 245  ILE A O   1 
ATOM   1813 C CB  . ILE A 1 245 ? -7.427  139.639 15.039  1.00 13.49  ? 245  ILE A CB  1 
ATOM   1814 C CG1 . ILE A 1 245 ? -6.447  138.484 15.288  1.00 13.57  ? 245  ILE A CG1 1 
ATOM   1815 C CG2 . ILE A 1 245 ? -8.675  139.154 14.299  1.00 8.97   ? 245  ILE A CG2 1 
ATOM   1816 C CD1 . ILE A 1 245 ? -7.077  137.263 15.940  1.00 9.80   ? 245  ILE A CD1 1 
ATOM   1817 N N   . ASP A 1 246 ? -7.222  142.990 13.383  1.00 15.69  ? 246  ASP A N   1 
ATOM   1818 C CA  . ASP A 1 246 ? -7.967  144.236 13.231  1.00 13.22  ? 246  ASP A CA  1 
ATOM   1819 C C   . ASP A 1 246 ? -9.481  144.119 13.207  1.00 18.65  ? 246  ASP A C   1 
ATOM   1820 O O   . ASP A 1 246 ? -10.181 145.026 13.652  1.00 28.72  ? 246  ASP A O   1 
ATOM   1821 C CB  . ASP A 1 246 ? -7.537  144.946 11.956  1.00 13.23  ? 246  ASP A CB  1 
ATOM   1822 C CG  . ASP A 1 246 ? -6.084  145.324 11.971  1.00 27.64  ? 246  ASP A CG  1 
ATOM   1823 O OD1 . ASP A 1 246 ? -5.440  145.149 13.022  1.00 38.99  ? 246  ASP A OD1 1 
ATOM   1824 O OD2 . ASP A 1 246 ? -5.582  145.801 10.932  1.00 35.82  ? 246  ASP A OD2 1 
ATOM   1825 N N   . LEU A 1 247 ? -10.002 143.011 12.702  1.00 23.89  ? 247  LEU A N   1 
ATOM   1826 C CA  . LEU A 1 247 ? -11.449 142.881 12.601  1.00 26.71  ? 247  LEU A CA  1 
ATOM   1827 C C   . LEU A 1 247 ? -12.156 142.252 13.793  1.00 27.77  ? 247  LEU A C   1 
ATOM   1828 O O   . LEU A 1 247 ? -13.289 141.788 13.682  1.00 31.51  ? 247  LEU A O   1 
ATOM   1829 C CB  . LEU A 1 247 ? -11.807 142.141 11.306  1.00 30.85  ? 247  LEU A CB  1 
ATOM   1830 C CG  . LEU A 1 247 ? -11.246 142.795 10.034  1.00 26.30  ? 247  LEU A CG  1 
ATOM   1831 C CD1 . LEU A 1 247 ? -11.746 142.049 8.834   1.00 34.60  ? 247  LEU A CD1 1 
ATOM   1832 C CD2 . LEU A 1 247 ? -11.669 144.246 9.951   1.00 26.60  ? 247  LEU A CD2 1 
ATOM   1833 N N   . VAL A 1 248 ? -11.490 142.234 14.937  1.00 24.29  ? 248  VAL A N   1 
ATOM   1834 C CA  . VAL A 1 248 ? -12.096 141.695 16.149  1.00 23.81  ? 248  VAL A CA  1 
ATOM   1835 C C   . VAL A 1 248 ? -11.689 142.638 17.264  1.00 27.44  ? 248  VAL A C   1 
ATOM   1836 O O   . VAL A 1 248 ? -10.510 142.746 17.565  1.00 23.19  ? 248  VAL A O   1 
ATOM   1837 C CB  . VAL A 1 248 ? -11.584 140.271 16.458  1.00 20.42  ? 248  VAL A CB  1 
ATOM   1838 C CG1 . VAL A 1 248 ? -11.802 139.930 17.926  1.00 11.76  ? 248  VAL A CG1 1 
ATOM   1839 C CG2 . VAL A 1 248 ? -12.301 139.275 15.576  1.00 20.05  ? 248  VAL A CG2 1 
ATOM   1840 N N   . GLU A 1 249 ? -12.651 143.331 17.868  1.00 36.16  ? 249  GLU A N   1 
ATOM   1841 C CA  . GLU A 1 249 ? -12.316 144.275 18.935  1.00 43.16  ? 249  GLU A CA  1 
ATOM   1842 C C   . GLU A 1 249 ? -11.670 143.566 20.119  1.00 44.32  ? 249  GLU A C   1 
ATOM   1843 O O   . GLU A 1 249 ? -12.204 142.581 20.637  1.00 42.48  ? 249  GLU A O   1 
ATOM   1844 C CB  . GLU A 1 249 ? -13.560 145.050 19.395  1.00 50.92  ? 249  GLU A CB  1 
ATOM   1845 C CG  . GLU A 1 249 ? -13.563 146.516 18.952  1.00 64.89  ? 249  GLU A CG  1 
ATOM   1846 C CD  . GLU A 1 249 ? -14.242 147.450 19.948  1.00 74.09  ? 249  GLU A CD  1 
ATOM   1847 O OE1 . GLU A 1 249 ? -15.258 147.048 20.556  1.00 76.31  ? 249  GLU A OE1 1 
ATOM   1848 O OE2 . GLU A 1 249 ? -13.758 148.592 20.119  1.00 76.94  ? 249  GLU A OE2 1 
ATOM   1849 N N   . GLY A 1 250 ? -10.508 144.069 20.532  1.00 42.77  ? 250  GLY A N   1 
ATOM   1850 C CA  . GLY A 1 250 ? -9.794  143.479 21.650  1.00 41.99  ? 250  GLY A CA  1 
ATOM   1851 C C   . GLY A 1 250 ? -8.302  143.672 21.497  1.00 42.04  ? 250  GLY A C   1 
ATOM   1852 O O   . GLY A 1 250 ? -7.855  144.385 20.605  1.00 44.72  ? 250  GLY A O   1 
ATOM   1853 N N   . ASP A 1 251 ? -7.524  143.045 22.368  1.00 44.62  ? 251  ASP A N   1 
ATOM   1854 C CA  . ASP A 1 251 ? -6.073  143.163 22.300  1.00 41.71  ? 251  ASP A CA  1 
ATOM   1855 C C   . ASP A 1 251 ? -5.409  142.217 23.284  1.00 38.85  ? 251  ASP A C   1 
ATOM   1856 O O   . ASP A 1 251 ? -4.185  142.141 23.351  1.00 38.65  ? 251  ASP A O   1 
ATOM   1857 C CB  . ASP A 1 251 ? -5.635  144.603 22.595  1.00 47.08  ? 251  ASP A CB  1 
ATOM   1858 C CG  . ASP A 1 251 ? -6.107  145.100 23.958  1.00 51.27  ? 251  ASP A CG  1 
ATOM   1859 O OD1 . ASP A 1 251 ? -6.923  144.410 24.603  1.00 55.75  ? 251  ASP A OD1 1 
ATOM   1860 O OD2 . ASP A 1 251 ? -5.660  146.189 24.383  1.00 51.76  ? 251  ASP A OD2 1 
ATOM   1861 N N   . GLU A 1 252 ? -6.219  141.485 24.038  1.00 37.94  ? 252  GLU A N   1 
ATOM   1862 C CA  . GLU A 1 252 ? -5.685  140.562 25.024  1.00 38.74  ? 252  GLU A CA  1 
ATOM   1863 C C   . GLU A 1 252 ? -5.775  139.110 24.599  1.00 36.38  ? 252  GLU A C   1 
ATOM   1864 O O   . GLU A 1 252 ? -6.830  138.631 24.192  1.00 37.68  ? 252  GLU A O   1 
ATOM   1865 C CB  . GLU A 1 252 ? -6.414  140.734 26.356  1.00 38.42  ? 252  GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 252 ? -7.918  140.589 26.252  1.00 46.73  ? 252  GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 252 ? -8.652  141.399 27.302  1.00 51.10  ? 252  GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 252 ? -7.982  142.072 28.113  1.00 50.17  ? 252  GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 252 ? -9.900  141.364 27.316  1.00 56.05  ? 252  GLU A OE2 1 
ATOM   1870 N N   . GLY A 1 253 ? -4.650  138.413 24.694  1.00 36.36  ? 253  GLY A N   1 
ATOM   1871 C CA  . GLY A 1 253 ? -4.624  137.005 24.360  1.00 36.82  ? 253  GLY A CA  1 
ATOM   1872 C C   . GLY A 1 253 ? -4.515  136.651 22.894  1.00 37.67  ? 253  GLY A C   1 
ATOM   1873 O O   . GLY A 1 253 ? -4.022  137.422 22.070  1.00 38.54  ? 253  GLY A O   1 
ATOM   1874 N N   . ARG A 1 254 ? -4.994  135.458 22.572  1.00 34.38  ? 254  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 254 ? -4.941  134.973 21.215  1.00 27.70  ? 254  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 254 ? -6.276  134.436 20.745  1.00 27.08  ? 254  ARG A C   1 
ATOM   1877 O O   . ARG A 1 254 ? -7.182  134.160 21.537  1.00 20.85  ? 254  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 254 ? -3.886  133.872 21.107  1.00 29.46  ? 254  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 254 ? -2.516  134.280 21.609  1.00 27.37  ? 254  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 254 ? -1.642  133.060 21.833  1.00 30.44  ? 254  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 254 ? -0.535  133.030 20.884  1.00 42.81  ? 254  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 254 ? 0.144   131.937 20.552  1.00 47.15  ? 254  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 254 ? -0.169  130.765 21.095  1.00 47.69  ? 254  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 254 ? 1.133   132.017 19.667  1.00 49.42  ? 254  ARG A NH2 1 
ATOM   1885 N N   . MET A 1 255 ? -6.379  134.295 19.431  1.00 26.99  ? 255  MET A N   1 
ATOM   1886 C CA  . MET A 1 255 ? -7.569  133.768 18.793  1.00 25.55  ? 255  MET A CA  1 
ATOM   1887 C C   . MET A 1 255 ? -7.066  132.941 17.625  1.00 25.47  ? 255  MET A C   1 
ATOM   1888 O O   . MET A 1 255 ? -6.118  133.334 16.943  1.00 27.21  ? 255  MET A O   1 
ATOM   1889 C CB  . MET A 1 255 ? -8.457  134.902 18.283  1.00 24.04  ? 255  MET A CB  1 
ATOM   1890 C CG  . MET A 1 255 ? -9.640  134.432 17.477  1.00 24.12  ? 255  MET A CG  1 
ATOM   1891 S SD  . MET A 1 255 ? -11.169 135.246 17.927  1.00 23.97  ? 255  MET A SD  1 
ATOM   1892 C CE  . MET A 1 255 ? -11.036 136.681 16.963  1.00 32.79  ? 255  MET A CE  1 
ATOM   1893 N N   . CYS A 1 256 ? -7.688  131.787 17.423  1.00 24.10  ? 256  CYS A N   1 
ATOM   1894 C CA  . CYS A 1 256 ? -7.335  130.889 16.336  1.00 19.06  ? 256  CYS A CA  1 
ATOM   1895 C C   . CYS A 1 256 ? -7.869  131.472 15.037  1.00 22.98  ? 256  CYS A C   1 
ATOM   1896 O O   . CYS A 1 256 ? -9.048  131.820 14.948  1.00 22.55  ? 256  CYS A O   1 
ATOM   1897 C CB  . CYS A 1 256 ? -7.969  129.526 16.578  1.00 19.17  ? 256  CYS A CB  1 
ATOM   1898 S SG  . CYS A 1 256 ? -7.544  128.284 15.369  1.00 22.27  ? 256  CYS A SG  1 
ATOM   1899 N N   . ILE A 1 257 ? -7.006  131.592 14.032  1.00 21.97  ? 257  ILE A N   1 
ATOM   1900 C CA  . ILE A 1 257 ? -7.429  132.129 12.741  1.00 20.16  ? 257  ILE A CA  1 
ATOM   1901 C C   . ILE A 1 257 ? -7.547  131.017 11.703  1.00 19.51  ? 257  ILE A C   1 
ATOM   1902 O O   . ILE A 1 257 ? -6.669  130.157 11.595  1.00 26.30  ? 257  ILE A O   1 
ATOM   1903 C CB  . ILE A 1 257 ? -6.434  133.176 12.211  1.00 17.78  ? 257  ILE A CB  1 
ATOM   1904 C CG1 . ILE A 1 257 ? -6.577  134.483 12.996  1.00 16.51  ? 257  ILE A CG1 1 
ATOM   1905 C CG2 . ILE A 1 257 ? -6.667  133.399 10.726  1.00 17.68  ? 257  ILE A CG2 1 
ATOM   1906 C CD1 . ILE A 1 257 ? -7.999  134.998 13.097  1.00 13.62  ? 257  ILE A CD1 1 
ATOM   1907 N N   . ASN A 1 258 ? -8.635  131.032 10.947  1.00 15.19  ? 258  ASN A N   1 
ATOM   1908 C CA  . ASN A 1 258 ? -8.855  130.032 9.906   1.00 10.71  ? 258  ASN A CA  1 
ATOM   1909 C C   . ASN A 1 258 ? -8.430  130.668 8.585   1.00 8.81   ? 258  ASN A C   1 
ATOM   1910 O O   . ASN A 1 258 ? -9.213  131.358 7.944   1.00 8.22   ? 258  ASN A O   1 
ATOM   1911 C CB  . ASN A 1 258 ? -10.330 129.648 9.864   1.00 5.00   ? 258  ASN A CB  1 
ATOM   1912 C CG  . ASN A 1 258 ? -10.671 128.801 8.668   1.00 15.48  ? 258  ASN A CG  1 
ATOM   1913 O OD1 . ASN A 1 258 ? -9.786  128.276 7.993   1.00 18.81  ? 258  ASN A OD1 1 
ATOM   1914 N ND2 . ASN A 1 258 ? -11.963 128.662 8.390   1.00 18.79  ? 258  ASN A ND2 1 
ATOM   1915 N N   . THR A 1 259 ? -7.186  130.438 8.180   1.00 9.40   ? 259  THR A N   1 
ATOM   1916 C CA  . THR A 1 259 ? -6.667  131.048 6.961   1.00 7.18   ? 259  THR A CA  1 
ATOM   1917 C C   . THR A 1 259 ? -7.485  130.789 5.703   1.00 5.18   ? 259  THR A C   1 
ATOM   1918 O O   . THR A 1 259 ? -7.695  131.697 4.921   1.00 6.80   ? 259  THR A O   1 
ATOM   1919 C CB  . THR A 1 259 ? -5.190  130.634 6.695   1.00 6.14   ? 259  THR A CB  1 
ATOM   1920 O OG1 . THR A 1 259 ? -5.119  129.237 6.389   1.00 11.82  ? 259  THR A OG1 1 
ATOM   1921 C CG2 . THR A 1 259 ? -4.328  130.916 7.911   1.00 5.00   ? 259  THR A CG2 1 
ATOM   1922 N N   . GLU A 1 260 ? -7.963  129.563 5.513   1.00 11.99  ? 260  GLU A N   1 
ATOM   1923 C CA  . GLU A 1 260 ? -8.726  129.227 4.302   1.00 12.52  ? 260  GLU A CA  1 
ATOM   1924 C C   . GLU A 1 260 ? -7.783  129.402 3.090   1.00 13.73  ? 260  GLU A C   1 
ATOM   1925 O O   . GLU A 1 260 ? -8.150  129.994 2.073   1.00 12.57  ? 260  GLU A O   1 
ATOM   1926 C CB  . GLU A 1 260 ? -9.945  130.156 4.164   1.00 5.00   ? 260  GLU A CB  1 
ATOM   1927 C CG  . GLU A 1 260 ? -11.190 129.706 4.944   1.00 9.07   ? 260  GLU A CG  1 
ATOM   1928 C CD  . GLU A 1 260 ? -11.620 128.278 4.623   1.00 15.86  ? 260  GLU A CD  1 
ATOM   1929 O OE1 . GLU A 1 260 ? -11.158 127.725 3.602   1.00 21.22  ? 260  GLU A OE1 1 
ATOM   1930 O OE2 . GLU A 1 260 ? -12.422 127.704 5.390   1.00 12.67  ? 260  GLU A OE2 1 
ATOM   1931 N N   . TRP A 1 261 ? -6.568  128.872 3.210   1.00 13.48  ? 261  TRP A N   1 
ATOM   1932 C CA  . TRP A 1 261 ? -5.555  129.009 2.169   1.00 11.02  ? 261  TRP A CA  1 
ATOM   1933 C C   . TRP A 1 261 ? -5.823  128.280 0.872   1.00 12.84  ? 261  TRP A C   1 
ATOM   1934 O O   . TRP A 1 261 ? -5.018  128.353 -0.050  1.00 16.00  ? 261  TRP A O   1 
ATOM   1935 C CB  . TRP A 1 261 ? -4.167  128.621 2.715   1.00 5.00   ? 261  TRP A CB  1 
ATOM   1936 C CG  . TRP A 1 261 ? -3.921  127.148 2.952   1.00 5.00   ? 261  TRP A CG  1 
ATOM   1937 C CD1 . TRP A 1 261 ? -4.670  126.103 2.503   1.00 7.31   ? 261  TRP A CD1 1 
ATOM   1938 C CD2 . TRP A 1 261 ? -2.821  126.570 3.671   1.00 5.00   ? 261  TRP A CD2 1 
ATOM   1939 N NE1 . TRP A 1 261 ? -4.108  124.912 2.895   1.00 11.93  ? 261  TRP A NE1 1 
ATOM   1940 C CE2 . TRP A 1 261 ? -2.971  125.171 3.615   1.00 5.00   ? 261  TRP A CE2 1 
ATOM   1941 C CE3 . TRP A 1 261 ? -1.725  127.098 4.360   1.00 8.49   ? 261  TRP A CE3 1 
ATOM   1942 C CZ2 . TRP A 1 261 ? -2.067  124.295 4.214   1.00 6.14   ? 261  TRP A CZ2 1 
ATOM   1943 C CZ3 . TRP A 1 261 ? -0.827  126.227 4.956   1.00 12.48  ? 261  TRP A CZ3 1 
ATOM   1944 C CH2 . TRP A 1 261 ? -1.006  124.840 4.879   1.00 7.25   ? 261  TRP A CH2 1 
ATOM   1945 N N   . GLY A 1 262 ? -6.935  127.561 0.795   1.00 7.45   ? 262  GLY A N   1 
ATOM   1946 C CA  . GLY A 1 262 ? -7.237  126.876 -0.444  1.00 11.16  ? 262  GLY A CA  1 
ATOM   1947 C C   . GLY A 1 262 ? -7.531  127.901 -1.534  1.00 16.35  ? 262  GLY A C   1 
ATOM   1948 O O   . GLY A 1 262 ? -7.329  127.645 -2.726  1.00 19.69  ? 262  GLY A O   1 
ATOM   1949 N N   . ALA A 1 263 ? -7.997  129.079 -1.124  1.00 14.10  ? 263  ALA A N   1 
ATOM   1950 C CA  . ALA A 1 263 ? -8.332  130.141 -2.062  1.00 5.36   ? 263  ALA A CA  1 
ATOM   1951 C C   . ALA A 1 263 ? -7.120  130.943 -2.463  1.00 5.44   ? 263  ALA A C   1 
ATOM   1952 O O   . ALA A 1 263 ? -7.235  131.911 -3.206  1.00 9.34   ? 263  ALA A O   1 
ATOM   1953 C CB  . ALA A 1 263 ? -9.351  131.047 -1.460  1.00 12.23  ? 263  ALA A CB  1 
ATOM   1954 N N   . PHE A 1 264 ? -5.964  130.550 -1.943  1.00 5.00   ? 264  PHE A N   1 
ATOM   1955 C CA  . PHE A 1 264 ? -4.706  131.214 -2.246  1.00 5.00   ? 264  PHE A CA  1 
ATOM   1956 C C   . PHE A 1 264 ? -4.580  131.181 -3.762  1.00 7.30   ? 264  PHE A C   1 
ATOM   1957 O O   . PHE A 1 264 ? -4.688  130.120 -4.366  1.00 13.95  ? 264  PHE A O   1 
ATOM   1958 C CB  . PHE A 1 264 ? -3.558  130.437 -1.574  1.00 9.27   ? 264  PHE A CB  1 
ATOM   1959 C CG  . PHE A 1 264 ? -2.174  130.999 -1.824  1.00 8.62   ? 264  PHE A CG  1 
ATOM   1960 C CD1 . PHE A 1 264 ? -1.980  132.341 -2.141  1.00 10.98  ? 264  PHE A CD1 1 
ATOM   1961 C CD2 . PHE A 1 264 ? -1.057  130.173 -1.720  1.00 8.26   ? 264  PHE A CD2 1 
ATOM   1962 C CE1 . PHE A 1 264 ? -0.697  132.848 -2.349  1.00 5.00   ? 264  PHE A CE1 1 
ATOM   1963 C CE2 . PHE A 1 264 ? 0.227   130.669 -1.926  1.00 5.00   ? 264  PHE A CE2 1 
ATOM   1964 C CZ  . PHE A 1 264 ? 0.407   132.006 -2.241  1.00 6.61   ? 264  PHE A CZ  1 
ATOM   1965 N N   . GLY A 1 265 ? -4.392  132.347 -4.372  1.00 11.42  ? 265  GLY A N   1 
ATOM   1966 C CA  . GLY A 1 265 ? -4.242  132.425 -5.817  1.00 9.18   ? 265  GLY A CA  1 
ATOM   1967 C C   . GLY A 1 265 ? -5.517  132.633 -6.621  1.00 8.62   ? 265  GLY A C   1 
ATOM   1968 O O   . GLY A 1 265 ? -5.463  132.797 -7.836  1.00 8.90   ? 265  GLY A O   1 
ATOM   1969 N N   . ASP A 1 266 ? -6.664  132.633 -5.954  1.00 11.24  ? 266  ASP A N   1 
ATOM   1970 C CA  . ASP A 1 266 ? -7.939  132.805 -6.638  1.00 9.02   ? 266  ASP A CA  1 
ATOM   1971 C C   . ASP A 1 266 ? -8.050  134.161 -7.307  1.00 12.61  ? 266  ASP A C   1 
ATOM   1972 O O   . ASP A 1 266 ? -9.055  134.464 -7.939  1.00 21.64  ? 266  ASP A O   1 
ATOM   1973 C CB  . ASP A 1 266 ? -9.094  132.641 -5.653  1.00 5.00   ? 266  ASP A CB  1 
ATOM   1974 C CG  . ASP A 1 266 ? -9.344  131.198 -5.296  1.00 11.96  ? 266  ASP A CG  1 
ATOM   1975 O OD1 . ASP A 1 266 ? -8.512  130.343 -5.664  1.00 18.77  ? 266  ASP A OD1 1 
ATOM   1976 O OD2 . ASP A 1 266 ? -10.370 130.914 -4.647  1.00 15.49  ? 266  ASP A OD2 1 
ATOM   1977 N N   . ASP A 1 267 ? -7.016  134.976 -7.182  1.00 11.55  ? 267  ASP A N   1 
ATOM   1978 C CA  . ASP A 1 267 ? -7.041  136.305 -7.775  1.00 14.26  ? 267  ASP A CA  1 
ATOM   1979 C C   . ASP A 1 267 ? -5.985  136.474 -8.857  1.00 15.41  ? 267  ASP A C   1 
ATOM   1980 O O   . ASP A 1 267 ? -5.786  137.577 -9.365  1.00 20.68  ? 267  ASP A O   1 
ATOM   1981 C CB  . ASP A 1 267 ? -6.816  137.358 -6.692  1.00 18.07  ? 267  ASP A CB  1 
ATOM   1982 C CG  . ASP A 1 267 ? -5.524  137.132 -5.926  1.00 25.89  ? 267  ASP A CG  1 
ATOM   1983 O OD1 . ASP A 1 267 ? -4.879  136.083 -6.154  1.00 31.38  ? 267  ASP A OD1 1 
ATOM   1984 O OD2 . ASP A 1 267 ? -5.156  137.999 -5.101  1.00 29.51  ? 267  ASP A OD2 1 
ATOM   1985 N N   . GLY A 1 268 ? -5.302  135.387 -9.199  1.00 9.96   ? 268  GLY A N   1 
ATOM   1986 C CA  . GLY A 1 268 ? -4.272  135.449 -10.216 1.00 8.42   ? 268  GLY A CA  1 
ATOM   1987 C C   . GLY A 1 268 ? -2.841  135.321 -9.709  1.00 17.53  ? 268  GLY A C   1 
ATOM   1988 O O   . GLY A 1 268 ? -1.937  135.021 -10.485 1.00 23.87  ? 268  GLY A O   1 
ATOM   1989 N N   . SER A 1 269 ? -2.631  135.528 -8.411  1.00 17.64  ? 269  SER A N   1 
ATOM   1990 C CA  . SER A 1 269 ? -1.296  135.465 -7.820  1.00 16.06  ? 269  SER A CA  1 
ATOM   1991 C C   . SER A 1 269 ? -0.451  134.248 -8.149  1.00 16.53  ? 269  SER A C   1 
ATOM   1992 O O   . SER A 1 269 ? 0.767   134.293 -8.014  1.00 19.47  ? 269  SER A O   1 
ATOM   1993 C CB  . SER A 1 269 ? -1.388  135.566 -6.297  1.00 20.55  ? 269  SER A CB  1 
ATOM   1994 O OG  . SER A 1 269 ? -2.455  136.407 -5.912  1.00 40.23  ? 269  SER A OG  1 
ATOM   1995 N N   . LEU A 1 270 ? -1.070  133.155 -8.575  1.00 18.71  ? 270  LEU A N   1 
ATOM   1996 C CA  . LEU A 1 270 ? -0.283  131.956 -8.843  1.00 18.81  ? 270  LEU A CA  1 
ATOM   1997 C C   . LEU A 1 270 ? -0.236  131.481 -10.290 1.00 19.14  ? 270  LEU A C   1 
ATOM   1998 O O   . LEU A 1 270 ? 0.355   130.439 -10.577 1.00 26.49  ? 270  LEU A O   1 
ATOM   1999 C CB  . LEU A 1 270 ? -0.780  130.812 -7.956  1.00 19.81  ? 270  LEU A CB  1 
ATOM   2000 C CG  . LEU A 1 270 ? -0.499  130.941 -6.462  1.00 17.24  ? 270  LEU A CG  1 
ATOM   2001 C CD1 . LEU A 1 270 ? -1.281  129.883 -5.700  1.00 16.51  ? 270  LEU A CD1 1 
ATOM   2002 C CD2 . LEU A 1 270 ? 0.984   130.785 -6.223  1.00 17.41  ? 270  LEU A CD2 1 
ATOM   2003 N N   . GLU A 1 271 ? -0.840  132.236 -11.200 1.00 15.92  ? 271  GLU A N   1 
ATOM   2004 C CA  . GLU A 1 271 ? -0.864  131.860 -12.611 1.00 11.47  ? 271  GLU A CA  1 
ATOM   2005 C C   . GLU A 1 271 ? 0.496   131.488 -13.164 1.00 12.42  ? 271  GLU A C   1 
ATOM   2006 O O   . GLU A 1 271 ? 0.589   130.745 -14.139 1.00 17.74  ? 271  GLU A O   1 
ATOM   2007 C CB  . GLU A 1 271 ? -1.451  132.991 -13.443 1.00 5.49   ? 271  GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 271 ? -2.932  133.080 -13.293 1.00 6.71   ? 271  GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 271 ? -3.570  131.728 -13.456 1.00 18.12  ? 271  GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 271 ? -3.163  131.007 -14.389 1.00 21.31  ? 271  GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 271 ? -4.465  131.382 -12.658 1.00 21.84  ? 271  GLU A OE2 1 
ATOM   2012 N N   . ASP A 1 272 ? 1.554   131.990 -12.536 1.00 10.30  ? 272  ASP A N   1 
ATOM   2013 C CA  . ASP A 1 272 ? 2.900   131.702 -13.005 1.00 11.68  ? 272  ASP A CA  1 
ATOM   2014 C C   . ASP A 1 272 ? 3.386   130.305 -12.657 1.00 13.68  ? 272  ASP A C   1 
ATOM   2015 O O   . ASP A 1 272 ? 4.375   129.836 -13.226 1.00 18.24  ? 272  ASP A O   1 
ATOM   2016 C CB  . ASP A 1 272 ? 3.897   132.765 -12.497 1.00 11.80  ? 272  ASP A CB  1 
ATOM   2017 C CG  . ASP A 1 272 ? 4.111   132.722 -10.994 1.00 17.32  ? 272  ASP A CG  1 
ATOM   2018 O OD1 . ASP A 1 272 ? 3.137   132.546 -10.238 1.00 27.53  ? 272  ASP A OD1 1 
ATOM   2019 O OD2 . ASP A 1 272 ? 5.272   132.875 -10.564 1.00 30.12  ? 272  ASP A OD2 1 
ATOM   2020 N N   . ILE A 1 273 ? 2.699   129.629 -11.737 1.00 12.98  ? 273  ILE A N   1 
ATOM   2021 C CA  . ILE A 1 273 ? 3.110   128.281 -11.360 1.00 13.60  ? 273  ILE A CA  1 
ATOM   2022 C C   . ILE A 1 273 ? 2.060   127.220 -11.681 1.00 17.52  ? 273  ILE A C   1 
ATOM   2023 O O   . ILE A 1 273 ? 2.303   126.029 -11.483 1.00 21.13  ? 273  ILE A O   1 
ATOM   2024 C CB  . ILE A 1 273 ? 3.485   128.191 -9.864  1.00 12.52  ? 273  ILE A CB  1 
ATOM   2025 C CG1 . ILE A 1 273 ? 2.231   128.217 -9.002  1.00 14.36  ? 273  ILE A CG1 1 
ATOM   2026 C CG2 . ILE A 1 273 ? 4.376   129.356 -9.476  1.00 14.86  ? 273  ILE A CG2 1 
ATOM   2027 C CD1 . ILE A 1 273 ? 2.408   127.505 -7.680  1.00 18.69  ? 273  ILE A CD1 1 
ATOM   2028 N N   . ARG A 1 274 ? 0.898   127.647 -12.174 1.00 14.48  ? 274  ARG A N   1 
ATOM   2029 C CA  . ARG A 1 274 ? -0.167  126.712 -12.541 1.00 13.88  ? 274  ARG A CA  1 
ATOM   2030 C C   . ARG A 1 274 ? 0.026   126.302 -14.000 1.00 15.39  ? 274  ARG A C   1 
ATOM   2031 O O   . ARG A 1 274 ? 0.407   127.117 -14.835 1.00 18.79  ? 274  ARG A O   1 
ATOM   2032 C CB  . ARG A 1 274 ? -1.537  127.357 -12.366 1.00 11.95  ? 274  ARG A CB  1 
ATOM   2033 C CG  . ARG A 1 274 ? -1.769  127.953 -10.999 1.00 5.00   ? 274  ARG A CG  1 
ATOM   2034 C CD  . ARG A 1 274 ? -3.227  127.846 -10.625 1.00 5.00   ? 274  ARG A CD  1 
ATOM   2035 N NE  . ARG A 1 274 ? -4.102  128.317 -11.693 1.00 9.14   ? 274  ARG A NE  1 
ATOM   2036 C CZ  . ARG A 1 274 ? -5.215  127.698 -12.067 1.00 12.31  ? 274  ARG A CZ  1 
ATOM   2037 N NH1 . ARG A 1 274 ? -5.590  126.582 -11.460 1.00 9.33   ? 274  ARG A NH1 1 
ATOM   2038 N NH2 . ARG A 1 274 ? -5.958  128.194 -13.044 1.00 13.53  ? 274  ARG A NH2 1 
ATOM   2039 N N   . THR A 1 275 ? -0.239  125.040 -14.302 1.00 12.93  ? 275  THR A N   1 
ATOM   2040 C CA  . THR A 1 275 ? -0.042  124.531 -15.648 1.00 9.73   ? 275  THR A CA  1 
ATOM   2041 C C   . THR A 1 275 ? -1.350  124.387 -16.382 1.00 14.84  ? 275  THR A C   1 
ATOM   2042 O O   . THR A 1 275 ? -2.413  124.636 -15.821 1.00 16.59  ? 275  THR A O   1 
ATOM   2043 C CB  . THR A 1 275 ? 0.619   123.146 -15.625 1.00 9.27   ? 275  THR A CB  1 
ATOM   2044 O OG1 . THR A 1 275 ? -0.310  122.190 -15.094 1.00 12.27  ? 275  THR A OG1 1 
ATOM   2045 C CG2 . THR A 1 275 ? 1.867   123.162 -14.772 1.00 5.85   ? 275  THR A CG2 1 
ATOM   2046 N N   . GLU A 1 276 ? -1.252  123.970 -17.642 1.00 13.01  ? 276  GLU A N   1 
ATOM   2047 C CA  . GLU A 1 276 ? -2.414  123.759 -18.491 1.00 15.11  ? 276  GLU A CA  1 
ATOM   2048 C C   . GLU A 1 276 ? -3.295  122.654 -17.918 1.00 13.94  ? 276  GLU A C   1 
ATOM   2049 O O   . GLU A 1 276 ? -4.503  122.613 -18.177 1.00 17.58  ? 276  GLU A O   1 
ATOM   2050 C CB  . GLU A 1 276 ? -1.965  123.377 -19.896 1.00 23.90  ? 276  GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 276 ? -1.142  122.103 -19.940 1.00 39.42  ? 276  GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 276 ? -1.036  121.515 -21.334 1.00 44.57  ? 276  GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 276 ? -2.066  121.028 -21.861 1.00 43.67  ? 276  GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 276 ? 0.082   121.541 -21.895 1.00 46.53  ? 276  GLU A OE2 1 
ATOM   2055 N N   . PHE A 1 277 ? -2.683  121.759 -17.144 1.00 13.94  ? 277  PHE A N   1 
ATOM   2056 C CA  . PHE A 1 277 ? -3.399  120.651 -16.515 1.00 5.88   ? 277  PHE A CA  1 
ATOM   2057 C C   . PHE A 1 277 ? -4.158  121.173 -15.319 1.00 8.08   ? 277  PHE A C   1 
ATOM   2058 O O   . PHE A 1 277 ? -5.248  120.705 -15.004 1.00 12.11  ? 277  PHE A O   1 
ATOM   2059 C CB  . PHE A 1 277 ? -2.419  119.579 -16.064 1.00 5.00   ? 277  PHE A CB  1 
ATOM   2060 C CG  . PHE A 1 277 ? -1.597  119.016 -17.175 1.00 5.00   ? 277  PHE A CG  1 
ATOM   2061 C CD1 . PHE A 1 277 ? -2.190  118.257 -18.172 1.00 6.06   ? 277  PHE A CD1 1 
ATOM   2062 C CD2 . PHE A 1 277 ? -0.231  119.249 -17.233 1.00 9.81   ? 277  PHE A CD2 1 
ATOM   2063 C CE1 . PHE A 1 277 ? -1.433  117.740 -19.210 1.00 9.36   ? 277  PHE A CE1 1 
ATOM   2064 C CE2 . PHE A 1 277 ? 0.538   118.733 -18.272 1.00 5.00   ? 277  PHE A CE2 1 
ATOM   2065 C CZ  . PHE A 1 277 ? -0.068  117.978 -19.259 1.00 7.87   ? 277  PHE A CZ  1 
ATOM   2066 N N   . ASP A 1 278 ? -3.569  122.151 -14.644 1.00 8.67   ? 278  ASP A N   1 
ATOM   2067 C CA  . ASP A 1 278 ? -4.213  122.743 -13.488 1.00 10.64  ? 278  ASP A CA  1 
ATOM   2068 C C   . ASP A 1 278 ? -5.467  123.481 -13.946 1.00 8.36   ? 278  ASP A C   1 
ATOM   2069 O O   . ASP A 1 278 ? -6.526  123.371 -13.330 1.00 15.59  ? 278  ASP A O   1 
ATOM   2070 C CB  . ASP A 1 278 ? -3.255  123.707 -12.788 1.00 7.55   ? 278  ASP A CB  1 
ATOM   2071 C CG  . ASP A 1 278 ? -2.065  122.999 -12.176 1.00 10.80  ? 278  ASP A CG  1 
ATOM   2072 O OD1 . ASP A 1 278 ? -2.274  122.163 -11.269 1.00 8.31   ? 278  ASP A OD1 1 
ATOM   2073 O OD2 . ASP A 1 278 ? -0.922  123.279 -12.599 1.00 5.00   ? 278  ASP A OD2 1 
ATOM   2074 N N   . ARG A 1 279 ? -5.343  124.224 -15.040 1.00 5.09   ? 279  ARG A N   1 
ATOM   2075 C CA  . ARG A 1 279 ? -6.464  124.981 -15.578 1.00 7.95   ? 279  ARG A CA  1 
ATOM   2076 C C   . ARG A 1 279 ? -7.581  124.093 -16.121 1.00 6.56   ? 279  ARG A C   1 
ATOM   2077 O O   . ARG A 1 279 ? -8.754  124.445 -16.009 1.00 6.66   ? 279  ARG A O   1 
ATOM   2078 C CB  . ARG A 1 279 ? -5.977  125.936 -16.667 1.00 7.66   ? 279  ARG A CB  1 
ATOM   2079 C CG  . ARG A 1 279 ? -4.665  126.618 -16.320 1.00 12.75  ? 279  ARG A CG  1 
ATOM   2080 C CD  . ARG A 1 279 ? -4.420  127.886 -17.127 1.00 7.93   ? 279  ARG A CD  1 
ATOM   2081 N NE  . ARG A 1 279 ? -3.541  128.792 -16.389 1.00 17.28  ? 279  ARG A NE  1 
ATOM   2082 C CZ  . ARG A 1 279 ? -2.211  128.738 -16.412 1.00 12.67  ? 279  ARG A CZ  1 
ATOM   2083 N NH1 . ARG A 1 279 ? -1.596  127.819 -17.143 1.00 19.23  ? 279  ARG A NH1 1 
ATOM   2084 N NH2 . ARG A 1 279 ? -1.495  129.589 -15.688 1.00 16.26  ? 279  ARG A NH2 1 
ATOM   2085 N N   . GLU A 1 280 ? -7.235  122.947 -16.705 1.00 5.77   ? 280  GLU A N   1 
ATOM   2086 C CA  . GLU A 1 280 ? -8.271  122.057 -17.217 1.00 10.90  ? 280  GLU A CA  1 
ATOM   2087 C C   . GLU A 1 280 ? -9.018  121.433 -16.045 1.00 11.32  ? 280  GLU A C   1 
ATOM   2088 O O   . GLU A 1 280 ? -10.234 121.253 -16.096 1.00 18.19  ? 280  GLU A O   1 
ATOM   2089 C CB  . GLU A 1 280 ? -7.676  120.950 -18.101 1.00 17.56  ? 280  GLU A CB  1 
ATOM   2090 C CG  . GLU A 1 280 ? -8.748  120.013 -18.698 1.00 26.54  ? 280  GLU A CG  1 
ATOM   2091 C CD  . GLU A 1 280 ? -8.277  119.212 -19.912 1.00 28.94  ? 280  GLU A CD  1 
ATOM   2092 O OE1 . GLU A 1 280 ? -7.053  119.147 -20.161 1.00 38.85  ? 280  GLU A OE1 1 
ATOM   2093 O OE2 . GLU A 1 280 ? -9.142  118.645 -20.617 1.00 27.21  ? 280  GLU A OE2 1 
ATOM   2094 N N   . ILE A 1 281 ? -8.286  121.102 -14.986 1.00 13.17  ? 281  ILE A N   1 
ATOM   2095 C CA  . ILE A 1 281 ? -8.895  120.512 -13.805 1.00 10.03  ? 281  ILE A CA  1 
ATOM   2096 C C   . ILE A 1 281 ? -9.925  121.482 -13.264 1.00 6.23   ? 281  ILE A C   1 
ATOM   2097 O O   . ILE A 1 281 ? -10.967 121.072 -12.777 1.00 19.66  ? 281  ILE A O   1 
ATOM   2098 C CB  . ILE A 1 281 ? -7.844  120.219 -12.700 1.00 12.66  ? 281  ILE A CB  1 
ATOM   2099 C CG1 . ILE A 1 281 ? -7.675  118.706 -12.534 1.00 12.30  ? 281  ILE A CG1 1 
ATOM   2100 C CG2 . ILE A 1 281 ? -8.271  120.848 -11.378 1.00 10.13  ? 281  ILE A CG2 1 
ATOM   2101 C CD1 . ILE A 1 281 ? -8.452  118.113 -11.371 1.00 8.17   ? 281  ILE A CD1 1 
ATOM   2102 N N   . ASP A 1 282 ? -9.624  122.773 -13.359 1.00 10.51  ? 282  ASP A N   1 
ATOM   2103 C CA  . ASP A 1 282 ? -10.514 123.824 -12.870 1.00 7.49   ? 282  ASP A CA  1 
ATOM   2104 C C   . ASP A 1 282 ? -11.778 123.958 -13.698 1.00 9.83   ? 282  ASP A C   1 
ATOM   2105 O O   . ASP A 1 282 ? -12.863 124.145 -13.153 1.00 10.96  ? 282  ASP A O   1 
ATOM   2106 C CB  . ASP A 1 282 ? -9.786  125.167 -12.865 1.00 5.69   ? 282  ASP A CB  1 
ATOM   2107 C CG  . ASP A 1 282 ? -10.611 126.273 -12.235 1.00 8.01   ? 282  ASP A CG  1 
ATOM   2108 O OD1 . ASP A 1 282 ? -11.388 125.979 -11.301 1.00 12.42  ? 282  ASP A OD1 1 
ATOM   2109 O OD2 . ASP A 1 282 ? -10.487 127.437 -12.674 1.00 9.61   ? 282  ASP A OD2 1 
ATOM   2110 N N   . ARG A 1 283 ? -11.621 123.873 -15.018 1.00 12.11  ? 283  ARG A N   1 
ATOM   2111 C CA  . ARG A 1 283 ? -12.728 123.989 -15.959 1.00 7.87   ? 283  ARG A CA  1 
ATOM   2112 C C   . ARG A 1 283 ? -13.769 122.891 -15.774 1.00 6.90   ? 283  ARG A C   1 
ATOM   2113 O O   . ARG A 1 283 ? -14.960 123.096 -16.011 1.00 10.64  ? 283  ARG A O   1 
ATOM   2114 C CB  . ARG A 1 283 ? -12.195 123.954 -17.391 1.00 9.35   ? 283  ARG A CB  1 
ATOM   2115 C CG  . ARG A 1 283 ? -11.216 125.062 -17.705 1.00 7.91   ? 283  ARG A CG  1 
ATOM   2116 C CD  . ARG A 1 283 ? -11.062 125.257 -19.199 1.00 14.15  ? 283  ARG A CD  1 
ATOM   2117 N NE  . ARG A 1 283 ? -10.034 124.385 -19.763 1.00 22.25  ? 283  ARG A NE  1 
ATOM   2118 C CZ  . ARG A 1 283 ? -10.277 123.387 -20.611 1.00 31.19  ? 283  ARG A CZ  1 
ATOM   2119 N NH1 . ARG A 1 283 ? -11.521 123.115 -21.009 1.00 20.98  ? 283  ARG A NH1 1 
ATOM   2120 N NH2 . ARG A 1 283 ? -9.269  122.655 -21.060 1.00 33.07  ? 283  ARG A NH2 1 
ATOM   2121 N N   . GLY A 1 284 ? -13.331 121.719 -15.352 1.00 5.00   ? 284  GLY A N   1 
ATOM   2122 C CA  . GLY A 1 284 ? -14.290 120.651 -15.142 1.00 11.68  ? 284  GLY A CA  1 
ATOM   2123 C C   . GLY A 1 284 ? -14.780 120.572 -13.703 1.00 12.38  ? 284  GLY A C   1 
ATOM   2124 O O   . GLY A 1 284 ? -15.503 119.640 -13.348 1.00 18.93  ? 284  GLY A O   1 
ATOM   2125 N N   . SER A 1 285 ? -14.406 121.551 -12.878 1.00 8.93   ? 285  SER A N   1 
ATOM   2126 C CA  . SER A 1 285 ? -14.790 121.560 -11.470 1.00 8.45   ? 285  SER A CA  1 
ATOM   2127 C C   . SER A 1 285 ? -16.130 122.206 -11.170 1.00 16.14  ? 285  SER A C   1 
ATOM   2128 O O   . SER A 1 285 ? -16.695 122.927 -11.985 1.00 24.15  ? 285  SER A O   1 
ATOM   2129 C CB  . SER A 1 285 ? -13.704 122.234 -10.632 1.00 5.00   ? 285  SER A CB  1 
ATOM   2130 O OG  . SER A 1 285 ? -13.645 123.621 -10.889 1.00 5.26   ? 285  SER A OG  1 
ATOM   2131 N N   . LEU A 1 286 ? -16.623 121.935 -9.970  1.00 22.78  ? 286  LEU A N   1 
ATOM   2132 C CA  . LEU A 1 286 ? -17.900 122.452 -9.501  1.00 22.19  ? 286  LEU A CA  1 
ATOM   2133 C C   . LEU A 1 286 ? -17.840 123.954 -9.276  1.00 23.27  ? 286  LEU A C   1 
ATOM   2134 O O   . LEU A 1 286 ? -18.793 124.677 -9.559  1.00 27.68  ? 286  LEU A O   1 
ATOM   2135 C CB  . LEU A 1 286 ? -18.257 121.777 -8.180  1.00 25.43  ? 286  LEU A CB  1 
ATOM   2136 C CG  . LEU A 1 286 ? -19.628 121.134 -8.015  1.00 32.44  ? 286  LEU A CG  1 
ATOM   2137 C CD1 . LEU A 1 286 ? -20.022 120.393 -9.289  1.00 37.34  ? 286  LEU A CD1 1 
ATOM   2138 C CD2 . LEU A 1 286 ? -19.578 120.186 -6.816  1.00 31.67  ? 286  LEU A CD2 1 
ATOM   2139 N N   . ASN A 1 287 ? -16.706 124.409 -8.760  1.00 17.83  ? 287  ASN A N   1 
ATOM   2140 C CA  . ASN A 1 287 ? -16.496 125.810 -8.439  1.00 9.68   ? 287  ASN A CA  1 
ATOM   2141 C C   . ASN A 1 287 ? -15.342 126.366 -9.255  1.00 10.94  ? 287  ASN A C   1 
ATOM   2142 O O   . ASN A 1 287 ? -14.281 126.684 -8.726  1.00 19.74  ? 287  ASN A O   1 
ATOM   2143 C CB  . ASN A 1 287 ? -16.183 125.930 -6.948  1.00 11.44  ? 287  ASN A CB  1 
ATOM   2144 C CG  . ASN A 1 287 ? -15.001 125.070 -6.532  1.00 11.99  ? 287  ASN A CG  1 
ATOM   2145 O OD1 . ASN A 1 287 ? -14.499 124.254 -7.306  1.00 12.54  ? 287  ASN A OD1 1 
ATOM   2146 N ND2 . ASN A 1 287 ? -14.544 125.258 -5.303  1.00 20.34  ? 287  ASN A ND2 1 
ATOM   2147 N N   . PRO A 1 288 ? -15.542 126.518 -10.560 1.00 10.34  ? 288  PRO A N   1 
ATOM   2148 C CA  . PRO A 1 288 ? -14.466 127.039 -11.408 1.00 8.18   ? 288  PRO A CA  1 
ATOM   2149 C C   . PRO A 1 288 ? -13.945 128.387 -10.959 1.00 9.53   ? 288  PRO A C   1 
ATOM   2150 O O   . PRO A 1 288 ? -14.719 129.291 -10.637 1.00 15.24  ? 288  PRO A O   1 
ATOM   2151 C CB  . PRO A 1 288 ? -15.099 127.105 -12.793 1.00 6.79   ? 288  PRO A CB  1 
ATOM   2152 C CG  . PRO A 1 288 ? -16.564 127.134 -12.523 1.00 8.98   ? 288  PRO A CG  1 
ATOM   2153 C CD  . PRO A 1 288 ? -16.772 126.272 -11.321 1.00 5.00   ? 288  PRO A CD  1 
ATOM   2154 N N   . GLY A 1 289 ? -12.625 128.513 -10.938 1.00 8.73   ? 289  GLY A N   1 
ATOM   2155 C CA  . GLY A 1 289 ? -12.004 129.763 -10.544 1.00 11.73  ? 289  GLY A CA  1 
ATOM   2156 C C   . GLY A 1 289 ? -11.799 129.956 -9.054  1.00 18.16  ? 289  GLY A C   1 
ATOM   2157 O O   . GLY A 1 289 ? -11.209 130.956 -8.641  1.00 23.41  ? 289  GLY A O   1 
ATOM   2158 N N   . LYS A 1 290 ? -12.276 129.010 -8.248  1.00 14.74  ? 290  LYS A N   1 
ATOM   2159 C CA  . LYS A 1 290 ? -12.144 129.104 -6.798  1.00 13.81  ? 290  LYS A CA  1 
ATOM   2160 C C   . LYS A 1 290 ? -11.250 128.003 -6.259  1.00 15.20  ? 290  LYS A C   1 
ATOM   2161 O O   . LYS A 1 290 ? -11.115 126.947 -6.872  1.00 18.14  ? 290  LYS A O   1 
ATOM   2162 C CB  . LYS A 1 290 ? -13.517 128.986 -6.121  1.00 15.69  ? 290  LYS A CB  1 
ATOM   2163 C CG  . LYS A 1 290 ? -14.516 130.074 -6.481  1.00 25.34  ? 290  LYS A CG  1 
ATOM   2164 C CD  . LYS A 1 290 ? -13.859 131.442 -6.542  1.00 42.17  ? 290  LYS A CD  1 
ATOM   2165 C CE  . LYS A 1 290 ? -14.882 132.555 -6.719  1.00 52.78  ? 290  LYS A CE  1 
ATOM   2166 N NZ  . LYS A 1 290 ? -14.238 133.808 -7.224  1.00 64.33  ? 290  LYS A NZ  1 
ATOM   2167 N N   . GLN A 1 291 ? -10.644 128.251 -5.105  1.00 9.24   ? 291  GLN A N   1 
ATOM   2168 C CA  . GLN A 1 291 ? -9.797  127.256 -4.477  1.00 7.34   ? 291  GLN A CA  1 
ATOM   2169 C C   . GLN A 1 291 ? -8.715  126.778 -5.428  1.00 5.76   ? 291  GLN A C   1 
ATOM   2170 O O   . GLN A 1 291 ? -8.388  125.594 -5.460  1.00 7.39   ? 291  GLN A O   1 
ATOM   2171 C CB  . GLN A 1 291 ? -10.657 126.073 -4.032  1.00 5.00   ? 291  GLN A CB  1 
ATOM   2172 C CG  . GLN A 1 291 ? -11.845 126.480 -3.162  1.00 15.85  ? 291  GLN A CG  1 
ATOM   2173 C CD  . GLN A 1 291 ? -11.438 126.925 -1.752  1.00 21.77  ? 291  GLN A CD  1 
ATOM   2174 O OE1 . GLN A 1 291 ? -11.503 128.114 -1.412  1.00 17.62  ? 291  GLN A OE1 1 
ATOM   2175 N NE2 . GLN A 1 291 ? -11.022 125.966 -0.927  1.00 14.50  ? 291  GLN A NE2 1 
ATOM   2176 N N   . LEU A 1 292 ? -8.145  127.708 -6.188  1.00 6.58   ? 292  LEU A N   1 
ATOM   2177 C CA  . LEU A 1 292 ? -7.115  127.366 -7.161  1.00 11.09  ? 292  LEU A CA  1 
ATOM   2178 C C   . LEU A 1 292 ? -5.885  126.695 -6.563  1.00 11.65  ? 292  LEU A C   1 
ATOM   2179 O O   . LEU A 1 292 ? -5.292  125.817 -7.187  1.00 21.77  ? 292  LEU A O   1 
ATOM   2180 C CB  . LEU A 1 292 ? -6.695  128.609 -7.955  1.00 8.42   ? 292  LEU A CB  1 
ATOM   2181 C CG  . LEU A 1 292 ? -7.725  129.225 -8.918  1.00 8.70   ? 292  LEU A CG  1 
ATOM   2182 C CD1 . LEU A 1 292 ? -7.001  129.951 -10.035 1.00 5.00   ? 292  LEU A CD1 1 
ATOM   2183 C CD2 . LEU A 1 292 ? -8.639  128.151 -9.483  1.00 5.00   ? 292  LEU A CD2 1 
ATOM   2184 N N   . PHE A 1 293 ? -5.489  127.100 -5.364  1.00 8.34   ? 293  PHE A N   1 
ATOM   2185 C CA  . PHE A 1 293 ? -4.322  126.500 -4.732  1.00 8.31   ? 293  PHE A CA  1 
ATOM   2186 C C   . PHE A 1 293 ? -4.668  125.085 -4.302  1.00 7.91   ? 293  PHE A C   1 
ATOM   2187 O O   . PHE A 1 293 ? -3.931  124.138 -4.560  1.00 15.95  ? 293  PHE A O   1 
ATOM   2188 C CB  . PHE A 1 293 ? -3.907  127.320 -3.519  1.00 10.28  ? 293  PHE A CB  1 
ATOM   2189 C CG  . PHE A 1 293 ? -2.715  126.772 -2.795  1.00 15.37  ? 293  PHE A CG  1 
ATOM   2190 C CD1 . PHE A 1 293 ? -1.449  126.838 -3.364  1.00 17.08  ? 293  PHE A CD1 1 
ATOM   2191 C CD2 . PHE A 1 293 ? -2.856  126.213 -1.528  1.00 10.64  ? 293  PHE A CD2 1 
ATOM   2192 C CE1 . PHE A 1 293 ? -0.343  126.360 -2.678  1.00 18.07  ? 293  PHE A CE1 1 
ATOM   2193 C CE2 . PHE A 1 293 ? -1.761  125.735 -0.837  1.00 5.00   ? 293  PHE A CE2 1 
ATOM   2194 C CZ  . PHE A 1 293 ? -0.501  125.808 -1.410  1.00 16.26  ? 293  PHE A CZ  1 
ATOM   2195 N N   . GLU A 1 294 ? -5.812  124.955 -3.649  1.00 8.37   ? 294  GLU A N   1 
ATOM   2196 C CA  . GLU A 1 294 ? -6.307  123.672 -3.168  1.00 7.95   ? 294  GLU A CA  1 
ATOM   2197 C C   . GLU A 1 294 ? -6.365  122.644 -4.287  1.00 11.66  ? 294  GLU A C   1 
ATOM   2198 O O   . GLU A 1 294 ? -6.031  121.482 -4.089  1.00 17.01  ? 294  GLU A O   1 
ATOM   2199 C CB  . GLU A 1 294 ? -7.698  123.872 -2.586  1.00 5.00   ? 294  GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 294 ? -8.476  122.622 -2.311  1.00 5.00   ? 294  GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 294 ? -9.680  122.921 -1.443  1.00 8.75   ? 294  GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 294 ? -9.524  122.938 -0.202  1.00 9.90   ? 294  GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 294 ? -10.776 123.153 -1.998  1.00 5.00   ? 294  GLU A OE2 1 
ATOM   2204 N N   . LYS A 1 295 ? -6.792  123.083 -5.465  1.00 13.73  ? 295  LYS A N   1 
ATOM   2205 C CA  . LYS A 1 295 ? -6.905  122.204 -6.621  1.00 6.61   ? 295  LYS A CA  1 
ATOM   2206 C C   . LYS A 1 295 ? -5.549  121.757 -7.148  1.00 7.59   ? 295  LYS A C   1 
ATOM   2207 O O   . LYS A 1 295 ? -5.488  121.027 -8.128  1.00 13.93  ? 295  LYS A O   1 
ATOM   2208 C CB  . LYS A 1 295 ? -7.675  122.909 -7.742  1.00 5.00   ? 295  LYS A CB  1 
ATOM   2209 C CG  . LYS A 1 295 ? -9.144  123.033 -7.463  1.00 5.00   ? 295  LYS A CG  1 
ATOM   2210 C CD  . LYS A 1 295 ? -9.818  124.000 -8.383  1.00 5.00   ? 295  LYS A CD  1 
ATOM   2211 C CE  . LYS A 1 295 ? -11.300 123.970 -8.099  1.00 5.00   ? 295  LYS A CE  1 
ATOM   2212 N NZ  . LYS A 1 295 ? -12.032 125.049 -8.786  1.00 8.37   ? 295  LYS A NZ  1 
ATOM   2213 N N   . MET A 1 296 ? -4.468  122.208 -6.514  1.00 5.00   ? 296  MET A N   1 
ATOM   2214 C CA  . MET A 1 296 ? -3.121  121.831 -6.938  1.00 5.00   ? 296  MET A CA  1 
ATOM   2215 C C   . MET A 1 296 ? -2.522  120.947 -5.875  1.00 5.00   ? 296  MET A C   1 
ATOM   2216 O O   . MET A 1 296 ? -1.444  120.398 -6.054  1.00 5.08   ? 296  MET A O   1 
ATOM   2217 C CB  . MET A 1 296 ? -2.209  123.058 -7.059  1.00 6.70   ? 296  MET A CB  1 
ATOM   2218 C CG  . MET A 1 296 ? -2.385  123.921 -8.301  1.00 5.00   ? 296  MET A CG  1 
ATOM   2219 S SD  . MET A 1 296 ? -1.078  125.192 -8.434  1.00 14.23  ? 296  MET A SD  1 
ATOM   2220 C CE  . MET A 1 296 ? -1.148  125.947 -6.844  1.00 19.56  ? 296  MET A CE  1 
ATOM   2221 N N   . VAL A 1 297 ? -3.250  120.798 -4.773  1.00 12.68  ? 297  VAL A N   1 
ATOM   2222 C CA  . VAL A 1 297 ? -2.757  120.057 -3.620  1.00 6.58   ? 297  VAL A CA  1 
ATOM   2223 C C   . VAL A 1 297 ? -3.586  118.920 -3.042  1.00 5.00   ? 297  VAL A C   1 
ATOM   2224 O O   . VAL A 1 297 ? -3.070  117.818 -2.852  1.00 6.73   ? 297  VAL A O   1 
ATOM   2225 C CB  . VAL A 1 297 ? -2.488  121.059 -2.460  1.00 7.43   ? 297  VAL A CB  1 
ATOM   2226 C CG1 . VAL A 1 297 ? -2.138  120.320 -1.194  1.00 10.40  ? 297  VAL A CG1 1 
ATOM   2227 C CG2 . VAL A 1 297 ? -1.384  122.024 -2.839  1.00 5.36   ? 297  VAL A CG2 1 
ATOM   2228 N N   . SER A 1 298 ? -4.858  119.178 -2.755  1.00 5.00   ? 298  SER A N   1 
ATOM   2229 C CA  . SER A 1 298 ? -5.696  118.182 -2.097  1.00 5.00   ? 298  SER A CA  1 
ATOM   2230 C C   . SER A 1 298 ? -5.988  116.886 -2.814  1.00 10.83  ? 298  SER A C   1 
ATOM   2231 O O   . SER A 1 298 ? -5.899  116.790 -4.037  1.00 18.08  ? 298  SER A O   1 
ATOM   2232 C CB  . SER A 1 298 ? -7.010  118.809 -1.627  1.00 5.00   ? 298  SER A CB  1 
ATOM   2233 O OG  . SER A 1 298 ? -7.499  119.743 -2.561  1.00 19.64  ? 298  SER A OG  1 
ATOM   2234 N N   . GLY A 1 299 ? -6.371  115.894 -2.019  1.00 10.97  ? 299  GLY A N   1 
ATOM   2235 C CA  . GLY A 1 299 ? -6.648  114.572 -2.530  1.00 9.26   ? 299  GLY A CA  1 
ATOM   2236 C C   . GLY A 1 299 ? -7.817  114.423 -3.471  1.00 10.25  ? 299  GLY A C   1 
ATOM   2237 O O   . GLY A 1 299 ? -7.830  113.511 -4.292  1.00 19.96  ? 299  GLY A O   1 
ATOM   2238 N N   . MET A 1 300 ? -8.810  115.291 -3.366  1.00 8.93   ? 300  MET A N   1 
ATOM   2239 C CA  . MET A 1 300 ? -9.964  115.192 -4.255  1.00 7.61   ? 300  MET A CA  1 
ATOM   2240 C C   . MET A 1 300 ? -9.581  115.499 -5.718  1.00 8.43   ? 300  MET A C   1 
ATOM   2241 O O   . MET A 1 300 ? -10.318 115.163 -6.643  1.00 9.76   ? 300  MET A O   1 
ATOM   2242 C CB  . MET A 1 300 ? -11.072 116.136 -3.763  1.00 5.00   ? 300  MET A CB  1 
ATOM   2243 C CG  . MET A 1 300 ? -11.887 116.791 -4.843  1.00 8.34   ? 300  MET A CG  1 
ATOM   2244 S SD  . MET A 1 300 ? -13.206 117.796 -4.172  1.00 15.53  ? 300  MET A SD  1 
ATOM   2245 C CE  . MET A 1 300 ? -14.512 117.361 -5.193  1.00 5.00   ? 300  MET A CE  1 
ATOM   2246 N N   . TYR A 1 301 ? -8.413  116.101 -5.925  1.00 8.76   ? 301  TYR A N   1 
ATOM   2247 C CA  . TYR A 1 301 ? -7.969  116.452 -7.265  1.00 8.46   ? 301  TYR A CA  1 
ATOM   2248 C C   . TYR A 1 301 ? -6.713  115.748 -7.763  1.00 12.83  ? 301  TYR A C   1 
ATOM   2249 O O   . TYR A 1 301 ? -6.506  115.649 -8.967  1.00 20.07  ? 301  TYR A O   1 
ATOM   2250 C CB  . TYR A 1 301 ? -7.749  117.962 -7.363  1.00 5.85   ? 301  TYR A CB  1 
ATOM   2251 C CG  . TYR A 1 301 ? -8.894  118.782 -6.816  1.00 12.69  ? 301  TYR A CG  1 
ATOM   2252 C CD1 . TYR A 1 301 ? -10.123 118.820 -7.468  1.00 9.96   ? 301  TYR A CD1 1 
ATOM   2253 C CD2 . TYR A 1 301 ? -8.750  119.523 -5.645  1.00 11.65  ? 301  TYR A CD2 1 
ATOM   2254 C CE1 . TYR A 1 301 ? -11.181 119.572 -6.969  1.00 13.35  ? 301  TYR A CE1 1 
ATOM   2255 C CE2 . TYR A 1 301 ? -9.802  120.277 -5.138  1.00 10.02  ? 301  TYR A CE2 1 
ATOM   2256 C CZ  . TYR A 1 301 ? -11.013 120.296 -5.803  1.00 13.09  ? 301  TYR A CZ  1 
ATOM   2257 O OH  . TYR A 1 301 ? -12.064 121.022 -5.295  1.00 14.84  ? 301  TYR A OH  1 
ATOM   2258 N N   . LEU A 1 302 ? -5.868  115.268 -6.860  1.00 11.08  ? 302  LEU A N   1 
ATOM   2259 C CA  . LEU A 1 302 ? -4.638  114.601 -7.280  1.00 8.39   ? 302  LEU A CA  1 
ATOM   2260 C C   . LEU A 1 302 ? -4.853  113.520 -8.328  1.00 8.91   ? 302  LEU A C   1 
ATOM   2261 O O   . LEU A 1 302 ? -4.216  113.527 -9.369  1.00 11.12  ? 302  LEU A O   1 
ATOM   2262 C CB  . LEU A 1 302 ? -3.933  113.989 -6.080  1.00 10.37  ? 302  LEU A CB  1 
ATOM   2263 C CG  . LEU A 1 302 ? -2.912  114.881 -5.385  1.00 7.99   ? 302  LEU A CG  1 
ATOM   2264 C CD1 . LEU A 1 302 ? -1.647  114.086 -5.149  1.00 15.53  ? 302  LEU A CD1 1 
ATOM   2265 C CD2 . LEU A 1 302 ? -2.631  116.106 -6.224  1.00 7.70   ? 302  LEU A CD2 1 
ATOM   2266 N N   . GLY A 1 303 ? -5.748  112.582 -8.051  1.00 11.29  ? 303  GLY A N   1 
ATOM   2267 C CA  . GLY A 1 303 ? -6.004  111.512 -9.000  1.00 7.88   ? 303  GLY A CA  1 
ATOM   2268 C C   . GLY A 1 303 ? -6.352  111.994 -10.396 1.00 8.74   ? 303  GLY A C   1 
ATOM   2269 O O   . GLY A 1 303 ? -5.715  111.597 -11.369 1.00 16.04  ? 303  GLY A O   1 
ATOM   2270 N N   . GLU A 1 304 ? -7.359  112.857 -10.493 1.00 5.86   ? 304  GLU A N   1 
ATOM   2271 C CA  . GLU A 1 304 ? -7.818  113.400 -11.774 1.00 6.85   ? 304  GLU A CA  1 
ATOM   2272 C C   . GLU A 1 304 ? -6.737  114.191 -12.512 1.00 10.68  ? 304  GLU A C   1 
ATOM   2273 O O   . GLU A 1 304 ? -6.678  114.202 -13.740 1.00 13.13  ? 304  GLU A O   1 
ATOM   2274 C CB  . GLU A 1 304 ? -9.047  114.288 -11.541 1.00 5.00   ? 304  GLU A CB  1 
ATOM   2275 C CG  . GLU A 1 304 ? -9.614  114.928 -12.789 1.00 14.46  ? 304  GLU A CG  1 
ATOM   2276 C CD  . GLU A 1 304 ? -10.346 113.953 -13.694 1.00 14.74  ? 304  GLU A CD  1 
ATOM   2277 O OE1 . GLU A 1 304 ? -10.444 112.753 -13.361 1.00 13.33  ? 304  GLU A OE1 1 
ATOM   2278 O OE2 . GLU A 1 304 ? -10.828 114.399 -14.752 1.00 18.80  ? 304  GLU A OE2 1 
ATOM   2279 N N   . LEU A 1 305 ? -5.878  114.853 -11.757 1.00 13.65  ? 305  LEU A N   1 
ATOM   2280 C CA  . LEU A 1 305 ? -4.813  115.643 -12.342 1.00 9.11   ? 305  LEU A CA  1 
ATOM   2281 C C   . LEU A 1 305 ? -3.835  114.727 -13.065 1.00 9.92   ? 305  LEU A C   1 
ATOM   2282 O O   . LEU A 1 305 ? -3.262  115.086 -14.092 1.00 17.51  ? 305  LEU A O   1 
ATOM   2283 C CB  . LEU A 1 305 ? -4.109  116.429 -11.237 1.00 7.73   ? 305  LEU A CB  1 
ATOM   2284 C CG  . LEU A 1 305 ? -3.049  117.465 -11.596 1.00 15.05  ? 305  LEU A CG  1 
ATOM   2285 C CD1 . LEU A 1 305 ? -3.521  118.335 -12.750 1.00 16.18  ? 305  LEU A CD1 1 
ATOM   2286 C CD2 . LEU A 1 305 ? -2.754  118.300 -10.363 1.00 7.85   ? 305  LEU A CD2 1 
ATOM   2287 N N   . VAL A 1 306 ? -3.642  113.534 -12.530 1.00 8.27   ? 306  VAL A N   1 
ATOM   2288 C CA  . VAL A 1 306 ? -2.732  112.597 -13.160 1.00 8.20   ? 306  VAL A CA  1 
ATOM   2289 C C   . VAL A 1 306 ? -3.397  112.046 -14.416 1.00 9.24   ? 306  VAL A C   1 
ATOM   2290 O O   . VAL A 1 306 ? -2.745  111.894 -15.441 1.00 13.51  ? 306  VAL A O   1 
ATOM   2291 C CB  . VAL A 1 306 ? -2.376  111.442 -12.211 1.00 7.34   ? 306  VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 306 ? -1.900  110.250 -13.003 1.00 10.29  ? 306  VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 306 ? -1.303  111.888 -11.233 1.00 5.00   ? 306  VAL A CG2 1 
ATOM   2294 N N   . ARG A 1 307 ? -4.693  111.753 -14.338 1.00 7.47   ? 307  ARG A N   1 
ATOM   2295 C CA  . ARG A 1 307 ? -5.417  111.230 -15.498 1.00 6.69   ? 307  ARG A CA  1 
ATOM   2296 C C   . ARG A 1 307 ? -5.255  112.171 -16.693 1.00 9.33   ? 307  ARG A C   1 
ATOM   2297 O O   . ARG A 1 307 ? -4.886  111.737 -17.780 1.00 11.89  ? 307  ARG A O   1 
ATOM   2298 C CB  . ARG A 1 307 ? -6.907  111.062 -15.176 1.00 5.00   ? 307  ARG A CB  1 
ATOM   2299 C CG  . ARG A 1 307 ? -7.650  110.077 -16.083 1.00 7.73   ? 307  ARG A CG  1 
ATOM   2300 C CD  . ARG A 1 307 ? -9.193  110.158 -15.934 1.00 5.20   ? 307  ARG A CD  1 
ATOM   2301 N NE  . ARG A 1 307 ? -9.741  111.491 -16.217 1.00 9.44   ? 307  ARG A NE  1 
ATOM   2302 C CZ  . ARG A 1 307 ? -9.900  112.008 -17.435 1.00 12.17  ? 307  ARG A CZ  1 
ATOM   2303 N NH1 . ARG A 1 307 ? -9.556  111.310 -18.510 1.00 10.74  ? 307  ARG A NH1 1 
ATOM   2304 N NH2 . ARG A 1 307 ? -10.380 113.238 -17.582 1.00 5.00   ? 307  ARG A NH2 1 
ATOM   2305 N N   . LEU A 1 308 ? -5.523  113.458 -16.487 1.00 9.27   ? 308  LEU A N   1 
ATOM   2306 C CA  . LEU A 1 308 ? -5.404  114.456 -17.553 1.00 11.03  ? 308  LEU A CA  1 
ATOM   2307 C C   . LEU A 1 308 ? -4.007  114.439 -18.165 1.00 12.69  ? 308  LEU A C   1 
ATOM   2308 O O   . LEU A 1 308 ? -3.839  114.590 -19.371 1.00 15.79  ? 308  LEU A O   1 
ATOM   2309 C CB  . LEU A 1 308 ? -5.682  115.865 -17.010 1.00 10.60  ? 308  LEU A CB  1 
ATOM   2310 C CG  . LEU A 1 308 ? -7.025  116.169 -16.343 1.00 10.06  ? 308  LEU A CG  1 
ATOM   2311 C CD1 . LEU A 1 308 ? -7.048  117.609 -15.842 1.00 5.00   ? 308  LEU A CD1 1 
ATOM   2312 C CD2 . LEU A 1 308 ? -8.140  115.925 -17.339 1.00 9.61   ? 308  LEU A CD2 1 
ATOM   2313 N N   . ILE A 1 309 ? -2.999  114.273 -17.325 1.00 11.99  ? 309  ILE A N   1 
ATOM   2314 C CA  . ILE A 1 309 ? -1.634  114.255 -17.816 1.00 16.73  ? 309  ILE A CA  1 
ATOM   2315 C C   . ILE A 1 309 ? -1.418  113.004 -18.653 1.00 18.15  ? 309  ILE A C   1 
ATOM   2316 O O   . ILE A 1 309 ? -0.667  113.018 -19.623 1.00 23.05  ? 309  ILE A O   1 
ATOM   2317 C CB  . ILE A 1 309 ? -0.614  114.273 -16.649 1.00 18.19  ? 309  ILE A CB  1 
ATOM   2318 C CG1 . ILE A 1 309 ? -0.512  115.684 -16.057 1.00 18.09  ? 309  ILE A CG1 1 
ATOM   2319 C CG2 . ILE A 1 309 ? 0.743   113.817 -17.141 1.00 18.57  ? 309  ILE A CG2 1 
ATOM   2320 C CD1 . ILE A 1 309 ? -0.114  115.722 -14.587 1.00 16.55  ? 309  ILE A CD1 1 
ATOM   2321 N N   . LEU A 1 310 ? -2.086  111.920 -18.276 1.00 19.07  ? 310  LEU A N   1 
ATOM   2322 C CA  . LEU A 1 310 ? -1.949  110.662 -18.996 1.00 15.19  ? 310  LEU A CA  1 
ATOM   2323 C C   . LEU A 1 310 ? -2.676  110.714 -20.335 1.00 17.81  ? 310  LEU A C   1 
ATOM   2324 O O   . LEU A 1 310 ? -2.173  110.202 -21.332 1.00 22.34  ? 310  LEU A O   1 
ATOM   2325 C CB  . LEU A 1 310 ? -2.474  109.499 -18.143 1.00 10.24  ? 310  LEU A CB  1 
ATOM   2326 C CG  . LEU A 1 310 ? -1.670  109.112 -16.897 1.00 5.00   ? 310  LEU A CG  1 
ATOM   2327 C CD1 . LEU A 1 310 ? -2.067  107.727 -16.479 1.00 7.38   ? 310  LEU A CD1 1 
ATOM   2328 C CD2 . LEU A 1 310 ? -0.187  109.147 -17.165 1.00 5.00   ? 310  LEU A CD2 1 
ATOM   2329 N N   . VAL A 1 311 ? -3.852  111.339 -20.364 1.00 18.67  ? 311  VAL A N   1 
ATOM   2330 C CA  . VAL A 1 311 ? -4.620  111.447 -21.607 1.00 16.28  ? 311  VAL A CA  1 
ATOM   2331 C C   . VAL A 1 311 ? -3.809  112.235 -22.633 1.00 17.74  ? 311  VAL A C   1 
ATOM   2332 O O   . VAL A 1 311 ? -3.724  111.846 -23.795 1.00 24.49  ? 311  VAL A O   1 
ATOM   2333 C CB  . VAL A 1 311 ? -5.986  112.160 -21.394 1.00 11.90  ? 311  VAL A CB  1 
ATOM   2334 C CG1 . VAL A 1 311 ? -6.618  112.473 -22.730 1.00 5.00   ? 311  VAL A CG1 1 
ATOM   2335 C CG2 . VAL A 1 311 ? -6.930  111.274 -20.581 1.00 11.98  ? 311  VAL A CG2 1 
ATOM   2336 N N   . LYS A 1 312 ? -3.202  113.333 -22.196 1.00 18.45  ? 312  LYS A N   1 
ATOM   2337 C CA  . LYS A 1 312 ? -2.398  114.161 -23.085 1.00 17.56  ? 312  LYS A CA  1 
ATOM   2338 C C   . LYS A 1 312 ? -1.230  113.368 -23.647 1.00 20.09  ? 312  LYS A C   1 
ATOM   2339 O O   . LYS A 1 312 ? -0.915  113.486 -24.826 1.00 30.85  ? 312  LYS A O   1 
ATOM   2340 C CB  . LYS A 1 312 ? -1.876  115.393 -22.340 1.00 22.15  ? 312  LYS A CB  1 
ATOM   2341 C CG  . LYS A 1 312 ? -0.772  116.159 -23.060 1.00 23.08  ? 312  LYS A CG  1 
ATOM   2342 C CD  . LYS A 1 312 ? -1.323  117.389 -23.771 1.00 30.75  ? 312  LYS A CD  1 
ATOM   2343 C CE  . LYS A 1 312 ? -0.485  118.638 -23.499 1.00 32.61  ? 312  LYS A CE  1 
ATOM   2344 N NZ  . LYS A 1 312 ? 0.987   118.369 -23.465 1.00 36.22  ? 312  LYS A NZ  1 
ATOM   2345 N N   . MET A 1 313 ? -0.594  112.550 -22.814 1.00 19.39  ? 313  MET A N   1 
ATOM   2346 C CA  . MET A 1 313 ? 0.545   111.753 -23.261 1.00 16.59  ? 313  MET A CA  1 
ATOM   2347 C C   . MET A 1 313 ? 0.177   110.617 -24.219 1.00 18.19  ? 313  MET A C   1 
ATOM   2348 O O   . MET A 1 313 ? 0.883   110.374 -25.192 1.00 16.32  ? 313  MET A O   1 
ATOM   2349 C CB  . MET A 1 313 ? 1.291   111.206 -22.055 1.00 12.18  ? 313  MET A CB  1 
ATOM   2350 C CG  . MET A 1 313 ? 2.153   112.258 -21.395 1.00 18.88  ? 313  MET A CG  1 
ATOM   2351 S SD  . MET A 1 313 ? 2.992   111.608 -19.959 1.00 23.54  ? 313  MET A SD  1 
ATOM   2352 C CE  . MET A 1 313 ? 4.445   112.583 -19.960 1.00 20.58  ? 313  MET A CE  1 
ATOM   2353 N N   . ALA A 1 314 ? -0.917  109.912 -23.951 1.00 21.66  ? 314  ALA A N   1 
ATOM   2354 C CA  . ALA A 1 314 ? -1.334  108.836 -24.848 1.00 20.45  ? 314  ALA A CA  1 
ATOM   2355 C C   . ALA A 1 314 ? -1.607  109.494 -26.193 1.00 23.77  ? 314  ALA A C   1 
ATOM   2356 O O   . ALA A 1 314 ? -1.112  109.055 -27.231 1.00 25.43  ? 314  ALA A O   1 
ATOM   2357 C CB  . ALA A 1 314 ? -2.593  108.172 -24.333 1.00 13.59  ? 314  ALA A CB  1 
ATOM   2358 N N   . LYS A 1 315 ? -2.394  110.564 -26.154 1.00 21.16  ? 315  LYS A N   1 
ATOM   2359 C CA  . LYS A 1 315 ? -2.729  111.313 -27.351 1.00 18.95  ? 315  LYS A CA  1 
ATOM   2360 C C   . LYS A 1 315 ? -1.477  111.665 -28.152 1.00 22.26  ? 315  LYS A C   1 
ATOM   2361 O O   . LYS A 1 315 ? -1.536  111.793 -29.369 1.00 28.91  ? 315  LYS A O   1 
ATOM   2362 C CB  . LYS A 1 315 ? -3.473  112.593 -26.976 1.00 12.67  ? 315  LYS A CB  1 
ATOM   2363 C CG  . LYS A 1 315 ? -4.983  112.459 -27.032 1.00 13.32  ? 315  LYS A CG  1 
ATOM   2364 C CD  . LYS A 1 315 ? -5.673  113.697 -26.482 1.00 27.99  ? 315  LYS A CD  1 
ATOM   2365 C CE  . LYS A 1 315 ? -7.105  113.392 -26.039 1.00 34.02  ? 315  LYS A CE  1 
ATOM   2366 N NZ  . LYS A 1 315 ? -7.785  114.586 -25.446 1.00 37.58  ? 315  LYS A NZ  1 
ATOM   2367 N N   . GLU A 1 316 ? -0.342  111.821 -27.481 1.00 22.94  ? 316  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 316 ? 0.890   112.152 -28.190 1.00 25.12  ? 316  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 316 ? 1.753   110.916 -28.393 1.00 26.00  ? 316  GLU A C   1 
ATOM   2370 O O   . GLU A 1 316 ? 2.944   111.013 -28.697 1.00 29.19  ? 316  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 316 ? 1.674   113.225 -27.429 1.00 24.84  ? 316  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 316 ? 1.006   114.591 -27.467 1.00 37.86  ? 316  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 316 ? 1.718   115.622 -26.614 1.00 49.48  ? 316  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 316 ? 2.970   115.640 -26.609 1.00 53.75  ? 316  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 316 ? 1.019   116.418 -25.948 1.00 54.77  ? 316  GLU A OE2 1 
ATOM   2376 N N   . GLY A 1 317 ? 1.140   109.751 -28.227 1.00 23.07  ? 317  GLY A N   1 
ATOM   2377 C CA  . GLY A 1 317 ? 1.864   108.512 -28.403 1.00 26.50  ? 317  GLY A CA  1 
ATOM   2378 C C   . GLY A 1 317 ? 3.107   108.451 -27.544 1.00 31.24  ? 317  GLY A C   1 
ATOM   2379 O O   . GLY A 1 317 ? 4.092   107.803 -27.901 1.00 41.56  ? 317  GLY A O   1 
ATOM   2380 N N   . LEU A 1 318 ? 3.066   109.134 -26.408 1.00 30.35  ? 318  LEU A N   1 
ATOM   2381 C CA  . LEU A 1 318 ? 4.187   109.150 -25.478 1.00 25.64  ? 318  LEU A CA  1 
ATOM   2382 C C   . LEU A 1 318 ? 4.055   108.013 -24.466 1.00 23.50  ? 318  LEU A C   1 
ATOM   2383 O O   . LEU A 1 318 ? 5.027   107.652 -23.807 1.00 21.10  ? 318  LEU A O   1 
ATOM   2384 C CB  . LEU A 1 318 ? 4.224   110.484 -24.741 1.00 32.17  ? 318  LEU A CB  1 
ATOM   2385 C CG  . LEU A 1 318 ? 5.364   111.435 -25.076 1.00 35.16  ? 318  LEU A CG  1 
ATOM   2386 C CD1 . LEU A 1 318 ? 5.370   112.577 -24.076 1.00 42.73  ? 318  LEU A CD1 1 
ATOM   2387 C CD2 . LEU A 1 318 ? 6.677   110.679 -25.040 1.00 43.54  ? 318  LEU A CD2 1 
ATOM   2388 N N   . LEU A 1 319 ? 2.842   107.470 -24.346 1.00 23.66  ? 319  LEU A N   1 
ATOM   2389 C CA  . LEU A 1 319 ? 2.535   106.371 -23.428 1.00 22.41  ? 319  LEU A CA  1 
ATOM   2390 C C   . LEU A 1 319 ? 1.573   105.407 -24.106 1.00 23.24  ? 319  LEU A C   1 
ATOM   2391 O O   . LEU A 1 319 ? 0.846   105.793 -25.016 1.00 23.38  ? 319  LEU A O   1 
ATOM   2392 C CB  . LEU A 1 319 ? 1.862   106.888 -22.148 1.00 19.56  ? 319  LEU A CB  1 
ATOM   2393 C CG  . LEU A 1 319 ? 2.641   107.716 -21.125 1.00 18.26  ? 319  LEU A CG  1 
ATOM   2394 C CD1 . LEU A 1 319 ? 1.725   108.011 -19.963 1.00 14.31  ? 319  LEU A CD1 1 
ATOM   2395 C CD2 . LEU A 1 319 ? 3.886   106.978 -20.653 1.00 14.99  ? 319  LEU A CD2 1 
ATOM   2396 N N   . PHE A 1 320 ? 1.566   104.159 -23.645 1.00 26.75  ? 320  PHE A N   1 
ATOM   2397 C CA  . PHE A 1 320 ? 0.684   103.126 -24.182 1.00 27.77  ? 320  PHE A CA  1 
ATOM   2398 C C   . PHE A 1 320 ? 0.737   103.042 -25.705 1.00 32.28  ? 320  PHE A C   1 
ATOM   2399 O O   . PHE A 1 320 ? -0.159  102.464 -26.330 1.00 32.14  ? 320  PHE A O   1 
ATOM   2400 C CB  . PHE A 1 320 ? -0.771  103.374 -23.748 1.00 25.60  ? 320  PHE A CB  1 
ATOM   2401 C CG  . PHE A 1 320 ? -0.912  103.974 -22.377 1.00 24.51  ? 320  PHE A CG  1 
ATOM   2402 C CD1 . PHE A 1 320 ? -0.263  103.413 -21.281 1.00 25.03  ? 320  PHE A CD1 1 
ATOM   2403 C CD2 . PHE A 1 320 ? -1.699  105.101 -22.179 1.00 25.99  ? 320  PHE A CD2 1 
ATOM   2404 C CE1 . PHE A 1 320 ? -0.394  103.969 -20.006 1.00 20.37  ? 320  PHE A CE1 1 
ATOM   2405 C CE2 . PHE A 1 320 ? -1.835  105.660 -20.909 1.00 24.86  ? 320  PHE A CE2 1 
ATOM   2406 C CZ  . PHE A 1 320 ? -1.179  105.091 -19.822 1.00 16.93  ? 320  PHE A CZ  1 
ATOM   2407 N N   . GLU A 1 321 ? 1.787   103.610 -26.295 1.00 33.82  ? 321  GLU A N   1 
ATOM   2408 C CA  . GLU A 1 321 ? 1.945   103.603 -27.744 1.00 33.38  ? 321  GLU A CA  1 
ATOM   2409 C C   . GLU A 1 321 ? 0.763   104.309 -28.395 1.00 32.82  ? 321  GLU A C   1 
ATOM   2410 O O   . GLU A 1 321 ? 0.256   103.875 -29.434 1.00 30.65  ? 321  GLU A O   1 
ATOM   2411 C CB  . GLU A 1 321 ? 2.033   102.167 -28.262 1.00 40.68  ? 321  GLU A CB  1 
ATOM   2412 C CG  . GLU A 1 321 ? 3.442   101.723 -28.620 1.00 62.58  ? 321  GLU A CG  1 
ATOM   2413 C CD  . GLU A 1 321 ? 3.748   100.313 -28.139 1.00 74.68  ? 321  GLU A CD  1 
ATOM   2414 O OE1 . GLU A 1 321 ? 3.759   100.092 -26.907 1.00 84.85  ? 321  GLU A OE1 1 
ATOM   2415 O OE2 . GLU A 1 321 ? 3.978   99.426  -28.993 1.00 81.01  ? 321  GLU A OE2 1 
ATOM   2416 N N   . GLY A 1 322 ? 0.312   105.386 -27.761 1.00 30.99  ? 322  GLY A N   1 
ATOM   2417 C CA  . GLY A 1 322 ? -0.798  106.158 -28.293 1.00 31.70  ? 322  GLY A CA  1 
ATOM   2418 C C   . GLY A 1 322 ? -2.188  105.552 -28.206 1.00 30.83  ? 322  GLY A C   1 
ATOM   2419 O O   . GLY A 1 322 ? -3.158  106.191 -28.605 1.00 35.87  ? 322  GLY A O   1 
ATOM   2420 N N   . ARG A 1 323 ? -2.304  104.330 -27.699 1.00 31.13  ? 323  ARG A N   1 
ATOM   2421 C CA  . ARG A 1 323 ? -3.611  103.691 -27.584 1.00 28.90  ? 323  ARG A CA  1 
ATOM   2422 C C   . ARG A 1 323 ? -4.460  104.416 -26.525 1.00 28.56  ? 323  ARG A C   1 
ATOM   2423 O O   . ARG A 1 323 ? -4.048  104.565 -25.376 1.00 30.14  ? 323  ARG A O   1 
ATOM   2424 C CB  . ARG A 1 323 ? -3.435  102.210 -27.225 1.00 28.25  ? 323  ARG A CB  1 
ATOM   2425 C CG  . ARG A 1 323 ? -4.720  101.504 -26.827 1.00 40.09  ? 323  ARG A CG  1 
ATOM   2426 C CD  . ARG A 1 323 ? -5.227  100.564 -27.918 1.00 46.37  ? 323  ARG A CD  1 
ATOM   2427 N NE  . ARG A 1 323 ? -6.473  99.895  -27.538 1.00 43.47  ? 323  ARG A NE  1 
ATOM   2428 C CZ  . ARG A 1 323 ? -6.624  99.166  -26.435 1.00 47.32  ? 323  ARG A CZ  1 
ATOM   2429 N NH1 . ARG A 1 323 ? -5.611  99.005  -25.593 1.00 50.91  ? 323  ARG A NH1 1 
ATOM   2430 N NH2 . ARG A 1 323 ? -7.791  98.594  -26.168 1.00 46.88  ? 323  ARG A NH2 1 
ATOM   2431 N N   . ILE A 1 324 ? -5.641  104.875 -26.927 1.00 24.86  ? 324  ILE A N   1 
ATOM   2432 C CA  . ILE A 1 324 ? -6.541  105.597 -26.039 1.00 16.60  ? 324  ILE A CA  1 
ATOM   2433 C C   . ILE A 1 324 ? -7.840  104.827 -25.915 1.00 17.12  ? 324  ILE A C   1 
ATOM   2434 O O   . ILE A 1 324 ? -8.411  104.401 -26.914 1.00 21.46  ? 324  ILE A O   1 
ATOM   2435 C CB  . ILE A 1 324 ? -6.832  107.013 -26.580 1.00 20.56  ? 324  ILE A CB  1 
ATOM   2436 C CG1 . ILE A 1 324 ? -5.652  107.932 -26.265 1.00 25.96  ? 324  ILE A CG1 1 
ATOM   2437 C CG2 . ILE A 1 324 ? -8.108  107.563 -25.965 1.00 23.66  ? 324  ILE A CG2 1 
ATOM   2438 C CD1 . ILE A 1 324 ? -5.927  109.389 -26.516 1.00 27.28  ? 324  ILE A CD1 1 
ATOM   2439 N N   . THR A 1 325 ? -8.310  104.663 -24.684 1.00 15.99  ? 325  THR A N   1 
ATOM   2440 C CA  . THR A 1 325 ? -9.523  103.905 -24.420 1.00 8.92   ? 325  THR A CA  1 
ATOM   2441 C C   . THR A 1 325 ? -10.598 104.762 -23.801 1.00 11.21  ? 325  THR A C   1 
ATOM   2442 O O   . THR A 1 325 ? -10.311 105.773 -23.174 1.00 18.11  ? 325  THR A O   1 
ATOM   2443 C CB  . THR A 1 325 ? -9.237  102.776 -23.443 1.00 12.59  ? 325  THR A CB  1 
ATOM   2444 O OG1 . THR A 1 325 ? -9.033  103.332 -22.142 1.00 18.13  ? 325  THR A OG1 1 
ATOM   2445 C CG2 . THR A 1 325 ? -7.992  102.035 -23.835 1.00 13.82  ? 325  THR A CG2 1 
ATOM   2446 N N   . PRO A 1 326 ? -11.862 104.366 -23.965 1.00 10.25  ? 326  PRO A N   1 
ATOM   2447 C CA  . PRO A 1 326 ? -12.992 105.113 -23.405 1.00 13.11  ? 326  PRO A CA  1 
ATOM   2448 C C   . PRO A 1 326 ? -12.873 105.330 -21.902 1.00 15.39  ? 326  PRO A C   1 
ATOM   2449 O O   . PRO A 1 326 ? -13.398 106.304 -21.369 1.00 25.17  ? 326  PRO A O   1 
ATOM   2450 C CB  . PRO A 1 326 ? -14.203 104.248 -23.752 1.00 8.63   ? 326  PRO A CB  1 
ATOM   2451 C CG  . PRO A 1 326 ? -13.780 103.496 -24.949 1.00 11.33  ? 326  PRO A CG  1 
ATOM   2452 C CD  . PRO A 1 326 ? -12.316 103.198 -24.733 1.00 15.09  ? 326  PRO A CD  1 
ATOM   2453 N N   . GLU A 1 327 ? -12.181 104.418 -21.226 1.00 18.52  ? 327  GLU A N   1 
ATOM   2454 C CA  . GLU A 1 327 ? -12.003 104.489 -19.776 1.00 18.26  ? 327  GLU A CA  1 
ATOM   2455 C C   . GLU A 1 327 ? -10.976 105.541 -19.369 1.00 17.54  ? 327  GLU A C   1 
ATOM   2456 O O   . GLU A 1 327 ? -11.202 106.333 -18.454 1.00 19.21  ? 327  GLU A O   1 
ATOM   2457 C CB  . GLU A 1 327 ? -11.584 103.116 -19.244 1.00 15.88  ? 327  GLU A CB  1 
ATOM   2458 C CG  . GLU A 1 327 ? -12.689 102.066 -19.311 1.00 27.34  ? 327  GLU A CG  1 
ATOM   2459 C CD  . GLU A 1 327 ? -12.714 101.314 -20.635 1.00 37.09  ? 327  GLU A CD  1 
ATOM   2460 O OE1 . GLU A 1 327 ? -13.144 101.903 -21.649 1.00 43.88  ? 327  GLU A OE1 1 
ATOM   2461 O OE2 . GLU A 1 327 ? -12.305 100.133 -20.664 1.00 43.73  ? 327  GLU A OE2 1 
ATOM   2462 N N   . LEU A 1 328 ? -9.844  105.544 -20.056 1.00 11.10  ? 328  LEU A N   1 
ATOM   2463 C CA  . LEU A 1 328 ? -8.793  106.502 -19.773 1.00 12.11  ? 328  LEU A CA  1 
ATOM   2464 C C   . LEU A 1 328 ? -9.299  107.935 -19.915 1.00 11.93  ? 328  LEU A C   1 
ATOM   2465 O O   . LEU A 1 328 ? -8.778  108.845 -19.283 1.00 15.31  ? 328  LEU A O   1 
ATOM   2466 C CB  . LEU A 1 328 ? -7.621  106.280 -20.730 1.00 7.33   ? 328  LEU A CB  1 
ATOM   2467 C CG  . LEU A 1 328 ? -6.382  107.133 -20.494 1.00 5.00   ? 328  LEU A CG  1 
ATOM   2468 C CD1 . LEU A 1 328 ? -5.750  106.718 -19.184 1.00 9.47   ? 328  LEU A CD1 1 
ATOM   2469 C CD2 . LEU A 1 328 ? -5.400  106.960 -21.643 1.00 5.29   ? 328  LEU A CD2 1 
ATOM   2470 N N   . LEU A 1 329 ? -10.320 108.130 -20.744 1.00 15.73  ? 329  LEU A N   1 
ATOM   2471 C CA  . LEU A 1 329 ? -10.869 109.466 -20.988 1.00 17.21  ? 329  LEU A CA  1 
ATOM   2472 C C   . LEU A 1 329 ? -12.043 109.829 -20.099 1.00 16.10  ? 329  LEU A C   1 
ATOM   2473 O O   . LEU A 1 329 ? -12.503 110.969 -20.113 1.00 17.99  ? 329  LEU A O   1 
ATOM   2474 C CB  . LEU A 1 329 ? -11.317 109.604 -22.446 1.00 10.72  ? 329  LEU A CB  1 
ATOM   2475 C CG  . LEU A 1 329 ? -10.269 109.415 -23.543 1.00 16.45  ? 329  LEU A CG  1 
ATOM   2476 C CD1 . LEU A 1 329 ? -10.967 109.315 -24.889 1.00 5.63   ? 329  LEU A CD1 1 
ATOM   2477 C CD2 . LEU A 1 329 ? -9.284  110.571 -23.529 1.00 13.53  ? 329  LEU A CD2 1 
ATOM   2478 N N   . THR A 1 330 ? -12.543 108.864 -19.339 1.00 15.82  ? 330  THR A N   1 
ATOM   2479 C CA  . THR A 1 330 ? -13.676 109.126 -18.470 1.00 13.65  ? 330  THR A CA  1 
ATOM   2480 C C   . THR A 1 330 ? -13.213 109.747 -17.166 1.00 16.03  ? 330  THR A C   1 
ATOM   2481 O O   . THR A 1 330 ? -12.368 109.195 -16.463 1.00 18.91  ? 330  THR A O   1 
ATOM   2482 C CB  . THR A 1 330 ? -14.463 107.845 -18.178 1.00 8.40   ? 330  THR A CB  1 
ATOM   2483 O OG1 . THR A 1 330 ? -14.900 107.269 -19.415 1.00 14.91  ? 330  THR A OG1 1 
ATOM   2484 C CG2 . THR A 1 330 ? -15.680 108.148 -17.329 1.00 5.00   ? 330  THR A CG2 1 
ATOM   2485 N N   . ARG A 1 331 ? -13.770 110.911 -16.861 1.00 16.40  ? 331  ARG A N   1 
ATOM   2486 C CA  . ARG A 1 331 ? -13.432 111.636 -15.651 1.00 19.74  ? 331  ARG A CA  1 
ATOM   2487 C C   . ARG A 1 331 ? -13.680 110.827 -14.382 1.00 16.90  ? 331  ARG A C   1 
ATOM   2488 O O   . ARG A 1 331 ? -14.727 110.206 -14.223 1.00 20.26  ? 331  ARG A O   1 
ATOM   2489 C CB  . ARG A 1 331 ? -14.237 112.927 -15.600 1.00 18.30  ? 331  ARG A CB  1 
ATOM   2490 C CG  . ARG A 1 331 ? -15.096 113.081 -14.382 1.00 23.31  ? 331  ARG A CG  1 
ATOM   2491 C CD  . ARG A 1 331 ? -15.879 114.360 -14.477 1.00 40.64  ? 331  ARG A CD  1 
ATOM   2492 N NE  . ARG A 1 331 ? -15.523 115.296 -13.422 1.00 50.17  ? 331  ARG A NE  1 
ATOM   2493 C CZ  . ARG A 1 331 ? -16.142 115.342 -12.252 1.00 58.60  ? 331  ARG A CZ  1 
ATOM   2494 N NH1 . ARG A 1 331 ? -17.144 114.502 -12.008 1.00 61.99  ? 331  ARG A NH1 1 
ATOM   2495 N NH2 . ARG A 1 331 ? -15.767 116.227 -11.337 1.00 60.16  ? 331  ARG A NH2 1 
ATOM   2496 N N   . GLY A 1 332 ? -12.702 110.829 -13.487 1.00 15.10  ? 332  GLY A N   1 
ATOM   2497 C CA  . GLY A 1 332 ? -12.854 110.116 -12.232 1.00 15.54  ? 332  GLY A CA  1 
ATOM   2498 C C   . GLY A 1 332 ? -12.429 108.666 -12.198 1.00 17.06  ? 332  GLY A C   1 
ATOM   2499 O O   . GLY A 1 332 ? -12.603 108.002 -11.178 1.00 20.27  ? 332  GLY A O   1 
ATOM   2500 N N   . LYS A 1 333 ? -11.866 108.169 -13.294 1.00 18.19  ? 333  LYS A N   1 
ATOM   2501 C CA  . LYS A 1 333 ? -11.433 106.777 -13.368 1.00 15.40  ? 333  LYS A CA  1 
ATOM   2502 C C   . LYS A 1 333 ? -10.093 106.504 -12.691 1.00 17.52  ? 333  LYS A C   1 
ATOM   2503 O O   . LYS A 1 333 ? -9.786  105.357 -12.361 1.00 23.11  ? 333  LYS A O   1 
ATOM   2504 C CB  . LYS A 1 333 ? -11.357 106.329 -14.824 1.00 17.48  ? 333  LYS A CB  1 
ATOM   2505 C CG  . LYS A 1 333 ? -12.706 106.050 -15.452 1.00 22.28  ? 333  LYS A CG  1 
ATOM   2506 C CD  . LYS A 1 333 ? -13.577 105.217 -14.547 1.00 17.10  ? 333  LYS A CD  1 
ATOM   2507 C CE  . LYS A 1 333 ? -14.839 104.789 -15.254 1.00 26.97  ? 333  LYS A CE  1 
ATOM   2508 N NZ  . LYS A 1 333 ? -15.086 103.338 -15.038 1.00 42.26  ? 333  LYS A NZ  1 
ATOM   2509 N N   . PHE A 1 334 ? -9.290  107.548 -12.502 1.00 12.67  ? 334  PHE A N   1 
ATOM   2510 C CA  . PHE A 1 334 ? -7.991  107.410 -11.851 1.00 6.96   ? 334  PHE A CA  1 
ATOM   2511 C C   . PHE A 1 334 ? -8.064  108.177 -10.541 1.00 9.75   ? 334  PHE A C   1 
ATOM   2512 O O   . PHE A 1 334 ? -7.941  109.398 -10.519 1.00 12.98  ? 334  PHE A O   1 
ATOM   2513 C CB  . PHE A 1 334 ? -6.885  107.984 -12.730 1.00 5.00   ? 334  PHE A CB  1 
ATOM   2514 C CG  . PHE A 1 334 ? -5.527  107.430 -12.433 1.00 5.56   ? 334  PHE A CG  1 
ATOM   2515 C CD1 . PHE A 1 334 ? -4.738  107.990 -11.438 1.00 10.90  ? 334  PHE A CD1 1 
ATOM   2516 C CD2 . PHE A 1 334 ? -5.030  106.353 -13.155 1.00 8.65   ? 334  PHE A CD2 1 
ATOM   2517 C CE1 . PHE A 1 334 ? -3.468  107.482 -11.165 1.00 14.38  ? 334  PHE A CE1 1 
ATOM   2518 C CE2 . PHE A 1 334 ? -3.762  105.834 -12.891 1.00 14.23  ? 334  PHE A CE2 1 
ATOM   2519 C CZ  . PHE A 1 334 ? -2.979  106.398 -11.896 1.00 14.50  ? 334  PHE A CZ  1 
ATOM   2520 N N   . ASN A 1 335 ? -8.271  107.443 -9.454  1.00 7.63   ? 335  ASN A N   1 
ATOM   2521 C CA  . ASN A 1 335 ? -8.403  108.022 -8.130  1.00 12.91  ? 335  ASN A CA  1 
ATOM   2522 C C   . ASN A 1 335 ? -7.081  108.312 -7.465  1.00 11.73  ? 335  ASN A C   1 
ATOM   2523 O O   . ASN A 1 335 ? -6.062  107.719 -7.805  1.00 13.36  ? 335  ASN A O   1 
ATOM   2524 C CB  . ASN A 1 335 ? -9.202  107.083 -7.226  1.00 24.28  ? 335  ASN A CB  1 
ATOM   2525 C CG  . ASN A 1 335 ? -10.664 107.056 -7.578  1.00 36.27  ? 335  ASN A CG  1 
ATOM   2526 O OD1 . ASN A 1 335 ? -11.370 108.050 -7.400  1.00 46.65  ? 335  ASN A OD1 1 
ATOM   2527 N ND2 . ASN A 1 335 ? -11.133 105.919 -8.091  1.00 41.66  ? 335  ASN A ND2 1 
ATOM   2528 N N   . THR A 1 336 ? -7.113  109.227 -6.502  1.00 12.51  ? 336  THR A N   1 
ATOM   2529 C CA  . THR A 1 336 ? -5.923  109.579 -5.747  1.00 12.35  ? 336  THR A CA  1 
ATOM   2530 C C   . THR A 1 336 ? -5.424  108.352 -4.987  1.00 9.31   ? 336  THR A C   1 
ATOM   2531 O O   . THR A 1 336 ? -4.268  108.293 -4.591  1.00 12.54  ? 336  THR A O   1 
ATOM   2532 C CB  . THR A 1 336 ? -6.214  110.692 -4.738  1.00 11.02  ? 336  THR A CB  1 
ATOM   2533 O OG1 . THR A 1 336 ? -6.603  111.873 -5.441  1.00 11.39  ? 336  THR A OG1 1 
ATOM   2534 C CG2 . THR A 1 336 ? -4.979  110.987 -3.894  1.00 12.16  ? 336  THR A CG2 1 
ATOM   2535 N N   . SER A 1 337 ? -6.295  107.371 -4.785  1.00 9.29   ? 337  SER A N   1 
ATOM   2536 C CA  . SER A 1 337 ? -5.896  106.167 -4.085  1.00 7.73   ? 337  SER A CA  1 
ATOM   2537 C C   . SER A 1 337 ? -5.043  105.286 -4.995  1.00 13.87  ? 337  SER A C   1 
ATOM   2538 O O   . SER A 1 337 ? -4.326  104.409 -4.516  1.00 23.80  ? 337  SER A O   1 
ATOM   2539 C CB  . SER A 1 337 ? -7.121  105.405 -3.597  1.00 5.00   ? 337  SER A CB  1 
ATOM   2540 O OG  . SER A 1 337 ? -7.694  104.663 -4.648  1.00 21.88  ? 337  SER A OG  1 
ATOM   2541 N N   . ASP A 1 338 ? -5.120  105.510 -6.306  1.00 13.43  ? 338  ASP A N   1 
ATOM   2542 C CA  . ASP A 1 338 ? -4.301  104.742 -7.245  1.00 8.19   ? 338  ASP A CA  1 
ATOM   2543 C C   . ASP A 1 338 ? -2.933  105.382 -7.263  1.00 10.08  ? 338  ASP A C   1 
ATOM   2544 O O   . ASP A 1 338 ? -1.928  104.716 -7.505  1.00 17.45  ? 338  ASP A O   1 
ATOM   2545 C CB  . ASP A 1 338 ? -4.876  104.791 -8.648  1.00 7.78   ? 338  ASP A CB  1 
ATOM   2546 C CG  . ASP A 1 338 ? -6.276  104.270 -8.704  1.00 14.06  ? 338  ASP A CG  1 
ATOM   2547 O OD1 . ASP A 1 338 ? -6.500  103.143 -8.218  1.00 21.71  ? 338  ASP A OD1 1 
ATOM   2548 O OD2 . ASP A 1 338 ? -7.155  104.988 -9.224  1.00 21.54  ? 338  ASP A OD2 1 
ATOM   2549 N N   . VAL A 1 339 ? -2.908  106.689 -7.016  1.00 8.38   ? 339  VAL A N   1 
ATOM   2550 C CA  . VAL A 1 339 ? -1.660  107.437 -6.979  1.00 6.60   ? 339  VAL A CA  1 
ATOM   2551 C C   . VAL A 1 339 ? -0.811  106.894 -5.837  1.00 7.39   ? 339  VAL A C   1 
ATOM   2552 O O   . VAL A 1 339 ? 0.396   106.740 -5.973  1.00 14.98  ? 339  VAL A O   1 
ATOM   2553 C CB  . VAL A 1 339 ? -1.934  108.939 -6.760  1.00 5.46   ? 339  VAL A CB  1 
ATOM   2554 C CG1 . VAL A 1 339 ? -0.632  109.698 -6.581  1.00 5.00   ? 339  VAL A CG1 1 
ATOM   2555 C CG2 . VAL A 1 339 ? -2.707  109.487 -7.943  1.00 5.00   ? 339  VAL A CG2 1 
ATOM   2556 N N   . SER A 1 340 ? -1.457  106.591 -4.716  1.00 8.60   ? 340  SER A N   1 
ATOM   2557 C CA  . SER A 1 340 ? -0.771  106.064 -3.545  1.00 7.67   ? 340  SER A CA  1 
ATOM   2558 C C   . SER A 1 340 ? -0.335  104.626 -3.775  1.00 8.13   ? 340  SER A C   1 
ATOM   2559 O O   . SER A 1 340 ? 0.808   104.262 -3.520  1.00 13.79  ? 340  SER A O   1 
ATOM   2560 C CB  . SER A 1 340 ? -1.692  106.131 -2.330  1.00 5.00   ? 340  SER A CB  1 
ATOM   2561 O OG  . SER A 1 340 ? -2.107  107.461 -2.086  1.00 12.38  ? 340  SER A OG  1 
ATOM   2562 N N   . ALA A 1 341 ? -1.257  103.804 -4.251  1.00 6.67   ? 341  ALA A N   1 
ATOM   2563 C CA  . ALA A 1 341 ? -0.947  102.412 -4.512  1.00 5.00   ? 341  ALA A CA  1 
ATOM   2564 C C   . ALA A 1 341 ? 0.270   102.307 -5.419  1.00 11.45  ? 341  ALA A C   1 
ATOM   2565 O O   . ALA A 1 341 ? 1.151   101.477 -5.211  1.00 15.14  ? 341  ALA A O   1 
ATOM   2566 C CB  . ALA A 1 341 ? -2.129  101.749 -5.162  1.00 5.00   ? 341  ALA A CB  1 
ATOM   2567 N N   . ILE A 1 342 ? 0.316   103.173 -6.425  1.00 15.19  ? 342  ILE A N   1 
ATOM   2568 C CA  . ILE A 1 342 ? 1.404   103.169 -7.392  1.00 12.25  ? 342  ILE A CA  1 
ATOM   2569 C C   . ILE A 1 342 ? 2.738   103.624 -6.809  1.00 12.62  ? 342  ILE A C   1 
ATOM   2570 O O   . ILE A 1 342 ? 3.796   103.161 -7.237  1.00 14.70  ? 342  ILE A O   1 
ATOM   2571 C CB  . ILE A 1 342 ? 1.028   104.039 -8.627  1.00 10.11  ? 342  ILE A CB  1 
ATOM   2572 C CG1 . ILE A 1 342 ? -0.072  103.335 -9.431  1.00 5.76   ? 342  ILE A CG1 1 
ATOM   2573 C CG2 . ILE A 1 342 ? 2.244   104.286 -9.507  1.00 5.00   ? 342  ILE A CG2 1 
ATOM   2574 C CD1 . ILE A 1 342 ? -0.497  104.072 -10.670 1.00 7.28   ? 342  ILE A CD1 1 
ATOM   2575 N N   . GLU A 1 343 ? 2.702   104.510 -5.823  1.00 8.86   ? 343  GLU A N   1 
ATOM   2576 C CA  . GLU A 1 343 ? 3.944   104.997 -5.229  1.00 11.03  ? 343  GLU A CA  1 
ATOM   2577 C C   . GLU A 1 343 ? 4.469   104.189 -4.032  1.00 13.28  ? 343  GLU A C   1 
ATOM   2578 O O   . GLU A 1 343 ? 5.375   104.635 -3.329  1.00 15.20  ? 343  GLU A O   1 
ATOM   2579 C CB  . GLU A 1 343 ? 3.791   106.461 -4.824  1.00 7.34   ? 343  GLU A CB  1 
ATOM   2580 C CG  . GLU A 1 343 ? 3.587   107.398 -5.976  1.00 5.57   ? 343  GLU A CG  1 
ATOM   2581 C CD  . GLU A 1 343 ? 3.678   108.841 -5.543  1.00 16.32  ? 343  GLU A CD  1 
ATOM   2582 O OE1 . GLU A 1 343 ? 4.793   109.271 -5.173  1.00 14.30  ? 343  GLU A OE1 1 
ATOM   2583 O OE2 . GLU A 1 343 ? 2.640   109.541 -5.569  1.00 14.70  ? 343  GLU A OE2 1 
ATOM   2584 N N   . LYS A 1 344 ? 3.901   103.012 -3.786  1.00 13.36  ? 344  LYS A N   1 
ATOM   2585 C CA  . LYS A 1 344 ? 4.375   102.178 -2.688  1.00 13.74  ? 344  LYS A CA  1 
ATOM   2586 C C   . LYS A 1 344 ? 5.772   101.717 -3.060  1.00 22.22  ? 344  LYS A C   1 
ATOM   2587 O O   . LYS A 1 344 ? 6.056   101.502 -4.230  1.00 31.24  ? 344  LYS A O   1 
ATOM   2588 C CB  . LYS A 1 344 ? 3.470   100.965 -2.508  1.00 5.83   ? 344  LYS A CB  1 
ATOM   2589 C CG  . LYS A 1 344 ? 2.088   101.306 -1.974  1.00 5.00   ? 344  LYS A CG  1 
ATOM   2590 C CD  . LYS A 1 344 ? 1.514   100.158 -1.170  1.00 7.56   ? 344  LYS A CD  1 
ATOM   2591 C CE  . LYS A 1 344 ? 0.289   100.596 -0.388  1.00 20.64  ? 344  LYS A CE  1 
ATOM   2592 N NZ  . LYS A 1 344 ? -0.960  99.956  -0.901  1.00 37.11  ? 344  LYS A NZ  1 
ATOM   2593 N N   . ASN A 1 345 ? 6.654   101.568 -2.081  1.00 35.50  ? 345  ASN A N   1 
ATOM   2594 C CA  . ASN A 1 345 ? 8.015   101.134 -2.383  1.00 41.50  ? 345  ASN A CA  1 
ATOM   2595 C C   . ASN A 1 345 ? 8.054   99.696  -2.879  1.00 44.00  ? 345  ASN A C   1 
ATOM   2596 O O   . ASN A 1 345 ? 8.729   99.372  -3.856  1.00 48.75  ? 345  ASN A O   1 
ATOM   2597 C CB  . ASN A 1 345 ? 8.902   101.250 -1.146  1.00 41.55  ? 345  ASN A CB  1 
ATOM   2598 C CG  . ASN A 1 345 ? 9.156   102.677 -0.755  1.00 48.41  ? 345  ASN A CG  1 
ATOM   2599 O OD1 . ASN A 1 345 ? 8.561   103.181 0.201   1.00 54.47  ? 345  ASN A OD1 1 
ATOM   2600 N ND2 . ASN A 1 345 ? 10.044  103.347 -1.488  1.00 50.99  ? 345  ASN A ND2 1 
ATOM   2601 N N   . LYS A 1 346 ? 7.320   98.833  -2.196  1.00 43.49  ? 346  LYS A N   1 
ATOM   2602 C CA  . LYS A 1 346 ? 7.303   97.429  -2.555  1.00 49.09  ? 346  LYS A CA  1 
ATOM   2603 C C   . LYS A 1 346 ? 6.616   97.157  -3.886  1.00 45.21  ? 346  LYS A C   1 
ATOM   2604 O O   . LYS A 1 346 ? 7.268   96.977  -4.913  1.00 43.35  ? 346  LYS A O   1 
ATOM   2605 C CB  . LYS A 1 346 ? 6.617   96.616  -1.443  1.00 61.78  ? 346  LYS A CB  1 
ATOM   2606 C CG  . LYS A 1 346 ? 5.428   97.328  -0.778  1.00 66.85  ? 346  LYS A CG  1 
ATOM   2607 C CD  . LYS A 1 346 ? 5.356   97.044  0.725   1.00 67.90  ? 346  LYS A CD  1 
ATOM   2608 C CE  . LYS A 1 346 ? 4.116   97.681  1.355   1.00 68.86  ? 346  LYS A CE  1 
ATOM   2609 N NZ  . LYS A 1 346 ? 3.166   96.677  1.937   1.00 67.17  ? 346  LYS A NZ  1 
ATOM   2610 N N   . GLU A 1 347 ? 5.290   97.163  -3.852  1.00 38.11  ? 347  GLU A N   1 
ATOM   2611 C CA  . GLU A 1 347 ? 4.465   96.851  -5.004  1.00 32.76  ? 347  GLU A CA  1 
ATOM   2612 C C   . GLU A 1 347 ? 4.007   98.014  -5.876  1.00 27.00  ? 347  GLU A C   1 
ATOM   2613 O O   . GLU A 1 347 ? 2.958   97.940  -6.504  1.00 27.34  ? 347  GLU A O   1 
ATOM   2614 C CB  . GLU A 1 347 ? 3.249   96.083  -4.500  1.00 46.42  ? 347  GLU A CB  1 
ATOM   2615 C CG  . GLU A 1 347 ? 3.233   95.942  -2.986  1.00 56.49  ? 347  GLU A CG  1 
ATOM   2616 C CD  . GLU A 1 347 ? 1.912   96.355  -2.369  1.00 72.10  ? 347  GLU A CD  1 
ATOM   2617 O OE1 . GLU A 1 347 ? 1.077   96.968  -3.075  1.00 73.68  ? 347  GLU A OE1 1 
ATOM   2618 O OE2 . GLU A 1 347 ? 1.710   96.061  -1.170  1.00 80.75  ? 347  GLU A OE2 1 
ATOM   2619 N N   . GLY A 1 348 ? 4.788   99.081  -5.933  1.00 21.91  ? 348  GLY A N   1 
ATOM   2620 C CA  . GLY A 1 348 ? 4.388   100.223 -6.737  1.00 18.08  ? 348  GLY A CA  1 
ATOM   2621 C C   . GLY A 1 348 ? 4.126   99.944  -8.205  1.00 16.91  ? 348  GLY A C   1 
ATOM   2622 O O   . GLY A 1 348 ? 3.035   100.207 -8.713  1.00 16.05  ? 348  GLY A O   1 
ATOM   2623 N N   . LEU A 1 349 ? 5.128   99.406  -8.891  1.00 16.42  ? 349  LEU A N   1 
ATOM   2624 C CA  . LEU A 1 349 ? 5.022   99.111  -10.314 1.00 14.92  ? 349  LEU A CA  1 
ATOM   2625 C C   . LEU A 1 349 ? 4.069   97.965  -10.651 1.00 19.35  ? 349  LEU A C   1 
ATOM   2626 O O   . LEU A 1 349 ? 3.565   97.879  -11.769 1.00 25.38  ? 349  LEU A O   1 
ATOM   2627 C CB  . LEU A 1 349 ? 6.407   98.822  -10.884 1.00 10.97  ? 349  LEU A CB  1 
ATOM   2628 C CG  . LEU A 1 349 ? 7.392   99.992  -10.910 1.00 13.01  ? 349  LEU A CG  1 
ATOM   2629 C CD1 . LEU A 1 349 ? 8.727   99.487  -11.394 1.00 17.52  ? 349  LEU A CD1 1 
ATOM   2630 C CD2 . LEU A 1 349 ? 6.898   101.100 -11.826 1.00 16.73  ? 349  LEU A CD2 1 
ATOM   2631 N N   . HIS A 1 350 ? 3.824   97.076  -9.699  1.00 21.52  ? 350  HIS A N   1 
ATOM   2632 C CA  . HIS A 1 350 ? 2.899   95.978  -9.943  1.00 23.42  ? 350  HIS A CA  1 
ATOM   2633 C C   . HIS A 1 350 ? 1.490   96.539  -9.835  1.00 23.36  ? 350  HIS A C   1 
ATOM   2634 O O   . HIS A 1 350 ? 0.589   96.149  -10.575 1.00 25.70  ? 350  HIS A O   1 
ATOM   2635 C CB  . HIS A 1 350 ? 3.096   94.868  -8.915  1.00 34.44  ? 350  HIS A CB  1 
ATOM   2636 C CG  . HIS A 1 350 ? 1.904   93.978  -8.751  1.00 52.69  ? 350  HIS A CG  1 
ATOM   2637 N ND1 . HIS A 1 350 ? 1.562   93.013  -9.675  1.00 61.21  ? 350  HIS A ND1 1 
ATOM   2638 C CD2 . HIS A 1 350 ? 0.976   93.904  -7.768  1.00 59.14  ? 350  HIS A CD2 1 
ATOM   2639 C CE1 . HIS A 1 350 ? 0.474   92.383  -9.267  1.00 65.58  ? 350  HIS A CE1 1 
ATOM   2640 N NE2 . HIS A 1 350 ? 0.098   92.904  -8.112  1.00 62.00  ? 350  HIS A NE2 1 
ATOM   2641 N N   . ASN A 1 351 ? 1.311   97.461  -8.897  1.00 25.44  ? 351  ASN A N   1 
ATOM   2642 C CA  . ASN A 1 351 ? 0.023   98.108  -8.690  1.00 22.35  ? 351  ASN A CA  1 
ATOM   2643 C C   . ASN A 1 351 ? -0.304  98.918  -9.931  1.00 21.84  ? 351  ASN A C   1 
ATOM   2644 O O   . ASN A 1 351 ? -1.454  98.969  -10.368 1.00 16.90  ? 351  ASN A O   1 
ATOM   2645 C CB  . ASN A 1 351 ? 0.093   99.029  -7.477  1.00 22.27  ? 351  ASN A CB  1 
ATOM   2646 C CG  . ASN A 1 351 ? 0.068   98.265  -6.178  1.00 22.54  ? 351  ASN A CG  1 
ATOM   2647 O OD1 . ASN A 1 351 ? -0.223  97.062  -6.160  1.00 18.40  ? 351  ASN A OD1 1 
ATOM   2648 N ND2 . ASN A 1 351 ? 0.376   98.949  -5.079  1.00 12.42  ? 351  ASN A ND2 1 
ATOM   2649 N N   . ALA A 1 352 ? 0.723   99.554  -10.488 1.00 21.97  ? 352  ALA A N   1 
ATOM   2650 C CA  . ALA A 1 352 ? 0.569   100.352 -11.694 1.00 20.17  ? 352  ALA A CA  1 
ATOM   2651 C C   . ALA A 1 352 ? 0.008   99.465  -12.804 1.00 23.24  ? 352  ALA A C   1 
ATOM   2652 O O   . ALA A 1 352 ? -1.065  99.748  -13.343 1.00 25.01  ? 352  ALA A O   1 
ATOM   2653 C CB  . ALA A 1 352 ? 1.912   100.937 -12.110 1.00 17.62  ? 352  ALA A CB  1 
ATOM   2654 N N   . LYS A 1 353 ? 0.723   98.387  -13.133 1.00 21.70  ? 353  LYS A N   1 
ATOM   2655 C CA  . LYS A 1 353 ? 0.279   97.471  -14.183 1.00 19.63  ? 353  LYS A CA  1 
ATOM   2656 C C   . LYS A 1 353 ? -1.166  97.019  -13.988 1.00 20.55  ? 353  LYS A C   1 
ATOM   2657 O O   . LYS A 1 353 ? -1.938  96.970  -14.942 1.00 23.68  ? 353  LYS A O   1 
ATOM   2658 C CB  . LYS A 1 353 ? 1.179   96.242  -14.246 1.00 14.34  ? 353  LYS A CB  1 
ATOM   2659 C CG  . LYS A 1 353 ? 0.646   95.153  -15.163 1.00 18.71  ? 353  LYS A CG  1 
ATOM   2660 C CD  . LYS A 1 353 ? 1.770   94.317  -15.776 1.00 28.02  ? 353  LYS A CD  1 
ATOM   2661 C CE  . LYS A 1 353 ? 2.779   95.189  -16.537 1.00 36.79  ? 353  LYS A CE  1 
ATOM   2662 N NZ  . LYS A 1 353 ? 3.269   94.556  -17.804 1.00 36.48  ? 353  LYS A NZ  1 
ATOM   2663 N N   . GLU A 1 354 ? -1.530  96.684  -12.756 1.00 17.45  ? 354  GLU A N   1 
ATOM   2664 C CA  . GLU A 1 354 ? -2.888  96.248  -12.477 1.00 15.58  ? 354  GLU A CA  1 
ATOM   2665 C C   . GLU A 1 354 ? -3.870  97.371  -12.753 1.00 13.97  ? 354  GLU A C   1 
ATOM   2666 O O   . GLU A 1 354 ? -4.827  97.195  -13.496 1.00 19.96  ? 354  GLU A O   1 
ATOM   2667 C CB  . GLU A 1 354 ? -3.018  95.807  -11.023 1.00 25.60  ? 354  GLU A CB  1 
ATOM   2668 C CG  . GLU A 1 354 ? -2.483  94.414  -10.740 1.00 45.22  ? 354  GLU A CG  1 
ATOM   2669 C CD  . GLU A 1 354 ? -3.298  93.675  -9.688  1.00 57.26  ? 354  GLU A CD  1 
ATOM   2670 O OE1 . GLU A 1 354 ? -3.959  94.345  -8.859  1.00 61.52  ? 354  GLU A OE1 1 
ATOM   2671 O OE2 . GLU A 1 354 ? -3.275  92.422  -9.691  1.00 65.69  ? 354  GLU A OE2 1 
ATOM   2672 N N   . ILE A 1 355 ? -3.622  98.530  -12.155 1.00 12.98  ? 355  ILE A N   1 
ATOM   2673 C CA  . ILE A 1 355 ? -4.493  99.687  -12.319 1.00 12.94  ? 355  ILE A CA  1 
ATOM   2674 C C   . ILE A 1 355 ? -4.675  100.064 -13.787 1.00 16.08  ? 355  ILE A C   1 
ATOM   2675 O O   . ILE A 1 355 ? -5.790  100.087 -14.301 1.00 17.48  ? 355  ILE A O   1 
ATOM   2676 C CB  . ILE A 1 355 ? -3.929  100.907 -11.561 1.00 15.11  ? 355  ILE A CB  1 
ATOM   2677 C CG1 . ILE A 1 355 ? -4.160  100.733 -10.060 1.00 17.02  ? 355  ILE A CG1 1 
ATOM   2678 C CG2 . ILE A 1 355 ? -4.575  102.192 -12.072 1.00 14.42  ? 355  ILE A CG2 1 
ATOM   2679 C CD1 . ILE A 1 355 ? -3.010  101.255 -9.197  1.00 21.75  ? 355  ILE A CD1 1 
ATOM   2680 N N   . LEU A 1 356 ? -3.571  100.369 -14.458 1.00 16.29  ? 356  LEU A N   1 
ATOM   2681 C CA  . LEU A 1 356 ? -3.613  100.746 -15.860 1.00 15.46  ? 356  LEU A CA  1 
ATOM   2682 C C   . LEU A 1 356 ? -4.343  99.697  -16.698 1.00 19.57  ? 356  LEU A C   1 
ATOM   2683 O O   . LEU A 1 356 ? -5.185  100.025 -17.534 1.00 23.31  ? 356  LEU A O   1 
ATOM   2684 C CB  . LEU A 1 356 ? -2.191  100.936 -16.374 1.00 7.43   ? 356  LEU A CB  1 
ATOM   2685 C CG  . LEU A 1 356 ? -1.513  102.171 -15.786 1.00 13.43  ? 356  LEU A CG  1 
ATOM   2686 C CD1 . LEU A 1 356 ? -0.061  102.218 -16.217 1.00 6.05   ? 356  LEU A CD1 1 
ATOM   2687 C CD2 . LEU A 1 356 ? -2.272  103.428 -16.228 1.00 6.77   ? 356  LEU A CD2 1 
ATOM   2688 N N   . THR A 1 357 ? -4.015  98.431  -16.466 1.00 21.68  ? 357  THR A N   1 
ATOM   2689 C CA  . THR A 1 357 ? -4.643  97.337  -17.186 1.00 17.61  ? 357  THR A CA  1 
ATOM   2690 C C   . THR A 1 357 ? -6.151  97.399  -16.990 1.00 19.92  ? 357  THR A C   1 
ATOM   2691 O O   . THR A 1 357 ? -6.910  97.174  -17.928 1.00 24.24  ? 357  THR A O   1 
ATOM   2692 C CB  . THR A 1 357 ? -4.123  95.975  -16.685 1.00 16.25  ? 357  THR A CB  1 
ATOM   2693 O OG1 . THR A 1 357 ? -2.774  95.782  -17.132 1.00 17.36  ? 357  THR A OG1 1 
ATOM   2694 C CG2 . THR A 1 357 ? -4.985  94.853  -17.211 1.00 16.39  ? 357  THR A CG2 1 
ATOM   2695 N N   . ARG A 1 358 ? -6.591  97.715  -15.777 1.00 22.82  ? 358  ARG A N   1 
ATOM   2696 C CA  . ARG A 1 358 ? -8.024  97.791  -15.501 1.00 29.67  ? 358  ARG A CA  1 
ATOM   2697 C C   . ARG A 1 358 ? -8.674  98.917  -16.294 1.00 31.33  ? 358  ARG A C   1 
ATOM   2698 O O   . ARG A 1 358 ? -9.898  98.957  -16.453 1.00 34.19  ? 358  ARG A O   1 
ATOM   2699 C CB  . ARG A 1 358 ? -8.263  97.997  -14.006 1.00 33.36  ? 358  ARG A CB  1 
ATOM   2700 C CG  . ARG A 1 358 ? -7.707  96.866  -13.149 1.00 53.29  ? 358  ARG A CG  1 
ATOM   2701 C CD  . ARG A 1 358 ? -8.485  96.699  -11.848 1.00 66.38  ? 358  ARG A CD  1 
ATOM   2702 N NE  . ARG A 1 358 ? -7.770  95.873  -10.876 1.00 70.57  ? 358  ARG A NE  1 
ATOM   2703 C CZ  . ARG A 1 358 ? -7.140  96.354  -9.808  1.00 73.60  ? 358  ARG A CZ  1 
ATOM   2704 N NH1 . ARG A 1 358 ? -7.136  97.660  -9.574  1.00 75.29  ? 358  ARG A NH1 1 
ATOM   2705 N NH2 . ARG A 1 358 ? -6.512  95.532  -8.975  1.00 75.09  ? 358  ARG A NH2 1 
ATOM   2706 N N   . LEU A 1 359 ? -7.834  99.820  -16.794 1.00 31.15  ? 359  LEU A N   1 
ATOM   2707 C CA  . LEU A 1 359 ? -8.275  100.966 -17.576 1.00 24.41  ? 359  LEU A CA  1 
ATOM   2708 C C   . LEU A 1 359 ? -8.409  100.616 -19.050 1.00 25.76  ? 359  LEU A C   1 
ATOM   2709 O O   . LEU A 1 359 ? -8.644  101.490 -19.880 1.00 29.46  ? 359  LEU A O   1 
ATOM   2710 C CB  . LEU A 1 359 ? -7.277  102.115 -17.428 1.00 15.02  ? 359  LEU A CB  1 
ATOM   2711 C CG  . LEU A 1 359 ? -7.454  103.006 -16.203 1.00 9.72   ? 359  LEU A CG  1 
ATOM   2712 C CD1 . LEU A 1 359 ? -6.639  104.282 -16.364 1.00 8.25   ? 359  LEU A CD1 1 
ATOM   2713 C CD2 . LEU A 1 359 ? -8.913  103.331 -16.031 1.00 5.17   ? 359  LEU A CD2 1 
ATOM   2714 N N   . GLY A 1 360 ? -8.252  99.339  -19.374 1.00 26.78  ? 360  GLY A N   1 
ATOM   2715 C CA  . GLY A 1 360 ? -8.363  98.914  -20.758 1.00 31.60  ? 360  GLY A CA  1 
ATOM   2716 C C   . GLY A 1 360 ? -7.061  99.026  -21.530 1.00 33.06  ? 360  GLY A C   1 
ATOM   2717 O O   . GLY A 1 360 ? -6.922  98.472  -22.620 1.00 36.37  ? 360  GLY A O   1 
ATOM   2718 N N   . VAL A 1 361 ? -6.107  99.764  -20.979 1.00 28.84  ? 361  VAL A N   1 
ATOM   2719 C CA  . VAL A 1 361 ? -4.824  99.912  -21.633 1.00 25.60  ? 361  VAL A CA  1 
ATOM   2720 C C   . VAL A 1 361 ? -4.058  98.609  -21.443 1.00 35.28  ? 361  VAL A C   1 
ATOM   2721 O O   . VAL A 1 361 ? -4.431  97.767  -20.617 1.00 37.01  ? 361  VAL A O   1 
ATOM   2722 C CB  . VAL A 1 361 ? -4.010  101.060 -21.007 1.00 18.97  ? 361  VAL A CB  1 
ATOM   2723 C CG1 . VAL A 1 361 ? -2.807  101.364 -21.854 1.00 21.69  ? 361  VAL A CG1 1 
ATOM   2724 C CG2 . VAL A 1 361 ? -4.862  102.293 -20.902 1.00 16.32  ? 361  VAL A CG2 1 
ATOM   2725 N N   . GLU A 1 362 ? -3.007  98.430  -22.235 1.00 39.19  ? 362  GLU A N   1 
ATOM   2726 C CA  . GLU A 1 362 ? -2.142  97.258  -22.137 1.00 41.88  ? 362  GLU A CA  1 
ATOM   2727 C C   . GLU A 1 362 ? -0.782  97.902  -21.886 1.00 41.23  ? 362  GLU A C   1 
ATOM   2728 O O   . GLU A 1 362 ? -0.046  98.220  -22.823 1.00 47.75  ? 362  GLU A O   1 
ATOM   2729 C CB  . GLU A 1 362 ? -2.146  96.475  -23.447 1.00 46.01  ? 362  GLU A CB  1 
ATOM   2730 C CG  . GLU A 1 362 ? -2.155  94.966  -23.265 1.00 50.58  ? 362  GLU A CG  1 
ATOM   2731 C CD  . GLU A 1 362 ? -3.205  94.510  -22.273 1.00 56.82  ? 362  GLU A CD  1 
ATOM   2732 O OE1 . GLU A 1 362 ? -4.198  95.248  -22.081 1.00 56.98  ? 362  GLU A OE1 1 
ATOM   2733 O OE2 . GLU A 1 362 ? -3.039  93.415  -21.687 1.00 61.14  ? 362  GLU A OE2 1 
ATOM   2734 N N   . PRO A 1 363 ? -0.428  98.092  -20.608 1.00 35.32  ? 363  PRO A N   1 
ATOM   2735 C CA  . PRO A 1 363 ? 0.838   98.720  -20.241 1.00 25.32  ? 363  PRO A CA  1 
ATOM   2736 C C   . PRO A 1 363 ? 2.097   97.891  -20.401 1.00 24.09  ? 363  PRO A C   1 
ATOM   2737 O O   . PRO A 1 363 ? 2.113   96.688  -20.150 1.00 25.40  ? 363  PRO A O   1 
ATOM   2738 C CB  . PRO A 1 363 ? 0.610   99.124  -18.793 1.00 20.94  ? 363  PRO A CB  1 
ATOM   2739 C CG  . PRO A 1 363 ? -0.292  98.049  -18.272 1.00 23.10  ? 363  PRO A CG  1 
ATOM   2740 C CD  . PRO A 1 363 ? -1.192  97.671  -19.419 1.00 31.54  ? 363  PRO A CD  1 
ATOM   2741 N N   . SER A 1 364 ? 3.152   98.564  -20.835 1.00 20.12  ? 364  SER A N   1 
ATOM   2742 C CA  . SER A 1 364 ? 4.453   97.948  -21.002 1.00 21.85  ? 364  SER A CA  1 
ATOM   2743 C C   . SER A 1 364 ? 5.224   98.285  -19.731 1.00 26.08  ? 364  SER A C   1 
ATOM   2744 O O   . SER A 1 364 ? 4.869   99.225  -19.024 1.00 29.85  ? 364  SER A O   1 
ATOM   2745 C CB  . SER A 1 364 ? 5.165   98.559  -22.198 1.00 26.26  ? 364  SER A CB  1 
ATOM   2746 O OG  . SER A 1 364 ? 5.912   99.701  -21.811 1.00 29.05  ? 364  SER A OG  1 
ATOM   2747 N N   . ASP A 1 365 ? 6.276   97.539  -19.432 1.00 28.30  ? 365  ASP A N   1 
ATOM   2748 C CA  . ASP A 1 365 ? 7.035   97.829  -18.227 1.00 29.71  ? 365  ASP A CA  1 
ATOM   2749 C C   . ASP A 1 365 ? 7.474   99.278  -18.255 1.00 28.01  ? 365  ASP A C   1 
ATOM   2750 O O   . ASP A 1 365 ? 7.519   99.944  -17.225 1.00 35.39  ? 365  ASP A O   1 
ATOM   2751 C CB  . ASP A 1 365 ? 8.246   96.910  -18.122 1.00 35.72  ? 365  ASP A CB  1 
ATOM   2752 C CG  . ASP A 1 365 ? 7.853   95.458  -17.964 1.00 47.61  ? 365  ASP A CG  1 
ATOM   2753 O OD1 . ASP A 1 365 ? 6.723   95.201  -17.488 1.00 46.98  ? 365  ASP A OD1 1 
ATOM   2754 O OD2 . ASP A 1 365 ? 8.667   94.575  -18.321 1.00 58.34  ? 365  ASP A OD2 1 
ATOM   2755 N N   . ASP A 1 366 ? 7.786   99.777  -19.438 1.00 23.49  ? 366  ASP A N   1 
ATOM   2756 C CA  . ASP A 1 366 ? 8.208   101.158 -19.547 1.00 25.60  ? 366  ASP A CA  1 
ATOM   2757 C C   . ASP A 1 366 ? 7.043   102.055 -19.164 1.00 21.33  ? 366  ASP A C   1 
ATOM   2758 O O   . ASP A 1 366 ? 7.212   103.028 -18.442 1.00 28.24  ? 366  ASP A O   1 
ATOM   2759 C CB  . ASP A 1 366 ? 8.657   101.468 -20.973 1.00 33.86  ? 366  ASP A CB  1 
ATOM   2760 C CG  . ASP A 1 366 ? 10.147  101.277 -21.169 1.00 41.87  ? 366  ASP A CG  1 
ATOM   2761 O OD1 . ASP A 1 366 ? 10.725  100.378 -20.520 1.00 47.68  ? 366  ASP A OD1 1 
ATOM   2762 O OD2 . ASP A 1 366 ? 10.737  102.028 -21.975 1.00 45.39  ? 366  ASP A OD2 1 
ATOM   2763 N N   . ASP A 1 367 ? 5.853   101.718 -19.637 1.00 18.78  ? 367  ASP A N   1 
ATOM   2764 C CA  . ASP A 1 367 ? 4.682   102.524 -19.336 1.00 19.70  ? 367  ASP A CA  1 
ATOM   2765 C C   . ASP A 1 367 ? 4.482   102.675 -17.835 1.00 16.53  ? 367  ASP A C   1 
ATOM   2766 O O   . ASP A 1 367 ? 4.248   103.780 -17.349 1.00 20.48  ? 367  ASP A O   1 
ATOM   2767 C CB  . ASP A 1 367 ? 3.431   101.904 -19.967 1.00 26.93  ? 367  ASP A CB  1 
ATOM   2768 C CG  . ASP A 1 367 ? 3.314   102.197 -21.460 1.00 31.76  ? 367  ASP A CG  1 
ATOM   2769 O OD1 . ASP A 1 367 ? 4.027   103.096 -21.963 1.00 29.45  ? 367  ASP A OD1 1 
ATOM   2770 O OD2 . ASP A 1 367 ? 2.501   101.522 -22.130 1.00 35.42  ? 367  ASP A OD2 1 
ATOM   2771 N N   . CYS A 1 368 ? 4.585   101.568 -17.106 1.00 14.10  ? 368  CYS A N   1 
ATOM   2772 C CA  . CYS A 1 368 ? 4.407   101.566 -15.654 1.00 12.62  ? 368  CYS A CA  1 
ATOM   2773 C C   . CYS A 1 368 ? 5.379   102.479 -14.915 1.00 16.76  ? 368  CYS A C   1 
ATOM   2774 O O   . CYS A 1 368 ? 4.994   103.199 -13.995 1.00 20.95  ? 368  CYS A O   1 
ATOM   2775 C CB  . CYS A 1 368 ? 4.552   100.151 -15.121 1.00 5.00   ? 368  CYS A CB  1 
ATOM   2776 S SG  . CYS A 1 368 ? 3.270   99.067  -15.696 1.00 10.09  ? 368  CYS A SG  1 
ATOM   2777 N N   . VAL A 1 369 ? 6.644   102.430 -15.303 1.00 15.51  ? 369  VAL A N   1 
ATOM   2778 C CA  . VAL A 1 369 ? 7.655   103.268 -14.680 1.00 16.46  ? 369  VAL A CA  1 
ATOM   2779 C C   . VAL A 1 369 ? 7.303   104.732 -14.917 1.00 16.98  ? 369  VAL A C   1 
ATOM   2780 O O   . VAL A 1 369 ? 7.372   105.551 -14.012 1.00 28.99  ? 369  VAL A O   1 
ATOM   2781 C CB  . VAL A 1 369 ? 9.054   102.978 -15.279 1.00 17.04  ? 369  VAL A CB  1 
ATOM   2782 C CG1 . VAL A 1 369 ? 10.011  104.115 -14.968 1.00 14.46  ? 369  VAL A CG1 1 
ATOM   2783 C CG2 . VAL A 1 369 ? 9.589   101.683 -14.719 1.00 11.77  ? 369  VAL A CG2 1 
ATOM   2784 N N   . SER A 1 370 ? 6.930   105.051 -16.148 1.00 18.92  ? 370  SER A N   1 
ATOM   2785 C CA  . SER A 1 370 ? 6.568   106.408 -16.519 1.00 16.85  ? 370  SER A CA  1 
ATOM   2786 C C   . SER A 1 370 ? 5.352   106.898 -15.760 1.00 13.69  ? 370  SER A C   1 
ATOM   2787 O O   . SER A 1 370 ? 5.372   107.985 -15.195 1.00 17.82  ? 370  SER A O   1 
ATOM   2788 C CB  . SER A 1 370 ? 6.289   106.479 -18.018 1.00 23.58  ? 370  SER A CB  1 
ATOM   2789 O OG  . SER A 1 370 ? 7.464   106.191 -18.755 1.00 30.27  ? 370  SER A OG  1 
ATOM   2790 N N   . VAL A 1 371 ? 4.283   106.107 -15.759 1.00 12.93  ? 371  VAL A N   1 
ATOM   2791 C CA  . VAL A 1 371 ? 3.072   106.498 -15.046 1.00 11.84  ? 371  VAL A CA  1 
ATOM   2792 C C   . VAL A 1 371 ? 3.366   106.660 -13.557 1.00 15.18  ? 371  VAL A C   1 
ATOM   2793 O O   . VAL A 1 371 ? 2.759   107.487 -12.881 1.00 23.28  ? 371  VAL A O   1 
ATOM   2794 C CB  . VAL A 1 371 ? 1.941   105.462 -15.226 1.00 8.09   ? 371  VAL A CB  1 
ATOM   2795 C CG1 . VAL A 1 371 ? 0.986   105.521 -14.050 1.00 6.31   ? 371  VAL A CG1 1 
ATOM   2796 C CG2 . VAL A 1 371 ? 1.184   105.738 -16.521 1.00 9.88   ? 371  VAL A CG2 1 
ATOM   2797 N N   . GLN A 1 372 ? 4.306   105.881 -13.038 1.00 17.09  ? 372  GLN A N   1 
ATOM   2798 C CA  . GLN A 1 372 ? 4.641   105.985 -11.624 1.00 13.95  ? 372  GLN A CA  1 
ATOM   2799 C C   . GLN A 1 372 ? 5.404   107.270 -11.342 1.00 13.84  ? 372  GLN A C   1 
ATOM   2800 O O   . GLN A 1 372 ? 5.296   107.831 -10.256 1.00 18.21  ? 372  GLN A O   1 
ATOM   2801 C CB  . GLN A 1 372 ? 5.470   104.788 -11.171 1.00 8.92   ? 372  GLN A CB  1 
ATOM   2802 C CG  . GLN A 1 372 ? 5.738   104.797 -9.682  1.00 14.61  ? 372  GLN A CG  1 
ATOM   2803 C CD  . GLN A 1 372 ? 6.907   103.915 -9.287  1.00 22.67  ? 372  GLN A CD  1 
ATOM   2804 O OE1 . GLN A 1 372 ? 7.982   103.970 -9.893  1.00 27.35  ? 372  GLN A OE1 1 
ATOM   2805 N NE2 . GLN A 1 372 ? 6.703   103.094 -8.262  1.00 18.10  ? 372  GLN A NE2 1 
ATOM   2806 N N   . HIS A 1 373 ? 6.172   107.738 -12.321 1.00 16.79  ? 373  HIS A N   1 
ATOM   2807 C CA  . HIS A 1 373 ? 6.948   108.963 -12.157 1.00 11.44  ? 373  HIS A CA  1 
ATOM   2808 C C   . HIS A 1 373 ? 6.066   110.188 -12.311 1.00 11.62  ? 373  HIS A C   1 
ATOM   2809 O O   . HIS A 1 373 ? 6.399   111.270 -11.823 1.00 13.41  ? 373  HIS A O   1 
ATOM   2810 C CB  . HIS A 1 373 ? 8.088   109.031 -13.167 1.00 9.48   ? 373  HIS A CB  1 
ATOM   2811 C CG  . HIS A 1 373 ? 9.093   110.091 -12.853 1.00 19.44  ? 373  HIS A CG  1 
ATOM   2812 N ND1 . HIS A 1 373 ? 9.911   110.035 -11.744 1.00 20.18  ? 373  HIS A ND1 1 
ATOM   2813 C CD2 . HIS A 1 373 ? 9.387   111.256 -13.478 1.00 22.64  ? 373  HIS A CD2 1 
ATOM   2814 C CE1 . HIS A 1 373 ? 10.661  111.121 -11.698 1.00 20.79  ? 373  HIS A CE1 1 
ATOM   2815 N NE2 . HIS A 1 373 ? 10.364  111.878 -12.738 1.00 20.17  ? 373  HIS A NE2 1 
ATOM   2816 N N   . VAL A 1 374 ? 4.950   110.028 -13.012 1.00 8.19   ? 374  VAL A N   1 
ATOM   2817 C CA  . VAL A 1 374 ? 4.038   111.142 -13.171 1.00 7.75   ? 374  VAL A CA  1 
ATOM   2818 C C   . VAL A 1 374 ? 3.430   111.344 -11.790 1.00 11.73  ? 374  VAL A C   1 
ATOM   2819 O O   . VAL A 1 374 ? 3.360   112.467 -11.298 1.00 14.84  ? 374  VAL A O   1 
ATOM   2820 C CB  . VAL A 1 374 ? 2.930   110.837 -14.183 1.00 6.22   ? 374  VAL A CB  1 
ATOM   2821 C CG1 . VAL A 1 374 ? 1.773   111.784 -13.973 1.00 5.00   ? 374  VAL A CG1 1 
ATOM   2822 C CG2 . VAL A 1 374 ? 3.475   110.973 -15.609 1.00 5.00   ? 374  VAL A CG2 1 
ATOM   2823 N N   . CYS A 1 375 ? 3.016   110.240 -11.162 1.00 14.21  ? 375  CYS A N   1 
ATOM   2824 C CA  . CYS A 1 375 ? 2.428   110.275 -9.820  1.00 7.62   ? 375  CYS A CA  1 
ATOM   2825 C C   . CYS A 1 375 ? 3.387   110.977 -8.871  1.00 11.41  ? 375  CYS A C   1 
ATOM   2826 O O   . CYS A 1 375 ? 3.005   111.918 -8.178  1.00 15.51  ? 375  CYS A O   1 
ATOM   2827 C CB  . CYS A 1 375 ? 2.169   108.862 -9.311  1.00 5.00   ? 375  CYS A CB  1 
ATOM   2828 S SG  . CYS A 1 375 ? 0.783   108.024 -10.105 1.00 5.38   ? 375  CYS A SG  1 
ATOM   2829 N N   . THR A 1 376 ? 4.632   110.506 -8.852  1.00 12.49  ? 376  THR A N   1 
ATOM   2830 C CA  . THR A 1 376 ? 5.682   111.069 -8.009  1.00 12.81  ? 376  THR A CA  1 
ATOM   2831 C C   . THR A 1 376 ? 5.810   112.581 -8.166  1.00 16.77  ? 376  THR A C   1 
ATOM   2832 O O   . THR A 1 376 ? 5.884   113.318 -7.179  1.00 18.52  ? 376  THR A O   1 
ATOM   2833 C CB  . THR A 1 376 ? 7.053   110.463 -8.351  1.00 11.91  ? 376  THR A CB  1 
ATOM   2834 O OG1 . THR A 1 376 ? 7.038   109.055 -8.090  1.00 19.05  ? 376  THR A OG1 1 
ATOM   2835 C CG2 . THR A 1 376 ? 8.147   111.124 -7.523  1.00 5.92   ? 376  THR A CG2 1 
ATOM   2836 N N   . ILE A 1 377 ? 5.848   113.031 -9.416  1.00 14.56  ? 377  ILE A N   1 
ATOM   2837 C CA  . ILE A 1 377 ? 5.985   114.444 -9.721  1.00 13.63  ? 377  ILE A CA  1 
ATOM   2838 C C   . ILE A 1 377 ? 4.777   115.265 -9.269  1.00 12.08  ? 377  ILE A C   1 
ATOM   2839 O O   . ILE A 1 377 ? 4.931   116.398 -8.793  1.00 14.15  ? 377  ILE A O   1 
ATOM   2840 C CB  . ILE A 1 377 ? 6.216   114.635 -11.232 1.00 12.31  ? 377  ILE A CB  1 
ATOM   2841 C CG1 . ILE A 1 377 ? 7.657   114.274 -11.565 1.00 16.44  ? 377  ILE A CG1 1 
ATOM   2842 C CG2 . ILE A 1 377 ? 5.945   116.068 -11.645 1.00 11.57  ? 377  ILE A CG2 1 
ATOM   2843 C CD1 . ILE A 1 377 ? 8.004   114.467 -13.011 1.00 25.33  ? 377  ILE A CD1 1 
ATOM   2844 N N   . VAL A 1 378 ? 3.585   114.690 -9.401  1.00 6.72   ? 378  VAL A N   1 
ATOM   2845 C CA  . VAL A 1 378 ? 2.350   115.375 -9.028  1.00 10.35  ? 378  VAL A CA  1 
ATOM   2846 C C   . VAL A 1 378 ? 2.155   115.439 -7.513  1.00 14.84  ? 378  VAL A C   1 
ATOM   2847 O O   . VAL A 1 378 ? 1.784   116.481 -6.973  1.00 17.60  ? 378  VAL A O   1 
ATOM   2848 C CB  . VAL A 1 378 ? 1.117   114.687 -9.686  1.00 5.00   ? 378  VAL A CB  1 
ATOM   2849 C CG1 . VAL A 1 378 ? -0.163  115.062 -8.968  1.00 5.00   ? 378  VAL A CG1 1 
ATOM   2850 C CG2 . VAL A 1 378 ? 1.026   115.093 -11.136 1.00 8.61   ? 378  VAL A CG2 1 
ATOM   2851 N N   . SER A 1 379 ? 2.405   114.329 -6.826  1.00 12.54  ? 379  SER A N   1 
ATOM   2852 C CA  . SER A 1 379 ? 2.242   114.300 -5.382  1.00 14.36  ? 379  SER A CA  1 
ATOM   2853 C C   . SER A 1 379 ? 3.388   115.026 -4.684  1.00 17.17  ? 379  SER A C   1 
ATOM   2854 O O   . SER A 1 379 ? 3.213   115.559 -3.587  1.00 26.52  ? 379  SER A O   1 
ATOM   2855 C CB  . SER A 1 379 ? 2.144   112.859 -4.881  1.00 14.41  ? 379  SER A CB  1 
ATOM   2856 O OG  . SER A 1 379 ? 3.415   112.246 -4.860  1.00 24.66  ? 379  SER A OG  1 
ATOM   2857 N N   . PHE A 1 380 ? 4.562   115.056 -5.302  1.00 10.92  ? 380  PHE A N   1 
ATOM   2858 C CA  . PHE A 1 380 ? 5.671   115.765 -4.680  1.00 5.80   ? 380  PHE A CA  1 
ATOM   2859 C C   . PHE A 1 380 ? 5.377   117.254 -4.686  1.00 7.02   ? 380  PHE A C   1 
ATOM   2860 O O   . PHE A 1 380 ? 5.764   117.969 -3.772  1.00 20.47  ? 380  PHE A O   1 
ATOM   2861 C CB  . PHE A 1 380 ? 6.980   115.506 -5.416  1.00 9.03   ? 380  PHE A CB  1 
ATOM   2862 C CG  . PHE A 1 380 ? 8.188   115.489 -4.516  1.00 17.38  ? 380  PHE A CG  1 
ATOM   2863 C CD1 . PHE A 1 380 ? 8.307   116.392 -3.466  1.00 18.76  ? 380  PHE A CD1 1 
ATOM   2864 C CD2 . PHE A 1 380 ? 9.194   114.548 -4.696  1.00 20.65  ? 380  PHE A CD2 1 
ATOM   2865 C CE1 . PHE A 1 380 ? 9.406   116.355 -2.609  1.00 21.07  ? 380  PHE A CE1 1 
ATOM   2866 C CE2 . PHE A 1 380 ? 10.297  114.504 -3.842  1.00 14.85  ? 380  PHE A CE2 1 
ATOM   2867 C CZ  . PHE A 1 380 ? 10.401  115.407 -2.800  1.00 18.01  ? 380  PHE A CZ  1 
ATOM   2868 N N   . ARG A 1 381 ? 4.688   117.727 -5.719  1.00 13.74  ? 381  ARG A N   1 
ATOM   2869 C CA  . ARG A 1 381 ? 4.348   119.145 -5.817  1.00 5.19   ? 381  ARG A CA  1 
ATOM   2870 C C   . ARG A 1 381 ? 3.408   119.502 -4.685  1.00 8.82   ? 381  ARG A C   1 
ATOM   2871 O O   . ARG A 1 381 ? 3.594   120.515 -4.025  1.00 18.18  ? 381  ARG A O   1 
ATOM   2872 C CB  . ARG A 1 381 ? 3.681   119.442 -7.158  1.00 8.00   ? 381  ARG A CB  1 
ATOM   2873 C CG  . ARG A 1 381 ? 3.613   120.914 -7.503  1.00 6.24   ? 381  ARG A CG  1 
ATOM   2874 C CD  . ARG A 1 381 ? 3.054   121.127 -8.900  1.00 6.12   ? 381  ARG A CD  1 
ATOM   2875 N NE  . ARG A 1 381 ? 1.679   120.648 -9.023  1.00 11.25  ? 381  ARG A NE  1 
ATOM   2876 C CZ  . ARG A 1 381 ? 0.759   121.219 -9.797  1.00 16.08  ? 381  ARG A CZ  1 
ATOM   2877 N NH1 . ARG A 1 381 ? 1.063   122.288 -10.516 1.00 18.70  ? 381  ARG A NH1 1 
ATOM   2878 N NH2 . ARG A 1 381 ? -0.464  120.718 -9.854  1.00 16.87  ? 381  ARG A NH2 1 
ATOM   2879 N N   . SER A 1 382 ? 2.396   118.663 -4.466  1.00 8.11   ? 382  SER A N   1 
ATOM   2880 C CA  . SER A 1 382 ? 1.434   118.873 -3.391  1.00 5.00   ? 382  SER A CA  1 
ATOM   2881 C C   . SER A 1 382 ? 2.201   119.084 -2.097  1.00 9.29   ? 382  SER A C   1 
ATOM   2882 O O   . SER A 1 382 ? 2.002   120.069 -1.397  1.00 14.66  ? 382  SER A O   1 
ATOM   2883 C CB  . SER A 1 382 ? 0.536   117.647 -3.237  1.00 5.00   ? 382  SER A CB  1 
ATOM   2884 O OG  . SER A 1 382 ? -0.662  117.963 -2.550  1.00 5.00   ? 382  SER A OG  1 
ATOM   2885 N N   . ALA A 1 383 ? 3.095   118.150 -1.797  1.00 9.54   ? 383  ALA A N   1 
ATOM   2886 C CA  . ALA A 1 383 ? 3.892   118.201 -0.585  1.00 7.95   ? 383  ALA A CA  1 
ATOM   2887 C C   . ALA A 1 383 ? 4.706   119.477 -0.476  1.00 7.20   ? 383  ALA A C   1 
ATOM   2888 O O   . ALA A 1 383 ? 4.668   120.156 0.542   1.00 12.96  ? 383  ALA A O   1 
ATOM   2889 C CB  . ALA A 1 383 ? 4.808   116.995 -0.528  1.00 10.25  ? 383  ALA A CB  1 
ATOM   2890 N N   . ASN A 1 384 ? 5.441   119.800 -1.529  1.00 5.00   ? 384  ASN A N   1 
ATOM   2891 C CA  . ASN A 1 384 ? 6.287   120.988 -1.540  1.00 5.00   ? 384  ASN A CA  1 
ATOM   2892 C C   . ASN A 1 384 ? 5.512   122.277 -1.409  1.00 5.00   ? 384  ASN A C   1 
ATOM   2893 O O   . ASN A 1 384 ? 5.950   123.193 -0.740  1.00 13.70  ? 384  ASN A O   1 
ATOM   2894 C CB  . ASN A 1 384 ? 7.108   121.041 -2.824  1.00 9.78   ? 384  ASN A CB  1 
ATOM   2895 C CG  . ASN A 1 384 ? 8.269   120.064 -2.824  1.00 14.78  ? 384  ASN A CG  1 
ATOM   2896 O OD1 . ASN A 1 384 ? 8.588   119.441 -1.808  1.00 23.63  ? 384  ASN A OD1 1 
ATOM   2897 N ND2 . ASN A 1 384 ? 8.915   119.930 -3.972  1.00 21.86  ? 384  ASN A ND2 1 
ATOM   2898 N N   . LEU A 1 385 ? 4.358   122.356 -2.054  1.00 7.31   ? 385  LEU A N   1 
ATOM   2899 C CA  . LEU A 1 385 ? 3.546   123.565 -1.994  1.00 9.53   ? 385  LEU A CA  1 
ATOM   2900 C C   . LEU A 1 385 ? 3.021   123.820 -0.584  1.00 9.99   ? 385  LEU A C   1 
ATOM   2901 O O   . LEU A 1 385 ? 2.993   124.959 -0.123  1.00 12.69  ? 385  LEU A O   1 
ATOM   2902 C CB  . LEU A 1 385 ? 2.365   123.461 -2.962  1.00 7.00   ? 385  LEU A CB  1 
ATOM   2903 C CG  . LEU A 1 385 ? 2.606   123.826 -4.425  1.00 11.25  ? 385  LEU A CG  1 
ATOM   2904 C CD1 . LEU A 1 385 ? 1.372   123.482 -5.224  1.00 17.23  ? 385  LEU A CD1 1 
ATOM   2905 C CD2 . LEU A 1 385 ? 2.912   125.303 -4.557  1.00 15.67  ? 385  LEU A CD2 1 
ATOM   2906 N N   . VAL A 1 386 ? 2.601   122.760 0.097   1.00 9.08   ? 386  VAL A N   1 
ATOM   2907 C CA  . VAL A 1 386 ? 2.070   122.883 1.447   1.00 7.93   ? 386  VAL A CA  1 
ATOM   2908 C C   . VAL A 1 386 ? 3.175   123.144 2.470   1.00 12.58  ? 386  VAL A C   1 
ATOM   2909 O O   . VAL A 1 386 ? 2.926   123.683 3.547   1.00 11.55  ? 386  VAL A O   1 
ATOM   2910 C CB  . VAL A 1 386 ? 1.309   121.630 1.838   1.00 5.67   ? 386  VAL A CB  1 
ATOM   2911 C CG1 . VAL A 1 386 ? 0.906   121.704 3.289   1.00 13.72  ? 386  VAL A CG1 1 
ATOM   2912 C CG2 . VAL A 1 386 ? 0.091   121.497 0.960   1.00 5.00   ? 386  VAL A CG2 1 
ATOM   2913 N N   . ALA A 1 387 ? 4.397   122.745 2.138   1.00 10.83  ? 387  ALA A N   1 
ATOM   2914 C CA  . ALA A 1 387 ? 5.517   122.991 3.023   1.00 5.60   ? 387  ALA A CA  1 
ATOM   2915 C C   . ALA A 1 387 ? 5.729   124.496 2.968   1.00 10.76  ? 387  ALA A C   1 
ATOM   2916 O O   . ALA A 1 387 ? 5.876   125.151 3.996   1.00 20.64  ? 387  ALA A O   1 
ATOM   2917 C CB  . ALA A 1 387 ? 6.753   122.266 2.527   1.00 5.00   ? 387  ALA A CB  1 
ATOM   2918 N N   . ALA A 1 388 ? 5.714   125.041 1.756   1.00 11.43  ? 388  ALA A N   1 
ATOM   2919 C CA  . ALA A 1 388 ? 5.906   126.472 1.552   1.00 13.18  ? 388  ALA A CA  1 
ATOM   2920 C C   . ALA A 1 388 ? 4.919   127.316 2.348   1.00 12.99  ? 388  ALA A C   1 
ATOM   2921 O O   . ALA A 1 388 ? 5.338   128.168 3.121   1.00 19.58  ? 388  ALA A O   1 
ATOM   2922 C CB  . ALA A 1 388 ? 5.801   126.817 0.065   1.00 6.15   ? 388  ALA A CB  1 
ATOM   2923 N N   . THR A 1 389 ? 3.618   127.093 2.161   1.00 12.48  ? 389  THR A N   1 
ATOM   2924 C CA  . THR A 1 389 ? 2.621   127.877 2.885   1.00 9.77   ? 389  THR A CA  1 
ATOM   2925 C C   . THR A 1 389 ? 2.640   127.627 4.393   1.00 10.72  ? 389  THR A C   1 
ATOM   2926 O O   . THR A 1 389 ? 2.420   128.556 5.169   1.00 15.89  ? 389  THR A O   1 
ATOM   2927 C CB  . THR A 1 389 ? 1.177   127.651 2.344   1.00 10.13  ? 389  THR A CB  1 
ATOM   2928 O OG1 . THR A 1 389 ? 0.824   126.268 2.427   1.00 14.67  ? 389  THR A OG1 1 
ATOM   2929 C CG2 . THR A 1 389 ? 1.074   128.104 0.915   1.00 10.44  ? 389  THR A CG2 1 
ATOM   2930 N N   . LEU A 1 390 ? 2.900   126.394 4.821   1.00 10.02  ? 390  LEU A N   1 
ATOM   2931 C CA  . LEU A 1 390 ? 2.956   126.120 6.259   1.00 10.56  ? 390  LEU A CA  1 
ATOM   2932 C C   . LEU A 1 390 ? 4.140   126.862 6.838   1.00 10.39  ? 390  LEU A C   1 
ATOM   2933 O O   . LEU A 1 390 ? 4.063   127.413 7.932   1.00 13.81  ? 390  LEU A O   1 
ATOM   2934 C CB  . LEU A 1 390 ? 3.127   124.633 6.558   1.00 8.96   ? 390  LEU A CB  1 
ATOM   2935 C CG  . LEU A 1 390 ? 3.344   124.338 8.052   1.00 11.70  ? 390  LEU A CG  1 
ATOM   2936 C CD1 . LEU A 1 390 ? 2.136   124.812 8.848   1.00 5.00   ? 390  LEU A CD1 1 
ATOM   2937 C CD2 . LEU A 1 390 ? 3.573   122.842 8.274   1.00 6.43   ? 390  LEU A CD2 1 
ATOM   2938 N N   . GLY A 1 391 ? 5.239   126.864 6.094   1.00 7.58   ? 391  GLY A N   1 
ATOM   2939 C CA  . GLY A 1 391 ? 6.428   127.558 6.539   1.00 9.95   ? 391  GLY A CA  1 
ATOM   2940 C C   . GLY A 1 391 ? 6.155   129.032 6.772   1.00 12.48  ? 391  GLY A C   1 
ATOM   2941 O O   . GLY A 1 391 ? 6.790   129.660 7.610   1.00 21.67  ? 391  GLY A O   1 
ATOM   2942 N N   . ALA A 1 392 ? 5.205   129.587 6.033   1.00 13.03  ? 392  ALA A N   1 
ATOM   2943 C CA  . ALA A 1 392 ? 4.873   130.996 6.174   1.00 16.83  ? 392  ALA A CA  1 
ATOM   2944 C C   . ALA A 1 392 ? 4.202   131.194 7.514   1.00 18.14  ? 392  ALA A C   1 
ATOM   2945 O O   . ALA A 1 392 ? 4.391   132.213 8.168   1.00 23.08  ? 392  ALA A O   1 
ATOM   2946 C CB  . ALA A 1 392 ? 3.935   131.440 5.046   1.00 17.98  ? 392  ALA A CB  1 
ATOM   2947 N N   . ILE A 1 393 ? 3.409   130.211 7.917   1.00 19.81  ? 393  ILE A N   1 
ATOM   2948 C CA  . ILE A 1 393 ? 2.706   130.278 9.185   1.00 16.51  ? 393  ILE A CA  1 
ATOM   2949 C C   . ILE A 1 393 ? 3.686   130.082 10.336  1.00 19.51  ? 393  ILE A C   1 
ATOM   2950 O O   . ILE A 1 393 ? 3.481   130.611 11.423  1.00 26.35  ? 393  ILE A O   1 
ATOM   2951 C CB  . ILE A 1 393 ? 1.601   129.210 9.252   1.00 13.05  ? 393  ILE A CB  1 
ATOM   2952 C CG1 . ILE A 1 393 ? 0.389   129.685 8.443   1.00 13.76  ? 393  ILE A CG1 1 
ATOM   2953 C CG2 . ILE A 1 393 ? 1.211   128.942 10.694  1.00 11.08  ? 393  ILE A CG2 1 
ATOM   2954 C CD1 . ILE A 1 393 ? -0.763  128.704 8.417   1.00 6.22   ? 393  ILE A CD1 1 
ATOM   2955 N N   . LEU A 1 394 ? 4.754   129.325 10.102  1.00 17.78  ? 394  LEU A N   1 
ATOM   2956 C CA  . LEU A 1 394 ? 5.741   129.103 11.146  1.00 12.50  ? 394  LEU A CA  1 
ATOM   2957 C C   . LEU A 1 394 ? 6.539   130.385 11.339  1.00 19.38  ? 394  LEU A C   1 
ATOM   2958 O O   . LEU A 1 394 ? 6.666   130.876 12.460  1.00 23.95  ? 394  LEU A O   1 
ATOM   2959 C CB  . LEU A 1 394 ? 6.660   127.939 10.779  1.00 5.00   ? 394  LEU A CB  1 
ATOM   2960 C CG  . LEU A 1 394 ? 5.943   126.587 10.672  1.00 8.41   ? 394  LEU A CG  1 
ATOM   2961 C CD1 . LEU A 1 394 ? 6.941   125.467 10.522  1.00 5.00   ? 394  LEU A CD1 1 
ATOM   2962 C CD2 . LEU A 1 394 ? 5.097   126.359 11.898  1.00 9.25   ? 394  LEU A CD2 1 
ATOM   2963 N N   . ASN A 1 395 ? 7.064   130.939 10.251  1.00 20.12  ? 395  ASN A N   1 
ATOM   2964 C CA  . ASN A 1 395 ? 7.816   132.183 10.343  1.00 22.75  ? 395  ASN A CA  1 
ATOM   2965 C C   . ASN A 1 395 ? 6.971   133.227 11.062  1.00 23.88  ? 395  ASN A C   1 
ATOM   2966 O O   . ASN A 1 395 ? 7.473   133.990 11.881  1.00 26.74  ? 395  ASN A O   1 
ATOM   2967 C CB  . ASN A 1 395 ? 8.171   132.696 8.956   1.00 25.13  ? 395  ASN A CB  1 
ATOM   2968 C CG  . ASN A 1 395 ? 9.282   131.902 8.320   1.00 37.83  ? 395  ASN A CG  1 
ATOM   2969 O OD1 . ASN A 1 395 ? 10.281  131.588 8.965   1.00 45.93  ? 395  ASN A OD1 1 
ATOM   2970 N ND2 . ASN A 1 395 ? 9.117   131.566 7.047   1.00 48.59  ? 395  ASN A ND2 1 
ATOM   2971 N N   . ARG A 1 396 ? 5.681   133.248 10.757  1.00 22.70  ? 396  ARG A N   1 
ATOM   2972 C CA  . ARG A 1 396 ? 4.773   134.196 11.379  1.00 22.41  ? 396  ARG A CA  1 
ATOM   2973 C C   . ARG A 1 396 ? 4.735   133.973 12.886  1.00 20.63  ? 396  ARG A C   1 
ATOM   2974 O O   . ARG A 1 396 ? 4.784   134.921 13.660  1.00 21.25  ? 396  ARG A O   1 
ATOM   2975 C CB  . ARG A 1 396 ? 3.372   134.043 10.792  1.00 23.81  ? 396  ARG A CB  1 
ATOM   2976 C CG  . ARG A 1 396 ? 2.286   134.717 11.598  1.00 31.12  ? 396  ARG A CG  1 
ATOM   2977 C CD  . ARG A 1 396 ? 2.211   136.194 11.253  1.00 37.39  ? 396  ARG A CD  1 
ATOM   2978 N NE  . ARG A 1 396 ? 1.385   136.944 12.200  1.00 45.37  ? 396  ARG A NE  1 
ATOM   2979 C CZ  . ARG A 1 396 ? 0.884   138.140 11.952  1.00 49.44  ? 396  ARG A CZ  1 
ATOM   2980 N NH1 . ARG A 1 396 ? 1.132   138.736 10.787  1.00 57.25  ? 396  ARG A NH1 1 
ATOM   2981 N NH2 . ARG A 1 396 ? 0.165   138.774 12.875  1.00 49.16  ? 396  ARG A NH2 1 
ATOM   2982 N N   . LEU A 1 397 ? 4.645   132.717 13.300  1.00 19.40  ? 397  LEU A N   1 
ATOM   2983 C CA  . LEU A 1 397 ? 4.610   132.399 14.718  1.00 20.58  ? 397  LEU A CA  1 
ATOM   2984 C C   . LEU A 1 397 ? 5.939   132.773 15.378  1.00 24.23  ? 397  LEU A C   1 
ATOM   2985 O O   . LEU A 1 397 ? 5.968   133.247 16.512  1.00 26.44  ? 397  LEU A O   1 
ATOM   2986 C CB  . LEU A 1 397 ? 4.333   130.906 14.920  1.00 13.70  ? 397  LEU A CB  1 
ATOM   2987 C CG  . LEU A 1 397 ? 2.871   130.459 14.852  1.00 17.51  ? 397  LEU A CG  1 
ATOM   2988 C CD1 . LEU A 1 397 ? 2.810   128.944 14.805  1.00 23.02  ? 397  LEU A CD1 1 
ATOM   2989 C CD2 . LEU A 1 397 ? 2.102   130.977 16.055  1.00 17.90  ? 397  LEU A CD2 1 
ATOM   2990 N N   . ARG A 1 398 ? 7.039   132.566 14.661  1.00 28.02  ? 398  ARG A N   1 
ATOM   2991 C CA  . ARG A 1 398 ? 8.365   132.873 15.185  1.00 29.05  ? 398  ARG A CA  1 
ATOM   2992 C C   . ARG A 1 398 ? 8.506   134.369 15.423  1.00 31.64  ? 398  ARG A C   1 
ATOM   2993 O O   . ARG A 1 398 ? 9.141   134.794 16.381  1.00 35.28  ? 398  ARG A O   1 
ATOM   2994 C CB  . ARG A 1 398 ? 9.437   132.390 14.201  1.00 28.23  ? 398  ARG A CB  1 
ATOM   2995 C CG  . ARG A 1 398 ? 10.720  133.205 14.183  1.00 37.19  ? 398  ARG A CG  1 
ATOM   2996 C CD  . ARG A 1 398 ? 11.602  132.838 12.987  1.00 44.78  ? 398  ARG A CD  1 
ATOM   2997 N NE  . ARG A 1 398 ? 11.847  131.399 12.912  1.00 60.51  ? 398  ARG A NE  1 
ATOM   2998 C CZ  . ARG A 1 398 ? 12.562  130.800 11.961  1.00 68.21  ? 398  ARG A CZ  1 
ATOM   2999 N NH1 . ARG A 1 398 ? 13.114  131.514 10.988  1.00 73.40  ? 398  ARG A NH1 1 
ATOM   3000 N NH2 . ARG A 1 398 ? 12.727  129.483 11.983  1.00 68.79  ? 398  ARG A NH2 1 
ATOM   3001 N N   . ASP A 1 399 ? 7.898   135.160 14.545  1.00 33.63  ? 399  ASP A N   1 
ATOM   3002 C CA  . ASP A 1 399 ? 7.955   136.611 14.634  1.00 31.78  ? 399  ASP A CA  1 
ATOM   3003 C C   . ASP A 1 399 ? 7.088   137.130 15.765  1.00 34.60  ? 399  ASP A C   1 
ATOM   3004 O O   . ASP A 1 399 ? 7.471   138.051 16.478  1.00 37.58  ? 399  ASP A O   1 
ATOM   3005 C CB  . ASP A 1 399 ? 7.490   137.234 13.319  1.00 35.30  ? 399  ASP A CB  1 
ATOM   3006 C CG  . ASP A 1 399 ? 8.499   137.058 12.201  1.00 45.44  ? 399  ASP A CG  1 
ATOM   3007 O OD1 . ASP A 1 399 ? 9.574   136.473 12.453  1.00 49.65  ? 399  ASP A OD1 1 
ATOM   3008 O OD2 . ASP A 1 399 ? 8.219   137.505 11.066  1.00 52.50  ? 399  ASP A OD2 1 
ATOM   3009 N N   . ASN A 1 400 ? 5.909   136.542 15.918  1.00 37.48  ? 400  ASN A N   1 
ATOM   3010 C CA  . ASN A 1 400 ? 4.983   136.953 16.965  1.00 40.21  ? 400  ASN A CA  1 
ATOM   3011 C C   . ASN A 1 400 ? 5.598   136.744 18.343  1.00 44.93  ? 400  ASN A C   1 
ATOM   3012 O O   . ASN A 1 400 ? 5.427   137.569 19.238  1.00 52.22  ? 400  ASN A O   1 
ATOM   3013 C CB  . ASN A 1 400 ? 3.671   136.160 16.863  1.00 34.31  ? 400  ASN A CB  1 
ATOM   3014 C CG  . ASN A 1 400 ? 2.681   136.790 15.898  1.00 32.90  ? 400  ASN A CG  1 
ATOM   3015 O OD1 . ASN A 1 400 ? 2.942   137.846 15.326  1.00 32.55  ? 400  ASN A OD1 1 
ATOM   3016 N ND2 . ASN A 1 400 ? 1.536   136.140 15.713  1.00 29.54  ? 400  ASN A ND2 1 
ATOM   3017 N N   . LYS A 1 401 ? 6.323   135.643 18.508  1.00 48.32  ? 401  LYS A N   1 
ATOM   3018 C CA  . LYS A 1 401 ? 6.948   135.327 19.785  1.00 49.65  ? 401  LYS A CA  1 
ATOM   3019 C C   . LYS A 1 401 ? 8.337   135.945 19.934  1.00 53.52  ? 401  LYS A C   1 
ATOM   3020 O O   . LYS A 1 401 ? 8.978   135.796 20.972  1.00 58.17  ? 401  LYS A O   1 
ATOM   3021 C CB  . LYS A 1 401 ? 7.022   133.809 19.962  1.00 50.37  ? 401  LYS A CB  1 
ATOM   3022 C CG  . LYS A 1 401 ? 5.659   133.130 19.983  1.00 54.74  ? 401  LYS A CG  1 
ATOM   3023 C CD  . LYS A 1 401 ? 5.706   131.745 19.347  1.00 58.80  ? 401  LYS A CD  1 
ATOM   3024 C CE  . LYS A 1 401 ? 5.377   130.648 20.356  1.00 61.49  ? 401  LYS A CE  1 
ATOM   3025 N NZ  . LYS A 1 401 ? 4.360   131.069 21.371  1.00 66.46  ? 401  LYS A NZ  1 
ATOM   3026 N N   . GLY A 1 402 ? 8.795   136.636 18.893  1.00 54.90  ? 402  GLY A N   1 
ATOM   3027 C CA  . GLY A 1 402 ? 10.096  137.284 18.932  1.00 52.77  ? 402  GLY A CA  1 
ATOM   3028 C C   . GLY A 1 402 ? 11.292  136.381 19.175  1.00 56.42  ? 402  GLY A C   1 
ATOM   3029 O O   . GLY A 1 402 ? 12.418  136.862 19.299  1.00 60.37  ? 402  GLY A O   1 
ATOM   3030 N N   . THR A 1 403 ? 11.063  135.073 19.234  1.00 56.86  ? 403  THR A N   1 
ATOM   3031 C CA  . THR A 1 403 ? 12.145  134.122 19.470  1.00 58.70  ? 403  THR A CA  1 
ATOM   3032 C C   . THR A 1 403 ? 12.964  133.850 18.211  1.00 61.19  ? 403  THR A C   1 
ATOM   3033 O O   . THR A 1 403 ? 12.414  133.735 17.118  1.00 66.05  ? 403  THR A O   1 
ATOM   3034 C CB  . THR A 1 403 ? 11.596  132.788 19.984  1.00 58.44  ? 403  THR A CB  1 
ATOM   3035 O OG1 . THR A 1 403 ? 10.604  133.039 20.985  1.00 61.44  ? 403  THR A OG1 1 
ATOM   3036 C CG2 . THR A 1 403 ? 12.710  131.951 20.589  1.00 63.16  ? 403  THR A CG2 1 
ATOM   3037 N N   . PRO A 1 404 ? 14.296  133.747 18.354  1.00 59.92  ? 404  PRO A N   1 
ATOM   3038 C CA  . PRO A 1 404 ? 15.210  133.486 17.234  1.00 57.76  ? 404  PRO A CA  1 
ATOM   3039 C C   . PRO A 1 404 ? 14.994  132.128 16.569  1.00 54.14  ? 404  PRO A C   1 
ATOM   3040 O O   . PRO A 1 404 ? 15.111  132.002 15.351  1.00 54.24  ? 404  PRO A O   1 
ATOM   3041 C CB  . PRO A 1 404 ? 16.595  133.595 17.866  1.00 60.06  ? 404  PRO A CB  1 
ATOM   3042 C CG  . PRO A 1 404 ? 16.369  133.315 19.314  1.00 60.41  ? 404  PRO A CG  1 
ATOM   3043 C CD  . PRO A 1 404 ? 15.025  133.896 19.626  1.00 61.31  ? 404  PRO A CD  1 
ATOM   3044 N N   . ARG A 1 405 ? 14.704  131.115 17.379  1.00 50.84  ? 405  ARG A N   1 
ATOM   3045 C CA  . ARG A 1 405 ? 14.453  129.764 16.881  1.00 48.64  ? 405  ARG A CA  1 
ATOM   3046 C C   . ARG A 1 405 ? 13.069  129.371 17.364  1.00 46.08  ? 405  ARG A C   1 
ATOM   3047 O O   . ARG A 1 405 ? 12.732  129.592 18.521  1.00 51.54  ? 405  ARG A O   1 
ATOM   3048 C CB  . ARG A 1 405 ? 15.485  128.780 17.426  1.00 50.43  ? 405  ARG A CB  1 
ATOM   3049 C CG  . ARG A 1 405 ? 15.834  127.667 16.458  1.00 58.31  ? 405  ARG A CG  1 
ATOM   3050 C CD  . ARG A 1 405 ? 16.710  126.623 17.122  1.00 67.94  ? 405  ARG A CD  1 
ATOM   3051 N NE  . ARG A 1 405 ? 16.321  125.263 16.755  1.00 74.25  ? 405  ARG A NE  1 
ATOM   3052 C CZ  . ARG A 1 405 ? 15.705  124.411 17.570  1.00 77.55  ? 405  ARG A CZ  1 
ATOM   3053 N NH1 . ARG A 1 405 ? 15.398  124.771 18.814  1.00 75.99  ? 405  ARG A NH1 1 
ATOM   3054 N NH2 . ARG A 1 405 ? 15.399  123.193 17.143  1.00 76.86  ? 405  ARG A NH2 1 
ATOM   3055 N N   . LEU A 1 406 ? 12.276  128.773 16.485  1.00 40.67  ? 406  LEU A N   1 
ATOM   3056 C CA  . LEU A 1 406 ? 10.913  128.409 16.841  1.00 35.68  ? 406  LEU A CA  1 
ATOM   3057 C C   . LEU A 1 406 ? 10.699  126.974 17.296  1.00 35.96  ? 406  LEU A C   1 
ATOM   3058 O O   . LEU A 1 406 ? 11.256  126.037 16.728  1.00 38.45  ? 406  LEU A O   1 
ATOM   3059 C CB  . LEU A 1 406 ? 9.988   128.707 15.656  1.00 32.51  ? 406  LEU A CB  1 
ATOM   3060 C CG  . LEU A 1 406 ? 8.592   128.089 15.679  1.00 28.17  ? 406  LEU A CG  1 
ATOM   3061 C CD1 . LEU A 1 406 ? 7.597   129.118 16.168  1.00 25.60  ? 406  LEU A CD1 1 
ATOM   3062 C CD2 . LEU A 1 406 ? 8.230   127.597 14.286  1.00 29.37  ? 406  LEU A CD2 1 
ATOM   3063 N N   . ARG A 1 407 ? 9.885   126.815 18.334  1.00 34.80  ? 407  ARG A N   1 
ATOM   3064 C CA  . ARG A 1 407 ? 9.542   125.497 18.847  1.00 34.91  ? 407  ARG A CA  1 
ATOM   3065 C C   . ARG A 1 407 ? 8.031   125.449 18.968  1.00 31.29  ? 407  ARG A C   1 
ATOM   3066 O O   . ARG A 1 407 ? 7.446   126.162 19.786  1.00 32.53  ? 407  ARG A O   1 
ATOM   3067 C CB  . ARG A 1 407 ? 10.164  125.254 20.213  1.00 42.59  ? 407  ARG A CB  1 
ATOM   3068 C CG  . ARG A 1 407 ? 9.779   123.912 20.816  1.00 54.57  ? 407  ARG A CG  1 
ATOM   3069 C CD  . ARG A 1 407 ? 8.500   124.013 21.637  1.00 69.66  ? 407  ARG A CD  1 
ATOM   3070 N NE  . ARG A 1 407 ? 8.191   122.768 22.337  1.00 85.34  ? 407  ARG A NE  1 
ATOM   3071 C CZ  . ARG A 1 407 ? 8.630   122.461 23.556  1.00 89.97  ? 407  ARG A CZ  1 
ATOM   3072 N NH1 . ARG A 1 407 ? 9.404   123.312 24.221  1.00 93.76  ? 407  ARG A NH1 1 
ATOM   3073 N NH2 . ARG A 1 407 ? 8.294   121.302 24.112  1.00 90.71  ? 407  ARG A NH2 1 
ATOM   3074 N N   . THR A 1 408 ? 7.402   124.610 18.154  1.00 24.39  ? 408  THR A N   1 
ATOM   3075 C CA  . THR A 1 408 ? 5.954   124.495 18.169  1.00 17.76  ? 408  THR A CA  1 
ATOM   3076 C C   . THR A 1 408 ? 5.517   123.115 17.731  1.00 18.12  ? 408  THR A C   1 
ATOM   3077 O O   . THR A 1 408 ? 6.311   122.346 17.184  1.00 16.21  ? 408  THR A O   1 
ATOM   3078 C CB  . THR A 1 408 ? 5.306   125.529 17.234  1.00 19.56  ? 408  THR A CB  1 
ATOM   3079 O OG1 . THR A 1 408 ? 3.885   125.438 17.340  1.00 27.78  ? 408  THR A OG1 1 
ATOM   3080 C CG2 . THR A 1 408 ? 5.701   125.276 15.797  1.00 18.65  ? 408  THR A CG2 1 
ATOM   3081 N N   . THR A 1 409 ? 4.247   122.810 17.979  1.00 17.16  ? 409  THR A N   1 
ATOM   3082 C CA  . THR A 1 409 ? 3.667   121.521 17.617  1.00 18.99  ? 409  THR A CA  1 
ATOM   3083 C C   . THR A 1 409 ? 2.506   121.763 16.669  1.00 19.99  ? 409  THR A C   1 
ATOM   3084 O O   . THR A 1 409 ? 1.628   122.579 16.949  1.00 23.25  ? 409  THR A O   1 
ATOM   3085 C CB  . THR A 1 409 ? 3.150   120.763 18.861  1.00 19.14  ? 409  THR A CB  1 
ATOM   3086 O OG1 . THR A 1 409 ? 4.269   120.286 19.616  1.00 26.62  ? 409  THR A OG1 1 
ATOM   3087 C CG2 . THR A 1 409 ? 2.274   119.574 18.457  1.00 13.60  ? 409  THR A CG2 1 
ATOM   3088 N N   . VAL A 1 410 ? 2.511   121.044 15.551  1.00 18.36  ? 410  VAL A N   1 
ATOM   3089 C CA  . VAL A 1 410 ? 1.482   121.167 14.531  1.00 9.92   ? 410  VAL A CA  1 
ATOM   3090 C C   . VAL A 1 410 ? 0.543   119.966 14.544  1.00 12.01  ? 410  VAL A C   1 
ATOM   3091 O O   . VAL A 1 410 ? 0.991   118.824 14.498  1.00 13.45  ? 410  VAL A O   1 
ATOM   3092 C CB  . VAL A 1 410 ? 2.132   121.284 13.145  1.00 7.56   ? 410  VAL A CB  1 
ATOM   3093 C CG1 . VAL A 1 410 ? 1.072   121.307 12.069  1.00 11.02  ? 410  VAL A CG1 1 
ATOM   3094 C CG2 . VAL A 1 410 ? 2.990   122.534 13.087  1.00 5.00   ? 410  VAL A CG2 1 
ATOM   3095 N N   . GLY A 1 411 ? -0.758  120.230 14.614  1.00 12.16  ? 411  GLY A N   1 
ATOM   3096 C CA  . GLY A 1 411 ? -1.735  119.156 14.615  1.00 13.61  ? 411  GLY A CA  1 
ATOM   3097 C C   . GLY A 1 411 ? -2.124  118.848 13.185  1.00 19.96  ? 411  GLY A C   1 
ATOM   3098 O O   . GLY A 1 411 ? -2.690  119.702 12.507  1.00 28.37  ? 411  GLY A O   1 
ATOM   3099 N N   . VAL A 1 412 ? -1.834  117.627 12.733  1.00 22.25  ? 412  VAL A N   1 
ATOM   3100 C CA  . VAL A 1 412 ? -2.117  117.207 11.359  1.00 17.36  ? 412  VAL A CA  1 
ATOM   3101 C C   . VAL A 1 412 ? -3.209  116.157 11.207  1.00 18.68  ? 412  VAL A C   1 
ATOM   3102 O O   . VAL A 1 412 ? -3.479  115.375 12.116  1.00 25.87  ? 412  VAL A O   1 
ATOM   3103 C CB  . VAL A 1 412 ? -0.847  116.642 10.681  1.00 16.73  ? 412  VAL A CB  1 
ATOM   3104 C CG1 . VAL A 1 412 ? -0.980  116.719 9.180   1.00 22.33  ? 412  VAL A CG1 1 
ATOM   3105 C CG2 . VAL A 1 412 ? 0.377   117.412 11.126  1.00 16.72  ? 412  VAL A CG2 1 
ATOM   3106 N N   . ASP A 1 413 ? -3.832  116.157 10.035  1.00 19.94  ? 413  ASP A N   1 
ATOM   3107 C CA  . ASP A 1 413 ? -4.881  115.207 9.689   1.00 15.64  ? 413  ASP A CA  1 
ATOM   3108 C C   . ASP A 1 413 ? -5.199  115.350 8.195   1.00 18.07  ? 413  ASP A C   1 
ATOM   3109 O O   . ASP A 1 413 ? -4.825  116.343 7.563   1.00 16.92  ? 413  ASP A O   1 
ATOM   3110 C CB  . ASP A 1 413 ? -6.132  115.459 10.524  1.00 15.95  ? 413  ASP A CB  1 
ATOM   3111 C CG  . ASP A 1 413 ? -6.899  114.185 10.822  1.00 24.48  ? 413  ASP A CG  1 
ATOM   3112 O OD1 . ASP A 1 413 ? -6.315  113.092 10.663  1.00 28.88  ? 413  ASP A OD1 1 
ATOM   3113 O OD2 . ASP A 1 413 ? -8.081  114.272 11.214  1.00 23.33  ? 413  ASP A OD2 1 
ATOM   3114 N N   . GLY A 1 414 ? -5.882  114.358 7.634   1.00 12.33  ? 414  GLY A N   1 
ATOM   3115 C CA  . GLY A 1 414 ? -6.218  114.394 6.224   1.00 7.52   ? 414  GLY A CA  1 
ATOM   3116 C C   . GLY A 1 414 ? -5.924  113.043 5.601   1.00 14.18  ? 414  GLY A C   1 
ATOM   3117 O O   . GLY A 1 414 ? -4.868  112.452 5.852   1.00 12.37  ? 414  GLY A O   1 
ATOM   3118 N N   . SER A 1 415 ? -6.858  112.547 4.794   1.00 13.41  ? 415  SER A N   1 
ATOM   3119 C CA  . SER A 1 415 ? -6.703  111.252 4.142   1.00 8.32   ? 415  SER A CA  1 
ATOM   3120 C C   . SER A 1 415 ? -5.438  111.141 3.296   1.00 12.58  ? 415  SER A C   1 
ATOM   3121 O O   . SER A 1 415 ? -4.752  110.120 3.335   1.00 15.17  ? 415  SER A O   1 
ATOM   3122 C CB  . SER A 1 415 ? -7.911  110.972 3.263   1.00 5.20   ? 415  SER A CB  1 
ATOM   3123 O OG  . SER A 1 415 ? -8.268  112.121 2.524   1.00 9.33   ? 415  SER A OG  1 
ATOM   3124 N N   . LEU A 1 416 ? -5.131  112.183 2.526   1.00 10.65  ? 416  LEU A N   1 
ATOM   3125 C CA  . LEU A 1 416 ? -3.942  112.169 1.678   1.00 7.63   ? 416  LEU A CA  1 
ATOM   3126 C C   . LEU A 1 416 ? -2.678  111.984 2.511   1.00 11.03  ? 416  LEU A C   1 
ATOM   3127 O O   . LEU A 1 416 ? -1.925  111.039 2.298   1.00 13.62  ? 416  LEU A O   1 
ATOM   3128 C CB  . LEU A 1 416 ? -3.850  113.468 0.870   1.00 6.16   ? 416  LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 416 ? -2.669  113.686 -0.082  1.00 5.00   ? 416  LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 416 ? -2.444  112.465 -0.964  1.00 7.26   ? 416  LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 416 ? -2.962  114.897 -0.933  1.00 5.44   ? 416  LEU A CD2 1 
ATOM   3132 N N   . TYR A 1 417 ? -2.460  112.882 3.468   1.00 11.96  ? 417  TYR A N   1 
ATOM   3133 C CA  . TYR A 1 417 ? -1.286  112.830 4.335   1.00 15.62  ? 417  TYR A CA  1 
ATOM   3134 C C   . TYR A 1 417 ? -1.170  111.497 5.082   1.00 19.40  ? 417  TYR A C   1 
ATOM   3135 O O   . TYR A 1 417 ? -0.089  110.909 5.161   1.00 18.13  ? 417  TYR A O   1 
ATOM   3136 C CB  . TYR A 1 417 ? -1.329  113.990 5.339   1.00 11.39  ? 417  TYR A CB  1 
ATOM   3137 C CG  . TYR A 1 417 ? -0.142  114.072 6.287   1.00 13.72  ? 417  TYR A CG  1 
ATOM   3138 C CD1 . TYR A 1 417 ? -0.114  113.328 7.468   1.00 16.06  ? 417  TYR A CD1 1 
ATOM   3139 C CD2 . TYR A 1 417 ? 0.943   114.909 6.013   1.00 12.07  ? 417  TYR A CD2 1 
ATOM   3140 C CE1 . TYR A 1 417 ? 0.970   113.410 8.353   1.00 11.91  ? 417  TYR A CE1 1 
ATOM   3141 C CE2 . TYR A 1 417 ? 2.030   114.999 6.890   1.00 6.42   ? 417  TYR A CE2 1 
ATOM   3142 C CZ  . TYR A 1 417 ? 2.034   114.241 8.056   1.00 13.45  ? 417  TYR A CZ  1 
ATOM   3143 O OH  . TYR A 1 417 ? 3.115   114.284 8.907   1.00 9.69   ? 417  TYR A OH  1 
ATOM   3144 N N   . LYS A 1 418 ? -2.290  111.013 5.608   1.00 18.62  ? 418  LYS A N   1 
ATOM   3145 C CA  . LYS A 1 418 ? -2.303  109.766 6.371   1.00 17.18  ? 418  LYS A CA  1 
ATOM   3146 C C   . LYS A 1 418 ? -2.209  108.485 5.557   1.00 16.65  ? 418  LYS A C   1 
ATOM   3147 O O   . LYS A 1 418 ? -1.821  107.458 6.094   1.00 25.30  ? 418  LYS A O   1 
ATOM   3148 C CB  . LYS A 1 418 ? -3.569  109.683 7.228   1.00 16.20  ? 418  LYS A CB  1 
ATOM   3149 C CG  . LYS A 1 418 ? -3.447  110.291 8.600   1.00 20.46  ? 418  LYS A CG  1 
ATOM   3150 C CD  . LYS A 1 418 ? -4.704  111.068 8.950   1.00 30.71  ? 418  LYS A CD  1 
ATOM   3151 C CE  . LYS A 1 418 ? -5.875  110.150 9.283   1.00 32.39  ? 418  LYS A CE  1 
ATOM   3152 N NZ  . LYS A 1 418 ? -6.358  110.380 10.681  1.00 41.93  ? 418  LYS A NZ  1 
ATOM   3153 N N   . THR A 1 419 ? -2.566  108.520 4.277   1.00 17.96  ? 419  THR A N   1 
ATOM   3154 C CA  . THR A 1 419 ? -2.522  107.294 3.478   1.00 11.90  ? 419  THR A CA  1 
ATOM   3155 C C   . THR A 1 419 ? -1.469  107.228 2.383   1.00 9.40   ? 419  THR A C   1 
ATOM   3156 O O   . THR A 1 419 ? -1.139  106.145 1.920   1.00 16.07  ? 419  THR A O   1 
ATOM   3157 C CB  . THR A 1 419 ? -3.873  106.996 2.828   1.00 6.30   ? 419  THR A CB  1 
ATOM   3158 O OG1 . THR A 1 419 ? -4.183  108.026 1.884   1.00 20.73  ? 419  THR A OG1 1 
ATOM   3159 C CG2 . THR A 1 419 ? -4.953  106.926 3.870   1.00 8.04   ? 419  THR A CG2 1 
ATOM   3160 N N   . HIS A 1 420 ? -0.943  108.361 1.946   1.00 6.06   ? 420  HIS A N   1 
ATOM   3161 C CA  . HIS A 1 420 ? 0.077   108.313 0.912   1.00 7.42   ? 420  HIS A CA  1 
ATOM   3162 C C   . HIS A 1 420 ? 1.382   107.820 1.538   1.00 11.89  ? 420  HIS A C   1 
ATOM   3163 O O   . HIS A 1 420 ? 1.832   108.347 2.554   1.00 17.25  ? 420  HIS A O   1 
ATOM   3164 C CB  . HIS A 1 420 ? 0.268   109.687 0.293   1.00 12.25  ? 420  HIS A CB  1 
ATOM   3165 C CG  . HIS A 1 420 ? 0.915   109.648 -1.054  1.00 11.28  ? 420  HIS A CG  1 
ATOM   3166 N ND1 . HIS A 1 420 ? 2.264   109.426 -1.221  1.00 8.33   ? 420  HIS A ND1 1 
ATOM   3167 C CD2 . HIS A 1 420 ? 0.400   109.813 -2.294  1.00 7.66   ? 420  HIS A CD2 1 
ATOM   3168 C CE1 . HIS A 1 420 ? 2.555   109.458 -2.509  1.00 10.25  ? 420  HIS A CE1 1 
ATOM   3169 N NE2 . HIS A 1 420 ? 1.441   109.692 -3.182  1.00 11.10  ? 420  HIS A NE2 1 
ATOM   3170 N N   . PRO A 1 421 ? 2.015   106.805 0.930   1.00 13.24  ? 421  PRO A N   1 
ATOM   3171 C CA  . PRO A 1 421 ? 3.264   106.279 1.491   1.00 10.52  ? 421  PRO A CA  1 
ATOM   3172 C C   . PRO A 1 421 ? 4.454   107.221 1.544   1.00 12.77  ? 421  PRO A C   1 
ATOM   3173 O O   . PRO A 1 421 ? 5.280   107.108 2.443   1.00 17.36  ? 421  PRO A O   1 
ATOM   3174 C CB  . PRO A 1 421 ? 3.557   105.041 0.642   1.00 11.89  ? 421  PRO A CB  1 
ATOM   3175 C CG  . PRO A 1 421 ? 2.778   105.219 -0.614  1.00 11.27  ? 421  PRO A CG  1 
ATOM   3176 C CD  . PRO A 1 421 ? 1.608   106.103 -0.302  1.00 14.16  ? 421  PRO A CD  1 
ATOM   3177 N N   . GLN A 1 422 ? 4.535   108.159 0.603   1.00 16.60  ? 422  GLN A N   1 
ATOM   3178 C CA  . GLN A 1 422 ? 5.668   109.088 0.543   1.00 9.31   ? 422  GLN A CA  1 
ATOM   3179 C C   . GLN A 1 422 ? 5.413   110.534 0.971   1.00 12.58  ? 422  GLN A C   1 
ATOM   3180 O O   . GLN A 1 422 ? 6.363   111.268 1.254   1.00 14.33  ? 422  GLN A O   1 
ATOM   3181 C CB  . GLN A 1 422 ? 6.243   109.108 -0.877  1.00 7.50   ? 422  GLN A CB  1 
ATOM   3182 C CG  . GLN A 1 422 ? 6.230   107.772 -1.588  1.00 15.35  ? 422  GLN A CG  1 
ATOM   3183 C CD  . GLN A 1 422 ? 7.132   106.759 -0.913  1.00 26.51  ? 422  GLN A CD  1 
ATOM   3184 O OE1 . GLN A 1 422 ? 8.050   107.127 -0.173  1.00 28.65  ? 422  GLN A OE1 1 
ATOM   3185 N NE2 . GLN A 1 422 ? 6.877   105.476 -1.159  1.00 28.06  ? 422  GLN A NE2 1 
ATOM   3186 N N   . TYR A 1 423 ? 4.151   110.954 1.018   1.00 13.01  ? 423  TYR A N   1 
ATOM   3187 C CA  . TYR A 1 423 ? 3.824   112.340 1.369   1.00 13.32  ? 423  TYR A CA  1 
ATOM   3188 C C   . TYR A 1 423 ? 4.483   112.857 2.645   1.00 14.54  ? 423  TYR A C   1 
ATOM   3189 O O   . TYR A 1 423 ? 5.236   113.830 2.634   1.00 12.39  ? 423  TYR A O   1 
ATOM   3190 C CB  . TYR A 1 423 ? 2.311   112.506 1.477   1.00 13.30  ? 423  TYR A CB  1 
ATOM   3191 C CG  . TYR A 1 423 ? 1.836   113.888 1.115   1.00 13.09  ? 423  TYR A CG  1 
ATOM   3192 C CD1 . TYR A 1 423 ? 1.764   114.898 2.074   1.00 10.74  ? 423  TYR A CD1 1 
ATOM   3193 C CD2 . TYR A 1 423 ? 1.464   114.193 -0.192  1.00 12.72  ? 423  TYR A CD2 1 
ATOM   3194 C CE1 . TYR A 1 423 ? 1.330   116.187 1.736   1.00 10.91  ? 423  TYR A CE1 1 
ATOM   3195 C CE2 . TYR A 1 423 ? 1.031   115.474 -0.540  1.00 14.82  ? 423  TYR A CE2 1 
ATOM   3196 C CZ  . TYR A 1 423 ? 0.967   116.466 0.426   1.00 10.69  ? 423  TYR A CZ  1 
ATOM   3197 O OH  . TYR A 1 423 ? 0.551   117.731 0.076   1.00 8.10   ? 423  TYR A OH  1 
ATOM   3198 N N   . SER A 1 424 ? 4.173   112.196 3.749   1.00 15.93  ? 424  SER A N   1 
ATOM   3199 C CA  . SER A 1 424 ? 4.719   112.548 5.042   1.00 10.01  ? 424  SER A CA  1 
ATOM   3200 C C   . SER A 1 424 ? 6.201   112.872 4.932   1.00 11.30  ? 424  SER A C   1 
ATOM   3201 O O   . SER A 1 424 ? 6.630   113.976 5.249   1.00 17.53  ? 424  SER A O   1 
ATOM   3202 C CB  . SER A 1 424 ? 4.526   111.378 6.004   1.00 9.59   ? 424  SER A CB  1 
ATOM   3203 O OG  . SER A 1 424 ? 4.963   111.708 7.309   1.00 21.94  ? 424  SER A OG  1 
ATOM   3204 N N   . ARG A 1 425 ? 6.976   111.905 4.459   1.00 12.39  ? 425  ARG A N   1 
ATOM   3205 C CA  . ARG A 1 425 ? 8.417   112.065 4.352   1.00 12.28  ? 425  ARG A CA  1 
ATOM   3206 C C   . ARG A 1 425 ? 8.878   113.222 3.489   1.00 11.73  ? 425  ARG A C   1 
ATOM   3207 O O   . ARG A 1 425 ? 9.739   113.995 3.902   1.00 18.43  ? 425  ARG A O   1 
ATOM   3208 C CB  . ARG A 1 425 ? 9.053   110.757 3.864   1.00 20.61  ? 425  ARG A CB  1 
ATOM   3209 C CG  . ARG A 1 425 ? 9.181   109.696 4.954   1.00 25.46  ? 425  ARG A CG  1 
ATOM   3210 C CD  . ARG A 1 425 ? 9.819   108.419 4.443   1.00 22.08  ? 425  ARG A CD  1 
ATOM   3211 N NE  . ARG A 1 425 ? 11.269  108.437 4.590   1.00 26.18  ? 425  ARG A NE  1 
ATOM   3212 C CZ  . ARG A 1 425 ? 12.064  107.418 4.278   1.00 29.76  ? 425  ARG A CZ  1 
ATOM   3213 N NH1 . ARG A 1 425 ? 11.549  106.293 3.799   1.00 27.86  ? 425  ARG A NH1 1 
ATOM   3214 N NH2 . ARG A 1 425 ? 13.378  107.524 4.438   1.00 28.44  ? 425  ARG A NH2 1 
ATOM   3215 N N   . ARG A 1 426 ? 8.307   113.355 2.296   1.00 13.00  ? 426  ARG A N   1 
ATOM   3216 C CA  . ARG A 1 426 ? 8.706   114.433 1.391   1.00 9.03   ? 426  ARG A CA  1 
ATOM   3217 C C   . ARG A 1 426 ? 8.358   115.783 1.988   1.00 11.99  ? 426  ARG A C   1 
ATOM   3218 O O   . ARG A 1 426 ? 9.142   116.730 1.925   1.00 17.09  ? 426  ARG A O   1 
ATOM   3219 C CB  . ARG A 1 426 ? 8.011   114.274 0.039   1.00 10.95  ? 426  ARG A CB  1 
ATOM   3220 C CG  . ARG A 1 426 ? 8.544   113.119 -0.786  1.00 7.26   ? 426  ARG A CG  1 
ATOM   3221 C CD  . ARG A 1 426 ? 7.624   112.788 -1.937  1.00 13.27  ? 426  ARG A CD  1 
ATOM   3222 N NE  . ARG A 1 426 ? 8.084   111.611 -2.668  1.00 15.30  ? 426  ARG A NE  1 
ATOM   3223 C CZ  . ARG A 1 426 ? 7.326   110.910 -3.505  1.00 14.10  ? 426  ARG A CZ  1 
ATOM   3224 N NH1 . ARG A 1 426 ? 6.068   111.271 -3.717  1.00 14.54  ? 426  ARG A NH1 1 
ATOM   3225 N NH2 . ARG A 1 426 ? 7.822   109.843 -4.119  1.00 20.40  ? 426  ARG A NH2 1 
ATOM   3226 N N   . PHE A 1 427 ? 7.168   115.856 2.575   1.00 12.20  ? 427  PHE A N   1 
ATOM   3227 C CA  . PHE A 1 427 ? 6.671   117.074 3.200   1.00 8.55   ? 427  PHE A CA  1 
ATOM   3228 C C   . PHE A 1 427 ? 7.583   117.533 4.331   1.00 5.36   ? 427  PHE A C   1 
ATOM   3229 O O   . PHE A 1 427 ? 7.949   118.703 4.410   1.00 5.00   ? 427  PHE A O   1 
ATOM   3230 C CB  . PHE A 1 427 ? 5.255   116.825 3.727   1.00 11.99  ? 427  PHE A CB  1 
ATOM   3231 C CG  . PHE A 1 427 ? 4.716   117.930 4.586   1.00 15.96  ? 427  PHE A CG  1 
ATOM   3232 C CD1 . PHE A 1 427 ? 4.405   119.163 4.039   1.00 12.77  ? 427  PHE A CD1 1 
ATOM   3233 C CD2 . PHE A 1 427 ? 4.496   117.726 5.946   1.00 23.36  ? 427  PHE A CD2 1 
ATOM   3234 C CE1 . PHE A 1 427 ? 3.880   120.175 4.831   1.00 17.51  ? 427  PHE A CE1 1 
ATOM   3235 C CE2 . PHE A 1 427 ? 3.971   118.736 6.746   1.00 19.03  ? 427  PHE A CE2 1 
ATOM   3236 C CZ  . PHE A 1 427 ? 3.663   119.960 6.186   1.00 14.45  ? 427  PHE A CZ  1 
ATOM   3237 N N   . HIS A 1 428 ? 7.962   116.613 5.205   1.00 5.00   ? 428  HIS A N   1 
ATOM   3238 C CA  . HIS A 1 428 ? 8.814   116.992 6.311   1.00 6.95   ? 428  HIS A CA  1 
ATOM   3239 C C   . HIS A 1 428 ? 10.178  117.416 5.820   1.00 6.65   ? 428  HIS A C   1 
ATOM   3240 O O   . HIS A 1 428 ? 10.707  118.436 6.248   1.00 11.95  ? 428  HIS A O   1 
ATOM   3241 C CB  . HIS A 1 428 ? 8.918   115.844 7.312   1.00 15.20  ? 428  HIS A CB  1 
ATOM   3242 C CG  . HIS A 1 428 ? 7.639   115.582 8.047   1.00 26.26  ? 428  HIS A CG  1 
ATOM   3243 N ND1 . HIS A 1 428 ? 6.774   116.591 8.414   1.00 31.64  ? 428  HIS A ND1 1 
ATOM   3244 C CD2 . HIS A 1 428 ? 7.046   114.425 8.425   1.00 25.14  ? 428  HIS A CD2 1 
ATOM   3245 C CE1 . HIS A 1 428 ? 5.703   116.068 8.982   1.00 28.95  ? 428  HIS A CE1 1 
ATOM   3246 N NE2 . HIS A 1 428 ? 5.843   114.755 9.002   1.00 24.78  ? 428  HIS A NE2 1 
ATOM   3247 N N   . LYS A 1 429 ? 10.743  116.648 4.900   1.00 7.60   ? 429  LYS A N   1 
ATOM   3248 C CA  . LYS A 1 429 ? 12.062  116.969 4.360   1.00 8.43   ? 429  LYS A CA  1 
ATOM   3249 C C   . LYS A 1 429 ? 12.114  118.387 3.795   1.00 9.82   ? 429  LYS A C   1 
ATOM   3250 O O   . LYS A 1 429 ? 12.935  119.201 4.210   1.00 13.89  ? 429  LYS A O   1 
ATOM   3251 C CB  . LYS A 1 429 ? 12.440  115.966 3.272   1.00 6.02   ? 429  LYS A CB  1 
ATOM   3252 C CG  . LYS A 1 429 ? 13.858  116.100 2.785   1.00 9.83   ? 429  LYS A CG  1 
ATOM   3253 C CD  . LYS A 1 429 ? 14.409  114.746 2.404   1.00 12.20  ? 429  LYS A CD  1 
ATOM   3254 C CE  . LYS A 1 429 ? 13.927  114.336 1.037   1.00 18.04  ? 429  LYS A CE  1 
ATOM   3255 N NZ  . LYS A 1 429 ? 14.847  114.856 -0.008  1.00 26.70  ? 429  LYS A NZ  1 
ATOM   3256 N N   . THR A 1 430 ? 11.231  118.682 2.847   1.00 13.39  ? 430  THR A N   1 
ATOM   3257 C CA  . THR A 1 430 ? 11.186  120.002 2.236   1.00 11.33  ? 430  THR A CA  1 
ATOM   3258 C C   . THR A 1 430 ? 10.974  121.092 3.277   1.00 11.76  ? 430  THR A C   1 
ATOM   3259 O O   . THR A 1 430 ? 11.613  122.137 3.223   1.00 14.48  ? 430  THR A O   1 
ATOM   3260 C CB  . THR A 1 430 ? 10.050  120.109 1.207   1.00 8.53   ? 430  THR A CB  1 
ATOM   3261 O OG1 . THR A 1 430 ? 10.211  119.106 0.197   1.00 9.30   ? 430  THR A OG1 1 
ATOM   3262 C CG2 . THR A 1 430 ? 10.066  121.472 0.558   1.00 5.60   ? 430  THR A CG2 1 
ATOM   3263 N N   . LEU A 1 431 ? 10.074  120.845 4.223   1.00 12.29  ? 431  LEU A N   1 
ATOM   3264 C CA  . LEU A 1 431 ? 9.773   121.824 5.261   1.00 8.86   ? 431  LEU A CA  1 
ATOM   3265 C C   . LEU A 1 431 ? 10.973  122.141 6.130   1.00 12.63  ? 431  LEU A C   1 
ATOM   3266 O O   . LEU A 1 431 ? 11.194  123.296 6.477   1.00 17.79  ? 431  LEU A O   1 
ATOM   3267 C CB  . LEU A 1 431 ? 8.635   121.330 6.155   1.00 7.64   ? 431  LEU A CB  1 
ATOM   3268 C CG  . LEU A 1 431 ? 8.186   122.310 7.244   1.00 5.04   ? 431  LEU A CG  1 
ATOM   3269 C CD1 . LEU A 1 431 ? 7.611   123.559 6.595   1.00 13.32  ? 431  LEU A CD1 1 
ATOM   3270 C CD2 . LEU A 1 431 ? 7.142   121.663 8.129   1.00 9.87   ? 431  LEU A CD2 1 
ATOM   3271 N N   . ARG A 1 432 ? 11.738  121.114 6.491   1.00 15.00  ? 432  ARG A N   1 
ATOM   3272 C CA  . ARG A 1 432 ? 12.917  121.289 7.336   1.00 14.88  ? 432  ARG A CA  1 
ATOM   3273 C C   . ARG A 1 432 ? 14.022  122.067 6.614   1.00 18.69  ? 432  ARG A C   1 
ATOM   3274 O O   . ARG A 1 432 ? 14.928  122.617 7.238   1.00 21.71  ? 432  ARG A O   1 
ATOM   3275 C CB  . ARG A 1 432 ? 13.459  119.925 7.762   1.00 15.54  ? 432  ARG A CB  1 
ATOM   3276 C CG  . ARG A 1 432 ? 13.054  119.503 9.151   1.00 26.32  ? 432  ARG A CG  1 
ATOM   3277 C CD  . ARG A 1 432 ? 13.471  118.073 9.425   1.00 33.97  ? 432  ARG A CD  1 
ATOM   3278 N NE  . ARG A 1 432 ? 12.676  117.471 10.494  1.00 43.92  ? 432  ARG A NE  1 
ATOM   3279 C CZ  . ARG A 1 432 ? 11.721  116.565 10.298  1.00 53.40  ? 432  ARG A CZ  1 
ATOM   3280 N NH1 . ARG A 1 432 ? 11.436  116.153 9.070   1.00 61.15  ? 432  ARG A NH1 1 
ATOM   3281 N NH2 . ARG A 1 432 ? 11.053  116.059 11.328  1.00 58.09  ? 432  ARG A NH2 1 
ATOM   3282 N N   . ARG A 1 433 ? 13.932  122.111 5.292   1.00 19.82  ? 433  ARG A N   1 
ATOM   3283 C CA  . ARG A 1 433 ? 14.917  122.790 4.472   1.00 13.23  ? 433  ARG A CA  1 
ATOM   3284 C C   . ARG A 1 433 ? 14.556  124.247 4.214   1.00 14.15  ? 433  ARG A C   1 
ATOM   3285 O O   . ARG A 1 433 ? 15.431  125.068 3.978   1.00 20.46  ? 433  ARG A O   1 
ATOM   3286 C CB  . ARG A 1 433 ? 15.050  122.047 3.146   1.00 8.21   ? 433  ARG A CB  1 
ATOM   3287 C CG  . ARG A 1 433 ? 16.171  122.533 2.268   1.00 12.19  ? 433  ARG A CG  1 
ATOM   3288 C CD  . ARG A 1 433 ? 16.306  121.649 1.026   1.00 17.14  ? 433  ARG A CD  1 
ATOM   3289 N NE  . ARG A 1 433 ? 15.103  121.671 0.195   1.00 22.72  ? 433  ARG A NE  1 
ATOM   3290 C CZ  . ARG A 1 433 ? 14.370  120.599 -0.089  1.00 28.85  ? 433  ARG A CZ  1 
ATOM   3291 N NH1 . ARG A 1 433 ? 14.719  119.413 0.393   1.00 32.63  ? 433  ARG A NH1 1 
ATOM   3292 N NH2 . ARG A 1 433 ? 13.282  120.712 -0.843  1.00 26.97  ? 433  ARG A NH2 1 
ATOM   3293 N N   . LEU A 1 434 ? 13.269  124.574 4.266   1.00 15.12  ? 434  LEU A N   1 
ATOM   3294 C CA  . LEU A 1 434 ? 12.822  125.939 4.006   1.00 19.68  ? 434  LEU A CA  1 
ATOM   3295 C C   . LEU A 1 434 ? 12.777  126.779 5.274   1.00 24.51  ? 434  LEU A C   1 
ATOM   3296 O O   . LEU A 1 434 ? 13.161  127.946 5.262   1.00 30.63  ? 434  LEU A O   1 
ATOM   3297 C CB  . LEU A 1 434 ? 11.435  125.929 3.342   1.00 22.82  ? 434  LEU A CB  1 
ATOM   3298 C CG  . LEU A 1 434 ? 11.322  125.371 1.911   1.00 25.41  ? 434  LEU A CG  1 
ATOM   3299 C CD1 . LEU A 1 434 ? 9.916   125.595 1.377   1.00 17.88  ? 434  LEU A CD1 1 
ATOM   3300 C CD2 . LEU A 1 434 ? 12.345  126.042 1.002   1.00 20.52  ? 434  LEU A CD2 1 
ATOM   3301 N N   . VAL A 1 435 ? 12.297  126.173 6.357   1.00 27.86  ? 435  VAL A N   1 
ATOM   3302 C CA  . VAL A 1 435 ? 12.183  126.809 7.676   1.00 30.04  ? 435  VAL A CA  1 
ATOM   3303 C C   . VAL A 1 435 ? 13.195  126.092 8.579   1.00 37.14  ? 435  VAL A C   1 
ATOM   3304 O O   . VAL A 1 435 ? 12.834  125.196 9.341   1.00 41.23  ? 435  VAL A O   1 
ATOM   3305 C CB  . VAL A 1 435 ? 10.776  126.597 8.239   1.00 24.80  ? 435  VAL A CB  1 
ATOM   3306 C CG1 . VAL A 1 435 ? 10.595  127.392 9.502   1.00 28.81  ? 435  VAL A CG1 1 
ATOM   3307 C CG2 . VAL A 1 435 ? 9.746   126.981 7.197   1.00 23.17  ? 435  VAL A CG2 1 
ATOM   3308 N N   . PRO A 1 436 ? 14.464  126.534 8.553   1.00 43.69  ? 436  PRO A N   1 
ATOM   3309 C CA  . PRO A 1 436 ? 15.561  125.942 9.327   1.00 50.81  ? 436  PRO A CA  1 
ATOM   3310 C C   . PRO A 1 436 ? 15.665  126.249 10.825  1.00 57.70  ? 436  PRO A C   1 
ATOM   3311 O O   . PRO A 1 436 ? 15.843  125.330 11.628  1.00 64.90  ? 436  PRO A O   1 
ATOM   3312 C CB  . PRO A 1 436 ? 16.817  126.375 8.563   1.00 47.79  ? 436  PRO A CB  1 
ATOM   3313 C CG  . PRO A 1 436 ? 16.372  127.486 7.623   1.00 46.48  ? 436  PRO A CG  1 
ATOM   3314 C CD  . PRO A 1 436 ? 14.909  127.725 7.812   1.00 44.60  ? 436  PRO A CD  1 
ATOM   3315 N N   . ASP A 1 437 ? 15.575  127.509 11.224  1.00 59.43  ? 437  ASP A N   1 
ATOM   3316 C CA  . ASP A 1 437 ? 15.722  127.799 12.644  1.00 64.30  ? 437  ASP A CA  1 
ATOM   3317 C C   . ASP A 1 437 ? 14.480  127.502 13.466  1.00 62.25  ? 437  ASP A C   1 
ATOM   3318 O O   . ASP A 1 437 ? 13.882  128.403 14.058  1.00 61.73  ? 437  ASP A O   1 
ATOM   3319 C CB  . ASP A 1 437 ? 16.158  129.248 12.826  1.00 77.22  ? 437  ASP A CB  1 
ATOM   3320 C CG  . ASP A 1 437 ? 17.633  129.441 12.552  1.00 87.47  ? 437  ASP A CG  1 
ATOM   3321 O OD1 . ASP A 1 437 ? 17.997  129.639 11.371  1.00 93.56  ? 437  ASP A OD1 1 
ATOM   3322 O OD2 . ASP A 1 437 ? 18.427  129.386 13.517  1.00 91.84  ? 437  ASP A OD2 1 
ATOM   3323 N N   . SER A 1 438 ? 14.105  126.229 13.526  1.00 56.05  ? 438  SER A N   1 
ATOM   3324 C CA  . SER A 1 438 ? 12.914  125.844 14.264  1.00 55.03  ? 438  SER A CA  1 
ATOM   3325 C C   . SER A 1 438 ? 12.732  124.340 14.347  1.00 54.24  ? 438  SER A C   1 
ATOM   3326 O O   . SER A 1 438 ? 13.084  123.620 13.416  1.00 58.11  ? 438  SER A O   1 
ATOM   3327 C CB  . SER A 1 438 ? 11.680  126.431 13.578  1.00 57.35  ? 438  SER A CB  1 
ATOM   3328 O OG  . SER A 1 438 ? 11.479  125.795 12.325  1.00 53.81  ? 438  SER A OG  1 
ATOM   3329 N N   . ASP A 1 439 ? 12.190  123.872 15.468  1.00 51.51  ? 439  ASP A N   1 
ATOM   3330 C CA  . ASP A 1 439 ? 11.906  122.453 15.642  1.00 52.02  ? 439  ASP A CA  1 
ATOM   3331 C C   . ASP A 1 439 ? 10.392  122.313 15.833  1.00 46.26  ? 439  ASP A C   1 
ATOM   3332 O O   . ASP A 1 439 ? 9.825   122.718 16.850  1.00 42.64  ? 439  ASP A O   1 
ATOM   3333 C CB  . ASP A 1 439 ? 12.679  121.857 16.828  1.00 64.30  ? 439  ASP A CB  1 
ATOM   3334 C CG  . ASP A 1 439 ? 12.395  122.559 18.140  1.00 78.57  ? 439  ASP A CG  1 
ATOM   3335 O OD1 . ASP A 1 439 ? 12.115  123.779 18.114  1.00 88.37  ? 439  ASP A OD1 1 
ATOM   3336 O OD2 . ASP A 1 439 ? 12.457  121.888 19.200  1.00 85.51  ? 439  ASP A OD2 1 
ATOM   3337 N N   . VAL A 1 440 ? 9.753   121.743 14.818  1.00 38.98  ? 440  VAL A N   1 
ATOM   3338 C CA  . VAL A 1 440 ? 8.313   121.563 14.793  1.00 33.58  ? 440  VAL A CA  1 
ATOM   3339 C C   . VAL A 1 440 ? 7.914   120.132 15.118  1.00 32.40  ? 440  VAL A C   1 
ATOM   3340 O O   . VAL A 1 440 ? 8.498   119.192 14.590  1.00 37.07  ? 440  VAL A O   1 
ATOM   3341 C CB  . VAL A 1 440 ? 7.772   121.926 13.392  1.00 34.74  ? 440  VAL A CB  1 
ATOM   3342 C CG1 . VAL A 1 440 ? 6.253   121.932 13.397  1.00 37.98  ? 440  VAL A CG1 1 
ATOM   3343 C CG2 . VAL A 1 440 ? 8.329   123.277 12.955  1.00 26.40  ? 440  VAL A CG2 1 
ATOM   3344 N N   . ARG A 1 441 ? 6.926   119.964 15.991  1.00 31.43  ? 441  ARG A N   1 
ATOM   3345 C CA  . ARG A 1 441 ? 6.461   118.628 16.344  1.00 29.86  ? 441  ARG A CA  1 
ATOM   3346 C C   . ARG A 1 441 ? 5.143   118.388 15.637  1.00 31.25  ? 441  ARG A C   1 
ATOM   3347 O O   . ARG A 1 441 ? 4.234   119.206 15.724  1.00 33.17  ? 441  ARG A O   1 
ATOM   3348 C CB  . ARG A 1 441 ? 6.256   118.487 17.851  1.00 32.81  ? 441  ARG A CB  1 
ATOM   3349 C CG  . ARG A 1 441 ? 6.041   117.044 18.289  1.00 40.90  ? 441  ARG A CG  1 
ATOM   3350 C CD  . ARG A 1 441 ? 5.480   116.938 19.698  1.00 48.60  ? 441  ARG A CD  1 
ATOM   3351 N NE  . ARG A 1 441 ? 4.973   115.594 19.978  1.00 54.00  ? 441  ARG A NE  1 
ATOM   3352 C CZ  . ARG A 1 441 ? 4.319   115.253 21.086  1.00 58.81  ? 441  ARG A CZ  1 
ATOM   3353 N NH1 . ARG A 1 441 ? 4.087   116.155 22.031  1.00 65.79  ? 441  ARG A NH1 1 
ATOM   3354 N NH2 . ARG A 1 441 ? 3.896   114.007 21.254  1.00 58.88  ? 441  ARG A NH2 1 
ATOM   3355 N N   . PHE A 1 442 ? 5.043   117.265 14.935  1.00 31.91  ? 442  PHE A N   1 
ATOM   3356 C CA  . PHE A 1 442 ? 3.832   116.935 14.202  1.00 29.61  ? 442  PHE A CA  1 
ATOM   3357 C C   . PHE A 1 442 ? 3.051   115.822 14.876  1.00 33.07  ? 442  PHE A C   1 
ATOM   3358 O O   . PHE A 1 442 ? 3.475   114.668 14.901  1.00 36.65  ? 442  PHE A O   1 
ATOM   3359 C CB  . PHE A 1 442 ? 4.177   116.548 12.759  1.00 18.77  ? 442  PHE A CB  1 
ATOM   3360 C CG  . PHE A 1 442 ? 4.451   117.728 11.878  1.00 18.06  ? 442  PHE A CG  1 
ATOM   3361 C CD1 . PHE A 1 442 ? 3.401   118.468 11.340  1.00 20.91  ? 442  PHE A CD1 1 
ATOM   3362 C CD2 . PHE A 1 442 ? 5.754   118.132 11.619  1.00 16.01  ? 442  PHE A CD2 1 
ATOM   3363 C CE1 . PHE A 1 442 ? 3.643   119.595 10.557  1.00 18.06  ? 442  PHE A CE1 1 
ATOM   3364 C CE2 . PHE A 1 442 ? 6.010   119.261 10.834  1.00 25.07  ? 442  PHE A CE2 1 
ATOM   3365 C CZ  . PHE A 1 442 ? 4.952   119.994 10.304  1.00 21.13  ? 442  PHE A CZ  1 
ATOM   3366 N N   . LEU A 1 443 ? 1.900   116.191 15.423  1.00 32.73  ? 443  LEU A N   1 
ATOM   3367 C CA  . LEU A 1 443 ? 1.027   115.258 16.106  1.00 31.76  ? 443  LEU A CA  1 
ATOM   3368 C C   . LEU A 1 443 ? -0.122  114.848 15.195  1.00 32.92  ? 443  LEU A C   1 
ATOM   3369 O O   . LEU A 1 443 ? -0.841  115.700 14.688  1.00 33.74  ? 443  LEU A O   1 
ATOM   3370 C CB  . LEU A 1 443 ? 0.464   115.926 17.356  1.00 37.55  ? 443  LEU A CB  1 
ATOM   3371 C CG  . LEU A 1 443 ? 0.578   115.205 18.694  1.00 39.53  ? 443  LEU A CG  1 
ATOM   3372 C CD1 . LEU A 1 443 ? 1.974   114.628 18.854  1.00 40.67  ? 443  LEU A CD1 1 
ATOM   3373 C CD2 . LEU A 1 443 ? 0.261   116.194 19.810  1.00 42.31  ? 443  LEU A CD2 1 
ATOM   3374 N N   . LEU A 1 444 ? -0.285  113.548 14.976  1.00 38.13  ? 444  LEU A N   1 
ATOM   3375 C CA  . LEU A 1 444 ? -1.380  113.039 14.148  1.00 40.12  ? 444  LEU A CA  1 
ATOM   3376 C C   . LEU A 1 444 ? -2.541  112.730 15.098  1.00 46.47  ? 444  LEU A C   1 
ATOM   3377 O O   . LEU A 1 444 ? -2.328  112.400 16.269  1.00 43.80  ? 444  LEU A O   1 
ATOM   3378 C CB  . LEU A 1 444 ? -0.944  111.767 13.409  1.00 33.99  ? 444  LEU A CB  1 
ATOM   3379 C CG  . LEU A 1 444 ? -1.600  111.296 12.101  1.00 26.99  ? 444  LEU A CG  1 
ATOM   3380 C CD1 . LEU A 1 444 ? -3.046  111.737 11.997  1.00 27.74  ? 444  LEU A CD1 1 
ATOM   3381 C CD2 . LEU A 1 444 ? -0.801  111.842 10.944  1.00 36.35  ? 444  LEU A CD2 1 
ATOM   3382 N N   . SER A 1 445 ? -3.766  112.837 14.600  1.00 55.29  ? 445  SER A N   1 
ATOM   3383 C CA  . SER A 1 445 ? -4.938  112.586 15.430  1.00 63.52  ? 445  SER A CA  1 
ATOM   3384 C C   . SER A 1 445 ? -5.839  111.511 14.842  1.00 69.13  ? 445  SER A C   1 
ATOM   3385 O O   . SER A 1 445 ? -6.005  111.425 13.622  1.00 71.40  ? 445  SER A O   1 
ATOM   3386 C CB  . SER A 1 445 ? -5.734  113.880 15.590  1.00 63.86  ? 445  SER A CB  1 
ATOM   3387 O OG  . SER A 1 445 ? -5.888  114.527 14.336  1.00 57.06  ? 445  SER A OG  1 
ATOM   3388 N N   . GLU A 1 446 ? -6.422  110.691 15.714  1.00 74.79  ? 446  GLU A N   1 
ATOM   3389 C CA  . GLU A 1 446 ? -7.323  109.624 15.279  1.00 85.66  ? 446  GLU A CA  1 
ATOM   3390 C C   . GLU A 1 446 ? -8.490  110.259 14.529  1.00 91.10  ? 446  GLU A C   1 
ATOM   3391 O O   . GLU A 1 446 ? -8.488  110.313 13.294  1.00 94.21  ? 446  GLU A O   1 
ATOM   3392 C CB  . GLU A 1 446 ? -7.843  108.837 16.485  1.00 88.72  ? 446  GLU A CB  1 
ATOM   3393 C CG  . GLU A 1 446 ? -6.749  108.120 17.274  1.00 96.94  ? 446  GLU A CG  1 
ATOM   3394 C CD  . GLU A 1 446 ? -6.213  108.948 18.437  1.00 100.00 ? 446  GLU A CD  1 
ATOM   3395 O OE1 . GLU A 1 446 ? -5.837  110.125 18.221  1.00 100.00 ? 446  GLU A OE1 1 
ATOM   3396 O OE2 . GLU A 1 446 ? -6.167  108.417 19.570  1.00 100.00 ? 446  GLU A OE2 1 
ATOM   3397 N N   . SER A 1 447 ? -9.490  110.731 15.271  1.00 95.69  ? 447  SER A N   1 
ATOM   3398 C CA  . SER A 1 447 ? -10.630 111.393 14.647  1.00 96.14  ? 447  SER A CA  1 
ATOM   3399 C C   . SER A 1 447 ? -10.233 112.842 14.408  1.00 95.64  ? 447  SER A C   1 
ATOM   3400 O O   . SER A 1 447 ? -10.782 113.509 13.534  1.00 100.00 ? 447  SER A O   1 
ATOM   3401 C CB  . SER A 1 447 ? -11.870 111.337 15.537  1.00 94.72  ? 447  SER A CB  1 
ATOM   3402 O OG  . SER A 1 447 ? -13.046 111.456 14.751  1.00 92.08  ? 447  SER A OG  1 
ATOM   3403 N N   . GLY A 1 448 ? -9.280  113.318 15.204  1.00 93.21  ? 448  GLY A N   1 
ATOM   3404 C CA  . GLY A 1 448 ? -8.773  114.670 15.047  1.00 90.48  ? 448  GLY A CA  1 
ATOM   3405 C C   . GLY A 1 448 ? -9.718  115.833 15.262  1.00 88.85  ? 448  GLY A C   1 
ATOM   3406 O O   . GLY A 1 448 ? -9.363  116.796 15.929  1.00 90.14  ? 448  GLY A O   1 
ATOM   3407 N N   . SER A 1 449 ? -10.907 115.776 14.677  1.00 88.67  ? 449  SER A N   1 
ATOM   3408 C CA  . SER A 1 449 ? -11.877 116.855 14.841  1.00 87.86  ? 449  SER A CA  1 
ATOM   3409 C C   . SER A 1 449 ? -13.061 116.324 15.632  1.00 84.47  ? 449  SER A C   1 
ATOM   3410 O O   . SER A 1 449 ? -14.023 117.044 15.904  1.00 85.11  ? 449  SER A O   1 
ATOM   3411 C CB  . SER A 1 449 ? -12.353 117.384 13.481  1.00 90.79  ? 449  SER A CB  1 
ATOM   3412 O OG  . SER A 1 449 ? -11.610 116.828 12.408  1.00 96.25  ? 449  SER A OG  1 
ATOM   3413 N N   . GLY A 1 450 ? -12.982 115.047 15.986  1.00 80.75  ? 450  GLY A N   1 
ATOM   3414 C CA  . GLY A 1 450 ? -14.037 114.434 16.760  1.00 73.94  ? 450  GLY A CA  1 
ATOM   3415 C C   . GLY A 1 450 ? -13.888 114.894 18.192  1.00 70.17  ? 450  GLY A C   1 
ATOM   3416 O O   . GLY A 1 450 ? -14.814 115.447 18.777  1.00 72.02  ? 450  GLY A O   1 
ATOM   3417 N N   . LYS A 1 451 ? -12.705 114.675 18.754  1.00 67.34  ? 451  LYS A N   1 
ATOM   3418 C CA  . LYS A 1 451 ? -12.432 115.075 20.129  1.00 64.36  ? 451  LYS A CA  1 
ATOM   3419 C C   . LYS A 1 451 ? -12.274 116.590 20.229  1.00 59.13  ? 451  LYS A C   1 
ATOM   3420 O O   . LYS A 1 451 ? -12.436 117.172 21.302  1.00 54.65  ? 451  LYS A O   1 
ATOM   3421 C CB  . LYS A 1 451 ? -11.156 114.390 20.629  1.00 69.47  ? 451  LYS A CB  1 
ATOM   3422 C CG  . LYS A 1 451 ? -11.103 114.193 22.142  1.00 74.98  ? 451  LYS A CG  1 
ATOM   3423 C CD  . LYS A 1 451 ? -9.688  114.361 22.687  1.00 75.24  ? 451  LYS A CD  1 
ATOM   3424 C CE  . LYS A 1 451 ? -8.909  113.054 22.616  1.00 76.46  ? 451  LYS A CE  1 
ATOM   3425 N NZ  . LYS A 1 451 ? -7.452  113.247 22.879  1.00 77.54  ? 451  LYS A NZ  1 
ATOM   3426 N N   . GLY A 1 452 ? -11.962 117.218 19.098  1.00 56.30  ? 452  GLY A N   1 
ATOM   3427 C CA  . GLY A 1 452 ? -11.766 118.656 19.065  1.00 46.92  ? 452  GLY A CA  1 
ATOM   3428 C C   . GLY A 1 452 ? -13.040 119.433 19.298  1.00 42.19  ? 452  GLY A C   1 
ATOM   3429 O O   . GLY A 1 452 ? -13.117 120.250 20.213  1.00 42.69  ? 452  GLY A O   1 
ATOM   3430 N N   . ALA A 1 453 ? -14.045 119.186 18.466  1.00 38.18  ? 453  ALA A N   1 
ATOM   3431 C CA  . ALA A 1 453 ? -15.318 119.872 18.602  1.00 36.14  ? 453  ALA A CA  1 
ATOM   3432 C C   . ALA A 1 453 ? -15.843 119.680 20.029  1.00 41.23  ? 453  ALA A C   1 
ATOM   3433 O O   . ALA A 1 453 ? -16.554 120.537 20.562  1.00 46.10  ? 453  ALA A O   1 
ATOM   3434 C CB  . ALA A 1 453 ? -16.316 119.326 17.587  1.00 22.17  ? 453  ALA A CB  1 
ATOM   3435 N N   . ALA A 1 454 ? -15.469 118.562 20.647  1.00 39.17  ? 454  ALA A N   1 
ATOM   3436 C CA  . ALA A 1 454 ? -15.901 118.244 22.005  1.00 37.51  ? 454  ALA A CA  1 
ATOM   3437 C C   . ALA A 1 454 ? -15.280 119.160 23.054  1.00 36.34  ? 454  ALA A C   1 
ATOM   3438 O O   . ALA A 1 454 ? -15.940 119.546 24.020  1.00 34.99  ? 454  ALA A O   1 
ATOM   3439 C CB  . ALA A 1 454 ? -15.564 116.796 22.327  1.00 37.50  ? 454  ALA A CB  1 
ATOM   3440 N N   . MET A 1 455 ? -14.009 119.500 22.866  1.00 36.43  ? 455  MET A N   1 
ATOM   3441 C CA  . MET A 1 455 ? -13.297 120.361 23.806  1.00 35.63  ? 455  MET A CA  1 
ATOM   3442 C C   . MET A 1 455 ? -13.808 121.788 23.711  1.00 34.62  ? 455  MET A C   1 
ATOM   3443 O O   . MET A 1 455 ? -13.863 122.509 24.703  1.00 35.32  ? 455  MET A O   1 
ATOM   3444 C CB  . MET A 1 455 ? -11.793 120.336 23.519  1.00 42.60  ? 455  MET A CB  1 
ATOM   3445 C CG  . MET A 1 455 ? -11.144 118.959 23.647  1.00 47.59  ? 455  MET A CG  1 
ATOM   3446 S SD  . MET A 1 455 ? -10.632 118.605 25.337  1.00 56.01  ? 455  MET A SD  1 
ATOM   3447 C CE  . MET A 1 455 ? -12.155 118.009 26.045  1.00 43.27  ? 455  MET A CE  1 
ATOM   3448 N N   . VAL A 1 456 ? -14.172 122.199 22.506  1.00 35.26  ? 456  VAL A N   1 
ATOM   3449 C CA  . VAL A 1 456 ? -14.689 123.539 22.312  1.00 31.97  ? 456  VAL A CA  1 
ATOM   3450 C C   . VAL A 1 456 ? -16.118 123.566 22.841  1.00 36.63  ? 456  VAL A C   1 
ATOM   3451 O O   . VAL A 1 456 ? -16.525 124.522 23.501  1.00 43.15  ? 456  VAL A O   1 
ATOM   3452 C CB  . VAL A 1 456 ? -14.644 123.938 20.826  1.00 25.18  ? 456  VAL A CB  1 
ATOM   3453 C CG1 . VAL A 1 456 ? -15.703 124.997 20.519  1.00 25.60  ? 456  VAL A CG1 1 
ATOM   3454 C CG2 . VAL A 1 456 ? -13.258 124.464 20.496  1.00 22.30  ? 456  VAL A CG2 1 
ATOM   3455 N N   . THR A 1 457 ? -16.877 122.513 22.559  1.00 35.66  ? 457  THR A N   1 
ATOM   3456 C CA  . THR A 1 457 ? -18.247 122.432 23.047  1.00 35.05  ? 457  THR A CA  1 
ATOM   3457 C C   . THR A 1 457 ? -18.204 122.549 24.571  1.00 34.98  ? 457  THR A C   1 
ATOM   3458 O O   . THR A 1 457 ? -18.936 123.338 25.163  1.00 35.75  ? 457  THR A O   1 
ATOM   3459 C CB  . THR A 1 457 ? -18.895 121.095 22.654  1.00 33.70  ? 457  THR A CB  1 
ATOM   3460 O OG1 . THR A 1 457 ? -19.320 121.164 21.291  1.00 39.66  ? 457  THR A OG1 1 
ATOM   3461 C CG2 . THR A 1 457 ? -20.094 120.795 23.535  1.00 34.50  ? 457  THR A CG2 1 
ATOM   3462 N N   . ALA A 1 458 ? -17.328 121.764 25.189  1.00 34.24  ? 458  ALA A N   1 
ATOM   3463 C CA  . ALA A 1 458 ? -17.162 121.764 26.637  1.00 36.26  ? 458  ALA A CA  1 
ATOM   3464 C C   . ALA A 1 458 ? -17.108 123.181 27.205  1.00 38.29  ? 458  ALA A C   1 
ATOM   3465 O O   . ALA A 1 458 ? -17.891 123.540 28.088  1.00 43.46  ? 458  ALA A O   1 
ATOM   3466 C CB  . ALA A 1 458 ? -15.886 121.007 27.010  1.00 37.90  ? 458  ALA A CB  1 
ATOM   3467 N N   . VAL A 1 459 ? -16.180 123.983 26.694  1.00 34.64  ? 459  VAL A N   1 
ATOM   3468 C CA  . VAL A 1 459 ? -16.011 125.356 27.151  1.00 27.52  ? 459  VAL A CA  1 
ATOM   3469 C C   . VAL A 1 459 ? -17.237 126.208 26.884  1.00 27.78  ? 459  VAL A C   1 
ATOM   3470 O O   . VAL A 1 459 ? -17.589 127.074 27.682  1.00 31.25  ? 459  VAL A O   1 
ATOM   3471 C CB  . VAL A 1 459 ? -14.828 126.019 26.462  1.00 21.67  ? 459  VAL A CB  1 
ATOM   3472 C CG1 . VAL A 1 459 ? -14.578 127.364 27.078  1.00 27.88  ? 459  VAL A CG1 1 
ATOM   3473 C CG2 . VAL A 1 459 ? -13.602 125.138 26.580  1.00 26.58  ? 459  VAL A CG2 1 
ATOM   3474 N N   . ALA A 1 460 ? -17.876 125.969 25.746  1.00 29.15  ? 460  ALA A N   1 
ATOM   3475 C CA  . ALA A 1 460 ? -19.063 126.717 25.374  1.00 31.85  ? 460  ALA A CA  1 
ATOM   3476 C C   . ALA A 1 460 ? -20.176 126.453 26.375  1.00 37.66  ? 460  ALA A C   1 
ATOM   3477 O O   . ALA A 1 460 ? -20.847 127.383 26.819  1.00 44.08  ? 460  ALA A O   1 
ATOM   3478 C CB  . ALA A 1 460 ? -19.511 126.328 23.978  1.00 36.32  ? 460  ALA A CB  1 
ATOM   3479 N N   . TYR A 1 461 ? -20.377 125.186 26.729  1.00 38.07  ? 461  TYR A N   1 
ATOM   3480 C CA  . TYR A 1 461 ? -21.413 124.836 27.693  1.00 36.52  ? 461  TYR A CA  1 
ATOM   3481 C C   . TYR A 1 461 ? -21.107 125.532 29.009  1.00 34.49  ? 461  TYR A C   1 
ATOM   3482 O O   . TYR A 1 461 ? -21.966 126.184 29.593  1.00 32.29  ? 461  TYR A O   1 
ATOM   3483 C CB  . TYR A 1 461 ? -21.458 123.328 27.917  1.00 35.91  ? 461  TYR A CB  1 
ATOM   3484 C CG  . TYR A 1 461 ? -22.806 122.851 28.392  1.00 43.63  ? 461  TYR A CG  1 
ATOM   3485 C CD1 . TYR A 1 461 ? -23.967 123.196 27.699  1.00 50.73  ? 461  TYR A CD1 1 
ATOM   3486 C CD2 . TYR A 1 461 ? -22.931 122.061 29.534  1.00 43.99  ? 461  TYR A CD2 1 
ATOM   3487 C CE1 . TYR A 1 461 ? -25.220 122.766 28.126  1.00 53.75  ? 461  TYR A CE1 1 
ATOM   3488 C CE2 . TYR A 1 461 ? -24.182 121.624 29.972  1.00 50.39  ? 461  TYR A CE2 1 
ATOM   3489 C CZ  . TYR A 1 461 ? -25.322 121.981 29.261  1.00 54.22  ? 461  TYR A CZ  1 
ATOM   3490 O OH  . TYR A 1 461 ? -26.564 121.548 29.668  1.00 59.15  ? 461  TYR A OH  1 
ATOM   3491 N N   . ARG A 1 462 ? -19.866 125.384 29.458  1.00 31.16  ? 462  ARG A N   1 
ATOM   3492 C CA  . ARG A 1 462 ? -19.399 125.998 30.688  1.00 31.21  ? 462  ARG A CA  1 
ATOM   3493 C C   . ARG A 1 462 ? -19.875 127.439 30.775  1.00 32.10  ? 462  ARG A C   1 
ATOM   3494 O O   . ARG A 1 462 ? -20.652 127.786 31.658  1.00 37.20  ? 462  ARG A O   1 
ATOM   3495 C CB  . ARG A 1 462 ? -17.878 125.959 30.727  1.00 34.75  ? 462  ARG A CB  1 
ATOM   3496 C CG  . ARG A 1 462 ? -17.264 126.567 31.962  1.00 46.95  ? 462  ARG A CG  1 
ATOM   3497 C CD  . ARG A 1 462 ? -15.795 126.168 32.069  1.00 64.52  ? 462  ARG A CD  1 
ATOM   3498 N NE  . ARG A 1 462 ? -14.890 127.310 31.945  1.00 78.87  ? 462  ARG A NE  1 
ATOM   3499 C CZ  . ARG A 1 462 ? -14.875 128.154 30.915  1.00 83.09  ? 462  ARG A CZ  1 
ATOM   3500 N NH1 . ARG A 1 462 ? -15.720 127.993 29.904  1.00 87.13  ? 462  ARG A NH1 1 
ATOM   3501 N NH2 . ARG A 1 462 ? -14.012 129.163 30.900  1.00 83.02  ? 462  ARG A NH2 1 
ATOM   3502 N N   . LEU A 1 463 ? -19.411 128.277 29.856  1.00 29.02  ? 463  LEU A N   1 
ATOM   3503 C CA  . LEU A 1 463 ? -19.803 129.682 29.847  1.00 33.13  ? 463  LEU A CA  1 
ATOM   3504 C C   . LEU A 1 463 ? -21.317 129.887 29.734  1.00 35.31  ? 463  LEU A C   1 
ATOM   3505 O O   . LEU A 1 463 ? -21.832 130.951 30.077  1.00 35.01  ? 463  LEU A O   1 
ATOM   3506 C CB  . LEU A 1 463 ? -19.116 130.413 28.694  1.00 29.08  ? 463  LEU A CB  1 
ATOM   3507 C CG  . LEU A 1 463 ? -17.613 130.199 28.555  1.00 31.46  ? 463  LEU A CG  1 
ATOM   3508 C CD1 . LEU A 1 463 ? -17.118 130.955 27.343  1.00 34.28  ? 463  LEU A CD1 1 
ATOM   3509 C CD2 . LEU A 1 463 ? -16.900 130.682 29.803  1.00 33.68  ? 463  LEU A CD2 1 
ATOM   3510 N N   . ALA A 1 464 ? -22.026 128.877 29.245  1.00 37.10  ? 464  ALA A N   1 
ATOM   3511 C CA  . ALA A 1 464 ? -23.471 128.977 29.086  1.00 40.68  ? 464  ALA A CA  1 
ATOM   3512 C C   . ALA A 1 464 ? -24.166 128.884 30.437  1.00 46.24  ? 464  ALA A C   1 
ATOM   3513 O O   . ALA A 1 464 ? -25.179 129.546 30.673  1.00 48.32  ? 464  ALA A O   1 
ATOM   3514 C CB  . ALA A 1 464 ? -23.971 127.871 28.165  1.00 42.13  ? 464  ALA A CB  1 
ATOM   3515 N N   . GLU A 1 465 ? -23.617 128.052 31.317  1.00 47.78  ? 465  GLU A N   1 
ATOM   3516 C CA  . GLU A 1 465 ? -24.171 127.855 32.652  1.00 50.59  ? 465  GLU A CA  1 
ATOM   3517 C C   . GLU A 1 465 ? -23.869 129.055 33.540  1.00 49.27  ? 465  GLU A C   1 
ATOM   3518 O O   . GLU A 1 465 ? -24.698 129.456 34.360  1.00 50.73  ? 465  GLU A O   1 
ATOM   3519 C CB  . GLU A 1 465 ? -23.587 126.590 33.284  1.00 57.75  ? 465  GLU A CB  1 
ATOM   3520 C CG  . GLU A 1 465 ? -24.136 125.304 32.703  1.00 63.46  ? 465  GLU A CG  1 
ATOM   3521 C CD  . GLU A 1 465 ? -25.641 125.338 32.557  1.00 69.85  ? 465  GLU A CD  1 
ATOM   3522 O OE1 . GLU A 1 465 ? -26.130 125.806 31.503  1.00 72.11  ? 465  GLU A OE1 1 
ATOM   3523 O OE2 . GLU A 1 465 ? -26.334 124.899 33.501  1.00 75.29  ? 465  GLU A OE2 1 
ATOM   3524 N N   . GLN A 1 466 ? -22.672 129.612 33.377  1.00 45.32  ? 466  GLN A N   1 
ATOM   3525 C CA  . GLN A 1 466 ? -22.258 130.779 34.142  1.00 39.85  ? 466  GLN A CA  1 
ATOM   3526 C C   . GLN A 1 466 ? -23.259 131.887 33.883  1.00 39.35  ? 466  GLN A C   1 
ATOM   3527 O O   . GLN A 1 466 ? -23.703 132.566 34.801  1.00 46.06  ? 466  GLN A O   1 
ATOM   3528 C CB  . GLN A 1 466 ? -20.878 131.246 33.698  1.00 39.98  ? 466  GLN A CB  1 
ATOM   3529 C CG  . GLN A 1 466 ? -19.740 130.370 34.175  1.00 42.42  ? 466  GLN A CG  1 
ATOM   3530 C CD  . GLN A 1 466 ? -18.398 131.064 34.057  1.00 46.28  ? 466  GLN A CD  1 
ATOM   3531 O OE1 . GLN A 1 466 ? -17.360 130.485 34.387  1.00 50.81  ? 466  GLN A OE1 1 
ATOM   3532 N NE2 . GLN A 1 466 ? -18.409 132.314 33.585  1.00 33.27  ? 466  GLN A NE2 1 
ATOM   3533 N N   . HIS A 1 467 ? -23.617 132.059 32.619  1.00 37.58  ? 467  HIS A N   1 
ATOM   3534 C CA  . HIS A 1 467 ? -24.567 133.084 32.244  1.00 38.24  ? 467  HIS A CA  1 
ATOM   3535 C C   . HIS A 1 467 ? -25.959 132.740 32.741  1.00 36.44  ? 467  HIS A C   1 
ATOM   3536 O O   . HIS A 1 467 ? -26.711 133.625 33.131  1.00 40.04  ? 467  HIS A O   1 
ATOM   3537 C CB  . HIS A 1 467 ? -24.587 133.260 30.728  1.00 48.91  ? 467  HIS A CB  1 
ATOM   3538 C CG  . HIS A 1 467 ? -25.459 134.385 30.265  1.00 61.69  ? 467  HIS A CG  1 
ATOM   3539 N ND1 . HIS A 1 467 ? -26.719 134.185 29.741  1.00 65.63  ? 467  HIS A ND1 1 
ATOM   3540 C CD2 . HIS A 1 467 ? -25.252 135.725 30.247  1.00 65.08  ? 467  HIS A CD2 1 
ATOM   3541 C CE1 . HIS A 1 467 ? -27.250 135.351 29.420  1.00 69.01  ? 467  HIS A CE1 1 
ATOM   3542 N NE2 . HIS A 1 467 ? -26.381 136.301 29.716  1.00 68.91  ? 467  HIS A NE2 1 
ATOM   3543 N N   . ARG A 1 468 ? -26.314 131.461 32.718  1.00 34.00  ? 468  ARG A N   1 
ATOM   3544 C CA  . ARG A 1 468 ? -27.632 131.066 33.192  1.00 36.08  ? 468  ARG A CA  1 
ATOM   3545 C C   . ARG A 1 468 ? -27.709 131.368 34.681  1.00 35.34  ? 468  ARG A C   1 
ATOM   3546 O O   . ARG A 1 468 ? -28.714 131.866 35.183  1.00 36.26  ? 468  ARG A O   1 
ATOM   3547 C CB  . ARG A 1 468 ? -27.865 129.576 32.960  1.00 41.43  ? 468  ARG A CB  1 
ATOM   3548 C CG  . ARG A 1 468 ? -29.309 129.141 33.188  1.00 50.02  ? 468  ARG A CG  1 
ATOM   3549 C CD  . ARG A 1 468 ? -29.444 128.221 34.395  1.00 52.42  ? 468  ARG A CD  1 
ATOM   3550 N NE  . ARG A 1 468 ? -28.175 127.597 34.745  1.00 64.03  ? 468  ARG A NE  1 
ATOM   3551 C CZ  . ARG A 1 468 ? -27.928 126.994 35.904  1.00 72.04  ? 468  ARG A CZ  1 
ATOM   3552 N NH1 . ARG A 1 468 ? -28.871 126.930 36.837  1.00 72.93  ? 468  ARG A NH1 1 
ATOM   3553 N NH2 . ARG A 1 468 ? -26.735 126.459 36.131  1.00 75.29  ? 468  ARG A NH2 1 
ATOM   3554 N N   . GLN A 1 469 ? -26.627 131.065 35.381  1.00 34.05  ? 469  GLN A N   1 
ATOM   3555 C CA  . GLN A 1 469 ? -26.558 131.309 36.807  1.00 37.23  ? 469  GLN A CA  1 
ATOM   3556 C C   . GLN A 1 469 ? -26.611 132.807 37.104  1.00 36.87  ? 469  GLN A C   1 
ATOM   3557 O O   . GLN A 1 469 ? -27.516 133.279 37.786  1.00 40.11  ? 469  GLN A O   1 
ATOM   3558 C CB  . GLN A 1 469 ? -25.276 130.700 37.364  1.00 41.04  ? 469  GLN A CB  1 
ATOM   3559 C CG  . GLN A 1 469 ? -25.260 129.180 37.309  1.00 47.43  ? 469  GLN A CG  1 
ATOM   3560 C CD  . GLN A 1 469 ? -24.095 128.583 38.073  1.00 54.76  ? 469  GLN A CD  1 
ATOM   3561 O OE1 . GLN A 1 469 ? -23.191 127.989 37.481  1.00 60.63  ? 469  GLN A OE1 1 
ATOM   3562 N NE2 . GLN A 1 469 ? -24.106 128.740 39.395  1.00 51.98  ? 469  GLN A NE2 1 
ATOM   3563 N N   . ILE A 1 470 ? -25.639 133.551 36.587  1.00 35.64  ? 470  ILE A N   1 
ATOM   3564 C CA  . ILE A 1 470 ? -25.583 134.994 36.789  1.00 29.96  ? 470  ILE A CA  1 
ATOM   3565 C C   . ILE A 1 470 ? -26.947 135.632 36.533  1.00 31.44  ? 470  ILE A C   1 
ATOM   3566 O O   . ILE A 1 470 ? -27.357 136.542 37.247  1.00 37.99  ? 470  ILE A O   1 
ATOM   3567 C CB  . ILE A 1 470 ? -24.535 135.648 35.847  1.00 25.27  ? 470  ILE A CB  1 
ATOM   3568 C CG1 . ILE A 1 470 ? -23.131 135.151 36.203  1.00 26.52  ? 470  ILE A CG1 1 
ATOM   3569 C CG2 . ILE A 1 470 ? -24.581 137.158 35.973  1.00 31.12  ? 470  ILE A CG2 1 
ATOM   3570 C CD1 . ILE A 1 470 ? -22.057 135.531 35.198  1.00 18.35  ? 470  ILE A CD1 1 
ATOM   3571 N N   . GLU A 1 471 ? -27.655 135.145 35.523  1.00 33.49  ? 471  GLU A N   1 
ATOM   3572 C CA  . GLU A 1 471 ? -28.959 135.692 35.193  1.00 39.04  ? 471  GLU A CA  1 
ATOM   3573 C C   . GLU A 1 471 ? -29.978 135.423 36.281  1.00 38.63  ? 471  GLU A C   1 
ATOM   3574 O O   . GLU A 1 471 ? -30.859 136.237 36.528  1.00 41.85  ? 471  GLU A O   1 
ATOM   3575 C CB  . GLU A 1 471 ? -29.455 135.120 33.869  1.00 51.87  ? 471  GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 471 ? -28.779 135.723 32.641  1.00 72.31  ? 471  GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 471 ? -28.962 137.233 32.533  1.00 84.38  ? 471  GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 471 ? -29.503 137.847 33.481  1.00 92.00  ? 471  GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 471 ? -28.563 137.810 31.496  1.00 91.83  ? 471  GLU A OE2 1 
ATOM   3580 N N   . GLU A 1 472 ? -29.865 134.276 36.931  1.00 41.16  ? 472  GLU A N   1 
ATOM   3581 C CA  . GLU A 1 472 ? -30.793 133.949 38.000  1.00 46.16  ? 472  GLU A CA  1 
ATOM   3582 C C   . GLU A 1 472 ? -30.533 134.827 39.221  1.00 43.27  ? 472  GLU A C   1 
ATOM   3583 O O   . GLU A 1 472 ? -31.473 135.331 39.835  1.00 47.09  ? 472  GLU A O   1 
ATOM   3584 C CB  . GLU A 1 472 ? -30.664 132.476 38.377  1.00 54.93  ? 472  GLU A CB  1 
ATOM   3585 C CG  . GLU A 1 472 ? -31.558 131.559 37.558  1.00 73.17  ? 472  GLU A CG  1 
ATOM   3586 C CD  . GLU A 1 472 ? -31.025 130.137 37.482  1.00 82.70  ? 472  GLU A CD  1 
ATOM   3587 O OE1 . GLU A 1 472 ? -30.613 129.599 38.535  1.00 87.82  ? 472  GLU A OE1 1 
ATOM   3588 O OE2 . GLU A 1 472 ? -31.017 129.559 36.370  1.00 84.79  ? 472  GLU A OE2 1 
ATOM   3589 N N   . THR A 1 473 ? -29.258 135.010 39.563  1.00 37.98  ? 473  THR A N   1 
ATOM   3590 C CA  . THR A 1 473 ? -28.858 135.833 40.707  1.00 29.61  ? 473  THR A CA  1 
ATOM   3591 C C   . THR A 1 473 ? -29.363 137.257 40.584  1.00 29.67  ? 473  THR A C   1 
ATOM   3592 O O   . THR A 1 473 ? -29.876 137.827 41.538  1.00 35.66  ? 473  THR A O   1 
ATOM   3593 C CB  . THR A 1 473 ? -27.343 135.927 40.834  1.00 27.84  ? 473  THR A CB  1 
ATOM   3594 O OG1 . THR A 1 473 ? -26.814 134.653 41.205  1.00 41.05  ? 473  THR A OG1 1 
ATOM   3595 C CG2 . THR A 1 473 ? -26.965 136.950 41.889  1.00 31.29  ? 473  THR A CG2 1 
ATOM   3596 N N   . LEU A 1 474 ? -29.201 137.835 39.404  1.00 25.08  ? 474  LEU A N   1 
ATOM   3597 C CA  . LEU A 1 474 ? -29.633 139.199 39.177  1.00 23.89  ? 474  LEU A CA  1 
ATOM   3598 C C   . LEU A 1 474 ? -31.145 139.336 39.030  1.00 23.12  ? 474  LEU A C   1 
ATOM   3599 O O   . LEU A 1 474 ? -31.681 140.443 39.032  1.00 22.04  ? 474  LEU A O   1 
ATOM   3600 C CB  . LEU A 1 474 ? -28.928 139.752 37.940  1.00 23.37  ? 474  LEU A CB  1 
ATOM   3601 C CG  . LEU A 1 474 ? -27.399 139.700 38.007  1.00 21.78  ? 474  LEU A CG  1 
ATOM   3602 C CD1 . LEU A 1 474 ? -26.844 140.410 36.796  1.00 23.80  ? 474  LEU A CD1 1 
ATOM   3603 C CD2 . LEU A 1 474 ? -26.886 140.351 39.281  1.00 13.00  ? 474  LEU A CD2 1 
ATOM   3604 N N   . ALA A 1 475 ? -31.838 138.212 38.915  1.00 27.13  ? 475  ALA A N   1 
ATOM   3605 C CA  . ALA A 1 475 ? -33.288 138.245 38.758  1.00 28.89  ? 475  ALA A CA  1 
ATOM   3606 C C   . ALA A 1 475 ? -33.976 138.762 40.016  1.00 27.56  ? 475  ALA A C   1 
ATOM   3607 O O   . ALA A 1 475 ? -35.044 139.366 39.942  1.00 26.90  ? 475  ALA A O   1 
ATOM   3608 C CB  . ALA A 1 475 ? -33.806 136.853 38.411  1.00 33.07  ? 475  ALA A CB  1 
ATOM   3609 N N   . HIS A 1 476 ? -33.360 138.519 41.168  1.00 29.33  ? 476  HIS A N   1 
ATOM   3610 C CA  . HIS A 1 476 ? -33.914 138.963 42.444  1.00 29.51  ? 476  HIS A CA  1 
ATOM   3611 C C   . HIS A 1 476 ? -34.008 140.483 42.487  1.00 28.18  ? 476  HIS A C   1 
ATOM   3612 O O   . HIS A 1 476 ? -34.831 141.046 43.211  1.00 28.03  ? 476  HIS A O   1 
ATOM   3613 C CB  . HIS A 1 476 ? -33.036 138.483 43.600  1.00 30.80  ? 476  HIS A CB  1 
ATOM   3614 C CG  . HIS A 1 476 ? -32.827 137.001 43.624  1.00 38.34  ? 476  HIS A CG  1 
ATOM   3615 N ND1 . HIS A 1 476 ? -33.827 136.102 43.319  1.00 39.97  ? 476  HIS A ND1 1 
ATOM   3616 C CD2 . HIS A 1 476 ? -31.730 136.260 43.912  1.00 42.36  ? 476  HIS A CD2 1 
ATOM   3617 C CE1 . HIS A 1 476 ? -33.355 134.873 43.418  1.00 41.59  ? 476  HIS A CE1 1 
ATOM   3618 N NE2 . HIS A 1 476 ? -32.085 134.940 43.777  1.00 39.81  ? 476  HIS A NE2 1 
ATOM   3619 N N   . PHE A 1 477 ? -33.161 141.138 41.699  1.00 24.01  ? 477  PHE A N   1 
ATOM   3620 C CA  . PHE A 1 477 ? -33.132 142.585 41.647  1.00 18.48  ? 477  PHE A CA  1 
ATOM   3621 C C   . PHE A 1 477 ? -34.197 143.144 40.737  1.00 22.24  ? 477  PHE A C   1 
ATOM   3622 O O   . PHE A 1 477 ? -34.382 144.354 40.674  1.00 27.61  ? 477  PHE A O   1 
ATOM   3623 C CB  . PHE A 1 477 ? -31.764 143.063 41.179  1.00 12.83  ? 477  PHE A CB  1 
ATOM   3624 C CG  . PHE A 1 477 ? -30.697 142.922 42.215  1.00 10.64  ? 477  PHE A CG  1 
ATOM   3625 C CD1 . PHE A 1 477 ? -30.500 143.917 43.167  1.00 5.00   ? 477  PHE A CD1 1 
ATOM   3626 C CD2 . PHE A 1 477 ? -29.894 141.784 42.254  1.00 9.83   ? 477  PHE A CD2 1 
ATOM   3627 C CE1 . PHE A 1 477 ? -29.512 143.781 44.147  1.00 9.45   ? 477  PHE A CE1 1 
ATOM   3628 C CE2 . PHE A 1 477 ? -28.902 141.636 43.231  1.00 9.87   ? 477  PHE A CE2 1 
ATOM   3629 C CZ  . PHE A 1 477 ? -28.711 142.639 44.179  1.00 7.18   ? 477  PHE A CZ  1 
ATOM   3630 N N   . HIS A 1 478 ? -34.902 142.270 40.026  1.00 31.58  ? 478  HIS A N   1 
ATOM   3631 C CA  . HIS A 1 478 ? -35.951 142.724 39.119  1.00 38.33  ? 478  HIS A CA  1 
ATOM   3632 C C   . HIS A 1 478 ? -37.296 142.882 39.812  1.00 39.11  ? 478  HIS A C   1 
ATOM   3633 O O   . HIS A 1 478 ? -37.926 141.902 40.216  1.00 43.27  ? 478  HIS A O   1 
ATOM   3634 C CB  . HIS A 1 478 ? -36.106 141.765 37.939  1.00 48.17  ? 478  HIS A CB  1 
ATOM   3635 C CG  . HIS A 1 478 ? -37.188 142.163 36.981  1.00 64.84  ? 478  HIS A CG  1 
ATOM   3636 N ND1 . HIS A 1 478 ? -37.041 143.191 36.073  1.00 70.46  ? 478  HIS A ND1 1 
ATOM   3637 C CD2 . HIS A 1 478 ? -38.443 141.679 36.800  1.00 68.63  ? 478  HIS A CD2 1 
ATOM   3638 C CE1 . HIS A 1 478 ? -38.156 143.324 35.376  1.00 72.51  ? 478  HIS A CE1 1 
ATOM   3639 N NE2 . HIS A 1 478 ? -39.021 142.421 35.796  1.00 72.73  ? 478  HIS A NE2 1 
ATOM   3640 N N   . LEU A 1 479 ? -37.734 144.128 39.942  1.00 38.21  ? 479  LEU A N   1 
ATOM   3641 C CA  . LEU A 1 479 ? -39.011 144.423 40.573  1.00 35.58  ? 479  LEU A CA  1 
ATOM   3642 C C   . LEU A 1 479 ? -40.071 144.550 39.482  1.00 33.33  ? 479  LEU A C   1 
ATOM   3643 O O   . LEU A 1 479 ? -39.834 145.160 38.438  1.00 32.17  ? 479  LEU A O   1 
ATOM   3644 C CB  . LEU A 1 479 ? -38.918 145.729 41.373  1.00 34.32  ? 479  LEU A CB  1 
ATOM   3645 C CG  . LEU A 1 479 ? -38.354 145.658 42.797  1.00 29.97  ? 479  LEU A CG  1 
ATOM   3646 C CD1 . LEU A 1 479 ? -39.298 144.860 43.679  1.00 30.39  ? 479  LEU A CD1 1 
ATOM   3647 C CD2 . LEU A 1 479 ? -36.983 145.018 42.783  1.00 30.28  ? 479  LEU A CD2 1 
ATOM   3648 N N   . THR A 1 480 ? -41.233 143.957 39.720  1.00 29.86  ? 480  THR A N   1 
ATOM   3649 C CA  . THR A 1 480 ? -42.320 144.010 38.759  1.00 32.12  ? 480  THR A CA  1 
ATOM   3650 C C   . THR A 1 480 ? -43.235 145.156 39.140  1.00 33.10  ? 480  THR A C   1 
ATOM   3651 O O   . THR A 1 480 ? -43.238 145.595 40.290  1.00 33.93  ? 480  THR A O   1 
ATOM   3652 C CB  . THR A 1 480 ? -43.114 142.693 38.749  1.00 38.28  ? 480  THR A CB  1 
ATOM   3653 O OG1 . THR A 1 480 ? -43.833 142.552 39.980  1.00 44.23  ? 480  THR A OG1 1 
ATOM   3654 C CG2 . THR A 1 480 ? -42.166 141.508 38.586  1.00 41.55  ? 480  THR A CG2 1 
ATOM   3655 N N   . LYS A 1 481 ? -44.009 145.641 38.174  1.00 35.66  ? 481  LYS A N   1 
ATOM   3656 C CA  . LYS A 1 481 ? -44.908 146.762 38.414  1.00 38.48  ? 481  LYS A CA  1 
ATOM   3657 C C   . LYS A 1 481 ? -45.864 146.542 39.575  1.00 39.81  ? 481  LYS A C   1 
ATOM   3658 O O   . LYS A 1 481 ? -46.405 147.497 40.128  1.00 39.28  ? 481  LYS A O   1 
ATOM   3659 C CB  . LYS A 1 481 ? -45.713 147.077 37.154  1.00 42.09  ? 481  LYS A CB  1 
ATOM   3660 C CG  . LYS A 1 481 ? -46.571 148.327 37.282  1.00 49.74  ? 481  LYS A CG  1 
ATOM   3661 C CD  . LYS A 1 481 ? -47.828 148.223 36.438  1.00 59.78  ? 481  LYS A CD  1 
ATOM   3662 C CE  . LYS A 1 481 ? -48.283 149.595 35.959  1.00 69.99  ? 481  LYS A CE  1 
ATOM   3663 N NZ  . LYS A 1 481 ? -48.297 149.713 34.467  1.00 76.74  ? 481  LYS A NZ  1 
ATOM   3664 N N   . ASP A 1 482 ? -46.080 145.285 39.944  1.00 43.73  ? 482  ASP A N   1 
ATOM   3665 C CA  . ASP A 1 482 ? -46.986 144.978 41.042  1.00 47.55  ? 482  ASP A CA  1 
ATOM   3666 C C   . ASP A 1 482 ? -46.280 145.132 42.368  1.00 47.22  ? 482  ASP A C   1 
ATOM   3667 O O   . ASP A 1 482 ? -46.864 145.629 43.332  1.00 50.93  ? 482  ASP A O   1 
ATOM   3668 C CB  . ASP A 1 482 ? -47.537 143.560 40.910  1.00 52.99  ? 482  ASP A CB  1 
ATOM   3669 C CG  . ASP A 1 482 ? -48.743 143.492 40.001  1.00 59.92  ? 482  ASP A CG  1 
ATOM   3670 O OD1 . ASP A 1 482 ? -49.784 144.106 40.340  1.00 61.63  ? 482  ASP A OD1 1 
ATOM   3671 O OD2 . ASP A 1 482 ? -48.644 142.831 38.945  1.00 65.62  ? 482  ASP A OD2 1 
ATOM   3672 N N   . MET A 1 483 ? -45.025 144.693 42.421  1.00 44.94  ? 483  MET A N   1 
ATOM   3673 C CA  . MET A 1 483 ? -44.250 144.819 43.646  1.00 44.22  ? 483  MET A CA  1 
ATOM   3674 C C   . MET A 1 483 ? -44.092 146.307 43.892  1.00 40.13  ? 483  MET A C   1 
ATOM   3675 O O   . MET A 1 483 ? -44.268 146.787 45.012  1.00 42.92  ? 483  MET A O   1 
ATOM   3676 C CB  . MET A 1 483 ? -42.873 144.184 43.490  1.00 45.10  ? 483  MET A CB  1 
ATOM   3677 C CG  . MET A 1 483 ? -42.884 142.672 43.485  1.00 53.45  ? 483  MET A CG  1 
ATOM   3678 S SD  . MET A 1 483 ? -41.649 142.048 42.337  1.00 66.88  ? 483  MET A SD  1 
ATOM   3679 C CE  . MET A 1 483 ? -40.720 140.936 43.389  1.00 73.31  ? 483  MET A CE  1 
ATOM   3680 N N   . LEU A 1 484 ? -43.782 147.033 42.823  1.00 32.23  ? 484  LEU A N   1 
ATOM   3681 C CA  . LEU A 1 484 ? -43.595 148.469 42.906  1.00 29.25  ? 484  LEU A CA  1 
ATOM   3682 C C   . LEU A 1 484 ? -44.839 149.152 43.445  1.00 30.02  ? 484  LEU A C   1 
ATOM   3683 O O   . LEU A 1 484 ? -44.749 150.165 44.132  1.00 37.22  ? 484  LEU A O   1 
ATOM   3684 C CB  . LEU A 1 484 ? -43.238 149.030 41.534  1.00 26.32  ? 484  LEU A CB  1 
ATOM   3685 C CG  . LEU A 1 484 ? -41.863 148.614 41.002  1.00 25.98  ? 484  LEU A CG  1 
ATOM   3686 C CD1 . LEU A 1 484 ? -41.536 149.424 39.761  1.00 26.60  ? 484  LEU A CD1 1 
ATOM   3687 C CD2 . LEU A 1 484 ? -40.799 148.833 42.076  1.00 24.19  ? 484  LEU A CD2 1 
ATOM   3688 N N   . LEU A 1 485 ? -46.001 148.592 43.148  1.00 26.78  ? 485  LEU A N   1 
ATOM   3689 C CA  . LEU A 1 485 ? -47.239 149.176 43.622  1.00 27.62  ? 485  LEU A CA  1 
ATOM   3690 C C   . LEU A 1 485 ? -47.409 148.909 45.108  1.00 31.75  ? 485  LEU A C   1 
ATOM   3691 O O   . LEU A 1 485 ? -47.987 149.724 45.827  1.00 33.38  ? 485  LEU A O   1 
ATOM   3692 C CB  . LEU A 1 485 ? -48.417 148.606 42.840  1.00 33.19  ? 485  LEU A CB  1 
ATOM   3693 C CG  . LEU A 1 485 ? -48.471 149.050 41.374  1.00 37.98  ? 485  LEU A CG  1 
ATOM   3694 C CD1 . LEU A 1 485 ? -49.693 148.445 40.697  1.00 39.44  ? 485  LEU A CD1 1 
ATOM   3695 C CD2 . LEU A 1 485 ? -48.510 150.571 41.299  1.00 34.91  ? 485  LEU A CD2 1 
ATOM   3696 N N   . GLU A 1 486 ? -46.902 147.766 45.567  1.00 32.89  ? 486  GLU A N   1 
ATOM   3697 C CA  . GLU A 1 486 ? -46.986 147.405 46.981  1.00 32.91  ? 486  GLU A CA  1 
ATOM   3698 C C   . GLU A 1 486 ? -46.067 148.340 47.744  1.00 32.29  ? 486  GLU A C   1 
ATOM   3699 O O   . GLU A 1 486 ? -46.429 148.881 48.793  1.00 28.59  ? 486  GLU A O   1 
ATOM   3700 C CB  . GLU A 1 486 ? -46.523 145.963 47.203  1.00 38.92  ? 486  GLU A CB  1 
ATOM   3701 C CG  . GLU A 1 486 ? -47.637 144.981 47.566  1.00 50.71  ? 486  GLU A CG  1 
ATOM   3702 C CD  . GLU A 1 486 ? -48.139 145.124 49.002  1.00 56.47  ? 486  GLU A CD  1 
ATOM   3703 O OE1 . GLU A 1 486 ? -47.316 145.113 49.949  1.00 47.31  ? 486  GLU A OE1 1 
ATOM   3704 O OE2 . GLU A 1 486 ? -49.372 145.242 49.176  1.00 63.72  ? 486  GLU A OE2 1 
ATOM   3705 N N   . VAL A 1 487 ? -44.868 148.520 47.202  1.00 29.99  ? 487  VAL A N   1 
ATOM   3706 C CA  . VAL A 1 487 ? -43.884 149.393 47.809  1.00 28.04  ? 487  VAL A CA  1 
ATOM   3707 C C   . VAL A 1 487 ? -44.503 150.775 47.962  1.00 29.27  ? 487  VAL A C   1 
ATOM   3708 O O   . VAL A 1 487 ? -44.373 151.411 49.011  1.00 31.28  ? 487  VAL A O   1 
ATOM   3709 C CB  . VAL A 1 487 ? -42.613 149.481 46.941  1.00 27.27  ? 487  VAL A CB  1 
ATOM   3710 C CG1 . VAL A 1 487 ? -41.779 150.696 47.344  1.00 31.55  ? 487  VAL A CG1 1 
ATOM   3711 C CG2 . VAL A 1 487 ? -41.794 148.202 47.101  1.00 24.34  ? 487  VAL A CG2 1 
ATOM   3712 N N   . LYS A 1 488 ? -45.183 151.231 46.914  1.00 26.32  ? 488  LYS A N   1 
ATOM   3713 C CA  . LYS A 1 488 ? -45.838 152.534 46.939  1.00 22.67  ? 488  LYS A CA  1 
ATOM   3714 C C   . LYS A 1 488 ? -46.961 152.492 47.973  1.00 27.36  ? 488  LYS A C   1 
ATOM   3715 O O   . LYS A 1 488 ? -47.206 153.461 48.697  1.00 24.30  ? 488  LYS A O   1 
ATOM   3716 C CB  . LYS A 1 488 ? -46.407 152.855 45.559  1.00 16.58  ? 488  LYS A CB  1 
ATOM   3717 C CG  . LYS A 1 488 ? -47.457 153.941 45.556  1.00 19.31  ? 488  LYS A CG  1 
ATOM   3718 C CD  . LYS A 1 488 ? -48.036 154.155 44.166  1.00 26.45  ? 488  LYS A CD  1 
ATOM   3719 C CE  . LYS A 1 488 ? -49.429 154.782 44.239  1.00 27.49  ? 488  LYS A CE  1 
ATOM   3720 N NZ  . LYS A 1 488 ? -49.714 155.660 43.065  1.00 22.60  ? 488  LYS A NZ  1 
ATOM   3721 N N   . LYS A 1 489 ? -47.637 151.351 48.040  1.00 32.31  ? 489  LYS A N   1 
ATOM   3722 C CA  . LYS A 1 489 ? -48.730 151.160 48.981  1.00 29.34  ? 489  LYS A CA  1 
ATOM   3723 C C   . LYS A 1 489 ? -48.198 151.258 50.395  1.00 24.61  ? 489  LYS A C   1 
ATOM   3724 O O   . LYS A 1 489 ? -48.734 151.989 51.217  1.00 28.83  ? 489  LYS A O   1 
ATOM   3725 C CB  . LYS A 1 489 ? -49.365 149.788 48.775  1.00 35.73  ? 489  LYS A CB  1 
ATOM   3726 C CG  . LYS A 1 489 ? -50.849 149.747 49.059  1.00 44.57  ? 489  LYS A CG  1 
ATOM   3727 C CD  . LYS A 1 489 ? -51.457 148.444 48.569  1.00 55.34  ? 489  LYS A CD  1 
ATOM   3728 C CE  . LYS A 1 489 ? -51.434 147.392 49.666  1.00 64.47  ? 489  LYS A CE  1 
ATOM   3729 N NZ  . LYS A 1 489 ? -52.077 147.878 50.925  1.00 72.88  ? 489  LYS A NZ  1 
ATOM   3730 N N   . ARG A 1 490 ? -47.131 150.517 50.665  1.00 20.75  ? 490  ARG A N   1 
ATOM   3731 C CA  . ARG A 1 490 ? -46.518 150.491 51.984  1.00 17.80  ? 490  ARG A CA  1 
ATOM   3732 C C   . ARG A 1 490 ? -45.932 151.829 52.416  1.00 16.28  ? 490  ARG A C   1 
ATOM   3733 O O   . ARG A 1 490 ? -46.046 152.218 53.574  1.00 18.16  ? 490  ARG A O   1 
ATOM   3734 C CB  . ARG A 1 490 ? -45.436 149.421 52.011  1.00 17.15  ? 490  ARG A CB  1 
ATOM   3735 C CG  . ARG A 1 490 ? -45.931 148.058 51.584  1.00 11.26  ? 490  ARG A CG  1 
ATOM   3736 C CD  . ARG A 1 490 ? -44.832 147.031 51.713  1.00 14.70  ? 490  ARG A CD  1 
ATOM   3737 N NE  . ARG A 1 490 ? -45.196 145.756 51.108  1.00 22.01  ? 490  ARG A NE  1 
ATOM   3738 C CZ  . ARG A 1 490 ? -44.324 144.791 50.835  1.00 26.78  ? 490  ARG A CZ  1 
ATOM   3739 N NH1 . ARG A 1 490 ? -43.038 144.957 51.114  1.00 25.87  ? 490  ARG A NH1 1 
ATOM   3740 N NH2 . ARG A 1 490 ? -44.737 143.659 50.276  1.00 27.13  ? 490  ARG A NH2 1 
ATOM   3741 N N   . MET A 1 491 ? -45.297 152.532 51.490  1.00 17.65  ? 491  MET A N   1 
ATOM   3742 C CA  . MET A 1 491 ? -44.719 153.824 51.821  1.00 20.39  ? 491  MET A CA  1 
ATOM   3743 C C   . MET A 1 491 ? -45.830 154.719 52.336  1.00 23.98  ? 491  MET A C   1 
ATOM   3744 O O   . MET A 1 491 ? -45.688 155.358 53.381  1.00 26.99  ? 491  MET A O   1 
ATOM   3745 C CB  . MET A 1 491 ? -44.067 154.461 50.587  1.00 23.01  ? 491  MET A CB  1 
ATOM   3746 C CG  . MET A 1 491 ? -43.714 155.938 50.750  1.00 19.45  ? 491  MET A CG  1 
ATOM   3747 S SD  . MET A 1 491 ? -42.545 156.212 52.099  1.00 22.43  ? 491  MET A SD  1 
ATOM   3748 C CE  . MET A 1 491 ? -40.994 155.868 51.300  1.00 15.56  ? 491  MET A CE  1 
ATOM   3749 N N   . ARG A 1 492 ? -46.942 154.742 51.604  1.00 27.32  ? 492  ARG A N   1 
ATOM   3750 C CA  . ARG A 1 492 ? -48.105 155.559 51.954  1.00 27.81  ? 492  ARG A CA  1 
ATOM   3751 C C   . ARG A 1 492 ? -48.652 155.277 53.348  1.00 30.85  ? 492  ARG A C   1 
ATOM   3752 O O   . ARG A 1 492 ? -49.083 156.191 54.047  1.00 38.29  ? 492  ARG A O   1 
ATOM   3753 C CB  . ARG A 1 492 ? -49.218 155.355 50.933  1.00 24.96  ? 492  ARG A CB  1 
ATOM   3754 C CG  . ARG A 1 492 ? -50.364 156.324 51.103  1.00 29.68  ? 492  ARG A CG  1 
ATOM   3755 C CD  . ARG A 1 492 ? -50.326 157.426 50.038  1.00 43.18  ? 492  ARG A CD  1 
ATOM   3756 N NE  . ARG A 1 492 ? -51.646 158.009 49.808  1.00 45.84  ? 492  ARG A NE  1 
ATOM   3757 C CZ  . ARG A 1 492 ? -52.476 158.380 50.779  1.00 43.54  ? 492  ARG A CZ  1 
ATOM   3758 N NH1 . ARG A 1 492 ? -52.122 158.232 52.050  1.00 41.63  ? 492  ARG A NH1 1 
ATOM   3759 N NH2 . ARG A 1 492 ? -53.668 158.881 50.482  1.00 38.63  ? 492  ARG A NH2 1 
ATOM   3760 N N   . ALA A 1 493 ? -48.648 154.009 53.742  1.00 29.79  ? 493  ALA A N   1 
ATOM   3761 C CA  . ALA A 1 493 ? -49.132 153.614 55.057  1.00 24.67  ? 493  ALA A CA  1 
ATOM   3762 C C   . ALA A 1 493 ? -48.151 154.116 56.110  1.00 28.11  ? 493  ALA A C   1 
ATOM   3763 O O   . ALA A 1 493 ? -48.545 154.581 57.188  1.00 31.40  ? 493  ALA A O   1 
ATOM   3764 C CB  . ALA A 1 493 ? -49.248 152.107 55.131  1.00 16.31  ? 493  ALA A CB  1 
ATOM   3765 N N   . GLU A 1 494 ? -46.865 154.010 55.793  1.00 24.52  ? 494  GLU A N   1 
ATOM   3766 C CA  . GLU A 1 494 ? -45.835 154.462 56.708  1.00 20.45  ? 494  GLU A CA  1 
ATOM   3767 C C   . GLU A 1 494 ? -46.020 155.954 56.946  1.00 20.65  ? 494  GLU A C   1 
ATOM   3768 O O   . GLU A 1 494 ? -45.939 156.419 58.072  1.00 23.34  ? 494  GLU A O   1 
ATOM   3769 C CB  . GLU A 1 494 ? -44.455 154.184 56.121  1.00 21.11  ? 494  GLU A CB  1 
ATOM   3770 C CG  . GLU A 1 494 ? -43.983 152.757 56.323  1.00 18.66  ? 494  GLU A CG  1 
ATOM   3771 C CD  . GLU A 1 494 ? -44.170 152.286 57.745  1.00 21.59  ? 494  GLU A CD  1 
ATOM   3772 O OE1 . GLU A 1 494 ? -43.867 153.070 58.670  1.00 33.52  ? 494  GLU A OE1 1 
ATOM   3773 O OE2 . GLU A 1 494 ? -44.622 151.139 57.941  1.00 19.96  ? 494  GLU A OE2 1 
ATOM   3774 N N   . MET A 1 495 ? -46.282 156.696 55.874  1.00 19.09  ? 495  MET A N   1 
ATOM   3775 C CA  . MET A 1 495 ? -46.494 158.137 55.959  1.00 14.54  ? 495  MET A CA  1 
ATOM   3776 C C   . MET A 1 495 ? -47.590 158.469 56.966  1.00 15.69  ? 495  MET A C   1 
ATOM   3777 O O   . MET A 1 495 ? -47.435 159.352 57.806  1.00 19.20  ? 495  MET A O   1 
ATOM   3778 C CB  . MET A 1 495 ? -46.885 158.693 54.585  1.00 11.37  ? 495  MET A CB  1 
ATOM   3779 C CG  . MET A 1 495 ? -45.844 158.474 53.507  1.00 11.00  ? 495  MET A CG  1 
ATOM   3780 S SD  . MET A 1 495 ? -46.240 159.280 51.940  1.00 18.12  ? 495  MET A SD  1 
ATOM   3781 C CE  . MET A 1 495 ? -46.748 160.892 52.504  1.00 18.42  ? 495  MET A CE  1 
ATOM   3782 N N   . GLU A 1 496 ? -48.703 157.758 56.873  1.00 19.10  ? 496  GLU A N   1 
ATOM   3783 C CA  . GLU A 1 496 ? -49.821 157.991 57.772  1.00 23.85  ? 496  GLU A CA  1 
ATOM   3784 C C   . GLU A 1 496 ? -49.454 157.750 59.233  1.00 20.44  ? 496  GLU A C   1 
ATOM   3785 O O   . GLU A 1 496 ? -49.768 158.562 60.097  1.00 24.32  ? 496  GLU A O   1 
ATOM   3786 C CB  . GLU A 1 496 ? -51.005 157.106 57.374  1.00 30.79  ? 496  GLU A CB  1 
ATOM   3787 C CG  . GLU A 1 496 ? -51.345 157.160 55.882  1.00 44.51  ? 496  GLU A CG  1 
ATOM   3788 C CD  . GLU A 1 496 ? -52.582 158.000 55.575  1.00 54.19  ? 496  GLU A CD  1 
ATOM   3789 O OE1 . GLU A 1 496 ? -52.996 158.797 56.448  1.00 67.33  ? 496  GLU A OE1 1 
ATOM   3790 O OE2 . GLU A 1 496 ? -53.142 157.866 54.462  1.00 54.99  ? 496  GLU A OE2 1 
ATOM   3791 N N   . LEU A 1 497 ? -48.786 156.641 59.520  1.00 17.67  ? 497  LEU A N   1 
ATOM   3792 C CA  . LEU A 1 497 ? -48.415 156.360 60.901  1.00 20.38  ? 497  LEU A CA  1 
ATOM   3793 C C   . LEU A 1 497 ? -47.594 157.497 61.496  1.00 21.13  ? 497  LEU A C   1 
ATOM   3794 O O   . LEU A 1 497 ? -47.736 157.831 62.666  1.00 25.98  ? 497  LEU A O   1 
ATOM   3795 C CB  . LEU A 1 497 ? -47.613 155.062 60.990  1.00 25.69  ? 497  LEU A CB  1 
ATOM   3796 C CG  . LEU A 1 497 ? -48.328 153.779 60.563  1.00 33.26  ? 497  LEU A CG  1 
ATOM   3797 C CD1 . LEU A 1 497 ? -47.494 152.571 60.958  1.00 30.86  ? 497  LEU A CD1 1 
ATOM   3798 C CD2 . LEU A 1 497 ? -49.700 153.716 61.215  1.00 35.74  ? 497  LEU A CD2 1 
ATOM   3799 N N   . GLY A 1 498 ? -46.741 158.096 60.677  1.00 20.22  ? 498  GLY A N   1 
ATOM   3800 C CA  . GLY A 1 498 ? -45.893 159.173 61.147  1.00 16.24  ? 498  GLY A CA  1 
ATOM   3801 C C   . GLY A 1 498 ? -46.603 160.494 61.336  1.00 20.25  ? 498  GLY A C   1 
ATOM   3802 O O   . GLY A 1 498 ? -46.151 161.323 62.118  1.00 23.09  ? 498  GLY A O   1 
ATOM   3803 N N   . LEU A 1 499 ? -47.709 160.705 60.629  1.00 19.80  ? 499  LEU A N   1 
ATOM   3804 C CA  . LEU A 1 499 ? -48.449 161.957 60.754  1.00 17.33  ? 499  LEU A CA  1 
ATOM   3805 C C   . LEU A 1 499 ? -49.413 161.907 61.934  1.00 21.08  ? 499  LEU A C   1 
ATOM   3806 O O   . LEU A 1 499 ? -49.560 162.885 62.667  1.00 21.52  ? 499  LEU A O   1 
ATOM   3807 C CB  . LEU A 1 499 ? -49.224 162.247 59.469  1.00 18.21  ? 499  LEU A CB  1 
ATOM   3808 C CG  . LEU A 1 499 ? -48.414 162.698 58.246  1.00 18.00  ? 499  LEU A CG  1 
ATOM   3809 C CD1 . LEU A 1 499 ? -49.278 162.609 57.008  1.00 19.54  ? 499  LEU A CD1 1 
ATOM   3810 C CD2 . LEU A 1 499 ? -47.923 164.123 58.433  1.00 17.79  ? 499  LEU A CD2 1 
ATOM   3811 N N   . ARG A 1 500 ? -50.064 160.762 62.116  1.00 25.90  ? 500  ARG A N   1 
ATOM   3812 C CA  . ARG A 1 500 ? -51.015 160.576 63.210  1.00 28.92  ? 500  ARG A CA  1 
ATOM   3813 C C   . ARG A 1 500 ? -50.300 160.725 64.541  1.00 27.96  ? 500  ARG A C   1 
ATOM   3814 O O   . ARG A 1 500 ? -49.184 160.246 64.701  1.00 32.81  ? 500  ARG A O   1 
ATOM   3815 C CB  . ARG A 1 500 ? -51.649 159.188 63.125  1.00 35.65  ? 500  ARG A CB  1 
ATOM   3816 C CG  . ARG A 1 500 ? -52.536 158.985 61.904  1.00 48.61  ? 500  ARG A CG  1 
ATOM   3817 C CD  . ARG A 1 500 ? -53.579 157.892 62.140  1.00 61.76  ? 500  ARG A CD  1 
ATOM   3818 N NE  . ARG A 1 500 ? -52.981 156.557 62.207  1.00 70.11  ? 500  ARG A NE  1 
ATOM   3819 C CZ  . ARG A 1 500 ? -53.364 155.606 63.054  1.00 72.36  ? 500  ARG A CZ  1 
ATOM   3820 N NH1 . ARG A 1 500 ? -54.348 155.834 63.914  1.00 75.59  ? 500  ARG A NH1 1 
ATOM   3821 N NH2 . ARG A 1 500 ? -52.762 154.425 63.042  1.00 71.25  ? 500  ARG A NH2 1 
ATOM   3822 N N   . LYS A 1 501 ? -50.945 161.384 65.499  1.00 30.24  ? 501  LYS A N   1 
ATOM   3823 C CA  . LYS A 1 501 ? -50.336 161.596 66.807  1.00 34.26  ? 501  LYS A CA  1 
ATOM   3824 C C   . LYS A 1 501 ? -50.302 160.339 67.661  1.00 35.23  ? 501  LYS A C   1 
ATOM   3825 O O   . LYS A 1 501 ? -49.446 160.192 68.531  1.00 35.55  ? 501  LYS A O   1 
ATOM   3826 C CB  . LYS A 1 501 ? -51.081 162.691 67.568  1.00 38.18  ? 501  LYS A CB  1 
ATOM   3827 C CG  . LYS A 1 501 ? -50.432 163.046 68.898  1.00 51.77  ? 501  LYS A CG  1 
ATOM   3828 C CD  . LYS A 1 501 ? -51.255 164.063 69.680  1.00 62.02  ? 501  LYS A CD  1 
ATOM   3829 C CE  . LYS A 1 501 ? -51.398 163.666 71.148  1.00 65.76  ? 501  LYS A CE  1 
ATOM   3830 N NZ  . LYS A 1 501 ? -52.293 164.598 71.903  1.00 69.60  ? 501  LYS A NZ  1 
ATOM   3831 N N   . GLN A 1 502 ? -51.235 159.432 67.399  1.00 42.72  ? 502  GLN A N   1 
ATOM   3832 C CA  . GLN A 1 502 ? -51.345 158.189 68.157  1.00 45.76  ? 502  GLN A CA  1 
ATOM   3833 C C   . GLN A 1 502 ? -50.279 157.140 67.850  1.00 42.33  ? 502  GLN A C   1 
ATOM   3834 O O   . GLN A 1 502 ? -50.065 156.219 68.637  1.00 45.94  ? 502  GLN A O   1 
ATOM   3835 C CB  . GLN A 1 502 ? -52.728 157.571 67.929  1.00 53.64  ? 502  GLN A CB  1 
ATOM   3836 C CG  . GLN A 1 502 ? -53.038 156.393 68.836  1.00 68.66  ? 502  GLN A CG  1 
ATOM   3837 C CD  . GLN A 1 502 ? -54.244 155.603 68.374  1.00 78.81  ? 502  GLN A CD  1 
ATOM   3838 O OE1 . GLN A 1 502 ? -54.454 155.412 67.176  1.00 87.60  ? 502  GLN A OE1 1 
ATOM   3839 N NE2 . GLN A 1 502 ? -55.049 155.139 69.325  1.00 85.15  ? 502  GLN A NE2 1 
ATOM   3840 N N   . THR A 1 503 ? -49.597 157.280 66.721  1.00 36.85  ? 503  THR A N   1 
ATOM   3841 C CA  . THR A 1 503 ? -48.600 156.293 66.337  1.00 29.81  ? 503  THR A CA  1 
ATOM   3842 C C   . THR A 1 503 ? -47.237 156.869 65.942  1.00 31.08  ? 503  THR A C   1 
ATOM   3843 O O   . THR A 1 503 ? -46.283 156.129 65.701  1.00 31.77  ? 503  THR A O   1 
ATOM   3844 C CB  . THR A 1 503 ? -49.151 155.458 65.182  1.00 23.86  ? 503  THR A CB  1 
ATOM   3845 O OG1 . THR A 1 503 ? -49.671 156.330 64.175  1.00 28.78  ? 503  THR A OG1 1 
ATOM   3846 C CG2 . THR A 1 503 ? -50.282 154.583 65.667  1.00 28.70  ? 503  THR A CG2 1 
ATOM   3847 N N   . HIS A 1 504 ? -47.144 158.193 65.906  1.00 29.02  ? 504  HIS A N   1 
ATOM   3848 C CA  . HIS A 1 504 ? -45.913 158.862 65.517  1.00 26.42  ? 504  HIS A CA  1 
ATOM   3849 C C   . HIS A 1 504 ? -44.648 158.415 66.237  1.00 26.64  ? 504  HIS A C   1 
ATOM   3850 O O   . HIS A 1 504 ? -43.609 158.198 65.612  1.00 27.91  ? 504  HIS A O   1 
ATOM   3851 C CB  . HIS A 1 504 ? -46.059 160.368 65.698  1.00 23.27  ? 504  HIS A CB  1 
ATOM   3852 C CG  . HIS A 1 504 ? -44.757 161.100 65.627  1.00 24.44  ? 504  HIS A CG  1 
ATOM   3853 N ND1 . HIS A 1 504 ? -44.219 161.547 64.440  1.00 26.20  ? 504  HIS A ND1 1 
ATOM   3854 C CD2 . HIS A 1 504 ? -43.881 161.456 66.595  1.00 25.19  ? 504  HIS A CD2 1 
ATOM   3855 C CE1 . HIS A 1 504 ? -43.070 162.149 64.678  1.00 34.25  ? 504  HIS A CE1 1 
ATOM   3856 N NE2 . HIS A 1 504 ? -42.841 162.109 65.978  1.00 31.80  ? 504  HIS A NE2 1 
ATOM   3857 N N   . ASN A 1 505 ? -44.727 158.293 67.554  1.00 29.23  ? 505  ASN A N   1 
ATOM   3858 C CA  . ASN A 1 505 ? -43.566 157.913 68.344  1.00 31.62  ? 505  ASN A CA  1 
ATOM   3859 C C   . ASN A 1 505 ? -42.997 156.544 67.992  1.00 28.82  ? 505  ASN A C   1 
ATOM   3860 O O   . ASN A 1 505 ? -41.833 156.263 68.278  1.00 32.93  ? 505  ASN A O   1 
ATOM   3861 C CB  . ASN A 1 505 ? -43.906 157.975 69.839  1.00 39.81  ? 505  ASN A CB  1 
ATOM   3862 C CG  . ASN A 1 505 ? -43.778 159.383 70.411  1.00 49.25  ? 505  ASN A CG  1 
ATOM   3863 O OD1 . ASN A 1 505 ? -42.742 159.750 70.973  1.00 52.08  ? 505  ASN A OD1 1 
ATOM   3864 N ND2 . ASN A 1 505 ? -44.836 160.180 70.269  1.00 55.54  ? 505  ASN A ND2 1 
ATOM   3865 N N   . ASN A 1 506 ? -43.805 155.700 67.359  1.00 26.64  ? 506  ASN A N   1 
ATOM   3866 C CA  . ASN A 1 506 ? -43.359 154.358 66.990  1.00 24.48  ? 506  ASN A CA  1 
ATOM   3867 C C   . ASN A 1 506 ? -43.169 154.175 65.491  1.00 25.74  ? 506  ASN A C   1 
ATOM   3868 O O   . ASN A 1 506 ? -42.804 153.093 65.034  1.00 30.19  ? 506  ASN A O   1 
ATOM   3869 C CB  . ASN A 1 506 ? -44.347 153.322 67.515  1.00 20.40  ? 506  ASN A CB  1 
ATOM   3870 C CG  . ASN A 1 506 ? -44.383 153.275 69.027  1.00 22.98  ? 506  ASN A CG  1 
ATOM   3871 O OD1 . ASN A 1 506 ? -43.360 153.044 69.672  1.00 25.48  ? 506  ASN A OD1 1 
ATOM   3872 N ND2 . ASN A 1 506 ? -45.558 153.499 69.601  1.00 25.66  ? 506  ASN A ND2 1 
ATOM   3873 N N   . ALA A 1 507 ? -43.409 155.242 64.734  1.00 25.95  ? 507  ALA A N   1 
ATOM   3874 C CA  . ALA A 1 507 ? -43.261 155.222 63.286  1.00 21.84  ? 507  ALA A CA  1 
ATOM   3875 C C   . ALA A 1 507 ? -41.792 155.353 62.886  1.00 22.82  ? 507  ALA A C   1 
ATOM   3876 O O   . ALA A 1 507 ? -41.023 156.054 63.541  1.00 24.73  ? 507  ALA A O   1 
ATOM   3877 C CB  . ALA A 1 507 ? -44.062 156.351 62.685  1.00 26.12  ? 507  ALA A CB  1 
ATOM   3878 N N   . VAL A 1 508 ? -41.403 154.683 61.807  1.00 21.35  ? 508  VAL A N   1 
ATOM   3879 C CA  . VAL A 1 508 ? -40.021 154.737 61.341  1.00 19.41  ? 508  VAL A CA  1 
ATOM   3880 C C   . VAL A 1 508 ? -39.821 155.879 60.356  1.00 19.70  ? 508  VAL A C   1 
ATOM   3881 O O   . VAL A 1 508 ? -38.726 156.430 60.250  1.00 20.41  ? 508  VAL A O   1 
ATOM   3882 C CB  . VAL A 1 508 ? -39.603 153.423 60.664  1.00 24.49  ? 508  VAL A CB  1 
ATOM   3883 C CG1 . VAL A 1 508 ? -39.391 152.352 61.720  1.00 23.75  ? 508  VAL A CG1 1 
ATOM   3884 C CG2 . VAL A 1 508 ? -40.657 152.993 59.660  1.00 27.56  ? 508  VAL A CG2 1 
ATOM   3885 N N   . VAL A 1 509 ? -40.875 156.213 59.616  1.00 18.01  ? 509  VAL A N   1 
ATOM   3886 C CA  . VAL A 1 509 ? -40.831 157.332 58.674  1.00 15.51  ? 509  VAL A CA  1 
ATOM   3887 C C   . VAL A 1 509 ? -41.418 158.468 59.517  1.00 17.48  ? 509  VAL A C   1 
ATOM   3888 O O   . VAL A 1 509 ? -42.620 158.706 59.520  1.00 22.43  ? 509  VAL A O   1 
ATOM   3889 C CB  . VAL A 1 509 ? -41.703 157.037 57.439  1.00 14.41  ? 509  VAL A CB  1 
ATOM   3890 C CG1 . VAL A 1 509 ? -41.721 158.234 56.495  1.00 5.00   ? 509  VAL A CG1 1 
ATOM   3891 C CG2 . VAL A 1 509 ? -41.153 155.809 56.730  1.00 11.76  ? 509  VAL A CG2 1 
ATOM   3892 N N   . LYS A 1 510 ? -40.541 159.157 60.233  1.00 16.65  ? 510  LYS A N   1 
ATOM   3893 C CA  . LYS A 1 510 ? -40.934 160.189 61.170  1.00 16.64  ? 510  LYS A CA  1 
ATOM   3894 C C   . LYS A 1 510 ? -41.836 161.321 60.719  1.00 20.24  ? 510  LYS A C   1 
ATOM   3895 O O   . LYS A 1 510 ? -42.604 161.850 61.521  1.00 23.66  ? 510  LYS A O   1 
ATOM   3896 C CB  . LYS A 1 510 ? -39.676 160.736 61.843  1.00 21.47  ? 510  LYS A CB  1 
ATOM   3897 C CG  . LYS A 1 510 ? -39.183 159.865 62.986  1.00 27.20  ? 510  LYS A CG  1 
ATOM   3898 C CD  . LYS A 1 510 ? -40.357 159.153 63.686  1.00 43.61  ? 510  LYS A CD  1 
ATOM   3899 C CE  . LYS A 1 510 ? -39.912 158.364 64.918  1.00 49.64  ? 510  LYS A CE  1 
ATOM   3900 N NZ  . LYS A 1 510 ? -40.597 158.836 66.161  1.00 60.03  ? 510  LYS A NZ  1 
ATOM   3901 N N   . MET A 1 511 ? -41.759 161.711 59.456  1.00 17.22  ? 511  MET A N   1 
ATOM   3902 C CA  . MET A 1 511 ? -42.623 162.790 58.976  1.00 17.29  ? 511  MET A CA  1 
ATOM   3903 C C   . MET A 1 511 ? -42.582 163.992 59.912  1.00 17.47  ? 511  MET A C   1 
ATOM   3904 O O   . MET A 1 511 ? -43.603 164.380 60.481  1.00 10.78  ? 511  MET A O   1 
ATOM   3905 C CB  . MET A 1 511 ? -44.069 162.304 58.870  1.00 15.87  ? 511  MET A CB  1 
ATOM   3906 C CG  . MET A 1 511 ? -44.235 160.998 58.124  1.00 17.74  ? 511  MET A CG  1 
ATOM   3907 S SD  . MET A 1 511 ? -44.197 161.242 56.351  1.00 23.39  ? 511  MET A SD  1 
ATOM   3908 C CE  . MET A 1 511 ? -45.618 162.312 56.120  1.00 21.58  ? 511  MET A CE  1 
ATOM   3909 N N   . LEU A 1 512 ? -41.397 164.576 60.066  1.00 18.58  ? 512  LEU A N   1 
ATOM   3910 C CA  . LEU A 1 512 ? -41.212 165.726 60.943  1.00 17.99  ? 512  LEU A CA  1 
ATOM   3911 C C   . LEU A 1 512 ? -41.652 167.012 60.266  1.00 19.35  ? 512  LEU A C   1 
ATOM   3912 O O   . LEU A 1 512 ? -41.439 167.189 59.070  1.00 22.87  ? 512  LEU A O   1 
ATOM   3913 C CB  . LEU A 1 512 ? -39.743 165.844 61.352  1.00 14.59  ? 512  LEU A CB  1 
ATOM   3914 C CG  . LEU A 1 512 ? -39.141 164.607 62.023  1.00 16.56  ? 512  LEU A CG  1 
ATOM   3915 C CD1 . LEU A 1 512 ? -37.631 164.674 61.952  1.00 15.93  ? 512  LEU A CD1 1 
ATOM   3916 C CD2 . LEU A 1 512 ? -39.605 164.524 63.465  1.00 11.22  ? 512  LEU A CD2 1 
ATOM   3917 N N   . PRO A 1 513 ? -42.272 167.930 61.026  1.00 17.54  ? 513  PRO A N   1 
ATOM   3918 C CA  . PRO A 1 513 ? -42.719 169.192 60.438  1.00 16.04  ? 513  PRO A CA  1 
ATOM   3919 C C   . PRO A 1 513 ? -41.557 170.162 60.373  1.00 16.56  ? 513  PRO A C   1 
ATOM   3920 O O   . PRO A 1 513 ? -40.794 170.285 61.323  1.00 22.40  ? 513  PRO A O   1 
ATOM   3921 C CB  . PRO A 1 513 ? -43.823 169.671 61.382  1.00 15.81  ? 513  PRO A CB  1 
ATOM   3922 C CG  . PRO A 1 513 ? -43.735 168.797 62.610  1.00 14.14  ? 513  PRO A CG  1 
ATOM   3923 C CD  . PRO A 1 513 ? -42.580 167.859 62.463  1.00 17.29  ? 513  PRO A CD  1 
ATOM   3924 N N   . SER A 1 514 ? -41.429 170.852 59.245  1.00 18.76  ? 514  SER A N   1 
ATOM   3925 C CA  . SER A 1 514 ? -40.344 171.798 59.042  1.00 15.99  ? 514  SER A CA  1 
ATOM   3926 C C   . SER A 1 514 ? -40.712 173.192 59.533  1.00 21.02  ? 514  SER A C   1 
ATOM   3927 O O   . SER A 1 514 ? -39.840 174.039 59.762  1.00 19.60  ? 514  SER A O   1 
ATOM   3928 C CB  . SER A 1 514 ? -39.987 171.848 57.555  1.00 15.26  ? 514  SER A CB  1 
ATOM   3929 O OG  . SER A 1 514 ? -41.072 172.341 56.794  1.00 14.95  ? 514  SER A OG  1 
ATOM   3930 N N   . PHE A 1 515 ? -42.013 173.418 59.693  1.00 22.25  ? 515  PHE A N   1 
ATOM   3931 C CA  . PHE A 1 515 ? -42.542 174.702 60.145  1.00 18.20  ? 515  PHE A CA  1 
ATOM   3932 C C   . PHE A 1 515 ? -42.461 175.757 59.048  1.00 17.68  ? 515  PHE A C   1 
ATOM   3933 O O   . PHE A 1 515 ? -42.554 176.954 59.313  1.00 18.77  ? 515  PHE A O   1 
ATOM   3934 C CB  . PHE A 1 515 ? -41.817 175.169 61.408  1.00 18.02  ? 515  PHE A CB  1 
ATOM   3935 C CG  . PHE A 1 515 ? -42.157 174.357 62.620  1.00 12.42  ? 515  PHE A CG  1 
ATOM   3936 C CD1 . PHE A 1 515 ? -43.416 174.452 63.202  1.00 11.33  ? 515  PHE A CD1 1 
ATOM   3937 C CD2 . PHE A 1 515 ? -41.241 173.457 63.150  1.00 13.51  ? 515  PHE A CD2 1 
ATOM   3938 C CE1 . PHE A 1 515 ? -43.755 173.661 64.290  1.00 7.77   ? 515  PHE A CE1 1 
ATOM   3939 C CE2 . PHE A 1 515 ? -41.574 172.661 64.239  1.00 12.93  ? 515  PHE A CE2 1 
ATOM   3940 C CZ  . PHE A 1 515 ? -42.833 172.764 64.808  1.00 6.50   ? 515  PHE A CZ  1 
ATOM   3941 N N   . VAL A 1 516 ? -42.266 175.293 57.817  1.00 20.50  ? 516  VAL A N   1 
ATOM   3942 C CA  . VAL A 1 516 ? -42.225 176.166 56.651  1.00 20.20  ? 516  VAL A CA  1 
ATOM   3943 C C   . VAL A 1 516 ? -43.653 176.074 56.128  1.00 26.18  ? 516  VAL A C   1 
ATOM   3944 O O   . VAL A 1 516 ? -44.011 175.114 55.447  1.00 29.75  ? 516  VAL A O   1 
ATOM   3945 C CB  . VAL A 1 516 ? -41.263 175.645 55.575  1.00 16.07  ? 516  VAL A CB  1 
ATOM   3946 C CG1 . VAL A 1 516 ? -41.404 176.476 54.312  1.00 18.07  ? 516  VAL A CG1 1 
ATOM   3947 C CG2 . VAL A 1 516 ? -39.835 175.707 56.089  1.00 17.22  ? 516  VAL A CG2 1 
ATOM   3948 N N   . ARG A 1 517 ? -44.464 177.076 56.454  1.00 31.80  ? 517  ARG A N   1 
ATOM   3949 C CA  . ARG A 1 517 ? -45.869 177.088 56.076  1.00 31.09  ? 517  ARG A CA  1 
ATOM   3950 C C   . ARG A 1 517 ? -46.204 177.619 54.697  1.00 30.91  ? 517  ARG A C   1 
ATOM   3951 O O   . ARG A 1 517 ? -47.364 177.614 54.302  1.00 33.74  ? 517  ARG A O   1 
ATOM   3952 C CB  . ARG A 1 517 ? -46.659 177.860 57.132  1.00 30.10  ? 517  ARG A CB  1 
ATOM   3953 C CG  . ARG A 1 517 ? -46.898 177.050 58.390  1.00 42.04  ? 517  ARG A CG  1 
ATOM   3954 C CD  . ARG A 1 517 ? -47.268 177.921 59.572  1.00 50.48  ? 517  ARG A CD  1 
ATOM   3955 N NE  . ARG A 1 517 ? -48.267 177.276 60.424  1.00 61.25  ? 517  ARG A NE  1 
ATOM   3956 C CZ  . ARG A 1 517 ? -48.045 176.878 61.673  1.00 67.20  ? 517  ARG A CZ  1 
ATOM   3957 N NH1 . ARG A 1 517 ? -46.851 177.056 62.231  1.00 66.30  ? 517  ARG A NH1 1 
ATOM   3958 N NH2 . ARG A 1 517 ? -49.020 176.301 62.368  1.00 72.92  ? 517  ARG A NH2 1 
ATOM   3959 N N   . ARG A 1 518 ? -45.205 178.065 53.950  1.00 31.53  ? 518  ARG A N   1 
ATOM   3960 C CA  . ARG A 1 518 ? -45.485 178.595 52.623  1.00 36.37  ? 518  ARG A CA  1 
ATOM   3961 C C   . ARG A 1 518 ? -44.239 178.638 51.745  1.00 33.75  ? 518  ARG A C   1 
ATOM   3962 O O   . ARG A 1 518 ? -43.129 178.859 52.230  1.00 37.67  ? 518  ARG A O   1 
ATOM   3963 C CB  . ARG A 1 518 ? -46.091 180.005 52.751  1.00 40.67  ? 518  ARG A CB  1 
ATOM   3964 C CG  . ARG A 1 518 ? -46.110 180.817 51.458  1.00 52.92  ? 518  ARG A CG  1 
ATOM   3965 C CD  . ARG A 1 518 ? -46.235 182.321 51.718  1.00 53.91  ? 518  ARG A CD  1 
ATOM   3966 N NE  . ARG A 1 518 ? -45.114 183.077 51.157  1.00 52.48  ? 518  ARG A NE  1 
ATOM   3967 C CZ  . ARG A 1 518 ? -44.927 184.383 51.331  1.00 53.84  ? 518  ARG A CZ  1 
ATOM   3968 N NH1 . ARG A 1 518 ? -45.787 185.092 52.052  1.00 56.42  ? 518  ARG A NH1 1 
ATOM   3969 N NH2 . ARG A 1 518 ? -43.870 184.981 50.797  1.00 53.58  ? 518  ARG A NH2 1 
ATOM   3970 N N   . THR A 1 519 ? -44.430 178.400 50.452  1.00 30.07  ? 519  THR A N   1 
ATOM   3971 C CA  . THR A 1 519 ? -43.333 178.440 49.493  1.00 32.39  ? 519  THR A CA  1 
ATOM   3972 C C   . THR A 1 519 ? -43.176 179.914 49.119  1.00 31.71  ? 519  THR A C   1 
ATOM   3973 O O   . THR A 1 519 ? -44.079 180.711 49.362  1.00 31.03  ? 519  THR A O   1 
ATOM   3974 C CB  . THR A 1 519 ? -43.673 177.621 48.231  1.00 32.46  ? 519  THR A CB  1 
ATOM   3975 O OG1 . THR A 1 519 ? -45.077 177.726 47.967  1.00 42.47  ? 519  THR A OG1 1 
ATOM   3976 C CG2 . THR A 1 519 ? -43.323 176.150 48.431  1.00 25.15  ? 519  THR A CG2 1 
ATOM   3977 N N   . PRO A 1 520 ? -42.031 180.303 48.536  1.00 32.08  ? 520  PRO A N   1 
ATOM   3978 C CA  . PRO A 1 520 ? -41.921 181.723 48.195  1.00 34.15  ? 520  PRO A CA  1 
ATOM   3979 C C   . PRO A 1 520 ? -43.038 182.106 47.236  1.00 42.28  ? 520  PRO A C   1 
ATOM   3980 O O   . PRO A 1 520 ? -43.559 181.253 46.518  1.00 49.00  ? 520  PRO A O   1 
ATOM   3981 C CB  . PRO A 1 520 ? -40.536 181.843 47.562  1.00 27.32  ? 520  PRO A CB  1 
ATOM   3982 C CG  . PRO A 1 520 ? -40.153 180.461 47.180  1.00 29.67  ? 520  PRO A CG  1 
ATOM   3983 C CD  . PRO A 1 520 ? -40.829 179.545 48.152  1.00 33.97  ? 520  PRO A CD  1 
ATOM   3984 N N   . ASP A 1 521 ? -43.421 183.378 47.231  1.00 47.57  ? 521  ASP A N   1 
ATOM   3985 C CA  . ASP A 1 521 ? -44.485 183.828 46.343  1.00 50.28  ? 521  ASP A CA  1 
ATOM   3986 C C   . ASP A 1 521 ? -44.018 184.932 45.407  1.00 51.17  ? 521  ASP A C   1 
ATOM   3987 O O   . ASP A 1 521 ? -44.781 185.396 44.560  1.00 56.76  ? 521  ASP A O   1 
ATOM   3988 C CB  . ASP A 1 521 ? -45.709 184.292 47.157  1.00 51.62  ? 521  ASP A CB  1 
ATOM   3989 C CG  . ASP A 1 521 ? -45.490 185.623 47.863  1.00 51.68  ? 521  ASP A CG  1 
ATOM   3990 O OD1 . ASP A 1 521 ? -44.371 186.169 47.785  1.00 53.93  ? 521  ASP A OD1 1 
ATOM   3991 O OD2 . ASP A 1 521 ? -46.446 186.121 48.502  1.00 49.16  ? 521  ASP A OD2 1 
ATOM   3992 N N   . GLY A 1 522 ? -42.759 185.336 45.554  1.00 52.22  ? 522  GLY A N   1 
ATOM   3993 C CA  . GLY A 1 522 ? -42.209 186.387 44.716  1.00 51.56  ? 522  GLY A CA  1 
ATOM   3994 C C   . GLY A 1 522 ? -42.119 187.714 45.448  1.00 51.37  ? 522  GLY A C   1 
ATOM   3995 O O   . GLY A 1 522 ? -41.310 188.572 45.100  1.00 52.60  ? 522  GLY A O   1 
ATOM   3996 N N   . THR A 1 523 ? -42.959 187.875 46.465  1.00 48.95  ? 523  THR A N   1 
ATOM   3997 C CA  . THR A 1 523 ? -42.984 189.086 47.273  1.00 52.30  ? 523  THR A CA  1 
ATOM   3998 C C   . THR A 1 523 ? -41.667 189.292 48.019  1.00 53.08  ? 523  THR A C   1 
ATOM   3999 O O   . THR A 1 523 ? -41.359 190.408 48.448  1.00 57.08  ? 523  THR A O   1 
ATOM   4000 C CB  . THR A 1 523 ? -44.107 189.027 48.332  1.00 56.38  ? 523  THR A CB  1 
ATOM   4001 O OG1 . THR A 1 523 ? -45.305 188.510 47.742  1.00 59.31  ? 523  THR A OG1 1 
ATOM   4002 C CG2 . THR A 1 523 ? -44.382 190.417 48.896  1.00 65.21  ? 523  THR A CG2 1 
ATOM   4003 N N   . GLU A 1 524 ? -40.895 188.218 48.173  1.00 51.13  ? 524  GLU A N   1 
ATOM   4004 C CA  . GLU A 1 524 ? -39.626 188.276 48.898  1.00 43.83  ? 524  GLU A CA  1 
ATOM   4005 C C   . GLU A 1 524 ? -38.589 189.224 48.315  1.00 40.61  ? 524  GLU A C   1 
ATOM   4006 O O   . GLU A 1 524 ? -38.233 189.136 47.138  1.00 42.02  ? 524  GLU A O   1 
ATOM   4007 C CB  . GLU A 1 524 ? -39.014 186.880 49.016  1.00 42.44  ? 524  GLU A CB  1 
ATOM   4008 C CG  . GLU A 1 524 ? -39.938 185.863 49.628  1.00 32.81  ? 524  GLU A CG  1 
ATOM   4009 C CD  . GLU A 1 524 ? -40.791 185.199 48.587  1.00 30.59  ? 524  GLU A CD  1 
ATOM   4010 O OE1 . GLU A 1 524 ? -40.374 185.171 47.405  1.00 27.61  ? 524  GLU A OE1 1 
ATOM   4011 O OE2 . GLU A 1 524 ? -41.876 184.709 48.952  1.00 27.67  ? 524  GLU A OE2 1 
ATOM   4012 N N   . ASN A 1 525 ? -38.095 190.116 49.166  1.00 34.33  ? 525  ASN A N   1 
ATOM   4013 C CA  . ASN A 1 525 ? -37.094 191.090 48.775  1.00 33.59  ? 525  ASN A CA  1 
ATOM   4014 C C   . ASN A 1 525 ? -36.245 191.434 49.992  1.00 32.81  ? 525  ASN A C   1 
ATOM   4015 O O   . ASN A 1 525 ? -36.780 191.682 51.071  1.00 33.30  ? 525  ASN A O   1 
ATOM   4016 C CB  . ASN A 1 525 ? -37.781 192.349 48.249  1.00 41.07  ? 525  ASN A CB  1 
ATOM   4017 C CG  . ASN A 1 525 ? -36.803 193.360 47.693  1.00 46.21  ? 525  ASN A CG  1 
ATOM   4018 O OD1 . ASN A 1 525 ? -36.605 193.449 46.479  1.00 50.54  ? 525  ASN A OD1 1 
ATOM   4019 N ND2 . ASN A 1 525 ? -36.185 194.134 48.580  1.00 47.96  ? 525  ASN A ND2 1 
ATOM   4020 N N   . GLY A 1 526 ? -34.927 191.442 49.824  1.00 31.04  ? 526  GLY A N   1 
ATOM   4021 C CA  . GLY A 1 526 ? -34.057 191.777 50.935  1.00 29.65  ? 526  GLY A CA  1 
ATOM   4022 C C   . GLY A 1 526 ? -32.682 191.144 50.874  1.00 30.58  ? 526  GLY A C   1 
ATOM   4023 O O   . GLY A 1 526 ? -32.351 190.434 49.923  1.00 31.58  ? 526  GLY A O   1 
ATOM   4024 N N   . ASP A 1 527 ? -31.880 191.414 51.898  1.00 27.22  ? 527  ASP A N   1 
ATOM   4025 C CA  . ASP A 1 527 ? -30.531 190.873 52.005  1.00 25.11  ? 527  ASP A CA  1 
ATOM   4026 C C   . ASP A 1 527 ? -30.500 189.893 53.169  1.00 25.57  ? 527  ASP A C   1 
ATOM   4027 O O   . ASP A 1 527 ? -30.770 190.272 54.311  1.00 28.38  ? 527  ASP A O   1 
ATOM   4028 C CB  . ASP A 1 527 ? -29.541 192.001 52.249  1.00 28.04  ? 527  ASP A CB  1 
ATOM   4029 C CG  . ASP A 1 527 ? -29.320 192.844 51.020  1.00 28.95  ? 527  ASP A CG  1 
ATOM   4030 O OD1 . ASP A 1 527 ? -29.868 192.488 49.956  1.00 34.05  ? 527  ASP A OD1 1 
ATOM   4031 O OD2 . ASP A 1 527 ? -28.599 193.857 51.114  1.00 34.75  ? 527  ASP A OD2 1 
ATOM   4032 N N   . PHE A 1 528 ? -30.166 188.638 52.882  1.00 21.61  ? 528  PHE A N   1 
ATOM   4033 C CA  . PHE A 1 528 ? -30.152 187.614 53.918  1.00 17.47  ? 528  PHE A CA  1 
ATOM   4034 C C   . PHE A 1 528 ? -28.861 186.844 54.019  1.00 16.33  ? 528  PHE A C   1 
ATOM   4035 O O   . PHE A 1 528 ? -28.145 186.681 53.040  1.00 28.02  ? 528  PHE A O   1 
ATOM   4036 C CB  . PHE A 1 528 ? -31.295 186.627 53.684  1.00 12.41  ? 528  PHE A CB  1 
ATOM   4037 C CG  . PHE A 1 528 ? -32.619 187.288 53.472  1.00 17.38  ? 528  PHE A CG  1 
ATOM   4038 C CD1 . PHE A 1 528 ? -33.430 187.606 54.553  1.00 20.88  ? 528  PHE A CD1 1 
ATOM   4039 C CD2 . PHE A 1 528 ? -33.042 187.629 52.194  1.00 16.32  ? 528  PHE A CD2 1 
ATOM   4040 C CE1 . PHE A 1 528 ? -34.642 188.261 54.366  1.00 19.18  ? 528  PHE A CE1 1 
ATOM   4041 C CE2 . PHE A 1 528 ? -34.250 188.281 51.998  1.00 20.02  ? 528  PHE A CE2 1 
ATOM   4042 C CZ  . PHE A 1 528 ? -35.052 188.599 53.087  1.00 14.71  ? 528  PHE A CZ  1 
ATOM   4043 N N   . LEU A 1 529 ? -28.569 186.373 55.222  1.00 13.97  ? 529  LEU A N   1 
ATOM   4044 C CA  . LEU A 1 529 ? -27.378 185.581 55.466  1.00 11.47  ? 529  LEU A CA  1 
ATOM   4045 C C   . LEU A 1 529 ? -27.822 184.136 55.648  1.00 10.47  ? 529  LEU A C   1 
ATOM   4046 O O   . LEU A 1 529 ? -28.949 183.869 56.059  1.00 8.25   ? 529  LEU A O   1 
ATOM   4047 C CB  . LEU A 1 529 ? -26.680 186.047 56.740  1.00 11.87  ? 529  LEU A CB  1 
ATOM   4048 C CG  . LEU A 1 529 ? -25.922 187.370 56.692  1.00 15.52  ? 529  LEU A CG  1 
ATOM   4049 C CD1 . LEU A 1 529 ? -25.839 187.933 58.092  1.00 18.72  ? 529  LEU A CD1 1 
ATOM   4050 C CD2 . LEU A 1 529 ? -24.525 187.161 56.134  1.00 17.77  ? 529  LEU A CD2 1 
ATOM   4051 N N   . ALA A 1 530 ? -26.938 183.202 55.333  1.00 8.91   ? 530  ALA A N   1 
ATOM   4052 C CA  . ALA A 1 530 ? -27.237 181.793 55.514  1.00 6.71   ? 530  ALA A CA  1 
ATOM   4053 C C   . ALA A 1 530 ? -25.965 181.145 56.024  1.00 9.86   ? 530  ALA A C   1 
ATOM   4054 O O   . ALA A 1 530 ? -24.860 181.571 55.695  1.00 17.07  ? 530  ALA A O   1 
ATOM   4055 C CB  . ALA A 1 530 ? -27.654 181.162 54.208  1.00 8.70   ? 530  ALA A CB  1 
ATOM   4056 N N   . LEU A 1 531 ? -26.125 180.129 56.854  1.00 9.72   ? 531  LEU A N   1 
ATOM   4057 C CA  . LEU A 1 531 ? -24.994 179.401 57.394  1.00 10.83  ? 531  LEU A CA  1 
ATOM   4058 C C   . LEU A 1 531 ? -25.225 177.968 56.921  1.00 12.65  ? 531  LEU A C   1 
ATOM   4059 O O   . LEU A 1 531 ? -26.289 177.400 57.147  1.00 21.54  ? 531  LEU A O   1 
ATOM   4060 C CB  . LEU A 1 531 ? -25.013 179.489 58.919  1.00 14.83  ? 531  LEU A CB  1 
ATOM   4061 C CG  . LEU A 1 531 ? -23.798 178.961 59.678  1.00 19.76  ? 531  LEU A CG  1 
ATOM   4062 C CD1 . LEU A 1 531 ? -22.625 179.915 59.516  1.00 25.76  ? 531  LEU A CD1 1 
ATOM   4063 C CD2 . LEU A 1 531 ? -24.157 178.809 61.137  1.00 14.84  ? 531  LEU A CD2 1 
ATOM   4064 N N   . ASP A 1 532 ? -24.252 177.390 56.237  1.00 9.06   ? 532  ASP A N   1 
ATOM   4065 C CA  . ASP A 1 532 ? -24.409 176.030 55.739  1.00 5.00   ? 532  ASP A CA  1 
ATOM   4066 C C   . ASP A 1 532 ? -23.454 175.129 56.507  1.00 5.37   ? 532  ASP A C   1 
ATOM   4067 O O   . ASP A 1 532 ? -22.277 175.039 56.179  1.00 8.55   ? 532  ASP A O   1 
ATOM   4068 C CB  . ASP A 1 532 ? -24.109 176.002 54.237  1.00 6.55   ? 532  ASP A CB  1 
ATOM   4069 C CG  . ASP A 1 532 ? -24.286 174.627 53.626  1.00 15.54  ? 532  ASP A CG  1 
ATOM   4070 O OD1 . ASP A 1 532 ? -24.890 173.753 54.278  1.00 19.89  ? 532  ASP A OD1 1 
ATOM   4071 O OD2 . ASP A 1 532 ? -23.819 174.417 52.485  1.00 21.62  ? 532  ASP A OD2 1 
ATOM   4072 N N   . LEU A 1 533 ? -23.956 174.474 57.547  1.00 8.85   ? 533  LEU A N   1 
ATOM   4073 C CA  . LEU A 1 533 ? -23.109 173.604 58.360  1.00 13.44  ? 533  LEU A CA  1 
ATOM   4074 C C   . LEU A 1 533 ? -23.442 172.126 58.203  1.00 14.54  ? 533  LEU A C   1 
ATOM   4075 O O   . LEU A 1 533 ? -24.504 171.663 58.621  1.00 16.34  ? 533  LEU A O   1 
ATOM   4076 C CB  . LEU A 1 533 ? -23.206 174.008 59.838  1.00 15.22  ? 533  LEU A CB  1 
ATOM   4077 C CG  . LEU A 1 533 ? -22.378 173.177 60.820  1.00 19.72  ? 533  LEU A CG  1 
ATOM   4078 C CD1 . LEU A 1 533 ? -20.894 173.477 60.653  1.00 12.60  ? 533  LEU A CD1 1 
ATOM   4079 C CD2 . LEU A 1 533 ? -22.831 173.487 62.229  1.00 22.13  ? 533  LEU A CD2 1 
ATOM   4080 N N   . GLY A 1 534 ? -22.524 171.389 57.592  1.00 16.58  ? 534  GLY A N   1 
ATOM   4081 C CA  . GLY A 1 534 ? -22.734 169.971 57.393  1.00 24.05  ? 534  GLY A CA  1 
ATOM   4082 C C   . GLY A 1 534 ? -21.423 169.219 57.306  1.00 30.90  ? 534  GLY A C   1 
ATOM   4083 O O   . GLY A 1 534 ? -21.359 168.160 56.681  1.00 38.15  ? 534  GLY A O   1 
ATOM   4084 N N   . GLY A 1 535 ? -20.378 169.766 57.931  1.00 31.06  ? 535  GLY A N   1 
ATOM   4085 C CA  . GLY A 1 535 ? -19.073 169.127 57.904  1.00 30.17  ? 535  GLY A CA  1 
ATOM   4086 C C   . GLY A 1 535 ? -17.918 170.048 58.266  1.00 34.10  ? 535  GLY A C   1 
ATOM   4087 O O   . GLY A 1 535 ? -18.120 171.203 58.639  1.00 31.75  ? 535  GLY A O   1 
ATOM   4088 N N   . THR A 1 536 ? -16.699 169.523 58.152  1.00 38.56  ? 536  THR A N   1 
ATOM   4089 C CA  . THR A 1 536 ? -15.474 170.265 58.457  1.00 39.77  ? 536  THR A CA  1 
ATOM   4090 C C   . THR A 1 536 ? -15.405 171.578 57.703  1.00 35.03  ? 536  THR A C   1 
ATOM   4091 O O   . THR A 1 536 ? -14.777 172.535 58.152  1.00 35.69  ? 536  THR A O   1 
ATOM   4092 C CB  . THR A 1 536 ? -14.221 169.464 58.065  1.00 48.26  ? 536  THR A CB  1 
ATOM   4093 O OG1 . THR A 1 536 ? -14.394 168.088 58.435  1.00 63.16  ? 536  THR A OG1 1 
ATOM   4094 C CG2 . THR A 1 536 ? -12.979 170.046 58.749  1.00 50.17  ? 536  THR A CG2 1 
ATOM   4095 N N   . ASN A 1 537 ? -16.026 171.600 56.532  1.00 29.76  ? 537  ASN A N   1 
ATOM   4096 C CA  . ASN A 1 537 ? -16.048 172.791 55.709  1.00 26.28  ? 537  ASN A CA  1 
ATOM   4097 C C   . ASN A 1 537 ? -17.492 173.260 55.580  1.00 26.09  ? 537  ASN A C   1 
ATOM   4098 O O   . ASN A 1 537 ? -18.305 172.652 54.877  1.00 25.62  ? 537  ASN A O   1 
ATOM   4099 C CB  . ASN A 1 537 ? -15.459 172.498 54.324  1.00 31.08  ? 537  ASN A CB  1 
ATOM   4100 C CG  . ASN A 1 537 ? -13.998 172.085 54.387  1.00 37.25  ? 537  ASN A CG  1 
ATOM   4101 O OD1 . ASN A 1 537 ? -13.184 172.741 55.032  1.00 48.16  ? 537  ASN A OD1 1 
ATOM   4102 N ND2 . ASN A 1 537 ? -13.663 170.987 53.719  1.00 40.34  ? 537  ASN A ND2 1 
ATOM   4103 N N   . PHE A 1 538 ? -17.812 174.326 56.301  1.00 18.73  ? 538  PHE A N   1 
ATOM   4104 C CA  . PHE A 1 538 ? -19.141 174.897 56.250  1.00 12.80  ? 538  PHE A CA  1 
ATOM   4105 C C   . PHE A 1 538 ? -18.928 176.214 55.530  1.00 14.86  ? 538  PHE A C   1 
ATOM   4106 O O   . PHE A 1 538 ? -17.785 176.584 55.238  1.00 13.93  ? 538  PHE A O   1 
ATOM   4107 C CB  . PHE A 1 538 ? -19.685 175.132 57.665  1.00 9.80   ? 538  PHE A CB  1 
ATOM   4108 C CG  . PHE A 1 538 ? -18.942 176.185 58.435  1.00 7.76   ? 538  PHE A CG  1 
ATOM   4109 C CD1 . PHE A 1 538 ? -17.640 175.961 58.865  1.00 8.59   ? 538  PHE A CD1 1 
ATOM   4110 C CD2 . PHE A 1 538 ? -19.538 177.412 58.713  1.00 7.37   ? 538  PHE A CD2 1 
ATOM   4111 C CE1 . PHE A 1 538 ? -16.937 176.950 59.560  1.00 18.97  ? 538  PHE A CE1 1 
ATOM   4112 C CE2 . PHE A 1 538 ? -18.843 178.409 59.407  1.00 9.97   ? 538  PHE A CE2 1 
ATOM   4113 C CZ  . PHE A 1 538 ? -17.541 178.181 59.830  1.00 5.00   ? 538  PHE A CZ  1 
ATOM   4114 N N   . ARG A 1 539 ? -20.012 176.914 55.222  1.00 12.79  ? 539  ARG A N   1 
ATOM   4115 C CA  . ARG A 1 539 ? -19.878 178.192 54.558  1.00 11.75  ? 539  ARG A CA  1 
ATOM   4116 C C   . ARG A 1 539 ? -20.919 179.179 55.023  1.00 11.32  ? 539  ARG A C   1 
ATOM   4117 O O   . ARG A 1 539 ? -21.985 178.800 55.521  1.00 10.65  ? 539  ARG A O   1 
ATOM   4118 C CB  . ARG A 1 539 ? -19.974 178.038 53.040  1.00 13.17  ? 539  ARG A CB  1 
ATOM   4119 C CG  . ARG A 1 539 ? -20.701 176.817 52.566  1.00 11.43  ? 539  ARG A CG  1 
ATOM   4120 C CD  . ARG A 1 539 ? -21.029 176.927 51.087  1.00 13.63  ? 539  ARG A CD  1 
ATOM   4121 N NE  . ARG A 1 539 ? -22.362 176.394 50.823  1.00 16.11  ? 539  ARG A NE  1 
ATOM   4122 C CZ  . ARG A 1 539 ? -23.143 176.780 49.824  1.00 5.00   ? 539  ARG A CZ  1 
ATOM   4123 N NH1 . ARG A 1 539 ? -22.734 177.707 48.977  1.00 15.34  ? 539  ARG A NH1 1 
ATOM   4124 N NH2 . ARG A 1 539 ? -24.344 176.252 49.689  1.00 10.34  ? 539  ARG A NH2 1 
ATOM   4125 N N   . VAL A 1 540 ? -20.580 180.454 54.883  1.00 9.54   ? 540  VAL A N   1 
ATOM   4126 C CA  . VAL A 1 540 ? -21.478 181.537 55.242  1.00 10.67  ? 540  VAL A CA  1 
ATOM   4127 C C   . VAL A 1 540 ? -21.823 182.137 53.894  1.00 12.74  ? 540  VAL A C   1 
ATOM   4128 O O   . VAL A 1 540 ? -21.029 182.062 52.960  1.00 11.50  ? 540  VAL A O   1 
ATOM   4129 C CB  . VAL A 1 540 ? -20.774 182.591 56.120  1.00 10.87  ? 540  VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 540 ? -21.794 183.588 56.673  1.00 5.00   ? 540  VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 540 ? -20.030 181.892 57.255  1.00 5.00   ? 540  VAL A CG2 1 
ATOM   4132 N N   . LEU A 1 541 ? -23.004 182.727 53.787  1.00 13.68  ? 541  LEU A N   1 
ATOM   4133 C CA  . LEU A 1 541 ? -23.427 183.306 52.524  1.00 14.92  ? 541  LEU A CA  1 
ATOM   4134 C C   . LEU A 1 541 ? -24.239 184.569 52.679  1.00 10.73  ? 541  LEU A C   1 
ATOM   4135 O O   . LEU A 1 541 ? -24.904 184.779 53.690  1.00 17.89  ? 541  LEU A O   1 
ATOM   4136 C CB  . LEU A 1 541 ? -24.309 182.316 51.755  1.00 23.87  ? 541  LEU A CB  1 
ATOM   4137 C CG  . LEU A 1 541 ? -23.851 180.932 51.305  1.00 24.50  ? 541  LEU A CG  1 
ATOM   4138 C CD1 . LEU A 1 541 ? -23.947 179.929 52.447  1.00 23.64  ? 541  LEU A CD1 1 
ATOM   4139 C CD2 . LEU A 1 541 ? -24.749 180.509 50.152  1.00 27.33  ? 541  LEU A CD2 1 
ATOM   4140 N N   . LEU A 1 542 ? -24.179 185.410 51.663  1.00 9.38   ? 542  LEU A N   1 
ATOM   4141 C CA  . LEU A 1 542 ? -24.999 186.603 51.634  1.00 9.82   ? 542  LEU A CA  1 
ATOM   4142 C C   . LEU A 1 542 ? -25.830 186.437 50.385  1.00 13.28  ? 542  LEU A C   1 
ATOM   4143 O O   . LEU A 1 542 ? -25.292 186.170 49.318  1.00 16.66  ? 542  LEU A O   1 
ATOM   4144 C CB  . LEU A 1 542 ? -24.169 187.871 51.522  1.00 13.76  ? 542  LEU A CB  1 
ATOM   4145 C CG  . LEU A 1 542 ? -25.058 189.089 51.235  1.00 11.98  ? 542  LEU A CG  1 
ATOM   4146 C CD1 . LEU A 1 542 ? -25.788 189.483 52.499  1.00 8.58   ? 542  LEU A CD1 1 
ATOM   4147 C CD2 . LEU A 1 542 ? -24.230 190.254 50.703  1.00 9.61   ? 542  LEU A CD2 1 
ATOM   4148 N N   . VAL A 1 543 ? -27.139 186.560 50.526  1.00 15.35  ? 543  VAL A N   1 
ATOM   4149 C CA  . VAL A 1 543 ? -28.040 186.407 49.401  1.00 16.21  ? 543  VAL A CA  1 
ATOM   4150 C C   . VAL A 1 543 ? -28.904 187.653 49.280  1.00 19.90  ? 543  VAL A C   1 
ATOM   4151 O O   . VAL A 1 543 ? -29.679 187.970 50.181  1.00 21.61  ? 543  VAL A O   1 
ATOM   4152 C CB  . VAL A 1 543 ? -28.950 185.179 49.609  1.00 14.35  ? 543  VAL A CB  1 
ATOM   4153 C CG1 . VAL A 1 543 ? -29.842 184.976 48.401  1.00 19.40  ? 543  VAL A CG1 1 
ATOM   4154 C CG2 . VAL A 1 543 ? -28.112 183.956 49.862  1.00 10.86  ? 543  VAL A CG2 1 
ATOM   4155 N N   . LYS A 1 544 ? -28.760 188.368 48.172  1.00 24.32  ? 544  LYS A N   1 
ATOM   4156 C CA  . LYS A 1 544 ? -29.550 189.574 47.944  1.00 26.47  ? 544  LYS A CA  1 
ATOM   4157 C C   . LYS A 1 544 ? -30.742 189.205 47.070  1.00 27.86  ? 544  LYS A C   1 
ATOM   4158 O O   . LYS A 1 544 ? -30.573 188.747 45.943  1.00 28.95  ? 544  LYS A O   1 
ATOM   4159 C CB  . LYS A 1 544 ? -28.700 190.637 47.253  1.00 24.36  ? 544  LYS A CB  1 
ATOM   4160 C CG  . LYS A 1 544 ? -27.480 191.044 48.049  1.00 26.79  ? 544  LYS A CG  1 
ATOM   4161 C CD  . LYS A 1 544 ? -27.018 192.432 47.666  1.00 38.52  ? 544  LYS A CD  1 
ATOM   4162 C CE  . LYS A 1 544 ? -25.728 192.792 48.383  1.00 51.08  ? 544  LYS A CE  1 
ATOM   4163 N NZ  . LYS A 1 544 ? -24.584 192.963 47.438  1.00 60.42  ? 544  LYS A NZ  1 
ATOM   4164 N N   . ILE A 1 545 ? -31.943 189.395 47.600  1.00 28.05  ? 545  ILE A N   1 
ATOM   4165 C CA  . ILE A 1 545 ? -33.157 189.064 46.867  1.00 30.93  ? 545  ILE A CA  1 
ATOM   4166 C C   . ILE A 1 545 ? -33.947 190.318 46.531  1.00 36.25  ? 545  ILE A C   1 
ATOM   4167 O O   . ILE A 1 545 ? -34.310 191.093 47.419  1.00 36.00  ? 545  ILE A O   1 
ATOM   4168 C CB  . ILE A 1 545 ? -34.076 188.125 47.690  1.00 27.86  ? 545  ILE A CB  1 
ATOM   4169 C CG1 . ILE A 1 545 ? -33.315 186.866 48.103  1.00 21.41  ? 545  ILE A CG1 1 
ATOM   4170 C CG2 . ILE A 1 545 ? -35.310 187.754 46.871  1.00 24.06  ? 545  ILE A CG2 1 
ATOM   4171 C CD1 . ILE A 1 545 ? -34.163 185.888 48.868  1.00 13.00  ? 545  ILE A CD1 1 
ATOM   4172 N N   . ARG A 1 546 ? -34.217 190.514 45.246  1.00 39.93  ? 546  ARG A N   1 
ATOM   4173 C CA  . ARG A 1 546 ? -34.976 191.675 44.811  1.00 45.38  ? 546  ARG A CA  1 
ATOM   4174 C C   . ARG A 1 546 ? -36.264 191.271 44.108  1.00 50.14  ? 546  ARG A C   1 
ATOM   4175 O O   . ARG A 1 546 ? -36.242 190.688 43.021  1.00 47.65  ? 546  ARG A O   1 
ATOM   4176 C CB  . ARG A 1 546 ? -34.129 192.542 43.886  1.00 46.06  ? 546  ARG A CB  1 
ATOM   4177 C CG  . ARG A 1 546 ? -33.055 193.348 44.599  1.00 51.37  ? 546  ARG A CG  1 
ATOM   4178 C CD  . ARG A 1 546 ? -33.458 193.750 46.016  1.00 54.77  ? 546  ARG A CD  1 
ATOM   4179 N NE  . ARG A 1 546 ? -32.339 194.354 46.742  1.00 63.71  ? 546  ARG A NE  1 
ATOM   4180 C CZ  . ARG A 1 546 ? -31.701 193.781 47.759  1.00 64.36  ? 546  ARG A CZ  1 
ATOM   4181 N NH1 . ARG A 1 546 ? -32.065 192.577 48.187  1.00 67.47  ? 546  ARG A NH1 1 
ATOM   4182 N NH2 . ARG A 1 546 ? -30.694 194.411 48.347  1.00 63.76  ? 546  ARG A NH2 1 
ATOM   4183 N N   . SER A 1 547 ? -37.387 191.586 44.742  1.00 56.42  ? 547  SER A N   1 
ATOM   4184 C CA  . SER A 1 547 ? -38.696 191.265 44.196  1.00 64.72  ? 547  SER A CA  1 
ATOM   4185 C C   . SER A 1 547 ? -39.105 192.316 43.179  1.00 72.13  ? 547  SER A C   1 
ATOM   4186 O O   . SER A 1 547 ? -40.194 192.880 43.264  1.00 77.23  ? 547  SER A O   1 
ATOM   4187 C CB  . SER A 1 547 ? -39.734 191.204 45.318  1.00 63.61  ? 547  SER A CB  1 
ATOM   4188 O OG  . SER A 1 547 ? -40.038 192.500 45.810  1.00 62.11  ? 547  SER A OG  1 
ATOM   4189 N N   . GLY A 1 548 ? -38.228 192.580 42.217  1.00 79.49  ? 548  GLY A N   1 
ATOM   4190 C CA  . GLY A 1 548 ? -38.536 193.570 41.202  1.00 90.06  ? 548  GLY A CA  1 
ATOM   4191 C C   . GLY A 1 548 ? -39.487 193.051 40.137  1.00 94.86  ? 548  GLY A C   1 
ATOM   4192 O O   . GLY A 1 548 ? -40.020 191.941 40.249  1.00 97.87  ? 548  GLY A O   1 
ATOM   4193 N N   . LYS A 1 549 ? -39.718 193.862 39.108  1.00 96.46  ? 549  LYS A N   1 
ATOM   4194 C CA  . LYS A 1 549 ? -40.591 193.466 38.011  1.00 94.45  ? 549  LYS A CA  1 
ATOM   4195 C C   . LYS A 1 549 ? -40.034 192.141 37.510  1.00 92.43  ? 549  LYS A C   1 
ATOM   4196 O O   . LYS A 1 549 ? -40.777 191.199 37.229  1.00 90.66  ? 549  LYS A O   1 
ATOM   4197 C CB  . LYS A 1 549 ? -40.546 194.516 36.898  1.00 96.77  ? 549  LYS A CB  1 
ATOM   4198 C CG  . LYS A 1 549 ? -41.219 194.088 35.602  1.00 99.60  ? 549  LYS A CG  1 
ATOM   4199 C CD  . LYS A 1 549 ? -42.405 194.985 35.270  1.00 100.00 ? 549  LYS A CD  1 
ATOM   4200 C CE  . LYS A 1 549 ? -43.515 194.845 36.306  1.00 100.00 ? 549  LYS A CE  1 
ATOM   4201 N NZ  . LYS A 1 549 ? -44.688 194.094 35.770  1.00 100.00 ? 549  LYS A NZ  1 
ATOM   4202 N N   . LYS A 1 550 ? -38.709 192.086 37.424  1.00 90.81  ? 550  LYS A N   1 
ATOM   4203 C CA  . LYS A 1 550 ? -38.005 190.891 36.989  1.00 90.41  ? 550  LYS A CA  1 
ATOM   4204 C C   . LYS A 1 550 ? -37.298 190.258 38.183  1.00 90.67  ? 550  LYS A C   1 
ATOM   4205 O O   . LYS A 1 550 ? -36.446 190.885 38.815  1.00 90.20  ? 550  LYS A O   1 
ATOM   4206 C CB  . LYS A 1 550 ? -36.980 191.243 35.915  1.00 91.24  ? 550  LYS A CB  1 
ATOM   4207 C CG  . LYS A 1 550 ? -36.502 190.044 35.116  1.00 95.82  ? 550  LYS A CG  1 
ATOM   4208 C CD  . LYS A 1 550 ? -37.673 189.299 34.480  1.00 99.63  ? 550  LYS A CD  1 
ATOM   4209 C CE  . LYS A 1 550 ? -37.625 187.805 34.790  1.00 100.00 ? 550  LYS A CE  1 
ATOM   4210 N NZ  . LYS A 1 550 ? -37.203 186.988 33.610  1.00 100.00 ? 550  LYS A NZ  1 
ATOM   4211 N N   . ARG A 1 551 ? -37.662 189.014 38.483  1.00 90.14  ? 551  ARG A N   1 
ATOM   4212 C CA  . ARG A 1 551 ? -37.082 188.272 39.599  1.00 86.49  ? 551  ARG A CA  1 
ATOM   4213 C C   . ARG A 1 551 ? -35.571 188.144 39.466  1.00 83.97  ? 551  ARG A C   1 
ATOM   4214 O O   . ARG A 1 551 ? -35.076 187.612 38.473  1.00 88.07  ? 551  ARG A O   1 
ATOM   4215 C CB  . ARG A 1 551 ? -37.691 186.871 39.665  1.00 85.68  ? 551  ARG A CB  1 
ATOM   4216 C CG  . ARG A 1 551 ? -38.871 186.755 40.594  1.00 87.02  ? 551  ARG A CG  1 
ATOM   4217 C CD  . ARG A 1 551 ? -38.979 185.349 41.157  1.00 90.80  ? 551  ARG A CD  1 
ATOM   4218 N NE  . ARG A 1 551 ? -40.315 184.775 41.008  1.00 95.80  ? 551  ARG A NE  1 
ATOM   4219 C CZ  . ARG A 1 551 ? -41.453 185.429 41.235  1.00 100.00 ? 551  ARG A CZ  1 
ATOM   4220 N NH1 . ARG A 1 551 ? -41.435 186.699 41.627  1.00 100.00 ? 551  ARG A NH1 1 
ATOM   4221 N NH2 . ARG A 1 551 ? -42.616 184.808 41.080  1.00 100.00 ? 551  ARG A NH2 1 
ATOM   4222 N N   . THR A 1 552 ? -34.840 188.626 40.467  1.00 77.76  ? 552  THR A N   1 
ATOM   4223 C CA  . THR A 1 552 ? -33.385 188.541 40.445  1.00 70.37  ? 552  THR A CA  1 
ATOM   4224 C C   . THR A 1 552 ? -32.783 188.303 41.831  1.00 67.39  ? 552  THR A C   1 
ATOM   4225 O O   . THR A 1 552 ? -33.179 188.932 42.815  1.00 66.53  ? 552  THR A O   1 
ATOM   4226 C CB  . THR A 1 552 ? -32.764 189.814 39.828  1.00 66.92  ? 552  THR A CB  1 
ATOM   4227 O OG1 . THR A 1 552 ? -31.443 189.518 39.360  1.00 69.90  ? 552  THR A OG1 1 
ATOM   4228 C CG2 . THR A 1 552 ? -32.702 190.942 40.850  1.00 66.39  ? 552  THR A CG2 1 
ATOM   4229 N N   . VAL A 1 553 ? -31.825 187.383 41.902  1.00 64.10  ? 553  VAL A N   1 
ATOM   4230 C CA  . VAL A 1 553 ? -31.164 187.067 43.164  1.00 62.46  ? 553  VAL A CA  1 
ATOM   4231 C C   . VAL A 1 553 ? -29.669 186.809 42.954  1.00 59.53  ? 553  VAL A C   1 
ATOM   4232 O O   . VAL A 1 553 ? -29.284 185.934 42.179  1.00 61.01  ? 553  VAL A O   1 
ATOM   4233 C CB  . VAL A 1 553 ? -31.828 185.834 43.845  1.00 60.74  ? 553  VAL A CB  1 
ATOM   4234 C CG1 . VAL A 1 553 ? -32.380 184.898 42.789  1.00 66.26  ? 553  VAL A CG1 1 
ATOM   4235 C CG2 . VAL A 1 553 ? -30.830 185.111 44.744  1.00 52.88  ? 553  VAL A CG2 1 
ATOM   4236 N N   . GLU A 1 554 ? -28.837 187.592 43.637  1.00 55.30  ? 554  GLU A N   1 
ATOM   4237 C CA  . GLU A 1 554 ? -27.385 187.453 43.544  1.00 54.25  ? 554  GLU A CA  1 
ATOM   4238 C C   . GLU A 1 554 ? -26.826 187.069 44.907  1.00 49.62  ? 554  GLU A C   1 
ATOM   4239 O O   . GLU A 1 554 ? -27.363 187.472 45.941  1.00 49.83  ? 554  GLU A O   1 
ATOM   4240 C CB  . GLU A 1 554 ? -26.746 188.766 43.072  1.00 58.24  ? 554  GLU A CB  1 
ATOM   4241 C CG  . GLU A 1 554 ? -26.670 189.864 44.132  1.00 60.48  ? 554  GLU A CG  1 
ATOM   4242 C CD  . GLU A 1 554 ? -25.394 190.690 44.040  1.00 63.46  ? 554  GLU A CD  1 
ATOM   4243 O OE1 . GLU A 1 554 ? -24.437 190.247 43.372  1.00 68.51  ? 554  GLU A OE1 1 
ATOM   4244 O OE2 . GLU A 1 554 ? -25.346 191.785 44.639  1.00 64.82  ? 554  GLU A OE2 1 
ATOM   4245 N N   . MET A 1 555 ? -25.752 186.289 44.916  1.00 44.13  ? 555  MET A N   1 
ATOM   4246 C CA  . MET A 1 555 ? -25.171 185.873 46.183  1.00 41.31  ? 555  MET A CA  1 
ATOM   4247 C C   . MET A 1 555 ? -23.674 185.609 46.159  1.00 35.45  ? 555  MET A C   1 
ATOM   4248 O O   . MET A 1 555 ? -23.079 185.369 45.107  1.00 36.71  ? 555  MET A O   1 
ATOM   4249 C CB  . MET A 1 555 ? -25.890 184.629 46.700  1.00 47.28  ? 555  MET A CB  1 
ATOM   4250 C CG  . MET A 1 555 ? -25.384 183.330 46.122  1.00 47.41  ? 555  MET A CG  1 
ATOM   4251 S SD  . MET A 1 555 ? -26.646 182.072 46.242  1.00 57.76  ? 555  MET A SD  1 
ATOM   4252 C CE  . MET A 1 555 ? -27.961 182.836 45.307  1.00 48.33  ? 555  MET A CE  1 
ATOM   4253 N N   . HIS A 1 556 ? -23.077 185.662 47.345  1.00 28.24  ? 556  HIS A N   1 
ATOM   4254 C CA  . HIS A 1 556 ? -21.653 185.427 47.520  1.00 22.78  ? 556  HIS A CA  1 
ATOM   4255 C C   . HIS A 1 556 ? -21.489 184.479 48.690  1.00 17.96  ? 556  HIS A C   1 
ATOM   4256 O O   . HIS A 1 556 ? -22.381 184.375 49.525  1.00 18.02  ? 556  HIS A O   1 
ATOM   4257 C CB  . HIS A 1 556 ? -20.937 186.741 47.814  1.00 17.69  ? 556  HIS A CB  1 
ATOM   4258 C CG  . HIS A 1 556 ? -21.312 187.845 46.881  1.00 22.66  ? 556  HIS A CG  1 
ATOM   4259 N ND1 . HIS A 1 556 ? -22.561 188.431 46.886  1.00 25.23  ? 556  HIS A ND1 1 
ATOM   4260 C CD2 . HIS A 1 556 ? -20.607 188.465 45.904  1.00 22.96  ? 556  HIS A CD2 1 
ATOM   4261 C CE1 . HIS A 1 556 ? -22.609 189.365 45.952  1.00 27.31  ? 556  HIS A CE1 1 
ATOM   4262 N NE2 . HIS A 1 556 ? -21.437 189.406 45.343  1.00 28.15  ? 556  HIS A NE2 1 
ATOM   4263 N N   . ASN A 1 557 ? -20.355 183.790 48.755  1.00 19.55  ? 557  ASN A N   1 
ATOM   4264 C CA  . ASN A 1 557 ? -20.116 182.865 49.849  1.00 21.07  ? 557  ASN A CA  1 
ATOM   4265 C C   . ASN A 1 557 ? -18.664 182.465 49.970  1.00 16.46  ? 557  ASN A C   1 
ATOM   4266 O O   . ASN A 1 557 ? -17.976 182.287 48.977  1.00 25.59  ? 557  ASN A O   1 
ATOM   4267 C CB  . ASN A 1 557 ? -20.959 181.609 49.664  1.00 31.48  ? 557  ASN A CB  1 
ATOM   4268 C CG  . ASN A 1 557 ? -20.839 181.034 48.269  1.00 44.46  ? 557  ASN A CG  1 
ATOM   4269 O OD1 . ASN A 1 557 ? -21.700 181.264 47.408  1.00 50.88  ? 557  ASN A OD1 1 
ATOM   4270 N ND2 . ASN A 1 557 ? -19.767 180.284 48.033  1.00 46.88  ? 557  ASN A ND2 1 
ATOM   4271 N N   . LYS A 1 558 ? -18.207 182.325 51.204  1.00 15.07  ? 558  LYS A N   1 
ATOM   4272 C CA  . LYS A 1 558 ? -16.844 181.915 51.483  1.00 8.61   ? 558  LYS A CA  1 
ATOM   4273 C C   . LYS A 1 558 ? -16.940 180.632 52.301  1.00 12.55  ? 558  LYS A C   1 
ATOM   4274 O O   . LYS A 1 558 ? -17.881 180.452 53.075  1.00 17.50  ? 558  LYS A O   1 
ATOM   4275 C CB  . LYS A 1 558 ? -16.112 182.992 52.277  1.00 5.00   ? 558  LYS A CB  1 
ATOM   4276 C CG  . LYS A 1 558 ? -14.650 182.674 52.548  1.00 10.27  ? 558  LYS A CG  1 
ATOM   4277 C CD  . LYS A 1 558 ? -13.814 183.931 52.710  1.00 5.00   ? 558  LYS A CD  1 
ATOM   4278 C CE  . LYS A 1 558 ? -12.383 183.581 53.037  1.00 5.00   ? 558  LYS A CE  1 
ATOM   4279 N NZ  . LYS A 1 558 ? -11.474 184.715 52.720  1.00 5.00   ? 558  LYS A NZ  1 
ATOM   4280 N N   . ILE A 1 559 ? -15.970 179.747 52.114  1.00 10.05  ? 559  ILE A N   1 
ATOM   4281 C CA  . ILE A 1 559 ? -15.925 178.469 52.801  1.00 6.04   ? 559  ILE A CA  1 
ATOM   4282 C C   . ILE A 1 559 ? -14.953 178.539 53.963  1.00 8.57   ? 559  ILE A C   1 
ATOM   4283 O O   . ILE A 1 559 ? -13.869 179.113 53.847  1.00 7.00   ? 559  ILE A O   1 
ATOM   4284 C CB  . ILE A 1 559 ? -15.466 177.363 51.830  1.00 8.30   ? 559  ILE A CB  1 
ATOM   4285 C CG1 . ILE A 1 559 ? -16.614 177.004 50.889  1.00 10.37  ? 559  ILE A CG1 1 
ATOM   4286 C CG2 . ILE A 1 559 ? -14.995 176.139 52.588  1.00 5.00   ? 559  ILE A CG2 1 
ATOM   4287 C CD1 . ILE A 1 559 ? -16.162 176.378 49.579  1.00 10.52  ? 559  ILE A CD1 1 
ATOM   4288 N N   . TYR A 1 560 ? -15.344 177.959 55.089  1.00 8.49   ? 560  TYR A N   1 
ATOM   4289 C CA  . TYR A 1 560 ? -14.483 177.951 56.265  1.00 8.60   ? 560  TYR A CA  1 
ATOM   4290 C C   . TYR A 1 560 ? -14.307 176.528 56.781  1.00 9.95   ? 560  TYR A C   1 
ATOM   4291 O O   . TYR A 1 560 ? -15.198 175.683 56.655  1.00 9.32   ? 560  TYR A O   1 
ATOM   4292 C CB  . TYR A 1 560 ? -15.064 178.834 57.382  1.00 5.00   ? 560  TYR A CB  1 
ATOM   4293 C CG  . TYR A 1 560 ? -15.165 180.294 57.024  1.00 5.00   ? 560  TYR A CG  1 
ATOM   4294 C CD1 . TYR A 1 560 ? -16.293 180.790 56.369  1.00 8.73   ? 560  TYR A CD1 1 
ATOM   4295 C CD2 . TYR A 1 560 ? -14.126 181.182 57.310  1.00 5.00   ? 560  TYR A CD2 1 
ATOM   4296 C CE1 . TYR A 1 560 ? -16.384 182.137 56.001  1.00 10.84  ? 560  TYR A CE1 1 
ATOM   4297 C CE2 . TYR A 1 560 ? -14.204 182.538 56.944  1.00 5.00   ? 560  TYR A CE2 1 
ATOM   4298 C CZ  . TYR A 1 560 ? -15.335 182.999 56.289  1.00 5.62   ? 560  TYR A CZ  1 
ATOM   4299 O OH  . TYR A 1 560 ? -15.424 184.302 55.883  1.00 7.43   ? 560  TYR A OH  1 
ATOM   4300 N N   . ALA A 1 561 ? -13.144 176.279 57.367  1.00 11.27  ? 561  ALA A N   1 
ATOM   4301 C CA  . ALA A 1 561 ? -12.819 174.980 57.914  1.00 13.77  ? 561  ALA A CA  1 
ATOM   4302 C C   . ALA A 1 561 ? -13.023 174.975 59.420  1.00 20.74  ? 561  ALA A C   1 
ATOM   4303 O O   . ALA A 1 561 ? -13.000 176.019 60.068  1.00 22.53  ? 561  ALA A O   1 
ATOM   4304 C CB  . ALA A 1 561 ? -11.388 174.648 57.599  1.00 10.70  ? 561  ALA A CB  1 
ATOM   4305 N N   . ILE A 1 562 ? -13.229 173.787 59.969  1.00 25.05  ? 562  ILE A N   1 
ATOM   4306 C CA  . ILE A 1 562 ? -13.406 173.621 61.403  1.00 20.72  ? 562  ILE A CA  1 
ATOM   4307 C C   . ILE A 1 562 ? -12.339 172.631 61.841  1.00 26.30  ? 562  ILE A C   1 
ATOM   4308 O O   . ILE A 1 562 ? -12.443 171.432 61.563  1.00 29.03  ? 562  ILE A O   1 
ATOM   4309 C CB  . ILE A 1 562 ? -14.784 173.040 61.747  1.00 13.35  ? 562  ILE A CB  1 
ATOM   4310 C CG1 . ILE A 1 562 ? -15.883 173.972 61.242  1.00 15.88  ? 562  ILE A CG1 1 
ATOM   4311 C CG2 . ILE A 1 562 ? -14.906 172.869 63.239  1.00 10.72  ? 562  ILE A CG2 1 
ATOM   4312 C CD1 . ILE A 1 562 ? -17.218 173.743 61.910  1.00 16.71  ? 562  ILE A CD1 1 
ATOM   4313 N N   . PRO A 1 563 ? -11.291 173.121 62.525  1.00 25.43  ? 563  PRO A N   1 
ATOM   4314 C CA  . PRO A 1 563 ? -10.214 172.244 62.989  1.00 26.21  ? 563  PRO A CA  1 
ATOM   4315 C C   . PRO A 1 563 ? -10.776 171.053 63.759  1.00 32.66  ? 563  PRO A C   1 
ATOM   4316 O O   . PRO A 1 563 ? -11.626 171.217 64.638  1.00 35.35  ? 563  PRO A O   1 
ATOM   4317 C CB  . PRO A 1 563 ? -9.373  173.154 63.877  1.00 21.13  ? 563  PRO A CB  1 
ATOM   4318 C CG  . PRO A 1 563 ? -9.650  174.519 63.392  1.00 17.81  ? 563  PRO A CG  1 
ATOM   4319 C CD  . PRO A 1 563 ? -11.067 174.520 62.922  1.00 24.74  ? 563  PRO A CD  1 
ATOM   4320 N N   . ILE A 1 564 ? -10.314 169.854 63.421  1.00 34.41  ? 564  ILE A N   1 
ATOM   4321 C CA  . ILE A 1 564 ? -10.782 168.652 64.103  1.00 36.91  ? 564  ILE A CA  1 
ATOM   4322 C C   . ILE A 1 564 ? -10.741 168.897 65.611  1.00 35.36  ? 564  ILE A C   1 
ATOM   4323 O O   . ILE A 1 564 ? -11.653 168.523 66.342  1.00 32.33  ? 564  ILE A O   1 
ATOM   4324 C CB  . ILE A 1 564 ? -9.893  167.445 63.761  1.00 35.95  ? 564  ILE A CB  1 
ATOM   4325 C CG1 . ILE A 1 564 ? -10.331 166.230 64.576  1.00 35.56  ? 564  ILE A CG1 1 
ATOM   4326 C CG2 . ILE A 1 564 ? -8.436  167.786 64.022  1.00 36.30  ? 564  ILE A CG2 1 
ATOM   4327 C CD1 . ILE A 1 564 ? -11.558 165.544 64.020  1.00 39.88  ? 564  ILE A CD1 1 
ATOM   4328 N N   . GLU A 1 565 ? -9.674  169.547 66.056  1.00 34.71  ? 565  GLU A N   1 
ATOM   4329 C CA  . GLU A 1 565 ? -9.489  169.874 67.458  1.00 35.99  ? 565  GLU A CA  1 
ATOM   4330 C C   . GLU A 1 565 ? -10.712 170.593 67.995  1.00 32.46  ? 565  GLU A C   1 
ATOM   4331 O O   . GLU A 1 565 ? -11.042 170.479 69.176  1.00 36.57  ? 565  GLU A O   1 
ATOM   4332 C CB  . GLU A 1 565 ? -8.258  170.763 67.619  1.00 45.16  ? 565  GLU A CB  1 
ATOM   4333 C CG  . GLU A 1 565 ? -7.099  170.359 66.717  1.00 61.88  ? 565  GLU A CG  1 
ATOM   4334 C CD  . GLU A 1 565 ? -6.831  171.370 65.616  1.00 70.46  ? 565  GLU A CD  1 
ATOM   4335 O OE1 . GLU A 1 565 ? -7.073  172.576 65.848  1.00 76.09  ? 565  GLU A OE1 1 
ATOM   4336 O OE2 . GLU A 1 565 ? -6.377  170.958 64.522  1.00 75.02  ? 565  GLU A OE2 1 
ATOM   4337 N N   . ILE A 1 566 ? -11.381 171.339 67.126  1.00 26.84  ? 566  ILE A N   1 
ATOM   4338 C CA  . ILE A 1 566 ? -12.570 172.073 67.525  1.00 24.78  ? 566  ILE A CA  1 
ATOM   4339 C C   . ILE A 1 566 ? -13.809 171.231 67.279  1.00 26.67  ? 566  ILE A C   1 
ATOM   4340 O O   . ILE A 1 566 ? -14.797 171.367 67.995  1.00 25.40  ? 566  ILE A O   1 
ATOM   4341 C CB  . ILE A 1 566 ? -12.704 173.387 66.749  1.00 20.92  ? 566  ILE A CB  1 
ATOM   4342 C CG1 . ILE A 1 566 ? -11.490 174.273 67.037  1.00 15.84  ? 566  ILE A CG1 1 
ATOM   4343 C CG2 . ILE A 1 566 ? -14.026 174.068 67.105  1.00 19.22  ? 566  ILE A CG2 1 
ATOM   4344 C CD1 . ILE A 1 566 ? -11.789 175.488 67.895  1.00 18.19  ? 566  ILE A CD1 1 
ATOM   4345 N N   . MET A 1 567 ? -13.754 170.374 66.261  1.00 29.17  ? 567  MET A N   1 
ATOM   4346 C CA  . MET A 1 567 ? -14.871 169.491 65.937  1.00 32.26  ? 567  MET A CA  1 
ATOM   4347 C C   . MET A 1 567 ? -15.111 168.614 67.155  1.00 39.45  ? 567  MET A C   1 
ATOM   4348 O O   . MET A 1 567 ? -16.251 168.318 67.515  1.00 46.09  ? 567  MET A O   1 
ATOM   4349 C CB  . MET A 1 567 ? -14.531 168.606 64.743  1.00 27.01  ? 567  MET A CB  1 
ATOM   4350 C CG  . MET A 1 567 ? -14.411 169.355 63.443  1.00 30.06  ? 567  MET A CG  1 
ATOM   4351 S SD  . MET A 1 567 ? -14.132 168.239 62.070  1.00 30.96  ? 567  MET A SD  1 
ATOM   4352 C CE  . MET A 1 567 ? -15.711 167.421 61.973  1.00 28.48  ? 567  MET A CE  1 
ATOM   4353 N N   . GLN A 1 568 ? -14.014 168.194 67.777  1.00 42.03  ? 568  GLN A N   1 
ATOM   4354 C CA  . GLN A 1 568 ? -14.061 167.368 68.977  1.00 42.29  ? 568  GLN A CA  1 
ATOM   4355 C C   . GLN A 1 568 ? -13.759 168.291 70.149  1.00 38.25  ? 568  GLN A C   1 
ATOM   4356 O O   . GLN A 1 568 ? -13.077 167.913 71.093  1.00 38.13  ? 568  GLN A O   1 
ATOM   4357 C CB  . GLN A 1 568 ? -13.012 166.260 68.890  1.00 45.95  ? 568  GLN A CB  1 
ATOM   4358 C CG  . GLN A 1 568 ? -12.550 165.987 67.466  1.00 54.39  ? 568  GLN A CG  1 
ATOM   4359 C CD  . GLN A 1 568 ? -12.233 164.530 67.215  1.00 54.14  ? 568  GLN A CD  1 
ATOM   4360 O OE1 . GLN A 1 568 ? -11.198 164.023 67.655  1.00 51.10  ? 568  GLN A OE1 1 
ATOM   4361 N NE2 . GLN A 1 568 ? -13.119 163.846 66.497  1.00 56.77  ? 568  GLN A NE2 1 
ATOM   4362 N N   . GLY A 1 569 ? -14.274 169.512 70.060  1.00 38.36  ? 569  GLY A N   1 
ATOM   4363 C CA  . GLY A 1 569 ? -14.063 170.505 71.094  1.00 36.44  ? 569  GLY A CA  1 
ATOM   4364 C C   . GLY A 1 569 ? -15.135 170.470 72.158  1.00 33.23  ? 569  GLY A C   1 
ATOM   4365 O O   . GLY A 1 569 ? -15.654 169.403 72.470  1.00 35.17  ? 569  GLY A O   1 
ATOM   4366 N N   . THR A 1 570 ? -15.492 171.634 72.693  1.00 30.17  ? 570  THR A N   1 
ATOM   4367 C CA  . THR A 1 570 ? -16.485 171.692 73.755  1.00 32.86  ? 570  THR A CA  1 
ATOM   4368 C C   . THR A 1 570 ? -17.840 172.283 73.401  1.00 35.65  ? 570  THR A C   1 
ATOM   4369 O O   . THR A 1 570 ? -18.589 172.684 74.290  1.00 45.85  ? 570  THR A O   1 
ATOM   4370 C CB  . THR A 1 570 ? -15.946 172.467 74.965  1.00 32.42  ? 570  THR A CB  1 
ATOM   4371 O OG1 . THR A 1 570 ? -15.982 173.872 74.683  1.00 35.34  ? 570  THR A OG1 1 
ATOM   4372 C CG2 . THR A 1 570 ? -14.516 172.036 75.280  1.00 37.10  ? 570  THR A CG2 1 
ATOM   4373 N N   . GLY A 1 571 ? -18.171 172.349 72.121  1.00 31.81  ? 571  GLY A N   1 
ATOM   4374 C CA  . GLY A 1 571 ? -19.470 172.887 71.765  1.00 34.79  ? 571  GLY A CA  1 
ATOM   4375 C C   . GLY A 1 571 ? -19.572 174.370 72.047  1.00 34.73  ? 571  GLY A C   1 
ATOM   4376 O O   . GLY A 1 571 ? -20.326 175.089 71.399  1.00 36.01  ? 571  GLY A O   1 
ATOM   4377 N N   . GLU A 1 572 ? -18.821 174.834 73.034  1.00 42.13  ? 572  GLU A N   1 
ATOM   4378 C CA  . GLU A 1 572 ? -18.809 176.251 73.369  1.00 46.38  ? 572  GLU A CA  1 
ATOM   4379 C C   . GLU A 1 572 ? -17.760 176.884 72.464  1.00 43.53  ? 572  GLU A C   1 
ATOM   4380 O O   . GLU A 1 572 ? -17.860 178.049 72.087  1.00 46.20  ? 572  GLU A O   1 
ATOM   4381 C CB  . GLU A 1 572 ? -18.427 176.450 74.835  1.00 52.90  ? 572  GLU A CB  1 
ATOM   4382 C CG  . GLU A 1 572 ? -18.294 177.903 75.244  1.00 62.36  ? 572  GLU A CG  1 
ATOM   4383 C CD  . GLU A 1 572 ? -18.847 178.175 76.628  1.00 67.35  ? 572  GLU A CD  1 
ATOM   4384 O OE1 . GLU A 1 572 ? -20.054 177.929 76.855  1.00 69.74  ? 572  GLU A OE1 1 
ATOM   4385 O OE2 . GLU A 1 572 ? -18.069 178.637 77.489  1.00 73.46  ? 572  GLU A OE2 1 
ATOM   4386 N N   . GLU A 1 573 ? -16.752 176.092 72.117  1.00 40.88  ? 573  GLU A N   1 
ATOM   4387 C CA  . GLU A 1 573 ? -15.690 176.543 71.237  1.00 36.59  ? 573  GLU A CA  1 
ATOM   4388 C C   . GLU A 1 573 ? -16.147 176.379 69.797  1.00 30.81  ? 573  GLU A C   1 
ATOM   4389 O O   . GLU A 1 573 ? -15.810 177.190 68.941  1.00 32.52  ? 573  GLU A O   1 
ATOM   4390 C CB  . GLU A 1 573 ? -14.424 175.714 71.452  1.00 41.04  ? 573  GLU A CB  1 
ATOM   4391 C CG  . GLU A 1 573 ? -14.055 175.478 72.902  1.00 52.50  ? 573  GLU A CG  1 
ATOM   4392 C CD  . GLU A 1 573 ? -12.885 174.523 73.047  1.00 59.10  ? 573  GLU A CD  1 
ATOM   4393 O OE1 . GLU A 1 573 ? -12.780 173.577 72.235  1.00 55.84  ? 573  GLU A OE1 1 
ATOM   4394 O OE2 . GLU A 1 573 ? -12.068 174.720 73.973  1.00 66.01  ? 573  GLU A OE2 1 
ATOM   4395 N N   . LEU A 1 574 ? -16.913 175.323 69.539  1.00 25.14  ? 574  LEU A N   1 
ATOM   4396 C CA  . LEU A 1 574 ? -17.405 175.054 68.197  1.00 21.29  ? 574  LEU A CA  1 
ATOM   4397 C C   . LEU A 1 574 ? -18.234 176.224 67.693  1.00 23.39  ? 574  LEU A C   1 
ATOM   4398 O O   . LEU A 1 574 ? -18.003 176.738 66.594  1.00 26.17  ? 574  LEU A O   1 
ATOM   4399 C CB  . LEU A 1 574 ? -18.256 173.780 68.179  1.00 20.36  ? 574  LEU A CB  1 
ATOM   4400 C CG  . LEU A 1 574 ? -18.873 173.400 66.826  1.00 20.84  ? 574  LEU A CG  1 
ATOM   4401 C CD1 . LEU A 1 574 ? -17.794 173.410 65.764  1.00 23.08  ? 574  LEU A CD1 1 
ATOM   4402 C CD2 . LEU A 1 574 ? -19.519 172.030 66.896  1.00 12.09  ? 574  LEU A CD2 1 
ATOM   4403 N N   . PHE A 1 575 ? -19.202 176.652 68.495  1.00 17.51  ? 575  PHE A N   1 
ATOM   4404 C CA  . PHE A 1 575 ? -20.055 177.755 68.092  1.00 15.89  ? 575  PHE A CA  1 
ATOM   4405 C C   . PHE A 1 575 ? -19.371 179.102 68.275  1.00 19.12  ? 575  PHE A C   1 
ATOM   4406 O O   . PHE A 1 575 ? -19.815 180.120 67.746  1.00 25.19  ? 575  PHE A O   1 
ATOM   4407 C CB  . PHE A 1 575 ? -21.387 177.676 68.839  1.00 9.91   ? 575  PHE A CB  1 
ATOM   4408 C CG  . PHE A 1 575 ? -22.267 176.566 68.344  1.00 15.18  ? 575  PHE A CG  1 
ATOM   4409 C CD1 . PHE A 1 575 ? -22.133 175.275 68.852  1.00 14.50  ? 575  PHE A CD1 1 
ATOM   4410 C CD2 . PHE A 1 575 ? -23.159 176.782 67.297  1.00 17.29  ? 575  PHE A CD2 1 
ATOM   4411 C CE1 . PHE A 1 575 ? -22.866 174.217 68.321  1.00 8.17   ? 575  PHE A CE1 1 
ATOM   4412 C CE2 . PHE A 1 575 ? -23.897 175.727 66.757  1.00 12.22  ? 575  PHE A CE2 1 
ATOM   4413 C CZ  . PHE A 1 575 ? -23.748 174.444 67.271  1.00 11.82  ? 575  PHE A CZ  1 
ATOM   4414 N N   . ASP A 1 576 ? -18.276 179.107 69.019  1.00 19.91  ? 576  ASP A N   1 
ATOM   4415 C CA  . ASP A 1 576 ? -17.516 180.331 69.219  1.00 21.15  ? 576  ASP A CA  1 
ATOM   4416 C C   . ASP A 1 576 ? -16.720 180.535 67.934  1.00 17.62  ? 576  ASP A C   1 
ATOM   4417 O O   . ASP A 1 576 ? -16.556 181.652 67.456  1.00 18.71  ? 576  ASP A O   1 
ATOM   4418 C CB  . ASP A 1 576 ? -16.555 180.177 70.401  1.00 25.44  ? 576  ASP A CB  1 
ATOM   4419 C CG  . ASP A 1 576 ? -17.064 180.853 71.660  1.00 22.81  ? 576  ASP A CG  1 
ATOM   4420 O OD1 . ASP A 1 576 ? -18.158 181.465 71.618  1.00 24.25  ? 576  ASP A OD1 1 
ATOM   4421 O OD2 . ASP A 1 576 ? -16.362 180.771 72.692  1.00 19.98  ? 576  ASP A OD2 1 
ATOM   4422 N N   . HIS A 1 577 ? -16.234 179.428 67.387  1.00 16.65  ? 577  HIS A N   1 
ATOM   4423 C CA  . HIS A 1 577 ? -15.454 179.424 66.157  1.00 13.57  ? 577  HIS A CA  1 
ATOM   4424 C C   . HIS A 1 577 ? -16.335 179.800 64.970  1.00 14.94  ? 577  HIS A C   1 
ATOM   4425 O O   . HIS A 1 577 ? -15.952 180.603 64.122  1.00 11.99  ? 577  HIS A O   1 
ATOM   4426 C CB  . HIS A 1 577 ? -14.865 178.031 65.939  1.00 17.05  ? 577  HIS A CB  1 
ATOM   4427 C CG  . HIS A 1 577 ? -14.234 177.843 64.598  1.00 20.89  ? 577  HIS A CG  1 
ATOM   4428 N ND1 . HIS A 1 577 ? -12.984 178.332 64.290  1.00 22.10  ? 577  HIS A ND1 1 
ATOM   4429 C CD2 . HIS A 1 577 ? -14.678 177.212 63.487  1.00 24.99  ? 577  HIS A CD2 1 
ATOM   4430 C CE1 . HIS A 1 577 ? -12.684 178.010 63.044  1.00 23.99  ? 577  HIS A CE1 1 
ATOM   4431 N NE2 . HIS A 1 577 ? -13.696 177.330 62.535  1.00 24.06  ? 577  HIS A NE2 1 
ATOM   4432 N N   . ILE A 1 578 ? -17.522 179.212 64.912  1.00 12.23  ? 578  ILE A N   1 
ATOM   4433 C CA  . ILE A 1 578 ? -18.436 179.499 63.828  1.00 7.87   ? 578  ILE A CA  1 
ATOM   4434 C C   . ILE A 1 578 ? -18.788 180.979 63.771  1.00 9.82   ? 578  ILE A C   1 
ATOM   4435 O O   . ILE A 1 578 ? -18.773 181.578 62.696  1.00 16.82  ? 578  ILE A O   1 
ATOM   4436 C CB  . ILE A 1 578 ? -19.713 178.673 63.964  1.00 5.49   ? 578  ILE A CB  1 
ATOM   4437 C CG1 . ILE A 1 578 ? -19.395 177.203 63.712  1.00 5.00   ? 578  ILE A CG1 1 
ATOM   4438 C CG2 . ILE A 1 578 ? -20.755 179.164 62.987  1.00 5.00   ? 578  ILE A CG2 1 
ATOM   4439 C CD1 . ILE A 1 578 ? -20.549 176.304 63.990  1.00 7.01   ? 578  ILE A CD1 1 
ATOM   4440 N N   . VAL A 1 579 ? -19.105 181.575 64.918  1.00 12.89  ? 579  VAL A N   1 
ATOM   4441 C CA  . VAL A 1 579 ? -19.452 182.999 64.950  1.00 12.53  ? 579  VAL A CA  1 
ATOM   4442 C C   . VAL A 1 579 ? -18.234 183.834 64.567  1.00 11.17  ? 579  VAL A C   1 
ATOM   4443 O O   . VAL A 1 579 ? -18.357 184.970 64.122  1.00 13.66  ? 579  VAL A O   1 
ATOM   4444 C CB  . VAL A 1 579 ? -19.950 183.453 66.347  1.00 7.28   ? 579  VAL A CB  1 
ATOM   4445 C CG1 . VAL A 1 579 ? -20.118 184.971 66.369  1.00 10.33  ? 579  VAL A CG1 1 
ATOM   4446 C CG2 . VAL A 1 579 ? -21.279 182.784 66.669  1.00 7.47   ? 579  VAL A CG2 1 
ATOM   4447 N N   . SER A 1 580 ? -17.056 183.254 64.750  1.00 12.65  ? 580  SER A N   1 
ATOM   4448 C CA  . SER A 1 580 ? -15.810 183.921 64.412  1.00 11.55  ? 580  SER A CA  1 
ATOM   4449 C C   . SER A 1 580 ? -15.734 184.008 62.894  1.00 15.64  ? 580  SER A C   1 
ATOM   4450 O O   . SER A 1 580 ? -15.353 185.036 62.332  1.00 18.06  ? 580  SER A O   1 
ATOM   4451 C CB  . SER A 1 580 ? -14.635 183.105 64.936  1.00 6.55   ? 580  SER A CB  1 
ATOM   4452 O OG  . SER A 1 580 ? -13.523 183.926 65.212  1.00 29.63  ? 580  SER A OG  1 
ATOM   4453 N N   . CYS A 1 581 ? -16.102 182.913 62.238  1.00 14.74  ? 581  CYS A N   1 
ATOM   4454 C CA  . CYS A 1 581 ? -16.092 182.851 60.791  1.00 9.92   ? 581  CYS A CA  1 
ATOM   4455 C C   . CYS A 1 581 ? -17.129 183.807 60.226  1.00 13.93  ? 581  CYS A C   1 
ATOM   4456 O O   . CYS A 1 581 ? -16.865 184.493 59.242  1.00 19.36  ? 581  CYS A O   1 
ATOM   4457 C CB  . CYS A 1 581 ? -16.378 181.431 60.333  1.00 8.96   ? 581  CYS A CB  1 
ATOM   4458 S SG  . CYS A 1 581 ? -14.986 180.339 60.605  1.00 12.22  ? 581  CYS A SG  1 
ATOM   4459 N N   . ILE A 1 582 ? -18.308 183.854 60.842  1.00 11.81  ? 582  ILE A N   1 
ATOM   4460 C CA  . ILE A 1 582 ? -19.355 184.765 60.384  1.00 9.92   ? 582  ILE A CA  1 
ATOM   4461 C C   . ILE A 1 582 ? -18.877 186.206 60.553  1.00 13.78  ? 582  ILE A C   1 
ATOM   4462 O O   . ILE A 1 582 ? -19.176 187.069 59.734  1.00 19.30  ? 582  ILE A O   1 
ATOM   4463 C CB  . ILE A 1 582 ? -20.652 184.622 61.205  1.00 12.46  ? 582  ILE A CB  1 
ATOM   4464 C CG1 . ILE A 1 582 ? -21.167 183.177 61.141  1.00 14.45  ? 582  ILE A CG1 1 
ATOM   4465 C CG2 . ILE A 1 582 ? -21.685 185.629 60.699  1.00 5.00   ? 582  ILE A CG2 1 
ATOM   4466 C CD1 . ILE A 1 582 ? -22.532 182.970 61.796  1.00 6.00   ? 582  ILE A CD1 1 
ATOM   4467 N N   . SER A 1 583 ? -18.143 186.462 61.630  1.00 12.71  ? 583  SER A N   1 
ATOM   4468 C CA  . SER A 1 583 ? -17.639 187.797 61.908  1.00 13.07  ? 583  SER A CA  1 
ATOM   4469 C C   . SER A 1 583 ? -16.664 188.206 60.810  1.00 16.55  ? 583  SER A C   1 
ATOM   4470 O O   . SER A 1 583 ? -16.562 189.376 60.437  1.00 17.94  ? 583  SER A O   1 
ATOM   4471 C CB  . SER A 1 583 ? -16.933 187.817 63.264  1.00 13.24  ? 583  SER A CB  1 
ATOM   4472 O OG  . SER A 1 583 ? -16.407 189.101 63.543  1.00 17.79  ? 583  SER A OG  1 
ATOM   4473 N N   . ASP A 1 584 ? -15.939 187.225 60.301  1.00 15.41  ? 584  ASP A N   1 
ATOM   4474 C CA  . ASP A 1 584 ? -14.972 187.457 59.244  1.00 7.77   ? 584  ASP A CA  1 
ATOM   4475 C C   . ASP A 1 584 ? -15.719 187.784 57.960  1.00 7.50   ? 584  ASP A C   1 
ATOM   4476 O O   . ASP A 1 584 ? -15.496 188.813 57.333  1.00 7.74   ? 584  ASP A O   1 
ATOM   4477 C CB  . ASP A 1 584 ? -14.137 186.202 59.065  1.00 8.46   ? 584  ASP A CB  1 
ATOM   4478 C CG  . ASP A 1 584 ? -13.172 186.315 57.945  1.00 14.14  ? 584  ASP A CG  1 
ATOM   4479 O OD1 . ASP A 1 584 ? -12.135 186.984 58.125  1.00 26.41  ? 584  ASP A OD1 1 
ATOM   4480 O OD2 . ASP A 1 584 ? -13.448 185.729 56.883  1.00 29.59  ? 584  ASP A OD2 1 
ATOM   4481 N N   . PHE A 1 585 ? -16.631 186.902 57.589  1.00 7.16   ? 585  PHE A N   1 
ATOM   4482 C CA  . PHE A 1 585 ? -17.415 187.084 56.385  1.00 11.87  ? 585  PHE A CA  1 
ATOM   4483 C C   . PHE A 1 585 ? -18.060 188.470 56.293  1.00 11.32  ? 585  PHE A C   1 
ATOM   4484 O O   . PHE A 1 585 ? -17.956 189.142 55.266  1.00 15.50  ? 585  PHE A O   1 
ATOM   4485 C CB  . PHE A 1 585 ? -18.496 185.998 56.298  1.00 10.84  ? 585  PHE A CB  1 
ATOM   4486 C CG  . PHE A 1 585 ? -19.189 185.946 54.969  1.00 9.85   ? 585  PHE A CG  1 
ATOM   4487 C CD1 . PHE A 1 585 ? -18.492 185.577 53.822  1.00 8.86   ? 585  PHE A CD1 1 
ATOM   4488 C CD2 . PHE A 1 585 ? -20.531 186.291 54.856  1.00 8.04   ? 585  PHE A CD2 1 
ATOM   4489 C CE1 . PHE A 1 585 ? -19.118 185.552 52.583  1.00 5.81   ? 585  PHE A CE1 1 
ATOM   4490 C CE2 . PHE A 1 585 ? -21.169 186.270 53.618  1.00 8.88   ? 585  PHE A CE2 1 
ATOM   4491 C CZ  . PHE A 1 585 ? -20.458 185.900 52.480  1.00 12.46  ? 585  PHE A CZ  1 
ATOM   4492 N N   . LEU A 1 586 ? -18.722 188.907 57.354  1.00 9.80   ? 586  LEU A N   1 
ATOM   4493 C CA  . LEU A 1 586 ? -19.384 190.205 57.317  1.00 8.33   ? 586  LEU A CA  1 
ATOM   4494 C C   . LEU A 1 586 ? -18.396 191.305 56.922  1.00 6.16   ? 586  LEU A C   1 
ATOM   4495 O O   . LEU A 1 586 ? -18.747 192.246 56.218  1.00 5.41   ? 586  LEU A O   1 
ATOM   4496 C CB  . LEU A 1 586 ? -20.046 190.501 58.672  1.00 5.00   ? 586  LEU A CB  1 
ATOM   4497 C CG  . LEU A 1 586 ? -21.271 189.630 59.010  1.00 5.00   ? 586  LEU A CG  1 
ATOM   4498 C CD1 . LEU A 1 586 ? -21.826 190.011 60.343  1.00 5.00   ? 586  LEU A CD1 1 
ATOM   4499 C CD2 . LEU A 1 586 ? -22.347 189.810 57.976  1.00 5.50   ? 586  LEU A CD2 1 
ATOM   4500 N N   . ASP A 1 587 ? -17.151 191.176 57.355  1.00 5.00   ? 587  ASP A N   1 
ATOM   4501 C CA  . ASP A 1 587 ? -16.144 192.169 57.000  1.00 10.82  ? 587  ASP A CA  1 
ATOM   4502 C C   . ASP A 1 587 ? -15.709 191.934 55.549  1.00 13.41  ? 587  ASP A C   1 
ATOM   4503 O O   . ASP A 1 587 ? -15.463 192.873 54.795  1.00 18.26  ? 587  ASP A O   1 
ATOM   4504 C CB  . ASP A 1 587 ? -14.934 192.065 57.935  1.00 8.98   ? 587  ASP A CB  1 
ATOM   4505 C CG  . ASP A 1 587 ? -15.099 192.889 59.210  1.00 13.11  ? 587  ASP A CG  1 
ATOM   4506 O OD1 . ASP A 1 587 ? -15.843 193.899 59.194  1.00 14.78  ? 587  ASP A OD1 1 
ATOM   4507 O OD2 . ASP A 1 587 ? -14.477 192.523 60.231  1.00 17.26  ? 587  ASP A OD2 1 
ATOM   4508 N N   . TYR A 1 588 ? -15.621 190.662 55.178  1.00 16.02  ? 588  TYR A N   1 
ATOM   4509 C CA  . TYR A 1 588 ? -15.237 190.244 53.834  1.00 8.12   ? 588  TYR A CA  1 
ATOM   4510 C C   . TYR A 1 588 ? -16.173 190.871 52.821  1.00 10.19  ? 588  TYR A C   1 
ATOM   4511 O O   . TYR A 1 588 ? -15.754 191.275 51.739  1.00 16.75  ? 588  TYR A O   1 
ATOM   4512 C CB  . TYR A 1 588 ? -15.337 188.728 53.741  1.00 5.00   ? 588  TYR A CB  1 
ATOM   4513 C CG  . TYR A 1 588 ? -15.055 188.146 52.387  1.00 5.00   ? 588  TYR A CG  1 
ATOM   4514 C CD1 . TYR A 1 588 ? -13.772 188.189 51.838  1.00 7.21   ? 588  TYR A CD1 1 
ATOM   4515 C CD2 . TYR A 1 588 ? -16.054 187.493 51.674  1.00 7.96   ? 588  TYR A CD2 1 
ATOM   4516 C CE1 . TYR A 1 588 ? -13.489 187.588 50.611  1.00 5.00   ? 588  TYR A CE1 1 
ATOM   4517 C CE2 . TYR A 1 588 ? -15.785 186.888 50.447  1.00 8.01   ? 588  TYR A CE2 1 
ATOM   4518 C CZ  . TYR A 1 588 ? -14.502 186.938 49.923  1.00 6.38   ? 588  TYR A CZ  1 
ATOM   4519 O OH  . TYR A 1 588 ? -14.244 186.332 48.721  1.00 8.14   ? 588  TYR A OH  1 
ATOM   4520 N N   . MET A 1 589 ? -17.447 190.942 53.185  1.00 9.13   ? 589  MET A N   1 
ATOM   4521 C CA  . MET A 1 589 ? -18.469 191.508 52.322  1.00 11.14  ? 589  MET A CA  1 
ATOM   4522 C C   . MET A 1 589 ? -18.646 193.000 52.600  1.00 13.59  ? 589  MET A C   1 
ATOM   4523 O O   . MET A 1 589 ? -19.484 193.661 51.990  1.00 15.52  ? 589  MET A O   1 
ATOM   4524 C CB  . MET A 1 589 ? -19.795 190.782 52.554  1.00 14.71  ? 589  MET A CB  1 
ATOM   4525 C CG  . MET A 1 589 ? -19.836 189.362 52.022  1.00 11.60  ? 589  MET A CG  1 
ATOM   4526 S SD  . MET A 1 589 ? -19.960 189.324 50.234  1.00 22.20  ? 589  MET A SD  1 
ATOM   4527 C CE  . MET A 1 589 ? -18.433 188.620 49.850  1.00 10.09  ? 589  MET A CE  1 
ATOM   4528 N N   . GLY A 1 590 ? -17.859 193.521 53.535  1.00 12.11  ? 590  GLY A N   1 
ATOM   4529 C CA  . GLY A 1 590 ? -17.946 194.927 53.880  1.00 6.24   ? 590  GLY A CA  1 
ATOM   4530 C C   . GLY A 1 590 ? -19.310 195.357 54.389  1.00 7.68   ? 590  GLY A C   1 
ATOM   4531 O O   . GLY A 1 590 ? -19.710 196.489 54.156  1.00 12.85  ? 590  GLY A O   1 
ATOM   4532 N N   . ILE A 1 591 ? -20.021 194.485 55.100  1.00 7.29   ? 591  ILE A N   1 
ATOM   4533 C CA  . ILE A 1 591 ? -21.350 194.835 55.592  1.00 6.10   ? 591  ILE A CA  1 
ATOM   4534 C C   . ILE A 1 591 ? -21.570 194.763 57.103  1.00 9.91   ? 591  ILE A C   1 
ATOM   4535 O O   . ILE A 1 591 ? -22.717 194.821 57.556  1.00 11.81  ? 591  ILE A O   1 
ATOM   4536 C CB  . ILE A 1 591 ? -22.446 193.948 54.929  1.00 9.26   ? 591  ILE A CB  1 
ATOM   4537 C CG1 . ILE A 1 591 ? -22.225 192.479 55.290  1.00 11.64  ? 591  ILE A CG1 1 
ATOM   4538 C CG2 . ILE A 1 591 ? -22.426 194.111 53.427  1.00 8.19   ? 591  ILE A CG2 1 
ATOM   4539 C CD1 . ILE A 1 591 ? -23.332 191.559 54.792  1.00 13.22  ? 591  ILE A CD1 1 
ATOM   4540 N N   . LYS A 1 592 ? -20.505 194.645 57.893  1.00 11.01  ? 592  LYS A N   1 
ATOM   4541 C CA  . LYS A 1 592 ? -20.699 194.551 59.339  1.00 7.18   ? 592  LYS A CA  1 
ATOM   4542 C C   . LYS A 1 592 ? -21.368 195.781 59.897  1.00 14.76  ? 592  LYS A C   1 
ATOM   4543 O O   . LYS A 1 592 ? -21.159 196.895 59.410  1.00 21.00  ? 592  LYS A O   1 
ATOM   4544 C CB  . LYS A 1 592 ? -19.382 194.335 60.067  1.00 8.55   ? 592  LYS A CB  1 
ATOM   4545 C CG  . LYS A 1 592 ? -19.549 193.746 61.460  1.00 5.00   ? 592  LYS A CG  1 
ATOM   4546 C CD  . LYS A 1 592 ? -18.201 193.482 62.109  1.00 5.00   ? 592  LYS A CD  1 
ATOM   4547 C CE  . LYS A 1 592 ? -17.581 192.229 61.549  1.00 5.00   ? 592  LYS A CE  1 
ATOM   4548 N NZ  . LYS A 1 592 ? -16.283 191.896 62.177  1.00 5.00   ? 592  LYS A NZ  1 
ATOM   4549 N N   . GLY A 1 593 ? -22.183 195.566 60.924  1.00 19.01  ? 593  GLY A N   1 
ATOM   4550 C CA  . GLY A 1 593 ? -22.884 196.657 61.563  1.00 15.71  ? 593  GLY A CA  1 
ATOM   4551 C C   . GLY A 1 593 ? -24.309 196.298 61.926  1.00 17.63  ? 593  GLY A C   1 
ATOM   4552 O O   . GLY A 1 593 ? -24.600 195.996 63.079  1.00 22.12  ? 593  GLY A O   1 
ATOM   4553 N N   . PRO A 1 594 ? -25.219 196.296 60.947  1.00 18.27  ? 594  PRO A N   1 
ATOM   4554 C CA  . PRO A 1 594 ? -26.636 195.980 61.153  1.00 15.79  ? 594  PRO A CA  1 
ATOM   4555 C C   . PRO A 1 594 ? -26.981 194.586 61.649  1.00 19.73  ? 594  PRO A C   1 
ATOM   4556 O O   . PRO A 1 594 ? -26.167 193.663 61.599  1.00 26.57  ? 594  PRO A O   1 
ATOM   4557 C CB  . PRO A 1 594 ? -27.279 196.273 59.795  1.00 11.50  ? 594  PRO A CB  1 
ATOM   4558 C CG  . PRO A 1 594 ? -26.168 196.207 58.814  1.00 17.44  ? 594  PRO A CG  1 
ATOM   4559 C CD  . PRO A 1 594 ? -24.914 196.599 59.538  1.00 23.50  ? 594  PRO A CD  1 
ATOM   4560 N N   . ARG A 1 595 ? -28.209 194.459 62.143  1.00 23.59  ? 595  ARG A N   1 
ATOM   4561 C CA  . ARG A 1 595 ? -28.744 193.200 62.643  1.00 21.65  ? 595  ARG A CA  1 
ATOM   4562 C C   . ARG A 1 595 ? -29.434 192.523 61.459  1.00 23.87  ? 595  ARG A C   1 
ATOM   4563 O O   . ARG A 1 595 ? -30.592 192.819 61.154  1.00 29.38  ? 595  ARG A O   1 
ATOM   4564 C CB  . ARG A 1 595 ? -29.756 193.477 63.749  1.00 11.89  ? 595  ARG A CB  1 
ATOM   4565 C CG  . ARG A 1 595 ? -30.376 192.237 64.348  1.00 25.97  ? 595  ARG A CG  1 
ATOM   4566 C CD  . ARG A 1 595 ? -31.159 192.573 65.606  1.00 32.30  ? 595  ARG A CD  1 
ATOM   4567 N NE  . ARG A 1 595 ? -31.242 191.439 66.518  1.00 39.34  ? 595  ARG A NE  1 
ATOM   4568 C CZ  . ARG A 1 595 ? -32.304 190.649 66.638  1.00 40.42  ? 595  ARG A CZ  1 
ATOM   4569 N NH1 . ARG A 1 595 ? -33.386 190.868 65.900  1.00 38.81  ? 595  ARG A NH1 1 
ATOM   4570 N NH2 . ARG A 1 595 ? -32.281 189.639 67.498  1.00 39.38  ? 595  ARG A NH2 1 
ATOM   4571 N N   . MET A 1 596 ? -28.714 191.621 60.797  1.00 23.77  ? 596  MET A N   1 
ATOM   4572 C CA  . MET A 1 596 ? -29.224 190.922 59.619  1.00 18.66  ? 596  MET A CA  1 
ATOM   4573 C C   . MET A 1 596 ? -29.879 189.594 59.931  1.00 18.04  ? 596  MET A C   1 
ATOM   4574 O O   . MET A 1 596 ? -29.536 188.948 60.924  1.00 20.35  ? 596  MET A O   1 
ATOM   4575 C CB  . MET A 1 596 ? -28.087 190.681 58.632  1.00 23.01  ? 596  MET A CB  1 
ATOM   4576 C CG  . MET A 1 596 ? -27.698 191.892 57.833  1.00 22.70  ? 596  MET A CG  1 
ATOM   4577 S SD  . MET A 1 596 ? -26.148 191.596 57.034  1.00 34.39  ? 596  MET A SD  1 
ATOM   4578 C CE  . MET A 1 596 ? -26.687 190.751 55.553  1.00 25.76  ? 596  MET A CE  1 
ATOM   4579 N N   . PRO A 1 597 ? -30.811 189.150 59.060  1.00 13.66  ? 597  PRO A N   1 
ATOM   4580 C CA  . PRO A 1 597 ? -31.532 187.882 59.226  1.00 12.72  ? 597  PRO A CA  1 
ATOM   4581 C C   . PRO A 1 597 ? -30.665 186.745 58.734  1.00 13.15  ? 597  PRO A C   1 
ATOM   4582 O O   . PRO A 1 597 ? -29.930 186.911 57.765  1.00 14.71  ? 597  PRO A O   1 
ATOM   4583 C CB  . PRO A 1 597 ? -32.789 188.051 58.380  1.00 6.58   ? 597  PRO A CB  1 
ATOM   4584 C CG  . PRO A 1 597 ? -32.574 189.284 57.553  1.00 13.58  ? 597  PRO A CG  1 
ATOM   4585 C CD  . PRO A 1 597 ? -31.203 189.829 57.818  1.00 13.69  ? 597  PRO A CD  1 
ATOM   4586 N N   . LEU A 1 598 ? -30.752 185.596 59.397  1.00 15.85  ? 598  LEU A N   1 
ATOM   4587 C CA  . LEU A 1 598 ? -29.928 184.457 59.026  1.00 15.75  ? 598  LEU A CA  1 
ATOM   4588 C C   . LEU A 1 598 ? -30.668 183.133 59.072  1.00 17.31  ? 598  LEU A C   1 
ATOM   4589 O O   . LEU A 1 598 ? -31.380 182.840 60.031  1.00 18.47  ? 598  LEU A O   1 
ATOM   4590 C CB  . LEU A 1 598 ? -28.707 184.388 59.952  1.00 15.29  ? 598  LEU A CB  1 
ATOM   4591 C CG  . LEU A 1 598 ? -27.778 183.168 59.902  1.00 17.52  ? 598  LEU A CG  1 
ATOM   4592 C CD1 . LEU A 1 598 ? -26.426 183.520 60.509  1.00 6.88   ? 598  LEU A CD1 1 
ATOM   4593 C CD2 . LEU A 1 598 ? -28.398 182.016 60.675  1.00 18.53  ? 598  LEU A CD2 1 
ATOM   4594 N N   . GLY A 1 599 ? -30.490 182.344 58.017  1.00 18.28  ? 599  GLY A N   1 
ATOM   4595 C CA  . GLY A 1 599 ? -31.093 181.025 57.935  1.00 10.33  ? 599  GLY A CA  1 
ATOM   4596 C C   . GLY A 1 599 ? -29.970 180.072 58.290  1.00 10.60  ? 599  GLY A C   1 
ATOM   4597 O O   . GLY A 1 599 ? -28.838 180.259 57.851  1.00 13.55  ? 599  GLY A O   1 
ATOM   4598 N N   . PHE A 1 600 ? -30.279 179.036 59.056  1.00 7.03   ? 600  PHE A N   1 
ATOM   4599 C CA  . PHE A 1 600 ? -29.263 178.098 59.516  1.00 6.40   ? 600  PHE A CA  1 
ATOM   4600 C C   . PHE A 1 600 ? -29.498 176.677 59.018  1.00 9.92   ? 600  PHE A C   1 
ATOM   4601 O O   . PHE A 1 600 ? -30.350 175.972 59.541  1.00 18.36  ? 600  PHE A O   1 
ATOM   4602 C CB  . PHE A 1 600 ? -29.261 178.150 61.053  1.00 5.31   ? 600  PHE A CB  1 
ATOM   4603 C CG  . PHE A 1 600 ? -28.191 177.332 61.709  1.00 10.42  ? 600  PHE A CG  1 
ATOM   4604 C CD1 . PHE A 1 600 ? -27.201 176.696 60.968  1.00 11.54  ? 600  PHE A CD1 1 
ATOM   4605 C CD2 . PHE A 1 600 ? -28.164 177.222 63.096  1.00 10.05  ? 600  PHE A CD2 1 
ATOM   4606 C CE1 . PHE A 1 600 ? -26.194 175.964 61.603  1.00 17.17  ? 600  PHE A CE1 1 
ATOM   4607 C CE2 . PHE A 1 600 ? -27.166 176.497 63.740  1.00 15.27  ? 600  PHE A CE2 1 
ATOM   4608 C CZ  . PHE A 1 600 ? -26.177 175.867 62.995  1.00 12.85  ? 600  PHE A CZ  1 
ATOM   4609 N N   . THR A 1 601 ? -28.750 176.255 58.001  1.00 8.34   ? 601  THR A N   1 
ATOM   4610 C CA  . THR A 1 601 ? -28.890 174.895 57.478  1.00 8.84   ? 601  THR A CA  1 
ATOM   4611 C C   . THR A 1 601 ? -28.001 174.018 58.354  1.00 11.24  ? 601  THR A C   1 
ATOM   4612 O O   . THR A 1 601 ? -26.778 174.165 58.350  1.00 16.24  ? 601  THR A O   1 
ATOM   4613 C CB  . THR A 1 601 ? -28.414 174.780 55.994  1.00 11.45  ? 601  THR A CB  1 
ATOM   4614 O OG1 . THR A 1 601 ? -29.177 175.671 55.166  1.00 6.01   ? 601  THR A OG1 1 
ATOM   4615 C CG2 . THR A 1 601 ? -28.588 173.352 55.480  1.00 5.00   ? 601  THR A CG2 1 
ATOM   4616 N N   . PHE A 1 602 ? -28.621 173.126 59.121  1.00 13.21  ? 602  PHE A N   1 
ATOM   4617 C CA  . PHE A 1 602 ? -27.895 172.226 60.028  1.00 14.47  ? 602  PHE A CA  1 
ATOM   4618 C C   . PHE A 1 602 ? -28.065 170.802 59.516  1.00 15.51  ? 602  PHE A C   1 
ATOM   4619 O O   . PHE A 1 602 ? -29.060 170.147 59.811  1.00 21.08  ? 602  PHE A O   1 
ATOM   4620 C CB  . PHE A 1 602 ? -28.473 172.346 61.449  1.00 17.58  ? 602  PHE A CB  1 
ATOM   4621 C CG  . PHE A 1 602 ? -27.616 171.719 62.517  1.00 17.18  ? 602  PHE A CG  1 
ATOM   4622 C CD1 . PHE A 1 602 ? -26.339 172.207 62.782  1.00 11.50  ? 602  PHE A CD1 1 
ATOM   4623 C CD2 . PHE A 1 602 ? -28.094 170.642 63.266  1.00 11.35  ? 602  PHE A CD2 1 
ATOM   4624 C CE1 . PHE A 1 602 ? -25.550 171.636 63.773  1.00 11.46  ? 602  PHE A CE1 1 
ATOM   4625 C CE2 . PHE A 1 602 ? -27.317 170.066 64.254  1.00 5.00   ? 602  PHE A CE2 1 
ATOM   4626 C CZ  . PHE A 1 602 ? -26.042 170.562 64.510  1.00 15.17  ? 602  PHE A CZ  1 
ATOM   4627 N N   . SER A 1 603 ? -27.090 170.315 58.761  1.00 12.34  ? 603  SER A N   1 
ATOM   4628 C CA  . SER A 1 603 ? -27.197 168.987 58.185  1.00 14.07  ? 603  SER A CA  1 
ATOM   4629 C C   . SER A 1 603 ? -26.769 167.808 59.048  1.00 15.95  ? 603  SER A C   1 
ATOM   4630 O O   . SER A 1 603 ? -25.977 166.968 58.621  1.00 19.08  ? 603  SER A O   1 
ATOM   4631 C CB  . SER A 1 603 ? -26.451 168.963 56.858  1.00 15.47  ? 603  SER A CB  1 
ATOM   4632 O OG  . SER A 1 603 ? -27.103 169.806 55.932  1.00 23.44  ? 603  SER A OG  1 
ATOM   4633 N N   . PHE A 1 604 ? -27.307 167.744 60.260  1.00 17.58  ? 604  PHE A N   1 
ATOM   4634 C CA  . PHE A 1 604 ? -27.014 166.653 61.188  1.00 16.38  ? 604  PHE A CA  1 
ATOM   4635 C C   . PHE A 1 604 ? -28.366 166.180 61.729  1.00 16.77  ? 604  PHE A C   1 
ATOM   4636 O O   . PHE A 1 604 ? -29.364 166.885 61.596  1.00 22.07  ? 604  PHE A O   1 
ATOM   4637 C CB  . PHE A 1 604 ? -26.136 167.146 62.344  1.00 12.99  ? 604  PHE A CB  1 
ATOM   4638 C CG  . PHE A 1 604 ? -24.724 167.514 61.942  1.00 7.52   ? 604  PHE A CG  1 
ATOM   4639 C CD1 . PHE A 1 604 ? -23.704 166.568 61.971  1.00 8.55   ? 604  PHE A CD1 1 
ATOM   4640 C CD2 . PHE A 1 604 ? -24.405 168.819 61.586  1.00 6.08   ? 604  PHE A CD2 1 
ATOM   4641 C CE1 . PHE A 1 604 ? -22.389 166.922 61.656  1.00 7.77   ? 604  PHE A CE1 1 
ATOM   4642 C CE2 . PHE A 1 604 ? -23.095 169.178 61.270  1.00 5.00   ? 604  PHE A CE2 1 
ATOM   4643 C CZ  . PHE A 1 604 ? -22.089 168.230 61.306  1.00 5.00   ? 604  PHE A CZ  1 
ATOM   4644 N N   . PRO A 1 605 ? -28.427 164.968 62.307  1.00 19.42  ? 605  PRO A N   1 
ATOM   4645 C CA  . PRO A 1 605 ? -29.683 164.430 62.862  1.00 18.54  ? 605  PRO A CA  1 
ATOM   4646 C C   . PRO A 1 605 ? -30.342 165.362 63.885  1.00 19.52  ? 605  PRO A C   1 
ATOM   4647 O O   . PRO A 1 605 ? -30.013 165.335 65.070  1.00 22.81  ? 605  PRO A O   1 
ATOM   4648 C CB  . PRO A 1 605 ? -29.259 163.095 63.475  1.00 16.10  ? 605  PRO A CB  1 
ATOM   4649 C CG  . PRO A 1 605 ? -28.037 162.702 62.702  1.00 15.89  ? 605  PRO A CG  1 
ATOM   4650 C CD  . PRO A 1 605 ? -27.322 163.998 62.413  1.00 21.47  ? 605  PRO A CD  1 
ATOM   4651 N N   . CYS A 1 606 ? -31.276 166.180 63.411  1.00 22.60  ? 606  CYS A N   1 
ATOM   4652 C CA  . CYS A 1 606 ? -31.972 167.146 64.252  1.00 25.43  ? 606  CYS A CA  1 
ATOM   4653 C C   . CYS A 1 606 ? -33.477 166.882 64.316  1.00 30.13  ? 606  CYS A C   1 
ATOM   4654 O O   . CYS A 1 606 ? -34.030 166.140 63.502  1.00 30.02  ? 606  CYS A O   1 
ATOM   4655 C CB  . CYS A 1 606 ? -31.686 168.586 63.745  1.00 22.70  ? 606  CYS A CB  1 
ATOM   4656 S SG  . CYS A 1 606 ? -32.928 169.415 62.645  1.00 22.92  ? 606  CYS A SG  1 
ATOM   4657 N N   . GLN A 1 607 ? -34.127 167.489 65.304  1.00 34.61  ? 607  GLN A N   1 
ATOM   4658 C CA  . GLN A 1 607 ? -35.567 167.360 65.506  1.00 36.86  ? 607  GLN A CA  1 
ATOM   4659 C C   . GLN A 1 607 ? -36.133 168.763 65.692  1.00 35.60  ? 607  GLN A C   1 
ATOM   4660 O O   . GLN A 1 607 ? -35.873 169.419 66.702  1.00 37.94  ? 607  GLN A O   1 
ATOM   4661 C CB  . GLN A 1 607 ? -35.844 166.521 66.749  1.00 44.27  ? 607  GLN A CB  1 
ATOM   4662 C CG  . GLN A 1 607 ? -37.306 166.241 67.002  1.00 53.26  ? 607  GLN A CG  1 
ATOM   4663 C CD  . GLN A 1 607 ? -37.504 165.024 67.876  1.00 59.32  ? 607  GLN A CD  1 
ATOM   4664 O OE1 . GLN A 1 607 ? -37.518 165.126 69.103  1.00 63.27  ? 607  GLN A OE1 1 
ATOM   4665 N NE2 . GLN A 1 607 ? -37.651 163.860 67.249  1.00 62.72  ? 607  GLN A NE2 1 
ATOM   4666 N N   . GLN A 1 608 ? -36.906 169.229 64.721  1.00 32.95  ? 608  GLN A N   1 
ATOM   4667 C CA  . GLN A 1 608 ? -37.451 170.573 64.806  1.00 32.51  ? 608  GLN A CA  1 
ATOM   4668 C C   . GLN A 1 608 ? -38.655 170.698 65.718  1.00 33.95  ? 608  GLN A C   1 
ATOM   4669 O O   . GLN A 1 608 ? -39.621 169.940 65.608  1.00 39.74  ? 608  GLN A O   1 
ATOM   4670 C CB  . GLN A 1 608 ? -37.804 171.096 63.416  1.00 27.30  ? 608  GLN A CB  1 
ATOM   4671 C CG  . GLN A 1 608 ? -37.561 172.576 63.282  1.00 18.69  ? 608  GLN A CG  1 
ATOM   4672 C CD  . GLN A 1 608 ? -37.059 172.958 61.917  1.00 16.35  ? 608  GLN A CD  1 
ATOM   4673 O OE1 . GLN A 1 608 ? -36.778 172.101 61.084  1.00 13.16  ? 608  GLN A OE1 1 
ATOM   4674 N NE2 . GLN A 1 608 ? -36.949 174.257 61.674  1.00 22.19  ? 608  GLN A NE2 1 
ATOM   4675 N N   . THR A 1 609 ? -38.586 171.677 66.613  1.00 32.40  ? 609  THR A N   1 
ATOM   4676 C CA  . THR A 1 609 ? -39.646 171.945 67.575  1.00 31.00  ? 609  THR A CA  1 
ATOM   4677 C C   . THR A 1 609 ? -40.285 173.302 67.275  1.00 32.68  ? 609  THR A C   1 
ATOM   4678 O O   . THR A 1 609 ? -41.253 173.711 67.918  1.00 34.75  ? 609  THR A O   1 
ATOM   4679 C CB  . THR A 1 609 ? -39.074 171.966 68.997  1.00 29.26  ? 609  THR A CB  1 
ATOM   4680 O OG1 . THR A 1 609 ? -38.137 173.045 69.116  1.00 33.03  ? 609  THR A OG1 1 
ATOM   4681 C CG2 . THR A 1 609 ? -38.357 170.649 69.297  1.00 24.25  ? 609  THR A CG2 1 
ATOM   4682 N N   . SER A 1 610 ? -39.730 173.985 66.280  1.00 32.22  ? 610  SER A N   1 
ATOM   4683 C CA  . SER A 1 610 ? -40.194 175.299 65.863  1.00 25.49  ? 610  SER A CA  1 
ATOM   4684 C C   . SER A 1 610 ? -39.337 175.718 64.667  1.00 22.66  ? 610  SER A C   1 
ATOM   4685 O O   . SER A 1 610 ? -38.282 175.131 64.426  1.00 19.37  ? 610  SER A O   1 
ATOM   4686 C CB  . SER A 1 610 ? -40.022 176.291 67.014  1.00 25.29  ? 610  SER A CB  1 
ATOM   4687 O OG  . SER A 1 610 ? -40.125 177.624 66.552  1.00 36.96  ? 610  SER A OG  1 
ATOM   4688 N N   . LEU A 1 611 ? -39.770 176.724 63.914  1.00 17.10  ? 611  LEU A N   1 
ATOM   4689 C CA  . LEU A 1 611 ? -38.982 177.135 62.763  1.00 15.94  ? 611  LEU A CA  1 
ATOM   4690 C C   . LEU A 1 611 ? -37.564 177.511 63.144  1.00 15.50  ? 611  LEU A C   1 
ATOM   4691 O O   . LEU A 1 611 ? -36.638 177.249 62.386  1.00 22.38  ? 611  LEU A O   1 
ATOM   4692 C CB  . LEU A 1 611 ? -39.628 178.313 62.030  1.00 12.03  ? 611  LEU A CB  1 
ATOM   4693 C CG  . LEU A 1 611 ? -38.890 178.768 60.755  1.00 19.23  ? 611  LEU A CG  1 
ATOM   4694 C CD1 . LEU A 1 611 ? -38.552 177.561 59.878  1.00 19.66  ? 611  LEU A CD1 1 
ATOM   4695 C CD2 . LEU A 1 611 ? -39.748 179.754 59.970  1.00 11.80  ? 611  LEU A CD2 1 
ATOM   4696 N N   . ASP A 1 612 ? -37.390 178.106 64.321  1.00 15.60  ? 612  ASP A N   1 
ATOM   4697 C CA  . ASP A 1 612 ? -36.068 178.549 64.768  1.00 18.89  ? 612  ASP A CA  1 
ATOM   4698 C C   . ASP A 1 612 ? -35.465 177.749 65.906  1.00 22.10  ? 612  ASP A C   1 
ATOM   4699 O O   . ASP A 1 612 ? -34.637 178.265 66.657  1.00 22.80  ? 612  ASP A O   1 
ATOM   4700 C CB  . ASP A 1 612 ? -36.126 180.017 65.188  1.00 22.11  ? 612  ASP A CB  1 
ATOM   4701 C CG  . ASP A 1 612 ? -37.025 180.242 66.389  1.00 27.08  ? 612  ASP A CG  1 
ATOM   4702 O OD1 . ASP A 1 612 ? -38.083 179.589 66.468  1.00 34.87  ? 612  ASP A OD1 1 
ATOM   4703 O OD2 . ASP A 1 612 ? -36.676 181.072 67.255  1.00 31.87  ? 612  ASP A OD2 1 
ATOM   4704 N N   . ALA A 1 613 ? -35.870 176.492 66.035  1.00 22.70  ? 613  ALA A N   1 
ATOM   4705 C CA  . ALA A 1 613 ? -35.357 175.644 67.098  1.00 15.95  ? 613  ALA A CA  1 
ATOM   4706 C C   . ALA A 1 613 ? -35.244 174.219 66.614  1.00 18.56  ? 613  ALA A C   1 
ATOM   4707 O O   . ALA A 1 613 ? -36.157 173.701 65.982  1.00 25.65  ? 613  ALA A O   1 
ATOM   4708 C CB  . ALA A 1 613 ? -36.271 175.701 68.288  1.00 17.84  ? 613  ALA A CB  1 
ATOM   4709 N N   . GLY A 1 614 ? -34.119 173.586 66.915  1.00 16.87  ? 614  GLY A N   1 
ATOM   4710 C CA  . GLY A 1 614 ? -33.917 172.218 66.500  1.00 14.37  ? 614  GLY A CA  1 
ATOM   4711 C C   . GLY A 1 614 ? -32.950 171.550 67.440  1.00 15.26  ? 614  GLY A C   1 
ATOM   4712 O O   . GLY A 1 614 ? -31.828 172.016 67.603  1.00 15.97  ? 614  GLY A O   1 
ATOM   4713 N N   . ILE A 1 615 ? -33.386 170.460 68.062  1.00 15.33  ? 615  ILE A N   1 
ATOM   4714 C CA  . ILE A 1 615 ? -32.547 169.727 68.996  1.00 19.01  ? 615  ILE A CA  1 
ATOM   4715 C C   . ILE A 1 615 ? -31.679 168.735 68.249  1.00 17.91  ? 615  ILE A C   1 
ATOM   4716 O O   . ILE A 1 615 ? -32.149 168.065 67.335  1.00 24.58  ? 615  ILE A O   1 
ATOM   4717 C CB  . ILE A 1 615 ? -33.394 168.939 70.016  1.00 22.93  ? 615  ILE A CB  1 
ATOM   4718 C CG1 . ILE A 1 615 ? -34.089 169.902 70.973  1.00 24.18  ? 615  ILE A CG1 1 
ATOM   4719 C CG2 . ILE A 1 615 ? -32.504 167.997 70.811  1.00 25.94  ? 615  ILE A CG2 1 
ATOM   4720 C CD1 . ILE A 1 615 ? -35.190 170.704 70.333  1.00 35.80  ? 615  ILE A CD1 1 
ATOM   4721 N N   . LEU A 1 616 ? -30.415 168.636 68.643  1.00 18.37  ? 616  LEU A N   1 
ATOM   4722 C CA  . LEU A 1 616 ? -29.501 167.701 67.993  1.00 22.61  ? 616  LEU A CA  1 
ATOM   4723 C C   . LEU A 1 616 ? -29.665 166.328 68.627  1.00 20.13  ? 616  LEU A C   1 
ATOM   4724 O O   . LEU A 1 616 ? -29.460 166.177 69.828  1.00 21.68  ? 616  LEU A O   1 
ATOM   4725 C CB  . LEU A 1 616 ? -28.052 168.172 68.150  1.00 19.54  ? 616  LEU A CB  1 
ATOM   4726 C CG  . LEU A 1 616 ? -26.956 167.111 67.998  1.00 22.53  ? 616  LEU A CG  1 
ATOM   4727 C CD1 . LEU A 1 616 ? -26.769 166.753 66.534  1.00 24.23  ? 616  LEU A CD1 1 
ATOM   4728 C CD2 . LEU A 1 616 ? -25.657 167.647 68.569  1.00 32.23  ? 616  LEU A CD2 1 
ATOM   4729 N N   . ILE A 1 617 ? -30.036 165.329 67.832  1.00 18.24  ? 617  ILE A N   1 
ATOM   4730 C CA  . ILE A 1 617 ? -30.203 163.995 68.390  1.00 24.42  ? 617  ILE A CA  1 
ATOM   4731 C C   . ILE A 1 617 ? -28.893 163.196 68.384  1.00 25.87  ? 617  ILE A C   1 
ATOM   4732 O O   . ILE A 1 617 ? -28.722 162.263 69.168  1.00 31.19  ? 617  ILE A O   1 
ATOM   4733 C CB  . ILE A 1 617 ? -31.342 163.197 67.682  1.00 18.42  ? 617  ILE A CB  1 
ATOM   4734 C CG1 . ILE A 1 617 ? -30.799 162.462 66.471  1.00 33.90  ? 617  ILE A CG1 1 
ATOM   4735 C CG2 . ILE A 1 617 ? -32.479 164.126 67.283  1.00 10.32  ? 617  ILE A CG2 1 
ATOM   4736 C CD1 . ILE A 1 617 ? -31.667 161.278 66.056  1.00 52.11  ? 617  ILE A CD1 1 
ATOM   4737 N N   . THR A 1 618 ? -27.957 163.559 67.517  1.00 22.05  ? 618  THR A N   1 
ATOM   4738 C CA  . THR A 1 618 ? -26.685 162.855 67.507  1.00 17.88  ? 618  THR A CA  1 
ATOM   4739 C C   . THR A 1 618 ? -25.701 163.434 66.513  1.00 19.06  ? 618  THR A C   1 
ATOM   4740 O O   . THR A 1 618 ? -26.082 163.857 65.428  1.00 22.67  ? 618  THR A O   1 
ATOM   4741 C CB  . THR A 1 618 ? -26.868 161.364 67.204  1.00 21.01  ? 618  THR A CB  1 
ATOM   4742 O OG1 . THR A 1 618 ? -25.584 160.737 67.154  1.00 23.18  ? 618  THR A OG1 1 
ATOM   4743 C CG2 . THR A 1 618 ? -27.574 161.168 65.869  1.00 21.35  ? 618  THR A CG2 1 
ATOM   4744 N N   . TRP A 1 619 ? -24.429 163.449 66.898  1.00 19.67  ? 619  TRP A N   1 
ATOM   4745 C CA  . TRP A 1 619 ? -23.370 163.976 66.051  1.00 19.90  ? 619  TRP A CA  1 
ATOM   4746 C C   . TRP A 1 619 ? -23.037 162.942 64.995  1.00 24.78  ? 619  TRP A C   1 
ATOM   4747 O O   . TRP A 1 619 ? -23.252 161.747 65.193  1.00 28.27  ? 619  TRP A O   1 
ATOM   4748 C CB  . TRP A 1 619 ? -22.107 164.252 66.871  1.00 16.24  ? 619  TRP A CB  1 
ATOM   4749 C CG  . TRP A 1 619 ? -22.017 165.622 67.500  1.00 22.15  ? 619  TRP A CG  1 
ATOM   4750 C CD1 . TRP A 1 619 ? -21.600 165.911 68.772  1.00 18.79  ? 619  TRP A CD1 1 
ATOM   4751 C CD2 . TRP A 1 619 ? -22.291 166.882 66.873  1.00 24.67  ? 619  TRP A CD2 1 
ATOM   4752 N NE1 . TRP A 1 619 ? -21.594 167.268 68.974  1.00 23.08  ? 619  TRP A NE1 1 
ATOM   4753 C CE2 . TRP A 1 619 ? -22.010 167.891 67.825  1.00 25.69  ? 619  TRP A CE2 1 
ATOM   4754 C CE3 . TRP A 1 619 ? -22.737 167.261 65.601  1.00 22.46  ? 619  TRP A CE3 1 
ATOM   4755 C CZ2 . TRP A 1 619 ? -22.170 169.255 67.545  1.00 23.45  ? 619  TRP A CZ2 1 
ATOM   4756 C CZ3 . TRP A 1 619 ? -22.896 168.617 65.323  1.00 24.66  ? 619  TRP A CZ3 1 
ATOM   4757 C CH2 . TRP A 1 619 ? -22.610 169.597 66.293  1.00 23.29  ? 619  TRP A CH2 1 
ATOM   4758 N N   . THR A 1 620 ? -22.511 163.408 63.870  1.00 29.37  ? 620  THR A N   1 
ATOM   4759 C CA  . THR A 1 620 ? -22.115 162.531 62.778  1.00 29.89  ? 620  THR A CA  1 
ATOM   4760 C C   . THR A 1 620 ? -20.951 163.191 62.041  1.00 34.12  ? 620  THR A C   1 
ATOM   4761 O O   . THR A 1 620 ? -20.522 164.295 62.396  1.00 37.38  ? 620  THR A O   1 
ATOM   4762 C CB  . THR A 1 620 ? -23.280 162.284 61.776  1.00 25.67  ? 620  THR A CB  1 
ATOM   4763 O OG1 . THR A 1 620 ? -23.535 163.474 61.021  1.00 32.36  ? 620  THR A OG1 1 
ATOM   4764 C CG2 . THR A 1 620 ? -24.549 161.888 62.509  1.00 22.14  ? 620  THR A CG2 1 
ATOM   4765 N N   . LYS A 1 621 ? -20.429 162.507 61.029  1.00 31.28  ? 621  LYS A N   1 
ATOM   4766 C CA  . LYS A 1 621 ? -19.336 163.040 60.236  1.00 30.64  ? 621  LYS A CA  1 
ATOM   4767 C C   . LYS A 1 621 ? -18.133 163.510 61.045  1.00 33.93  ? 621  LYS A C   1 
ATOM   4768 O O   . LYS A 1 621 ? -17.498 164.504 60.690  1.00 45.23  ? 621  LYS A O   1 
ATOM   4769 C CB  . LYS A 1 621 ? -19.847 164.191 59.363  1.00 31.14  ? 621  LYS A CB  1 
ATOM   4770 C CG  . LYS A 1 621 ? -21.039 163.823 58.495  1.00 29.04  ? 621  LYS A CG  1 
ATOM   4771 C CD  . LYS A 1 621 ? -21.732 165.059 57.966  1.00 26.34  ? 621  LYS A CD  1 
ATOM   4772 C CE  . LYS A 1 621 ? -23.234 164.867 57.927  1.00 32.44  ? 621  LYS A CE  1 
ATOM   4773 N NZ  . LYS A 1 621 ? -23.907 166.087 57.414  1.00 31.73  ? 621  LYS A NZ  1 
ATOM   4774 N N   . GLY A 1 622 ? -17.831 162.815 62.139  1.00 35.40  ? 622  GLY A N   1 
ATOM   4775 C CA  . GLY A 1 622 ? -16.666 163.166 62.942  1.00 32.82  ? 622  GLY A CA  1 
ATOM   4776 C C   . GLY A 1 622 ? -16.792 164.214 64.034  1.00 31.99  ? 622  GLY A C   1 
ATOM   4777 O O   . GLY A 1 622 ? -15.834 164.446 64.779  1.00 31.76  ? 622  GLY A O   1 
ATOM   4778 N N   . PHE A 1 623 ? -17.950 164.861 64.139  1.00 28.11  ? 623  PHE A N   1 
ATOM   4779 C CA  . PHE A 1 623 ? -18.145 165.871 65.173  1.00 26.49  ? 623  PHE A CA  1 
ATOM   4780 C C   . PHE A 1 623 ? -18.339 165.175 66.497  1.00 28.73  ? 623  PHE A C   1 
ATOM   4781 O O   . PHE A 1 623 ? -19.027 164.160 66.565  1.00 31.88  ? 623  PHE A O   1 
ATOM   4782 C CB  . PHE A 1 623 ? -19.377 166.719 64.882  1.00 24.88  ? 623  PHE A CB  1 
ATOM   4783 C CG  . PHE A 1 623 ? -19.168 167.722 63.806  1.00 25.00  ? 623  PHE A CG  1 
ATOM   4784 C CD1 . PHE A 1 623 ? -19.056 167.321 62.482  1.00 24.72  ? 623  PHE A CD1 1 
ATOM   4785 C CD2 . PHE A 1 623 ? -19.069 169.069 64.111  1.00 23.81  ? 623  PHE A CD2 1 
ATOM   4786 C CE1 . PHE A 1 623 ? -18.848 168.252 61.477  1.00 28.33  ? 623  PHE A CE1 1 
ATOM   4787 C CE2 . PHE A 1 623 ? -18.862 170.008 63.112  1.00 26.14  ? 623  PHE A CE2 1 
ATOM   4788 C CZ  . PHE A 1 623 ? -18.751 169.601 61.792  1.00 25.01  ? 623  PHE A CZ  1 
ATOM   4789 N N   . LYS A 1 624 ? -17.733 165.717 67.548  1.00 33.02  ? 624  LYS A N   1 
ATOM   4790 C CA  . LYS A 1 624 ? -17.857 165.139 68.879  1.00 30.46  ? 624  LYS A CA  1 
ATOM   4791 C C   . LYS A 1 624 ? -17.967 166.238 69.904  1.00 26.42  ? 624  LYS A C   1 
ATOM   4792 O O   . LYS A 1 624 ? -17.868 165.980 71.097  1.00 31.71  ? 624  LYS A O   1 
ATOM   4793 C CB  . LYS A 1 624 ? -16.641 164.281 69.203  1.00 34.89  ? 624  LYS A CB  1 
ATOM   4794 C CG  . LYS A 1 624 ? -16.398 163.161 68.211  1.00 46.62  ? 624  LYS A CG  1 
ATOM   4795 C CD  . LYS A 1 624 ? -15.358 162.191 68.726  1.00 54.18  ? 624  LYS A CD  1 
ATOM   4796 C CE  . LYS A 1 624 ? -15.183 161.029 67.771  1.00 64.06  ? 624  LYS A CE  1 
ATOM   4797 N NZ  . LYS A 1 624 ? -13.964 160.246 68.117  1.00 78.96  ? 624  LYS A NZ  1 
ATOM   4798 N N   . ALA A 1 625 ? -18.162 167.464 69.434  1.00 24.09  ? 625  ALA A N   1 
ATOM   4799 C CA  . ALA A 1 625 ? -18.267 168.611 70.320  1.00 23.08  ? 625  ALA A CA  1 
ATOM   4800 C C   . ALA A 1 625 ? -19.168 168.243 71.480  1.00 25.14  ? 625  ALA A C   1 
ATOM   4801 O O   . ALA A 1 625 ? -20.245 167.682 71.282  1.00 29.78  ? 625  ALA A O   1 
ATOM   4802 C CB  . ALA A 1 625 ? -18.832 169.805 69.570  1.00 22.57  ? 625  ALA A CB  1 
ATOM   4803 N N   . THR A 1 626 ? -18.726 168.562 72.691  1.00 26.41  ? 626  THR A N   1 
ATOM   4804 C CA  . THR A 1 626 ? -19.493 168.238 73.889  1.00 26.31  ? 626  THR A CA  1 
ATOM   4805 C C   . THR A 1 626 ? -20.596 169.237 74.236  1.00 27.12  ? 626  THR A C   1 
ATOM   4806 O O   . THR A 1 626 ? -20.530 170.421 73.888  1.00 27.17  ? 626  THR A O   1 
ATOM   4807 C CB  . THR A 1 626 ? -18.565 168.081 75.113  1.00 20.41  ? 626  THR A CB  1 
ATOM   4808 O OG1 . THR A 1 626 ? -18.002 169.349 75.464  1.00 26.09  ? 626  THR A OG1 1 
ATOM   4809 C CG2 . THR A 1 626 ? -17.445 167.116 74.799  1.00 22.56  ? 626  THR A CG2 1 
ATOM   4810 N N   . ASP A 1 627 ? -21.614 168.730 74.923  1.00 26.78  ? 627  ASP A N   1 
ATOM   4811 C CA  . ASP A 1 627 ? -22.751 169.522 75.354  1.00 23.62  ? 627  ASP A CA  1 
ATOM   4812 C C   . ASP A 1 627 ? -23.483 170.199 74.219  1.00 22.49  ? 627  ASP A C   1 
ATOM   4813 O O   . ASP A 1 627 ? -23.778 171.391 74.283  1.00 28.48  ? 627  ASP A O   1 
ATOM   4814 C CB  . ASP A 1 627 ? -22.311 170.561 76.382  1.00 33.03  ? 627  ASP A CB  1 
ATOM   4815 C CG  . ASP A 1 627 ? -21.948 169.935 77.710  1.00 44.95  ? 627  ASP A CG  1 
ATOM   4816 O OD1 . ASP A 1 627 ? -22.803 169.218 78.277  1.00 51.56  ? 627  ASP A OD1 1 
ATOM   4817 O OD2 . ASP A 1 627 ? -20.809 170.154 78.182  1.00 49.88  ? 627  ASP A OD2 1 
ATOM   4818 N N   . CYS A 1 628 ? -23.777 169.430 73.178  1.00 17.89  ? 628  CYS A N   1 
ATOM   4819 C CA  . CYS A 1 628 ? -24.509 169.940 72.032  1.00 16.90  ? 628  CYS A CA  1 
ATOM   4820 C C   . CYS A 1 628 ? -25.707 169.024 71.832  1.00 18.89  ? 628  CYS A C   1 
ATOM   4821 O O   . CYS A 1 628 ? -26.838 169.482 71.623  1.00 20.60  ? 628  CYS A O   1 
ATOM   4822 C CB  . CYS A 1 628 ? -23.620 169.931 70.795  1.00 17.94  ? 628  CYS A CB  1 
ATOM   4823 S SG  . CYS A 1 628 ? -22.159 170.974 70.963  1.00 26.19  ? 628  CYS A SG  1 
ATOM   4824 N N   . VAL A 1 629 ? -25.443 167.723 71.910  1.00 15.56  ? 629  VAL A N   1 
ATOM   4825 C CA  . VAL A 1 629 ? -26.480 166.712 71.763  1.00 17.91  ? 629  VAL A CA  1 
ATOM   4826 C C   . VAL A 1 629 ? -27.588 166.922 72.802  1.00 20.63  ? 629  VAL A C   1 
ATOM   4827 O O   . VAL A 1 629 ? -27.333 166.964 74.004  1.00 23.12  ? 629  VAL A O   1 
ATOM   4828 C CB  . VAL A 1 629 ? -25.895 165.300 71.952  1.00 18.24  ? 629  VAL A CB  1 
ATOM   4829 C CG1 . VAL A 1 629 ? -27.024 164.297 72.136  1.00 18.97  ? 629  VAL A CG1 1 
ATOM   4830 C CG2 . VAL A 1 629 ? -25.030 164.924 70.752  1.00 15.04  ? 629  VAL A CG2 1 
ATOM   4831 N N   . GLY A 1 630 ? -28.822 167.045 72.341  1.00 19.50  ? 630  GLY A N   1 
ATOM   4832 C CA  . GLY A 1 630 ? -29.905 167.250 73.277  1.00 21.03  ? 630  GLY A CA  1 
ATOM   4833 C C   . GLY A 1 630 ? -30.182 168.724 73.475  1.00 25.58  ? 630  GLY A C   1 
ATOM   4834 O O   . GLY A 1 630 ? -31.235 169.109 73.978  1.00 31.73  ? 630  GLY A O   1 
ATOM   4835 N N   . HIS A 1 631 ? -29.231 169.562 73.088  1.00 27.74  ? 631  HIS A N   1 
ATOM   4836 C CA  . HIS A 1 631 ? -29.425 170.995 73.217  1.00 28.59  ? 631  HIS A CA  1 
ATOM   4837 C C   . HIS A 1 631 ? -29.974 171.537 71.902  1.00 27.35  ? 631  HIS A C   1 
ATOM   4838 O O   . HIS A 1 631 ? -29.912 170.864 70.870  1.00 28.17  ? 631  HIS A O   1 
ATOM   4839 C CB  . HIS A 1 631 ? -28.102 171.674 73.566  1.00 34.11  ? 631  HIS A CB  1 
ATOM   4840 C CG  . HIS A 1 631 ? -27.526 171.223 74.871  1.00 46.04  ? 631  HIS A CG  1 
ATOM   4841 N ND1 . HIS A 1 631 ? -26.331 170.541 74.962  1.00 51.50  ? 631  HIS A ND1 1 
ATOM   4842 C CD2 . HIS A 1 631 ? -27.995 171.330 76.137  1.00 48.21  ? 631  HIS A CD2 1 
ATOM   4843 C CE1 . HIS A 1 631 ? -26.089 170.247 76.228  1.00 49.72  ? 631  HIS A CE1 1 
ATOM   4844 N NE2 . HIS A 1 631 ? -27.083 170.714 76.960  1.00 50.14  ? 631  HIS A NE2 1 
ATOM   4845 N N   . ASP A 1 632 ? -30.534 172.742 71.948  1.00 22.42  ? 632  ASP A N   1 
ATOM   4846 C CA  . ASP A 1 632 ? -31.075 173.369 70.752  1.00 19.91  ? 632  ASP A CA  1 
ATOM   4847 C C   . ASP A 1 632 ? -29.981 174.163 70.060  1.00 21.38  ? 632  ASP A C   1 
ATOM   4848 O O   . ASP A 1 632 ? -29.566 175.216 70.543  1.00 26.24  ? 632  ASP A O   1 
ATOM   4849 C CB  . ASP A 1 632 ? -32.212 174.310 71.102  1.00 20.70  ? 632  ASP A CB  1 
ATOM   4850 C CG  . ASP A 1 632 ? -32.608 175.171 69.938  1.00 25.23  ? 632  ASP A CG  1 
ATOM   4851 O OD1 . ASP A 1 632 ? -32.645 174.638 68.812  1.00 37.50  ? 632  ASP A OD1 1 
ATOM   4852 O OD2 . ASP A 1 632 ? -32.874 176.373 70.137  1.00 29.41  ? 632  ASP A OD2 1 
ATOM   4853 N N   . VAL A 1 633 ? -29.528 173.656 68.921  1.00 21.25  ? 633  VAL A N   1 
ATOM   4854 C CA  . VAL A 1 633 ? -28.463 174.284 68.157  1.00 17.81  ? 633  VAL A CA  1 
ATOM   4855 C C   . VAL A 1 633 ? -28.618 175.790 67.935  1.00 17.64  ? 633  VAL A C   1 
ATOM   4856 O O   . VAL A 1 633 ? -27.637 176.527 68.028  1.00 16.99  ? 633  VAL A O   1 
ATOM   4857 C CB  . VAL A 1 633 ? -28.293 173.576 66.804  1.00 18.47  ? 633  VAL A CB  1 
ATOM   4858 C CG1 . VAL A 1 633 ? -27.747 172.188 67.030  1.00 14.15  ? 633  VAL A CG1 1 
ATOM   4859 C CG2 . VAL A 1 633 ? -29.625 173.494 66.081  1.00 12.78  ? 633  VAL A CG2 1 
ATOM   4860 N N   . VAL A 1 634 ? -29.832 176.259 67.654  1.00 16.45  ? 634  VAL A N   1 
ATOM   4861 C CA  . VAL A 1 634 ? -30.027 177.694 67.440  1.00 18.57  ? 634  VAL A CA  1 
ATOM   4862 C C   . VAL A 1 634 ? -29.700 178.485 68.708  1.00 17.19  ? 634  VAL A C   1 
ATOM   4863 O O   . VAL A 1 634 ? -29.219 179.614 68.631  1.00 20.72  ? 634  VAL A O   1 
ATOM   4864 C CB  . VAL A 1 634 ? -31.473 178.037 66.990  1.00 16.51  ? 634  VAL A CB  1 
ATOM   4865 C CG1 . VAL A 1 634 ? -31.613 179.541 66.770  1.00 12.10  ? 634  VAL A CG1 1 
ATOM   4866 C CG2 . VAL A 1 634 ? -31.799 177.314 65.705  1.00 12.87  ? 634  VAL A CG2 1 
ATOM   4867 N N   . THR A 1 635 ? -29.957 177.905 69.875  1.00 14.52  ? 635  THR A N   1 
ATOM   4868 C CA  . THR A 1 635 ? -29.642 178.608 71.111  1.00 13.91  ? 635  THR A CA  1 
ATOM   4869 C C   . THR A 1 635 ? -28.129 178.603 71.303  1.00 15.07  ? 635  THR A C   1 
ATOM   4870 O O   . THR A 1 635 ? -27.550 179.600 71.737  1.00 14.36  ? 635  THR A O   1 
ATOM   4871 C CB  . THR A 1 635 ? -30.315 177.965 72.338  1.00 9.51   ? 635  THR A CB  1 
ATOM   4872 O OG1 . THR A 1 635 ? -31.649 178.460 72.454  1.00 16.30  ? 635  THR A OG1 1 
ATOM   4873 C CG2 . THR A 1 635 ? -29.573 178.331 73.605  1.00 8.95   ? 635  THR A CG2 1 
ATOM   4874 N N   . LEU A 1 636 ? -27.484 177.488 70.978  1.00 7.04   ? 636  LEU A N   1 
ATOM   4875 C CA  . LEU A 1 636 ? -26.039 177.431 71.121  1.00 13.29  ? 636  LEU A CA  1 
ATOM   4876 C C   . LEU A 1 636 ? -25.425 178.545 70.266  1.00 16.59  ? 636  LEU A C   1 
ATOM   4877 O O   . LEU A 1 636 ? -24.463 179.187 70.679  1.00 17.20  ? 636  LEU A O   1 
ATOM   4878 C CB  . LEU A 1 636 ? -25.492 176.069 70.662  1.00 19.85  ? 636  LEU A CB  1 
ATOM   4879 C CG  . LEU A 1 636 ? -25.791 174.787 71.456  1.00 19.33  ? 636  LEU A CG  1 
ATOM   4880 C CD1 . LEU A 1 636 ? -24.794 173.706 71.070  1.00 16.76  ? 636  LEU A CD1 1 
ATOM   4881 C CD2 . LEU A 1 636 ? -25.714 175.052 72.942  1.00 23.40  ? 636  LEU A CD2 1 
ATOM   4882 N N   . LEU A 1 637 ? -25.991 178.776 69.082  1.00 14.43  ? 637  LEU A N   1 
ATOM   4883 C CA  . LEU A 1 637 ? -25.478 179.804 68.181  1.00 14.58  ? 637  LEU A CA  1 
ATOM   4884 C C   . LEU A 1 637 ? -25.771 181.200 68.711  1.00 18.85  ? 637  LEU A C   1 
ATOM   4885 O O   . LEU A 1 637 ? -24.892 182.065 68.739  1.00 21.54  ? 637  LEU A O   1 
ATOM   4886 C CB  . LEU A 1 637 ? -26.083 179.645 66.777  1.00 15.30  ? 637  LEU A CB  1 
ATOM   4887 C CG  . LEU A 1 637 ? -25.738 180.720 65.730  1.00 7.48   ? 637  LEU A CG  1 
ATOM   4888 C CD1 . LEU A 1 637 ? -24.294 180.578 65.304  1.00 5.00   ? 637  LEU A CD1 1 
ATOM   4889 C CD2 . LEU A 1 637 ? -26.657 180.588 64.524  1.00 5.00   ? 637  LEU A CD2 1 
ATOM   4890 N N   . ARG A 1 638 ? -27.009 181.430 69.125  1.00 19.75  ? 638  ARG A N   1 
ATOM   4891 C CA  . ARG A 1 638 ? -27.376 182.731 69.662  1.00 20.03  ? 638  ARG A CA  1 
ATOM   4892 C C   . ARG A 1 638 ? -26.516 183.038 70.889  1.00 25.02  ? 638  ARG A C   1 
ATOM   4893 O O   . ARG A 1 638 ? -26.107 184.174 71.107  1.00 32.85  ? 638  ARG A O   1 
ATOM   4894 C CB  . ARG A 1 638 ? -28.843 182.743 70.053  1.00 13.96  ? 638  ARG A CB  1 
ATOM   4895 C CG  . ARG A 1 638 ? -29.786 182.859 68.886  1.00 14.67  ? 638  ARG A CG  1 
ATOM   4896 C CD  . ARG A 1 638 ? -31.227 182.844 69.363  1.00 9.53   ? 638  ARG A CD  1 
ATOM   4897 N NE  . ARG A 1 638 ? -32.162 182.934 68.249  1.00 19.43  ? 638  ARG A NE  1 
ATOM   4898 C CZ  . ARG A 1 638 ? -33.285 182.233 68.163  1.00 17.27  ? 638  ARG A CZ  1 
ATOM   4899 N NH1 . ARG A 1 638 ? -33.614 181.388 69.131  1.00 19.30  ? 638  ARG A NH1 1 
ATOM   4900 N NH2 . ARG A 1 638 ? -34.070 182.370 67.106  1.00 16.80  ? 638  ARG A NH2 1 
ATOM   4901 N N   . ASP A 1 639 ? -26.240 182.019 71.690  1.00 22.00  ? 639  ASP A N   1 
ATOM   4902 C CA  . ASP A 1 639 ? -25.421 182.210 72.872  1.00 21.15  ? 639  ASP A CA  1 
ATOM   4903 C C   . ASP A 1 639 ? -24.004 182.605 72.496  1.00 19.01  ? 639  ASP A C   1 
ATOM   4904 O O   . ASP A 1 639 ? -23.397 183.433 73.157  1.00 24.66  ? 639  ASP A O   1 
ATOM   4905 C CB  . ASP A 1 639 ? -25.380 180.933 73.703  1.00 29.73  ? 639  ASP A CB  1 
ATOM   4906 C CG  . ASP A 1 639 ? -26.604 180.772 74.584  1.00 34.95  ? 639  ASP A CG  1 
ATOM   4907 O OD1 . ASP A 1 639 ? -27.590 181.524 74.391  1.00 31.01  ? 639  ASP A OD1 1 
ATOM   4908 O OD2 . ASP A 1 639 ? -26.573 179.885 75.468  1.00 37.67  ? 639  ASP A OD2 1 
ATOM   4909 N N   . ALA A 1 640 ? -23.471 182.015 71.436  1.00 20.40  ? 640  ALA A N   1 
ATOM   4910 C CA  . ALA A 1 640 ? -22.113 182.332 71.016  1.00 16.16  ? 640  ALA A CA  1 
ATOM   4911 C C   . ALA A 1 640 ? -22.043 183.727 70.432  1.00 16.20  ? 640  ALA A C   1 
ATOM   4912 O O   . ALA A 1 640 ? -21.051 184.429 70.614  1.00 21.41  ? 640  ALA A O   1 
ATOM   4913 C CB  . ALA A 1 640 ? -21.627 181.324 70.000  1.00 12.07  ? 640  ALA A CB  1 
ATOM   4914 N N   . ILE A 1 641 ? -23.093 184.133 69.730  1.00 15.89  ? 641  ILE A N   1 
ATOM   4915 C CA  . ILE A 1 641 ? -23.113 185.459 69.123  1.00 22.24  ? 641  ILE A CA  1 
ATOM   4916 C C   . ILE A 1 641 ? -23.022 186.521 70.201  1.00 24.09  ? 641  ILE A C   1 
ATOM   4917 O O   . ILE A 1 641 ? -22.216 187.442 70.115  1.00 31.18  ? 641  ILE A O   1 
ATOM   4918 C CB  . ILE A 1 641 ? -24.413 185.719 68.322  1.00 18.24  ? 641  ILE A CB  1 
ATOM   4919 C CG1 . ILE A 1 641 ? -24.486 184.801 67.096  1.00 20.80  ? 641  ILE A CG1 1 
ATOM   4920 C CG2 . ILE A 1 641 ? -24.456 187.169 67.889  1.00 17.26  ? 641  ILE A CG2 1 
ATOM   4921 C CD1 . ILE A 1 641 ? -25.753 184.964 66.258  1.00 7.99   ? 641  ILE A CD1 1 
ATOM   4922 N N   . LYS A 1 642 ? -23.864 186.375 71.218  1.00 33.25  ? 642  LYS A N   1 
ATOM   4923 C CA  . LYS A 1 642 ? -23.934 187.307 72.341  1.00 33.38  ? 642  LYS A CA  1 
ATOM   4924 C C   . LYS A 1 642 ? -22.635 187.335 73.137  1.00 29.19  ? 642  LYS A C   1 
ATOM   4925 O O   . LYS A 1 642 ? -22.245 188.367 73.669  1.00 35.92  ? 642  LYS A O   1 
ATOM   4926 C CB  . LYS A 1 642 ? -25.105 186.914 73.246  1.00 39.86  ? 642  LYS A CB  1 
ATOM   4927 C CG  . LYS A 1 642 ? -25.346 187.833 74.432  1.00 55.91  ? 642  LYS A CG  1 
ATOM   4928 C CD  . LYS A 1 642 ? -26.044 187.080 75.568  1.00 68.41  ? 642  LYS A CD  1 
ATOM   4929 C CE  . LYS A 1 642 ? -25.164 185.953 76.128  1.00 73.18  ? 642  LYS A CE  1 
ATOM   4930 N NZ  . LYS A 1 642 ? -25.940 184.920 76.879  1.00 76.20  ? 642  LYS A NZ  1 
ATOM   4931 N N   . ARG A 1 643 ? -21.969 186.192 73.210  1.00 23.13  ? 643  ARG A N   1 
ATOM   4932 C CA  . ARG A 1 643 ? -20.713 186.071 73.930  1.00 21.61  ? 643  ARG A CA  1 
ATOM   4933 C C   . ARG A 1 643 ? -19.656 186.986 73.322  1.00 31.79  ? 643  ARG A C   1 
ATOM   4934 O O   . ARG A 1 643 ? -18.753 187.456 74.019  1.00 38.50  ? 643  ARG A O   1 
ATOM   4935 C CB  . ARG A 1 643 ? -20.223 184.627 73.860  1.00 23.53  ? 643  ARG A CB  1 
ATOM   4936 C CG  . ARG A 1 643 ? -19.792 184.025 75.177  1.00 25.23  ? 643  ARG A CG  1 
ATOM   4937 C CD  . ARG A 1 643 ? -19.587 182.520 75.041  1.00 24.72  ? 643  ARG A CD  1 
ATOM   4938 N NE  . ARG A 1 643 ? -20.834 181.852 74.693  1.00 27.07  ? 643  ARG A NE  1 
ATOM   4939 C CZ  . ARG A 1 643 ? -20.929 180.852 73.828  1.00 26.21  ? 643  ARG A CZ  1 
ATOM   4940 N NH1 . ARG A 1 643 ? -19.845 180.396 73.218  1.00 16.32  ? 643  ARG A NH1 1 
ATOM   4941 N NH2 . ARG A 1 643 ? -22.114 180.323 73.561  1.00 31.20  ? 643  ARG A NH2 1 
ATOM   4942 N N   . ARG A 1 644 ? -19.769 187.230 72.017  1.00 33.83  ? 644  ARG A N   1 
ATOM   4943 C CA  . ARG A 1 644 ? -18.821 188.073 71.284  1.00 33.13  ? 644  ARG A CA  1 
ATOM   4944 C C   . ARG A 1 644 ? -19.132 189.563 71.438  1.00 35.81  ? 644  ARG A C   1 
ATOM   4945 O O   . ARG A 1 644 ? -18.230 190.395 71.530  1.00 35.75  ? 644  ARG A O   1 
ATOM   4946 C CB  . ARG A 1 644 ? -18.847 187.705 69.800  1.00 29.34  ? 644  ARG A CB  1 
ATOM   4947 C CG  . ARG A 1 644 ? -17.486 187.544 69.163  1.00 24.70  ? 644  ARG A CG  1 
ATOM   4948 C CD  . ARG A 1 644 ? -17.620 187.429 67.659  1.00 18.95  ? 644  ARG A CD  1 
ATOM   4949 N NE  . ARG A 1 644 ? -16.554 188.121 66.942  1.00 14.55  ? 644  ARG A NE  1 
ATOM   4950 C CZ  . ARG A 1 644 ? -15.328 187.634 66.777  1.00 16.74  ? 644  ARG A CZ  1 
ATOM   4951 N NH1 . ARG A 1 644 ? -15.009 186.451 67.281  1.00 17.75  ? 644  ARG A NH1 1 
ATOM   4952 N NH2 . ARG A 1 644 ? -14.423 188.323 66.096  1.00 17.40  ? 644  ARG A NH2 1 
ATOM   4953 N N   . GLU A 1 645 ? -20.417 189.892 71.441  1.00 37.58  ? 645  GLU A N   1 
ATOM   4954 C CA  . GLU A 1 645 ? -20.860 191.272 71.595  1.00 41.38  ? 645  GLU A CA  1 
ATOM   4955 C C   . GLU A 1 645 ? -20.355 192.216 70.517  1.00 33.88  ? 645  GLU A C   1 
ATOM   4956 O O   . GLU A 1 645 ? -20.482 193.431 70.642  1.00 33.41  ? 645  GLU A O   1 
ATOM   4957 C CB  . GLU A 1 645 ? -20.455 191.803 72.971  1.00 51.12  ? 645  GLU A CB  1 
ATOM   4958 C CG  . GLU A 1 645 ? -21.519 191.587 74.039  1.00 66.41  ? 645  GLU A CG  1 
ATOM   4959 C CD  . GLU A 1 645 ? -21.363 192.521 75.220  1.00 71.91  ? 645  GLU A CD  1 
ATOM   4960 O OE1 . GLU A 1 645 ? -20.521 192.227 76.099  1.00 74.20  ? 645  GLU A OE1 1 
ATOM   4961 O OE2 . GLU A 1 645 ? -22.087 193.544 75.263  1.00 75.73  ? 645  GLU A OE2 1 
ATOM   4962 N N   . GLU A 1 646 ? -19.791 191.660 69.455  1.00 31.65  ? 646  GLU A N   1 
ATOM   4963 C CA  . GLU A 1 646 ? -19.290 192.474 68.357  1.00 28.17  ? 646  GLU A CA  1 
ATOM   4964 C C   . GLU A 1 646 ? -20.426 192.900 67.436  1.00 24.83  ? 646  GLU A C   1 
ATOM   4965 O O   . GLU A 1 646 ? -20.394 193.992 66.878  1.00 28.17  ? 646  GLU A O   1 
ATOM   4966 C CB  . GLU A 1 646 ? -18.258 191.701 67.549  1.00 29.44  ? 646  GLU A CB  1 
ATOM   4967 C CG  . GLU A 1 646 ? -17.811 192.424 66.307  1.00 33.27  ? 646  GLU A CG  1 
ATOM   4968 C CD  . GLU A 1 646 ? -16.681 191.712 65.617  1.00 38.97  ? 646  GLU A CD  1 
ATOM   4969 O OE1 . GLU A 1 646 ? -16.400 190.554 65.994  1.00 38.33  ? 646  GLU A OE1 1 
ATOM   4970 O OE2 . GLU A 1 646 ? -16.078 192.311 64.702  1.00 37.71  ? 646  GLU A OE2 1 
ATOM   4971 N N   . PHE A 1 647 ? -21.416 192.025 67.273  1.00 26.07  ? 647  PHE A N   1 
ATOM   4972 C CA  . PHE A 1 647 ? -22.583 192.289 66.423  1.00 25.90  ? 647  PHE A CA  1 
ATOM   4973 C C   . PHE A 1 647 ? -23.750 191.397 66.837  1.00 26.40  ? 647  PHE A C   1 
ATOM   4974 O O   . PHE A 1 647 ? -23.605 190.521 67.691  1.00 30.21  ? 647  PHE A O   1 
ATOM   4975 C CB  . PHE A 1 647 ? -22.256 192.046 64.939  1.00 25.65  ? 647  PHE A CB  1 
ATOM   4976 C CG  . PHE A 1 647 ? -21.724 190.666 64.651  1.00 26.10  ? 647  PHE A CG  1 
ATOM   4977 C CD1 . PHE A 1 647 ? -20.365 190.390 64.783  1.00 18.45  ? 647  PHE A CD1 1 
ATOM   4978 C CD2 . PHE A 1 647 ? -22.584 189.638 64.277  1.00 22.66  ? 647  PHE A CD2 1 
ATOM   4979 C CE1 . PHE A 1 647 ? -19.873 189.115 64.551  1.00 21.69  ? 647  PHE A CE1 1 
ATOM   4980 C CE2 . PHE A 1 647 ? -22.101 188.358 64.042  1.00 21.64  ? 647  PHE A CE2 1 
ATOM   4981 C CZ  . PHE A 1 647 ? -20.739 188.096 64.182  1.00 22.93  ? 647  PHE A CZ  1 
ATOM   4982 N N   . ASP A 1 648 ? -24.903 191.622 66.219  1.00 26.55  ? 648  ASP A N   1 
ATOM   4983 C CA  . ASP A 1 648 ? -26.102 190.855 66.526  1.00 30.57  ? 648  ASP A CA  1 
ATOM   4984 C C   . ASP A 1 648 ? -26.813 190.399 65.251  1.00 29.53  ? 648  ASP A C   1 
ATOM   4985 O O   . ASP A 1 648 ? -26.852 191.123 64.254  1.00 35.03  ? 648  ASP A O   1 
ATOM   4986 C CB  . ASP A 1 648 ? -27.049 191.707 67.378  1.00 34.72  ? 648  ASP A CB  1 
ATOM   4987 C CG  . ASP A 1 648 ? -28.117 190.884 68.074  1.00 43.05  ? 648  ASP A CG  1 
ATOM   4988 O OD1 . ASP A 1 648 ? -27.776 189.839 68.675  1.00 44.32  ? 648  ASP A OD1 1 
ATOM   4989 O OD2 . ASP A 1 648 ? -29.300 191.289 68.021  1.00 44.51  ? 648  ASP A OD2 1 
ATOM   4990 N N   . LEU A 1 649 ? -27.368 189.192 65.290  1.00 23.35  ? 649  LEU A N   1 
ATOM   4991 C CA  . LEU A 1 649 ? -28.077 188.639 64.147  1.00 18.48  ? 649  LEU A CA  1 
ATOM   4992 C C   . LEU A 1 649 ? -29.449 188.203 64.583  1.00 16.34  ? 649  LEU A C   1 
ATOM   4993 O O   . LEU A 1 649 ? -29.701 188.032 65.769  1.00 25.33  ? 649  LEU A O   1 
ATOM   4994 C CB  . LEU A 1 649 ? -27.342 187.431 63.580  1.00 19.64  ? 649  LEU A CB  1 
ATOM   4995 C CG  . LEU A 1 649 ? -25.933 187.646 63.050  1.00 20.88  ? 649  LEU A CG  1 
ATOM   4996 C CD1 . LEU A 1 649 ? -25.428 186.318 62.536  1.00 28.50  ? 649  LEU A CD1 1 
ATOM   4997 C CD2 . LEU A 1 649 ? -25.923 188.711 61.954  1.00 23.94  ? 649  LEU A CD2 1 
ATOM   4998 N N   . ASP A 1 650 ? -30.329 188.001 63.614  1.00 15.26  ? 650  ASP A N   1 
ATOM   4999 C CA  . ASP A 1 650 ? -31.688 187.581 63.900  1.00 13.91  ? 650  ASP A CA  1 
ATOM   5000 C C   . ASP A 1 650 ? -31.919 186.200 63.309  1.00 16.06  ? 650  ASP A C   1 
ATOM   5001 O O   . ASP A 1 650 ? -32.545 186.079 62.260  1.00 23.07  ? 650  ASP A O   1 
ATOM   5002 C CB  . ASP A 1 650 ? -32.657 188.585 63.289  1.00 12.96  ? 650  ASP A CB  1 
ATOM   5003 C CG  . ASP A 1 650 ? -34.096 188.113 63.318  1.00 26.82  ? 650  ASP A CG  1 
ATOM   5004 O OD1 . ASP A 1 650 ? -34.416 187.171 64.077  1.00 38.42  ? 650  ASP A OD1 1 
ATOM   5005 O OD2 . ASP A 1 650 ? -34.912 188.699 62.574  1.00 30.76  ? 650  ASP A OD2 1 
ATOM   5006 N N   . VAL A 1 651 ? -31.421 185.158 63.971  1.00 12.11  ? 651  VAL A N   1 
ATOM   5007 C CA  . VAL A 1 651 ? -31.597 183.802 63.452  1.00 12.57  ? 651  VAL A CA  1 
ATOM   5008 C C   . VAL A 1 651 ? -33.078 183.498 63.254  1.00 13.48  ? 651  VAL A C   1 
ATOM   5009 O O   . VAL A 1 651 ? -33.796 183.196 64.202  1.00 19.35  ? 651  VAL A O   1 
ATOM   5010 C CB  . VAL A 1 651 ? -30.994 182.741 64.385  1.00 7.97   ? 651  VAL A CB  1 
ATOM   5011 C CG1 . VAL A 1 651 ? -30.989 181.386 63.676  1.00 5.00   ? 651  VAL A CG1 1 
ATOM   5012 C CG2 . VAL A 1 651 ? -29.575 183.143 64.790  1.00 5.00   ? 651  VAL A CG2 1 
ATOM   5013 N N   . VAL A 1 652 ? -33.524 183.576 62.006  1.00 15.10  ? 652  VAL A N   1 
ATOM   5014 C CA  . VAL A 1 652 ? -34.923 183.348 61.680  1.00 16.11  ? 652  VAL A CA  1 
ATOM   5015 C C   . VAL A 1 652 ? -35.303 181.887 61.480  1.00 16.29  ? 652  VAL A C   1 
ATOM   5016 O O   . VAL A 1 652 ? -36.479 181.537 61.589  1.00 24.33  ? 652  VAL A O   1 
ATOM   5017 C CB  . VAL A 1 652 ? -35.325 184.148 60.409  1.00 12.90  ? 652  VAL A CB  1 
ATOM   5018 C CG1 . VAL A 1 652 ? -36.766 183.860 60.034  1.00 15.20  ? 652  VAL A CG1 1 
ATOM   5019 C CG2 . VAL A 1 652 ? -35.147 185.627 60.656  1.00 13.98  ? 652  VAL A CG2 1 
ATOM   5020 N N   . ALA A 1 653 ? -34.332 181.021 61.212  1.00 12.63  ? 653  ALA A N   1 
ATOM   5021 C CA  . ALA A 1 653 ? -34.683 179.631 60.980  1.00 7.83   ? 653  ALA A CA  1 
ATOM   5022 C C   . ALA A 1 653 ? -33.553 178.632 60.939  1.00 7.43   ? 653  ALA A C   1 
ATOM   5023 O O   . ALA A 1 653 ? -32.412 178.976 60.647  1.00 14.12  ? 653  ALA A O   1 
ATOM   5024 C CB  . ALA A 1 653 ? -35.465 179.523 59.684  1.00 6.36   ? 653  ALA A CB  1 
ATOM   5025 N N   . VAL A 1 654 ? -33.891 177.390 61.263  1.00 8.65   ? 654  VAL A N   1 
ATOM   5026 C CA  . VAL A 1 654 ? -32.959 176.278 61.183  1.00 13.71  ? 654  VAL A CA  1 
ATOM   5027 C C   . VAL A 1 654 ? -33.498 175.446 60.022  1.00 13.70  ? 654  VAL A C   1 
ATOM   5028 O O   . VAL A 1 654 ? -34.681 175.152 59.975  1.00 14.53  ? 654  VAL A O   1 
ATOM   5029 C CB  . VAL A 1 654 ? -32.904 175.475 62.505  1.00 14.53  ? 654  VAL A CB  1 
ATOM   5030 C CG1 . VAL A 1 654 ? -34.250 174.835 62.802  1.00 17.18  ? 654  VAL A CG1 1 
ATOM   5031 C CG2 . VAL A 1 654 ? -31.803 174.423 62.428  1.00 15.51  ? 654  VAL A CG2 1 
ATOM   5032 N N   . VAL A 1 655 ? -32.629 175.096 59.084  1.00 18.19  ? 655  VAL A N   1 
ATOM   5033 C CA  . VAL A 1 655 ? -33.065 174.435 57.866  1.00 18.60  ? 655  VAL A CA  1 
ATOM   5034 C C   . VAL A 1 655 ? -32.523 173.061 57.501  1.00 18.77  ? 655  VAL A C   1 
ATOM   5035 O O   . VAL A 1 655 ? -31.374 172.726 57.794  1.00 19.62  ? 655  VAL A O   1 
ATOM   5036 C CB  . VAL A 1 655 ? -32.779 175.400 56.679  1.00 22.75  ? 655  VAL A CB  1 
ATOM   5037 C CG1 . VAL A 1 655 ? -32.965 174.697 55.342  1.00 27.89  ? 655  VAL A CG1 1 
ATOM   5038 C CG2 . VAL A 1 655 ? -33.672 176.617 56.783  1.00 28.15  ? 655  VAL A CG2 1 
ATOM   5039 N N   . ASN A 1 656 ? -33.380 172.278 56.846  1.00 15.44  ? 656  ASN A N   1 
ATOM   5040 C CA  . ASN A 1 656 ? -33.024 170.955 56.347  1.00 14.15  ? 656  ASN A CA  1 
ATOM   5041 C C   . ASN A 1 656 ? -32.758 171.178 54.854  1.00 14.40  ? 656  ASN A C   1 
ATOM   5042 O O   . ASN A 1 656 ? -33.590 171.760 54.164  1.00 19.37  ? 656  ASN A O   1 
ATOM   5043 C CB  . ASN A 1 656 ? -34.182 169.978 56.519  1.00 10.80  ? 656  ASN A CB  1 
ATOM   5044 C CG  . ASN A 1 656 ? -33.895 168.621 55.906  1.00 19.90  ? 656  ASN A CG  1 
ATOM   5045 O OD1 . ASN A 1 656 ? -34.352 168.311 54.803  1.00 29.23  ? 656  ASN A OD1 1 
ATOM   5046 N ND2 . ASN A 1 656 ? -33.131 167.804 56.618  1.00 24.29  ? 656  ASN A ND2 1 
ATOM   5047 N N   . ASP A 1 657 ? -31.613 170.718 54.355  1.00 15.36  ? 657  ASP A N   1 
ATOM   5048 C CA  . ASP A 1 657 ? -31.261 170.926 52.953  1.00 13.87  ? 657  ASP A CA  1 
ATOM   5049 C C   . ASP A 1 657 ? -32.272 170.422 51.930  1.00 15.39  ? 657  ASP A C   1 
ATOM   5050 O O   . ASP A 1 657 ? -32.345 170.948 50.820  1.00 18.34  ? 657  ASP A O   1 
ATOM   5051 C CB  . ASP A 1 657 ? -29.881 170.328 52.659  1.00 15.46  ? 657  ASP A CB  1 
ATOM   5052 C CG  . ASP A 1 657 ? -29.840 168.839 52.859  1.00 25.72  ? 657  ASP A CG  1 
ATOM   5053 O OD1 . ASP A 1 657 ? -30.851 168.273 53.324  1.00 36.21  ? 657  ASP A OD1 1 
ATOM   5054 O OD2 . ASP A 1 657 ? -28.792 168.229 52.550  1.00 33.15  ? 657  ASP A OD2 1 
ATOM   5055 N N   . THR A 1 658 ? -33.046 169.404 52.286  1.00 14.21  ? 658  THR A N   1 
ATOM   5056 C CA  . THR A 1 658 ? -34.041 168.875 51.365  1.00 10.06  ? 658  THR A CA  1 
ATOM   5057 C C   . THR A 1 658 ? -35.146 169.900 51.225  1.00 15.61  ? 658  THR A C   1 
ATOM   5058 O O   . THR A 1 658 ? -35.612 170.183 50.120  1.00 19.13  ? 658  THR A O   1 
ATOM   5059 C CB  . THR A 1 658 ? -34.662 167.588 51.877  1.00 7.05   ? 658  THR A CB  1 
ATOM   5060 O OG1 . THR A 1 658 ? -33.641 166.604 52.055  1.00 13.42  ? 658  THR A OG1 1 
ATOM   5061 C CG2 . THR A 1 658 ? -35.670 167.075 50.884  1.00 13.58  ? 658  THR A CG2 1 
ATOM   5062 N N   . VAL A 1 659 ? -35.572 170.444 52.360  1.00 13.77  ? 659  VAL A N   1 
ATOM   5063 C CA  . VAL A 1 659 ? -36.612 171.461 52.373  1.00 8.36   ? 659  VAL A CA  1 
ATOM   5064 C C   . VAL A 1 659 ? -36.082 172.675 51.624  1.00 10.59  ? 659  VAL A C   1 
ATOM   5065 O O   . VAL A 1 659 ? -36.812 173.339 50.894  1.00 16.19  ? 659  VAL A O   1 
ATOM   5066 C CB  . VAL A 1 659 ? -36.966 171.865 53.806  1.00 7.35   ? 659  VAL A CB  1 
ATOM   5067 C CG1 . VAL A 1 659 ? -38.066 172.914 53.795  1.00 12.20  ? 659  VAL A CG1 1 
ATOM   5068 C CG2 . VAL A 1 659 ? -37.407 170.635 54.592  1.00 10.74  ? 659  VAL A CG2 1 
ATOM   5069 N N   . GLY A 1 660 ? -34.798 172.956 51.801  1.00 13.03  ? 660  GLY A N   1 
ATOM   5070 C CA  . GLY A 1 660 ? -34.198 174.083 51.118  1.00 14.16  ? 660  GLY A CA  1 
ATOM   5071 C C   . GLY A 1 660 ? -34.227 173.876 49.616  1.00 18.08  ? 660  GLY A C   1 
ATOM   5072 O O   . GLY A 1 660 ? -34.377 174.831 48.857  1.00 23.50  ? 660  GLY A O   1 
ATOM   5073 N N   . THR A 1 661 ? -34.089 172.624 49.186  1.00 20.84  ? 661  THR A N   1 
ATOM   5074 C CA  . THR A 1 661 ? -34.090 172.287 47.765  1.00 17.08  ? 661  THR A CA  1 
ATOM   5075 C C   . THR A 1 661 ? -35.453 172.543 47.127  1.00 17.69  ? 661  THR A C   1 
ATOM   5076 O O   . THR A 1 661 ? -35.532 172.996 45.988  1.00 24.41  ? 661  THR A O   1 
ATOM   5077 C CB  . THR A 1 661 ? -33.711 170.808 47.539  1.00 14.41  ? 661  THR A CB  1 
ATOM   5078 O OG1 . THR A 1 661 ? -32.387 170.567 48.031  1.00 17.99  ? 661  THR A OG1 1 
ATOM   5079 C CG2 . THR A 1 661 ? -33.754 170.472 46.067  1.00 11.59  ? 661  THR A CG2 1 
ATOM   5080 N N   . MET A 1 662 ? -36.529 172.258 47.847  1.00 9.68   ? 662  MET A N   1 
ATOM   5081 C CA  . MET A 1 662 ? -37.845 172.500 47.284  1.00 10.84  ? 662  MET A CA  1 
ATOM   5082 C C   . MET A 1 662 ? -38.075 174.002 47.187  1.00 14.65  ? 662  MET A C   1 
ATOM   5083 O O   . MET A 1 662 ? -38.464 174.505 46.138  1.00 17.27  ? 662  MET A O   1 
ATOM   5084 C CB  . MET A 1 662 ? -38.932 171.860 48.150  1.00 8.75   ? 662  MET A CB  1 
ATOM   5085 C CG  . MET A 1 662 ? -40.118 172.768 48.433  1.00 9.07   ? 662  MET A CG  1 
ATOM   5086 S SD  . MET A 1 662 ? -41.519 171.870 49.089  1.00 18.14  ? 662  MET A SD  1 
ATOM   5087 C CE  . MET A 1 662 ? -42.028 172.951 50.430  1.00 15.20  ? 662  MET A CE  1 
ATOM   5088 N N   . MET A 1 663 ? -37.827 174.712 48.285  1.00 17.24  ? 663  MET A N   1 
ATOM   5089 C CA  . MET A 1 663 ? -38.008 176.157 48.327  1.00 15.15  ? 663  MET A CA  1 
ATOM   5090 C C   . MET A 1 663 ? -37.282 176.800 47.158  1.00 17.99  ? 663  MET A C   1 
ATOM   5091 O O   . MET A 1 663 ? -37.859 177.602 46.426  1.00 22.74  ? 663  MET A O   1 
ATOM   5092 C CB  . MET A 1 663 ? -37.466 176.710 49.636  1.00 14.80  ? 663  MET A CB  1 
ATOM   5093 C CG  . MET A 1 663 ? -38.281 176.321 50.844  1.00 16.89  ? 663  MET A CG  1 
ATOM   5094 S SD  . MET A 1 663 ? -39.988 176.872 50.719  1.00 22.08  ? 663  MET A SD  1 
ATOM   5095 C CE  . MET A 1 663 ? -39.908 178.428 51.615  1.00 7.46   ? 663  MET A CE  1 
ATOM   5096 N N   . THR A 1 664 ? -36.012 176.447 46.994  1.00 17.49  ? 664  THR A N   1 
ATOM   5097 C CA  . THR A 1 664 ? -35.195 176.961 45.897  1.00 22.30  ? 664  THR A CA  1 
ATOM   5098 C C   . THR A 1 664 ? -35.898 176.751 44.555  1.00 26.17  ? 664  THR A C   1 
ATOM   5099 O O   . THR A 1 664 ? -35.842 177.607 43.673  1.00 29.64  ? 664  THR A O   1 
ATOM   5100 C CB  . THR A 1 664 ? -33.849 176.233 45.822  1.00 17.30  ? 664  THR A CB  1 
ATOM   5101 O OG1 . THR A 1 664 ? -33.039 176.606 46.938  1.00 34.55  ? 664  THR A OG1 1 
ATOM   5102 C CG2 . THR A 1 664 ? -33.130 176.589 44.549  1.00 26.02  ? 664  THR A CG2 1 
ATOM   5103 N N   . CYS A 1 665 ? -36.545 175.600 44.401  1.00 26.91  ? 665  CYS A N   1 
ATOM   5104 C CA  . CYS A 1 665 ? -37.249 175.281 43.168  1.00 25.76  ? 665  CYS A CA  1 
ATOM   5105 C C   . CYS A 1 665 ? -38.574 176.023 43.059  1.00 26.83  ? 665  CYS A C   1 
ATOM   5106 O O   . CYS A 1 665 ? -38.893 176.566 42.009  1.00 30.24  ? 665  CYS A O   1 
ATOM   5107 C CB  . CYS A 1 665 ? -37.501 173.781 43.080  1.00 24.95  ? 665  CYS A CB  1 
ATOM   5108 S SG  . CYS A 1 665 ? -38.333 173.276 41.569  1.00 31.38  ? 665  CYS A SG  1 
ATOM   5109 N N   . ALA A 1 666 ? -39.346 176.042 44.142  1.00 27.86  ? 666  ALA A N   1 
ATOM   5110 C CA  . ALA A 1 666 ? -40.634 176.729 44.145  1.00 25.04  ? 666  ALA A CA  1 
ATOM   5111 C C   . ALA A 1 666 ? -40.473 178.185 43.733  1.00 30.61  ? 666  ALA A C   1 
ATOM   5112 O O   . ALA A 1 666 ? -41.316 178.736 43.028  1.00 36.35  ? 666  ALA A O   1 
ATOM   5113 C CB  . ALA A 1 666 ? -41.268 176.652 45.521  1.00 21.89  ? 666  ALA A CB  1 
ATOM   5114 N N   . TYR A 1 667 ? -39.387 178.809 44.173  1.00 32.14  ? 667  TYR A N   1 
ATOM   5115 C CA  . TYR A 1 667 ? -39.133 180.203 43.844  1.00 34.75  ? 667  TYR A CA  1 
ATOM   5116 C C   . TYR A 1 667 ? -39.356 180.502 42.360  1.00 36.48  ? 667  TYR A C   1 
ATOM   5117 O O   . TYR A 1 667 ? -39.905 181.545 42.009  1.00 39.96  ? 667  TYR A O   1 
ATOM   5118 C CB  . TYR A 1 667 ? -37.707 180.579 44.243  1.00 34.35  ? 667  TYR A CB  1 
ATOM   5119 C CG  . TYR A 1 667 ? -37.429 182.062 44.182  1.00 35.39  ? 667  TYR A CG  1 
ATOM   5120 C CD1 . TYR A 1 667 ? -38.240 182.976 44.864  1.00 36.08  ? 667  TYR A CD1 1 
ATOM   5121 C CD2 . TYR A 1 667 ? -36.358 182.555 43.444  1.00 34.86  ? 667  TYR A CD2 1 
ATOM   5122 C CE1 . TYR A 1 667 ? -37.985 184.349 44.810  1.00 34.67  ? 667  TYR A CE1 1 
ATOM   5123 C CE2 . TYR A 1 667 ? -36.092 183.924 43.381  1.00 37.89  ? 667  TYR A CE2 1 
ATOM   5124 C CZ  . TYR A 1 667 ? -36.906 184.814 44.065  1.00 37.79  ? 667  TYR A CZ  1 
ATOM   5125 O OH  . TYR A 1 667 ? -36.628 186.163 44.003  1.00 41.65  ? 667  TYR A OH  1 
ATOM   5126 N N   . GLU A 1 668 ? -38.941 179.580 41.495  1.00 38.70  ? 668  GLU A N   1 
ATOM   5127 C CA  . GLU A 1 668 ? -39.087 179.749 40.050  1.00 43.08  ? 668  GLU A CA  1 
ATOM   5128 C C   . GLU A 1 668 ? -40.321 179.031 39.517  1.00 43.67  ? 668  GLU A C   1 
ATOM   5129 O O   . GLU A 1 668 ? -41.150 179.625 38.834  1.00 48.69  ? 668  GLU A O   1 
ATOM   5130 C CB  . GLU A 1 668 ? -37.846 179.216 39.326  1.00 46.46  ? 668  GLU A CB  1 
ATOM   5131 C CG  . GLU A 1 668 ? -36.532 179.797 39.830  1.00 60.75  ? 668  GLU A CG  1 
ATOM   5132 C CD  . GLU A 1 668 ? -35.331 179.362 39.002  1.00 69.15  ? 668  GLU A CD  1 
ATOM   5133 O OE1 . GLU A 1 668 ? -35.534 178.773 37.917  1.00 73.87  ? 668  GLU A OE1 1 
ATOM   5134 O OE2 . GLU A 1 668 ? -34.184 179.610 39.437  1.00 72.06  ? 668  GLU A OE2 1 
ATOM   5135 N N   . GLU A 1 669 ? -40.426 177.745 39.833  1.00 44.79  ? 669  GLU A N   1 
ATOM   5136 C CA  . GLU A 1 669 ? -41.543 176.912 39.400  1.00 41.05  ? 669  GLU A CA  1 
ATOM   5137 C C   . GLU A 1 669 ? -42.551 176.807 40.542  1.00 39.00  ? 669  GLU A C   1 
ATOM   5138 O O   . GLU A 1 669 ? -42.385 176.006 41.455  1.00 42.67  ? 669  GLU A O   1 
ATOM   5139 C CB  . GLU A 1 669 ? -41.023 175.524 39.019  1.00 40.73  ? 669  GLU A CB  1 
ATOM   5140 C CG  . GLU A 1 669 ? -41.931 174.739 38.099  1.00 48.62  ? 669  GLU A CG  1 
ATOM   5141 C CD  . GLU A 1 669 ? -42.945 175.612 37.409  1.00 51.31  ? 669  GLU A CD  1 
ATOM   5142 O OE1 . GLU A 1 669 ? -42.578 176.256 36.408  1.00 56.10  ? 669  GLU A OE1 1 
ATOM   5143 O OE2 . GLU A 1 669 ? -44.105 175.659 37.870  1.00 51.87  ? 669  GLU A OE2 1 
ATOM   5144 N N   . PRO A 1 670 ? -43.622 177.612 40.491  1.00 39.92  ? 670  PRO A N   1 
ATOM   5145 C CA  . PRO A 1 670 ? -44.697 177.671 41.495  1.00 37.15  ? 670  PRO A CA  1 
ATOM   5146 C C   . PRO A 1 670 ? -45.501 176.402 41.751  1.00 34.47  ? 670  PRO A C   1 
ATOM   5147 O O   . PRO A 1 670 ? -46.202 176.300 42.761  1.00 33.37  ? 670  PRO A O   1 
ATOM   5148 C CB  . PRO A 1 670 ? -45.592 178.802 41.000  1.00 38.16  ? 670  PRO A CB  1 
ATOM   5149 C CG  . PRO A 1 670 ? -45.324 178.868 39.534  1.00 48.14  ? 670  PRO A CG  1 
ATOM   5150 C CD  . PRO A 1 670 ? -43.867 178.548 39.381  1.00 41.51  ? 670  PRO A CD  1 
ATOM   5151 N N   . THR A 1 671 ? -45.419 175.443 40.840  1.00 32.77  ? 671  THR A N   1 
ATOM   5152 C CA  . THR A 1 671 ? -46.161 174.203 41.008  1.00 36.63  ? 671  THR A CA  1 
ATOM   5153 C C   . THR A 1 671 ? -45.349 173.196 41.810  1.00 38.81  ? 671  THR A C   1 
ATOM   5154 O O   . THR A 1 671 ? -45.753 172.043 41.980  1.00 42.60  ? 671  THR A O   1 
ATOM   5155 C CB  . THR A 1 671 ? -46.514 173.581 39.649  1.00 37.84  ? 671  THR A CB  1 
ATOM   5156 O OG1 . THR A 1 671 ? -45.373 172.886 39.129  1.00 40.68  ? 671  THR A OG1 1 
ATOM   5157 C CG2 . THR A 1 671 ? -46.936 174.664 38.671  1.00 41.79  ? 671  THR A CG2 1 
ATOM   5158 N N   . CYS A 1 672 ? -44.202 173.643 42.310  1.00 34.67  ? 672  CYS A N   1 
ATOM   5159 C CA  . CYS A 1 672 ? -43.325 172.780 43.084  1.00 32.94  ? 672  CYS A CA  1 
ATOM   5160 C C   . CYS A 1 672 ? -43.738 172.722 44.549  1.00 31.30  ? 672  CYS A C   1 
ATOM   5161 O O   . CYS A 1 672 ? -43.851 173.757 45.202  1.00 31.61  ? 672  CYS A O   1 
ATOM   5162 C CB  . CYS A 1 672 ? -41.887 173.283 42.972  1.00 33.52  ? 672  CYS A CB  1 
ATOM   5163 S SG  . CYS A 1 672 ? -40.727 172.403 44.010  1.00 28.60  ? 672  CYS A SG  1 
ATOM   5164 N N   . GLU A 1 673 ? -43.981 171.510 45.051  1.00 28.83  ? 673  GLU A N   1 
ATOM   5165 C CA  . GLU A 1 673 ? -44.359 171.304 46.454  1.00 26.14  ? 673  GLU A CA  1 
ATOM   5166 C C   . GLU A 1 673 ? -43.722 170.026 47.000  1.00 22.62  ? 673  GLU A C   1 
ATOM   5167 O O   . GLU A 1 673 ? -44.146 169.485 48.025  1.00 17.98  ? 673  GLU A O   1 
ATOM   5168 C CB  . GLU A 1 673 ? -45.876 171.206 46.615  1.00 29.54  ? 673  GLU A CB  1 
ATOM   5169 C CG  . GLU A 1 673 ? -46.696 171.839 45.513  1.00 38.76  ? 673  GLU A CG  1 
ATOM   5170 C CD  . GLU A 1 673 ? -48.162 171.911 45.883  1.00 42.51  ? 673  GLU A CD  1 
ATOM   5171 O OE1 . GLU A 1 673 ? -48.452 172.298 47.035  1.00 42.52  ? 673  GLU A OE1 1 
ATOM   5172 O OE2 . GLU A 1 673 ? -49.018 171.580 45.033  1.00 43.89  ? 673  GLU A OE2 1 
ATOM   5173 N N   . VAL A 1 674 ? -42.700 169.552 46.300  1.00 16.42  ? 674  VAL A N   1 
ATOM   5174 C CA  . VAL A 1 674 ? -41.992 168.350 46.682  1.00 11.72  ? 674  VAL A CA  1 
ATOM   5175 C C   . VAL A 1 674 ? -40.507 168.513 46.376  1.00 18.95  ? 674  VAL A C   1 
ATOM   5176 O O   . VAL A 1 674 ? -40.126 168.932 45.284  1.00 25.70  ? 674  VAL A O   1 
ATOM   5177 C CB  . VAL A 1 674 ? -42.524 167.135 45.898  1.00 17.80  ? 674  VAL A CB  1 
ATOM   5178 C CG1 . VAL A 1 674 ? -41.766 165.884 46.289  1.00 19.91  ? 674  VAL A CG1 1 
ATOM   5179 C CG2 . VAL A 1 674 ? -44.004 166.955 46.159  1.00 18.44  ? 674  VAL A CG2 1 
ATOM   5180 N N   . GLY A 1 675 ? -39.667 168.202 47.355  1.00 20.86  ? 675  GLY A N   1 
ATOM   5181 C CA  . GLY A 1 675 ? -38.236 168.282 47.143  1.00 11.86  ? 675  GLY A CA  1 
ATOM   5182 C C   . GLY A 1 675 ? -37.690 166.875 47.282  1.00 11.93  ? 675  GLY A C   1 
ATOM   5183 O O   . GLY A 1 675 ? -38.274 166.059 47.992  1.00 16.00  ? 675  GLY A O   1 
ATOM   5184 N N   . LEU A 1 676 ? -36.589 166.568 46.610  1.00 11.55  ? 676  LEU A N   1 
ATOM   5185 C CA  . LEU A 1 676 ? -36.016 165.234 46.713  1.00 10.91  ? 676  LEU A CA  1 
ATOM   5186 C C   . LEU A 1 676 ? -34.513 165.283 46.600  1.00 14.94  ? 676  LEU A C   1 
ATOM   5187 O O   . LEU A 1 676 ? -33.963 165.993 45.759  1.00 18.96  ? 676  LEU A O   1 
ATOM   5188 C CB  . LEU A 1 676 ? -36.561 164.316 45.616  1.00 10.85  ? 676  LEU A CB  1 
ATOM   5189 C CG  . LEU A 1 676 ? -35.778 163.025 45.337  1.00 13.76  ? 676  LEU A CG  1 
ATOM   5190 C CD1 . LEU A 1 676 ? -36.233 161.920 46.280  1.00 10.30  ? 676  LEU A CD1 1 
ATOM   5191 C CD2 . LEU A 1 676 ? -35.990 162.603 43.894  1.00 14.15  ? 676  LEU A CD2 1 
ATOM   5192 N N   . ILE A 1 677 ? -33.846 164.522 47.455  1.00 15.44  ? 677  ILE A N   1 
ATOM   5193 C CA  . ILE A 1 677 ? -32.406 164.466 47.409  1.00 12.36  ? 677  ILE A CA  1 
ATOM   5194 C C   . ILE A 1 677 ? -31.956 163.022 47.204  1.00 17.40  ? 677  ILE A C   1 
ATOM   5195 O O   . ILE A 1 677 ? -32.362 162.123 47.945  1.00 21.35  ? 677  ILE A O   1 
ATOM   5196 C CB  . ILE A 1 677 ? -31.790 165.009 48.704  1.00 11.15  ? 677  ILE A CB  1 
ATOM   5197 C CG1 . ILE A 1 677 ? -32.115 166.499 48.844  1.00 15.94  ? 677  ILE A CG1 1 
ATOM   5198 C CG2 . ILE A 1 677 ? -30.292 164.745 48.716  1.00 7.99   ? 677  ILE A CG2 1 
ATOM   5199 C CD1 . ILE A 1 677 ? -31.006 167.443 48.403  1.00 14.11  ? 677  ILE A CD1 1 
ATOM   5200 N N   . VAL A 1 678 ? -31.142 162.804 46.176  1.00 16.30  ? 678  VAL A N   1 
ATOM   5201 C CA  . VAL A 1 678 ? -30.593 161.486 45.891  1.00 13.05  ? 678  VAL A CA  1 
ATOM   5202 C C   . VAL A 1 678 ? -29.104 161.682 45.637  1.00 15.17  ? 678  VAL A C   1 
ATOM   5203 O O   . VAL A 1 678 ? -28.691 162.035 44.535  1.00 17.82  ? 678  VAL A O   1 
ATOM   5204 C CB  . VAL A 1 678 ? -31.234 160.847 44.657  1.00 11.59  ? 678  VAL A CB  1 
ATOM   5205 C CG1 . VAL A 1 678 ? -30.585 159.512 44.385  1.00 18.81  ? 678  VAL A CG1 1 
ATOM   5206 C CG2 . VAL A 1 678 ? -32.720 160.654 44.890  1.00 15.66  ? 678  VAL A CG2 1 
ATOM   5207 N N   . GLY A 1 679 ? -28.309 161.476 46.682  1.00 13.39  ? 679  GLY A N   1 
ATOM   5208 C CA  . GLY A 1 679 ? -26.874 161.637 46.584  1.00 9.98   ? 679  GLY A CA  1 
ATOM   5209 C C   . GLY A 1 679 ? -26.246 160.604 47.484  1.00 14.70  ? 679  GLY A C   1 
ATOM   5210 O O   . GLY A 1 679 ? -26.486 159.414 47.309  1.00 22.46  ? 679  GLY A O   1 
ATOM   5211 N N   . THR A 1 680 ? -25.441 161.030 48.447  1.00 19.06  ? 680  THR A N   1 
ATOM   5212 C CA  . THR A 1 680 ? -24.831 160.061 49.348  1.00 21.73  ? 680  THR A CA  1 
ATOM   5213 C C   . THR A 1 680 ? -25.959 159.509 50.199  1.00 19.53  ? 680  THR A C   1 
ATOM   5214 O O   . THR A 1 680 ? -25.971 158.327 50.549  1.00 28.64  ? 680  THR A O   1 
ATOM   5215 C CB  . THR A 1 680 ? -23.778 160.700 50.249  1.00 22.58  ? 680  THR A CB  1 
ATOM   5216 O OG1 . THR A 1 680 ? -24.345 161.836 50.907  1.00 35.11  ? 680  THR A OG1 1 
ATOM   5217 C CG2 . THR A 1 680 ? -22.581 161.135 49.424  1.00 26.42  ? 680  THR A CG2 1 
ATOM   5218 N N   . GLY A 1 681 ? -26.908 160.378 50.524  1.00 10.73  ? 681  GLY A N   1 
ATOM   5219 C CA  . GLY A 1 681 ? -28.056 159.961 51.299  1.00 7.27   ? 681  GLY A CA  1 
ATOM   5220 C C   . GLY A 1 681 ? -29.287 160.324 50.495  1.00 11.91  ? 681  GLY A C   1 
ATOM   5221 O O   . GLY A 1 681 ? -29.162 160.839 49.387  1.00 18.03  ? 681  GLY A O   1 
ATOM   5222 N N   . SER A 1 682 ? -30.472 160.058 51.028  1.00 10.01  ? 682  SER A N   1 
ATOM   5223 C CA  . SER A 1 682 ? -31.691 160.400 50.321  1.00 11.23  ? 682  SER A CA  1 
ATOM   5224 C C   . SER A 1 682 ? -32.803 160.807 51.279  1.00 14.02  ? 682  SER A C   1 
ATOM   5225 O O   . SER A 1 682 ? -32.956 160.237 52.353  1.00 19.23  ? 682  SER A O   1 
ATOM   5226 C CB  . SER A 1 682 ? -32.159 159.224 49.468  1.00 16.82  ? 682  SER A CB  1 
ATOM   5227 O OG  . SER A 1 682 ? -33.405 159.508 48.849  1.00 23.66  ? 682  SER A OG  1 
ATOM   5228 N N   . ASN A 1 683 ? -33.580 161.803 50.875  1.00 12.16  ? 683  ASN A N   1 
ATOM   5229 C CA  . ASN A 1 683 ? -34.689 162.288 51.678  1.00 10.13  ? 683  ASN A CA  1 
ATOM   5230 C C   . ASN A 1 683 ? -35.652 162.997 50.732  1.00 13.79  ? 683  ASN A C   1 
ATOM   5231 O O   . ASN A 1 683 ? -35.311 163.278 49.577  1.00 16.51  ? 683  ASN A O   1 
ATOM   5232 C CB  . ASN A 1 683 ? -34.179 163.253 52.753  1.00 10.32  ? 683  ASN A CB  1 
ATOM   5233 C CG  . ASN A 1 683 ? -35.168 163.457 53.880  1.00 5.14   ? 683  ASN A CG  1 
ATOM   5234 O OD1 . ASN A 1 683 ? -36.140 162.720 54.009  1.00 17.59  ? 683  ASN A OD1 1 
ATOM   5235 N ND2 . ASN A 1 683 ? -34.926 164.460 54.702  1.00 5.00   ? 683  ASN A ND2 1 
ATOM   5236 N N   . ALA A 1 684 ? -36.850 163.288 51.222  1.00 9.53   ? 684  ALA A N   1 
ATOM   5237 C CA  . ALA A 1 684 ? -37.860 163.951 50.416  1.00 11.29  ? 684  ALA A CA  1 
ATOM   5238 C C   . ALA A 1 684 ? -38.806 164.713 51.322  1.00 13.67  ? 684  ALA A C   1 
ATOM   5239 O O   . ALA A 1 684 ? -38.996 164.340 52.483  1.00 15.33  ? 684  ALA A O   1 
ATOM   5240 C CB  . ALA A 1 684 ? -38.638 162.920 49.610  1.00 12.97  ? 684  ALA A CB  1 
ATOM   5241 N N   . CYS A 1 685 ? -39.393 165.779 50.788  1.00 12.92  ? 685  CYS A N   1 
ATOM   5242 C CA  . CYS A 1 685 ? -40.339 166.596 51.538  1.00 15.16  ? 685  CYS A CA  1 
ATOM   5243 C C   . CYS A 1 685 ? -41.480 167.022 50.618  1.00 16.42  ? 685  CYS A C   1 
ATOM   5244 O O   . CYS A 1 685 ? -41.357 166.961 49.398  1.00 19.77  ? 685  CYS A O   1 
ATOM   5245 C CB  . CYS A 1 685 ? -39.645 167.830 52.096  1.00 11.89  ? 685  CYS A CB  1 
ATOM   5246 S SG  . CYS A 1 685 ? -39.011 168.886 50.806  1.00 18.89  ? 685  CYS A SG  1 
ATOM   5247 N N   . TYR A 1 686 ? -42.585 167.461 51.203  1.00 13.28  ? 686  TYR A N   1 
ATOM   5248 C CA  . TYR A 1 686 ? -43.729 167.875 50.413  1.00 15.86  ? 686  TYR A CA  1 
ATOM   5249 C C   . TYR A 1 686 ? -44.696 168.672 51.279  1.00 19.27  ? 686  TYR A C   1 
ATOM   5250 O O   . TYR A 1 686 ? -44.737 168.492 52.493  1.00 20.46  ? 686  TYR A O   1 
ATOM   5251 C CB  . TYR A 1 686 ? -44.435 166.638 49.850  1.00 21.35  ? 686  TYR A CB  1 
ATOM   5252 C CG  . TYR A 1 686 ? -45.203 165.850 50.893  1.00 20.10  ? 686  TYR A CG  1 
ATOM   5253 C CD1 . TYR A 1 686 ? -44.539 165.040 51.809  1.00 22.15  ? 686  TYR A CD1 1 
ATOM   5254 C CD2 . TYR A 1 686 ? -46.591 165.937 50.983  1.00 21.95  ? 686  TYR A CD2 1 
ATOM   5255 C CE1 . TYR A 1 686 ? -45.233 164.337 52.795  1.00 23.27  ? 686  TYR A CE1 1 
ATOM   5256 C CE2 . TYR A 1 686 ? -47.298 165.239 51.966  1.00 24.04  ? 686  TYR A CE2 1 
ATOM   5257 C CZ  . TYR A 1 686 ? -46.611 164.442 52.871  1.00 24.21  ? 686  TYR A CZ  1 
ATOM   5258 O OH  . TYR A 1 686 ? -47.290 163.765 53.860  1.00 22.41  ? 686  TYR A OH  1 
ATOM   5259 N N   . MET A 1 687 ? -45.474 169.548 50.651  1.00 22.24  ? 687  MET A N   1 
ATOM   5260 C CA  . MET A 1 687 ? -46.454 170.363 51.367  1.00 22.20  ? 687  MET A CA  1 
ATOM   5261 C C   . MET A 1 687 ? -47.657 169.528 51.829  1.00 22.62  ? 687  MET A C   1 
ATOM   5262 O O   . MET A 1 687 ? -48.404 168.994 51.014  1.00 24.37  ? 687  MET A O   1 
ATOM   5263 C CB  . MET A 1 687 ? -46.929 171.497 50.467  1.00 19.26  ? 687  MET A CB  1 
ATOM   5264 C CG  . MET A 1 687 ? -45.915 172.601 50.306  1.00 22.04  ? 687  MET A CG  1 
ATOM   5265 S SD  . MET A 1 687 ? -45.144 173.046 51.859  1.00 28.05  ? 687  MET A SD  1 
ATOM   5266 C CE  . MET A 1 687 ? -45.980 174.547 52.253  1.00 22.50  ? 687  MET A CE  1 
ATOM   5267 N N   . GLU A 1 688 ? -47.843 169.432 53.141  1.00 22.05  ? 688  GLU A N   1 
ATOM   5268 C CA  . GLU A 1 688 ? -48.933 168.652 53.714  1.00 18.78  ? 688  GLU A CA  1 
ATOM   5269 C C   . GLU A 1 688 ? -50.024 169.572 54.229  1.00 23.20  ? 688  GLU A C   1 
ATOM   5270 O O   . GLU A 1 688 ? -49.781 170.754 54.463  1.00 25.92  ? 688  GLU A O   1 
ATOM   5271 C CB  . GLU A 1 688 ? -48.394 167.792 54.864  1.00 21.68  ? 688  GLU A CB  1 
ATOM   5272 C CG  . GLU A 1 688 ? -49.442 166.999 55.616  1.00 21.93  ? 688  GLU A CG  1 
ATOM   5273 C CD  . GLU A 1 688 ? -50.178 166.025 54.717  1.00 28.56  ? 688  GLU A CD  1 
ATOM   5274 O OE1 . GLU A 1 688 ? -49.541 165.072 54.217  1.00 23.68  ? 688  GLU A OE1 1 
ATOM   5275 O OE2 . GLU A 1 688 ? -51.395 166.215 54.512  1.00 28.47  ? 688  GLU A OE2 1 
ATOM   5276 N N   . GLU A 1 689 ? -51.227 169.030 54.402  1.00 25.80  ? 689  GLU A N   1 
ATOM   5277 C CA  . GLU A 1 689 ? -52.359 169.805 54.904  1.00 23.14  ? 689  GLU A CA  1 
ATOM   5278 C C   . GLU A 1 689 ? -52.305 169.822 56.420  1.00 23.08  ? 689  GLU A C   1 
ATOM   5279 O O   . GLU A 1 689 ? -52.230 168.769 57.053  1.00 24.49  ? 689  GLU A O   1 
ATOM   5280 C CB  . GLU A 1 689 ? -53.675 169.177 54.455  1.00 23.91  ? 689  GLU A CB  1 
ATOM   5281 C CG  . GLU A 1 689 ? -53.811 169.043 52.956  1.00 30.89  ? 689  GLU A CG  1 
ATOM   5282 C CD  . GLU A 1 689 ? -53.678 170.370 52.240  1.00 36.80  ? 689  GLU A CD  1 
ATOM   5283 O OE1 . GLU A 1 689 ? -54.312 171.350 52.693  1.00 42.74  ? 689  GLU A OE1 1 
ATOM   5284 O OE2 . GLU A 1 689 ? -52.940 170.430 51.226  1.00 36.37  ? 689  GLU A OE2 1 
ATOM   5285 N N   . MET A 1 690 ? -52.353 171.014 57.003  1.00 21.48  ? 690  MET A N   1 
ATOM   5286 C CA  . MET A 1 690 ? -52.287 171.141 58.450  1.00 22.48  ? 690  MET A CA  1 
ATOM   5287 C C   . MET A 1 690 ? -53.285 170.247 59.171  1.00 25.15  ? 690  MET A C   1 
ATOM   5288 O O   . MET A 1 690 ? -52.971 169.697 60.215  1.00 33.02  ? 690  MET A O   1 
ATOM   5289 C CB  . MET A 1 690 ? -52.500 172.594 58.877  1.00 26.03  ? 690  MET A CB  1 
ATOM   5290 C CG  . MET A 1 690 ? -51.216 173.404 59.038  1.00 25.80  ? 690  MET A CG  1 
ATOM   5291 S SD  . MET A 1 690 ? -49.998 172.612 60.095  1.00 32.93  ? 690  MET A SD  1 
ATOM   5292 C CE  . MET A 1 690 ? -50.177 173.522 61.621  1.00 20.61  ? 690  MET A CE  1 
ATOM   5293 N N   . LYS A 1 691 ? -54.484 170.085 58.626  1.00 29.21  ? 691  LYS A N   1 
ATOM   5294 C CA  . LYS A 1 691 ? -55.471 169.239 59.295  1.00 35.17  ? 691  LYS A CA  1 
ATOM   5295 C C   . LYS A 1 691 ? -54.907 167.837 59.502  1.00 36.46  ? 691  LYS A C   1 
ATOM   5296 O O   . LYS A 1 691 ? -55.339 167.104 60.393  1.00 38.85  ? 691  LYS A O   1 
ATOM   5297 C CB  . LYS A 1 691 ? -56.763 169.154 58.475  1.00 39.99  ? 691  LYS A CB  1 
ATOM   5298 C CG  . LYS A 1 691 ? -56.577 168.572 57.082  1.00 52.32  ? 691  LYS A CG  1 
ATOM   5299 C CD  . LYS A 1 691 ? -57.728 167.646 56.690  1.00 56.78  ? 691  LYS A CD  1 
ATOM   5300 C CE  . LYS A 1 691 ? -57.809 167.469 55.170  1.00 58.06  ? 691  LYS A CE  1 
ATOM   5301 N NZ  . LYS A 1 691 ? -57.590 166.056 54.729  1.00 56.29  ? 691  LYS A NZ  1 
ATOM   5302 N N   . ASN A 1 692 ? -53.925 167.481 58.678  1.00 36.19  ? 692  ASN A N   1 
ATOM   5303 C CA  . ASN A 1 692 ? -53.299 166.165 58.736  1.00 34.72  ? 692  ASN A CA  1 
ATOM   5304 C C   . ASN A 1 692 ? -52.090 166.073 59.671  1.00 34.11  ? 692  ASN A C   1 
ATOM   5305 O O   . ASN A 1 692 ? -51.778 164.997 60.186  1.00 36.60  ? 692  ASN A O   1 
ATOM   5306 C CB  . ASN A 1 692 ? -52.897 165.728 57.326  1.00 35.43  ? 692  ASN A CB  1 
ATOM   5307 C CG  . ASN A 1 692 ? -54.094 165.479 56.431  1.00 37.36  ? 692  ASN A CG  1 
ATOM   5308 O OD1 . ASN A 1 692 ? -55.179 165.138 56.905  1.00 39.98  ? 692  ASN A OD1 1 
ATOM   5309 N ND2 . ASN A 1 692 ? -53.903 165.650 55.130  1.00 36.15  ? 692  ASN A ND2 1 
ATOM   5310 N N   . VAL A 1 693 ? -51.408 167.193 59.888  1.00 29.54  ? 693  VAL A N   1 
ATOM   5311 C CA  . VAL A 1 693 ? -50.245 167.215 60.769  1.00 24.08  ? 693  VAL A CA  1 
ATOM   5312 C C   . VAL A 1 693 ? -50.710 167.195 62.223  1.00 23.04  ? 693  VAL A C   1 
ATOM   5313 O O   . VAL A 1 693 ? -50.660 168.204 62.911  1.00 24.96  ? 693  VAL A O   1 
ATOM   5314 C CB  . VAL A 1 693 ? -49.398 168.481 60.532  1.00 23.65  ? 693  VAL A CB  1 
ATOM   5315 C CG1 . VAL A 1 693 ? -48.146 168.448 61.398  1.00 28.20  ? 693  VAL A CG1 1 
ATOM   5316 C CG2 . VAL A 1 693 ? -49.033 168.585 59.058  1.00 25.86  ? 693  VAL A CG2 1 
ATOM   5317 N N   . GLU A 1 694 ? -51.154 166.035 62.688  1.00 23.93  ? 694  GLU A N   1 
ATOM   5318 C CA  . GLU A 1 694 ? -51.646 165.901 64.054  1.00 29.24  ? 694  GLU A CA  1 
ATOM   5319 C C   . GLU A 1 694 ? -50.665 166.335 65.135  1.00 30.29  ? 694  GLU A C   1 
ATOM   5320 O O   . GLU A 1 694 ? -51.062 166.549 66.278  1.00 29.13  ? 694  GLU A O   1 
ATOM   5321 C CB  . GLU A 1 694 ? -52.061 164.454 64.321  1.00 33.88  ? 694  GLU A CB  1 
ATOM   5322 C CG  . GLU A 1 694 ? -53.319 164.038 63.594  1.00 40.77  ? 694  GLU A CG  1 
ATOM   5323 C CD  . GLU A 1 694 ? -53.915 162.765 64.149  1.00 45.52  ? 694  GLU A CD  1 
ATOM   5324 O OE1 . GLU A 1 694 ? -53.360 162.221 65.130  1.00 51.57  ? 694  GLU A OE1 1 
ATOM   5325 O OE2 . GLU A 1 694 ? -54.939 162.308 63.599  1.00 45.14  ? 694  GLU A OE2 1 
ATOM   5326 N N   . MET A 1 695 ? -49.392 166.471 64.782  1.00 29.34  ? 695  MET A N   1 
ATOM   5327 C CA  . MET A 1 695 ? -48.382 166.855 65.761  1.00 30.03  ? 695  MET A CA  1 
ATOM   5328 C C   . MET A 1 695 ? -48.288 168.356 66.033  1.00 33.23  ? 695  MET A C   1 
ATOM   5329 O O   . MET A 1 695 ? -47.665 168.781 67.009  1.00 35.59  ? 695  MET A O   1 
ATOM   5330 C CB  . MET A 1 695 ? -47.015 166.324 65.327  1.00 27.93  ? 695  MET A CB  1 
ATOM   5331 C CG  . MET A 1 695 ? -46.835 164.832 65.536  1.00 30.19  ? 695  MET A CG  1 
ATOM   5332 S SD  . MET A 1 695 ? -47.705 164.222 66.997  1.00 36.39  ? 695  MET A SD  1 
ATOM   5333 C CE  . MET A 1 695 ? -46.451 163.213 67.754  1.00 35.06  ? 695  MET A CE  1 
ATOM   5334 N N   . VAL A 1 696 ? -48.912 169.162 65.182  1.00 36.62  ? 696  VAL A N   1 
ATOM   5335 C CA  . VAL A 1 696 ? -48.874 170.613 65.350  1.00 40.68  ? 696  VAL A CA  1 
ATOM   5336 C C   . VAL A 1 696 ? -50.275 171.206 65.356  1.00 46.13  ? 696  VAL A C   1 
ATOM   5337 O O   . VAL A 1 696 ? -51.029 171.024 64.406  1.00 43.94  ? 696  VAL A O   1 
ATOM   5338 C CB  . VAL A 1 696 ? -48.082 171.275 64.215  1.00 39.78  ? 696  VAL A CB  1 
ATOM   5339 C CG1 . VAL A 1 696 ? -47.888 172.748 64.508  1.00 40.88  ? 696  VAL A CG1 1 
ATOM   5340 C CG2 . VAL A 1 696 ? -46.750 170.574 64.040  1.00 41.88  ? 696  VAL A CG2 1 
ATOM   5341 N N   . GLU A 1 697 ? -50.609 171.931 66.422  1.00 54.92  ? 697  GLU A N   1 
ATOM   5342 C CA  . GLU A 1 697 ? -51.929 172.549 66.564  1.00 59.89  ? 697  GLU A CA  1 
ATOM   5343 C C   . GLU A 1 697 ? -52.277 173.524 65.438  1.00 57.57  ? 697  GLU A C   1 
ATOM   5344 O O   . GLU A 1 697 ? -51.477 174.392 65.073  1.00 56.34  ? 697  GLU A O   1 
ATOM   5345 C CB  . GLU A 1 697 ? -52.029 173.277 67.909  1.00 72.51  ? 697  GLU A CB  1 
ATOM   5346 C CG  . GLU A 1 697 ? -51.953 172.361 69.124  1.00 88.77  ? 697  GLU A CG  1 
ATOM   5347 C CD  . GLU A 1 697 ? -52.050 173.123 70.438  1.00 98.17  ? 697  GLU A CD  1 
ATOM   5348 O OE1 . GLU A 1 697 ? -52.435 174.314 70.411  1.00 100.00 ? 697  GLU A OE1 1 
ATOM   5349 O OE2 . GLU A 1 697 ? -51.741 172.532 71.499  1.00 100.00 ? 697  GLU A OE2 1 
ATOM   5350 N N   . GLY A 1 698 ? -53.484 173.379 64.900  1.00 53.24  ? 698  GLY A N   1 
ATOM   5351 C CA  . GLY A 1 698 ? -53.922 174.245 63.823  1.00 52.67  ? 698  GLY A CA  1 
ATOM   5352 C C   . GLY A 1 698 ? -54.280 173.430 62.601  1.00 53.98  ? 698  GLY A C   1 
ATOM   5353 O O   . GLY A 1 698 ? -53.431 172.747 62.035  1.00 55.93  ? 698  GLY A O   1 
ATOM   5354 N N   . ASP A 1 699 ? -55.541 173.504 62.192  1.00 57.26  ? 699  ASP A N   1 
ATOM   5355 C CA  . ASP A 1 699 ? -56.016 172.755 61.038  1.00 59.66  ? 699  ASP A CA  1 
ATOM   5356 C C   . ASP A 1 699 ? -56.077 173.628 59.800  1.00 57.32  ? 699  ASP A C   1 
ATOM   5357 O O   . ASP A 1 699 ? -56.550 173.201 58.745  1.00 57.02  ? 699  ASP A O   1 
ATOM   5358 C CB  . ASP A 1 699 ? -57.402 172.181 61.330  1.00 69.19  ? 699  ASP A CB  1 
ATOM   5359 C CG  . ASP A 1 699 ? -57.534 171.678 62.758  1.00 79.40  ? 699  ASP A CG  1 
ATOM   5360 O OD1 . ASP A 1 699 ? -56.512 171.256 63.344  1.00 83.43  ? 699  ASP A OD1 1 
ATOM   5361 O OD2 . ASP A 1 699 ? -58.662 171.705 63.295  1.00 85.73  ? 699  ASP A OD2 1 
ATOM   5362 N N   . GLN A 1 700 ? -55.584 174.853 59.931  1.00 57.70  ? 700  GLN A N   1 
ATOM   5363 C CA  . GLN A 1 700 ? -55.600 175.796 58.825  1.00 60.80  ? 700  GLN A CA  1 
ATOM   5364 C C   . GLN A 1 700 ? -54.226 175.967 58.199  1.00 55.58  ? 700  GLN A C   1 
ATOM   5365 O O   . GLN A 1 700 ? -53.211 176.012 58.896  1.00 52.91  ? 700  GLN A O   1 
ATOM   5366 C CB  . GLN A 1 700 ? -56.116 177.162 59.302  1.00 71.40  ? 700  GLN A CB  1 
ATOM   5367 C CG  . GLN A 1 700 ? -57.637 177.284 59.364  1.00 83.37  ? 700  GLN A CG  1 
ATOM   5368 C CD  . GLN A 1 700 ? -58.262 177.607 58.015  1.00 92.46  ? 700  GLN A CD  1 
ATOM   5369 O OE1 . GLN A 1 700 ? -57.564 177.748 57.005  1.00 94.76  ? 700  GLN A OE1 1 
ATOM   5370 N NE2 . GLN A 1 700 ? -59.586 177.724 57.993  1.00 98.55  ? 700  GLN A NE2 1 
ATOM   5371 N N   . GLY A 1 701 ? -54.207 176.069 56.876  1.00 51.15  ? 701  GLY A N   1 
ATOM   5372 C CA  . GLY A 1 701 ? -52.956 176.256 56.170  1.00 51.99  ? 701  GLY A CA  1 
ATOM   5373 C C   . GLY A 1 701 ? -52.249 174.962 55.827  1.00 50.81  ? 701  GLY A C   1 
ATOM   5374 O O   . GLY A 1 701 ? -52.845 173.881 55.866  1.00 53.24  ? 701  GLY A O   1 
ATOM   5375 N N   . GLN A 1 702 ? -50.969 175.075 55.487  1.00 47.07  ? 702  GLN A N   1 
ATOM   5376 C CA  . GLN A 1 702 ? -50.172 173.912 55.134  1.00 39.74  ? 702  GLN A CA  1 
ATOM   5377 C C   . GLN A 1 702 ? -48.896 173.864 55.945  1.00 37.70  ? 702  GLN A C   1 
ATOM   5378 O O   . GLN A 1 702 ? -48.603 174.775 56.723  1.00 38.04  ? 702  GLN A O   1 
ATOM   5379 C CB  . GLN A 1 702 ? -49.837 173.934 53.649  1.00 36.02  ? 702  GLN A CB  1 
ATOM   5380 C CG  . GLN A 1 702 ? -51.043 174.130 52.761  1.00 35.19  ? 702  GLN A CG  1 
ATOM   5381 C CD  . GLN A 1 702 ? -50.739 173.824 51.318  1.00 37.89  ? 702  GLN A CD  1 
ATOM   5382 O OE1 . GLN A 1 702 ? -51.191 172.817 50.777  1.00 42.92  ? 702  GLN A OE1 1 
ATOM   5383 N NE2 . GLN A 1 702 ? -49.962 174.690 50.682  1.00 40.97  ? 702  GLN A NE2 1 
ATOM   5384 N N   . MET A 1 703 ? -48.134 172.792 55.748  1.00 35.70  ? 703  MET A N   1 
ATOM   5385 C CA  . MET A 1 703 ? -46.882 172.588 56.464  1.00 31.58  ? 703  MET A CA  1 
ATOM   5386 C C   . MET A 1 703 ? -45.977 171.652 55.679  1.00 29.00  ? 703  MET A C   1 
ATOM   5387 O O   . MET A 1 703 ? -46.346 170.517 55.381  1.00 29.46  ? 703  MET A O   1 
ATOM   5388 C CB  . MET A 1 703 ? -47.165 171.985 57.842  1.00 28.75  ? 703  MET A CB  1 
ATOM   5389 C CG  . MET A 1 703 ? -45.930 171.552 58.599  1.00 23.84  ? 703  MET A CG  1 
ATOM   5390 S SD  . MET A 1 703 ? -45.219 172.928 59.461  1.00 22.57  ? 703  MET A SD  1 
ATOM   5391 C CE  . MET A 1 703 ? -45.809 172.670 61.075  1.00 11.86  ? 703  MET A CE  1 
ATOM   5392 N N   . CYS A 1 704 ? -44.792 172.132 55.332  1.00 26.19  ? 704  CYS A N   1 
ATOM   5393 C CA  . CYS A 1 704 ? -43.854 171.303 54.601  1.00 19.74  ? 704  CYS A CA  1 
ATOM   5394 C C   . CYS A 1 704 ? -43.329 170.254 55.560  1.00 19.40  ? 704  CYS A C   1 
ATOM   5395 O O   . CYS A 1 704 ? -42.783 170.586 56.608  1.00 19.45  ? 704  CYS A O   1 
ATOM   5396 C CB  . CYS A 1 704 ? -42.690 172.128 54.080  1.00 13.46  ? 704  CYS A CB  1 
ATOM   5397 S SG  . CYS A 1 704 ? -41.436 171.098 53.348  1.00 20.30  ? 704  CYS A SG  1 
ATOM   5398 N N   . ILE A 1 705 ? -43.506 168.991 55.194  1.00 19.53  ? 705  ILE A N   1 
ATOM   5399 C CA  . ILE A 1 705 ? -43.066 167.879 56.019  1.00 14.46  ? 705  ILE A CA  1 
ATOM   5400 C C   . ILE A 1 705 ? -41.733 167.326 55.555  1.00 16.09  ? 705  ILE A C   1 
ATOM   5401 O O   . ILE A 1 705 ? -41.505 167.170 54.356  1.00 19.80  ? 705  ILE A O   1 
ATOM   5402 C CB  . ILE A 1 705 ? -44.079 166.734 55.972  1.00 12.65  ? 705  ILE A CB  1 
ATOM   5403 C CG1 . ILE A 1 705 ? -45.385 167.171 56.625  1.00 11.06  ? 705  ILE A CG1 1 
ATOM   5404 C CG2 . ILE A 1 705 ? -43.512 165.512 56.658  1.00 19.27  ? 705  ILE A CG2 1 
ATOM   5405 C CD1 . ILE A 1 705 ? -45.306 167.242 58.119  1.00 15.81  ? 705  ILE A CD1 1 
ATOM   5406 N N   . ASN A 1 706 ? -40.856 167.041 56.515  1.00 15.44  ? 706  ASN A N   1 
ATOM   5407 C CA  . ASN A 1 706 ? -39.540 166.459 56.243  1.00 12.33  ? 706  ASN A CA  1 
ATOM   5408 C C   . ASN A 1 706 ? -39.678 164.982 56.630  1.00 10.91  ? 706  ASN A C   1 
ATOM   5409 O O   . ASN A 1 706 ? -39.550 164.607 57.791  1.00 12.15  ? 706  ASN A O   1 
ATOM   5410 C CB  . ASN A 1 706 ? -38.476 167.150 57.097  1.00 8.76   ? 706  ASN A CB  1 
ATOM   5411 C CG  . ASN A 1 706 ? -37.215 166.327 57.246  1.00 10.86  ? 706  ASN A CG  1 
ATOM   5412 O OD1 . ASN A 1 706 ? -36.994 165.364 56.516  1.00 17.42  ? 706  ASN A OD1 1 
ATOM   5413 N ND2 . ASN A 1 706 ? -36.375 166.708 58.199  1.00 14.26  ? 706  ASN A ND2 1 
ATOM   5414 N N   . MET A 1 707 ? -39.947 164.152 55.633  1.00 8.38   ? 707  MET A N   1 
ATOM   5415 C CA  . MET A 1 707 ? -40.171 162.733 55.841  1.00 10.56  ? 707  MET A CA  1 
ATOM   5416 C C   . MET A 1 707 ? -39.084 161.920 56.518  1.00 11.03  ? 707  MET A C   1 
ATOM   5417 O O   . MET A 1 707 ? -39.368 161.114 57.405  1.00 8.79   ? 707  MET A O   1 
ATOM   5418 C CB  . MET A 1 707 ? -40.490 162.070 54.503  1.00 13.16  ? 707  MET A CB  1 
ATOM   5419 C CG  . MET A 1 707 ? -41.609 162.725 53.724  1.00 14.11  ? 707  MET A CG  1 
ATOM   5420 S SD  . MET A 1 707 ? -41.853 161.882 52.162  1.00 20.01  ? 707  MET A SD  1 
ATOM   5421 C CE  . MET A 1 707 ? -42.628 160.367 52.728  1.00 14.28  ? 707  MET A CE  1 
ATOM   5422 N N   . GLU A 1 708 ? -37.838 162.133 56.113  1.00 15.41  ? 708  GLU A N   1 
ATOM   5423 C CA  . GLU A 1 708 ? -36.744 161.331 56.647  1.00 12.40  ? 708  GLU A CA  1 
ATOM   5424 C C   . GLU A 1 708 ? -37.076 159.904 56.212  1.00 12.98  ? 708  GLU A C   1 
ATOM   5425 O O   . GLU A 1 708 ? -36.912 158.946 56.961  1.00 14.14  ? 708  GLU A O   1 
ATOM   5426 C CB  . GLU A 1 708 ? -36.699 161.410 58.177  1.00 12.96  ? 708  GLU A CB  1 
ATOM   5427 C CG  . GLU A 1 708 ? -36.372 162.789 58.735  1.00 22.96  ? 708  GLU A CG  1 
ATOM   5428 C CD  . GLU A 1 708 ? -34.981 163.263 58.359  1.00 37.42  ? 708  GLU A CD  1 
ATOM   5429 O OE1 . GLU A 1 708 ? -34.169 162.430 57.902  1.00 47.38  ? 708  GLU A OE1 1 
ATOM   5430 O OE2 . GLU A 1 708 ? -34.698 164.472 58.520  1.00 45.21  ? 708  GLU A OE2 1 
ATOM   5431 N N   . TRP A 1 709 ? -37.554 159.783 54.978  1.00 14.06  ? 709  TRP A N   1 
ATOM   5432 C CA  . TRP A 1 709 ? -37.980 158.507 54.434  1.00 9.54   ? 709  TRP A CA  1 
ATOM   5433 C C   . TRP A 1 709 ? -36.932 157.418 54.296  1.00 8.34   ? 709  TRP A C   1 
ATOM   5434 O O   . TRP A 1 709 ? -37.255 156.298 53.922  1.00 16.03  ? 709  TRP A O   1 
ATOM   5435 C CB  . TRP A 1 709 ? -38.692 158.740 53.088  1.00 11.17  ? 709  TRP A CB  1 
ATOM   5436 C CG  . TRP A 1 709 ? -37.806 158.982 51.904  1.00 5.56   ? 709  TRP A CG  1 
ATOM   5437 C CD1 . TRP A 1 709 ? -36.447 159.075 51.890  1.00 13.79  ? 709  TRP A CD1 1 
ATOM   5438 C CD2 . TRP A 1 709 ? -38.229 159.111 50.542  1.00 11.24  ? 709  TRP A CD2 1 
ATOM   5439 N NE1 . TRP A 1 709 ? -35.993 159.251 50.601  1.00 10.79  ? 709  TRP A NE1 1 
ATOM   5440 C CE2 . TRP A 1 709 ? -37.070 159.278 49.755  1.00 11.12  ? 709  TRP A CE2 1 
ATOM   5441 C CE3 . TRP A 1 709 ? -39.479 159.102 49.908  1.00 13.17  ? 709  TRP A CE3 1 
ATOM   5442 C CZ2 . TRP A 1 709 ? -37.122 159.431 48.365  1.00 15.94  ? 709  TRP A CZ2 1 
ATOM   5443 C CZ3 . TRP A 1 709 ? -39.529 159.252 48.524  1.00 9.24   ? 709  TRP A CZ3 1 
ATOM   5444 C CH2 . TRP A 1 709 ? -38.356 159.416 47.770  1.00 10.22  ? 709  TRP A CH2 1 
ATOM   5445 N N   . GLY A 1 710 ? -35.679 157.729 54.590  1.00 7.69   ? 710  GLY A N   1 
ATOM   5446 C CA  . GLY A 1 710 ? -34.651 156.712 54.466  1.00 6.98   ? 710  GLY A CA  1 
ATOM   5447 C C   . GLY A 1 710 ? -34.852 155.559 55.435  1.00 13.30  ? 710  GLY A C   1 
ATOM   5448 O O   . GLY A 1 710 ? -34.328 154.468 55.217  1.00 16.54  ? 710  GLY A O   1 
ATOM   5449 N N   . ALA A 1 711 ? -35.615 155.792 56.503  1.00 16.71  ? 711  ALA A N   1 
ATOM   5450 C CA  . ALA A 1 711 ? -35.867 154.765 57.518  1.00 13.13  ? 711  ALA A CA  1 
ATOM   5451 C C   . ALA A 1 711 ? -36.994 153.825 57.128  1.00 12.73  ? 711  ALA A C   1 
ATOM   5452 O O   . ALA A 1 711 ? -37.322 152.896 57.860  1.00 16.98  ? 711  ALA A O   1 
ATOM   5453 C CB  . ALA A 1 711 ? -36.171 155.413 58.861  1.00 7.11   ? 711  ALA A CB  1 
ATOM   5454 N N   . PHE A 1 712 ? -37.595 154.085 55.976  1.00 15.21  ? 712  PHE A N   1 
ATOM   5455 C CA  . PHE A 1 712 ? -38.667 153.244 55.449  1.00 12.17  ? 712  PHE A CA  1 
ATOM   5456 C C   . PHE A 1 712 ? -38.105 151.816 55.340  1.00 13.75  ? 712  PHE A C   1 
ATOM   5457 O O   . PHE A 1 712 ? -37.037 151.595 54.770  1.00 12.77  ? 712  PHE A O   1 
ATOM   5458 C CB  . PHE A 1 712 ? -39.074 153.784 54.072  1.00 9.43   ? 712  PHE A CB  1 
ATOM   5459 C CG  . PHE A 1 712 ? -40.069 152.939 53.336  1.00 10.39  ? 712  PHE A CG  1 
ATOM   5460 C CD1 . PHE A 1 712 ? -41.197 152.443 53.971  1.00 7.68   ? 712  PHE A CD1 1 
ATOM   5461 C CD2 . PHE A 1 712 ? -39.894 152.679 51.978  1.00 15.42  ? 712  PHE A CD2 1 
ATOM   5462 C CE1 . PHE A 1 712 ? -42.138 151.705 53.267  1.00 10.52  ? 712  PHE A CE1 1 
ATOM   5463 C CE2 . PHE A 1 712 ? -40.829 151.940 51.264  1.00 12.88  ? 712  PHE A CE2 1 
ATOM   5464 C CZ  . PHE A 1 712 ? -41.953 151.453 51.908  1.00 15.25  ? 712  PHE A CZ  1 
ATOM   5465 N N   . GLY A 1 713 ? -38.805 150.850 55.916  1.00 15.91  ? 713  GLY A N   1 
ATOM   5466 C CA  . GLY A 1 713 ? -38.326 149.484 55.844  1.00 17.29  ? 713  GLY A CA  1 
ATOM   5467 C C   . GLY A 1 713 ? -37.540 149.082 57.072  1.00 20.98  ? 713  GLY A C   1 
ATOM   5468 O O   . GLY A 1 713 ? -37.158 147.919 57.218  1.00 19.00  ? 713  GLY A O   1 
ATOM   5469 N N   . ASP A 1 714 ? -37.304 150.039 57.963  1.00 22.03  ? 714  ASP A N   1 
ATOM   5470 C CA  . ASP A 1 714 ? -36.561 149.770 59.189  1.00 19.58  ? 714  ASP A CA  1 
ATOM   5471 C C   . ASP A 1 714 ? -37.331 148.900 60.176  1.00 21.96  ? 714  ASP A C   1 
ATOM   5472 O O   . ASP A 1 714 ? -36.791 148.505 61.205  1.00 24.72  ? 714  ASP A O   1 
ATOM   5473 C CB  . ASP A 1 714 ? -36.171 151.076 59.866  1.00 14.63  ? 714  ASP A CB  1 
ATOM   5474 C CG  . ASP A 1 714 ? -34.860 151.620 59.354  1.00 17.36  ? 714  ASP A CG  1 
ATOM   5475 O OD1 . ASP A 1 714 ? -34.276 151.006 58.433  1.00 19.25  ? 714  ASP A OD1 1 
ATOM   5476 O OD2 . ASP A 1 714 ? -34.414 152.663 59.871  1.00 21.85  ? 714  ASP A OD2 1 
ATOM   5477 N N   . ASN A 1 715 ? -38.593 148.618 59.868  1.00 22.61  ? 715  ASN A N   1 
ATOM   5478 C CA  . ASN A 1 715 ? -39.418 147.774 60.724  1.00 15.80  ? 715  ASN A CA  1 
ATOM   5479 C C   . ASN A 1 715 ? -39.721 146.483 59.986  1.00 19.33  ? 715  ASN A C   1 
ATOM   5480 O O   . ASN A 1 715 ? -40.671 145.777 60.318  1.00 22.05  ? 715  ASN A O   1 
ATOM   5481 C CB  . ASN A 1 715 ? -40.722 148.477 61.101  1.00 12.57  ? 715  ASN A CB  1 
ATOM   5482 C CG  . ASN A 1 715 ? -41.599 148.765 59.900  1.00 23.59  ? 715  ASN A CG  1 
ATOM   5483 O OD1 . ASN A 1 715 ? -41.164 148.659 58.749  1.00 27.19  ? 715  ASN A OD1 1 
ATOM   5484 N ND2 . ASN A 1 715 ? -42.847 149.135 60.161  1.00 28.63  ? 715  ASN A ND2 1 
ATOM   5485 N N   . GLY A 1 716 ? -38.919 146.202 58.962  1.00 19.02  ? 716  GLY A N   1 
ATOM   5486 C CA  . GLY A 1 716 ? -39.073 144.983 58.193  1.00 16.08  ? 716  GLY A CA  1 
ATOM   5487 C C   . GLY A 1 716 ? -40.044 144.980 57.030  1.00 20.20  ? 716  GLY A C   1 
ATOM   5488 O O   . GLY A 1 716 ? -40.123 143.982 56.318  1.00 26.16  ? 716  GLY A O   1 
ATOM   5489 N N   . CYS A 1 717 ? -40.760 146.075 56.797  1.00 20.37  ? 717  CYS A N   1 
ATOM   5490 C CA  . CYS A 1 717 ? -41.746 146.106 55.709  1.00 25.48  ? 717  CYS A CA  1 
ATOM   5491 C C   . CYS A 1 717 ? -41.214 146.004 54.282  1.00 21.40  ? 717  CYS A C   1 
ATOM   5492 O O   . CYS A 1 717 ? -41.992 145.978 53.332  1.00 29.49  ? 717  CYS A O   1 
ATOM   5493 C CB  . CYS A 1 717 ? -42.645 147.349 55.827  1.00 29.26  ? 717  CYS A CB  1 
ATOM   5494 S SG  . CYS A 1 717 ? -41.837 148.917 55.420  1.00 45.29  ? 717  CYS A SG  1 
ATOM   5495 N N   . LEU A 1 718 ? -39.901 145.951 54.118  1.00 17.32  ? 718  LEU A N   1 
ATOM   5496 C CA  . LEU A 1 718 ? -39.323 145.839 52.782  1.00 17.02  ? 718  LEU A CA  1 
ATOM   5497 C C   . LEU A 1 718 ? -38.553 144.536 52.736  1.00 20.83  ? 718  LEU A C   1 
ATOM   5498 O O   . LEU A 1 718 ? -37.967 144.172 51.712  1.00 17.41  ? 718  LEU A O   1 
ATOM   5499 C CB  . LEU A 1 718 ? -38.350 146.990 52.511  1.00 18.48  ? 718  LEU A CB  1 
ATOM   5500 C CG  . LEU A 1 718 ? -38.890 148.321 51.987  1.00 16.63  ? 718  LEU A CG  1 
ATOM   5501 C CD1 . LEU A 1 718 ? -37.711 149.194 51.603  1.00 8.77   ? 718  LEU A CD1 1 
ATOM   5502 C CD2 . LEU A 1 718 ? -39.818 148.100 50.795  1.00 11.79  ? 718  LEU A CD2 1 
ATOM   5503 N N   . ASP A 1 719 ? -38.570 143.839 53.867  1.00 22.99  ? 719  ASP A N   1 
ATOM   5504 C CA  . ASP A 1 719 ? -37.858 142.584 54.031  1.00 25.37  ? 719  ASP A CA  1 
ATOM   5505 C C   . ASP A 1 719 ? -38.188 141.507 53.024  1.00 27.72  ? 719  ASP A C   1 
ATOM   5506 O O   . ASP A 1 719 ? -37.465 140.517 52.928  1.00 32.64  ? 719  ASP A O   1 
ATOM   5507 C CB  . ASP A 1 719 ? -38.074 142.050 55.439  1.00 26.90  ? 719  ASP A CB  1 
ATOM   5508 C CG  . ASP A 1 719 ? -37.038 142.556 56.406  1.00 34.71  ? 719  ASP A CG  1 
ATOM   5509 O OD1 . ASP A 1 719 ? -36.103 143.241 55.940  1.00 32.33  ? 719  ASP A OD1 1 
ATOM   5510 O OD2 . ASP A 1 719 ? -37.154 142.273 57.620  1.00 42.17  ? 719  ASP A OD2 1 
ATOM   5511 N N   . ASP A 1 720 ? -39.272 141.674 52.275  1.00 27.24  ? 720  ASP A N   1 
ATOM   5512 C CA  . ASP A 1 720 ? -39.615 140.673 51.279  1.00 26.79  ? 720  ASP A CA  1 
ATOM   5513 C C   . ASP A 1 720 ? -39.057 141.024 49.904  1.00 27.92  ? 720  ASP A C   1 
ATOM   5514 O O   . ASP A 1 720 ? -39.055 140.186 49.006  1.00 34.80  ? 720  ASP A O   1 
ATOM   5515 C CB  . ASP A 1 720 ? -41.128 140.465 51.200  1.00 28.50  ? 720  ASP A CB  1 
ATOM   5516 C CG  . ASP A 1 720 ? -41.881 141.741 50.948  1.00 36.19  ? 720  ASP A CG  1 
ATOM   5517 O OD1 . ASP A 1 720 ? -41.253 142.734 50.524  1.00 43.32  ? 720  ASP A OD1 1 
ATOM   5518 O OD2 . ASP A 1 720 ? -43.109 141.745 51.176  1.00 43.27  ? 720  ASP A OD2 1 
ATOM   5519 N N   . ILE A 1 721 ? -38.581 142.256 49.734  1.00 25.34  ? 721  ILE A N   1 
ATOM   5520 C CA  . ILE A 1 721 ? -38.000 142.649 48.454  1.00 25.44  ? 721  ILE A CA  1 
ATOM   5521 C C   . ILE A 1 721 ? -36.488 142.852 48.560  1.00 26.39  ? 721  ILE A C   1 
ATOM   5522 O O   . ILE A 1 721 ? -35.819 143.121 47.563  1.00 28.71  ? 721  ILE A O   1 
ATOM   5523 C CB  . ILE A 1 721 ? -38.644 143.944 47.875  1.00 23.98  ? 721  ILE A CB  1 
ATOM   5524 C CG1 . ILE A 1 721 ? -38.186 145.170 48.649  1.00 23.75  ? 721  ILE A CG1 1 
ATOM   5525 C CG2 . ILE A 1 721 ? -40.146 143.849 47.923  1.00 25.19  ? 721  ILE A CG2 1 
ATOM   5526 C CD1 . ILE A 1 721 ? -38.593 146.463 47.980  1.00 33.16  ? 721  ILE A CD1 1 
ATOM   5527 N N   . ARG A 1 722 ? -35.950 142.721 49.766  1.00 23.58  ? 722  ARG A N   1 
ATOM   5528 C CA  . ARG A 1 722 ? -34.516 142.888 49.965  1.00 26.00  ? 722  ARG A CA  1 
ATOM   5529 C C   . ARG A 1 722 ? -33.811 141.573 49.679  1.00 27.36  ? 722  ARG A C   1 
ATOM   5530 O O   . ARG A 1 722 ? -34.338 140.502 49.963  1.00 31.51  ? 722  ARG A O   1 
ATOM   5531 C CB  . ARG A 1 722 ? -34.236 143.362 51.390  1.00 21.82  ? 722  ARG A CB  1 
ATOM   5532 C CG  . ARG A 1 722 ? -35.031 144.612 51.735  1.00 28.76  ? 722  ARG A CG  1 
ATOM   5533 C CD  . ARG A 1 722 ? -34.899 144.993 53.180  1.00 24.25  ? 722  ARG A CD  1 
ATOM   5534 N NE  . ARG A 1 722 ? -33.519 145.307 53.519  1.00 28.65  ? 722  ARG A NE  1 
ATOM   5535 C CZ  . ARG A 1 722 ? -32.801 144.603 54.382  1.00 30.87  ? 722  ARG A CZ  1 
ATOM   5536 N NH1 . ARG A 1 722 ? -33.345 143.551 54.981  1.00 29.78  ? 722  ARG A NH1 1 
ATOM   5537 N NH2 . ARG A 1 722 ? -31.552 144.956 54.659  1.00 34.67  ? 722  ARG A NH2 1 
ATOM   5538 N N   . THR A 1 723 ? -32.614 141.657 49.115  1.00 25.65  ? 723  THR A N   1 
ATOM   5539 C CA  . THR A 1 723 ? -31.869 140.464 48.760  1.00 20.00  ? 723  THR A CA  1 
ATOM   5540 C C   . THR A 1 723 ? -30.796 140.069 49.757  1.00 24.23  ? 723  THR A C   1 
ATOM   5541 O O   . THR A 1 723 ? -30.601 140.708 50.792  1.00 27.82  ? 723  THR A O   1 
ATOM   5542 C CB  . THR A 1 723 ? -31.191 140.638 47.407  1.00 17.68  ? 723  THR A CB  1 
ATOM   5543 O OG1 . THR A 1 723 ? -30.090 141.543 47.551  1.00 13.58  ? 723  THR A OG1 1 
ATOM   5544 C CG2 . THR A 1 723 ? -32.169 141.185 46.390  1.00 12.32  ? 723  THR A CG2 1 
ATOM   5545 N N   . HIS A 1 724 ? -30.091 139.000 49.420  1.00 22.79  ? 724  HIS A N   1 
ATOM   5546 C CA  . HIS A 1 724 ? -29.027 138.503 50.257  1.00 18.88  ? 724  HIS A CA  1 
ATOM   5547 C C   . HIS A 1 724 ? -27.930 139.554 50.323  1.00 21.81  ? 724  HIS A C   1 
ATOM   5548 O O   . HIS A 1 724 ? -27.301 139.746 51.363  1.00 27.98  ? 724  HIS A O   1 
ATOM   5549 C CB  . HIS A 1 724 ? -28.483 137.209 49.664  1.00 17.94  ? 724  HIS A CB  1 
ATOM   5550 C CG  . HIS A 1 724 ? -27.188 136.765 50.265  1.00 23.63  ? 724  HIS A CG  1 
ATOM   5551 N ND1 . HIS A 1 724 ? -27.112 136.164 51.502  1.00 26.07  ? 724  HIS A ND1 1 
ATOM   5552 C CD2 . HIS A 1 724 ? -25.918 136.845 49.805  1.00 28.88  ? 724  HIS A CD2 1 
ATOM   5553 C CE1 . HIS A 1 724 ? -25.848 135.892 51.779  1.00 33.92  ? 724  HIS A CE1 1 
ATOM   5554 N NE2 . HIS A 1 724 ? -25.104 136.295 50.765  1.00 29.77  ? 724  HIS A NE2 1 
ATOM   5555 N N   . TYR A 1 725 ? -27.708 140.245 49.209  1.00 20.35  ? 725  TYR A N   1 
ATOM   5556 C CA  . TYR A 1 725 ? -26.666 141.261 49.151  1.00 18.60  ? 725  TYR A CA  1 
ATOM   5557 C C   . TYR A 1 725 ? -27.103 142.535 49.838  1.00 19.90  ? 725  TYR A C   1 
ATOM   5558 O O   . TYR A 1 725 ? -26.267 143.311 50.301  1.00 24.65  ? 725  TYR A O   1 
ATOM   5559 C CB  . TYR A 1 725 ? -26.287 141.545 47.703  1.00 18.07  ? 725  TYR A CB  1 
ATOM   5560 C CG  . TYR A 1 725 ? -25.976 140.293 46.923  1.00 19.02  ? 725  TYR A CG  1 
ATOM   5561 C CD1 . TYR A 1 725 ? -24.727 139.674 47.026  1.00 11.52  ? 725  TYR A CD1 1 
ATOM   5562 C CD2 . TYR A 1 725 ? -26.937 139.713 46.094  1.00 16.28  ? 725  TYR A CD2 1 
ATOM   5563 C CE1 . TYR A 1 725 ? -24.444 138.510 46.324  1.00 13.86  ? 725  TYR A CE1 1 
ATOM   5564 C CE2 . TYR A 1 725 ? -26.666 138.549 45.387  1.00 17.86  ? 725  TYR A CE2 1 
ATOM   5565 C CZ  . TYR A 1 725 ? -25.420 137.955 45.504  1.00 20.19  ? 725  TYR A CZ  1 
ATOM   5566 O OH  . TYR A 1 725 ? -25.156 136.814 44.781  1.00 32.19  ? 725  TYR A OH  1 
ATOM   5567 N N   . ASP A 1 726 ? -28.413 142.758 49.891  1.00 17.73  ? 726  ASP A N   1 
ATOM   5568 C CA  . ASP A 1 726 ? -28.951 143.931 50.573  1.00 12.57  ? 726  ASP A CA  1 
ATOM   5569 C C   . ASP A 1 726 ? -28.714 143.699 52.063  1.00 16.05  ? 726  ASP A C   1 
ATOM   5570 O O   . ASP A 1 726 ? -28.310 144.608 52.792  1.00 22.48  ? 726  ASP A O   1 
ATOM   5571 C CB  . ASP A 1 726 ? -30.441 144.076 50.296  1.00 9.44   ? 726  ASP A CB  1 
ATOM   5572 C CG  . ASP A 1 726 ? -30.717 144.652 48.929  1.00 12.79  ? 726  ASP A CG  1 
ATOM   5573 O OD1 . ASP A 1 726 ? -30.227 145.766 48.641  1.00 13.76  ? 726  ASP A OD1 1 
ATOM   5574 O OD2 . ASP A 1 726 ? -31.419 143.990 48.138  1.00 11.10  ? 726  ASP A OD2 1 
ATOM   5575 N N   . ARG A 1 727 ? -28.952 142.466 52.503  1.00 15.55  ? 727  ARG A N   1 
ATOM   5576 C CA  . ARG A 1 727 ? -28.732 142.097 53.894  1.00 15.49  ? 727  ARG A CA  1 
ATOM   5577 C C   . ARG A 1 727 ? -27.240 142.195 54.274  1.00 13.64  ? 727  ARG A C   1 
ATOM   5578 O O   . ARG A 1 727 ? -26.893 142.743 55.314  1.00 14.35  ? 727  ARG A O   1 
ATOM   5579 C CB  . ARG A 1 727 ? -29.247 140.682 54.138  1.00 15.26  ? 727  ARG A CB  1 
ATOM   5580 C CG  . ARG A 1 727 ? -30.715 140.494 53.796  1.00 20.58  ? 727  ARG A CG  1 
ATOM   5581 C CD  . ARG A 1 727 ? -31.287 139.259 54.476  1.00 32.25  ? 727  ARG A CD  1 
ATOM   5582 N NE  . ARG A 1 727 ? -31.001 138.034 53.727  1.00 54.42  ? 727  ARG A NE  1 
ATOM   5583 C CZ  . ARG A 1 727 ? -29.992 137.200 53.987  1.00 63.54  ? 727  ARG A CZ  1 
ATOM   5584 N NH1 . ARG A 1 727 ? -29.148 137.445 54.989  1.00 57.06  ? 727  ARG A NH1 1 
ATOM   5585 N NH2 . ARG A 1 727 ? -29.828 136.110 53.243  1.00 65.14  ? 727  ARG A NH2 1 
ATOM   5586 N N   . LEU A 1 728 ? -26.352 141.673 53.436  1.00 12.41  ? 728  LEU A N   1 
ATOM   5587 C CA  . LEU A 1 728 ? -24.928 141.752 53.744  1.00 14.97  ? 728  LEU A CA  1 
ATOM   5588 C C   . LEU A 1 728 ? -24.510 143.205 53.945  1.00 12.66  ? 728  LEU A C   1 
ATOM   5589 O O   . LEU A 1 728 ? -23.846 143.540 54.925  1.00 15.57  ? 728  LEU A O   1 
ATOM   5590 C CB  . LEU A 1 728 ? -24.098 141.142 52.613  1.00 17.90  ? 728  LEU A CB  1 
ATOM   5591 C CG  . LEU A 1 728 ? -24.105 139.619 52.475  1.00 17.78  ? 728  LEU A CG  1 
ATOM   5592 C CD1 . LEU A 1 728 ? -23.247 139.225 51.298  1.00 18.29  ? 728  LEU A CD1 1 
ATOM   5593 C CD2 . LEU A 1 728 ? -23.584 138.979 53.744  1.00 17.69  ? 728  LEU A CD2 1 
ATOM   5594 N N   . VAL A 1 729 ? -24.904 144.059 53.004  1.00 11.96  ? 729  VAL A N   1 
ATOM   5595 C CA  . VAL A 1 729 ? -24.575 145.475 53.061  1.00 13.26  ? 729  VAL A CA  1 
ATOM   5596 C C   . VAL A 1 729 ? -25.047 146.063 54.384  1.00 16.05  ? 729  VAL A C   1 
ATOM   5597 O O   . VAL A 1 729 ? -24.365 146.888 54.991  1.00 21.41  ? 729  VAL A O   1 
ATOM   5598 C CB  . VAL A 1 729 ? -25.227 146.241 51.890  1.00 13.64  ? 729  VAL A CB  1 
ATOM   5599 C CG1 . VAL A 1 729 ? -25.161 147.739 52.138  1.00 6.98   ? 729  VAL A CG1 1 
ATOM   5600 C CG2 . VAL A 1 729 ? -24.517 145.896 50.592  1.00 9.77   ? 729  VAL A CG2 1 
ATOM   5601 N N   . ASN A 1 730 ? -26.216 145.637 54.836  1.00 14.59  ? 730  ASN A N   1 
ATOM   5602 C CA  . ASN A 1 730 ? -26.736 146.127 56.102  1.00 17.10  ? 730  ASN A CA  1 
ATOM   5603 C C   . ASN A 1 730 ? -25.892 145.570 57.246  1.00 20.98  ? 730  ASN A C   1 
ATOM   5604 O O   . ASN A 1 730 ? -25.398 146.320 58.096  1.00 22.69  ? 730  ASN A O   1 
ATOM   5605 C CB  . ASN A 1 730 ? -28.195 145.694 56.264  1.00 17.22  ? 730  ASN A CB  1 
ATOM   5606 C CG  . ASN A 1 730 ? -28.905 146.450 57.362  1.00 14.95  ? 730  ASN A CG  1 
ATOM   5607 O OD1 . ASN A 1 730 ? -28.542 147.578 57.695  1.00 20.94  ? 730  ASN A OD1 1 
ATOM   5608 N ND2 . ASN A 1 730 ? -29.934 145.827 57.933  1.00 6.17   ? 730  ASN A ND2 1 
ATOM   5609 N N   . GLU A 1 731 ? -25.725 144.249 57.247  1.00 19.91  ? 731  GLU A N   1 
ATOM   5610 C CA  . GLU A 1 731 ? -24.950 143.559 58.267  1.00 19.53  ? 731  GLU A CA  1 
ATOM   5611 C C   . GLU A 1 731 ? -23.611 144.228 58.488  1.00 20.13  ? 731  GLU A C   1 
ATOM   5612 O O   . GLU A 1 731 ? -23.184 144.415 59.623  1.00 23.69  ? 731  GLU A O   1 
ATOM   5613 C CB  . GLU A 1 731 ? -24.711 142.105 57.861  1.00 22.73  ? 731  GLU A CB  1 
ATOM   5614 C CG  . GLU A 1 731 ? -23.388 141.526 58.353  1.00 23.16  ? 731  GLU A CG  1 
ATOM   5615 C CD  . GLU A 1 731 ? -23.426 140.013 58.498  1.00 30.30  ? 731  GLU A CD  1 
ATOM   5616 O OE1 . GLU A 1 731 ? -24.207 139.362 57.766  1.00 36.23  ? 731  GLU A OE1 1 
ATOM   5617 O OE2 . GLU A 1 731 ? -22.674 139.474 59.341  1.00 30.05  ? 731  GLU A OE2 1 
ATOM   5618 N N   . TYR A 1 732 ? -22.942 144.589 57.404  1.00 23.18  ? 732  TYR A N   1 
ATOM   5619 C CA  . TYR A 1 732 ? -21.637 145.214 57.533  1.00 26.59  ? 732  TYR A CA  1 
ATOM   5620 C C   . TYR A 1 732 ? -21.649 146.732 57.592  1.00 25.52  ? 732  TYR A C   1 
ATOM   5621 O O   . TYR A 1 732 ? -20.592 147.348 57.643  1.00 24.60  ? 732  TYR A O   1 
ATOM   5622 C CB  . TYR A 1 732 ? -20.727 144.739 56.404  1.00 28.16  ? 732  TYR A CB  1 
ATOM   5623 C CG  . TYR A 1 732 ? -20.578 143.243 56.389  1.00 36.59  ? 732  TYR A CG  1 
ATOM   5624 C CD1 . TYR A 1 732 ? -19.794 142.591 57.344  1.00 37.48  ? 732  TYR A CD1 1 
ATOM   5625 C CD2 . TYR A 1 732 ? -21.249 142.473 55.449  1.00 38.45  ? 732  TYR A CD2 1 
ATOM   5626 C CE1 . TYR A 1 732 ? -19.688 141.206 57.363  1.00 42.89  ? 732  TYR A CE1 1 
ATOM   5627 C CE2 . TYR A 1 732 ? -21.153 141.089 55.455  1.00 50.10  ? 732  TYR A CE2 1 
ATOM   5628 C CZ  . TYR A 1 732 ? -20.373 140.456 56.415  1.00 50.70  ? 732  TYR A CZ  1 
ATOM   5629 O OH  . TYR A 1 732 ? -20.295 139.075 56.424  1.00 54.17  ? 732  TYR A OH  1 
ATOM   5630 N N   . SER A 1 733 ? -22.834 147.337 57.598  1.00 23.95  ? 733  SER A N   1 
ATOM   5631 C CA  . SER A 1 733 ? -22.926 148.791 57.659  1.00 22.11  ? 733  SER A CA  1 
ATOM   5632 C C   . SER A 1 733 ? -22.723 149.288 59.091  1.00 26.06  ? 733  SER A C   1 
ATOM   5633 O O   . SER A 1 733 ? -22.835 148.520 60.042  1.00 31.15  ? 733  SER A O   1 
ATOM   5634 C CB  . SER A 1 733 ? -24.280 149.259 57.126  1.00 13.58  ? 733  SER A CB  1 
ATOM   5635 O OG  . SER A 1 733 ? -25.313 148.977 58.044  1.00 12.43  ? 733  SER A OG  1 
ATOM   5636 N N   . LEU A 1 734 ? -22.419 150.572 59.243  1.00 27.43  ? 734  LEU A N   1 
ATOM   5637 C CA  . LEU A 1 734 ? -22.204 151.142 60.569  1.00 26.59  ? 734  LEU A CA  1 
ATOM   5638 C C   . LEU A 1 734 ? -23.492 151.270 61.378  1.00 24.98  ? 734  LEU A C   1 
ATOM   5639 O O   . LEU A 1 734 ? -23.461 151.290 62.604  1.00 33.37  ? 734  LEU A O   1 
ATOM   5640 C CB  . LEU A 1 734 ? -21.552 152.519 60.448  1.00 30.40  ? 734  LEU A CB  1 
ATOM   5641 C CG  . LEU A 1 734 ? -20.046 152.508 60.691  1.00 38.33  ? 734  LEU A CG  1 
ATOM   5642 C CD1 . LEU A 1 734 ? -19.756 151.952 62.077  1.00 47.07  ? 734  LEU A CD1 1 
ATOM   5643 C CD2 . LEU A 1 734 ? -19.370 151.655 59.635  1.00 45.41  ? 734  LEU A CD2 1 
ATOM   5644 N N   . ASN A 1 735 ? -24.621 151.351 60.686  1.00 16.40  ? 735  ASN A N   1 
ATOM   5645 C CA  . ASN A 1 735 ? -25.915 151.504 61.334  1.00 12.47  ? 735  ASN A CA  1 
ATOM   5646 C C   . ASN A 1 735 ? -26.823 150.329 61.024  1.00 13.83  ? 735  ASN A C   1 
ATOM   5647 O O   . ASN A 1 735 ? -27.959 150.511 60.577  1.00 16.76  ? 735  ASN A O   1 
ATOM   5648 C CB  . ASN A 1 735 ? -26.578 152.790 60.849  1.00 19.07  ? 735  ASN A CB  1 
ATOM   5649 C CG  . ASN A 1 735 ? -26.607 152.896 59.335  1.00 20.20  ? 735  ASN A CG  1 
ATOM   5650 O OD1 . ASN A 1 735 ? -26.169 151.985 58.623  1.00 27.40  ? 735  ASN A OD1 1 
ATOM   5651 N ND2 . ASN A 1 735 ? -27.124 154.011 58.833  1.00 21.77  ? 735  ASN A ND2 1 
ATOM   5652 N N   . ALA A 1 736 ? -26.323 149.124 61.263  1.00 12.01  ? 736  ALA A N   1 
ATOM   5653 C CA  . ALA A 1 736 ? -27.080 147.913 60.989  1.00 11.76  ? 736  ALA A CA  1 
ATOM   5654 C C   . ALA A 1 736 ? -28.536 148.024 61.424  1.00 14.11  ? 736  ALA A C   1 
ATOM   5655 O O   . ALA A 1 736 ? -28.834 148.569 62.483  1.00 18.05  ? 736  ALA A O   1 
ATOM   5656 C CB  . ALA A 1 736 ? -26.418 146.733 61.671  1.00 10.12  ? 736  ALA A CB  1 
ATOM   5657 N N   . GLY A 1 737 ? -29.439 147.514 60.589  1.00 15.44  ? 737  GLY A N   1 
ATOM   5658 C CA  . GLY A 1 737 ? -30.857 147.550 60.902  1.00 13.54  ? 737  GLY A CA  1 
ATOM   5659 C C   . GLY A 1 737 ? -31.548 148.883 60.687  1.00 16.12  ? 737  GLY A C   1 
ATOM   5660 O O   . GLY A 1 737 ? -32.768 148.969 60.793  1.00 18.34  ? 737  GLY A O   1 
ATOM   5661 N N   . LYS A 1 738 ? -30.779 149.925 60.388  1.00 15.25  ? 738  LYS A N   1 
ATOM   5662 C CA  . LYS A 1 738 ? -31.354 151.244 60.166  1.00 17.65  ? 738  LYS A CA  1 
ATOM   5663 C C   . LYS A 1 738 ? -31.105 151.728 58.745  1.00 18.93  ? 738  LYS A C   1 
ATOM   5664 O O   . LYS A 1 738 ? -30.145 151.310 58.090  1.00 18.53  ? 738  LYS A O   1 
ATOM   5665 C CB  . LYS A 1 738 ? -30.762 152.263 61.147  1.00 23.85  ? 738  LYS A CB  1 
ATOM   5666 C CG  . LYS A 1 738 ? -30.517 151.736 62.552  1.00 29.76  ? 738  LYS A CG  1 
ATOM   5667 C CD  . LYS A 1 738 ? -31.683 152.058 63.469  1.00 40.71  ? 738  LYS A CD  1 
ATOM   5668 C CE  . LYS A 1 738 ? -32.905 151.206 63.125  1.00 49.89  ? 738  LYS A CE  1 
ATOM   5669 N NZ  . LYS A 1 738 ? -33.810 150.988 64.294  1.00 54.66  ? 738  LYS A NZ  1 
ATOM   5670 N N   . GLN A 1 739 ? -31.980 152.617 58.282  1.00 17.45  ? 739  GLN A N   1 
ATOM   5671 C CA  . GLN A 1 739 ? -31.887 153.203 56.949  1.00 13.85  ? 739  GLN A CA  1 
ATOM   5672 C C   . GLN A 1 739 ? -31.930 152.160 55.844  1.00 18.04  ? 739  GLN A C   1 
ATOM   5673 O O   . GLN A 1 739 ? -31.209 152.282 54.857  1.00 22.72  ? 739  GLN A O   1 
ATOM   5674 C CB  . GLN A 1 739 ? -30.595 154.017 56.827  1.00 9.54   ? 739  GLN A CB  1 
ATOM   5675 C CG  . GLN A 1 739 ? -30.446 155.129 57.866  1.00 13.01  ? 739  GLN A CG  1 
ATOM   5676 C CD  . GLN A 1 739 ? -31.575 156.148 57.815  1.00 18.02  ? 739  GLN A CD  1 
ATOM   5677 O OE1 . GLN A 1 739 ? -32.415 156.209 58.719  1.00 23.19  ? 739  GLN A OE1 1 
ATOM   5678 N NE2 . GLN A 1 739 ? -31.602 156.954 56.754  1.00 19.33  ? 739  GLN A NE2 1 
ATOM   5679 N N   . ARG A 1 740 ? -32.777 151.143 56.004  1.00 18.95  ? 740  ARG A N   1 
ATOM   5680 C CA  . ARG A 1 740 ? -32.895 150.074 55.010  1.00 15.59  ? 740  ARG A CA  1 
ATOM   5681 C C   . ARG A 1 740 ? -33.256 150.579 53.615  1.00 20.22  ? 740  ARG A C   1 
ATOM   5682 O O   . ARG A 1 740 ? -32.656 150.151 52.631  1.00 29.36  ? 740  ARG A O   1 
ATOM   5683 C CB  . ARG A 1 740 ? -33.923 149.038 55.458  1.00 14.35  ? 740  ARG A CB  1 
ATOM   5684 C CG  . ARG A 1 740 ? -33.319 147.811 56.137  1.00 8.99   ? 740  ARG A CG  1 
ATOM   5685 C CD  . ARG A 1 740 ? -32.916 148.110 57.568  1.00 15.02  ? 740  ARG A CD  1 
ATOM   5686 N NE  . ARG A 1 740 ? -32.859 146.913 58.405  1.00 21.95  ? 740  ARG A NE  1 
ATOM   5687 C CZ  . ARG A 1 740 ? -33.869 146.062 58.567  1.00 26.76  ? 740  ARG A CZ  1 
ATOM   5688 N NH1 . ARG A 1 740 ? -35.025 146.267 57.950  1.00 36.19  ? 740  ARG A NH1 1 
ATOM   5689 N NH2 . ARG A 1 740 ? -33.727 145.003 59.346  1.00 31.70  ? 740  ARG A NH2 1 
ATOM   5690 N N   . TYR A 1 741 ? -34.227 151.485 53.527  1.00 17.11  ? 741  TYR A N   1 
ATOM   5691 C CA  . TYR A 1 741 ? -34.652 152.049 52.241  1.00 14.86  ? 741  TYR A CA  1 
ATOM   5692 C C   . TYR A 1 741 ? -33.537 152.862 51.595  1.00 13.10  ? 741  TYR A C   1 
ATOM   5693 O O   . TYR A 1 741 ? -33.216 152.672 50.430  1.00 18.40  ? 741  TYR A O   1 
ATOM   5694 C CB  . TYR A 1 741 ? -35.873 152.942 52.443  1.00 19.72  ? 741  TYR A CB  1 
ATOM   5695 C CG  . TYR A 1 741 ? -36.483 153.505 51.177  1.00 25.57  ? 741  TYR A CG  1 
ATOM   5696 C CD1 . TYR A 1 741 ? -36.892 152.669 50.136  1.00 28.76  ? 741  TYR A CD1 1 
ATOM   5697 C CD2 . TYR A 1 741 ? -36.730 154.876 51.054  1.00 27.75  ? 741  TYR A CD2 1 
ATOM   5698 C CE1 . TYR A 1 741 ? -37.542 153.186 49.005  1.00 24.41  ? 741  TYR A CE1 1 
ATOM   5699 C CE2 . TYR A 1 741 ? -37.379 155.401 49.929  1.00 19.61  ? 741  TYR A CE2 1 
ATOM   5700 C CZ  . TYR A 1 741 ? -37.783 154.552 48.916  1.00 17.16  ? 741  TYR A CZ  1 
ATOM   5701 O OH  . TYR A 1 741 ? -38.442 155.069 47.830  1.00 16.62  ? 741  TYR A OH  1 
ATOM   5702 N N   . GLU A 1 742 ? -32.953 153.772 52.362  1.00 11.27  ? 742  GLU A N   1 
ATOM   5703 C CA  . GLU A 1 742 ? -31.874 154.614 51.872  1.00 6.26   ? 742  GLU A CA  1 
ATOM   5704 C C   . GLU A 1 742 ? -30.686 153.777 51.423  1.00 8.26   ? 742  GLU A C   1 
ATOM   5705 O O   . GLU A 1 742 ? -29.848 154.245 50.664  1.00 11.03  ? 742  GLU A O   1 
ATOM   5706 C CB  . GLU A 1 742 ? -31.432 155.567 52.981  1.00 10.62  ? 742  GLU A CB  1 
ATOM   5707 C CG  . GLU A 1 742 ? -30.126 156.294 52.729  1.00 14.51  ? 742  GLU A CG  1 
ATOM   5708 C CD  . GLU A 1 742 ? -29.720 157.164 53.902  1.00 26.98  ? 742  GLU A CD  1 
ATOM   5709 O OE1 . GLU A 1 742 ? -30.168 158.327 53.963  1.00 30.98  ? 742  GLU A OE1 1 
ATOM   5710 O OE2 . GLU A 1 742 ? -28.954 156.683 54.768  1.00 39.80  ? 742  GLU A OE2 1 
ATOM   5711 N N   . LYS A 1 743 ? -30.625 152.535 51.892  1.00 13.58  ? 743  LYS A N   1 
ATOM   5712 C CA  . LYS A 1 743 ? -29.524 151.630 51.572  1.00 12.87  ? 743  LYS A CA  1 
ATOM   5713 C C   . LYS A 1 743 ? -29.677 150.928 50.221  1.00 15.96  ? 743  LYS A C   1 
ATOM   5714 O O   . LYS A 1 743 ? -28.722 150.371 49.691  1.00 18.48  ? 743  LYS A O   1 
ATOM   5715 C CB  . LYS A 1 743 ? -29.379 150.593 52.693  1.00 13.89  ? 743  LYS A CB  1 
ATOM   5716 C CG  . LYS A 1 743 ? -28.378 150.994 53.780  1.00 12.30  ? 743  LYS A CG  1 
ATOM   5717 C CD  . LYS A 1 743 ? -28.577 150.234 55.089  1.00 5.00   ? 743  LYS A CD  1 
ATOM   5718 C CE  . LYS A 1 743 ? -27.403 150.498 56.028  1.00 5.00   ? 743  LYS A CE  1 
ATOM   5719 N NZ  . LYS A 1 743 ? -27.712 150.230 57.457  1.00 5.00   ? 743  LYS A NZ  1 
ATOM   5720 N N   . MET A 1 744 ? -30.886 150.955 49.672  1.00 18.10  ? 744  MET A N   1 
ATOM   5721 C CA  . MET A 1 744 ? -31.162 150.334 48.378  1.00 16.38  ? 744  MET A CA  1 
ATOM   5722 C C   . MET A 1 744 ? -31.280 151.427 47.326  1.00 18.12  ? 744  MET A C   1 
ATOM   5723 O O   . MET A 1 744 ? -31.549 151.143 46.164  1.00 24.44  ? 744  MET A O   1 
ATOM   5724 C CB  . MET A 1 744 ? -32.506 149.593 48.408  1.00 11.18  ? 744  MET A CB  1 
ATOM   5725 C CG  . MET A 1 744 ? -32.590 148.415 49.355  1.00 18.92  ? 744  MET A CG  1 
ATOM   5726 S SD  . MET A 1 744 ? -34.305 147.992 49.730  1.00 22.42  ? 744  MET A SD  1 
ATOM   5727 C CE  . MET A 1 744 ? -34.586 146.704 48.532  1.00 26.32  ? 744  MET A CE  1 
ATOM   5728 N N   . ILE A 1 745 ? -31.055 152.672 47.732  1.00 18.73  ? 745  ILE A N   1 
ATOM   5729 C CA  . ILE A 1 745 ? -31.249 153.797 46.830  1.00 15.50  ? 745  ILE A CA  1 
ATOM   5730 C C   . ILE A 1 745 ? -30.171 154.878 46.801  1.00 15.44  ? 745  ILE A C   1 
ATOM   5731 O O   . ILE A 1 745 ? -29.963 155.509 45.771  1.00 16.37  ? 745  ILE A O   1 
ATOM   5732 C CB  . ILE A 1 745 ? -32.617 154.429 47.170  1.00 16.50  ? 745  ILE A CB  1 
ATOM   5733 C CG1 . ILE A 1 745 ? -33.719 153.630 46.491  1.00 22.65  ? 745  ILE A CG1 1 
ATOM   5734 C CG2 . ILE A 1 745 ? -32.661 155.879 46.786  1.00 13.94  ? 745  ILE A CG2 1 
ATOM   5735 C CD1 . ILE A 1 745 ? -35.093 154.074 46.879  1.00 43.72  ? 745  ILE A CD1 1 
ATOM   5736 N N   . SER A 1 746 ? -29.483 155.087 47.918  1.00 16.81  ? 746  SER A N   1 
ATOM   5737 C CA  . SER A 1 746 ? -28.454 156.118 48.010  1.00 18.06  ? 746  SER A CA  1 
ATOM   5738 C C   . SER A 1 746 ? -27.143 155.744 47.351  1.00 19.23  ? 746  SER A C   1 
ATOM   5739 O O   . SER A 1 746 ? -26.776 154.574 47.289  1.00 22.76  ? 746  SER A O   1 
ATOM   5740 C CB  . SER A 1 746 ? -28.191 156.464 49.470  1.00 24.44  ? 746  SER A CB  1 
ATOM   5741 O OG  . SER A 1 746 ? -29.138 157.404 49.937  1.00 40.21  ? 746  SER A OG  1 
ATOM   5742 N N   . GLY A 1 747 ? -26.421 156.755 46.887  1.00 22.52  ? 747  GLY A N   1 
ATOM   5743 C CA  . GLY A 1 747 ? -25.164 156.507 46.211  1.00 26.51  ? 747  GLY A CA  1 
ATOM   5744 C C   . GLY A 1 747 ? -24.080 156.019 47.139  1.00 29.59  ? 747  GLY A C   1 
ATOM   5745 O O   . GLY A 1 747 ? -23.002 155.617 46.699  1.00 38.55  ? 747  GLY A O   1 
ATOM   5746 N N   . MET A 1 748 ? -24.363 156.042 48.433  1.00 29.17  ? 748  MET A N   1 
ATOM   5747 C CA  . MET A 1 748 ? -23.384 155.616 49.417  1.00 26.24  ? 748  MET A CA  1 
ATOM   5748 C C   . MET A 1 748 ? -23.338 154.105 49.565  1.00 24.36  ? 748  MET A C   1 
ATOM   5749 O O   . MET A 1 748 ? -22.355 153.551 50.050  1.00 24.99  ? 748  MET A O   1 
ATOM   5750 C CB  . MET A 1 748 ? -23.709 156.249 50.761  1.00 35.54  ? 748  MET A CB  1 
ATOM   5751 C CG  . MET A 1 748 ? -22.553 156.251 51.717  1.00 49.42  ? 748  MET A CG  1 
ATOM   5752 S SD  . MET A 1 748 ? -23.137 156.349 53.405  1.00 63.93  ? 748  MET A SD  1 
ATOM   5753 C CE  . MET A 1 748 ? -21.568 156.288 54.277  1.00 65.33  ? 748  MET A CE  1 
ATOM   5754 N N   . TYR A 1 749 ? -24.402 153.438 49.138  1.00 22.82  ? 749  TYR A N   1 
ATOM   5755 C CA  . TYR A 1 749 ? -24.473 151.991 49.246  1.00 22.84  ? 749  TYR A CA  1 
ATOM   5756 C C   . TYR A 1 749 ? -24.528 151.232 47.922  1.00 26.54  ? 749  TYR A C   1 
ATOM   5757 O O   . TYR A 1 749 ? -24.031 150.105 47.839  1.00 28.96  ? 749  TYR A O   1 
ATOM   5758 C CB  . TYR A 1 749 ? -25.673 151.611 50.109  1.00 18.22  ? 749  TYR A CB  1 
ATOM   5759 C CG  . TYR A 1 749 ? -25.645 152.287 51.453  1.00 23.72  ? 749  TYR A CG  1 
ATOM   5760 C CD1 . TYR A 1 749 ? -24.981 151.708 52.538  1.00 15.36  ? 749  TYR A CD1 1 
ATOM   5761 C CD2 . TYR A 1 749 ? -26.277 153.514 51.645  1.00 27.63  ? 749  TYR A CD2 1 
ATOM   5762 C CE1 . TYR A 1 749 ? -24.951 152.333 53.778  1.00 14.00  ? 749  TYR A CE1 1 
ATOM   5763 C CE2 . TYR A 1 749 ? -26.254 154.148 52.881  1.00 26.73  ? 749  TYR A CE2 1 
ATOM   5764 C CZ  . TYR A 1 749 ? -25.592 153.553 53.943  1.00 21.77  ? 749  TYR A CZ  1 
ATOM   5765 O OH  . TYR A 1 749 ? -25.606 154.172 55.169  1.00 25.97  ? 749  TYR A OH  1 
ATOM   5766 N N   . LEU A 1 750 ? -25.117 151.836 46.890  1.00 21.52  ? 750  LEU A N   1 
ATOM   5767 C CA  . LEU A 1 750 ? -25.228 151.163 45.597  1.00 17.85  ? 750  LEU A CA  1 
ATOM   5768 C C   . LEU A 1 750 ? -23.950 150.417 45.232  1.00 12.94  ? 750  LEU A C   1 
ATOM   5769 O O   . LEU A 1 750 ? -23.997 149.244 44.891  1.00 20.82  ? 750  LEU A O   1 
ATOM   5770 C CB  . LEU A 1 750 ? -25.583 152.159 44.491  1.00 17.66  ? 750  LEU A CB  1 
ATOM   5771 C CG  . LEU A 1 750 ? -26.993 152.752 44.539  1.00 18.85  ? 750  LEU A CG  1 
ATOM   5772 C CD1 . LEU A 1 750 ? -27.301 153.386 43.203  1.00 19.74  ? 750  LEU A CD1 1 
ATOM   5773 C CD2 . LEU A 1 750 ? -28.020 151.680 44.876  1.00 17.46  ? 750  LEU A CD2 1 
ATOM   5774 N N   . GLY A 1 751 ? -22.811 151.089 45.318  1.00 10.73  ? 751  GLY A N   1 
ATOM   5775 C CA  . GLY A 1 751 ? -21.556 150.441 44.989  1.00 5.99   ? 751  GLY A CA  1 
ATOM   5776 C C   . GLY A 1 751 ? -21.275 149.223 45.844  1.00 11.62  ? 751  GLY A C   1 
ATOM   5777 O O   . GLY A 1 751 ? -20.708 148.251 45.352  1.00 18.01  ? 751  GLY A O   1 
ATOM   5778 N N   . GLU A 1 752 ? -21.678 149.272 47.115  1.00 16.02  ? 752  GLU A N   1 
ATOM   5779 C CA  . GLU A 1 752 ? -21.466 148.177 48.071  1.00 10.80  ? 752  GLU A CA  1 
ATOM   5780 C C   . GLU A 1 752 ? -22.330 146.958 47.784  1.00 11.92  ? 752  GLU A C   1 
ATOM   5781 O O   . GLU A 1 752 ? -21.960 145.833 48.112  1.00 10.20  ? 752  GLU A O   1 
ATOM   5782 C CB  . GLU A 1 752 ? -21.728 148.660 49.496  1.00 12.10  ? 752  GLU A CB  1 
ATOM   5783 C CG  . GLU A 1 752 ? -20.594 149.502 50.074  1.00 12.53  ? 752  GLU A CG  1 
ATOM   5784 C CD  . GLU A 1 752 ? -19.351 148.686 50.356  1.00 18.51  ? 752  GLU A CD  1 
ATOM   5785 O OE1 . GLU A 1 752 ? -19.436 147.768 51.202  1.00 29.34  ? 752  GLU A OE1 1 
ATOM   5786 O OE2 . GLU A 1 752 ? -18.295 148.953 49.734  1.00 16.28  ? 752  GLU A OE2 1 
ATOM   5787 N N   . ILE A 1 753 ? -23.496 147.180 47.194  1.00 13.92  ? 753  ILE A N   1 
ATOM   5788 C CA  . ILE A 1 753 ? -24.348 146.060 46.828  1.00 12.57  ? 753  ILE A CA  1 
ATOM   5789 C C   . ILE A 1 753 ? -23.617 145.427 45.661  1.00 15.45  ? 753  ILE A C   1 
ATOM   5790 O O   . ILE A 1 753 ? -23.459 144.214 45.591  1.00 22.56  ? 753  ILE A O   1 
ATOM   5791 C CB  . ILE A 1 753 ? -25.711 146.514 46.314  1.00 11.53  ? 753  ILE A CB  1 
ATOM   5792 C CG1 . ILE A 1 753 ? -26.489 147.203 47.428  1.00 11.46  ? 753  ILE A CG1 1 
ATOM   5793 C CG2 . ILE A 1 753 ? -26.471 145.324 45.765  1.00 13.83  ? 753  ILE A CG2 1 
ATOM   5794 C CD1 . ILE A 1 753 ? -27.513 148.196 46.915  1.00 13.07  ? 753  ILE A CD1 1 
ATOM   5795 N N   . VAL A 1 754 ? -23.163 146.286 44.752  1.00 15.04  ? 754  VAL A N   1 
ATOM   5796 C CA  . VAL A 1 754 ? -22.443 145.870 43.560  1.00 12.11  ? 754  VAL A CA  1 
ATOM   5797 C C   . VAL A 1 754 ? -21.189 145.120 43.919  1.00 13.26  ? 754  VAL A C   1 
ATOM   5798 O O   . VAL A 1 754 ? -20.975 144.010 43.446  1.00 21.25  ? 754  VAL A O   1 
ATOM   5799 C CB  . VAL A 1 754 ? -22.034 147.074 42.700  1.00 10.03  ? 754  VAL A CB  1 
ATOM   5800 C CG1 . VAL A 1 754 ? -21.048 146.642 41.625  1.00 11.25  ? 754  VAL A CG1 1 
ATOM   5801 C CG2 . VAL A 1 754 ? -23.256 147.681 42.066  1.00 11.25  ? 754  VAL A CG2 1 
ATOM   5802 N N   . ARG A 1 755 ? -20.354 145.732 44.748  1.00 16.36  ? 755  ARG A N   1 
ATOM   5803 C CA  . ARG A 1 755 ? -19.101 145.106 45.152  1.00 17.92  ? 755  ARG A CA  1 
ATOM   5804 C C   . ARG A 1 755 ? -19.336 143.750 45.803  1.00 18.55  ? 755  ARG A C   1 
ATOM   5805 O O   . ARG A 1 755 ? -18.578 142.810 45.580  1.00 19.92  ? 755  ARG A O   1 
ATOM   5806 C CB  . ARG A 1 755 ? -18.328 146.011 46.119  1.00 11.77  ? 755  ARG A CB  1 
ATOM   5807 C CG  . ARG A 1 755 ? -16.927 145.502 46.446  1.00 9.10   ? 755  ARG A CG  1 
ATOM   5808 C CD  . ARG A 1 755 ? -16.208 146.415 47.428  1.00 11.24  ? 755  ARG A CD  1 
ATOM   5809 N NE  . ARG A 1 755 ? -16.935 146.565 48.688  1.00 18.21  ? 755  ARG A NE  1 
ATOM   5810 C CZ  . ARG A 1 755 ? -16.647 145.894 49.801  1.00 27.74  ? 755  ARG A CZ  1 
ATOM   5811 N NH1 . ARG A 1 755 ? -15.645 145.023 49.817  1.00 30.89  ? 755  ARG A NH1 1 
ATOM   5812 N NH2 . ARG A 1 755 ? -17.359 146.092 50.904  1.00 28.11  ? 755  ARG A NH2 1 
ATOM   5813 N N   . ASN A 1 756 ? -20.393 143.639 46.600  1.00 21.80  ? 756  ASN A N   1 
ATOM   5814 C CA  . ASN A 1 756 ? -20.673 142.375 47.271  1.00 26.18  ? 756  ASN A CA  1 
ATOM   5815 C C   . ASN A 1 756 ? -21.143 141.286 46.319  1.00 26.63  ? 756  ASN A C   1 
ATOM   5816 O O   . ASN A 1 756 ? -21.038 140.099 46.625  1.00 31.57  ? 756  ASN A O   1 
ATOM   5817 C CB  . ASN A 1 756 ? -21.685 142.584 48.396  1.00 22.64  ? 756  ASN A CB  1 
ATOM   5818 C CG  . ASN A 1 756 ? -21.014 142.921 49.707  1.00 24.95  ? 756  ASN A CG  1 
ATOM   5819 O OD1 . ASN A 1 756 ? -20.494 142.043 50.396  1.00 31.56  ? 756  ASN A OD1 1 
ATOM   5820 N ND2 . ASN A 1 756 ? -21.007 144.199 50.054  1.00 31.82  ? 756  ASN A ND2 1 
ATOM   5821 N N   . ILE A 1 757 ? -21.666 141.689 45.166  1.00 25.65  ? 757  ILE A N   1 
ATOM   5822 C CA  . ILE A 1 757 ? -22.113 140.726 44.169  1.00 19.27  ? 757  ILE A CA  1 
ATOM   5823 C C   . ILE A 1 757 ? -20.873 140.233 43.434  1.00 18.76  ? 757  ILE A C   1 
ATOM   5824 O O   . ILE A 1 757 ? -20.699 139.037 43.226  1.00 19.33  ? 757  ILE A O   1 
ATOM   5825 C CB  . ILE A 1 757 ? -23.071 141.366 43.165  1.00 10.68  ? 757  ILE A CB  1 
ATOM   5826 C CG1 . ILE A 1 757 ? -24.296 141.901 43.906  1.00 15.40  ? 757  ILE A CG1 1 
ATOM   5827 C CG2 . ILE A 1 757 ? -23.482 140.347 42.129  1.00 13.44  ? 757  ILE A CG2 1 
ATOM   5828 C CD1 . ILE A 1 757 ? -25.474 142.258 43.009  1.00 16.49  ? 757  ILE A CD1 1 
ATOM   5829 N N   . LEU A 1 758 ? -20.007 141.168 43.058  1.00 18.74  ? 758  LEU A N   1 
ATOM   5830 C CA  . LEU A 1 758 ? -18.778 140.835 42.359  1.00 21.17  ? 758  LEU A CA  1 
ATOM   5831 C C   . LEU A 1 758 ? -17.955 139.832 43.162  1.00 26.69  ? 758  LEU A C   1 
ATOM   5832 O O   . LEU A 1 758 ? -17.476 138.837 42.614  1.00 35.08  ? 758  LEU A O   1 
ATOM   5833 C CB  . LEU A 1 758 ? -17.947 142.099 42.111  1.00 16.60  ? 758  LEU A CB  1 
ATOM   5834 C CG  . LEU A 1 758 ? -18.581 143.170 41.230  1.00 14.22  ? 758  LEU A CG  1 
ATOM   5835 C CD1 . LEU A 1 758 ? -17.577 144.266 40.920  1.00 15.71  ? 758  LEU A CD1 1 
ATOM   5836 C CD2 . LEU A 1 758 ? -19.068 142.525 39.955  1.00 21.47  ? 758  LEU A CD2 1 
ATOM   5837 N N   . ILE A 1 759 ? -17.782 140.094 44.454  1.00 25.47  ? 759  ILE A N   1 
ATOM   5838 C CA  . ILE A 1 759 ? -17.005 139.196 45.299  1.00 23.06  ? 759  ILE A CA  1 
ATOM   5839 C C   . ILE A 1 759 ? -17.589 137.806 45.152  1.00 23.60  ? 759  ILE A C   1 
ATOM   5840 O O   . ILE A 1 759 ? -16.871 136.835 44.921  1.00 25.27  ? 759  ILE A O   1 
ATOM   5841 C CB  . ILE A 1 759 ? -17.073 139.608 46.781  1.00 18.30  ? 759  ILE A CB  1 
ATOM   5842 C CG1 . ILE A 1 759 ? -16.088 140.741 47.045  1.00 10.81  ? 759  ILE A CG1 1 
ATOM   5843 C CG2 . ILE A 1 759 ? -16.730 138.426 47.672  1.00 11.60  ? 759  ILE A CG2 1 
ATOM   5844 C CD1 . ILE A 1 759 ? -16.249 141.358 48.398  1.00 9.06   ? 759  ILE A CD1 1 
ATOM   5845 N N   . ASP A 1 760 ? -18.905 137.731 45.273  1.00 21.24  ? 760  ASP A N   1 
ATOM   5846 C CA  . ASP A 1 760 ? -19.617 136.475 45.158  1.00 25.13  ? 760  ASP A CA  1 
ATOM   5847 C C   . ASP A 1 760 ? -19.281 135.796 43.839  1.00 26.56  ? 760  ASP A C   1 
ATOM   5848 O O   . ASP A 1 760 ? -18.850 134.644 43.816  1.00 30.08  ? 760  ASP A O   1 
ATOM   5849 C CB  . ASP A 1 760 ? -21.117 136.734 45.244  1.00 38.43  ? 760  ASP A CB  1 
ATOM   5850 C CG  . ASP A 1 760 ? -21.906 135.478 45.502  1.00 52.05  ? 760  ASP A CG  1 
ATOM   5851 O OD1 . ASP A 1 760 ? -21.354 134.382 45.272  1.00 64.43  ? 760  ASP A OD1 1 
ATOM   5852 O OD2 . ASP A 1 760 ? -23.074 135.585 45.934  1.00 60.93  ? 760  ASP A OD2 1 
ATOM   5853 N N   . PHE A 1 761 ? -19.479 136.516 42.740  1.00 25.61  ? 761  PHE A N   1 
ATOM   5854 C CA  . PHE A 1 761 ? -19.196 135.980 41.413  1.00 23.11  ? 761  PHE A CA  1 
ATOM   5855 C C   . PHE A 1 761 ? -17.727 135.583 41.287  1.00 23.79  ? 761  PHE A C   1 
ATOM   5856 O O   . PHE A 1 761 ? -17.399 134.582 40.651  1.00 21.40  ? 761  PHE A O   1 
ATOM   5857 C CB  . PHE A 1 761 ? -19.555 137.010 40.335  1.00 18.43  ? 761  PHE A CB  1 
ATOM   5858 C CG  . PHE A 1 761 ? -21.039 137.125 40.065  1.00 14.00  ? 761  PHE A CG  1 
ATOM   5859 C CD1 . PHE A 1 761 ? -21.957 136.349 40.769  1.00 10.30  ? 761  PHE A CD1 1 
ATOM   5860 C CD2 . PHE A 1 761 ? -21.517 138.022 39.114  1.00 10.98  ? 761  PHE A CD2 1 
ATOM   5861 C CE1 . PHE A 1 761 ? -23.329 136.465 40.531  1.00 10.42  ? 761  PHE A CE1 1 
ATOM   5862 C CE2 . PHE A 1 761 ? -22.887 138.145 38.870  1.00 10.62  ? 761  PHE A CE2 1 
ATOM   5863 C CZ  . PHE A 1 761 ? -23.793 137.365 39.581  1.00 11.11  ? 761  PHE A CZ  1 
ATOM   5864 N N   . THR A 1 762 ? -16.841 136.366 41.894  1.00 23.04  ? 762  THR A N   1 
ATOM   5865 C CA  . THR A 1 762 ? -15.418 136.059 41.844  1.00 25.33  ? 762  THR A CA  1 
ATOM   5866 C C   . THR A 1 762 ? -15.175 134.699 42.481  1.00 28.81  ? 762  THR A C   1 
ATOM   5867 O O   . THR A 1 762 ? -14.399 133.896 41.972  1.00 29.94  ? 762  THR A O   1 
ATOM   5868 C CB  . THR A 1 762 ? -14.582 137.095 42.609  1.00 24.08  ? 762  THR A CB  1 
ATOM   5869 O OG1 . THR A 1 762 ? -14.664 138.364 41.948  1.00 24.84  ? 762  THR A OG1 1 
ATOM   5870 C CG2 . THR A 1 762 ? -13.127 136.652 42.674  1.00 13.35  ? 762  THR A CG2 1 
ATOM   5871 N N   . LYS A 1 763 ? -15.840 134.452 43.606  1.00 34.37  ? 763  LYS A N   1 
ATOM   5872 C CA  . LYS A 1 763 ? -15.702 133.185 44.315  1.00 34.52  ? 763  LYS A CA  1 
ATOM   5873 C C   . LYS A 1 763 ? -16.213 132.043 43.452  1.00 32.58  ? 763  LYS A C   1 
ATOM   5874 O O   . LYS A 1 763 ? -15.566 131.006 43.346  1.00 33.09  ? 763  LYS A O   1 
ATOM   5875 C CB  . LYS A 1 763 ? -16.470 133.227 45.632  1.00 35.51  ? 763  LYS A CB  1 
ATOM   5876 C CG  . LYS A 1 763 ? -15.812 134.112 46.676  1.00 45.82  ? 763  LYS A CG  1 
ATOM   5877 C CD  . LYS A 1 763 ? -15.844 133.475 48.056  1.00 52.27  ? 763  LYS A CD  1 
ATOM   5878 C CE  . LYS A 1 763 ? -15.719 134.526 49.152  1.00 55.81  ? 763  LYS A CE  1 
ATOM   5879 N NZ  . LYS A 1 763 ? -17.051 134.934 49.689  1.00 59.72  ? 763  LYS A NZ  1 
ATOM   5880 N N   . LYS A 1 764 ? -17.375 132.228 42.838  1.00 30.91  ? 764  LYS A N   1 
ATOM   5881 C CA  . LYS A 1 764 ? -17.918 131.197 41.969  1.00 34.75  ? 764  LYS A CA  1 
ATOM   5882 C C   . LYS A 1 764 ? -17.017 131.099 40.738  1.00 40.94  ? 764  LYS A C   1 
ATOM   5883 O O   . LYS A 1 764 ? -17.187 130.212 39.895  1.00 48.94  ? 764  LYS A O   1 
ATOM   5884 C CB  . LYS A 1 764 ? -19.345 131.543 41.547  1.00 30.53  ? 764  LYS A CB  1 
ATOM   5885 C CG  . LYS A 1 764 ? -20.248 131.926 42.695  1.00 31.54  ? 764  LYS A CG  1 
ATOM   5886 C CD  . LYS A 1 764 ? -21.579 131.205 42.605  1.00 36.21  ? 764  LYS A CD  1 
ATOM   5887 C CE  . LYS A 1 764 ? -22.551 131.723 43.656  1.00 34.50  ? 764  LYS A CE  1 
ATOM   5888 N NZ  . LYS A 1 764 ? -23.259 132.968 43.224  1.00 38.88  ? 764  LYS A NZ  1 
ATOM   5889 N N   . GLY A 1 765 ? -16.062 132.023 40.642  1.00 38.12  ? 765  GLY A N   1 
ATOM   5890 C CA  . GLY A 1 765 ? -15.133 132.026 39.527  1.00 33.85  ? 765  GLY A CA  1 
ATOM   5891 C C   . GLY A 1 765 ? -15.666 132.510 38.190  1.00 32.82  ? 765  GLY A C   1 
ATOM   5892 O O   . GLY A 1 765 ? -15.336 131.936 37.160  1.00 37.56  ? 765  GLY A O   1 
ATOM   5893 N N   . PHE A 1 766 ? -16.492 133.550 38.191  1.00 31.80  ? 766  PHE A N   1 
ATOM   5894 C CA  . PHE A 1 766 ? -17.019 134.091 36.940  1.00 28.24  ? 766  PHE A CA  1 
ATOM   5895 C C   . PHE A 1 766 ? -16.319 135.407 36.608  1.00 27.07  ? 766  PHE A C   1 
ATOM   5896 O O   . PHE A 1 766 ? -16.564 135.981 35.549  1.00 28.64  ? 766  PHE A O   1 
ATOM   5897 C CB  . PHE A 1 766 ? -18.523 134.384 37.031  1.00 31.25  ? 766  PHE A CB  1 
ATOM   5898 C CG  . PHE A 1 766 ? -19.347 133.271 37.620  1.00 32.76  ? 766  PHE A CG  1 
ATOM   5899 C CD1 . PHE A 1 766 ? -18.865 131.971 37.690  1.00 33.15  ? 766  PHE A CD1 1 
ATOM   5900 C CD2 . PHE A 1 766 ? -20.634 133.531 38.089  1.00 36.06  ? 766  PHE A CD2 1 
ATOM   5901 C CE1 . PHE A 1 766 ? -19.659 130.951 38.218  1.00 37.88  ? 766  PHE A CE1 1 
ATOM   5902 C CE2 . PHE A 1 766 ? -21.431 132.520 38.617  1.00 30.46  ? 766  PHE A CE2 1 
ATOM   5903 C CZ  . PHE A 1 766 ? -20.946 131.233 38.681  1.00 33.79  ? 766  PHE A CZ  1 
ATOM   5904 N N   . LEU A 1 767 ? -15.460 135.880 37.513  1.00 24.74  ? 767  LEU A N   1 
ATOM   5905 C CA  . LEU A 1 767 ? -14.756 137.152 37.336  1.00 22.05  ? 767  LEU A CA  1 
ATOM   5906 C C   . LEU A 1 767 ? -13.329 137.127 37.854  1.00 23.24  ? 767  LEU A C   1 
ATOM   5907 O O   . LEU A 1 767 ? -12.995 136.331 38.724  1.00 27.60  ? 767  LEU A O   1 
ATOM   5908 C CB  . LEU A 1 767 ? -15.496 138.263 38.077  1.00 25.95  ? 767  LEU A CB  1 
ATOM   5909 C CG  . LEU A 1 767 ? -16.587 139.031 37.352  1.00 26.55  ? 767  LEU A CG  1 
ATOM   5910 C CD1 . LEU A 1 767 ? -17.752 139.272 38.297  1.00 36.64  ? 767  LEU A CD1 1 
ATOM   5911 C CD2 . LEU A 1 767 ? -16.022 140.343 36.868  1.00 33.40  ? 767  LEU A CD2 1 
ATOM   5912 N N   . PHE A 1 768 ? -12.500 138.023 37.326  1.00 27.43  ? 768  PHE A N   1 
ATOM   5913 C CA  . PHE A 1 768 ? -11.099 138.148 37.731  1.00 31.44  ? 768  PHE A CA  1 
ATOM   5914 C C   . PHE A 1 768 ? -10.380 136.830 38.009  1.00 36.58  ? 768  PHE A C   1 
ATOM   5915 O O   . PHE A 1 768 ? -9.549  136.750 38.919  1.00 37.19  ? 768  PHE A O   1 
ATOM   5916 C CB  . PHE A 1 768 ? -10.996 139.043 38.965  1.00 32.58  ? 768  PHE A CB  1 
ATOM   5917 C CG  . PHE A 1 768 ? -11.942 140.208 38.946  1.00 37.49  ? 768  PHE A CG  1 
ATOM   5918 C CD1 . PHE A 1 768 ? -11.750 141.261 38.055  1.00 33.39  ? 768  PHE A CD1 1 
ATOM   5919 C CD2 . PHE A 1 768 ? -13.025 140.256 39.823  1.00 37.21  ? 768  PHE A CD2 1 
ATOM   5920 C CE1 . PHE A 1 768 ? -12.621 142.346 38.037  1.00 35.34  ? 768  PHE A CE1 1 
ATOM   5921 C CE2 . PHE A 1 768 ? -13.905 141.339 39.814  1.00 37.81  ? 768  PHE A CE2 1 
ATOM   5922 C CZ  . PHE A 1 768 ? -13.703 142.386 38.921  1.00 38.70  ? 768  PHE A CZ  1 
ATOM   5923 N N   . ARG A 1 769 ? -10.699 135.806 37.219  1.00 41.21  ? 769  ARG A N   1 
ATOM   5924 C CA  . ARG A 1 769 ? -10.090 134.486 37.361  1.00 46.67  ? 769  ARG A CA  1 
ATOM   5925 C C   . ARG A 1 769 ? -10.325 133.877 38.746  1.00 47.81  ? 769  ARG A C   1 
ATOM   5926 O O   . ARG A 1 769 ? -9.489  133.132 39.256  1.00 49.38  ? 769  ARG A O   1 
ATOM   5927 C CB  . ARG A 1 769 ? -8.587  134.571 37.077  1.00 54.53  ? 769  ARG A CB  1 
ATOM   5928 C CG  . ARG A 1 769 ? -8.220  134.461 35.597  1.00 66.56  ? 769  ARG A CG  1 
ATOM   5929 C CD  . ARG A 1 769 ? -8.775  135.631 34.784  1.00 74.13  ? 769  ARG A CD  1 
ATOM   5930 N NE  . ARG A 1 769 ? -8.341  136.923 35.315  1.00 82.08  ? 769  ARG A NE  1 
ATOM   5931 C CZ  . ARG A 1 769 ? -9.037  138.053 35.213  1.00 80.78  ? 769  ARG A CZ  1 
ATOM   5932 N NH1 . ARG A 1 769 ? -10.213 138.063 34.594  1.00 79.46  ? 769  ARG A NH1 1 
ATOM   5933 N NH2 . ARG A 1 769 ? -8.556  139.174 35.735  1.00 75.57  ? 769  ARG A NH2 1 
ATOM   5934 N N   . GLY A 1 770 ? -11.465 134.199 39.346  1.00 45.54  ? 770  GLY A N   1 
ATOM   5935 C CA  . GLY A 1 770 ? -11.789 133.676 40.657  1.00 46.11  ? 770  GLY A CA  1 
ATOM   5936 C C   . GLY A 1 770 ? -10.924 134.252 41.761  1.00 50.82  ? 770  GLY A C   1 
ATOM   5937 O O   . GLY A 1 770 ? -11.092 133.908 42.930  1.00 55.68  ? 770  GLY A O   1 
ATOM   5938 N N   . GLN A 1 771 ? -10.000 135.136 41.401  1.00 50.64  ? 771  GLN A N   1 
ATOM   5939 C CA  . GLN A 1 771 ? -9.111  135.733 42.387  1.00 54.47  ? 771  GLN A CA  1 
ATOM   5940 C C   . GLN A 1 771 ? -9.688  136.994 43.019  1.00 52.21  ? 771  GLN A C   1 
ATOM   5941 O O   . GLN A 1 771 ? -9.909  137.995 42.336  1.00 52.07  ? 771  GLN A O   1 
ATOM   5942 C CB  . GLN A 1 771 ? -7.763  136.047 41.744  1.00 64.24  ? 771  GLN A CB  1 
ATOM   5943 C CG  . GLN A 1 771 ? -7.061  134.822 41.184  1.00 78.09  ? 771  GLN A CG  1 
ATOM   5944 C CD  . GLN A 1 771 ? -5.651  135.122 40.714  1.00 88.75  ? 771  GLN A CD  1 
ATOM   5945 O OE1 . GLN A 1 771 ? -5.097  136.184 41.007  1.00 95.36  ? 771  GLN A OE1 1 
ATOM   5946 N NE2 . GLN A 1 771 ? -5.061  134.184 39.978  1.00 94.19  ? 771  GLN A NE2 1 
ATOM   5947 N N   . ILE A 1 772 ? -9.927  136.930 44.327  1.00 50.27  ? 772  ILE A N   1 
ATOM   5948 C CA  . ILE A 1 772 ? -10.478 138.054 45.081  1.00 45.57  ? 772  ILE A CA  1 
ATOM   5949 C C   . ILE A 1 772 ? -9.382  139.068 45.387  1.00 46.18  ? 772  ILE A C   1 
ATOM   5950 O O   . ILE A 1 772 ? -8.493  138.810 46.194  1.00 48.77  ? 772  ILE A O   1 
ATOM   5951 C CB  . ILE A 1 772 ? -11.093 137.593 46.420  1.00 41.22  ? 772  ILE A CB  1 
ATOM   5952 C CG1 . ILE A 1 772 ? -12.168 136.531 46.166  1.00 37.26  ? 772  ILE A CG1 1 
ATOM   5953 C CG2 . ILE A 1 772 ? -11.643 138.792 47.174  1.00 34.10  ? 772  ILE A CG2 1 
ATOM   5954 C CD1 . ILE A 1 772 ? -13.574 137.072 46.047  1.00 39.60  ? 772  ILE A CD1 1 
ATOM   5955 N N   . SER A 1 773 ? -9.464  140.225 44.744  1.00 48.65  ? 773  SER A N   1 
ATOM   5956 C CA  . SER A 1 773 ? -8.479  141.283 44.917  1.00 47.12  ? 773  SER A CA  1 
ATOM   5957 C C   . SER A 1 773 ? -8.594  141.980 46.268  1.00 48.28  ? 773  SER A C   1 
ATOM   5958 O O   . SER A 1 773 ? -9.637  141.932 46.919  1.00 47.83  ? 773  SER A O   1 
ATOM   5959 C CB  . SER A 1 773 ? -8.641  142.307 43.790  1.00 45.55  ? 773  SER A CB  1 
ATOM   5960 O OG  . SER A 1 773 ? -7.585  143.250 43.798  1.00 55.80  ? 773  SER A OG  1 
ATOM   5961 N N   . GLU A 1 774 ? -7.509  142.623 46.688  1.00 53.01  ? 774  GLU A N   1 
ATOM   5962 C CA  . GLU A 1 774 ? -7.490  143.364 47.946  1.00 55.90  ? 774  GLU A CA  1 
ATOM   5963 C C   . GLU A 1 774 ? -8.327  144.621 47.751  1.00 50.97  ? 774  GLU A C   1 
ATOM   5964 O O   . GLU A 1 774 ? -8.961  145.117 48.680  1.00 52.28  ? 774  GLU A O   1 
ATOM   5965 C CB  . GLU A 1 774 ? -6.059  143.762 48.313  1.00 65.25  ? 774  GLU A CB  1 
ATOM   5966 C CG  . GLU A 1 774 ? -5.922  144.399 49.688  1.00 78.45  ? 774  GLU A CG  1 
ATOM   5967 C CD  . GLU A 1 774 ? -6.161  143.409 50.819  1.00 88.94  ? 774  GLU A CD  1 
ATOM   5968 O OE1 . GLU A 1 774 ? -6.231  142.189 50.549  1.00 92.62  ? 774  GLU A OE1 1 
ATOM   5969 O OE2 . GLU A 1 774 ? -6.280  143.852 51.981  1.00 95.41  ? 774  GLU A OE2 1 
ATOM   5970 N N   . THR A 1 775 ? -8.310  145.124 46.523  1.00 46.89  ? 775  THR A N   1 
ATOM   5971 C CA  . THR A 1 775 ? -9.065  146.308 46.144  1.00 40.55  ? 775  THR A CA  1 
ATOM   5972 C C   . THR A 1 775 ? -10.548 145.964 46.150  1.00 36.10  ? 775  THR A C   1 
ATOM   5973 O O   . THR A 1 775 ? -11.397 146.811 46.411  1.00 38.90  ? 775  THR A O   1 
ATOM   5974 C CB  . THR A 1 775 ? -8.676  146.759 44.731  1.00 41.77  ? 775  THR A CB  1 
ATOM   5975 O OG1 . THR A 1 775 ? -7.248  146.818 44.630  1.00 48.26  ? 775  THR A OG1 1 
ATOM   5976 C CG2 . THR A 1 775 ? -9.266  148.121 44.423  1.00 45.45  ? 775  THR A CG2 1 
ATOM   5977 N N   . LEU A 1 776 ? -10.846 144.706 45.854  1.00 29.87  ? 776  LEU A N   1 
ATOM   5978 C CA  . LEU A 1 776 ? -12.216 144.231 45.818  1.00 26.95  ? 776  LEU A CA  1 
ATOM   5979 C C   . LEU A 1 776 ? -12.738 144.090 47.234  1.00 29.29  ? 776  LEU A C   1 
ATOM   5980 O O   . LEU A 1 776 ? -13.948 144.061 47.465  1.00 28.85  ? 776  LEU A O   1 
ATOM   5981 C CB  . LEU A 1 776 ? -12.269 142.880 45.113  1.00 21.19  ? 776  LEU A CB  1 
ATOM   5982 C CG  . LEU A 1 776 ? -13.650 142.438 44.647  1.00 21.47  ? 776  LEU A CG  1 
ATOM   5983 C CD1 . LEU A 1 776 ? -14.265 143.508 43.762  1.00 14.14  ? 776  LEU A CD1 1 
ATOM   5984 C CD2 . LEU A 1 776 ? -13.523 141.120 43.900  1.00 27.32  ? 776  LEU A CD2 1 
ATOM   5985 N N   . LYS A 1 777 ? -11.804 144.007 48.177  1.00 34.24  ? 777  LYS A N   1 
ATOM   5986 C CA  . LYS A 1 777 ? -12.117 143.851 49.592  1.00 34.12  ? 777  LYS A CA  1 
ATOM   5987 C C   . LYS A 1 777 ? -12.292 145.193 50.285  1.00 33.56  ? 777  LYS A C   1 
ATOM   5988 O O   . LYS A 1 777 ? -12.796 145.262 51.401  1.00 36.83  ? 777  LYS A O   1 
ATOM   5989 C CB  . LYS A 1 777 ? -11.005 143.057 50.283  1.00 38.60  ? 777  LYS A CB  1 
ATOM   5990 C CG  . LYS A 1 777 ? -10.923 141.595 49.857  1.00 42.01  ? 777  LYS A CG  1 
ATOM   5991 C CD  . LYS A 1 777 ? -10.414 140.713 50.983  1.00 50.60  ? 777  LYS A CD  1 
ATOM   5992 C CE  . LYS A 1 777 ? -8.937  140.975 51.270  1.00 58.87  ? 777  LYS A CE  1 
ATOM   5993 N NZ  . LYS A 1 777 ? -8.410  140.149 52.399  1.00 61.04  ? 777  LYS A NZ  1 
ATOM   5994 N N   . THR A 1 778 ? -11.871 146.259 49.615  1.00 34.47  ? 778  THR A N   1 
ATOM   5995 C CA  . THR A 1 778 ? -11.977 147.610 50.157  1.00 35.25  ? 778  THR A CA  1 
ATOM   5996 C C   . THR A 1 778 ? -13.385 148.145 49.984  1.00 32.92  ? 778  THR A C   1 
ATOM   5997 O O   . THR A 1 778 ? -13.936 148.099 48.896  1.00 36.82  ? 778  THR A O   1 
ATOM   5998 C CB  . THR A 1 778 ? -11.025 148.564 49.431  1.00 36.11  ? 778  THR A CB  1 
ATOM   5999 O OG1 . THR A 1 778 ? -9.670  148.197 49.721  1.00 43.77  ? 778  THR A OG1 1 
ATOM   6000 C CG2 . THR A 1 778 ? -11.279 150.000 49.865  1.00 32.87  ? 778  THR A CG2 1 
ATOM   6001 N N   . ARG A 1 779 ? -13.966 148.668 51.053  1.00 38.87  ? 779  ARG A N   1 
ATOM   6002 C CA  . ARG A 1 779 ? -15.318 149.198 50.973  1.00 43.30  ? 779  ARG A CA  1 
ATOM   6003 C C   . ARG A 1 779 ? -15.333 150.625 50.447  1.00 38.81  ? 779  ARG A C   1 
ATOM   6004 O O   . ARG A 1 779 ? -14.415 151.403 50.705  1.00 38.98  ? 779  ARG A O   1 
ATOM   6005 C CB  . ARG A 1 779 ? -15.993 149.151 52.343  1.00 52.69  ? 779  ARG A CB  1 
ATOM   6006 C CG  . ARG A 1 779 ? -15.046 149.331 53.517  1.00 68.36  ? 779  ARG A CG  1 
ATOM   6007 C CD  . ARG A 1 779 ? -15.744 149.003 54.827  1.00 77.96  ? 779  ARG A CD  1 
ATOM   6008 N NE  . ARG A 1 779 ? -17.192 148.937 54.657  1.00 82.96  ? 779  ARG A NE  1 
ATOM   6009 C CZ  . ARG A 1 779 ? -18.063 148.915 55.657  1.00 84.64  ? 779  ARG A CZ  1 
ATOM   6010 N NH1 . ARG A 1 779 ? -17.635 148.956 56.913  1.00 86.89  ? 779  ARG A NH1 1 
ATOM   6011 N NH2 . ARG A 1 779 ? -19.364 148.857 55.398  1.00 87.77  ? 779  ARG A NH2 1 
ATOM   6012 N N   . GLY A 1 780 ? -16.387 150.954 49.708  1.00 34.06  ? 780  GLY A N   1 
ATOM   6013 C CA  . GLY A 1 780 ? -16.522 152.281 49.144  1.00 30.59  ? 780  GLY A CA  1 
ATOM   6014 C C   . GLY A 1 780 ? -15.605 152.510 47.960  1.00 31.01  ? 780  GLY A C   1 
ATOM   6015 O O   . GLY A 1 780 ? -15.308 153.648 47.603  1.00 39.54  ? 780  GLY A O   1 
ATOM   6016 N N   . ILE A 1 781 ? -15.150 151.430 47.340  1.00 30.74  ? 781  ILE A N   1 
ATOM   6017 C CA  . ILE A 1 781 ? -14.257 151.554 46.201  1.00 25.80  ? 781  ILE A CA  1 
ATOM   6018 C C   . ILE A 1 781 ? -15.020 152.034 44.968  1.00 26.51  ? 781  ILE A C   1 
ATOM   6019 O O   . ILE A 1 781 ? -14.459 152.697 44.102  1.00 32.13  ? 781  ILE A O   1 
ATOM   6020 C CB  . ILE A 1 781 ? -13.545 150.204 45.914  1.00 24.36  ? 781  ILE A CB  1 
ATOM   6021 C CG1 . ILE A 1 781 ? -12.307 150.452 45.064  1.00 31.82  ? 781  ILE A CG1 1 
ATOM   6022 C CG2 . ILE A 1 781 ? -14.477 149.231 45.217  1.00 23.14  ? 781  ILE A CG2 1 
ATOM   6023 C CD1 . ILE A 1 781 ? -11.093 150.796 45.880  1.00 40.92  ? 781  ILE A CD1 1 
ATOM   6024 N N   . PHE A 1 782 ? -16.311 151.719 44.914  1.00 25.29  ? 782  PHE A N   1 
ATOM   6025 C CA  . PHE A 1 782 ? -17.160 152.101 43.791  1.00 22.47  ? 782  PHE A CA  1 
ATOM   6026 C C   . PHE A 1 782 ? -17.987 153.359 44.078  1.00 21.74  ? 782  PHE A C   1 
ATOM   6027 O O   . PHE A 1 782 ? -19.189 153.273 44.323  1.00 18.27  ? 782  PHE A O   1 
ATOM   6028 C CB  . PHE A 1 782 ? -18.107 150.946 43.439  1.00 24.51  ? 782  PHE A CB  1 
ATOM   6029 C CG  . PHE A 1 782 ? -17.413 149.724 42.898  1.00 24.00  ? 782  PHE A CG  1 
ATOM   6030 C CD1 . PHE A 1 782 ? -16.788 149.751 41.660  1.00 27.27  ? 782  PHE A CD1 1 
ATOM   6031 C CD2 . PHE A 1 782 ? -17.394 148.539 43.628  1.00 28.49  ? 782  PHE A CD2 1 
ATOM   6032 C CE1 . PHE A 1 782 ? -16.153 148.611 41.154  1.00 31.13  ? 782  PHE A CE1 1 
ATOM   6033 C CE2 . PHE A 1 782 ? -16.763 147.396 43.132  1.00 27.32  ? 782  PHE A CE2 1 
ATOM   6034 C CZ  . PHE A 1 782 ? -16.142 147.432 41.893  1.00 27.38  ? 782  PHE A CZ  1 
ATOM   6035 N N   . GLU A 1 783 ? -17.353 154.526 44.039  1.00 24.57  ? 783  GLU A N   1 
ATOM   6036 C CA  . GLU A 1 783 ? -18.066 155.775 44.300  1.00 29.78  ? 783  GLU A CA  1 
ATOM   6037 C C   . GLU A 1 783 ? -19.089 156.080 43.210  1.00 28.98  ? 783  GLU A C   1 
ATOM   6038 O O   . GLU A 1 783 ? -19.009 155.538 42.111  1.00 31.51  ? 783  GLU A O   1 
ATOM   6039 C CB  . GLU A 1 783 ? -17.079 156.936 44.410  1.00 30.72  ? 783  GLU A CB  1 
ATOM   6040 C CG  . GLU A 1 783 ? -15.817 156.581 45.152  1.00 49.60  ? 783  GLU A CG  1 
ATOM   6041 C CD  . GLU A 1 783 ? -14.676 157.525 44.839  1.00 61.49  ? 783  GLU A CD  1 
ATOM   6042 O OE1 . GLU A 1 783 ? -14.950 158.632 44.327  1.00 66.10  ? 783  GLU A OE1 1 
ATOM   6043 O OE2 . GLU A 1 783 ? -13.508 157.159 45.104  1.00 69.37  ? 783  GLU A OE2 1 
ATOM   6044 N N   . THR A 1 784 ? -20.044 156.953 43.524  1.00 28.96  ? 784  THR A N   1 
ATOM   6045 C CA  . THR A 1 784 ? -21.099 157.351 42.590  1.00 29.70  ? 784  THR A CA  1 
ATOM   6046 C C   . THR A 1 784 ? -20.531 157.858 41.269  1.00 30.41  ? 784  THR A C   1 
ATOM   6047 O O   . THR A 1 784 ? -21.105 157.631 40.209  1.00 28.51  ? 784  THR A O   1 
ATOM   6048 C CB  . THR A 1 784 ? -21.978 158.476 43.182  1.00 29.74  ? 784  THR A CB  1 
ATOM   6049 O OG1 . THR A 1 784 ? -22.521 158.058 44.441  1.00 30.02  ? 784  THR A OG1 1 
ATOM   6050 C CG2 . THR A 1 784 ? -23.111 158.824 42.229  1.00 31.88  ? 784  THR A CG2 1 
ATOM   6051 N N   . LYS A 1 785 ? -19.406 158.562 41.349  1.00 35.76  ? 785  LYS A N   1 
ATOM   6052 C CA  . LYS A 1 785 ? -18.749 159.110 40.171  1.00 37.72  ? 785  LYS A CA  1 
ATOM   6053 C C   . LYS A 1 785 ? -18.359 157.983 39.223  1.00 37.10  ? 785  LYS A C   1 
ATOM   6054 O O   . LYS A 1 785 ? -18.687 158.015 38.042  1.00 38.58  ? 785  LYS A O   1 
ATOM   6055 C CB  . LYS A 1 785 ? -17.504 159.897 40.587  1.00 47.16  ? 785  LYS A CB  1 
ATOM   6056 C CG  . LYS A 1 785 ? -16.592 160.285 39.434  1.00 61.56  ? 785  LYS A CG  1 
ATOM   6057 C CD  . LYS A 1 785 ? -16.945 161.668 38.887  1.00 71.55  ? 785  LYS A CD  1 
ATOM   6058 C CE  . LYS A 1 785 ? -17.776 161.577 37.610  1.00 72.94  ? 785  LYS A CE  1 
ATOM   6059 N NZ  . LYS A 1 785 ? -17.089 162.208 36.448  1.00 72.12  ? 785  LYS A NZ  1 
ATOM   6060 N N   . PHE A 1 786 ? -17.662 156.982 39.749  1.00 38.63  ? 786  PHE A N   1 
ATOM   6061 C CA  . PHE A 1 786 ? -17.235 155.847 38.943  1.00 36.12  ? 786  PHE A CA  1 
ATOM   6062 C C   . PHE A 1 786 ? -18.390 154.936 38.563  1.00 29.59  ? 786  PHE A C   1 
ATOM   6063 O O   . PHE A 1 786 ? -18.309 154.199 37.594  1.00 28.35  ? 786  PHE A O   1 
ATOM   6064 C CB  . PHE A 1 786 ? -16.160 155.059 39.683  1.00 41.35  ? 786  PHE A CB  1 
ATOM   6065 C CG  . PHE A 1 786 ? -14.820 155.726 39.660  1.00 52.49  ? 786  PHE A CG  1 
ATOM   6066 C CD1 . PHE A 1 786 ? -14.140 155.903 38.458  1.00 57.22  ? 786  PHE A CD1 1 
ATOM   6067 C CD2 . PHE A 1 786 ? -14.248 156.206 40.830  1.00 60.04  ? 786  PHE A CD2 1 
ATOM   6068 C CE1 . PHE A 1 786 ? -12.911 156.551 38.417  1.00 59.50  ? 786  PHE A CE1 1 
ATOM   6069 C CE2 . PHE A 1 786 ? -13.016 156.858 40.803  1.00 65.04  ? 786  PHE A CE2 1 
ATOM   6070 C CZ  . PHE A 1 786 ? -12.346 157.030 39.591  1.00 65.34  ? 786  PHE A CZ  1 
ATOM   6071 N N   . LEU A 1 787 ? -19.466 154.990 39.333  1.00 30.21  ? 787  LEU A N   1 
ATOM   6072 C CA  . LEU A 1 787 ? -20.642 154.185 39.048  1.00 29.85  ? 787  LEU A CA  1 
ATOM   6073 C C   . LEU A 1 787 ? -21.353 154.813 37.863  1.00 32.22  ? 787  LEU A C   1 
ATOM   6074 O O   . LEU A 1 787 ? -21.904 154.117 37.016  1.00 37.22  ? 787  LEU A O   1 
ATOM   6075 C CB  . LEU A 1 787 ? -21.582 154.178 40.248  1.00 27.72  ? 787  LEU A CB  1 
ATOM   6076 C CG  . LEU A 1 787 ? -22.510 152.973 40.379  1.00 29.30  ? 787  LEU A CG  1 
ATOM   6077 C CD1 . LEU A 1 787 ? -21.681 151.712 40.634  1.00 20.80  ? 787  LEU A CD1 1 
ATOM   6078 C CD2 . LEU A 1 787 ? -23.499 153.222 41.510  1.00 30.05  ? 787  LEU A CD2 1 
ATOM   6079 N N   . SER A 1 788 ? -21.329 156.141 37.816  1.00 33.20  ? 788  SER A N   1 
ATOM   6080 C CA  . SER A 1 788 ? -21.973 156.890 36.750  1.00 30.91  ? 788  SER A CA  1 
ATOM   6081 C C   . SER A 1 788 ? -21.220 156.765 35.431  1.00 31.48  ? 788  SER A C   1 
ATOM   6082 O O   . SER A 1 788 ? -21.815 156.882 34.361  1.00 35.70  ? 788  SER A O   1 
ATOM   6083 C CB  . SER A 1 788 ? -22.086 158.362 37.146  1.00 29.86  ? 788  SER A CB  1 
ATOM   6084 O OG  . SER A 1 788 ? -22.979 158.526 38.235  1.00 31.26  ? 788  SER A OG  1 
ATOM   6085 N N   . GLN A 1 789 ? -19.914 156.524 35.508  1.00 30.04  ? 789  GLN A N   1 
ATOM   6086 C CA  . GLN A 1 789 ? -19.083 156.384 34.313  1.00 29.09  ? 789  GLN A CA  1 
ATOM   6087 C C   . GLN A 1 789 ? -19.275 155.031 33.635  1.00 31.59  ? 789  GLN A C   1 
ATOM   6088 O O   . GLN A 1 789 ? -19.683 154.969 32.476  1.00 31.36  ? 789  GLN A O   1 
ATOM   6089 C CB  . GLN A 1 789 ? -17.610 156.551 34.672  1.00 30.34  ? 789  GLN A CB  1 
ATOM   6090 C CG  . GLN A 1 789 ? -17.280 157.875 35.300  1.00 35.03  ? 789  GLN A CG  1 
ATOM   6091 C CD  . GLN A 1 789 ? -15.954 158.399 34.831  1.00 42.80  ? 789  GLN A CD  1 
ATOM   6092 O OE1 . GLN A 1 789 ? -14.938 158.261 35.515  1.00 48.38  ? 789  GLN A OE1 1 
ATOM   6093 N NE2 . GLN A 1 789 ? -15.948 159.001 33.650  1.00 48.39  ? 789  GLN A NE2 1 
ATOM   6094 N N   . ILE A 1 790 ? -18.970 153.957 34.365  1.00 32.56  ? 790  ILE A N   1 
ATOM   6095 C CA  . ILE A 1 790 ? -19.095 152.589 33.862  1.00 29.43  ? 790  ILE A CA  1 
ATOM   6096 C C   . ILE A 1 790 ? -20.387 152.352 33.083  1.00 31.54  ? 790  ILE A C   1 
ATOM   6097 O O   . ILE A 1 790 ? -20.399 151.590 32.121  1.00 36.71  ? 790  ILE A O   1 
ATOM   6098 C CB  . ILE A 1 790 ? -19.030 151.560 35.015  1.00 26.86  ? 790  ILE A CB  1 
ATOM   6099 C CG1 . ILE A 1 790 ? -17.689 151.673 35.737  1.00 29.71  ? 790  ILE A CG1 1 
ATOM   6100 C CG2 . ILE A 1 790 ? -19.185 150.153 34.474  1.00 26.14  ? 790  ILE A CG2 1 
ATOM   6101 C CD1 . ILE A 1 790 ? -17.569 150.776 36.964  1.00 35.10  ? 790  ILE A CD1 1 
ATOM   6102 N N   . GLU A 1 791 ? -21.469 153.007 33.496  1.00 26.23  ? 791  GLU A N   1 
ATOM   6103 C CA  . GLU A 1 791 ? -22.760 152.858 32.832  1.00 28.52  ? 791  GLU A CA  1 
ATOM   6104 C C   . GLU A 1 791 ? -22.985 153.889 31.718  1.00 32.55  ? 791  GLU A C   1 
ATOM   6105 O O   . GLU A 1 791 ? -24.058 153.937 31.111  1.00 34.14  ? 791  GLU A O   1 
ATOM   6106 C CB  . GLU A 1 791 ? -23.884 152.999 33.858  1.00 29.16  ? 791  GLU A CB  1 
ATOM   6107 C CG  . GLU A 1 791 ? -24.153 151.773 34.693  1.00 27.73  ? 791  GLU A CG  1 
ATOM   6108 C CD  . GLU A 1 791 ? -25.468 151.882 35.428  1.00 29.92  ? 791  GLU A CD  1 
ATOM   6109 O OE1 . GLU A 1 791 ? -26.511 152.014 34.757  1.00 30.42  ? 791  GLU A OE1 1 
ATOM   6110 O OE2 . GLU A 1 791 ? -25.462 151.845 36.674  1.00 34.44  ? 791  GLU A OE2 1 
ATOM   6111 N N   . SER A 1 792 ? -21.978 154.712 31.454  1.00 33.16  ? 792  SER A N   1 
ATOM   6112 C CA  . SER A 1 792 ? -22.086 155.751 30.441  1.00 34.59  ? 792  SER A CA  1 
ATOM   6113 C C   . SER A 1 792 ? -22.266 155.222 29.027  1.00 38.89  ? 792  SER A C   1 
ATOM   6114 O O   . SER A 1 792 ? -21.586 154.279 28.616  1.00 36.92  ? 792  SER A O   1 
ATOM   6115 C CB  . SER A 1 792 ? -20.851 156.646 30.484  1.00 34.38  ? 792  SER A CB  1 
ATOM   6116 O OG  . SER A 1 792 ? -20.989 157.730 29.587  1.00 39.10  ? 792  SER A OG  1 
ATOM   6117 N N   . ASP A 1 793 ? -23.182 155.851 28.289  1.00 46.05  ? 793  ASP A N   1 
ATOM   6118 C CA  . ASP A 1 793 ? -23.471 155.486 26.900  1.00 50.05  ? 793  ASP A CA  1 
ATOM   6119 C C   . ASP A 1 793 ? -22.311 155.882 25.995  1.00 49.33  ? 793  ASP A C   1 
ATOM   6120 O O   . ASP A 1 793 ? -22.049 155.227 24.991  1.00 53.55  ? 793  ASP A O   1 
ATOM   6121 C CB  . ASP A 1 793 ? -24.721 156.211 26.389  1.00 59.50  ? 793  ASP A CB  1 
ATOM   6122 C CG  . ASP A 1 793 ? -25.975 155.842 27.156  1.00 69.70  ? 793  ASP A CG  1 
ATOM   6123 O OD1 . ASP A 1 793 ? -26.502 154.726 26.941  1.00 71.46  ? 793  ASP A OD1 1 
ATOM   6124 O OD2 . ASP A 1 793 ? -26.438 156.677 27.968  1.00 73.24  ? 793  ASP A OD2 1 
ATOM   6125 N N   . ARG A 1 794 ? -21.628 156.962 26.355  1.00 47.12  ? 794  ARG A N   1 
ATOM   6126 C CA  . ARG A 1 794 ? -20.515 157.466 25.568  1.00 51.19  ? 794  ARG A CA  1 
ATOM   6127 C C   . ARG A 1 794 ? -19.183 156.794 25.865  1.00 50.40  ? 794  ARG A C   1 
ATOM   6128 O O   . ARG A 1 794 ? -18.140 157.258 25.409  1.00 55.21  ? 794  ARG A O   1 
ATOM   6129 C CB  . ARG A 1 794 ? -20.374 158.974 25.781  1.00 61.42  ? 794  ARG A CB  1 
ATOM   6130 C CG  . ARG A 1 794 ? -21.696 159.720 25.837  1.00 78.16  ? 794  ARG A CG  1 
ATOM   6131 C CD  . ARG A 1 794 ? -22.411 159.703 24.490  1.00 88.44  ? 794  ARG A CD  1 
ATOM   6132 N NE  . ARG A 1 794 ? -23.422 160.755 24.402  1.00 96.42  ? 794  ARG A NE  1 
ATOM   6133 C CZ  . ARG A 1 794 ? -23.253 161.906 23.756  1.00 100.00 ? 794  ARG A CZ  1 
ATOM   6134 N NH1 . ARG A 1 794 ? -22.107 162.162 23.134  1.00 99.86  ? 794  ARG A NH1 1 
ATOM   6135 N NH2 . ARG A 1 794 ? -24.229 162.807 23.735  1.00 100.00 ? 794  ARG A NH2 1 
ATOM   6136 N N   . LEU A 1 795 ? -19.204 155.704 26.622  1.00 47.16  ? 795  LEU A N   1 
ATOM   6137 C CA  . LEU A 1 795 ? -17.962 155.012 26.950  1.00 43.06  ? 795  LEU A CA  1 
ATOM   6138 C C   . LEU A 1 795 ? -17.793 153.685 26.212  1.00 41.43  ? 795  LEU A C   1 
ATOM   6139 O O   . LEU A 1 795 ? -18.741 152.907 26.068  1.00 45.81  ? 795  LEU A O   1 
ATOM   6140 C CB  . LEU A 1 795 ? -17.871 154.779 28.461  1.00 42.47  ? 795  LEU A CB  1 
ATOM   6141 C CG  . LEU A 1 795 ? -17.086 155.823 29.256  1.00 34.76  ? 795  LEU A CG  1 
ATOM   6142 C CD1 . LEU A 1 795 ? -16.567 155.207 30.542  1.00 33.17  ? 795  LEU A CD1 1 
ATOM   6143 C CD2 . LEU A 1 795 ? -15.931 156.333 28.419  1.00 38.32  ? 795  LEU A CD2 1 
ATOM   6144 N N   . ALA A 1 796 ? -16.578 153.440 25.736  1.00 37.39  ? 796  ALA A N   1 
ATOM   6145 C CA  . ALA A 1 796 ? -16.263 152.210 25.025  1.00 33.83  ? 796  ALA A CA  1 
ATOM   6146 C C   . ALA A 1 796 ? -15.810 151.175 26.046  1.00 35.42  ? 796  ALA A C   1 
ATOM   6147 O O   . ALA A 1 796 ? -15.194 151.514 27.056  1.00 39.66  ? 796  ALA A O   1 
ATOM   6148 C CB  . ALA A 1 796 ? -15.163 152.461 24.016  1.00 29.95  ? 796  ALA A CB  1 
ATOM   6149 N N   . LEU A 1 797 ? -16.107 149.912 25.787  1.00 33.44  ? 797  LEU A N   1 
ATOM   6150 C CA  . LEU A 1 797 ? -15.725 148.863 26.715  1.00 32.62  ? 797  LEU A CA  1 
ATOM   6151 C C   . LEU A 1 797 ? -14.242 148.869 27.050  1.00 33.36  ? 797  LEU A C   1 
ATOM   6152 O O   . LEU A 1 797 ? -13.847 148.435 28.133  1.00 33.53  ? 797  LEU A O   1 
ATOM   6153 C CB  . LEU A 1 797 ? -16.106 147.498 26.153  1.00 37.74  ? 797  LEU A CB  1 
ATOM   6154 C CG  . LEU A 1 797 ? -17.305 146.866 26.848  1.00 39.06  ? 797  LEU A CG  1 
ATOM   6155 C CD1 . LEU A 1 797 ? -18.331 146.471 25.803  1.00 46.47  ? 797  LEU A CD1 1 
ATOM   6156 C CD2 . LEU A 1 797 ? -16.852 145.667 27.661  1.00 40.43  ? 797  LEU A CD2 1 
ATOM   6157 N N   . LEU A 1 798 ? -13.416 149.355 26.129  1.00 32.98  ? 798  LEU A N   1 
ATOM   6158 C CA  . LEU A 1 798 ? -11.977 149.380 26.367  1.00 34.30  ? 798  LEU A CA  1 
ATOM   6159 C C   . LEU A 1 798 ? -11.614 150.473 27.353  1.00 33.14  ? 798  LEU A C   1 
ATOM   6160 O O   . LEU A 1 798 ? -10.549 150.448 27.973  1.00 33.50  ? 798  LEU A O   1 
ATOM   6161 C CB  . LEU A 1 798 ? -11.231 149.579 25.053  1.00 37.18  ? 798  LEU A CB  1 
ATOM   6162 C CG  . LEU A 1 798 ? -11.295 148.337 24.165  1.00 43.31  ? 798  LEU A CG  1 
ATOM   6163 C CD1 . LEU A 1 798 ? -10.925 148.724 22.749  1.00 49.86  ? 798  LEU A CD1 1 
ATOM   6164 C CD2 . LEU A 1 798 ? -10.357 147.256 24.704  1.00 44.02  ? 798  LEU A CD2 1 
ATOM   6165 N N   . GLN A 1 799 ? -12.513 151.438 27.484  1.00 31.08  ? 799  GLN A N   1 
ATOM   6166 C CA  . GLN A 1 799 ? -12.323 152.534 28.413  1.00 27.90  ? 799  GLN A CA  1 
ATOM   6167 C C   . GLN A 1 799 ? -12.840 152.059 29.772  1.00 31.08  ? 799  GLN A C   1 
ATOM   6168 O O   . GLN A 1 799 ? -12.171 152.238 30.793  1.00 34.16  ? 799  GLN A O   1 
ATOM   6169 C CB  . GLN A 1 799 ? -13.093 153.765 27.928  1.00 31.68  ? 799  GLN A CB  1 
ATOM   6170 C CG  . GLN A 1 799 ? -12.682 154.225 26.530  1.00 32.19  ? 799  GLN A CG  1 
ATOM   6171 C CD  . GLN A 1 799 ? -13.358 155.516 26.107  1.00 30.56  ? 799  GLN A CD  1 
ATOM   6172 O OE1 . GLN A 1 799 ? -14.451 155.498 25.536  1.00 33.99  ? 799  GLN A OE1 1 
ATOM   6173 N NE2 . GLN A 1 799 ? -12.709 156.646 26.381  1.00 23.96  ? 799  GLN A NE2 1 
ATOM   6174 N N   . VAL A 1 800 ? -14.027 151.446 29.779  1.00 26.23  ? 800  VAL A N   1 
ATOM   6175 C CA  . VAL A 1 800 ? -14.610 150.907 31.010  1.00 21.38  ? 800  VAL A CA  1 
ATOM   6176 C C   . VAL A 1 800 ? -13.572 149.999 31.677  1.00 22.63  ? 800  VAL A C   1 
ATOM   6177 O O   . VAL A 1 800 ? -13.349 150.068 32.887  1.00 21.59  ? 800  VAL A O   1 
ATOM   6178 C CB  . VAL A 1 800 ? -15.875 150.073 30.718  1.00 15.50  ? 800  VAL A CB  1 
ATOM   6179 C CG1 . VAL A 1 800 ? -16.379 149.425 31.994  1.00 10.23  ? 800  VAL A CG1 1 
ATOM   6180 C CG2 . VAL A 1 800 ? -16.951 150.960 30.118  1.00 17.76  ? 800  VAL A CG2 1 
ATOM   6181 N N   . ARG A 1 801 ? -12.937 149.156 30.869  1.00 22.11  ? 801  ARG A N   1 
ATOM   6182 C CA  . ARG A 1 801 ? -11.914 148.245 31.352  1.00 19.34  ? 801  ARG A CA  1 
ATOM   6183 C C   . ARG A 1 801 ? -10.740 149.024 31.915  1.00 19.48  ? 801  ARG A C   1 
ATOM   6184 O O   . ARG A 1 801 ? -10.140 148.614 32.902  1.00 26.33  ? 801  ARG A O   1 
ATOM   6185 C CB  . ARG A 1 801 ? -11.425 147.350 30.221  1.00 21.96  ? 801  ARG A CB  1 
ATOM   6186 C CG  . ARG A 1 801 ? -10.560 146.201 30.683  1.00 26.61  ? 801  ARG A CG  1 
ATOM   6187 C CD  . ARG A 1 801 ? -9.118  146.439 30.329  1.00 29.80  ? 801  ARG A CD  1 
ATOM   6188 N NE  . ARG A 1 801 ? -8.689  145.625 29.197  1.00 43.22  ? 801  ARG A NE  1 
ATOM   6189 C CZ  . ARG A 1 801 ? -8.177  146.119 28.071  1.00 51.26  ? 801  ARG A CZ  1 
ATOM   6190 N NH1 . ARG A 1 801 ? -8.030  147.431 27.923  1.00 58.23  ? 801  ARG A NH1 1 
ATOM   6191 N NH2 . ARG A 1 801 ? -7.799  145.302 27.096  1.00 51.34  ? 801  ARG A NH2 1 
ATOM   6192 N N   . ALA A 1 802 ? -10.407 150.144 31.282  1.00 19.37  ? 802  ALA A N   1 
ATOM   6193 C CA  . ALA A 1 802 ? -9.297  150.975 31.741  1.00 20.67  ? 802  ALA A CA  1 
ATOM   6194 C C   . ALA A 1 802 ? -9.645  151.562 33.100  1.00 26.44  ? 802  ALA A C   1 
ATOM   6195 O O   . ALA A 1 802 ? -8.819  151.581 34.012  1.00 29.80  ? 802  ALA A O   1 
ATOM   6196 C CB  . ALA A 1 802 ? -9.028  152.091 30.747  1.00 17.19  ? 802  ALA A CB  1 
ATOM   6197 N N   . ILE A 1 803 ? -10.877 152.046 33.222  1.00 26.02  ? 803  ILE A N   1 
ATOM   6198 C CA  . ILE A 1 803 ? -11.355 152.620 34.469  1.00 28.80  ? 803  ILE A CA  1 
ATOM   6199 C C   . ILE A 1 803 ? -11.195 151.599 35.598  1.00 30.87  ? 803  ILE A C   1 
ATOM   6200 O O   . ILE A 1 803 ? -10.599 151.888 36.633  1.00 32.07  ? 803  ILE A O   1 
ATOM   6201 C CB  . ILE A 1 803 ? -12.839 153.019 34.353  1.00 30.09  ? 803  ILE A CB  1 
ATOM   6202 C CG1 . ILE A 1 803 ? -12.961 154.363 33.628  1.00 29.78  ? 803  ILE A CG1 1 
ATOM   6203 C CG2 . ILE A 1 803 ? -13.462 153.098 35.731  1.00 32.12  ? 803  ILE A CG2 1 
ATOM   6204 C CD1 . ILE A 1 803 ? -14.393 154.803 33.374  1.00 23.04  ? 803  ILE A CD1 1 
ATOM   6205 N N   . LEU A 1 804 ? -11.730 150.402 35.392  1.00 28.89  ? 804  LEU A N   1 
ATOM   6206 C CA  . LEU A 1 804 ? -11.633 149.353 36.396  1.00 26.44  ? 804  LEU A CA  1 
ATOM   6207 C C   . LEU A 1 804 ? -10.179 149.110 36.775  1.00 25.36  ? 804  LEU A C   1 
ATOM   6208 O O   . LEU A 1 804 ? -9.816  149.119 37.947  1.00 30.10  ? 804  LEU A O   1 
ATOM   6209 C CB  . LEU A 1 804 ? -12.236 148.049 35.866  1.00 20.54  ? 804  LEU A CB  1 
ATOM   6210 C CG  . LEU A 1 804 ? -13.758 147.905 35.831  1.00 17.20  ? 804  LEU A CG  1 
ATOM   6211 C CD1 . LEU A 1 804 ? -14.111 146.520 35.321  1.00 16.61  ? 804  LEU A CD1 1 
ATOM   6212 C CD2 . LEU A 1 804 ? -14.341 148.117 37.215  1.00 15.90  ? 804  LEU A CD2 1 
ATOM   6213 N N   . GLN A 1 805 ? -9.344  148.881 35.774  1.00 30.14  ? 805  GLN A N   1 
ATOM   6214 C CA  . GLN A 1 805 ? -7.938  148.621 36.034  1.00 37.23  ? 805  GLN A CA  1 
ATOM   6215 C C   . GLN A 1 805 ? -7.329  149.811 36.741  1.00 35.91  ? 805  GLN A C   1 
ATOM   6216 O O   . GLN A 1 805 ? -6.356  149.679 37.482  1.00 36.67  ? 805  GLN A O   1 
ATOM   6217 C CB  . GLN A 1 805 ? -7.196  148.355 34.725  1.00 39.94  ? 805  GLN A CB  1 
ATOM   6218 C CG  . GLN A 1 805 ? -7.678  147.119 33.988  1.00 47.97  ? 805  GLN A CG  1 
ATOM   6219 C CD  . GLN A 1 805 ? -6.574  146.453 33.205  1.00 50.29  ? 805  GLN A CD  1 
ATOM   6220 O OE1 . GLN A 1 805 ? -5.594  147.096 32.826  1.00 52.54  ? 805  GLN A OE1 1 
ATOM   6221 N NE2 . GLN A 1 805 ? -6.722  145.157 32.957  1.00 52.48  ? 805  GLN A NE2 1 
ATOM   6222 N N   . GLN A 1 806 ? -7.909  150.981 36.511  1.00 38.68  ? 806  GLN A N   1 
ATOM   6223 C CA  . GLN A 1 806 ? -7.410  152.192 37.140  1.00 44.18  ? 806  GLN A CA  1 
ATOM   6224 C C   . GLN A 1 806 ? -7.780  152.216 38.622  1.00 41.71  ? 806  GLN A C   1 
ATOM   6225 O O   . GLN A 1 806 ? -7.092  152.834 39.432  1.00 42.60  ? 806  GLN A O   1 
ATOM   6226 C CB  . GLN A 1 806 ? -7.954  153.430 36.415  1.00 49.17  ? 806  GLN A CB  1 
ATOM   6227 C CG  . GLN A 1 806 ? -6.985  153.993 35.372  1.00 54.43  ? 806  GLN A CG  1 
ATOM   6228 C CD  . GLN A 1 806 ? -7.624  155.016 34.454  1.00 60.09  ? 806  GLN A CD  1 
ATOM   6229 O OE1 . GLN A 1 806 ? -8.508  155.775 34.861  1.00 63.25  ? 806  GLN A OE1 1 
ATOM   6230 N NE2 . GLN A 1 806 ? -7.176  155.045 33.203  1.00 64.93  ? 806  GLN A NE2 1 
ATOM   6231 N N   . LEU A 1 807 ? -8.863  151.531 38.971  1.00 38.20  ? 807  LEU A N   1 
ATOM   6232 C CA  . LEU A 1 807 ? -9.298  151.456 40.356  1.00 33.41  ? 807  LEU A CA  1 
ATOM   6233 C C   . LEU A 1 807 ? -8.329  150.542 41.077  1.00 36.58  ? 807  LEU A C   1 
ATOM   6234 O O   . LEU A 1 807 ? -7.993  150.763 42.240  1.00 43.06  ? 807  LEU A O   1 
ATOM   6235 C CB  . LEU A 1 807 ? -10.699 150.863 40.448  1.00 31.03  ? 807  LEU A CB  1 
ATOM   6236 C CG  . LEU A 1 807 ? -11.867 151.837 40.345  1.00 33.35  ? 807  LEU A CG  1 
ATOM   6237 C CD1 . LEU A 1 807 ? -13.129 151.142 40.814  1.00 36.57  ? 807  LEU A CD1 1 
ATOM   6238 C CD2 . LEU A 1 807 ? -11.589 153.076 41.179  1.00 31.28  ? 807  LEU A CD2 1 
ATOM   6239 N N   . GLY A 1 808 ? -7.878  149.515 40.366  1.00 37.95  ? 808  GLY A N   1 
ATOM   6240 C CA  . GLY A 1 808 ? -6.951  148.558 40.938  1.00 36.27  ? 808  GLY A CA  1 
ATOM   6241 C C   . GLY A 1 808 ? -7.439  147.150 40.682  1.00 38.80  ? 808  GLY A C   1 
ATOM   6242 O O   . GLY A 1 808 ? -6.991  146.200 41.325  1.00 41.80  ? 808  GLY A O   1 
ATOM   6243 N N   . LEU A 1 809 ? -8.362  147.016 39.736  1.00 39.52  ? 809  LEU A N   1 
ATOM   6244 C CA  . LEU A 1 809 ? -8.922  145.716 39.395  1.00 44.38  ? 809  LEU A CA  1 
ATOM   6245 C C   . LEU A 1 809 ? -8.356  145.196 38.084  1.00 46.69  ? 809  LEU A C   1 
ATOM   6246 O O   . LEU A 1 809 ? -8.515  145.822 37.040  1.00 51.36  ? 809  LEU A O   1 
ATOM   6247 C CB  . LEU A 1 809 ? -10.448 145.809 39.295  1.00 38.81  ? 809  LEU A CB  1 
ATOM   6248 C CG  . LEU A 1 809 ? -11.127 146.593 40.420  1.00 37.37  ? 809  LEU A CG  1 
ATOM   6249 C CD1 . LEU A 1 809 ? -12.631 146.669 40.187  1.00 31.40  ? 809  LEU A CD1 1 
ATOM   6250 C CD2 . LEU A 1 809 ? -10.819 145.912 41.744  1.00 33.93  ? 809  LEU A CD2 1 
ATOM   6251 N N   . ASN A 1 810 ? -7.688  144.050 38.143  1.00 50.63  ? 810  ASN A N   1 
ATOM   6252 C CA  . ASN A 1 810 ? -7.114  143.443 36.947  1.00 52.42  ? 810  ASN A CA  1 
ATOM   6253 C C   . ASN A 1 810 ? -8.255  142.857 36.128  1.00 46.15  ? 810  ASN A C   1 
ATOM   6254 O O   . ASN A 1 810 ? -8.389  141.643 35.995  1.00 48.20  ? 810  ASN A O   1 
ATOM   6255 C CB  . ASN A 1 810 ? -6.126  142.336 37.331  1.00 61.64  ? 810  ASN A CB  1 
ATOM   6256 C CG  . ASN A 1 810 ? -4.870  142.349 36.477  1.00 71.03  ? 810  ASN A CG  1 
ATOM   6257 O OD1 . ASN A 1 810 ? -4.267  141.303 36.226  1.00 78.26  ? 810  ASN A OD1 1 
ATOM   6258 N ND2 . ASN A 1 810 ? -4.468  143.537 36.025  1.00 78.61  ? 810  ASN A ND2 1 
ATOM   6259 N N   . SER A 1 811 ? -9.083  143.732 35.580  1.00 38.83  ? 811  SER A N   1 
ATOM   6260 C CA  . SER A 1 811 ? -10.218 143.290 34.799  1.00 36.02  ? 811  SER A CA  1 
ATOM   6261 C C   . SER A 1 811 ? -9.846  143.116 33.342  1.00 34.59  ? 811  SER A C   1 
ATOM   6262 O O   . SER A 1 811 ? -8.873  143.699 32.862  1.00 36.33  ? 811  SER A O   1 
ATOM   6263 C CB  . SER A 1 811 ? -11.344 144.313 34.919  1.00 38.20  ? 811  SER A CB  1 
ATOM   6264 O OG  . SER A 1 811 ? -10.829 145.621 34.747  1.00 43.59  ? 811  SER A OG  1 
ATOM   6265 N N   . THR A 1 812 ? -10.625 142.297 32.644  1.00 31.49  ? 812  THR A N   1 
ATOM   6266 C CA  . THR A 1 812 ? -10.421 142.064 31.221  1.00 30.69  ? 812  THR A CA  1 
ATOM   6267 C C   . THR A 1 812 ? -11.652 142.587 30.502  1.00 28.43  ? 812  THR A C   1 
ATOM   6268 O O   . THR A 1 812 ? -12.645 142.926 31.133  1.00 31.51  ? 812  THR A O   1 
ATOM   6269 C CB  . THR A 1 812 ? -10.287 140.577 30.892  1.00 28.99  ? 812  THR A CB  1 
ATOM   6270 O OG1 . THR A 1 812 ? -11.558 139.937 31.063  1.00 35.08  ? 812  THR A OG1 1 
ATOM   6271 C CG2 . THR A 1 812 ? -9.256  139.928 31.795  1.00 24.83  ? 812  THR A CG2 1 
ATOM   6272 N N   . CYS A 1 813 ? -11.589 142.646 29.180  1.00 35.09  ? 813  CYS A N   1 
ATOM   6273 C CA  . CYS A 1 813 ? -12.718 143.131 28.399  1.00 38.51  ? 813  CYS A CA  1 
ATOM   6274 C C   . CYS A 1 813 ? -13.979 142.373 28.808  1.00 38.56  ? 813  CYS A C   1 
ATOM   6275 O O   . CYS A 1 813 ? -15.070 142.946 28.862  1.00 38.33  ? 813  CYS A O   1 
ATOM   6276 C CB  . CYS A 1 813 ? -12.446 142.938 26.900  1.00 35.55  ? 813  CYS A CB  1 
ATOM   6277 S SG  . CYS A 1 813 ? -12.193 144.468 25.973  1.00 35.13  ? 813  CYS A SG  1 
ATOM   6278 N N   . ASP A 1 814 ? -13.813 141.088 29.117  1.00 38.86  ? 814  ASP A N   1 
ATOM   6279 C CA  . ASP A 1 814 ? -14.927 140.229 29.515  1.00 41.95  ? 814  ASP A CA  1 
ATOM   6280 C C   . ASP A 1 814 ? -15.450 140.568 30.908  1.00 34.61  ? 814  ASP A C   1 
ATOM   6281 O O   . ASP A 1 814 ? -16.661 140.626 31.128  1.00 30.55  ? 814  ASP A O   1 
ATOM   6282 C CB  . ASP A 1 814 ? -14.500 138.760 29.452  1.00 51.99  ? 814  ASP A CB  1 
ATOM   6283 C CG  . ASP A 1 814 ? -14.800 138.122 28.101  1.00 61.33  ? 814  ASP A CG  1 
ATOM   6284 O OD1 . ASP A 1 814 ? -15.856 138.454 27.512  1.00 62.33  ? 814  ASP A OD1 1 
ATOM   6285 O OD2 . ASP A 1 814 ? -13.984 137.296 27.631  1.00 65.87  ? 814  ASP A OD2 1 
ATOM   6286 N N   . ASP A 1 815 ? -14.529 140.770 31.846  1.00 31.03  ? 815  ASP A N   1 
ATOM   6287 C CA  . ASP A 1 815 ? -14.892 141.146 33.209  1.00 25.11  ? 815  ASP A CA  1 
ATOM   6288 C C   . ASP A 1 815 ? -15.738 142.414 33.095  1.00 24.78  ? 815  ASP A C   1 
ATOM   6289 O O   . ASP A 1 815 ? -16.850 142.495 33.616  1.00 22.86  ? 815  ASP A O   1 
ATOM   6290 C CB  . ASP A 1 815 ? -13.633 141.452 34.030  1.00 20.50  ? 815  ASP A CB  1 
ATOM   6291 C CG  . ASP A 1 815 ? -12.859 140.197 34.407  1.00 27.64  ? 815  ASP A CG  1 
ATOM   6292 O OD1 . ASP A 1 815 ? -13.492 139.136 34.593  1.00 30.33  ? 815  ASP A OD1 1 
ATOM   6293 O OD2 . ASP A 1 815 ? -11.615 140.272 34.523  1.00 25.37  ? 815  ASP A OD2 1 
ATOM   6294 N N   . SER A 1 816 ? -15.195 143.392 32.381  1.00 21.90  ? 816  SER A N   1 
ATOM   6295 C CA  . SER A 1 816 ? -15.853 144.667 32.167  1.00 23.04  ? 816  SER A CA  1 
ATOM   6296 C C   . SER A 1 816 ? -17.308 144.535 31.740  1.00 21.80  ? 816  SER A C   1 
ATOM   6297 O O   . SER A 1 816 ? -18.177 145.252 32.230  1.00 22.70  ? 816  SER A O   1 
ATOM   6298 C CB  . SER A 1 816 ? -15.079 145.463 31.120  1.00 23.58  ? 816  SER A CB  1 
ATOM   6299 O OG  . SER A 1 816 ? -13.699 145.497 31.445  1.00 26.64  ? 816  SER A OG  1 
ATOM   6300 N N   . ILE A 1 817 ? -17.579 143.624 30.821  1.00 21.93  ? 817  ILE A N   1 
ATOM   6301 C CA  . ILE A 1 817 ? -18.942 143.456 30.353  1.00 25.47  ? 817  ILE A CA  1 
ATOM   6302 C C   . ILE A 1 817 ? -19.816 143.038 31.523  1.00 27.32  ? 817  ILE A C   1 
ATOM   6303 O O   . ILE A 1 817 ? -20.969 143.456 31.638  1.00 29.40  ? 817  ILE A O   1 
ATOM   6304 C CB  . ILE A 1 817 ? -19.026 142.382 29.248  1.00 30.34  ? 817  ILE A CB  1 
ATOM   6305 C CG1 . ILE A 1 817 ? -18.173 142.791 28.042  1.00 28.55  ? 817  ILE A CG1 1 
ATOM   6306 C CG2 . ILE A 1 817 ? -20.468 142.201 28.815  1.00 34.19  ? 817  ILE A CG2 1 
ATOM   6307 C CD1 . ILE A 1 817 ? -17.269 141.683 27.512  1.00 28.63  ? 817  ILE A CD1 1 
ATOM   6308 N N   . LEU A 1 818 ? -19.252 142.219 32.400  1.00 28.26  ? 818  LEU A N   1 
ATOM   6309 C CA  . LEU A 1 818 ? -19.978 141.724 33.564  1.00 26.93  ? 818  LEU A CA  1 
ATOM   6310 C C   . LEU A 1 818 ? -20.253 142.819 34.590  1.00 28.04  ? 818  LEU A C   1 
ATOM   6311 O O   . LEU A 1 818 ? -21.407 143.074 34.948  1.00 28.44  ? 818  LEU A O   1 
ATOM   6312 C CB  . LEU A 1 818 ? -19.187 140.595 34.225  1.00 23.10  ? 818  LEU A CB  1 
ATOM   6313 C CG  . LEU A 1 818 ? -19.924 139.771 35.276  1.00 27.13  ? 818  LEU A CG  1 
ATOM   6314 C CD1 . LEU A 1 818 ? -21.372 139.523 34.863  1.00 26.64  ? 818  LEU A CD1 1 
ATOM   6315 C CD2 . LEU A 1 818 ? -19.193 138.461 35.440  1.00 34.11  ? 818  LEU A CD2 1 
ATOM   6316 N N   . VAL A 1 819 ? -19.188 143.459 35.064  1.00 24.34  ? 819  VAL A N   1 
ATOM   6317 C CA  . VAL A 1 819 ? -19.316 144.517 36.051  1.00 20.36  ? 819  VAL A CA  1 
ATOM   6318 C C   . VAL A 1 819 ? -20.342 145.567 35.617  1.00 22.78  ? 819  VAL A C   1 
ATOM   6319 O O   . VAL A 1 819 ? -21.136 146.044 36.432  1.00 27.75  ? 819  VAL A O   1 
ATOM   6320 C CB  . VAL A 1 819 ? -17.952 145.195 36.316  1.00 18.63  ? 819  VAL A CB  1 
ATOM   6321 C CG1 . VAL A 1 819 ? -18.094 146.254 37.396  1.00 21.69  ? 819  VAL A CG1 1 
ATOM   6322 C CG2 . VAL A 1 819 ? -16.936 144.155 36.753  1.00 13.28  ? 819  VAL A CG2 1 
ATOM   6323 N N   . LYS A 1 820 ? -20.345 145.916 34.336  1.00 21.07  ? 820  LYS A N   1 
ATOM   6324 C CA  . LYS A 1 820 ? -21.287 146.913 33.836  1.00 21.41  ? 820  LYS A CA  1 
ATOM   6325 C C   . LYS A 1 820 ? -22.735 146.443 33.966  1.00 23.79  ? 820  LYS A C   1 
ATOM   6326 O O   . LYS A 1 820 ? -23.626 147.231 34.264  1.00 27.60  ? 820  LYS A O   1 
ATOM   6327 C CB  . LYS A 1 820 ? -20.978 147.245 32.376  1.00 24.61  ? 820  LYS A CB  1 
ATOM   6328 C CG  . LYS A 1 820 ? -21.896 148.293 31.766  1.00 32.16  ? 820  LYS A CG  1 
ATOM   6329 C CD  . LYS A 1 820 ? -21.513 148.577 30.320  1.00 35.99  ? 820  LYS A CD  1 
ATOM   6330 C CE  . LYS A 1 820 ? -22.369 149.684 29.715  1.00 44.01  ? 820  LYS A CE  1 
ATOM   6331 N NZ  . LYS A 1 820 ? -21.591 150.506 28.736  1.00 52.83  ? 820  LYS A NZ  1 
ATOM   6332 N N   . THR A 1 821 ? -22.967 145.155 33.745  1.00 27.64  ? 821  THR A N   1 
ATOM   6333 C CA  . THR A 1 821 ? -24.312 144.592 33.839  1.00 26.45  ? 821  THR A CA  1 
ATOM   6334 C C   . THR A 1 821 ? -24.811 144.642 35.279  1.00 27.00  ? 821  THR A C   1 
ATOM   6335 O O   . THR A 1 821 ? -25.942 145.057 35.538  1.00 29.58  ? 821  THR A O   1 
ATOM   6336 C CB  . THR A 1 821 ? -24.334 143.127 33.344  1.00 29.89  ? 821  THR A CB  1 
ATOM   6337 O OG1 . THR A 1 821 ? -23.767 143.064 32.029  1.00 27.16  ? 821  THR A OG1 1 
ATOM   6338 C CG2 . THR A 1 821 ? -25.759 142.589 33.299  1.00 24.42  ? 821  THR A CG2 1 
ATOM   6339 N N   . VAL A 1 822 ? -23.967 144.214 36.215  1.00 22.84  ? 822  VAL A N   1 
ATOM   6340 C CA  . VAL A 1 822 ? -24.334 144.231 37.626  1.00 17.46  ? 822  VAL A CA  1 
ATOM   6341 C C   . VAL A 1 822 ? -24.745 145.646 38.010  1.00 15.74  ? 822  VAL A C   1 
ATOM   6342 O O   . VAL A 1 822 ? -25.869 145.875 38.463  1.00 12.04  ? 822  VAL A O   1 
ATOM   6343 C CB  . VAL A 1 822 ? -23.161 143.808 38.512  1.00 17.90  ? 822  VAL A CB  1 
ATOM   6344 C CG1 . VAL A 1 822 ? -23.559 143.908 39.965  1.00 13.91  ? 822  VAL A CG1 1 
ATOM   6345 C CG2 . VAL A 1 822 ? -22.728 142.390 38.164  1.00 17.75  ? 822  VAL A CG2 1 
ATOM   6346 N N   . CYS A 1 823 ? -23.826 146.592 37.818  1.00 11.68  ? 823  CYS A N   1 
ATOM   6347 C CA  . CYS A 1 823 ? -24.087 147.992 38.125  1.00 8.21   ? 823  CYS A CA  1 
ATOM   6348 C C   . CYS A 1 823 ? -25.459 148.359 37.602  1.00 15.72  ? 823  CYS A C   1 
ATOM   6349 O O   . CYS A 1 823 ? -26.297 148.900 38.328  1.00 23.41  ? 823  CYS A O   1 
ATOM   6350 C CB  . CYS A 1 823 ? -23.060 148.901 37.450  1.00 5.00   ? 823  CYS A CB  1 
ATOM   6351 S SG  . CYS A 1 823 ? -21.411 148.845 38.160  1.00 15.40  ? 823  CYS A SG  1 
ATOM   6352 N N   . GLY A 1 824 ? -25.678 148.051 36.329  1.00 11.24  ? 824  GLY A N   1 
ATOM   6353 C CA  . GLY A 1 824 ? -26.936 148.376 35.693  1.00 6.13   ? 824  GLY A CA  1 
ATOM   6354 C C   . GLY A 1 824 ? -28.134 147.817 36.411  1.00 8.05   ? 824  GLY A C   1 
ATOM   6355 O O   . GLY A 1 824 ? -29.142 148.494 36.586  1.00 15.50  ? 824  GLY A O   1 
ATOM   6356 N N   . VAL A 1 825 ? -28.028 146.573 36.837  1.00 10.08  ? 825  VAL A N   1 
ATOM   6357 C CA  . VAL A 1 825 ? -29.131 145.941 37.527  1.00 14.08  ? 825  VAL A CA  1 
ATOM   6358 C C   . VAL A 1 825 ? -29.452 146.657 38.835  1.00 17.51  ? 825  VAL A C   1 
ATOM   6359 O O   . VAL A 1 825 ? -30.612 146.923 39.154  1.00 17.31  ? 825  VAL A O   1 
ATOM   6360 C CB  . VAL A 1 825 ? -28.791 144.499 37.826  1.00 10.62  ? 825  VAL A CB  1 
ATOM   6361 C CG1 . VAL A 1 825 ? -29.948 143.833 38.501  1.00 22.38  ? 825  VAL A CG1 1 
ATOM   6362 C CG2 . VAL A 1 825 ? -28.434 143.791 36.546  1.00 16.70  ? 825  VAL A CG2 1 
ATOM   6363 N N   . VAL A 1 826 ? -28.403 146.979 39.577  1.00 17.20  ? 826  VAL A N   1 
ATOM   6364 C CA  . VAL A 1 826 ? -28.529 147.643 40.863  1.00 15.48  ? 826  VAL A CA  1 
ATOM   6365 C C   . VAL A 1 826 ? -29.072 149.073 40.785  1.00 20.31  ? 826  VAL A C   1 
ATOM   6366 O O   . VAL A 1 826 ? -29.967 149.445 41.554  1.00 20.85  ? 826  VAL A O   1 
ATOM   6367 C CB  . VAL A 1 826 ? -27.161 147.639 41.575  1.00 10.99  ? 826  VAL A CB  1 
ATOM   6368 C CG1 . VAL A 1 826 ? -27.173 148.576 42.756  1.00 12.14  ? 826  VAL A CG1 1 
ATOM   6369 C CG2 . VAL A 1 826 ? -26.819 146.226 41.998  1.00 5.00   ? 826  VAL A CG2 1 
ATOM   6370 N N   . SER A 1 827 ? -28.537 149.869 39.858  1.00 21.10  ? 827  SER A N   1 
ATOM   6371 C CA  . SER A 1 827 ? -28.961 151.260 39.699  1.00 18.06  ? 827  SER A CA  1 
ATOM   6372 C C   . SER A 1 827 ? -30.374 151.405 39.135  1.00 16.70  ? 827  SER A C   1 
ATOM   6373 O O   . SER A 1 827 ? -31.040 152.418 39.347  1.00 20.89  ? 827  SER A O   1 
ATOM   6374 C CB  . SER A 1 827 ? -27.974 152.009 38.808  1.00 16.80  ? 827  SER A CB  1 
ATOM   6375 O OG  . SER A 1 827 ? -28.186 151.689 37.447  1.00 34.34  ? 827  SER A OG  1 
ATOM   6376 N N   . ARG A 1 828 ? -30.837 150.400 38.408  1.00 16.60  ? 828  ARG A N   1 
ATOM   6377 C CA  . ARG A 1 828 ? -32.179 150.469 37.859  1.00 18.45  ? 828  ARG A CA  1 
ATOM   6378 C C   . ARG A 1 828 ? -33.175 150.329 38.997  1.00 17.04  ? 828  ARG A C   1 
ATOM   6379 O O   . ARG A 1 828 ? -34.096 151.128 39.116  1.00 22.33  ? 828  ARG A O   1 
ATOM   6380 C CB  . ARG A 1 828 ? -32.410 149.359 36.837  1.00 21.44  ? 828  ARG A CB  1 
ATOM   6381 C CG  . ARG A 1 828 ? -33.794 149.390 36.217  1.00 32.60  ? 828  ARG A CG  1 
ATOM   6382 C CD  . ARG A 1 828 ? -34.286 147.992 35.881  1.00 52.34  ? 828  ARG A CD  1 
ATOM   6383 N NE  . ARG A 1 828 ? -33.775 147.536 34.594  1.00 66.52  ? 828  ARG A NE  1 
ATOM   6384 C CZ  . ARG A 1 828 ? -34.059 148.117 33.432  1.00 74.69  ? 828  ARG A CZ  1 
ATOM   6385 N NH1 . ARG A 1 828 ? -34.854 149.181 33.393  1.00 75.26  ? 828  ARG A NH1 1 
ATOM   6386 N NH2 . ARG A 1 828 ? -33.545 147.636 32.309  1.00 80.60  ? 828  ARG A NH2 1 
ATOM   6387 N N   . ARG A 1 829 ? -32.972 149.311 39.835  1.00 21.66  ? 829  ARG A N   1 
ATOM   6388 C CA  . ARG A 1 829 ? -33.848 149.046 40.977  1.00 15.66  ? 829  ARG A CA  1 
ATOM   6389 C C   . ARG A 1 829 ? -33.885 150.242 41.907  1.00 17.73  ? 829  ARG A C   1 
ATOM   6390 O O   . ARG A 1 829 ? -34.926 150.560 42.485  1.00 17.31  ? 829  ARG A O   1 
ATOM   6391 C CB  . ARG A 1 829 ? -33.366 147.824 41.757  1.00 9.47   ? 829  ARG A CB  1 
ATOM   6392 C CG  . ARG A 1 829 ? -34.438 147.242 42.675  1.00 17.61  ? 829  ARG A CG  1 
ATOM   6393 C CD  . ARG A 1 829 ? -33.874 146.230 43.658  1.00 17.75  ? 829  ARG A CD  1 
ATOM   6394 N NE  . ARG A 1 829 ? -32.681 146.730 44.331  1.00 19.69  ? 829  ARG A NE  1 
ATOM   6395 C CZ  . ARG A 1 829 ? -32.066 146.103 45.324  1.00 14.32  ? 829  ARG A CZ  1 
ATOM   6396 N NH1 . ARG A 1 829 ? -32.528 144.944 45.767  1.00 12.22  ? 829  ARG A NH1 1 
ATOM   6397 N NH2 . ARG A 1 829 ? -30.998 146.647 45.885  1.00 18.83  ? 829  ARG A NH2 1 
ATOM   6398 N N   . ALA A 1 830 ? -32.734 150.893 42.049  1.00 19.24  ? 830  ALA A N   1 
ATOM   6399 C CA  . ALA A 1 830 ? -32.607 152.072 42.890  1.00 13.22  ? 830  ALA A CA  1 
ATOM   6400 C C   . ALA A 1 830 ? -33.573 153.146 42.396  1.00 14.09  ? 830  ALA A C   1 
ATOM   6401 O O   . ALA A 1 830 ? -34.390 153.669 43.167  1.00 17.73  ? 830  ALA A O   1 
ATOM   6402 C CB  . ALA A 1 830 ? -31.174 152.580 42.848  1.00 16.37  ? 830  ALA A CB  1 
ATOM   6403 N N   . ALA A 1 831 ? -33.490 153.463 41.106  1.00 14.21  ? 831  ALA A N   1 
ATOM   6404 C CA  . ALA A 1 831 ? -34.373 154.464 40.506  1.00 12.21  ? 831  ALA A CA  1 
ATOM   6405 C C   . ALA A 1 831 ? -35.835 154.066 40.656  1.00 10.42  ? 831  ALA A C   1 
ATOM   6406 O O   . ALA A 1 831 ? -36.671 154.898 40.983  1.00 17.84  ? 831  ALA A O   1 
ATOM   6407 C CB  . ALA A 1 831 ? -34.039 154.642 39.044  1.00 9.55   ? 831  ALA A CB  1 
ATOM   6408 N N   . GLN A 1 832 ? -36.141 152.792 40.429  1.00 10.38  ? 832  GLN A N   1 
ATOM   6409 C CA  . GLN A 1 832 ? -37.514 152.300 40.536  1.00 10.35  ? 832  GLN A CA  1 
ATOM   6410 C C   . GLN A 1 832 ? -38.045 152.381 41.957  1.00 14.15  ? 832  GLN A C   1 
ATOM   6411 O O   . GLN A 1 832 ? -39.155 152.870 42.184  1.00 12.95  ? 832  GLN A O   1 
ATOM   6412 C CB  . GLN A 1 832 ? -37.594 150.855 40.073  1.00 14.89  ? 832  GLN A CB  1 
ATOM   6413 C CG  . GLN A 1 832 ? -36.877 150.576 38.781  1.00 24.31  ? 832  GLN A CG  1 
ATOM   6414 C CD  . GLN A 1 832 ? -37.505 149.430 38.032  1.00 28.21  ? 832  GLN A CD  1 
ATOM   6415 O OE1 . GLN A 1 832 ? -37.232 148.264 38.317  1.00 31.43  ? 832  GLN A OE1 1 
ATOM   6416 N NE2 . GLN A 1 832 ? -38.360 149.754 37.069  1.00 33.43  ? 832  GLN A NE2 1 
ATOM   6417 N N   . LEU A 1 833 ? -37.261 151.874 42.906  1.00 13.81  ? 833  LEU A N   1 
ATOM   6418 C CA  . LEU A 1 833 ? -37.642 151.895 44.312  1.00 12.15  ? 833  LEU A CA  1 
ATOM   6419 C C   . LEU A 1 833 ? -37.809 153.344 44.745  1.00 18.48  ? 833  LEU A C   1 
ATOM   6420 O O   . LEU A 1 833 ? -38.617 153.655 45.624  1.00 17.18  ? 833  LEU A O   1 
ATOM   6421 C CB  . LEU A 1 833 ? -36.568 151.226 45.158  1.00 9.53   ? 833  LEU A CB  1 
ATOM   6422 C CG  . LEU A 1 833 ? -36.635 149.707 45.175  1.00 5.00   ? 833  LEU A CG  1 
ATOM   6423 C CD1 . LEU A 1 833 ? -35.373 149.163 45.791  1.00 5.00   ? 833  LEU A CD1 1 
ATOM   6424 C CD2 . LEU A 1 833 ? -37.862 149.257 45.960  1.00 9.00   ? 833  LEU A CD2 1 
ATOM   6425 N N   . CYS A 1 834 ? -37.028 154.228 44.129  1.00 18.16  ? 834  CYS A N   1 
ATOM   6426 C CA  . CYS A 1 834 ? -37.130 155.647 44.435  1.00 21.02  ? 834  CYS A CA  1 
ATOM   6427 C C   . CYS A 1 834 ? -38.442 156.164 43.847  1.00 20.77  ? 834  CYS A C   1 
ATOM   6428 O O   . CYS A 1 834 ? -39.146 156.945 44.482  1.00 23.72  ? 834  CYS A O   1 
ATOM   6429 C CB  . CYS A 1 834 ? -35.952 156.414 43.833  1.00 24.87  ? 834  CYS A CB  1 
ATOM   6430 S SG  . CYS A 1 834 ? -35.873 158.151 44.351  1.00 26.72  ? 834  CYS A SG  1 
ATOM   6431 N N   . GLY A 1 835 ? -38.762 155.709 42.636  1.00 21.00  ? 835  GLY A N   1 
ATOM   6432 C CA  . GLY A 1 835 ? -39.992 156.113 41.972  1.00 19.41  ? 835  GLY A CA  1 
ATOM   6433 C C   . GLY A 1 835 ? -41.242 155.709 42.739  1.00 22.60  ? 835  GLY A C   1 
ATOM   6434 O O   . GLY A 1 835 ? -42.164 156.509 42.889  1.00 21.02  ? 835  GLY A O   1 
ATOM   6435 N N   . ALA A 1 836 ? -41.283 154.464 43.211  1.00 22.69  ? 836  ALA A N   1 
ATOM   6436 C CA  . ALA A 1 836 ? -42.422 153.975 43.984  1.00 21.03  ? 836  ALA A CA  1 
ATOM   6437 C C   . ALA A 1 836 ? -42.613 154.885 45.190  1.00 22.73  ? 836  ALA A C   1 
ATOM   6438 O O   . ALA A 1 836 ? -43.737 155.179 45.591  1.00 27.69  ? 836  ALA A O   1 
ATOM   6439 C CB  . ALA A 1 836 ? -42.170 152.552 44.448  1.00 15.90  ? 836  ALA A CB  1 
ATOM   6440 N N   . GLY A 1 837 ? -41.503 155.324 45.770  1.00 25.12  ? 837  GLY A N   1 
ATOM   6441 C CA  . GLY A 1 837 ? -41.582 156.211 46.913  1.00 24.64  ? 837  GLY A CA  1 
ATOM   6442 C C   . GLY A 1 837 ? -42.165 157.545 46.494  1.00 24.17  ? 837  GLY A C   1 
ATOM   6443 O O   . GLY A 1 837 ? -43.193 157.980 47.019  1.00 22.76  ? 837  GLY A O   1 
ATOM   6444 N N   . MET A 1 838 ? -41.505 158.198 45.542  1.00 21.10  ? 838  MET A N   1 
ATOM   6445 C CA  . MET A 1 838 ? -41.963 159.489 45.048  1.00 21.40  ? 838  MET A CA  1 
ATOM   6446 C C   . MET A 1 838 ? -43.411 159.392 44.588  1.00 21.21  ? 838  MET A C   1 
ATOM   6447 O O   . MET A 1 838 ? -44.194 160.316 44.775  1.00 23.91  ? 838  MET A O   1 
ATOM   6448 C CB  . MET A 1 838 ? -41.084 159.948 43.886  1.00 22.18  ? 838  MET A CB  1 
ATOM   6449 C CG  . MET A 1 838 ? -41.097 161.443 43.665  1.00 21.29  ? 838  MET A CG  1 
ATOM   6450 S SD  . MET A 1 838 ? -40.667 162.327 45.164  1.00 29.34  ? 838  MET A SD  1 
ATOM   6451 C CE  . MET A 1 838 ? -42.256 162.701 45.784  1.00 40.98  ? 838  MET A CE  1 
ATOM   6452 N N   . ALA A 1 839 ? -43.760 158.256 43.997  1.00 24.28  ? 839  ALA A N   1 
ATOM   6453 C CA  . ALA A 1 839 ? -45.106 158.022 43.492  1.00 23.71  ? 839  ALA A CA  1 
ATOM   6454 C C   . ALA A 1 839 ? -46.159 158.077 44.584  1.00 23.96  ? 839  ALA A C   1 
ATOM   6455 O O   . ALA A 1 839 ? -47.307 158.422 44.327  1.00 31.38  ? 839  ALA A O   1 
ATOM   6456 C CB  . ALA A 1 839 ? -45.167 156.671 42.782  1.00 21.93  ? 839  ALA A CB  1 
ATOM   6457 N N   . ALA A 1 840 ? -45.776 157.729 45.804  1.00 23.93  ? 840  ALA A N   1 
ATOM   6458 C CA  . ALA A 1 840 ? -46.723 157.740 46.911  1.00 24.66  ? 840  ALA A CA  1 
ATOM   6459 C C   . ALA A 1 840 ? -47.008 159.160 47.403  1.00 28.92  ? 840  ALA A C   1 
ATOM   6460 O O   . ALA A 1 840 ? -48.134 159.483 47.791  1.00 33.47  ? 840  ALA A O   1 
ATOM   6461 C CB  . ALA A 1 840 ? -46.188 156.889 48.049  1.00 19.50  ? 840  ALA A CB  1 
ATOM   6462 N N   . VAL A 1 841 ? -45.983 160.006 47.381  1.00 29.15  ? 841  VAL A N   1 
ATOM   6463 C CA  . VAL A 1 841 ? -46.109 161.382 47.841  1.00 24.92  ? 841  VAL A CA  1 
ATOM   6464 C C   . VAL A 1 841 ? -47.063 162.185 46.964  1.00 28.57  ? 841  VAL A C   1 
ATOM   6465 O O   . VAL A 1 841 ? -48.048 162.731 47.459  1.00 27.72  ? 841  VAL A O   1 
ATOM   6466 C CB  . VAL A 1 841 ? -44.724 162.084 47.872  1.00 21.89  ? 841  VAL A CB  1 
ATOM   6467 C CG1 . VAL A 1 841 ? -44.861 163.519 48.361  1.00 21.13  ? 841  VAL A CG1 1 
ATOM   6468 C CG2 . VAL A 1 841 ? -43.773 161.311 48.767  1.00 13.45  ? 841  VAL A CG2 1 
ATOM   6469 N N   . VAL A 1 842 ? -46.779 162.246 45.665  1.00 30.98  ? 842  VAL A N   1 
ATOM   6470 C CA  . VAL A 1 842 ? -47.621 162.997 44.734  1.00 29.96  ? 842  VAL A CA  1 
ATOM   6471 C C   . VAL A 1 842 ? -49.084 162.576 44.808  1.00 31.65  ? 842  VAL A C   1 
ATOM   6472 O O   . VAL A 1 842 ? -49.978 163.421 44.809  1.00 34.21  ? 842  VAL A O   1 
ATOM   6473 C CB  . VAL A 1 842 ? -47.142 162.849 43.263  1.00 28.53  ? 842  VAL A CB  1 
ATOM   6474 C CG1 . VAL A 1 842 ? -45.788 163.514 43.091  1.00 27.10  ? 842  VAL A CG1 1 
ATOM   6475 C CG2 . VAL A 1 842 ? -47.076 161.386 42.866  1.00 21.73  ? 842  VAL A CG2 1 
ATOM   6476 N N   . ASP A 1 843 ? -49.336 161.274 44.874  1.00 30.09  ? 843  ASP A N   1 
ATOM   6477 C CA  . ASP A 1 843 ? -50.709 160.804 44.946  1.00 33.92  ? 843  ASP A CA  1 
ATOM   6478 C C   . ASP A 1 843 ? -51.363 161.199 46.260  1.00 33.46  ? 843  ASP A C   1 
ATOM   6479 O O   . ASP A 1 843 ? -52.551 161.513 46.297  1.00 36.81  ? 843  ASP A O   1 
ATOM   6480 C CB  . ASP A 1 843 ? -50.775 159.290 44.765  1.00 38.21  ? 843  ASP A CB  1 
ATOM   6481 C CG  . ASP A 1 843 ? -51.504 158.890 43.495  1.00 42.90  ? 843  ASP A CG  1 
ATOM   6482 O OD1 . ASP A 1 843 ? -52.013 159.788 42.784  1.00 40.84  ? 843  ASP A OD1 1 
ATOM   6483 O OD2 . ASP A 1 843 ? -51.567 157.678 43.206  1.00 48.84  ? 843  ASP A OD2 1 
ATOM   6484 N N   . LYS A 1 844 ? -50.595 161.182 47.342  1.00 33.92  ? 844  LYS A N   1 
ATOM   6485 C CA  . LYS A 1 844 ? -51.150 161.566 48.632  1.00 31.34  ? 844  LYS A CA  1 
ATOM   6486 C C   . LYS A 1 844 ? -51.541 163.044 48.560  1.00 31.88  ? 844  LYS A C   1 
ATOM   6487 O O   . LYS A 1 844 ? -52.569 163.445 49.102  1.00 32.80  ? 844  LYS A O   1 
ATOM   6488 C CB  . LYS A 1 844 ? -50.133 161.331 49.756  1.00 26.14  ? 844  LYS A CB  1 
ATOM   6489 C CG  . LYS A 1 844 ? -50.471 162.057 51.056  1.00 25.46  ? 844  LYS A CG  1 
ATOM   6490 C CD  . LYS A 1 844 ? -50.288 161.177 52.285  1.00 22.90  ? 844  LYS A CD  1 
ATOM   6491 C CE  . LYS A 1 844 ? -51.318 161.507 53.356  1.00 14.77  ? 844  LYS A CE  1 
ATOM   6492 N NZ  . LYS A 1 844 ? -51.085 162.835 53.972  1.00 16.37  ? 844  LYS A NZ  1 
ATOM   6493 N N   . ILE A 1 845 ? -50.726 163.848 47.876  1.00 32.33  ? 845  ILE A N   1 
ATOM   6494 C CA  . ILE A 1 845 ? -51.006 165.277 47.725  1.00 31.44  ? 845  ILE A CA  1 
ATOM   6495 C C   . ILE A 1 845 ? -52.275 165.452 46.893  1.00 30.49  ? 845  ILE A C   1 
ATOM   6496 O O   . ILE A 1 845 ? -53.150 166.251 47.231  1.00 30.63  ? 845  ILE A O   1 
ATOM   6497 C CB  . ILE A 1 845 ? -49.845 166.024 47.019  1.00 28.49  ? 845  ILE A CB  1 
ATOM   6498 C CG1 . ILE A 1 845 ? -48.554 165.877 47.828  1.00 27.46  ? 845  ILE A CG1 1 
ATOM   6499 C CG2 . ILE A 1 845 ? -50.194 167.494 46.870  1.00 26.41  ? 845  ILE A CG2 1 
ATOM   6500 C CD1 . ILE A 1 845 ? -47.335 166.482 47.156  1.00 13.96  ? 845  ILE A CD1 1 
ATOM   6501 N N   . ARG A 1 846 ? -52.364 164.701 45.800  1.00 29.06  ? 846  ARG A N   1 
ATOM   6502 C CA  . ARG A 1 846 ? -53.533 164.759 44.939  1.00 29.85  ? 846  ARG A CA  1 
ATOM   6503 C C   . ARG A 1 846 ? -54.762 164.445 45.778  1.00 29.11  ? 846  ARG A C   1 
ATOM   6504 O O   . ARG A 1 846 ? -55.664 165.269 45.906  1.00 27.40  ? 846  ARG A O   1 
ATOM   6505 C CB  . ARG A 1 846 ? -53.409 163.737 43.813  1.00 31.59  ? 846  ARG A CB  1 
ATOM   6506 C CG  . ARG A 1 846 ? -54.662 163.592 42.975  1.00 31.90  ? 846  ARG A CG  1 
ATOM   6507 C CD  . ARG A 1 846 ? -54.410 162.701 41.767  1.00 33.54  ? 846  ARG A CD  1 
ATOM   6508 N NE  . ARG A 1 846 ? -54.370 161.289 42.136  1.00 36.95  ? 846  ARG A NE  1 
ATOM   6509 C CZ  . ARG A 1 846 ? -55.396 160.622 42.654  1.00 36.20  ? 846  ARG A CZ  1 
ATOM   6510 N NH1 . ARG A 1 846 ? -56.550 161.237 42.867  1.00 38.75  ? 846  ARG A NH1 1 
ATOM   6511 N NH2 . ARG A 1 846 ? -55.271 159.340 42.962  1.00 36.19  ? 846  ARG A NH2 1 
ATOM   6512 N N   . GLU A 1 847 ? -54.777 163.253 46.363  1.00 28.13  ? 847  GLU A N   1 
ATOM   6513 C CA  . GLU A 1 847 ? -55.890 162.819 47.195  1.00 35.25  ? 847  GLU A CA  1 
ATOM   6514 C C   . GLU A 1 847 ? -56.103 163.718 48.410  1.00 37.73  ? 847  GLU A C   1 
ATOM   6515 O O   . GLU A 1 847 ? -57.221 163.864 48.896  1.00 41.33  ? 847  GLU A O   1 
ATOM   6516 C CB  . GLU A 1 847 ? -55.666 161.377 47.649  1.00 38.39  ? 847  GLU A CB  1 
ATOM   6517 C CG  . GLU A 1 847 ? -55.427 160.410 46.496  1.00 50.82  ? 847  GLU A CG  1 
ATOM   6518 C CD  . GLU A 1 847 ? -55.284 158.969 46.949  1.00 57.14  ? 847  GLU A CD  1 
ATOM   6519 O OE1 . GLU A 1 847 ? -55.605 158.673 48.122  1.00 66.52  ? 847  GLU A OE1 1 
ATOM   6520 O OE2 . GLU A 1 847 ? -54.851 158.130 46.130  1.00 59.41  ? 847  GLU A OE2 1 
ATOM   6521 N N   . ASN A 1 848 ? -55.030 164.318 48.903  1.00 40.70  ? 848  ASN A N   1 
ATOM   6522 C CA  . ASN A 1 848 ? -55.137 165.196 50.057  1.00 42.98  ? 848  ASN A CA  1 
ATOM   6523 C C   . ASN A 1 848 ? -56.057 166.358 49.698  1.00 44.10  ? 848  ASN A C   1 
ATOM   6524 O O   . ASN A 1 848 ? -56.890 166.788 50.496  1.00 44.53  ? 848  ASN A O   1 
ATOM   6525 C CB  . ASN A 1 848 ? -53.754 165.735 50.437  1.00 42.88  ? 848  ASN A CB  1 
ATOM   6526 C CG  . ASN A 1 848 ? -53.101 164.946 51.558  1.00 40.97  ? 848  ASN A CG  1 
ATOM   6527 O OD1 . ASN A 1 848 ? -52.044 165.328 52.062  1.00 42.77  ? 848  ASN A OD1 1 
ATOM   6528 N ND2 . ASN A 1 848 ? -53.726 163.842 51.954  1.00 40.45  ? 848  ASN A ND2 1 
ATOM   6529 N N   . ARG A 1 849 ? -55.895 166.859 48.481  1.00 44.31  ? 849  ARG A N   1 
ATOM   6530 C CA  . ARG A 1 849 ? -56.691 167.976 48.009  1.00 49.46  ? 849  ARG A CA  1 
ATOM   6531 C C   . ARG A 1 849 ? -57.922 167.515 47.233  1.00 55.54  ? 849  ARG A C   1 
ATOM   6532 O O   . ARG A 1 849 ? -58.558 168.302 46.530  1.00 58.38  ? 849  ARG A O   1 
ATOM   6533 C CB  . ARG A 1 849 ? -55.822 168.880 47.138  1.00 44.14  ? 849  ARG A CB  1 
ATOM   6534 C CG  . ARG A 1 849 ? -54.748 169.593 47.932  1.00 40.45  ? 849  ARG A CG  1 
ATOM   6535 C CD  . ARG A 1 849 ? -53.587 170.034 47.071  1.00 33.88  ? 849  ARG A CD  1 
ATOM   6536 N NE  . ARG A 1 849 ? -52.435 170.378 47.896  1.00 37.36  ? 849  ARG A NE  1 
ATOM   6537 C CZ  . ARG A 1 849 ? -51.359 171.021 47.455  1.00 36.76  ? 849  ARG A CZ  1 
ATOM   6538 N NH1 . ARG A 1 849 ? -51.274 171.398 46.187  1.00 31.22  ? 849  ARG A NH1 1 
ATOM   6539 N NH2 . ARG A 1 849 ? -50.365 171.287 48.289  1.00 39.28  ? 849  ARG A NH2 1 
ATOM   6540 N N   . GLY A 1 850 ? -58.251 166.233 47.368  1.00 58.54  ? 850  GLY A N   1 
ATOM   6541 C CA  . GLY A 1 850 ? -59.407 165.675 46.684  1.00 56.09  ? 850  GLY A CA  1 
ATOM   6542 C C   . GLY A 1 850 ? -59.487 165.970 45.196  1.00 55.35  ? 850  GLY A C   1 
ATOM   6543 O O   . GLY A 1 850 ? -60.516 166.435 44.711  1.00 58.31  ? 850  GLY A O   1 
ATOM   6544 N N   . LEU A 1 851 ? -58.408 165.698 44.470  1.00 53.44  ? 851  LEU A N   1 
ATOM   6545 C CA  . LEU A 1 851 ? -58.380 165.939 43.033  1.00 54.04  ? 851  LEU A CA  1 
ATOM   6546 C C   . LEU A 1 851 ? -58.318 164.624 42.272  1.00 54.82  ? 851  LEU A C   1 
ATOM   6547 O O   . LEU A 1 851 ? -58.089 163.569 42.861  1.00 54.70  ? 851  LEU A O   1 
ATOM   6548 C CB  . LEU A 1 851 ? -57.174 166.801 42.668  1.00 52.75  ? 851  LEU A CB  1 
ATOM   6549 C CG  . LEU A 1 851 ? -57.031 168.075 43.501  1.00 54.16  ? 851  LEU A CG  1 
ATOM   6550 C CD1 . LEU A 1 851 ? -55.562 168.419 43.672  1.00 55.46  ? 851  LEU A CD1 1 
ATOM   6551 C CD2 . LEU A 1 851 ? -57.771 169.210 42.815  1.00 57.03  ? 851  LEU A CD2 1 
ATOM   6552 N N   . ASP A 1 852 ? -58.527 164.688 40.962  1.00 56.86  ? 852  ASP A N   1 
ATOM   6553 C CA  . ASP A 1 852 ? -58.488 163.492 40.134  1.00 62.91  ? 852  ASP A CA  1 
ATOM   6554 C C   . ASP A 1 852 ? -57.407 163.648 39.075  1.00 60.48  ? 852  ASP A C   1 
ATOM   6555 O O   . ASP A 1 852 ? -57.224 162.788 38.212  1.00 58.51  ? 852  ASP A O   1 
ATOM   6556 C CB  . ASP A 1 852 ? -59.853 163.250 39.483  1.00 74.65  ? 852  ASP A CB  1 
ATOM   6557 C CG  . ASP A 1 852 ? -60.823 162.518 40.408  1.00 81.62  ? 852  ASP A CG  1 
ATOM   6558 O OD1 . ASP A 1 852 ? -60.380 161.594 41.129  1.00 83.25  ? 852  ASP A OD1 1 
ATOM   6559 O OD2 . ASP A 1 852 ? -62.025 162.865 40.412  1.00 83.16  ? 852  ASP A OD2 1 
ATOM   6560 N N   . ARG A 1 853 ? -56.701 164.768 39.156  1.00 58.86  ? 853  ARG A N   1 
ATOM   6561 C CA  . ARG A 1 853 ? -55.603 165.079 38.253  1.00 60.97  ? 853  ARG A CA  1 
ATOM   6562 C C   . ARG A 1 853 ? -54.765 166.140 38.946  1.00 58.87  ? 853  ARG A C   1 
ATOM   6563 O O   . ARG A 1 853 ? -55.292 167.167 39.375  1.00 58.39  ? 853  ARG A O   1 
ATOM   6564 C CB  . ARG A 1 853 ? -56.120 165.617 36.923  1.00 68.20  ? 853  ARG A CB  1 
ATOM   6565 C CG  . ARG A 1 853 ? -55.062 166.354 36.106  1.00 79.98  ? 853  ARG A CG  1 
ATOM   6566 C CD  . ARG A 1 853 ? -54.504 165.482 34.991  1.00 89.67  ? 853  ARG A CD  1 
ATOM   6567 N NE  . ARG A 1 853 ? -54.272 166.246 33.767  1.00 95.19  ? 853  ARG A NE  1 
ATOM   6568 C CZ  . ARG A 1 853 ? -53.075 166.444 33.224  1.00 96.84  ? 853  ARG A CZ  1 
ATOM   6569 N NH1 . ARG A 1 853 ? -51.994 165.932 33.798  1.00 98.10  ? 853  ARG A NH1 1 
ATOM   6570 N NH2 . ARG A 1 853 ? -52.957 167.153 32.108  1.00 95.97  ? 853  ARG A NH2 1 
ATOM   6571 N N   . LEU A 1 854 ? -53.465 165.893 39.054  1.00 55.76  ? 854  LEU A N   1 
ATOM   6572 C CA  . LEU A 1 854 ? -52.576 166.833 39.721  1.00 49.81  ? 854  LEU A CA  1 
ATOM   6573 C C   . LEU A 1 854 ? -51.302 167.115 38.945  1.00 42.34  ? 854  LEU A C   1 
ATOM   6574 O O   . LEU A 1 854 ? -50.632 166.203 38.468  1.00 39.49  ? 854  LEU A O   1 
ATOM   6575 C CB  . LEU A 1 854 ? -52.214 166.301 41.115  1.00 54.17  ? 854  LEU A CB  1 
ATOM   6576 C CG  . LEU A 1 854 ? -51.105 167.027 41.884  1.00 55.99  ? 854  LEU A CG  1 
ATOM   6577 C CD1 . LEU A 1 854 ? -51.471 168.494 42.040  1.00 58.52  ? 854  LEU A CD1 1 
ATOM   6578 C CD2 . LEU A 1 854 ? -50.908 166.379 43.246  1.00 56.52  ? 854  LEU A CD2 1 
ATOM   6579 N N   . ASN A 1 855 ? -50.975 168.391 38.814  1.00 37.87  ? 855  ASN A N   1 
ATOM   6580 C CA  . ASN A 1 855 ? -49.759 168.785 38.124  1.00 40.41  ? 855  ASN A CA  1 
ATOM   6581 C C   . ASN A 1 855 ? -48.858 169.384 39.176  1.00 37.87  ? 855  ASN A C   1 
ATOM   6582 O O   . ASN A 1 855 ? -49.145 170.449 39.719  1.00 42.13  ? 855  ASN A O   1 
ATOM   6583 C CB  . ASN A 1 855 ? -50.068 169.812 37.047  1.00 45.85  ? 855  ASN A CB  1 
ATOM   6584 C CG  . ASN A 1 855 ? -51.126 169.334 36.095  1.00 49.15  ? 855  ASN A CG  1 
ATOM   6585 O OD1 . ASN A 1 855 ? -50.833 168.610 35.145  1.00 52.39  ? 855  ASN A OD1 1 
ATOM   6586 N ND2 . ASN A 1 855 ? -52.371 169.718 36.351  1.00 53.28  ? 855  ASN A ND2 1 
ATOM   6587 N N   . VAL A 1 856 ? -47.770 168.691 39.473  1.00 34.48  ? 856  VAL A N   1 
ATOM   6588 C CA  . VAL A 1 856 ? -46.848 169.153 40.490  1.00 26.60  ? 856  VAL A CA  1 
ATOM   6589 C C   . VAL A 1 856 ? -45.426 169.000 40.001  1.00 26.36  ? 856  VAL A C   1 
ATOM   6590 O O   . VAL A 1 856 ? -45.114 168.058 39.274  1.00 25.90  ? 856  VAL A O   1 
ATOM   6591 C CB  . VAL A 1 856 ? -47.033 168.337 41.789  1.00 27.99  ? 856  VAL A CB  1 
ATOM   6592 C CG1 . VAL A 1 856 ? -46.917 166.835 41.488  1.00 19.99  ? 856  VAL A CG1 1 
ATOM   6593 C CG2 . VAL A 1 856 ? -46.017 168.770 42.823  1.00 25.82  ? 856  VAL A CG2 1 
ATOM   6594 N N   . THR A 1 857 ? -44.567 169.942 40.373  1.00 26.64  ? 857  THR A N   1 
ATOM   6595 C CA  . THR A 1 857 ? -43.164 169.861 39.988  1.00 24.46  ? 857  THR A CA  1 
ATOM   6596 C C   . THR A 1 857 ? -42.384 169.454 41.225  1.00 27.30  ? 857  THR A C   1 
ATOM   6597 O O   . THR A 1 857 ? -42.776 169.789 42.348  1.00 27.71  ? 857  THR A O   1 
ATOM   6598 C CB  . THR A 1 857 ? -42.616 171.202 39.508  1.00 17.73  ? 857  THR A CB  1 
ATOM   6599 O OG1 . THR A 1 857 ? -43.282 171.585 38.302  1.00 30.26  ? 857  THR A OG1 1 
ATOM   6600 C CG2 . THR A 1 857 ? -41.124 171.094 39.235  1.00 11.14  ? 857  THR A CG2 1 
ATOM   6601 N N   . VAL A 1 858 ? -41.294 168.722 41.021  1.00 23.64  ? 858  VAL A N   1 
ATOM   6602 C CA  . VAL A 1 858 ? -40.457 168.289 42.126  1.00 20.15  ? 858  VAL A CA  1 
ATOM   6603 C C   . VAL A 1 858 ? -39.056 168.849 41.937  1.00 19.80  ? 858  VAL A C   1 
ATOM   6604 O O   . VAL A 1 858 ? -38.496 168.771 40.844  1.00 16.29  ? 858  VAL A O   1 
ATOM   6605 C CB  . VAL A 1 858 ? -40.371 166.748 42.201  1.00 22.82  ? 858  VAL A CB  1 
ATOM   6606 C CG1 . VAL A 1 858 ? -39.378 166.334 43.277  1.00 18.42  ? 858  VAL A CG1 1 
ATOM   6607 C CG2 . VAL A 1 858 ? -41.744 166.162 42.500  1.00 21.50  ? 858  VAL A CG2 1 
ATOM   6608 N N   . GLY A 1 859 ? -38.503 169.430 42.998  1.00 16.42  ? 859  GLY A N   1 
ATOM   6609 C CA  . GLY A 1 859 ? -37.154 169.965 42.921  1.00 16.01  ? 859  GLY A CA  1 
ATOM   6610 C C   . GLY A 1 859 ? -36.202 168.906 43.440  1.00 16.47  ? 859  GLY A C   1 
ATOM   6611 O O   . GLY A 1 859 ? -36.362 168.448 44.568  1.00 16.12  ? 859  GLY A O   1 
ATOM   6612 N N   . VAL A 1 860 ? -35.224 168.507 42.628  1.00 14.61  ? 860  VAL A N   1 
ATOM   6613 C CA  . VAL A 1 860 ? -34.278 167.482 43.043  1.00 17.37  ? 860  VAL A CA  1 
ATOM   6614 C C   . VAL A 1 860 ? -32.827 167.914 42.948  1.00 18.33  ? 860  VAL A C   1 
ATOM   6615 O O   . VAL A 1 860 ? -32.478 168.813 42.185  1.00 19.36  ? 860  VAL A O   1 
ATOM   6616 C CB  . VAL A 1 860 ? -34.424 166.194 42.208  1.00 15.36  ? 860  VAL A CB  1 
ATOM   6617 C CG1 . VAL A 1 860 ? -35.779 165.572 42.433  1.00 24.77  ? 860  VAL A CG1 1 
ATOM   6618 C CG2 . VAL A 1 860 ? -34.230 166.509 40.754  1.00 21.64  ? 860  VAL A CG2 1 
ATOM   6619 N N   . ASP A 1 861 ? -31.989 167.237 43.726  1.00 17.14  ? 861  ASP A N   1 
ATOM   6620 C CA  . ASP A 1 861 ? -30.559 167.489 43.774  1.00 13.96  ? 861  ASP A CA  1 
ATOM   6621 C C   . ASP A 1 861 ? -29.924 166.186 44.229  1.00 13.67  ? 861  ASP A C   1 
ATOM   6622 O O   . ASP A 1 861 ? -30.622 165.277 44.665  1.00 18.94  ? 861  ASP A O   1 
ATOM   6623 C CB  . ASP A 1 861 ? -30.255 168.592 44.782  1.00 17.28  ? 861  ASP A CB  1 
ATOM   6624 C CG  . ASP A 1 861 ? -28.955 169.315 44.490  1.00 23.55  ? 861  ASP A CG  1 
ATOM   6625 O OD1 . ASP A 1 861 ? -28.280 168.966 43.495  1.00 18.49  ? 861  ASP A OD1 1 
ATOM   6626 O OD2 . ASP A 1 861 ? -28.610 170.242 45.262  1.00 29.05  ? 861  ASP A OD2 1 
ATOM   6627 N N   . GLY A 1 862 ? -28.607 166.089 44.131  1.00 12.20  ? 862  GLY A N   1 
ATOM   6628 C CA  . GLY A 1 862 ? -27.938 164.873 44.544  1.00 13.61  ? 862  GLY A CA  1 
ATOM   6629 C C   . GLY A 1 862 ? -26.987 164.411 43.468  1.00 19.91  ? 862  GLY A C   1 
ATOM   6630 O O   . GLY A 1 862 ? -27.345 164.385 42.298  1.00 26.84  ? 862  GLY A O   1 
ATOM   6631 N N   . THR A 1 863 ? -25.776 164.040 43.861  1.00 23.26  ? 863  THR A N   1 
ATOM   6632 C CA  . THR A 1 863 ? -24.763 163.591 42.920  1.00 25.24  ? 863  THR A CA  1 
ATOM   6633 C C   . THR A 1 863 ? -25.128 162.343 42.117  1.00 26.46  ? 863  THR A C   1 
ATOM   6634 O O   . THR A 1 863 ? -24.635 162.170 41.008  1.00 35.94  ? 863  THR A O   1 
ATOM   6635 C CB  . THR A 1 863 ? -23.433 163.327 43.635  1.00 27.83  ? 863  THR A CB  1 
ATOM   6636 O OG1 . THR A 1 863 ? -23.668 162.515 44.792  1.00 38.95  ? 863  THR A OG1 1 
ATOM   6637 C CG2 . THR A 1 863 ? -22.793 164.628 44.061  1.00 27.11  ? 863  THR A CG2 1 
ATOM   6638 N N   . LEU A 1 864 ? -25.968 161.466 42.658  1.00 23.00  ? 864  LEU A N   1 
ATOM   6639 C CA  . LEU A 1 864 ? -26.346 160.261 41.916  1.00 20.84  ? 864  LEU A CA  1 
ATOM   6640 C C   . LEU A 1 864 ? -27.382 160.597 40.847  1.00 22.48  ? 864  LEU A C   1 
ATOM   6641 O O   . LEU A 1 864 ? -27.251 160.190 39.695  1.00 23.10  ? 864  LEU A O   1 
ATOM   6642 C CB  . LEU A 1 864 ? -26.909 159.184 42.854  1.00 16.21  ? 864  LEU A CB  1 
ATOM   6643 C CG  . LEU A 1 864 ? -27.499 157.934 42.188  1.00 7.18   ? 864  LEU A CG  1 
ATOM   6644 C CD1 . LEU A 1 864 ? -26.405 157.066 41.596  1.00 6.41   ? 864  LEU A CD1 1 
ATOM   6645 C CD2 . LEU A 1 864 ? -28.262 157.154 43.206  1.00 5.26   ? 864  LEU A CD2 1 
ATOM   6646 N N   . TYR A 1 865 ? -28.413 161.340 41.235  1.00 22.67  ? 865  TYR A N   1 
ATOM   6647 C CA  . TYR A 1 865 ? -29.465 161.734 40.304  1.00 25.36  ? 865  TYR A CA  1 
ATOM   6648 C C   . TYR A 1 865 ? -28.873 162.583 39.176  1.00 25.46  ? 865  TYR A C   1 
ATOM   6649 O O   . TYR A 1 865 ? -29.196 162.410 38.004  1.00 29.65  ? 865  TYR A O   1 
ATOM   6650 C CB  . TYR A 1 865 ? -30.546 162.533 41.045  1.00 20.36  ? 865  TYR A CB  1 
ATOM   6651 C CG  . TYR A 1 865 ? -31.634 163.091 40.151  1.00 21.02  ? 865  TYR A CG  1 
ATOM   6652 C CD1 . TYR A 1 865 ? -31.443 164.278 39.446  1.00 17.80  ? 865  TYR A CD1 1 
ATOM   6653 C CD2 . TYR A 1 865 ? -32.847 162.416 39.983  1.00 25.51  ? 865  TYR A CD2 1 
ATOM   6654 C CE1 . TYR A 1 865 ? -32.427 164.780 38.594  1.00 18.87  ? 865  TYR A CE1 1 
ATOM   6655 C CE2 . TYR A 1 865 ? -33.840 162.911 39.130  1.00 23.32  ? 865  TYR A CE2 1 
ATOM   6656 C CZ  . TYR A 1 865 ? -33.617 164.091 38.438  1.00 18.12  ? 865  TYR A CZ  1 
ATOM   6657 O OH  . TYR A 1 865 ? -34.569 164.576 37.578  1.00 17.08  ? 865  TYR A OH  1 
ATOM   6658 N N   . LYS A 1 866 ? -27.990 163.491 39.555  1.00 25.48  ? 866  LYS A N   1 
ATOM   6659 C CA  . LYS A 1 866 ? -27.343 164.403 38.629  1.00 22.35  ? 866  LYS A CA  1 
ATOM   6660 C C   . LYS A 1 866 ? -26.295 163.751 37.731  1.00 23.09  ? 866  LYS A C   1 
ATOM   6661 O O   . LYS A 1 866 ? -26.366 163.862 36.514  1.00 34.19  ? 866  LYS A O   1 
ATOM   6662 C CB  . LYS A 1 866 ? -26.722 165.545 39.438  1.00 23.12  ? 866  LYS A CB  1 
ATOM   6663 C CG  . LYS A 1 866 ? -25.783 166.446 38.692  1.00 33.02  ? 866  LYS A CG  1 
ATOM   6664 C CD  . LYS A 1 866 ? -25.366 167.599 39.591  1.00 40.96  ? 866  LYS A CD  1 
ATOM   6665 C CE  . LYS A 1 866 ? -25.259 168.905 38.818  1.00 46.38  ? 866  LYS A CE  1 
ATOM   6666 N NZ  . LYS A 1 866 ? -23.956 169.594 39.076  1.00 53.29  ? 866  LYS A NZ  1 
ATOM   6667 N N   . LEU A 1 867 ? -25.330 163.062 38.325  1.00 24.43  ? 867  LEU A N   1 
ATOM   6668 C CA  . LEU A 1 867 ? -24.253 162.432 37.561  1.00 23.21  ? 867  LEU A CA  1 
ATOM   6669 C C   . LEU A 1 867 ? -24.588 161.149 36.816  1.00 25.64  ? 867  LEU A C   1 
ATOM   6670 O O   . LEU A 1 867 ? -24.004 160.870 35.776  1.00 29.76  ? 867  LEU A O   1 
ATOM   6671 C CB  . LEU A 1 867 ? -23.055 162.145 38.477  1.00 23.64  ? 867  LEU A CB  1 
ATOM   6672 C CG  . LEU A 1 867 ? -22.233 163.328 38.998  1.00 27.20  ? 867  LEU A CG  1 
ATOM   6673 C CD1 . LEU A 1 867 ? -20.786 162.911 39.158  1.00 31.57  ? 867  LEU A CD1 1 
ATOM   6674 C CD2 . LEU A 1 867 ? -22.337 164.498 38.042  1.00 35.15  ? 867  LEU A CD2 1 
ATOM   6675 N N   . HIS A 1 868 ? -25.515 160.359 37.342  1.00 27.62  ? 868  HIS A N   1 
ATOM   6676 C CA  . HIS A 1 868 ? -25.852 159.084 36.717  1.00 24.80  ? 868  HIS A CA  1 
ATOM   6677 C C   . HIS A 1 868 ? -26.576 159.162 35.379  1.00 28.31  ? 868  HIS A C   1 
ATOM   6678 O O   . HIS A 1 868 ? -27.557 159.894 35.235  1.00 25.11  ? 868  HIS A O   1 
ATOM   6679 C CB  . HIS A 1 868 ? -26.669 158.219 37.677  1.00 22.97  ? 868  HIS A CB  1 
ATOM   6680 C CG  . HIS A 1 868 ? -26.630 156.762 37.343  1.00 15.37  ? 868  HIS A CG  1 
ATOM   6681 N ND1 . HIS A 1 868 ? -27.533 156.170 36.489  1.00 15.34  ? 868  HIS A ND1 1 
ATOM   6682 C CD2 . HIS A 1 868 ? -25.767 155.789 37.716  1.00 11.07  ? 868  HIS A CD2 1 
ATOM   6683 C CE1 . HIS A 1 868 ? -27.230 154.893 36.348  1.00 17.67  ? 868  HIS A CE1 1 
ATOM   6684 N NE2 . HIS A 1 868 ? -26.161 154.635 37.083  1.00 12.72  ? 868  HIS A NE2 1 
ATOM   6685 N N   . PRO A 1 869 ? -26.107 158.377 34.387  1.00 32.24  ? 869  PRO A N   1 
ATOM   6686 C CA  . PRO A 1 869 ? -26.656 158.301 33.027  1.00 28.50  ? 869  PRO A CA  1 
ATOM   6687 C C   . PRO A 1 869 ? -28.129 157.916 32.910  1.00 31.19  ? 869  PRO A C   1 
ATOM   6688 O O   . PRO A 1 869 ? -28.844 158.475 32.082  1.00 36.02  ? 869  PRO A O   1 
ATOM   6689 C CB  . PRO A 1 869 ? -25.770 157.266 32.335  1.00 22.50  ? 869  PRO A CB  1 
ATOM   6690 C CG  . PRO A 1 869 ? -24.532 157.224 33.131  1.00 23.70  ? 869  PRO A CG  1 
ATOM   6691 C CD  . PRO A 1 869 ? -24.948 157.479 34.541  1.00 30.96  ? 869  PRO A CD  1 
ATOM   6692 N N   . HIS A 1 870 ? -28.587 156.977 33.737  1.00 31.65  ? 870  HIS A N   1 
ATOM   6693 C CA  . HIS A 1 870 ? -29.969 156.513 33.638  1.00 28.79  ? 870  HIS A CA  1 
ATOM   6694 C C   . HIS A 1 870 ? -30.877 156.615 34.857  1.00 28.55  ? 870  HIS A C   1 
ATOM   6695 O O   . HIS A 1 870 ? -32.077 156.350 34.747  1.00 28.62  ? 870  HIS A O   1 
ATOM   6696 C CB  . HIS A 1 870 ? -29.984 155.059 33.153  1.00 27.43  ? 870  HIS A CB  1 
ATOM   6697 C CG  . HIS A 1 870 ? -28.841 154.709 32.256  1.00 28.23  ? 870  HIS A CG  1 
ATOM   6698 N ND1 . HIS A 1 870 ? -28.800 155.073 30.927  1.00 33.70  ? 870  HIS A ND1 1 
ATOM   6699 C CD2 . HIS A 1 870 ? -27.691 154.037 32.496  1.00 27.84  ? 870  HIS A CD2 1 
ATOM   6700 C CE1 . HIS A 1 870 ? -27.673 154.642 30.390  1.00 28.67  ? 870  HIS A CE1 1 
ATOM   6701 N NE2 . HIS A 1 870 ? -26.982 154.009 31.322  1.00 33.53  ? 870  HIS A NE2 1 
ATOM   6702 N N   . PHE A 1 871 ? -30.342 157.000 36.010  1.00 23.91  ? 871  PHE A N   1 
ATOM   6703 C CA  . PHE A 1 871 ? -31.180 157.075 37.194  1.00 18.06  ? 871  PHE A CA  1 
ATOM   6704 C C   . PHE A 1 871 ? -32.419 157.946 37.037  1.00 21.91  ? 871  PHE A C   1 
ATOM   6705 O O   . PHE A 1 871 ? -33.542 157.451 37.129  1.00 24.11  ? 871  PHE A O   1 
ATOM   6706 C CB  . PHE A 1 871 ? -30.387 157.559 38.401  1.00 18.15  ? 871  PHE A CB  1 
ATOM   6707 C CG  . PHE A 1 871 ? -31.135 157.414 39.693  1.00 19.32  ? 871  PHE A CG  1 
ATOM   6708 C CD1 . PHE A 1 871 ? -32.041 158.388 40.101  1.00 17.41  ? 871  PHE A CD1 1 
ATOM   6709 C CD2 . PHE A 1 871 ? -30.988 156.272 40.471  1.00 18.47  ? 871  PHE A CD2 1 
ATOM   6710 C CE1 . PHE A 1 871 ? -32.796 158.221 41.262  1.00 20.06  ? 871  PHE A CE1 1 
ATOM   6711 C CE2 . PHE A 1 871 ? -31.739 156.098 41.634  1.00 18.23  ? 871  PHE A CE2 1 
ATOM   6712 C CZ  . PHE A 1 871 ? -32.645 157.074 42.028  1.00 16.92  ? 871  PHE A CZ  1 
ATOM   6713 N N   . SER A 1 872 ? -32.218 159.240 36.806  1.00 22.61  ? 872  SER A N   1 
ATOM   6714 C CA  . SER A 1 872 ? -33.332 160.179 36.666  1.00 23.52  ? 872  SER A CA  1 
ATOM   6715 C C   . SER A 1 872 ? -34.385 159.751 35.651  1.00 22.87  ? 872  SER A C   1 
ATOM   6716 O O   . SER A 1 872 ? -35.575 159.931 35.882  1.00 21.79  ? 872  SER A O   1 
ATOM   6717 C CB  . SER A 1 872 ? -32.813 161.569 36.298  1.00 24.73  ? 872  SER A CB  1 
ATOM   6718 O OG  . SER A 1 872 ? -32.577 161.666 34.905  1.00 39.24  ? 872  SER A OG  1 
ATOM   6719 N N   . ARG A 1 873 ? -33.947 159.180 34.531  1.00 30.32  ? 873  ARG A N   1 
ATOM   6720 C CA  . ARG A 1 873 ? -34.870 158.736 33.481  1.00 31.20  ? 873  ARG A CA  1 
ATOM   6721 C C   . ARG A 1 873 ? -35.783 157.609 33.943  1.00 25.48  ? 873  ARG A C   1 
ATOM   6722 O O   . ARG A 1 873 ? -37.006 157.741 33.914  1.00 21.66  ? 873  ARG A O   1 
ATOM   6723 C CB  . ARG A 1 873 ? -34.095 158.273 32.242  1.00 38.56  ? 873  ARG A CB  1 
ATOM   6724 C CG  . ARG A 1 873 ? -34.973 157.604 31.185  1.00 48.06  ? 873  ARG A CG  1 
ATOM   6725 C CD  . ARG A 1 873 ? -34.159 157.119 29.997  1.00 53.91  ? 873  ARG A CD  1 
ATOM   6726 N NE  . ARG A 1 873 ? -33.587 155.793 30.223  1.00 60.11  ? 873  ARG A NE  1 
ATOM   6727 C CZ  . ARG A 1 873 ? -32.287 155.520 30.166  1.00 63.70  ? 873  ARG A CZ  1 
ATOM   6728 N NH1 . ARG A 1 873 ? -31.410 156.483 29.889  1.00 60.20  ? 873  ARG A NH1 1 
ATOM   6729 N NH2 . ARG A 1 873 ? -31.860 154.281 30.380  1.00 66.85  ? 873  ARG A NH2 1 
ATOM   6730 N N   . ILE A 1 874 ? -35.182 156.495 34.352  1.00 23.24  ? 874  ILE A N   1 
ATOM   6731 C CA  . ILE A 1 874 ? -35.942 155.345 34.828  1.00 17.81  ? 874  ILE A CA  1 
ATOM   6732 C C   . ILE A 1 874 ? -36.822 155.781 35.987  1.00 19.12  ? 874  ILE A C   1 
ATOM   6733 O O   . ILE A 1 874 ? -37.952 155.316 36.127  1.00 17.85  ? 874  ILE A O   1 
ATOM   6734 C CB  . ILE A 1 874 ? -35.014 154.206 35.316  1.00 11.68  ? 874  ILE A CB  1 
ATOM   6735 C CG1 . ILE A 1 874 ? -34.211 153.650 34.145  1.00 7.94   ? 874  ILE A CG1 1 
ATOM   6736 C CG2 . ILE A 1 874 ? -35.834 153.086 35.932  1.00 14.89  ? 874  ILE A CG2 1 
ATOM   6737 C CD1 . ILE A 1 874 ? -32.880 153.087 34.540  1.00 9.41   ? 874  ILE A CD1 1 
ATOM   6738 N N   . MET A 1 875 ? -36.288 156.676 36.815  1.00 21.04  ? 875  MET A N   1 
ATOM   6739 C CA  . MET A 1 875 ? -37.026 157.177 37.961  1.00 21.34  ? 875  MET A CA  1 
ATOM   6740 C C   . MET A 1 875 ? -38.306 157.798 37.449  1.00 20.65  ? 875  MET A C   1 
ATOM   6741 O O   . MET A 1 875 ? -39.398 157.447 37.892  1.00 20.93  ? 875  MET A O   1 
ATOM   6742 C CB  . MET A 1 875 ? -36.208 158.231 38.712  1.00 25.18  ? 875  MET A CB  1 
ATOM   6743 C CG  . MET A 1 875 ? -36.584 158.390 40.186  1.00 24.85  ? 875  MET A CG  1 
ATOM   6744 S SD  . MET A 1 875 ? -37.556 159.872 40.555  1.00 31.71  ? 875  MET A SD  1 
ATOM   6745 C CE  . MET A 1 875 ? -36.280 161.098 40.771  1.00 20.12  ? 875  MET A CE  1 
ATOM   6746 N N   . HIS A 1 876 ? -38.165 158.713 36.498  1.00 21.48  ? 876  HIS A N   1 
ATOM   6747 C CA  . HIS A 1 876 ? -39.316 159.398 35.934  1.00 30.87  ? 876  HIS A CA  1 
ATOM   6748 C C   . HIS A 1 876 ? -40.298 158.430 35.298  1.00 34.52  ? 876  HIS A C   1 
ATOM   6749 O O   . HIS A 1 876 ? -41.491 158.454 35.607  1.00 40.25  ? 876  HIS A O   1 
ATOM   6750 C CB  . HIS A 1 876 ? -38.855 160.438 34.921  1.00 35.12  ? 876  HIS A CB  1 
ATOM   6751 C CG  . HIS A 1 876 ? -37.910 161.450 35.491  1.00 40.06  ? 876  HIS A CG  1 
ATOM   6752 N ND1 . HIS A 1 876 ? -37.130 162.272 34.705  1.00 42.99  ? 876  HIS A ND1 1 
ATOM   6753 C CD2 . HIS A 1 876 ? -37.604 161.758 36.774  1.00 42.35  ? 876  HIS A CD2 1 
ATOM   6754 C CE1 . HIS A 1 876 ? -36.386 163.040 35.479  1.00 45.74  ? 876  HIS A CE1 1 
ATOM   6755 N NE2 . HIS A 1 876 ? -36.653 162.749 36.738  1.00 46.51  ? 876  HIS A NE2 1 
ATOM   6756 N N   . GLN A 1 877 ? -39.805 157.572 34.415  1.00 35.16  ? 877  GLN A N   1 
ATOM   6757 C CA  . GLN A 1 877 ? -40.676 156.602 33.771  1.00 38.39  ? 877  GLN A CA  1 
ATOM   6758 C C   . GLN A 1 877 ? -41.528 155.922 34.841  1.00 33.24  ? 877  GLN A C   1 
ATOM   6759 O O   . GLN A 1 877 ? -42.747 155.811 34.710  1.00 36.33  ? 877  GLN A O   1 
ATOM   6760 C CB  . GLN A 1 877 ? -39.845 155.555 33.012  1.00 49.70  ? 877  GLN A CB  1 
ATOM   6761 C CG  . GLN A 1 877 ? -39.127 156.096 31.756  1.00 64.88  ? 877  GLN A CG  1 
ATOM   6762 C CD  . GLN A 1 877 ? -38.155 155.087 31.123  1.00 72.00  ? 877  GLN A CD  1 
ATOM   6763 O OE1 . GLN A 1 877 ? -37.180 155.470 30.463  1.00 68.15  ? 877  GLN A OE1 1 
ATOM   6764 N NE2 . GLN A 1 877 ? -38.423 153.796 31.323  1.00 74.00  ? 877  GLN A NE2 1 
ATOM   6765 N N   . THR A 1 878 ? -40.882 155.508 35.922  1.00 27.43  ? 878  THR A N   1 
ATOM   6766 C CA  . THR A 1 878 ? -41.568 154.819 37.000  1.00 23.87  ? 878  THR A CA  1 
ATOM   6767 C C   . THR A 1 878 ? -42.653 155.611 37.723  1.00 29.42  ? 878  THR A C   1 
ATOM   6768 O O   . THR A 1 878 ? -43.731 155.078 37.989  1.00 33.00  ? 878  THR A O   1 
ATOM   6769 C CB  . THR A 1 878 ? -40.570 154.317 38.045  1.00 20.10  ? 878  THR A CB  1 
ATOM   6770 O OG1 . THR A 1 878 ? -39.567 153.513 37.410  1.00 24.16  ? 878  THR A OG1 1 
ATOM   6771 C CG2 . THR A 1 878 ? -41.286 153.488 39.092  1.00 23.22  ? 878  THR A CG2 1 
ATOM   6772 N N   . VAL A 1 879 ? -42.389 156.867 38.064  1.00 26.91  ? 879  VAL A N   1 
ATOM   6773 C CA  . VAL A 1 879 ? -43.407 157.647 38.765  1.00 28.76  ? 879  VAL A CA  1 
ATOM   6774 C C   . VAL A 1 879 ? -44.655 157.766 37.886  1.00 34.28  ? 879  VAL A C   1 
ATOM   6775 O O   . VAL A 1 879 ? -45.783 157.850 38.383  1.00 29.99  ? 879  VAL A O   1 
ATOM   6776 C CB  . VAL A 1 879 ? -42.892 159.062 39.128  1.00 26.36  ? 879  VAL A CB  1 
ATOM   6777 C CG1 . VAL A 1 879 ? -43.963 159.827 39.867  1.00 13.37  ? 879  VAL A CG1 1 
ATOM   6778 C CG2 . VAL A 1 879 ? -41.643 158.962 39.989  1.00 25.95  ? 879  VAL A CG2 1 
ATOM   6779 N N   . LYS A 1 880 ? -44.438 157.758 36.573  1.00 39.92  ? 880  LYS A N   1 
ATOM   6780 C CA  . LYS A 1 880 ? -45.523 157.854 35.598  1.00 40.00  ? 880  LYS A CA  1 
ATOM   6781 C C   . LYS A 1 880 ? -46.445 156.640 35.662  1.00 39.79  ? 880  LYS A C   1 
ATOM   6782 O O   . LYS A 1 880 ? -47.661 156.779 35.779  1.00 40.96  ? 880  LYS A O   1 
ATOM   6783 C CB  . LYS A 1 880 ? -44.946 157.972 34.190  1.00 40.26  ? 880  LYS A CB  1 
ATOM   6784 C CG  . LYS A 1 880 ? -45.820 158.729 33.216  1.00 44.81  ? 880  LYS A CG  1 
ATOM   6785 C CD  . LYS A 1 880 ? -45.165 158.794 31.850  1.00 50.03  ? 880  LYS A CD  1 
ATOM   6786 C CE  . LYS A 1 880 ? -45.471 160.109 31.159  1.00 56.46  ? 880  LYS A CE  1 
ATOM   6787 N NZ  . LYS A 1 880 ? -44.910 160.144 29.778  1.00 64.75  ? 880  LYS A NZ  1 
ATOM   6788 N N   . GLU A 1 881 ? -45.855 155.450 35.586  1.00 38.01  ? 881  GLU A N   1 
ATOM   6789 C CA  . GLU A 1 881 ? -46.609 154.201 35.625  1.00 37.40  ? 881  GLU A CA  1 
ATOM   6790 C C   . GLU A 1 881 ? -47.437 154.008 36.891  1.00 36.37  ? 881  GLU A C   1 
ATOM   6791 O O   . GLU A 1 881 ? -48.605 153.626 36.824  1.00 40.86  ? 881  GLU A O   1 
ATOM   6792 C CB  . GLU A 1 881 ? -45.656 153.014 35.488  1.00 39.13  ? 881  GLU A CB  1 
ATOM   6793 C CG  . GLU A 1 881 ? -45.519 152.472 34.083  1.00 55.86  ? 881  GLU A CG  1 
ATOM   6794 C CD  . GLU A 1 881 ? -44.190 151.773 33.865  1.00 63.52  ? 881  GLU A CD  1 
ATOM   6795 O OE1 . GLU A 1 881 ? -43.845 150.885 34.677  1.00 64.51  ? 881  GLU A OE1 1 
ATOM   6796 O OE2 . GLU A 1 881 ? -43.492 152.114 32.884  1.00 66.91  ? 881  GLU A OE2 1 
ATOM   6797 N N   . LEU A 1 882 ? -46.829 154.272 38.043  1.00 36.55  ? 882  LEU A N   1 
ATOM   6798 C CA  . LEU A 1 882 ? -47.494 154.077 39.328  1.00 32.81  ? 882  LEU A CA  1 
ATOM   6799 C C   . LEU A 1 882 ? -48.417 155.202 39.756  1.00 32.88  ? 882  LEU A C   1 
ATOM   6800 O O   . LEU A 1 882 ? -49.263 155.012 40.620  1.00 34.30  ? 882  LEU A O   1 
ATOM   6801 C CB  . LEU A 1 882 ? -46.452 153.829 40.427  1.00 31.23  ? 882  LEU A CB  1 
ATOM   6802 C CG  . LEU A 1 882 ? -45.203 153.038 40.034  1.00 25.39  ? 882  LEU A CG  1 
ATOM   6803 C CD1 . LEU A 1 882 ? -44.148 153.228 41.099  1.00 30.58  ? 882  LEU A CD1 1 
ATOM   6804 C CD2 . LEU A 1 882 ? -45.545 151.562 39.871  1.00 26.43  ? 882  LEU A CD2 1 
ATOM   6805 N N   . SER A 1 883 ? -48.253 156.380 39.174  1.00 36.06  ? 883  SER A N   1 
ATOM   6806 C CA  . SER A 1 883 ? -49.111 157.505 39.530  1.00 43.17  ? 883  SER A CA  1 
ATOM   6807 C C   . SER A 1 883 ? -49.530 158.242 38.262  1.00 46.70  ? 883  SER A C   1 
ATOM   6808 O O   . SER A 1 883 ? -48.974 159.291 37.919  1.00 52.84  ? 883  SER A O   1 
ATOM   6809 C CB  . SER A 1 883 ? -48.378 158.451 40.485  1.00 42.13  ? 883  SER A CB  1 
ATOM   6810 O OG  . SER A 1 883 ? -48.709 158.153 41.830  1.00 39.20  ? 883  SER A OG  1 
ATOM   6811 N N   . PRO A 1 884 ? -50.524 157.695 37.549  1.00 43.82  ? 884  PRO A N   1 
ATOM   6812 C CA  . PRO A 1 884 ? -51.018 158.293 36.309  1.00 41.63  ? 884  PRO A CA  1 
ATOM   6813 C C   . PRO A 1 884 ? -52.001 159.439 36.498  1.00 40.46  ? 884  PRO A C   1 
ATOM   6814 O O   . PRO A 1 884 ? -52.256 160.196 35.567  1.00 46.07  ? 884  PRO A O   1 
ATOM   6815 C CB  . PRO A 1 884 ? -51.635 157.114 35.558  1.00 43.02  ? 884  PRO A CB  1 
ATOM   6816 C CG  . PRO A 1 884 ? -51.666 155.951 36.550  1.00 45.02  ? 884  PRO A CG  1 
ATOM   6817 C CD  . PRO A 1 884 ? -51.253 156.464 37.887  1.00 42.19  ? 884  PRO A CD  1 
ATOM   6818 N N   . LYS A 1 885 ? -52.563 159.568 37.692  1.00 35.40  ? 885  LYS A N   1 
ATOM   6819 C CA  . LYS A 1 885 ? -53.494 160.658 37.947  1.00 38.47  ? 885  LYS A CA  1 
ATOM   6820 C C   . LYS A 1 885 ? -52.698 161.917 38.273  1.00 43.23  ? 885  LYS A C   1 
ATOM   6821 O O   . LYS A 1 885 ? -53.268 162.974 38.554  1.00 43.84  ? 885  LYS A O   1 
ATOM   6822 C CB  . LYS A 1 885 ? -54.409 160.315 39.122  1.00 43.12  ? 885  LYS A CB  1 
ATOM   6823 C CG  . LYS A 1 885 ? -55.074 158.960 39.010  1.00 50.52  ? 885  LYS A CG  1 
ATOM   6824 C CD  . LYS A 1 885 ? -56.121 158.959 37.916  1.00 60.65  ? 885  LYS A CD  1 
ATOM   6825 C CE  . LYS A 1 885 ? -57.420 159.570 38.411  1.00 69.78  ? 885  LYS A CE  1 
ATOM   6826 N NZ  . LYS A 1 885 ? -58.165 158.631 39.296  1.00 76.77  ? 885  LYS A NZ  1 
ATOM   6827 N N   . CYS A 1 886 ? -51.374 161.794 38.232  1.00 47.45  ? 886  CYS A N   1 
ATOM   6828 C CA  . CYS A 1 886 ? -50.479 162.906 38.540  1.00 47.57  ? 886  CYS A CA  1 
ATOM   6829 C C   . CYS A 1 886 ? -49.529 163.204 37.394  1.00 49.01  ? 886  CYS A C   1 
ATOM   6830 O O   . CYS A 1 886 ? -48.951 162.294 36.794  1.00 51.23  ? 886  CYS A O   1 
ATOM   6831 C CB  . CYS A 1 886 ? -49.640 162.602 39.792  1.00 45.08  ? 886  CYS A CB  1 
ATOM   6832 S SG  . CYS A 1 886 ? -50.556 162.260 41.309  1.00 40.27  ? 886  CYS A SG  1 
ATOM   6833 N N   . ASN A 1 887 ? -49.370 164.488 37.101  1.00 52.65  ? 887  ASN A N   1 
ATOM   6834 C CA  . ASN A 1 887 ? -48.463 164.936 36.055  1.00 55.81  ? 887  ASN A CA  1 
ATOM   6835 C C   . ASN A 1 887 ? -47.335 165.636 36.795  1.00 51.66  ? 887  ASN A C   1 
ATOM   6836 O O   . ASN A 1 887 ? -47.377 166.847 37.022  1.00 53.18  ? 887  ASN A O   1 
ATOM   6837 C CB  . ASN A 1 887 ? -49.168 165.916 35.115  1.00 67.87  ? 887  ASN A CB  1 
ATOM   6838 C CG  . ASN A 1 887 ? -48.275 166.372 33.973  1.00 79.54  ? 887  ASN A CG  1 
ATOM   6839 O OD1 . ASN A 1 887 ? -47.185 165.832 33.767  1.00 85.75  ? 887  ASN A OD1 1 
ATOM   6840 N ND2 . ASN A 1 887 ? -48.732 167.374 33.225  1.00 87.23  ? 887  ASN A ND2 1 
ATOM   6841 N N   . VAL A 1 888 ? -46.330 164.862 37.179  1.00 47.28  ? 888  VAL A N   1 
ATOM   6842 C CA  . VAL A 1 888 ? -45.211 165.399 37.935  1.00 44.51  ? 888  VAL A CA  1 
ATOM   6843 C C   . VAL A 1 888 ? -44.016 165.765 37.058  1.00 41.48  ? 888  VAL A C   1 
ATOM   6844 O O   . VAL A 1 888 ? -43.670 165.050 36.117  1.00 38.04  ? 888  VAL A O   1 
ATOM   6845 C CB  . VAL A 1 888 ? -44.799 164.403 39.065  1.00 41.87  ? 888  VAL A CB  1 
ATOM   6846 C CG1 . VAL A 1 888 ? -45.334 163.022 38.750  1.00 45.90  ? 888  VAL A CG1 1 
ATOM   6847 C CG2 . VAL A 1 888 ? -43.291 164.371 39.240  1.00 40.22  ? 888  VAL A CG2 1 
ATOM   6848 N N   . SER A 1 889 ? -43.401 166.901 37.372  1.00 40.75  ? 889  SER A N   1 
ATOM   6849 C CA  . SER A 1 889 ? -42.249 167.384 36.626  1.00 37.85  ? 889  SER A CA  1 
ATOM   6850 C C   . SER A 1 889 ? -41.043 167.496 37.550  1.00 33.83  ? 889  SER A C   1 
ATOM   6851 O O   . SER A 1 889 ? -41.144 168.010 38.663  1.00 31.65  ? 889  SER A O   1 
ATOM   6852 C CB  . SER A 1 889 ? -42.563 168.743 35.998  1.00 42.79  ? 889  SER A CB  1 
ATOM   6853 O OG  . SER A 1 889 ? -43.957 168.876 35.753  1.00 53.55  ? 889  SER A OG  1 
ATOM   6854 N N   . PHE A 1 890 ? -39.903 167.011 37.076  1.00 27.52  ? 890  PHE A N   1 
ATOM   6855 C CA  . PHE A 1 890 ? -38.684 167.032 37.860  1.00 29.60  ? 890  PHE A CA  1 
ATOM   6856 C C   . PHE A 1 890 ? -37.690 168.077 37.380  1.00 31.14  ? 890  PHE A C   1 
ATOM   6857 O O   . PHE A 1 890 ? -37.279 168.070 36.222  1.00 39.55  ? 890  PHE A O   1 
ATOM   6858 C CB  . PHE A 1 890 ? -38.032 165.652 37.825  1.00 26.89  ? 890  PHE A CB  1 
ATOM   6859 C CG  . PHE A 1 890 ? -38.808 164.601 38.559  1.00 32.67  ? 890  PHE A CG  1 
ATOM   6860 C CD1 . PHE A 1 890 ? -39.789 163.865 37.910  1.00 28.18  ? 890  PHE A CD1 1 
ATOM   6861 C CD2 . PHE A 1 890 ? -38.548 164.338 39.902  1.00 35.43  ? 890  PHE A CD2 1 
ATOM   6862 C CE1 . PHE A 1 890 ? -40.496 162.881 38.584  1.00 34.06  ? 890  PHE A CE1 1 
ATOM   6863 C CE2 . PHE A 1 890 ? -39.252 163.355 40.587  1.00 32.64  ? 890  PHE A CE2 1 
ATOM   6864 C CZ  . PHE A 1 890 ? -40.227 162.624 39.928  1.00 35.37  ? 890  PHE A CZ  1 
ATOM   6865 N N   . LEU A 1 891 ? -37.301 168.974 38.279  1.00 28.93  ? 891  LEU A N   1 
ATOM   6866 C CA  . LEU A 1 891 ? -36.342 170.013 37.941  1.00 32.00  ? 891  LEU A CA  1 
ATOM   6867 C C   . LEU A 1 891 ? -35.123 169.937 38.842  1.00 32.02  ? 891  LEU A C   1 
ATOM   6868 O O   . LEU A 1 891 ? -35.253 169.916 40.064  1.00 38.07  ? 891  LEU A O   1 
ATOM   6869 C CB  . LEU A 1 891 ? -36.973 171.390 38.097  1.00 39.83  ? 891  LEU A CB  1 
ATOM   6870 C CG  . LEU A 1 891 ? -38.083 171.773 37.127  1.00 48.46  ? 891  LEU A CG  1 
ATOM   6871 C CD1 . LEU A 1 891 ? -38.581 173.164 37.494  1.00 51.80  ? 891  LEU A CD1 1 
ATOM   6872 C CD2 . LEU A 1 891 ? -37.569 171.727 35.688  1.00 51.90  ? 891  LEU A CD2 1 
ATOM   6873 N N   . LEU A 1 892 ? -33.935 169.890 38.249  1.00 31.20  ? 892  LEU A N   1 
ATOM   6874 C CA  . LEU A 1 892 ? -32.731 169.851 39.057  1.00 33.27  ? 892  LEU A CA  1 
ATOM   6875 C C   . LEU A 1 892 ? -32.620 171.217 39.717  1.00 36.57  ? 892  LEU A C   1 
ATOM   6876 O O   . LEU A 1 892 ? -32.467 172.228 39.038  1.00 42.31  ? 892  LEU A O   1 
ATOM   6877 C CB  . LEU A 1 892 ? -31.489 169.600 38.202  1.00 26.40  ? 892  LEU A CB  1 
ATOM   6878 C CG  . LEU A 1 892 ? -30.211 169.551 39.047  1.00 25.50  ? 892  LEU A CG  1 
ATOM   6879 C CD1 . LEU A 1 892 ? -30.055 168.165 39.633  1.00 25.37  ? 892  LEU A CD1 1 
ATOM   6880 C CD2 . LEU A 1 892 ? -29.005 169.915 38.218  1.00 18.25  ? 892  LEU A CD2 1 
ATOM   6881 N N   . SER A 1 893 ? -32.727 171.245 41.038  1.00 37.49  ? 893  SER A N   1 
ATOM   6882 C CA  . SER A 1 893 ? -32.625 172.489 41.781  1.00 34.35  ? 893  SER A CA  1 
ATOM   6883 C C   . SER A 1 893 ? -31.408 172.363 42.669  1.00 29.27  ? 893  SER A C   1 
ATOM   6884 O O   . SER A 1 893 ? -31.319 171.450 43.474  1.00 36.70  ? 893  SER A O   1 
ATOM   6885 C CB  . SER A 1 893 ? -33.876 172.703 42.623  1.00 37.07  ? 893  SER A CB  1 
ATOM   6886 O OG  . SER A 1 893 ? -35.013 172.844 41.788  1.00 48.86  ? 893  SER A OG  1 
ATOM   6887 N N   . GLU A 1 894 ? -30.467 173.281 42.522  1.00 28.57  ? 894  GLU A N   1 
ATOM   6888 C CA  . GLU A 1 894 ? -29.248 173.219 43.302  1.00 28.08  ? 894  GLU A CA  1 
ATOM   6889 C C   . GLU A 1 894 ? -29.114 174.280 44.380  1.00 28.22  ? 894  GLU A C   1 
ATOM   6890 O O   . GLU A 1 894 ? -29.835 175.283 44.391  1.00 24.11  ? 894  GLU A O   1 
ATOM   6891 C CB  . GLU A 1 894 ? -28.042 173.279 42.368  1.00 35.79  ? 894  GLU A CB  1 
ATOM   6892 C CG  . GLU A 1 894 ? -27.940 172.093 41.428  1.00 44.62  ? 894  GLU A CG  1 
ATOM   6893 C CD  . GLU A 1 894 ? -26.823 172.250 40.421  1.00 47.75  ? 894  GLU A CD  1 
ATOM   6894 O OE1 . GLU A 1 894 ? -26.860 173.223 39.637  1.00 54.32  ? 894  GLU A OE1 1 
ATOM   6895 O OE2 . GLU A 1 894 ? -25.908 171.401 40.417  1.00 51.01  ? 894  GLU A OE2 1 
ATOM   6896 N N   . ASP A 1 895 ? -28.167 174.033 45.282  1.00 27.82  ? 895  ASP A N   1 
ATOM   6897 C CA  . ASP A 1 895 ? -27.878 174.909 46.408  1.00 24.93  ? 895  ASP A CA  1 
ATOM   6898 C C   . ASP A 1 895 ? -29.074 175.140 47.319  1.00 26.11  ? 895  ASP A C   1 
ATOM   6899 O O   . ASP A 1 895 ? -29.387 176.276 47.670  1.00 28.99  ? 895  ASP A O   1 
ATOM   6900 C CB  . ASP A 1 895 ? -27.357 176.254 45.926  1.00 23.04  ? 895  ASP A CB  1 
ATOM   6901 C CG  . ASP A 1 895 ? -26.609 176.994 47.008  1.00 26.66  ? 895  ASP A CG  1 
ATOM   6902 O OD1 . ASP A 1 895 ? -25.706 176.389 47.613  1.00 30.20  ? 895  ASP A OD1 1 
ATOM   6903 O OD2 . ASP A 1 895 ? -26.919 178.174 47.259  1.00 29.21  ? 895  ASP A OD2 1 
ATOM   6904 N N   . GLY A 1 896 ? -29.743 174.061 47.705  1.00 24.77  ? 896  GLY A N   1 
ATOM   6905 C CA  . GLY A 1 896 ? -30.885 174.203 48.583  1.00 22.32  ? 896  GLY A CA  1 
ATOM   6906 C C   . GLY A 1 896 ? -30.408 174.513 49.983  1.00 20.28  ? 896  GLY A C   1 
ATOM   6907 O O   . GLY A 1 896 ? -31.193 174.925 50.834  1.00 22.74  ? 896  GLY A O   1 
ATOM   6908 N N   . SER A 1 897 ? -29.114 174.321 50.218  1.00 19.28  ? 897  SER A N   1 
ATOM   6909 C CA  . SER A 1 897 ? -28.523 174.560 51.526  1.00 17.54  ? 897  SER A CA  1 
ATOM   6910 C C   . SER A 1 897 ? -28.160 176.031 51.764  1.00 17.15  ? 897  SER A C   1 
ATOM   6911 O O   . SER A 1 897 ? -28.155 176.495 52.905  1.00 20.73  ? 897  SER A O   1 
ATOM   6912 C CB  . SER A 1 897 ? -27.297 173.662 51.709  1.00 20.86  ? 897  SER A CB  1 
ATOM   6913 O OG  . SER A 1 897 ? -26.232 174.058 50.868  1.00 28.88  ? 897  SER A OG  1 
ATOM   6914 N N   . GLY A 1 898 ? -27.852 176.752 50.690  1.00 13.94  ? 898  GLY A N   1 
ATOM   6915 C CA  . GLY A 1 898 ? -27.536 178.166 50.804  1.00 7.88   ? 898  GLY A CA  1 
ATOM   6916 C C   . GLY A 1 898 ? -28.742 178.964 50.331  1.00 13.97  ? 898  GLY A C   1 
ATOM   6917 O O   . GLY A 1 898 ? -29.542 179.432 51.136  1.00 20.17  ? 898  GLY A O   1 
ATOM   6918 N N   . LYS A 1 899 ? -28.882 179.106 49.018  1.00 15.47  ? 899  LYS A N   1 
ATOM   6919 C CA  . LYS A 1 899 ? -30.001 179.832 48.422  1.00 14.79  ? 899  LYS A CA  1 
ATOM   6920 C C   . LYS A 1 899 ? -31.327 179.429 49.071  1.00 16.77  ? 899  LYS A C   1 
ATOM   6921 O O   . LYS A 1 899 ? -32.176 180.280 49.353  1.00 22.50  ? 899  LYS A O   1 
ATOM   6922 C CB  . LYS A 1 899 ? -30.060 179.546 46.918  1.00 12.36  ? 899  LYS A CB  1 
ATOM   6923 C CG  . LYS A 1 899 ? -30.560 180.699 46.075  1.00 18.31  ? 899  LYS A CG  1 
ATOM   6924 C CD  . LYS A 1 899 ? -31.348 180.203 44.862  1.00 31.37  ? 899  LYS A CD  1 
ATOM   6925 C CE  . LYS A 1 899 ? -30.558 180.370 43.562  1.00 41.02  ? 899  LYS A CE  1 
ATOM   6926 N NZ  . LYS A 1 899 ? -29.990 179.082 43.044  1.00 44.32  ? 899  LYS A NZ  1 
ATOM   6927 N N   . GLY A 1 900 ? -31.506 178.133 49.305  1.00 14.06  ? 900  GLY A N   1 
ATOM   6928 C CA  . GLY A 1 900 ? -32.736 177.658 49.920  1.00 10.56  ? 900  GLY A CA  1 
ATOM   6929 C C   . GLY A 1 900 ? -32.940 178.173 51.338  1.00 14.35  ? 900  GLY A C   1 
ATOM   6930 O O   . GLY A 1 900 ? -34.018 178.652 51.684  1.00 15.88  ? 900  GLY A O   1 
ATOM   6931 N N   . ALA A 1 901 ? -31.904 178.070 52.166  1.00 13.72  ? 901  ALA A N   1 
ATOM   6932 C CA  . ALA A 1 901 ? -31.978 178.531 53.546  1.00 13.54  ? 901  ALA A CA  1 
ATOM   6933 C C   . ALA A 1 901 ? -32.323 180.019 53.589  1.00 15.83  ? 901  ALA A C   1 
ATOM   6934 O O   . ALA A 1 901 ? -33.024 180.476 54.488  1.00 19.43  ? 901  ALA A O   1 
ATOM   6935 C CB  . ALA A 1 901 ? -30.656 178.274 54.247  1.00 8.52   ? 901  ALA A CB  1 
ATOM   6936 N N   . ALA A 1 902 ? -31.831 180.771 52.610  1.00 16.82  ? 902  ALA A N   1 
ATOM   6937 C CA  . ALA A 1 902 ? -32.108 182.202 52.533  1.00 16.45  ? 902  ALA A CA  1 
ATOM   6938 C C   . ALA A 1 902 ? -33.570 182.423 52.159  1.00 20.30  ? 902  ALA A C   1 
ATOM   6939 O O   . ALA A 1 902 ? -34.251 183.267 52.743  1.00 23.55  ? 902  ALA A O   1 
ATOM   6940 C CB  . ALA A 1 902 ? -31.205 182.856 51.498  1.00 15.55  ? 902  ALA A CB  1 
ATOM   6941 N N   . LEU A 1 903 ? -34.054 181.664 51.183  1.00 20.39  ? 903  LEU A N   1 
ATOM   6942 C CA  . LEU A 1 903 ? -35.440 181.797 50.757  1.00 18.59  ? 903  LEU A CA  1 
ATOM   6943 C C   . LEU A 1 903 ? -36.386 181.433 51.889  1.00 17.05  ? 903  LEU A C   1 
ATOM   6944 O O   . LEU A 1 903 ? -37.467 182.008 52.017  1.00 18.24  ? 903  LEU A O   1 
ATOM   6945 C CB  . LEU A 1 903 ? -35.710 180.914 49.541  1.00 13.84  ? 903  LEU A CB  1 
ATOM   6946 C CG  . LEU A 1 903 ? -35.274 181.571 48.228  1.00 19.53  ? 903  LEU A CG  1 
ATOM   6947 C CD1 . LEU A 1 903 ? -35.605 180.676 47.050  1.00 24.38  ? 903  LEU A CD1 1 
ATOM   6948 C CD2 . LEU A 1 903 ? -35.968 182.911 48.089  1.00 16.73  ? 903  LEU A CD2 1 
ATOM   6949 N N   . ILE A 1 904 ? -35.979 180.481 52.720  1.00 17.80  ? 904  ILE A N   1 
ATOM   6950 C CA  . ILE A 1 904 ? -36.814 180.075 53.841  1.00 14.55  ? 904  ILE A CA  1 
ATOM   6951 C C   . ILE A 1 904 ? -36.851 181.216 54.843  1.00 17.74  ? 904  ILE A C   1 
ATOM   6952 O O   . ILE A 1 904 ? -37.880 181.461 55.467  1.00 12.65  ? 904  ILE A O   1 
ATOM   6953 C CB  . ILE A 1 904 ? -36.270 178.800 54.511  1.00 14.90  ? 904  ILE A CB  1 
ATOM   6954 C CG1 . ILE A 1 904 ? -36.530 177.601 53.592  1.00 8.72   ? 904  ILE A CG1 1 
ATOM   6955 C CG2 . ILE A 1 904 ? -36.909 178.611 55.892  1.00 7.35   ? 904  ILE A CG2 1 
ATOM   6956 C CD1 . ILE A 1 904 ? -36.204 176.267 54.203  1.00 10.56  ? 904  ILE A CD1 1 
ATOM   6957 N N   . THR A 1 905 ? -35.723 181.918 54.972  1.00 20.67  ? 905  THR A N   1 
ATOM   6958 C CA  . THR A 1 905 ? -35.596 183.061 55.879  1.00 21.83  ? 905  THR A CA  1 
ATOM   6959 C C   . THR A 1 905 ? -36.438 184.246 55.415  1.00 27.40  ? 905  THR A C   1 
ATOM   6960 O O   . THR A 1 905 ? -37.108 184.895 56.219  1.00 31.94  ? 905  THR A O   1 
ATOM   6961 C CB  . THR A 1 905 ? -34.146 183.539 55.969  1.00 17.56  ? 905  THR A CB  1 
ATOM   6962 O OG1 . THR A 1 905 ? -33.288 182.411 56.141  1.00 18.64  ? 905  THR A OG1 1 
ATOM   6963 C CG2 . THR A 1 905 ? -33.970 184.489 57.141  1.00 21.61  ? 905  THR A CG2 1 
ATOM   6964 N N   . ALA A 1 906 ? -36.380 184.532 54.117  1.00 29.72  ? 906  ALA A N   1 
ATOM   6965 C CA  . ALA A 1 906 ? -37.130 185.635 53.530  1.00 29.69  ? 906  ALA A CA  1 
ATOM   6966 C C   . ALA A 1 906 ? -38.619 185.418 53.732  1.00 29.76  ? 906  ALA A C   1 
ATOM   6967 O O   . ALA A 1 906 ? -39.349 186.348 54.070  1.00 33.74  ? 906  ALA A O   1 
ATOM   6968 C CB  . ALA A 1 906 ? -36.816 185.744 52.048  1.00 32.40  ? 906  ALA A CB  1 
ATOM   6969 N N   . VAL A 1 907 ? -39.066 184.186 53.515  1.00 29.37  ? 907  VAL A N   1 
ATOM   6970 C CA  . VAL A 1 907 ? -40.472 183.847 53.686  1.00 28.23  ? 907  VAL A CA  1 
ATOM   6971 C C   . VAL A 1 907 ? -40.777 183.910 55.168  1.00 28.07  ? 907  VAL A C   1 
ATOM   6972 O O   . VAL A 1 907 ? -41.890 184.232 55.577  1.00 28.28  ? 907  VAL A O   1 
ATOM   6973 C CB  . VAL A 1 907 ? -40.772 182.415 53.186  1.00 26.62  ? 907  VAL A CB  1 
ATOM   6974 C CG1 . VAL A 1 907 ? -42.059 181.898 53.817  1.00 24.39  ? 907  VAL A CG1 1 
ATOM   6975 C CG2 . VAL A 1 907 ? -40.879 182.404 51.668  1.00 25.61  ? 907  VAL A CG2 1 
ATOM   6976 N N   . GLY A 1 908 ? -39.762 183.601 55.966  1.00 30.86  ? 908  GLY A N   1 
ATOM   6977 C CA  . GLY A 1 908 ? -39.917 183.605 57.406  1.00 35.12  ? 908  GLY A CA  1 
ATOM   6978 C C   . GLY A 1 908 ? -40.244 184.968 57.966  1.00 38.39  ? 908  GLY A C   1 
ATOM   6979 O O   . GLY A 1 908 ? -41.260 185.132 58.634  1.00 42.65  ? 908  GLY A O   1 
ATOM   6980 N N   . VAL A 1 909 ? -39.382 185.946 57.703  1.00 41.88  ? 909  VAL A N   1 
ATOM   6981 C CA  . VAL A 1 909 ? -39.610 187.301 58.192  1.00 43.84  ? 909  VAL A CA  1 
ATOM   6982 C C   . VAL A 1 909 ? -40.911 187.845 57.606  1.00 45.63  ? 909  VAL A C   1 
ATOM   6983 O O   . VAL A 1 909 ? -41.670 188.533 58.287  1.00 45.86  ? 909  VAL A O   1 
ATOM   6984 C CB  . VAL A 1 909 ? -38.446 188.254 57.805  1.00 39.28  ? 909  VAL A CB  1 
ATOM   6985 C CG1 . VAL A 1 909 ? -37.123 187.698 58.307  1.00 31.99  ? 909  VAL A CG1 1 
ATOM   6986 C CG2 . VAL A 1 909 ? -38.405 188.439 56.304  1.00 39.07  ? 909  VAL A CG2 1 
ATOM   6987 N N   . ARG A 1 910 ? -41.169 187.516 56.344  1.00 45.85  ? 910  ARG A N   1 
ATOM   6988 C CA  . ARG A 1 910 ? -42.366 187.977 55.661  1.00 47.61  ? 910  ARG A CA  1 
ATOM   6989 C C   . ARG A 1 910 ? -43.643 187.533 56.362  1.00 46.07  ? 910  ARG A C   1 
ATOM   6990 O O   . ARG A 1 910 ? -44.646 188.239 56.350  1.00 49.21  ? 910  ARG A O   1 
ATOM   6991 C CB  . ARG A 1 910 ? -42.373 187.464 54.221  1.00 57.98  ? 910  ARG A CB  1 
ATOM   6992 C CG  . ARG A 1 910 ? -43.753 187.425 53.582  1.00 73.45  ? 910  ARG A CG  1 
ATOM   6993 C CD  . ARG A 1 910 ? -43.771 188.110 52.217  1.00 88.89  ? 910  ARG A CD  1 
ATOM   6994 N NE  . ARG A 1 910 ? -44.073 189.541 52.305  1.00 98.42  ? 910  ARG A NE  1 
ATOM   6995 C CZ  . ARG A 1 910 ? -45.300 190.058 52.313  1.00 100.00 ? 910  ARG A CZ  1 
ATOM   6996 N NH1 . ARG A 1 910 ? -46.366 189.267 52.238  1.00 100.00 ? 910  ARG A NH1 1 
ATOM   6997 N NH2 . ARG A 1 910 ? -45.464 191.373 52.392  1.00 100.00 ? 910  ARG A NH2 1 
ATOM   6998 N N   . LEU A 1 911 ? -43.608 186.368 56.985  1.00 46.97  ? 911  LEU A N   1 
ATOM   6999 C CA  . LEU A 1 911 ? -44.794 185.860 57.649  1.00 50.97  ? 911  LEU A CA  1 
ATOM   7000 C C   . LEU A 1 911 ? -45.013 186.323 59.081  1.00 57.24  ? 911  LEU A C   1 
ATOM   7001 O O   . LEU A 1 911 ? -46.107 186.150 59.614  1.00 61.46  ? 911  LEU A O   1 
ATOM   7002 C CB  . LEU A 1 911 ? -44.804 184.332 57.594  1.00 49.56  ? 911  LEU A CB  1 
ATOM   7003 C CG  . LEU A 1 911 ? -45.022 183.712 56.210  1.00 50.36  ? 911  LEU A CG  1 
ATOM   7004 C CD1 . LEU A 1 911 ? -45.756 182.397 56.373  1.00 51.79  ? 911  LEU A CD1 1 
ATOM   7005 C CD2 . LEU A 1 911 ? -45.815 184.655 55.315  1.00 50.94  ? 911  LEU A CD2 1 
ATOM   7006 N N   . ARG A 1 912 ? -43.994 186.894 59.721  1.00 60.78  ? 912  ARG A N   1 
ATOM   7007 C CA  . ARG A 1 912 ? -44.182 187.370 61.090  1.00 64.42  ? 912  ARG A CA  1 
ATOM   7008 C C   . ARG A 1 912 ? -44.824 188.746 61.023  1.00 69.85  ? 912  ARG A C   1 
ATOM   7009 O O   . ARG A 1 912 ? -44.984 189.429 62.036  1.00 70.26  ? 912  ARG A O   1 
ATOM   7010 C CB  . ARG A 1 912 ? -42.857 187.450 61.857  1.00 59.60  ? 912  ARG A CB  1 
ATOM   7011 C CG  . ARG A 1 912 ? -41.613 187.556 61.003  1.00 58.66  ? 912  ARG A CG  1 
ATOM   7012 C CD  . ARG A 1 912 ? -40.486 188.230 61.776  1.00 57.09  ? 912  ARG A CD  1 
ATOM   7013 N NE  . ARG A 1 912 ? -39.668 187.278 62.522  1.00 50.93  ? 912  ARG A NE  1 
ATOM   7014 C CZ  . ARG A 1 912 ? -38.350 187.386 62.668  1.00 49.29  ? 912  ARG A CZ  1 
ATOM   7015 N NH1 . ARG A 1 912 ? -37.707 188.406 62.117  1.00 49.17  ? 912  ARG A NH1 1 
ATOM   7016 N NH2 . ARG A 1 912 ? -37.674 186.480 63.361  1.00 47.57  ? 912  ARG A NH2 1 
ATOM   7017 N N   . THR A 1 913 ? -45.194 189.134 59.806  1.00 77.82  ? 913  THR A N   1 
ATOM   7018 C CA  . THR A 1 913 ? -45.841 190.414 59.549  1.00 83.56  ? 913  THR A CA  1 
ATOM   7019 C C   . THR A 1 913 ? -47.346 190.190 59.418  1.00 87.50  ? 913  THR A C   1 
ATOM   7020 O O   . THR A 1 913 ? -48.149 190.986 59.909  1.00 88.51  ? 913  THR A O   1 
ATOM   7021 C CB  . THR A 1 913 ? -45.309 191.051 58.253  1.00 82.70  ? 913  THR A CB  1 
ATOM   7022 O OG1 . THR A 1 913 ? -43.979 191.537 58.476  1.00 83.08  ? 913  THR A OG1 1 
ATOM   7023 C CG2 . THR A 1 913 ? -46.198 192.204 57.819  1.00 85.84  ? 913  THR A CG2 1 
ATOM   7024 N N   . GLU A 1 914 ? -47.716 189.101 58.749  1.00 92.22  ? 914  GLU A N   1 
ATOM   7025 C CA  . GLU A 1 914 ? -49.120 188.749 58.565  1.00 96.88  ? 914  GLU A CA  1 
ATOM   7026 C C   . GLU A 1 914 ? -49.770 188.433 59.913  1.00 100.00 ? 914  GLU A C   1 
ATOM   7027 O O   . GLU A 1 914 ? -51.007 188.598 60.027  1.00 100.00 ? 914  GLU A O   1 
ATOM   7028 C CB  . GLU A 1 914 ? -49.242 187.528 57.654  1.00 98.03  ? 914  GLU A CB  1 
ATOM   7029 C CG  . GLU A 1 914 ? -49.367 187.854 56.183  1.00 100.00 ? 914  GLU A CG  1 
ATOM   7030 C CD  . GLU A 1 914 ? -48.852 186.731 55.309  1.00 100.00 ? 914  GLU A CD  1 
ATOM   7031 O OE1 . GLU A 1 914 ? -49.283 185.573 55.509  1.00 100.00 ? 914  GLU A OE1 1 
ATOM   7032 O OE2 . GLU A 1 914 ? -48.011 187.007 54.425  1.00 100.00 ? 914  GLU A OE2 1 
HETATM 7033 C C2  . BGC B 2 .   ? -12.326 124.301 3.254   1.00 38.65  ? 918  BGC A C2  1 
HETATM 7034 C C3  . BGC B 2 .   ? -11.893 124.392 4.720   1.00 39.94  ? 918  BGC A C3  1 
HETATM 7035 C C4  . BGC B 2 .   ? -11.369 123.041 5.254   1.00 38.11  ? 918  BGC A C4  1 
HETATM 7036 C C5  . BGC B 2 .   ? -10.431 122.328 4.255   1.00 37.15  ? 918  BGC A C5  1 
HETATM 7037 C C6  . BGC B 2 .   ? -10.158 120.877 4.632   1.00 34.77  ? 918  BGC A C6  1 
HETATM 7038 C C1  . BGC B 2 .   ? -11.222 123.653 2.438   1.00 42.43  ? 918  BGC A C1  1 
HETATM 7039 O O1  . BGC B 2 .   ? -11.615 123.571 1.116   1.00 55.24  ? 918  BGC A O1  1 
HETATM 7040 O O2  . BGC B 2 .   ? -12.576 125.598 2.745   1.00 33.60  ? 918  BGC A O2  1 
HETATM 7041 O O3  . BGC B 2 .   ? -12.995 124.815 5.514   1.00 28.04  ? 918  BGC A O3  1 
HETATM 7042 O O4  . BGC B 2 .   ? -10.652 123.272 6.460   1.00 26.86  ? 918  BGC A O4  1 
HETATM 7043 O O5  . BGC B 2 .   ? -10.995 122.326 2.925   1.00 46.65  ? 918  BGC A O5  1 
HETATM 7044 O O6  . BGC B 2 .   ? -11.326 120.071 4.529   1.00 30.30  ? 918  BGC A O6  1 
HETATM 7045 P P   . PO4 C 3 .   ? -10.472 114.096 4.875   1.00 34.67  ? 919  PO4 A P   1 
HETATM 7046 O O1  . PO4 C 3 .   ? -9.330  114.315 5.793   1.00 35.14  ? 919  PO4 A O1  1 
HETATM 7047 O O2  . PO4 C 3 .   ? -11.700 113.768 5.643   1.00 30.70  ? 919  PO4 A O2  1 
HETATM 7048 O O3  . PO4 C 3 .   ? -10.713 115.334 4.104   1.00 43.25  ? 919  PO4 A O3  1 
HETATM 7049 O O4  . PO4 C 3 .   ? -10.143 112.983 3.958   1.00 26.13  ? 919  PO4 A O4  1 
HETATM 7050 P P   . PO4 D 3 .   ? -25.090 164.809 47.643  1.00 94.18  ? 920  PO4 A P   1 
HETATM 7051 O O1  . PO4 D 3 .   ? -25.606 164.419 46.306  1.00 79.64  ? 920  PO4 A O1  1 
HETATM 7052 O O2  . PO4 D 3 .   ? -25.398 163.739 48.637  1.00 83.10  ? 920  PO4 A O2  1 
HETATM 7053 O O3  . PO4 D 3 .   ? -23.611 165.004 47.566  1.00 84.79  ? 920  PO4 A O3  1 
HETATM 7054 O O4  . PO4 D 3 .   ? -25.747 166.082 48.062  1.00 85.02  ? 920  PO4 A O4  1 
HETATM 7055 K K   . K   E 4 .   ? -7.835  143.616 17.512  1.00 40.72  ? 921  K   A K   1 
HETATM 7056 K K   . K   F 4 .   ? -53.358 169.742 63.189  1.00 46.85  ? 922  K   A K   1 
HETATM 7057 O O   . HOH G 5 .   ? 2.395   110.310 4.091   1.00 7.08   ? 923  HOH A O   1 
HETATM 7058 O O   . HOH G 5 .   ? -43.647 150.774 71.353  1.00 32.95  ? 924  HOH A O   1 
HETATM 7059 O O   . HOH G 5 .   ? -11.258 97.872  -19.931 1.00 44.60  ? 925  HOH A O   1 
HETATM 7060 O O   . HOH G 5 .   ? -11.100 99.058  -23.170 1.00 36.16  ? 926  HOH A O   1 
HETATM 7061 O O   . HOH G 5 .   ? -48.172 165.193 62.787  1.00 29.16  ? 927  HOH A O   1 
HETATM 7062 O O   . HOH G 5 .   ? -13.616 109.800 -7.843  1.00 62.33  ? 928  HOH A O   1 
HETATM 7063 O O   . HOH G 5 .   ? -16.343 114.969 7.296   1.00 23.45  ? 929  HOH A O   1 
HETATM 7064 O O   . HOH G 5 .   ? -49.864 176.519 58.524  1.00 26.91  ? 930  HOH A O   1 
HETATM 7065 O O   . HOH G 5 .   ? -17.156 123.974 -14.657 1.00 21.83  ? 931  HOH A O   1 
HETATM 7066 O O   . HOH G 5 .   ? -12.376 186.923 54.527  1.00 20.61  ? 932  HOH A O   1 
HETATM 7067 O O   . HOH G 5 .   ? -22.961 136.353 60.265  1.00 20.79  ? 933  HOH A O   1 
HETATM 7068 O O   . HOH G 5 .   ? -1.608  100.053 -26.339 1.00 48.81  ? 934  HOH A O   1 
HETATM 7069 O O   . HOH G 5 .   ? -3.040  102.452 33.893  1.00 31.86  ? 935  HOH A O   1 
HETATM 7070 O O   . HOH G 5 .   ? -11.898 117.052 -14.992 1.00 13.04  ? 936  HOH A O   1 
HETATM 7071 O O   . HOH G 5 .   ? -9.072  112.865 -7.955  1.00 32.89  ? 937  HOH A O   1 
HETATM 7072 O O   . HOH G 5 .   ? -15.583 127.414 -3.876  1.00 16.79  ? 938  HOH A O   1 
HETATM 7073 O O   . HOH G 5 .   ? -8.301  115.804 -21.047 1.00 27.05  ? 939  HOH A O   1 
HETATM 7074 O O   . HOH G 5 .   ? -19.527 138.198 54.058  1.00 56.61  ? 940  HOH A O   1 
HETATM 7075 O O   . HOH G 5 .   ? -5.700  116.106 -21.045 1.00 18.87  ? 941  HOH A O   1 
HETATM 7076 O O   . HOH G 5 .   ? -9.079  126.474 1.703   1.00 12.90  ? 942  HOH A O   1 
HETATM 7077 O O   . HOH G 5 .   ? -4.899  122.226 -10.390 1.00 14.37  ? 943  HOH A O   1 
HETATM 7078 O O   . HOH G 5 .   ? -9.432  132.255 1.870   1.00 11.62  ? 944  HOH A O   1 
HETATM 7079 O O   . HOH G 5 .   ? 10.151  107.849 -9.720  1.00 28.65  ? 945  HOH A O   1 
HETATM 7080 O O   . HOH G 5 .   ? -5.600  138.777 -2.465  1.00 21.96  ? 946  HOH A O   1 
HETATM 7081 O O   . HOH G 5 .   ? 15.901  106.956 1.994   1.00 43.72  ? 947  HOH A O   1 
HETATM 7082 O O   . HOH G 5 .   ? 0.920   133.868 17.507  1.00 16.13  ? 948  HOH A O   1 
HETATM 7083 O O   . HOH G 5 .   ? 13.323  114.790 7.594   1.00 19.01  ? 949  HOH A O   1 
HETATM 7084 O O   . HOH G 5 .   ? -22.580 178.176 72.221  1.00 18.20  ? 950  HOH A O   1 
HETATM 7085 O O   . HOH G 5 .   ? -23.703 192.815 60.859  1.00 26.64  ? 951  HOH A O   1 
HETATM 7086 O O   . HOH G 5 .   ? -5.203  124.895 -9.704  1.00 19.17  ? 952  HOH A O   1 
HETATM 7087 O O   . HOH G 5 .   ? -37.719 121.882 23.572  1.00 69.84  ? 953  HOH A O   1 
HETATM 7088 O O   . HOH G 5 .   ? -37.232 123.756 20.974  1.00 76.28  ? 954  HOH A O   1 
HETATM 7089 O O   . HOH G 5 .   ? -24.297 103.907 10.173  1.00 47.36  ? 955  HOH A O   1 
HETATM 7090 O O   . HOH G 5 .   ? -32.881 125.035 -2.092  1.00 76.29  ? 956  HOH A O   1 
HETATM 7091 O O   . HOH G 5 .   ? -36.003 136.046 40.788  1.00 75.41  ? 957  HOH A O   1 
HETATM 7092 O O   . HOH G 5 .   ? -52.907 170.515 39.634  1.00 65.90  ? 958  HOH A O   1 
HETATM 7093 O O   . HOH G 5 .   ? -53.206 171.796 43.645  1.00 43.81  ? 959  HOH A O   1 
HETATM 7094 O O   . HOH G 5 .   ? -37.468 145.819 55.291  1.00 26.60  ? 960  HOH A O   1 
HETATM 7095 O O   . HOH G 5 .   ? -25.867 127.471 -1.730  1.00 41.85  ? 961  HOH A O   1 
HETATM 7096 O O   . HOH G 5 .   ? -36.265 144.107 59.926  1.00 34.55  ? 962  HOH A O   1 
HETATM 7097 O O   . HOH G 5 .   ? -16.968 114.717 0.607   1.00 44.27  ? 963  HOH A O   1 
HETATM 7098 O O   . HOH G 5 .   ? -9.371  101.965 -28.406 1.00 18.56  ? 964  HOH A O   1 
HETATM 7099 O O   . HOH G 5 .   ? -45.699 164.098 62.302  1.00 15.50  ? 965  HOH A O   1 
HETATM 7100 O O   . HOH G 5 .   ? -49.343 172.268 42.421  1.00 49.79  ? 966  HOH A O   1 
HETATM 7101 O O   . HOH G 5 .   ? -26.574 134.005 13.763  1.00 37.30  ? 967  HOH A O   1 
HETATM 7102 O O   . HOH G 5 .   ? -42.266 162.071 69.992  1.00 71.20  ? 968  HOH A O   1 
HETATM 7103 O O   . HOH G 5 .   ? -12.541 113.555 -5.797  1.00 89.70  ? 969  HOH A O   1 
HETATM 7104 O O   . HOH G 5 .   ? -1.069  94.401  -18.516 1.00 51.29  ? 970  HOH A O   1 
HETATM 7105 O O   . HOH G 5 .   ? -4.389  102.601 -2.175  1.00 40.53  ? 971  HOH A O   1 
HETATM 7106 O O   . HOH G 5 .   ? -34.780 153.881 61.918  1.00 35.06  ? 972  HOH A O   1 
HETATM 7107 O O   . HOH G 5 .   ? -37.914 158.845 59.643  1.00 23.00  ? 973  HOH A O   1 
HETATM 7108 O O   . HOH G 5 .   ? -10.317 113.862 -20.625 1.00 15.87  ? 974  HOH A O   1 
HETATM 7109 O O   . HOH G 5 .   ? -11.769 116.093 -9.028  1.00 27.23  ? 975  HOH A O   1 
HETATM 7110 O O   . HOH G 5 .   ? -30.841 149.042 44.113  1.00 23.26  ? 976  HOH A O   1 
HETATM 7111 O O   . HOH G 5 .   ? -14.546 121.597 -6.264  1.00 15.56  ? 977  HOH A O   1 
HETATM 7112 O O   . HOH G 5 .   ? -21.556 134.238 30.264  1.00 61.16  ? 978  HOH A O   1 
HETATM 7113 O O   . HOH G 5 .   ? -29.373 147.337 50.881  1.00 44.61  ? 979  HOH A O   1 
HETATM 7114 O O   . HOH G 5 .   ? -12.659 123.052 -3.802  1.00 12.94  ? 980  HOH A O   1 
HETATM 7115 O O   . HOH G 5 .   ? -46.548 180.896 47.043  1.00 54.19  ? 981  HOH A O   1 
HETATM 7116 O O   . HOH G 5 .   ? -33.768 159.494 55.169  1.00 35.20  ? 982  HOH A O   1 
HETATM 7117 O O   . HOH G 5 .   ? -14.346 129.592 9.869   1.00 27.10  ? 983  HOH A O   1 
HETATM 7118 O O   . HOH G 5 .   ? -20.150 138.510 49.399  1.00 53.83  ? 984  HOH A O   1 
HETATM 7119 O O   . HOH G 5 .   ? -42.712 179.880 57.921  1.00 39.44  ? 985  HOH A O   1 
HETATM 7120 O O   . HOH G 5 .   ? -2.175  110.307 44.609  1.00 46.43  ? 986  HOH A O   1 
HETATM 7121 O O   . HOH G 5 .   ? -29.897 160.252 36.763  1.00 15.93  ? 987  HOH A O   1 
HETATM 7122 O O   . HOH G 5 .   ? -37.193 174.986 58.509  1.00 18.14  ? 988  HOH A O   1 
HETATM 7123 O O   . HOH G 5 .   ? -14.639 136.138 33.135  1.00 54.36  ? 989  HOH A O   1 
HETATM 7124 O O   . HOH G 5 .   ? -24.735 151.598 28.468  1.00 66.90  ? 990  HOH A O   1 
HETATM 7125 O O   . HOH G 5 .   ? -32.128 165.203 55.116  1.00 39.17  ? 991  HOH A O   1 
HETATM 7126 O O   . HOH G 5 .   ? -8.437  127.834 -14.412 1.00 34.27  ? 992  HOH A O   1 
HETATM 7127 O O   . HOH G 5 .   ? 7.797   100.213 -6.584  1.00 53.11  ? 993  HOH A O   1 
HETATM 7128 O O   . HOH G 5 .   ? -11.284 133.867 -1.126  1.00 18.51  ? 994  HOH A O   1 
HETATM 7129 O O   . HOH G 5 .   ? -12.201 138.297 1.602   1.00 74.99  ? 995  HOH A O   1 
HETATM 7130 O O   . HOH G 5 .   ? 8.020   105.257 -4.496  1.00 57.05  ? 996  HOH A O   1 
HETATM 7131 O O   . HOH G 5 .   ? -34.775 178.612 69.316  1.00 21.39  ? 997  HOH A O   1 
HETATM 7132 O O   . HOH G 5 .   ? -23.928 162.036 32.868  1.00 52.52  ? 998  HOH A O   1 
HETATM 7133 O O   . HOH G 5 .   ? -3.814  127.795 24.016  1.00 66.31  ? 999  HOH A O   1 
HETATM 7134 O O   . HOH G 5 .   ? -31.183 174.021 74.646  1.00 43.33  ? 1000 HOH A O   1 
HETATM 7135 O O   . HOH G 5 .   ? -33.830 179.579 42.245  1.00 75.11  ? 1001 HOH A O   1 
HETATM 7136 O O   . HOH G 5 .   ? -38.457 188.163 44.664  1.00 27.74  ? 1002 HOH A O   1 
HETATM 7137 O O   . HOH G 5 .   ? -23.310 161.812 69.485  1.00 30.29  ? 1003 HOH A O   1 
HETATM 7138 O O   . HOH G 5 .   ? -28.022 169.943 49.940  1.00 66.42  ? 1004 HOH A O   1 
HETATM 7139 O O   . HOH G 5 .   ? -6.289  133.940 24.224  1.00 46.97  ? 1005 HOH A O   1 
HETATM 7140 O O   . HOH G 5 .   ? -20.691 160.502 66.284  1.00 76.31  ? 1006 HOH A O   1 
HETATM 7141 O O   . HOH G 5 .   ? -4.038  135.029 -3.596  1.00 16.45  ? 1007 HOH A O   1 
HETATM 7142 O O   . HOH G 5 .   ? 3.568   123.851 -11.271 1.00 9.56   ? 1008 HOH A O   1 
HETATM 7143 O O   . HOH G 5 .   ? 5.569   120.935 -17.712 1.00 25.11  ? 1009 HOH A O   1 
HETATM 7144 O O   . HOH G 5 .   ? 11.643  112.800 6.084   1.00 17.55  ? 1010 HOH A O   1 
HETATM 7145 O O   . HOH G 5 .   ? 13.542  112.612 -10.232 1.00 78.25  ? 1011 HOH A O   1 
HETATM 7146 O O   . HOH G 5 .   ? 6.371   126.154 -13.131 1.00 60.27  ? 1012 HOH A O   1 
HETATM 7147 O O   . HOH G 5 .   ? -20.933 172.269 55.081  1.00 42.84  ? 1013 HOH A O   1 
HETATM 7148 O O   . HOH G 5 .   ? -24.061 178.347 75.269  1.00 41.85  ? 1014 HOH A O   1 
HETATM 7149 O O   . HOH G 5 .   ? 17.194  106.240 4.285   1.00 66.24  ? 1015 HOH A O   1 
HETATM 7150 O O   . HOH G 5 .   ? -20.742 174.052 76.308  1.00 36.69  ? 1016 HOH A O   1 
HETATM 7151 O O   . HOH G 5 .   ? 11.016  126.280 -10.293 1.00 18.54  ? 1017 HOH A O   1 
HETATM 7152 O O   . HOH G 5 .   ? 12.168  129.925 6.878   1.00 54.96  ? 1018 HOH A O   1 
HETATM 7153 O O   . HOH G 5 .   ? -21.364 188.725 67.928  1.00 22.95  ? 1019 HOH A O   1 
HETATM 7154 O O   . HOH G 5 .   ? 14.139  128.748 -10.084 1.00 66.51  ? 1020 HOH A O   1 
HETATM 7155 O O   . HOH G 5 .   ? -14.111 179.687 72.635  1.00 56.17  ? 1021 HOH A O   1 
HETATM 7156 O O   . HOH G 5 .   ? -16.461 184.295 68.482  1.00 18.31  ? 1022 HOH A O   1 
HETATM 7157 O O   . HOH G 5 .   ? -18.930 196.200 69.674  1.00 76.16  ? 1023 HOH A O   1 
HETATM 7158 O O   . HOH G 5 .   ? -5.251  104.568 0.014   1.00 40.92  ? 1024 HOH A O   1 
HETATM 7159 O O   . HOH G 5 .   ? -50.293 150.627 45.338  1.00 29.86  ? 1025 HOH A O   1 
HETATM 7160 O O   . HOH G 5 .   ? -52.301 158.109 40.010  1.00 33.58  ? 1026 HOH A O   1 
HETATM 7161 O O   . HOH G 5 .   ? -41.158 141.659 54.704  1.00 55.52  ? 1027 HOH A O   1 
HETATM 7162 O O   . HOH G 5 .   ? -45.936 150.033 55.738  1.00 50.04  ? 1028 HOH A O   1 
HETATM 7163 O O   . HOH G 5 .   ? -32.886 138.481 52.010  1.00 62.34  ? 1029 HOH A O   1 
HETATM 7164 O O   . HOH G 5 .   ? -27.378 130.852 15.986  1.00 51.51  ? 1030 HOH A O   1 
HETATM 7165 O O   . HOH G 5 .   ? -34.904 143.407 45.075  1.00 26.36  ? 1031 HOH A O   1 
HETATM 7166 O O   . HOH G 5 .   ? -13.757 107.955 17.023  1.00 60.01  ? 1032 HOH A O   1 
HETATM 7167 O O   . HOH G 5 .   ? -7.627  101.010 33.120  1.00 56.22  ? 1033 HOH A O   1 
HETATM 7168 O O   . HOH G 5 .   ? -8.923  102.517 -5.588  1.00 73.30  ? 1034 HOH A O   1 
HETATM 7169 O O   . HOH G 5 .   ? -16.140 117.768 0.445   1.00 28.13  ? 1035 HOH A O   1 
HETATM 7170 O O   . HOH G 5 .   ? -12.976 113.823 -10.385 1.00 32.63  ? 1036 HOH A O   1 
HETATM 7171 O O   . HOH G 5 .   ? -15.405 119.611 -8.597  1.00 26.68  ? 1037 HOH A O   1 
HETATM 7172 O O   . HOH G 5 .   ? -37.062 155.875 62.767  1.00 35.46  ? 1038 HOH A O   1 
HETATM 7173 O O   . HOH G 5 .   ? -2.162  100.641 1.645   1.00 70.00  ? 1039 HOH A O   1 
HETATM 7174 O O   . HOH G 5 .   ? -38.065 162.430 70.942  1.00 63.81  ? 1040 HOH A O   1 
HETATM 7175 O O   . HOH G 5 .   ? -27.800 145.414 33.337  1.00 41.01  ? 1041 HOH A O   1 
HETATM 7176 O O   . HOH G 5 .   ? -15.913 126.797 9.887   1.00 30.74  ? 1042 HOH A O   1 
HETATM 7177 O O   . HOH G 5 .   ? -13.876 127.391 13.663  1.00 40.89  ? 1043 HOH A O   1 
HETATM 7178 O O   . HOH G 5 .   ? -18.327 137.759 27.284  1.00 67.44  ? 1044 HOH A O   1 
HETATM 7179 O O   . HOH G 5 .   ? -10.465 125.060 25.024  1.00 66.50  ? 1045 HOH A O   1 
HETATM 7180 O O   . HOH G 5 .   ? -12.509 131.456 44.029  1.00 72.03  ? 1046 HOH A O   1 
HETATM 7181 O O   . HOH G 5 .   ? -40.757 181.339 64.619  1.00 55.15  ? 1047 HOH A O   1 
HETATM 7182 O O   . HOH G 5 .   ? -20.668 152.957 47.727  1.00 72.51  ? 1048 HOH A O   1 
HETATM 7183 O O   . HOH G 5 .   ? -7.215  132.791 -12.266 1.00 56.49  ? 1049 HOH A O   1 
HETATM 7184 O O   . HOH G 5 .   ? -8.461  136.107 23.475  1.00 47.10  ? 1050 HOH A O   1 
HETATM 7185 O O   . HOH G 5 .   ? 9.182   106.207 2.477   1.00 64.03  ? 1051 HOH A O   1 
HETATM 7186 O O   . HOH G 5 .   ? -25.760 168.528 42.542  1.00 38.50  ? 1052 HOH A O   1 
HETATM 7187 O O   . HOH G 5 .   ? -18.446 160.282 43.847  1.00 51.65  ? 1053 HOH A O   1 
HETATM 7188 O O   . HOH G 5 .   ? -25.459 171.167 54.648  1.00 44.65  ? 1054 HOH A O   1 
HETATM 7189 O O   . HOH G 5 .   ? 7.612   121.303 19.777  1.00 53.36  ? 1055 HOH A O   1 
HETATM 7190 O O   . HOH G 5 .   ? 4.823   125.511 26.830  1.00 78.60  ? 1056 HOH A O   1 
HETATM 7191 O O   . HOH G 5 .   ? -2.996  139.742 22.231  1.00 57.04  ? 1057 HOH A O   1 
HETATM 7192 O O   . HOH G 5 .   ? -5.121  144.620 15.992  1.00 53.10  ? 1058 HOH A O   1 
HETATM 7193 O O   . HOH G 5 .   ? -18.117 169.919 53.287  1.00 68.73  ? 1059 HOH A O   1 
HETATM 7194 O O   . HOH G 5 .   ? 12.296  117.707 -0.570  1.00 45.19  ? 1060 HOH A O   1 
HETATM 7195 O O   . HOH G 5 .   ? 14.461  119.253 12.253  1.00 59.87  ? 1061 HOH A O   1 
HETATM 7196 O O   . HOH G 5 .   ? -12.136 132.855 -3.833  1.00 19.41  ? 1062 HOH A O   1 
HETATM 7197 O O   . HOH G 5 .   ? -32.360 125.177 1.782   1.00 54.58  ? 1063 HOH A O   1 
HETATM 7198 O O   . HOH G 5 .   ? -14.812 195.598 60.867  1.00 25.35  ? 1064 HOH A O   1 
HETATM 7199 O O   . HOH G 5 .   ? -13.492 178.677 69.801  1.00 53.82  ? 1065 HOH A O   1 
HETATM 7200 O O   . HOH G 5 .   ? -15.722 195.034 63.865  1.00 58.88  ? 1066 HOH A O   1 
HETATM 7201 O O   . HOH G 5 .   ? -34.795 140.044 54.478  1.00 32.04  ? 1067 HOH A O   1 
HETATM 7202 O O   . HOH G 5 .   ? -26.192 160.015 70.167  1.00 53.68  ? 1068 HOH A O   1 
HETATM 7203 O O   . HOH G 5 .   ? 11.886  98.122  -21.008 1.00 55.74  ? 1069 HOH A O   1 
HETATM 7204 O O   . HOH G 5 .   ? 6.187   104.808 3.349   1.00 44.01  ? 1070 HOH A O   1 
HETATM 7205 O O   . HOH G 5 .   ? 8.806   124.062 26.737  1.00 62.19  ? 1071 HOH A O   1 
HETATM 7206 O O   . HOH G 5 .   ? -21.813 105.418 24.308  1.00 76.10  ? 1072 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLN 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   ?   ?   ?   A . n 
A 1 8   ALA 8   8   ?   ?   ?   A . n 
A 1 9   TYR 9   9   ?   ?   ?   A . n 
A 1 10  TYR 10  10  ?   ?   ?   A . n 
A 1 11  PHE 11  11  ?   ?   ?   A . n 
A 1 12  THR 12  12  ?   ?   ?   A . n 
A 1 13  GLU 13  13  ?   ?   ?   A . n 
A 1 14  LEU 14  14  ?   ?   ?   A . n 
A 1 15  LYS 15  15  ?   ?   ?   A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLN 18  18  18  GLN GLN A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  MET 47  47  47  MET MET A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  ARG 91  91  91  ARG ARG A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 MET 107 107 107 MET MET A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 HIS 120 120 120 HIS HIS A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 HIS 129 129 129 HIS HIS A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 CYS 133 133 133 CYS CYS A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 MET 214 214 214 MET MET A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 CYS 217 217 217 CYS CYS A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 CYS 224 224 224 CYS CYS A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 CYS 237 237 237 CYS CYS A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 MET 239 239 239 MET MET A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 HIS 244 244 244 HIS HIS A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 ASP 246 246 246 ASP ASP A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 MET 255 255 255 MET MET A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ASN 258 258 258 ASN ASN A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 TRP 261 261 261 TRP TRP A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 ASP 282 282 282 ASP ASP A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ASN 287 287 287 ASN ASN A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 GLY 289 289 289 GLY GLY A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 MET 300 300 300 MET MET A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LYS 312 312 312 LYS LYS A . n 
A 1 313 MET 313 313 313 MET MET A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 GLU 316 316 316 GLU GLU A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PHE 320 320 320 PHE PHE A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 ILE 324 324 324 ILE ILE A . n 
A 1 325 THR 325 325 325 THR THR A . n 
A 1 326 PRO 326 326 326 PRO PRO A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 LYS 333 333 333 LYS LYS A . n 
A 1 334 PHE 334 334 334 PHE PHE A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 THR 336 336 336 THR THR A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 ASP 338 338 338 ASP ASP A . n 
A 1 339 VAL 339 339 339 VAL VAL A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 LYS 344 344 344 LYS LYS A . n 
A 1 345 ASN 345 345 345 ASN ASN A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 HIS 350 350 350 HIS HIS A . n 
A 1 351 ASN 351 351 351 ASN ASN A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 GLU 362 362 362 GLU GLU A . n 
A 1 363 PRO 363 363 363 PRO PRO A . n 
A 1 364 SER 364 364 364 SER SER A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 ASP 367 367 367 ASP ASP A . n 
A 1 368 CYS 368 368 368 CYS CYS A . n 
A 1 369 VAL 369 369 369 VAL VAL A . n 
A 1 370 SER 370 370 370 SER SER A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 GLN 372 372 372 GLN GLN A . n 
A 1 373 HIS 373 373 373 HIS HIS A . n 
A 1 374 VAL 374 374 374 VAL VAL A . n 
A 1 375 CYS 375 375 375 CYS CYS A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 SER 382 382 382 SER SER A . n 
A 1 383 ALA 383 383 383 ALA ALA A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 LEU 385 385 385 LEU LEU A . n 
A 1 386 VAL 386 386 386 VAL VAL A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 THR 389 389 389 THR THR A . n 
A 1 390 LEU 390 390 390 LEU LEU A . n 
A 1 391 GLY 391 391 391 GLY GLY A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 ARG 396 396 396 ARG ARG A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 ARG 398 398 398 ARG ARG A . n 
A 1 399 ASP 399 399 399 ASP ASP A . n 
A 1 400 ASN 400 400 400 ASN ASN A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 PRO 404 404 404 PRO PRO A . n 
A 1 405 ARG 405 405 405 ARG ARG A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 ARG 407 407 407 ARG ARG A . n 
A 1 408 THR 408 408 408 THR THR A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 GLY 411 411 411 GLY GLY A . n 
A 1 412 VAL 412 412 412 VAL VAL A . n 
A 1 413 ASP 413 413 413 ASP ASP A . n 
A 1 414 GLY 414 414 414 GLY GLY A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 LEU 416 416 416 LEU LEU A . n 
A 1 417 TYR 417 417 417 TYR TYR A . n 
A 1 418 LYS 418 418 418 LYS LYS A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 HIS 420 420 420 HIS HIS A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 GLN 422 422 422 GLN GLN A . n 
A 1 423 TYR 423 423 423 TYR TYR A . n 
A 1 424 SER 424 424 424 SER SER A . n 
A 1 425 ARG 425 425 425 ARG ARG A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 PHE 427 427 427 PHE PHE A . n 
A 1 428 HIS 428 428 428 HIS HIS A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 THR 430 430 430 THR THR A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 ARG 432 432 432 ARG ARG A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 LEU 434 434 434 LEU LEU A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 PRO 436 436 436 PRO PRO A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 SER 438 438 438 SER SER A . n 
A 1 439 ASP 439 439 439 ASP ASP A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 ARG 441 441 441 ARG ARG A . n 
A 1 442 PHE 442 442 442 PHE PHE A . n 
A 1 443 LEU 443 443 443 LEU LEU A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 SER 445 445 445 SER SER A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 SER 447 447 447 SER SER A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 SER 449 449 449 SER SER A . n 
A 1 450 GLY 450 450 450 GLY GLY A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 GLY 452 452 452 GLY GLY A . n 
A 1 453 ALA 453 453 453 ALA ALA A . n 
A 1 454 ALA 454 454 454 ALA ALA A . n 
A 1 455 MET 455 455 455 MET MET A . n 
A 1 456 VAL 456 456 456 VAL VAL A . n 
A 1 457 THR 457 457 457 THR THR A . n 
A 1 458 ALA 458 458 458 ALA ALA A . n 
A 1 459 VAL 459 459 459 VAL VAL A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 ARG 462 462 462 ARG ARG A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 GLN 466 466 466 GLN GLN A . n 
A 1 467 HIS 467 467 467 HIS HIS A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 GLN 469 469 469 GLN GLN A . n 
A 1 470 ILE 470 470 470 ILE ILE A . n 
A 1 471 GLU 471 471 471 GLU GLU A . n 
A 1 472 GLU 472 472 472 GLU GLU A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 LEU 474 474 474 LEU LEU A . n 
A 1 475 ALA 475 475 475 ALA ALA A . n 
A 1 476 HIS 476 476 476 HIS HIS A . n 
A 1 477 PHE 477 477 477 PHE PHE A . n 
A 1 478 HIS 478 478 478 HIS HIS A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 THR 480 480 480 THR THR A . n 
A 1 481 LYS 481 481 481 LYS LYS A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 MET 483 483 483 MET MET A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 LEU 485 485 485 LEU LEU A . n 
A 1 486 GLU 486 486 486 GLU GLU A . n 
A 1 487 VAL 487 487 487 VAL VAL A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 LYS 489 489 489 LYS LYS A . n 
A 1 490 ARG 490 490 490 ARG ARG A . n 
A 1 491 MET 491 491 491 MET MET A . n 
A 1 492 ARG 492 492 492 ARG ARG A . n 
A 1 493 ALA 493 493 493 ALA ALA A . n 
A 1 494 GLU 494 494 494 GLU GLU A . n 
A 1 495 MET 495 495 495 MET MET A . n 
A 1 496 GLU 496 496 496 GLU GLU A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 GLY 498 498 498 GLY GLY A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 ARG 500 500 500 ARG ARG A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 GLN 502 502 502 GLN GLN A . n 
A 1 503 THR 503 503 503 THR THR A . n 
A 1 504 HIS 504 504 504 HIS HIS A . n 
A 1 505 ASN 505 505 505 ASN ASN A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 VAL 508 508 508 VAL VAL A . n 
A 1 509 VAL 509 509 509 VAL VAL A . n 
A 1 510 LYS 510 510 510 LYS LYS A . n 
A 1 511 MET 511 511 511 MET MET A . n 
A 1 512 LEU 512 512 512 LEU LEU A . n 
A 1 513 PRO 513 513 513 PRO PRO A . n 
A 1 514 SER 514 514 514 SER SER A . n 
A 1 515 PHE 515 515 515 PHE PHE A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 ARG 518 518 518 ARG ARG A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 PRO 520 520 520 PRO PRO A . n 
A 1 521 ASP 521 521 521 ASP ASP A . n 
A 1 522 GLY 522 522 522 GLY GLY A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 GLU 524 524 524 GLU GLU A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 ASP 527 527 527 ASP ASP A . n 
A 1 528 PHE 528 528 528 PHE PHE A . n 
A 1 529 LEU 529 529 529 LEU LEU A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 ASP 532 532 532 ASP ASP A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 GLY 534 534 534 GLY GLY A . n 
A 1 535 GLY 535 535 535 GLY GLY A . n 
A 1 536 THR 536 536 536 THR THR A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 PHE 538 538 538 PHE PHE A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 VAL 540 540 540 VAL VAL A . n 
A 1 541 LEU 541 541 541 LEU LEU A . n 
A 1 542 LEU 542 542 542 LEU LEU A . n 
A 1 543 VAL 543 543 543 VAL VAL A . n 
A 1 544 LYS 544 544 544 LYS LYS A . n 
A 1 545 ILE 545 545 545 ILE ILE A . n 
A 1 546 ARG 546 546 546 ARG ARG A . n 
A 1 547 SER 547 547 547 SER SER A . n 
A 1 548 GLY 548 548 548 GLY GLY A . n 
A 1 549 LYS 549 549 549 LYS LYS A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 ARG 551 551 551 ARG ARG A . n 
A 1 552 THR 552 552 552 THR THR A . n 
A 1 553 VAL 553 553 553 VAL VAL A . n 
A 1 554 GLU 554 554 554 GLU GLU A . n 
A 1 555 MET 555 555 555 MET MET A . n 
A 1 556 HIS 556 556 556 HIS HIS A . n 
A 1 557 ASN 557 557 557 ASN ASN A . n 
A 1 558 LYS 558 558 558 LYS LYS A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 TYR 560 560 560 TYR TYR A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 ILE 562 562 562 ILE ILE A . n 
A 1 563 PRO 563 563 563 PRO PRO A . n 
A 1 564 ILE 564 564 564 ILE ILE A . n 
A 1 565 GLU 565 565 565 GLU GLU A . n 
A 1 566 ILE 566 566 566 ILE ILE A . n 
A 1 567 MET 567 567 567 MET MET A . n 
A 1 568 GLN 568 568 568 GLN GLN A . n 
A 1 569 GLY 569 569 569 GLY GLY A . n 
A 1 570 THR 570 570 570 THR THR A . n 
A 1 571 GLY 571 571 571 GLY GLY A . n 
A 1 572 GLU 572 572 572 GLU GLU A . n 
A 1 573 GLU 573 573 573 GLU GLU A . n 
A 1 574 LEU 574 574 574 LEU LEU A . n 
A 1 575 PHE 575 575 575 PHE PHE A . n 
A 1 576 ASP 576 576 576 ASP ASP A . n 
A 1 577 HIS 577 577 577 HIS HIS A . n 
A 1 578 ILE 578 578 578 ILE ILE A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 SER 580 580 580 SER SER A . n 
A 1 581 CYS 581 581 581 CYS CYS A . n 
A 1 582 ILE 582 582 582 ILE ILE A . n 
A 1 583 SER 583 583 583 SER SER A . n 
A 1 584 ASP 584 584 584 ASP ASP A . n 
A 1 585 PHE 585 585 585 PHE PHE A . n 
A 1 586 LEU 586 586 586 LEU LEU A . n 
A 1 587 ASP 587 587 587 ASP ASP A . n 
A 1 588 TYR 588 588 588 TYR TYR A . n 
A 1 589 MET 589 589 589 MET MET A . n 
A 1 590 GLY 590 590 590 GLY GLY A . n 
A 1 591 ILE 591 591 591 ILE ILE A . n 
A 1 592 LYS 592 592 592 LYS LYS A . n 
A 1 593 GLY 593 593 593 GLY GLY A . n 
A 1 594 PRO 594 594 594 PRO PRO A . n 
A 1 595 ARG 595 595 595 ARG ARG A . n 
A 1 596 MET 596 596 596 MET MET A . n 
A 1 597 PRO 597 597 597 PRO PRO A . n 
A 1 598 LEU 598 598 598 LEU LEU A . n 
A 1 599 GLY 599 599 599 GLY GLY A . n 
A 1 600 PHE 600 600 600 PHE PHE A . n 
A 1 601 THR 601 601 601 THR THR A . n 
A 1 602 PHE 602 602 602 PHE PHE A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 PHE 604 604 604 PHE PHE A . n 
A 1 605 PRO 605 605 605 PRO PRO A . n 
A 1 606 CYS 606 606 606 CYS CYS A . n 
A 1 607 GLN 607 607 607 GLN GLN A . n 
A 1 608 GLN 608 608 608 GLN GLN A . n 
A 1 609 THR 609 609 609 THR THR A . n 
A 1 610 SER 610 610 610 SER SER A . n 
A 1 611 LEU 611 611 611 LEU LEU A . n 
A 1 612 ASP 612 612 612 ASP ASP A . n 
A 1 613 ALA 613 613 613 ALA ALA A . n 
A 1 614 GLY 614 614 614 GLY GLY A . n 
A 1 615 ILE 615 615 615 ILE ILE A . n 
A 1 616 LEU 616 616 616 LEU LEU A . n 
A 1 617 ILE 617 617 617 ILE ILE A . n 
A 1 618 THR 618 618 618 THR THR A . n 
A 1 619 TRP 619 619 619 TRP TRP A . n 
A 1 620 THR 620 620 620 THR THR A . n 
A 1 621 LYS 621 621 621 LYS LYS A . n 
A 1 622 GLY 622 622 622 GLY GLY A . n 
A 1 623 PHE 623 623 623 PHE PHE A . n 
A 1 624 LYS 624 624 624 LYS LYS A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 THR 626 626 626 THR THR A . n 
A 1 627 ASP 627 627 627 ASP ASP A . n 
A 1 628 CYS 628 628 628 CYS CYS A . n 
A 1 629 VAL 629 629 629 VAL VAL A . n 
A 1 630 GLY 630 630 630 GLY GLY A . n 
A 1 631 HIS 631 631 631 HIS HIS A . n 
A 1 632 ASP 632 632 632 ASP ASP A . n 
A 1 633 VAL 633 633 633 VAL VAL A . n 
A 1 634 VAL 634 634 634 VAL VAL A . n 
A 1 635 THR 635 635 635 THR THR A . n 
A 1 636 LEU 636 636 636 LEU LEU A . n 
A 1 637 LEU 637 637 637 LEU LEU A . n 
A 1 638 ARG 638 638 638 ARG ARG A . n 
A 1 639 ASP 639 639 639 ASP ASP A . n 
A 1 640 ALA 640 640 640 ALA ALA A . n 
A 1 641 ILE 641 641 641 ILE ILE A . n 
A 1 642 LYS 642 642 642 LYS LYS A . n 
A 1 643 ARG 643 643 643 ARG ARG A . n 
A 1 644 ARG 644 644 644 ARG ARG A . n 
A 1 645 GLU 645 645 645 GLU GLU A . n 
A 1 646 GLU 646 646 646 GLU GLU A . n 
A 1 647 PHE 647 647 647 PHE PHE A . n 
A 1 648 ASP 648 648 648 ASP ASP A . n 
A 1 649 LEU 649 649 649 LEU LEU A . n 
A 1 650 ASP 650 650 650 ASP ASP A . n 
A 1 651 VAL 651 651 651 VAL VAL A . n 
A 1 652 VAL 652 652 652 VAL VAL A . n 
A 1 653 ALA 653 653 653 ALA ALA A . n 
A 1 654 VAL 654 654 654 VAL VAL A . n 
A 1 655 VAL 655 655 655 VAL VAL A . n 
A 1 656 ASN 656 656 656 ASN ASN A . n 
A 1 657 ASP 657 657 657 ASP ASP A . n 
A 1 658 THR 658 658 658 THR THR A . n 
A 1 659 VAL 659 659 659 VAL VAL A . n 
A 1 660 GLY 660 660 660 GLY GLY A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 MET 662 662 662 MET MET A . n 
A 1 663 MET 663 663 663 MET MET A . n 
A 1 664 THR 664 664 664 THR THR A . n 
A 1 665 CYS 665 665 665 CYS CYS A . n 
A 1 666 ALA 666 666 666 ALA ALA A . n 
A 1 667 TYR 667 667 667 TYR TYR A . n 
A 1 668 GLU 668 668 668 GLU GLU A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 PRO 670 670 670 PRO PRO A . n 
A 1 671 THR 671 671 671 THR THR A . n 
A 1 672 CYS 672 672 672 CYS CYS A . n 
A 1 673 GLU 673 673 673 GLU GLU A . n 
A 1 674 VAL 674 674 674 VAL VAL A . n 
A 1 675 GLY 675 675 675 GLY GLY A . n 
A 1 676 LEU 676 676 676 LEU LEU A . n 
A 1 677 ILE 677 677 677 ILE ILE A . n 
A 1 678 VAL 678 678 678 VAL VAL A . n 
A 1 679 GLY 679 679 679 GLY GLY A . n 
A 1 680 THR 680 680 680 THR THR A . n 
A 1 681 GLY 681 681 681 GLY GLY A . n 
A 1 682 SER 682 682 682 SER SER A . n 
A 1 683 ASN 683 683 683 ASN ASN A . n 
A 1 684 ALA 684 684 684 ALA ALA A . n 
A 1 685 CYS 685 685 685 CYS CYS A . n 
A 1 686 TYR 686 686 686 TYR TYR A . n 
A 1 687 MET 687 687 687 MET MET A . n 
A 1 688 GLU 688 688 688 GLU GLU A . n 
A 1 689 GLU 689 689 689 GLU GLU A . n 
A 1 690 MET 690 690 690 MET MET A . n 
A 1 691 LYS 691 691 691 LYS LYS A . n 
A 1 692 ASN 692 692 692 ASN ASN A . n 
A 1 693 VAL 693 693 693 VAL VAL A . n 
A 1 694 GLU 694 694 694 GLU GLU A . n 
A 1 695 MET 695 695 695 MET MET A . n 
A 1 696 VAL 696 696 696 VAL VAL A . n 
A 1 697 GLU 697 697 697 GLU GLU A . n 
A 1 698 GLY 698 698 698 GLY GLY A . n 
A 1 699 ASP 699 699 699 ASP ASP A . n 
A 1 700 GLN 700 700 700 GLN GLN A . n 
A 1 701 GLY 701 701 701 GLY GLY A . n 
A 1 702 GLN 702 702 702 GLN GLN A . n 
A 1 703 MET 703 703 703 MET MET A . n 
A 1 704 CYS 704 704 704 CYS CYS A . n 
A 1 705 ILE 705 705 705 ILE ILE A . n 
A 1 706 ASN 706 706 706 ASN ASN A . n 
A 1 707 MET 707 707 707 MET MET A . n 
A 1 708 GLU 708 708 708 GLU GLU A . n 
A 1 709 TRP 709 709 709 TRP TRP A . n 
A 1 710 GLY 710 710 710 GLY GLY A . n 
A 1 711 ALA 711 711 711 ALA ALA A . n 
A 1 712 PHE 712 712 712 PHE PHE A . n 
A 1 713 GLY 713 713 713 GLY GLY A . n 
A 1 714 ASP 714 714 714 ASP ASP A . n 
A 1 715 ASN 715 715 715 ASN ASN A . n 
A 1 716 GLY 716 716 716 GLY GLY A . n 
A 1 717 CYS 717 717 717 CYS CYS A . n 
A 1 718 LEU 718 718 718 LEU LEU A . n 
A 1 719 ASP 719 719 719 ASP ASP A . n 
A 1 720 ASP 720 720 720 ASP ASP A . n 
A 1 721 ILE 721 721 721 ILE ILE A . n 
A 1 722 ARG 722 722 722 ARG ARG A . n 
A 1 723 THR 723 723 723 THR THR A . n 
A 1 724 HIS 724 724 724 HIS HIS A . n 
A 1 725 TYR 725 725 725 TYR TYR A . n 
A 1 726 ASP 726 726 726 ASP ASP A . n 
A 1 727 ARG 727 727 727 ARG ARG A . n 
A 1 728 LEU 728 728 728 LEU LEU A . n 
A 1 729 VAL 729 729 729 VAL VAL A . n 
A 1 730 ASN 730 730 730 ASN ASN A . n 
A 1 731 GLU 731 731 731 GLU GLU A . n 
A 1 732 TYR 732 732 732 TYR TYR A . n 
A 1 733 SER 733 733 733 SER SER A . n 
A 1 734 LEU 734 734 734 LEU LEU A . n 
A 1 735 ASN 735 735 735 ASN ASN A . n 
A 1 736 ALA 736 736 736 ALA ALA A . n 
A 1 737 GLY 737 737 737 GLY GLY A . n 
A 1 738 LYS 738 738 738 LYS LYS A . n 
A 1 739 GLN 739 739 739 GLN GLN A . n 
A 1 740 ARG 740 740 740 ARG ARG A . n 
A 1 741 TYR 741 741 741 TYR TYR A . n 
A 1 742 GLU 742 742 742 GLU GLU A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 MET 744 744 744 MET MET A . n 
A 1 745 ILE 745 745 745 ILE ILE A . n 
A 1 746 SER 746 746 746 SER SER A . n 
A 1 747 GLY 747 747 747 GLY GLY A . n 
A 1 748 MET 748 748 748 MET MET A . n 
A 1 749 TYR 749 749 749 TYR TYR A . n 
A 1 750 LEU 750 750 750 LEU LEU A . n 
A 1 751 GLY 751 751 751 GLY GLY A . n 
A 1 752 GLU 752 752 752 GLU GLU A . n 
A 1 753 ILE 753 753 753 ILE ILE A . n 
A 1 754 VAL 754 754 754 VAL VAL A . n 
A 1 755 ARG 755 755 755 ARG ARG A . n 
A 1 756 ASN 756 756 756 ASN ASN A . n 
A 1 757 ILE 757 757 757 ILE ILE A . n 
A 1 758 LEU 758 758 758 LEU LEU A . n 
A 1 759 ILE 759 759 759 ILE ILE A . n 
A 1 760 ASP 760 760 760 ASP ASP A . n 
A 1 761 PHE 761 761 761 PHE PHE A . n 
A 1 762 THR 762 762 762 THR THR A . n 
A 1 763 LYS 763 763 763 LYS LYS A . n 
A 1 764 LYS 764 764 764 LYS LYS A . n 
A 1 765 GLY 765 765 765 GLY GLY A . n 
A 1 766 PHE 766 766 766 PHE PHE A . n 
A 1 767 LEU 767 767 767 LEU LEU A . n 
A 1 768 PHE 768 768 768 PHE PHE A . n 
A 1 769 ARG 769 769 769 ARG ARG A . n 
A 1 770 GLY 770 770 770 GLY GLY A . n 
A 1 771 GLN 771 771 771 GLN GLN A . n 
A 1 772 ILE 772 772 772 ILE ILE A . n 
A 1 773 SER 773 773 773 SER SER A . n 
A 1 774 GLU 774 774 774 GLU GLU A . n 
A 1 775 THR 775 775 775 THR THR A . n 
A 1 776 LEU 776 776 776 LEU LEU A . n 
A 1 777 LYS 777 777 777 LYS LYS A . n 
A 1 778 THR 778 778 778 THR THR A . n 
A 1 779 ARG 779 779 779 ARG ARG A . n 
A 1 780 GLY 780 780 780 GLY GLY A . n 
A 1 781 ILE 781 781 781 ILE ILE A . n 
A 1 782 PHE 782 782 782 PHE PHE A . n 
A 1 783 GLU 783 783 783 GLU GLU A . n 
A 1 784 THR 784 784 784 THR THR A . n 
A 1 785 LYS 785 785 785 LYS LYS A . n 
A 1 786 PHE 786 786 786 PHE PHE A . n 
A 1 787 LEU 787 787 787 LEU LEU A . n 
A 1 788 SER 788 788 788 SER SER A . n 
A 1 789 GLN 789 789 789 GLN GLN A . n 
A 1 790 ILE 790 790 790 ILE ILE A . n 
A 1 791 GLU 791 791 791 GLU GLU A . n 
A 1 792 SER 792 792 792 SER SER A . n 
A 1 793 ASP 793 793 793 ASP ASP A . n 
A 1 794 ARG 794 794 794 ARG ARG A . n 
A 1 795 LEU 795 795 795 LEU LEU A . n 
A 1 796 ALA 796 796 796 ALA ALA A . n 
A 1 797 LEU 797 797 797 LEU LEU A . n 
A 1 798 LEU 798 798 798 LEU LEU A . n 
A 1 799 GLN 799 799 799 GLN GLN A . n 
A 1 800 VAL 800 800 800 VAL VAL A . n 
A 1 801 ARG 801 801 801 ARG ARG A . n 
A 1 802 ALA 802 802 802 ALA ALA A . n 
A 1 803 ILE 803 803 803 ILE ILE A . n 
A 1 804 LEU 804 804 804 LEU LEU A . n 
A 1 805 GLN 805 805 805 GLN GLN A . n 
A 1 806 GLN 806 806 806 GLN GLN A . n 
A 1 807 LEU 807 807 807 LEU LEU A . n 
A 1 808 GLY 808 808 808 GLY GLY A . n 
A 1 809 LEU 809 809 809 LEU LEU A . n 
A 1 810 ASN 810 810 810 ASN ASN A . n 
A 1 811 SER 811 811 811 SER SER A . n 
A 1 812 THR 812 812 812 THR THR A . n 
A 1 813 CYS 813 813 813 CYS CYS A . n 
A 1 814 ASP 814 814 814 ASP ASP A . n 
A 1 815 ASP 815 815 815 ASP ASP A . n 
A 1 816 SER 816 816 816 SER SER A . n 
A 1 817 ILE 817 817 817 ILE ILE A . n 
A 1 818 LEU 818 818 818 LEU LEU A . n 
A 1 819 VAL 819 819 819 VAL VAL A . n 
A 1 820 LYS 820 820 820 LYS LYS A . n 
A 1 821 THR 821 821 821 THR THR A . n 
A 1 822 VAL 822 822 822 VAL VAL A . n 
A 1 823 CYS 823 823 823 CYS CYS A . n 
A 1 824 GLY 824 824 824 GLY GLY A . n 
A 1 825 VAL 825 825 825 VAL VAL A . n 
A 1 826 VAL 826 826 826 VAL VAL A . n 
A 1 827 SER 827 827 827 SER SER A . n 
A 1 828 ARG 828 828 828 ARG ARG A . n 
A 1 829 ARG 829 829 829 ARG ARG A . n 
A 1 830 ALA 830 830 830 ALA ALA A . n 
A 1 831 ALA 831 831 831 ALA ALA A . n 
A 1 832 GLN 832 832 832 GLN GLN A . n 
A 1 833 LEU 833 833 833 LEU LEU A . n 
A 1 834 CYS 834 834 834 CYS CYS A . n 
A 1 835 GLY 835 835 835 GLY GLY A . n 
A 1 836 ALA 836 836 836 ALA ALA A . n 
A 1 837 GLY 837 837 837 GLY GLY A . n 
A 1 838 MET 838 838 838 MET MET A . n 
A 1 839 ALA 839 839 839 ALA ALA A . n 
A 1 840 ALA 840 840 840 ALA ALA A . n 
A 1 841 VAL 841 841 841 VAL VAL A . n 
A 1 842 VAL 842 842 842 VAL VAL A . n 
A 1 843 ASP 843 843 843 ASP ASP A . n 
A 1 844 LYS 844 844 844 LYS LYS A . n 
A 1 845 ILE 845 845 845 ILE ILE A . n 
A 1 846 ARG 846 846 846 ARG ARG A . n 
A 1 847 GLU 847 847 847 GLU GLU A . n 
A 1 848 ASN 848 848 848 ASN ASN A . n 
A 1 849 ARG 849 849 849 ARG ARG A . n 
A 1 850 GLY 850 850 850 GLY GLY A . n 
A 1 851 LEU 851 851 851 LEU LEU A . n 
A 1 852 ASP 852 852 852 ASP ASP A . n 
A 1 853 ARG 853 853 853 ARG ARG A . n 
A 1 854 LEU 854 854 854 LEU LEU A . n 
A 1 855 ASN 855 855 855 ASN ASN A . n 
A 1 856 VAL 856 856 856 VAL VAL A . n 
A 1 857 THR 857 857 857 THR THR A . n 
A 1 858 VAL 858 858 858 VAL VAL A . n 
A 1 859 GLY 859 859 859 GLY GLY A . n 
A 1 860 VAL 860 860 860 VAL VAL A . n 
A 1 861 ASP 861 861 861 ASP ASP A . n 
A 1 862 GLY 862 862 862 GLY GLY A . n 
A 1 863 THR 863 863 863 THR THR A . n 
A 1 864 LEU 864 864 864 LEU LEU A . n 
A 1 865 TYR 865 865 865 TYR TYR A . n 
A 1 866 LYS 866 866 866 LYS LYS A . n 
A 1 867 LEU 867 867 867 LEU LEU A . n 
A 1 868 HIS 868 868 868 HIS HIS A . n 
A 1 869 PRO 869 869 869 PRO PRO A . n 
A 1 870 HIS 870 870 870 HIS HIS A . n 
A 1 871 PHE 871 871 871 PHE PHE A . n 
A 1 872 SER 872 872 872 SER SER A . n 
A 1 873 ARG 873 873 873 ARG ARG A . n 
A 1 874 ILE 874 874 874 ILE ILE A . n 
A 1 875 MET 875 875 875 MET MET A . n 
A 1 876 HIS 876 876 876 HIS HIS A . n 
A 1 877 GLN 877 877 877 GLN GLN A . n 
A 1 878 THR 878 878 878 THR THR A . n 
A 1 879 VAL 879 879 879 VAL VAL A . n 
A 1 880 LYS 880 880 880 LYS LYS A . n 
A 1 881 GLU 881 881 881 GLU GLU A . n 
A 1 882 LEU 882 882 882 LEU LEU A . n 
A 1 883 SER 883 883 883 SER SER A . n 
A 1 884 PRO 884 884 884 PRO PRO A . n 
A 1 885 LYS 885 885 885 LYS LYS A . n 
A 1 886 CYS 886 886 886 CYS CYS A . n 
A 1 887 ASN 887 887 887 ASN ASN A . n 
A 1 888 VAL 888 888 888 VAL VAL A . n 
A 1 889 SER 889 889 889 SER SER A . n 
A 1 890 PHE 890 890 890 PHE PHE A . n 
A 1 891 LEU 891 891 891 LEU LEU A . n 
A 1 892 LEU 892 892 892 LEU LEU A . n 
A 1 893 SER 893 893 893 SER SER A . n 
A 1 894 GLU 894 894 894 GLU GLU A . n 
A 1 895 ASP 895 895 895 ASP ASP A . n 
A 1 896 GLY 896 896 896 GLY GLY A . n 
A 1 897 SER 897 897 897 SER SER A . n 
A 1 898 GLY 898 898 898 GLY GLY A . n 
A 1 899 LYS 899 899 899 LYS LYS A . n 
A 1 900 GLY 900 900 900 GLY GLY A . n 
A 1 901 ALA 901 901 901 ALA ALA A . n 
A 1 902 ALA 902 902 902 ALA ALA A . n 
A 1 903 LEU 903 903 903 LEU LEU A . n 
A 1 904 ILE 904 904 904 ILE ILE A . n 
A 1 905 THR 905 905 905 THR THR A . n 
A 1 906 ALA 906 906 906 ALA ALA A . n 
A 1 907 VAL 907 907 907 VAL VAL A . n 
A 1 908 GLY 908 908 908 GLY GLY A . n 
A 1 909 VAL 909 909 909 VAL VAL A . n 
A 1 910 ARG 910 910 910 ARG ARG A . n 
A 1 911 LEU 911 911 911 LEU LEU A . n 
A 1 912 ARG 912 912 912 ARG ARG A . n 
A 1 913 THR 913 913 913 THR THR A . n 
A 1 914 GLU 914 914 914 GLU GLU A . n 
A 1 915 ALA 915 915 ?   ?   ?   A . n 
A 1 916 SER 916 916 ?   ?   ?   A . n 
A 1 917 SER 917 917 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BGC 1   918  915  BGC BGC A . 
C 3 PO4 1   919  916  PO4 PO4 A . 
D 3 PO4 1   920  917  PO4 PO4 A . 
E 4 K   1   921  918  K   K   A . 
F 4 K   1   922  919  K   K   A . 
G 5 HOH 1   923  920  HOH HOH A . 
G 5 HOH 2   924  921  HOH HOH A . 
G 5 HOH 3   925  922  HOH HOH A . 
G 5 HOH 4   926  923  HOH HOH A . 
G 5 HOH 5   927  924  HOH HOH A . 
G 5 HOH 6   928  925  HOH HOH A . 
G 5 HOH 7   929  926  HOH HOH A . 
G 5 HOH 8   930  927  HOH HOH A . 
G 5 HOH 9   931  928  HOH HOH A . 
G 5 HOH 10  932  929  HOH HOH A . 
G 5 HOH 11  933  930  HOH HOH A . 
G 5 HOH 12  934  931  HOH HOH A . 
G 5 HOH 13  935  932  HOH HOH A . 
G 5 HOH 14  936  933  HOH HOH A . 
G 5 HOH 15  937  934  HOH HOH A . 
G 5 HOH 16  938  935  HOH HOH A . 
G 5 HOH 17  939  936  HOH HOH A . 
G 5 HOH 18  940  937  HOH HOH A . 
G 5 HOH 19  941  938  HOH HOH A . 
G 5 HOH 20  942  939  HOH HOH A . 
G 5 HOH 21  943  940  HOH HOH A . 
G 5 HOH 22  944  941  HOH HOH A . 
G 5 HOH 23  945  942  HOH HOH A . 
G 5 HOH 24  946  943  HOH HOH A . 
G 5 HOH 25  947  944  HOH HOH A . 
G 5 HOH 26  948  945  HOH HOH A . 
G 5 HOH 27  949  946  HOH HOH A . 
G 5 HOH 28  950  947  HOH HOH A . 
G 5 HOH 29  951  948  HOH HOH A . 
G 5 HOH 30  952  949  HOH HOH A . 
G 5 HOH 31  953  950  HOH HOH A . 
G 5 HOH 32  954  951  HOH HOH A . 
G 5 HOH 33  955  952  HOH HOH A . 
G 5 HOH 34  956  953  HOH HOH A . 
G 5 HOH 35  957  954  HOH HOH A . 
G 5 HOH 36  958  955  HOH HOH A . 
G 5 HOH 37  959  956  HOH HOH A . 
G 5 HOH 38  960  957  HOH HOH A . 
G 5 HOH 39  961  958  HOH HOH A . 
G 5 HOH 40  962  959  HOH HOH A . 
G 5 HOH 41  963  960  HOH HOH A . 
G 5 HOH 42  964  961  HOH HOH A . 
G 5 HOH 43  965  962  HOH HOH A . 
G 5 HOH 44  966  963  HOH HOH A . 
G 5 HOH 45  967  964  HOH HOH A . 
G 5 HOH 46  968  965  HOH HOH A . 
G 5 HOH 47  969  966  HOH HOH A . 
G 5 HOH 48  970  967  HOH HOH A . 
G 5 HOH 49  971  968  HOH HOH A . 
G 5 HOH 50  972  969  HOH HOH A . 
G 5 HOH 51  973  970  HOH HOH A . 
G 5 HOH 52  974  971  HOH HOH A . 
G 5 HOH 53  975  972  HOH HOH A . 
G 5 HOH 54  976  973  HOH HOH A . 
G 5 HOH 55  977  974  HOH HOH A . 
G 5 HOH 56  978  975  HOH HOH A . 
G 5 HOH 57  979  976  HOH HOH A . 
G 5 HOH 58  980  977  HOH HOH A . 
G 5 HOH 59  981  978  HOH HOH A . 
G 5 HOH 60  982  979  HOH HOH A . 
G 5 HOH 61  983  980  HOH HOH A . 
G 5 HOH 62  984  981  HOH HOH A . 
G 5 HOH 63  985  982  HOH HOH A . 
G 5 HOH 64  986  983  HOH HOH A . 
G 5 HOH 65  987  984  HOH HOH A . 
G 5 HOH 66  988  985  HOH HOH A . 
G 5 HOH 67  989  986  HOH HOH A . 
G 5 HOH 68  990  987  HOH HOH A . 
G 5 HOH 69  991  988  HOH HOH A . 
G 5 HOH 70  992  989  HOH HOH A . 
G 5 HOH 71  993  990  HOH HOH A . 
G 5 HOH 72  994  991  HOH HOH A . 
G 5 HOH 73  995  992  HOH HOH A . 
G 5 HOH 74  996  993  HOH HOH A . 
G 5 HOH 75  997  994  HOH HOH A . 
G 5 HOH 76  998  995  HOH HOH A . 
G 5 HOH 77  999  996  HOH HOH A . 
G 5 HOH 78  1000 997  HOH HOH A . 
G 5 HOH 79  1001 998  HOH HOH A . 
G 5 HOH 80  1002 999  HOH HOH A . 
G 5 HOH 81  1003 1000 HOH HOH A . 
G 5 HOH 82  1004 1001 HOH HOH A . 
G 5 HOH 83  1005 1002 HOH HOH A . 
G 5 HOH 84  1006 1003 HOH HOH A . 
G 5 HOH 85  1007 1004 HOH HOH A . 
G 5 HOH 86  1008 1005 HOH HOH A . 
G 5 HOH 87  1009 1006 HOH HOH A . 
G 5 HOH 88  1010 1007 HOH HOH A . 
G 5 HOH 89  1011 1008 HOH HOH A . 
G 5 HOH 90  1012 1009 HOH HOH A . 
G 5 HOH 91  1013 1010 HOH HOH A . 
G 5 HOH 92  1014 1011 HOH HOH A . 
G 5 HOH 93  1015 1012 HOH HOH A . 
G 5 HOH 94  1016 1013 HOH HOH A . 
G 5 HOH 95  1017 1014 HOH HOH A . 
G 5 HOH 96  1018 1015 HOH HOH A . 
G 5 HOH 97  1019 1016 HOH HOH A . 
G 5 HOH 98  1020 1017 HOH HOH A . 
G 5 HOH 99  1021 1018 HOH HOH A . 
G 5 HOH 100 1022 1019 HOH HOH A . 
G 5 HOH 101 1023 1020 HOH HOH A . 
G 5 HOH 102 1024 1021 HOH HOH A . 
G 5 HOH 103 1025 1022 HOH HOH A . 
G 5 HOH 104 1026 1023 HOH HOH A . 
G 5 HOH 105 1027 1024 HOH HOH A . 
G 5 HOH 106 1028 1025 HOH HOH A . 
G 5 HOH 107 1029 1026 HOH HOH A . 
G 5 HOH 108 1030 1027 HOH HOH A . 
G 5 HOH 109 1031 1028 HOH HOH A . 
G 5 HOH 110 1032 1029 HOH HOH A . 
G 5 HOH 111 1033 1030 HOH HOH A . 
G 5 HOH 112 1034 1031 HOH HOH A . 
G 5 HOH 113 1035 1032 HOH HOH A . 
G 5 HOH 114 1036 1033 HOH HOH A . 
G 5 HOH 115 1037 1034 HOH HOH A . 
G 5 HOH 116 1038 1035 HOH HOH A . 
G 5 HOH 117 1039 1036 HOH HOH A . 
G 5 HOH 118 1040 1037 HOH HOH A . 
G 5 HOH 119 1041 1038 HOH HOH A . 
G 5 HOH 120 1042 1039 HOH HOH A . 
G 5 HOH 121 1043 1040 HOH HOH A . 
G 5 HOH 122 1044 1041 HOH HOH A . 
G 5 HOH 123 1045 1042 HOH HOH A . 
G 5 HOH 124 1046 1043 HOH HOH A . 
G 5 HOH 125 1047 1044 HOH HOH A . 
G 5 HOH 126 1048 1045 HOH HOH A . 
G 5 HOH 127 1049 1046 HOH HOH A . 
G 5 HOH 128 1050 1047 HOH HOH A . 
G 5 HOH 129 1051 1048 HOH HOH A . 
G 5 HOH 130 1052 1049 HOH HOH A . 
G 5 HOH 131 1053 1050 HOH HOH A . 
G 5 HOH 132 1054 1051 HOH HOH A . 
G 5 HOH 133 1055 1052 HOH HOH A . 
G 5 HOH 134 1056 1053 HOH HOH A . 
G 5 HOH 135 1057 1054 HOH HOH A . 
G 5 HOH 136 1058 1055 HOH HOH A . 
G 5 HOH 137 1059 1056 HOH HOH A . 
G 5 HOH 138 1060 1057 HOH HOH A . 
G 5 HOH 139 1061 1058 HOH HOH A . 
G 5 HOH 140 1062 1059 HOH HOH A . 
G 5 HOH 141 1063 1060 HOH HOH A . 
G 5 HOH 142 1064 1061 HOH HOH A . 
G 5 HOH 143 1065 1062 HOH HOH A . 
G 5 HOH 144 1066 1063 HOH HOH A . 
G 5 HOH 145 1067 1064 HOH HOH A . 
G 5 HOH 146 1068 1065 HOH HOH A . 
G 5 HOH 147 1069 1066 HOH HOH A . 
G 5 HOH 148 1070 1067 HOH HOH A . 
G 5 HOH 149 1071 1068 HOH HOH A . 
G 5 HOH 150 1072 1069 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 303.2647758972 0.0000000000 0.0000000000 -1.0000000000 33.1566666667 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A LEU 242 ? A LEU 242 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A ILE 245 ? A ILE 245  ? 1_555 84.1  ? 
2  O ? A LEU 242 ? A LEU 242 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A VAL 248 ? A VAL 248  ? 1_555 116.2 ? 
3  O ? A ILE 245 ? A ILE 245 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A VAL 248 ? A VAL 248  ? 1_555 67.6  ? 
4  O ? A LEU 242 ? A LEU 242 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A GLY 250 ? A GLY 250  ? 1_555 95.8  ? 
5  O ? A ILE 245 ? A ILE 245 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A GLY 250 ? A GLY 250  ? 1_555 157.7 ? 
6  O ? A VAL 248 ? A VAL 248 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? A GLY 250 ? A GLY 250  ? 1_555 92.9  ? 
7  O ? A LEU 242 ? A LEU 242 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? G HOH .   ? A HOH 1058 ? 1_555 71.1  ? 
8  O ? A ILE 245 ? A ILE 245 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? G HOH .   ? A HOH 1058 ? 1_555 88.7  ? 
9  O ? A VAL 248 ? A VAL 248 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? G HOH .   ? A HOH 1058 ? 1_555 153.3 ? 
10 O ? A GLY 250 ? A GLY 250 ? 1_555 K ? E K . ? A K 921 ? 1_555 O   ? G HOH .   ? A HOH 1058 ? 1_555 112.5 ? 
11 O ? A MET 690 ? A MET 690 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A VAL 693 ? A VAL 693  ? 1_555 78.0  ? 
12 O ? A MET 690 ? A MET 690 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A VAL 696 ? A VAL 696  ? 1_555 108.5 ? 
13 O ? A VAL 693 ? A VAL 693 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A VAL 696 ? A VAL 696  ? 1_555 64.2  ? 
14 O ? A MET 690 ? A MET 690 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A GLY 698 ? A GLY 698  ? 1_555 70.2  ? 
15 O ? A VAL 693 ? A VAL 693 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A GLY 698 ? A GLY 698  ? 1_555 116.6 ? 
16 O ? A VAL 696 ? A VAL 696 ? 1_555 K ? F K . ? A K 922 ? 1_555 O   ? A GLY 698 ? A GLY 698  ? 1_555 76.0  ? 
17 O ? A MET 690 ? A MET 690 ? 1_555 K ? F K . ? A K 922 ? 1_555 OD1 ? A ASP 699 ? A ASP 699  ? 1_555 99.6  ? 
18 O ? A VAL 693 ? A VAL 693 ? 1_555 K ? F K . ? A K 922 ? 1_555 OD1 ? A ASP 699 ? A ASP 699  ? 1_555 175.2 ? 
19 O ? A VAL 696 ? A VAL 696 ? 1_555 K ? F K . ? A K 922 ? 1_555 OD1 ? A ASP 699 ? A ASP 699  ? 1_555 120.6 ? 
20 O ? A GLY 698 ? A GLY 698 ? 1_555 K ? F K . ? A K 922 ? 1_555 OD1 ? A ASP 699 ? A ASP 699  ? 1_555 65.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-11 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_database_status      
5 4 'Structure model' pdbx_entity_nonpoly       
6 4 'Structure model' pdbx_struct_conn_angle    
7 4 'Structure model' struct_conn               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                             
2  4 'Structure model' '_chem_comp.type'                             
3  4 'Structure model' '_entity.pdbx_description'                    
4  4 'Structure model' '_pdbx_database_status.process_site'          
5  4 'Structure model' '_pdbx_entity_nonpoly.name'                   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.value'               
17 4 'Structure model' '_struct_conn.pdbx_dist_value'                
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.851 ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          3.851 ? 5 
# 
_pdbx_entry_details.entry_id                 1HKC 
_pdbx_entry_details.compound_details         
;IN THIS STRUCTURE THE N-TERMINAL, REGULATORY DOMAIN IS IN
THE CLOSED CONFORMATION AND CONTAINS TIGHTLY BOUND GLUCOSE
AND PHOSPHATE.  THE C-TERMINAL, CATALYTIC DOMAIN IS OPEN
AND ONLY CONTAINS LOOSELY BOUND PHOSPHATE.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 75  ? ? -55.46  -0.06   
2  1 ASN A 102 ? ? 74.12   30.14   
3  1 ASN A 104 ? ? -52.82  -179.74 
4  1 LYS A 147 ? ? -60.22  87.01   
5  1 LYS A 173 ? ? 58.41   -124.64 
6  1 LYS A 176 ? ? -165.27 43.30   
7  1 ASN A 202 ? ? -117.30 77.69   
8  1 GLN A 222 ? ? -66.30  4.21    
9  1 ARG A 243 ? ? -68.69  17.48   
10 1 ASP A 246 ? ? -38.66  -31.18  
11 1 ASP A 251 ? ? -172.66 -1.35   
12 1 ASN A 287 ? ? -118.77 70.06   
13 1 VAL A 297 ? ? -126.18 -51.58  
14 1 PHE A 320 ? ? 49.79   17.79   
15 1 LYS A 346 ? ? -68.76  -78.33  
16 1 SER A 438 ? ? -173.68 145.78  
17 1 GLU A 446 ? ? -59.71  -83.08  
18 1 PRO A 605 ? ? -54.62  94.61   
19 1 THR A 618 ? ? -176.99 142.80  
20 1 LYS A 624 ? ? -141.21 11.05   
21 1 GLU A 645 ? ? 59.88   11.73   
22 1 ASP A 650 ? ? -115.95 77.78   
23 1 VAL A 651 ? ? -56.47  101.47  
24 1 GLU A 673 ? ? -142.77 17.75   
25 1 ASN A 735 ? ? -118.53 52.54   
26 1 PHE A 768 ? ? 38.58   36.90   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A ALA 4   ? A ALA 4   
5  1 Y 1 A GLN 5   ? A GLN 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A LEU 7   ? A LEU 7   
8  1 Y 1 A ALA 8   ? A ALA 8   
9  1 Y 1 A TYR 9   ? A TYR 9   
10 1 Y 1 A TYR 10  ? A TYR 10  
11 1 Y 1 A PHE 11  ? A PHE 11  
12 1 Y 1 A THR 12  ? A THR 12  
13 1 Y 1 A GLU 13  ? A GLU 13  
14 1 Y 1 A LEU 14  ? A LEU 14  
15 1 Y 1 A LYS 15  ? A LYS 15  
16 1 Y 1 A ALA 915 ? A ALA 915 
17 1 Y 1 A SER 916 ? A SER 916 
18 1 Y 1 A SER 917 ? A SER 917 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpb            
BGC 'COMMON NAME'                         GMML     1.0 b-D-glucopyranose 
BGC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Glcp          
BGC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc               
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 beta-D-glucopyranose BGC 
3 'PHOSPHATE ION'      PO4 
4 'POTASSIUM ION'      K   
5 water                HOH 
#